1B89A

Clathrin heavy chain proximal leg segment (bovine)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
319
Chain Sequence
RLAELEEFINGPMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFACVDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTELAILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFSKVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Clathrin
molecule keywords PROTEIN (CLATHRIN HEAVY CHAIN)
publication title Clathrin self-assembly is mediated by a tandemly repeated superhelix.
pubmed doi rcsb
source organism Bos taurus
total genus 99
structure length 319
sequence length 335
ec nomenclature
pdb deposition date 1999-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00637 Clathrin Region in Clathrin and VPS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1b89A00
3LY9A 2FO7A 3CVNA 1ELRA 5G04J 1HH8A 3GZ1A 5CCMA 3RO2A 3ZPJA 5BW8C 3S7BA 4AIFA 3GYZA 5FJYA 1IYGA 4UI9J 4UI9C 2C0LA 5FZSA 4HOQA 3RKVA 3CK8A 5KJLA 3RU0A 4F3VA 4GYYA 2KCKA 2I6HA 4N39A 3UUXA 5DIZA 1NA3A 4JHRA 1P5QA 2AVPA 3MV3B 2KC7A 3R9AB 2LSUA 3SF4A 2DBAA 4G25A 3O48A 4KBQA 3ULQA 4AM9A 3CVPA 3PE3A 4H7XA 1ZBPA 2VGYA 3AS4A 4UQZA 4HOTA 5HI7A 1A17A 3VTYA 4Y6CA 4J0UA 1KT1A 2C0MA 5KJNA 4N3AA 3ZHEA 1PC2A 2UY1B 3TG5A 3OXFA 4I9EA 3U4TA 2XPIA 4WNFA 3URZA 2BUGA 2Y4UA 5BT1A 4J8DA 1IHGA 4JA7A 1ZU2A 3S7DA 5ARFA 3FWVA 3K9IA 4YNDA 4XIFA 3TGOA 3S7FA 3MKRA 3TAXA 4G2VA 4IN3B 5AYWD 4G23A 2FEZA 4GPKA 2VSNA 4KXKB 4WNDA 4YVQC 4JL0A 3ASHA 2Q7FA 3Q15A 3Q5MA 2FBNA 5DBKA 4GYWA 3GZ2A 2XGOA 2E2EA 1NZNA 2YQ8A 4I9CA 5G04C 3Q47B 4BWRA 3MV2B 2L6JA 1E96B 5LCWJ 5LCWC 2WPVA 5KJMA 2ONDA 2VGXA 4W9RA 4GCNA 4N5CA 5EKQD 4CGVA 4J8FA 4UI9K 3CK9A 4NQ0A 3QOUA 3SZ7A 5JJTA 2PQRA 3ZGQA 2XCCA 2WQHA 3WXXA 5D0OD 3ZHEB 3IEGA 3CVLA 5FTPA 4GA1A 4U0SA 5G05J 5G05C 3CVQA 4ABNA 2XGMA 4O6FA 5A6CA 5CHEE 4A1SA 4BTBA 4HOSA 1ELWA 2MHKA 4N3CA 3ZN3A 4Y6WA 4BT8A 2FI7A 2VQ2A 2V5FA 1KLXA 4I2WA 3AS8A 4N3BA 3CK7A 4WUYA 3ASGA 4B94A 1B89A 3EDTB 5JJ6A 3LKUA 1KT0A 3QWWA 5BNWA 3U3WA 2PZIA 4U0ZA 2JLBA 4I1AA 3GW4A 4I2ZA 3PE4A 2VGXB 2HR2A 3JYSA 1TJCA 4XI9A 3FP3A 4AY6A 3LY8A 2PL2A 4CDRA 3VTXA 1NA0A 3UQ3A 4G1TA 3ASDA 5JJ7A 4GYOA 2LNIA 2GW1A 2KCVA 4GZ5A 3CV0A 2XCBA 3S7JA 4U04A 4N2SA 2P58C 5ARGA 2IFUA 4UQYA 3UPVA 4GA0A 3RIBA 4GA2A 4BTAA 4H7YA 3RJVA 2HO1A 4NRHB 4JA9A 3E4BA 3ASFA 3ZFWA 2LSVA 4J8EA 1W3BA 3Q49B 4YVOA 2FF4A 4U07A 3RO3A 3Q4AB 2KATA 2PQNA 3MA5A 4WNGA 4GZ6A 4N2QA 3TG4A 1QZ2A 5KJKA 4G26A 3QKYA 5FT9A 3ESKA 3CKBA 3FFLA 4WNEA 2UWJG 2NC9A 3NF1A 5HQ8A 3QWVA 3CEQA 4RG9A 3OXLA 4U0UA 5C1DA 2OOEA 2QFCA 2J9QA 4GCOA 2XGSA 1OUVA 2C2LA 3KS2A 3BEEA 1WM5A 4ME2A 3CKCA 2VSYA 1HZ4A 2R5SA 5EX3A 4HORA 4XI0A 3KD7A 2YHCA 2Y4TA 4HOUA 3HYMB 1Y8MA 4GZ3A 2KCLA 3QWPA 5M72A 3MEKA 5D0QD 5CCLA 2HYZA 4RG6A 4CGWA 4APOA 3LYAA 4AY5A 4UQXA 4BT9A 3QDNA 5FZQA 4KYOB 2XEVA 3LY7A 4EQFA 4I17A 1XNFA 1HXIA 3AS5A 3PDNA 3N71A 1QQEA 1WAO1 3KAEA 3LPZA 5A7DB 3OXGA 2IF4A 4G24A 3LCAA 5EX0A 2VYIA 5FZRA 1FCHA 4LEUA 2UY1A 1YA0A
chains in the Genus database with same CATH superfamily
4R7LA 4URKA 2DVWA 1HH8A 2L0IA 2XQ0A 3NQPA 5CCMA 1IYGA 3DSVA 5FZSA 4KT6B 4ZHBA 3IBEA 1QYMA 5KJLA 1LD7A 4F3VA 3G2VA 3SD5A 3U66A 3QARA 2P9PG 5AARA 2VGEA 2I6HA 3UT7A 4UWKA 3UUXA 5CRUA 4U96D 3ZNGA 3CGHA 3W9GA 4Q96A 3T5XA 1JWGA 3JUEA 3MV3B 2KC7A 3BQOA 2ETCA 2LSUA 3B13A 4YDOA 1IQUA 3J5QB 4G25A 4U8HA 2WXOA 3D9LA 4JEHA 5FQ6A 3UX4A 2P9SG 3DBSA 4H7XA 4U7EB 3AS4A 2AXVA 2XENA 3GZSA 3PNLB 3AG2E 3FUDA 4TUMA 2C0MA 5FIOA 2IU1A 2CHXA 2WXRA 1E8XA 3AAAC 1V55E 4AJWA 1K1BA 3ZYKA 3EIQC 3ZEFA 3E32A 4JPSA 3UINC 1ZU2A 4LUNU 3MKRA 4PUCA 3HG0D 4G23A 4B8CB 2FEZA 3DXKG 3UT4A 4YVQC 3ASHA 3CHRA 3SBTB 1KZPA 2FBNA 4EZKA 4BESA 1IXVA 5ANRA 5EILA 2QYJA 2ZGGA 1NZNA 3PRZA 5B1BE 4EPZA 4O1PA 3SI5A 4Q94A 2L6JA 3DSSA 2V5QC 3ML8A 5LCWC 4AEZC 3UIOC 5H7PA 5JA4D 3LVQE 3IV0A 3G2SA 3FDHA 4GCNA 3RRMB 3O4ZA 1RW2A 3R7QA 3D9HA 4L1BA 2J8SD 5BV0A 5JJTA 5AQ9A 3ZGQA 2XCCA 1MX6A 2QY7A 2WQHA 3FU6A 3ZHEB 4KVMA 5AIJA 2GRRB 1OWLA 4L23A 1G3NB 5G05J 2IO3C 3FU5A 4O1OA 3CQGB 2CHZA 1INZA 3C3OA 4N3CA 3ZN3A 3D9PA 4HI9A 3PUJA 1KLXA 5FQ7A 4WUYA 4DI4A 3ASGA 2LAIA 3ZU7B 3L13A 3Q9UC 3FTSA 4LSZE 1Z3XA 5EYPF 2PZIA 1Y6IA 4I43A 4U0ZA 2JLBA 3FTUA 2OVBA 1V54E 5AJLA 5EIDA 2VGXB 3FP3A 3LY8A 1OT8A 1TN6A 4P29A 2RKKA 3C5RA 5BUZA 4HLEA 4UWLA 4G1TA 3TWTA 5CMYA 1D8EA 4G11A 3ISMC 4GZ5A 3ZW3A 5JHAA 4CT0A 3S7JA 4DI3A 4N2SA 3ZUVB 3LS8A 2P58C 2IFUA 2A4ZA 4XX5A 3DEPA 4KZ0A 3RIBA 4GA2A 3PZ2A 1S70B 2HO1A 3HXFA 3E4BA 2V0PA 1N4SA 4HRLA 3KEZA 4TV3A 1W3BA 1U2VG 3T9KA 4GMRA 3SGHA 3E34A 2WXKA 4B8AA 5EIBE 3ABME 3MA5A 2JABA 3LJ3A 2DYRE 2MOWA 2XPYA 3RRNB 2J09A 2ZISA 1QZ2A 1JWFA 5KJKA 1DCEA 1OCOE 3QKYA 3L6AA 3NZSA 4TUUA 4WNEA 2UWJG 2NC9A 4UUCA 3QWVA 2F37A 4HXIA 3OXLA 3CLJA 5C1DA 1HO8A 2OOEA 4GZDA 4ILIA 1EF1C 1HU3A 3PZDA 2XGSA 4FULA 5AJDA 3QNKA 4ME2A 1UN8A 1E90A 3JQ0A 2R5SA 1E8WA 2YHCA 1N4RA 4Q69A 1TYQG 2R05A 1Y8MA 3HYMB 1H6OA 4K5AB 5M72A 3L17A 3SY2A 3L9TA 4GTSA 3MX3A 4RG6A 4CGWA 1N54A 3LYAA 4AY5A 4GTRA 4UQXA 3X2QE 4B89A 5FZQA 4KYOB 5KNHD 1PY1A 3G2UA 3APCA 4EBAG 4BX8A 1H6KA 3FH5A 4AP2A 4DX7D 1BI7B 3LPZA 3OXGA 3CVWA 2IJGX 3TXMA 3VLFA 4EZJA 4GZCA 1N94A 1H2TC 2ZGDA 4FADA 4F1SA 4CCAA 2UY1A 3B7TA 4D10C 5HS0A 2FO7A 3CVNA 3V31A 1MX4A 2DZNA 2XRZA 4LNUD 3ZPJA 1ZB1A 3IKOB 4AIFA 4UI9C 2C0LA 4HOQA 3CK8A 3JXIA 2YHEA 4DRXE 3RU0A 3CHOA 2KCKA 1K3ZD 4N39A 3LEWA 1RZ4A 1AWCB 3ZYLA 1LD8A 2AVPA 2V4LA 3PUKA 4L2YA 3R9AB 4K0RA 4LERA 3SF4A 4RVBA 3FEYA 1BI8B 2WMOA 2DBAA 1MYOA 3DSXA 5BXOA 2DYSE 3CVPA 3PE3A 1O1SA 5CBOA 3T8MA 3V2XA 3ULEG 2IO2C 4QFVA 1JUQA 1TNYA 5HI7A 4DX5D 4AXHA 4U95D 4Y6CA 3SFZA 4J6IA 3UM3A 2X6JA 2IOSA 5KJNA 4N3AA 4GB9A 5IY5E 3FTYA 4BSXA 1BD8A 2X3MA 1YMPA 4I9EA 4FJYA 3U4TA 2XPIA 4WNFA 3URZA 2Y4UA 4J8DA 1IHGA 4TXRA 4JA7A 4OVVA 4XIFA 1U3CA 2R2LA 4FC8A 5AYWD 3PVLA 2VSNA 4KXKB 2X6FA 4CDNA 2H6IA 2MRIA 2XGOA 1SW6A 1HFAA 5KNGA 4J8SA 2CG3A 1E96B 3ZYQA 5CMWA 3QJZA 2WPVA 4YDEA 3PZ4A 1HE8A 2XS8A 2VJ8A 3G2TA 3KEAA 4CYMD 3NOCD 4U63A 4M3OA 2RG8A 4UI9K 4WWOA 4XEIG 4NQ0A 3V30A 4XKCA 3CSFA 3MYVA 2H6FA 4C0MA 3ZXSA 3Q79A 3ASOE 3KSQA 3DSWA 2XGMA 4O6FA 5CHEE 1TNOA 2DZOA 5JHBA 1E7VA 3L82A 5E76A 4HOSA 2YINA 2MHKA 1TR4A 4BT8A 2FI7A 2V5FA 4AV7A 3CR3A 4CEMA 3E33A 1EDUA 1S64A 2XS1A 3EDTB 5JJ6A 4F6RD 4WWNA 3HRAA 3EUVA 5LOZA 5BNWA 3UM2A 3ZIMA 2BKKB 2V4HC 5AQBA 3GW4A 3CVXA 3CHSA 3I5PA 2GROB 3QC1A 5CERB 4FU3A 3UQ3A 1IKND 2WMNA 5J08A 3ASDA 1LTXA 2RFMA 5JJ7A 4GYOA 2LNIA 2XZTG 2FULA 2GW1A 2R17C 1TJFA 2OEWA 4FJZA 1SA4A 3CV0A 4I6GA 3PEVB 3F6QA 4RSYA 2GRNB 4BTAA 2WXFA 5T8IA 3FY4A 4B0ZA 5BV1A 1Q2ZA 2X6HA 2WXQA 5CBNA 1JPLA 2A5UA 3IHVA 3TWQA 5CEDB 1ELKA 1TNZA 3DEOA 4CDMA 3AJIA 2PQNA 2OV8A 4GZ6A 5C2YA 2EIJE 2EILE 3UI2A 4N2QA 3CVYA 3MKQA 4GTPA 4G26A 4ANXA 1D9SA 4GTMA 3FFLA 3PZ1A 2OEVA 3CEQA 1KZOA 2R03A 4RG9A 1YCSB 4L7TA 4YDWA 2QFCA 3FTWA 4BSZB 3RSEG 2C2LA 3ZYMA 2QZAA 3BEEA 4NACA 1WM5A 2QYUA 1SVXA 2AWIA 1H2UA 4JXTA 1O1TA 1MQSA 2MYOA 3WG7E 3LXUX 3ML9A 3VLEA 1D8DA 4GPMA 1TN7A 3FUEA 5CRVA 4GZ3A 4DX2A 3ZVVA 4J7WA 4C9BB 3QDNA 5EN5D 2GRMA 4K03A 4HNAD 3EU9A 4I17A 5AQ7A 2NXPA 2P2CP 3RAUA 4PDXA 4LRZA 1UJKA 3PDNA 2WM9A 4MS6A 2J49A 1WAO1 3KAEA 3NZUA 1FVHA 1N95A 2M63A 3PREA 4A55A 2XHEA 1QNFA 1S63A 1TEZA 5FZRA 3FH7A 2B6CA 1FCHA 2I1JA 1N4PA 4MRUA 4HQDA 4BFRA 4LCTA 4TXQA 1WY6A 4BERA 3RO2A 3S7BA 4DK5A 3GYZA 5FJYA 5EDSA 3D3MA 3RKVA 3V79K 4ILHB 2XRYA 5ENQD 4X8QA 4GYYA 3P1UA 2VSXE 2BEDA 1OCRE 5DIZA 4FA6A 1NA3A 1N52A 4JHRA 2WVIA 2NSZA 4MBGA 2XEHA 4C0EA 3HVEA 4JVSA 5ENSD 4OAVB 4WWPA 1XGWA 5G2NA 4KZCA 4AOFA 3Q7AA 3BUAA 5E75A 3BU8A 4BETA 3IHYA 3QB2A 4KBQA 3QAQA 4CZ2D 3ULQA 3J5PA 3CHMA 5AENA 4HS2A 3AU5A 4I6EA 2KM4A 4I6JA 4UQZA 1IHBA 2IQCA 3HXCA 1EYHA 3VTYA 4JW1A 4IYPA 1KT1A 3EHMA 2GGFA 5G55A 2XPZA 5ANLA 3FULA 2UY1B 3TG5A 3OTNA 1N9AA 3ULYA 2ETAA 3W9FA 2CFUA 2F0YA 3S7DA 3FWVA 3K9IA 3CVUA 3S7FA 1OCCE 3BG0B 3Q78A 4GPKA 2EQXA 4JL0A 2Q7FA 3Q15A 4GTVA 3ONKA 3GZ2A 1L5JA 3V2OA 3FTVA 2E2EA 1DC2A 3SNXA 1WG0A 2YQ8A 3FH8A 5G04C 2V8SE 2IONA 4BWRA 3TWVA 3MV2B 4IRUA 5LCWJ 1H0AA 2ONDA 1UJJA 3I3NA 1BU9A 2Y69E 1X5BA 1E8YA 3B7SA 4N5CA 5EKQD 4CGVA 1YYHA 4MKTA 2PM7A 2RD0A 1JCQA 3CK9A 3FUKA 3SZ7A 2PQRA 4ACLA 3NB2A 5HKPA 3DSTA 2DWZA 3PEUB 3IEGA 2B0OE 2DCPA 4GMJA 5FTPA 2LXMA 4GA1A 4OYSA 5LFAA 2BTDA 2Y0BG 2H6GA 1E8ZA 5G05C 3UMVA 3CVQA 5T4YA 3L54A 5A6CA 3ABKE 3FTZA 1VDYA 1A5EA 1OXJA 4A1SA 4BTBA 1ELWA 4Y6WA 3R7RA 3SQVA 3PH0C 3NOGD 4J8YA 2WXNA 4EZLA 3CK7A 5ENPD 3L16A 4RLYA 1SZ9A 5HRYA 1KT0A 3AG3E 2A5EA 1X81A 4KVOA 3UKRG 3AG4E 1OWOA 1AP7A 3BG1B 4UWHA 4I2ZA 2Y3AA 3JYSA 3ZKJA 1TJCA 4AY6A 4BY6A 4K5BA 4U8YD 2PL2A 4YDYA 3VTXA 1NA0A 4E85A 3LDZA 3JUIA 4DX6D 3T5VA 3ABLE 2EINE 4OAUC 2WXLA 1NL4A 2VTBA 3CSTA 5FWQA 5ARGA 3D9IA 1DNPA 4NURA 5FQ4A 2HM8A 1HX8A 4H7YA 2KZTA 3APFA 4TRQA 4JA9A 4PH4B 3SHFA 4J8EA 1HF8A 1OY3D 3ZRHA 4YVOA 2FF4A 4U07A 3RO3A 3Q4AB 4WNGA 3Q9NC 5LP0A 3UM0A 4ILGA 3B7BA 2IY0C 2CHWA 2EIME 4I1MA 3DSUA 4ANWA 4ZFHA 5HQ8A 3KSLA 4E6HA 4U0UA 4A3VA 4G8KA 1O5MA 4HI8A 2J9QA 4GTQA 3PZ3A 3TWRA 4DLQA 3JXJA 3KS2A 1OWNA 4IULA 5KWDA 1SQMA 4HORA 4XI0A 5CECB 4ANVA 2J07A 2L9BA 3KD7A 2E0IA 2P9NG 2L0TB 2Y4TA 3ENEA 3DWLG 4HOUA 3EIJA 3E30A 3QWPA 4FLHA 3MEKA 2AW6A 4EHMA 5CCLA 3JQ1A 4APOA 4N5QA 1NFIE 1E7UA 4KMOA 4HRNA 2XEVA 3D9KA 1HXIA 1EPUA 3FTXA 4F53A 5ENTD 3I4GA 3N71A 4NIKA 5FINA 1QQEA 3TWXA 4GMLA 3MKQB 3TL5A 2WXMA 2IF4A 3APDA 4G24A 5EX0A 3TWUA 1U3DA 3FU3A 2VYIA 2J4DA 4LEUA 2WQ7A 3ASNE 2ZU6B 1YA0A 2X6KA 3LY9A 2R02A 1ELRA 5KCMA 3Q75A 5G04J 3GZ1A 3HIZA 5BW8C 4DX1A 3MZLB 3C3QA 4UI9J 3FUFA 1SA5A 1HS6A 2LUHA 5B1AE 4A3TA 3ONLA 1P5QA 1N4QA 1UN9A 2L6BA 4GTTA 3FUMA 4EBAA 5ITZF 1FPPA 2PNNA 3FHEA 2GRLA 2I1KA 3CHQA 2AXUA 3HHMA 3T8KA 3O48A 4GAAA 2PM6A 3DXMG 4AM9A 3FUHA 5ENRD 4GTOA 4XZ4A 2WXJA 4HFGA 1ZBPA 1DCQA 2VGYA 1BPOA 2J08A 3NBNB 4JZYA 4M7CA 4HOTA 3S2AA 1A17A 4MLPA 2WXIA 4J0UA 3EHNA 1LF8A 3PNTB 4FHKA 4PS8A 5CEAA 3TWSA 3ZHEA 5EYLA 1PC2A 3ESLA 2P9LG 3OXFA 2XEEA 3DRAA 4ANUA 3RRUA 1N0RA 1SZAA 2BUGA 1N11A 3D9JA 1FVFA 3U64A 5BT1A 3U9WA 2X6IA 5ARFA 4APFA 3AU4A 4YNDA 2IOLA 3TGOA 5BXUA 2P9KG 3TAXA 3UM1A 4G2VA 4IN3B 3MCXA 2ILRA 4ATZD 4WNDA 3L22A 1N0QA 3Q5MA 2WQ6A 1FT1A 5DBKA 4GYWA 4RQIA 3HVEB 1UOHA 1GW6A 3VLDA 2J4BA 4I9CA 3Q47B 2JEKA 1MJ0A 4JHKA 2R59A 4GU5A 3HXBA 4CRWA 1UW4B 5KJMA 3MJWA 2XZDG 2VGXA 4O60A 1TNUA 4W9RA 2F8XK 3MGBA 3LVRE 4DLOA 3FUJA 4J8FA 1UG3A 3DPDA 3SFXA 4L9PA 4DJAA 2CFZA 2AJAA 3PS6A 4L2LA 3Q7FA 3QOUA 1PAQA 3FUIA 4A1GA 3B95A 4G8LA 3WXXA 5D0OD 3FEXA 5FQ8A 3CVLA 4V3IA 1NI1A 1OCZE 2GRQB 2LAHA 2IEJA 4U0SA 2YNQA 1OWMA 2AXZA 5AQAA 1WDYA 2FO1E 3D9OA 4WAFA 4PS7A 3C98A 4XE0A 4ABNA 2WXGA 4JB8P 3JCKC 3NAWA 1O1RA 5BPPA 4LG6A 1H2VC 5J90A 2VQ2A 3SFYA 4I2WA 4ACKA 3FUNA 1K8KG 3AS8A 4N3BA 3UXGA 3TJPA 3AG1E 4B94A 1B89A 1HG2A 1TN8A 4UWGA 3LKUA 3QWWA 3RK6A 5LX8A 1MX2A 1FT2A 3U3WA 5JMND 3G2WA 4A63B 1HG5A 4OVUA 4I1AA 1K1AA 3QK0A 3PE4A 3UIPC 2HR2A 2CG2A 3L08A 5ENOD 4LNGA 4XI9A 4CDRA 4B93B 3TWWA 4BEPA 3HDXA 1KPSB 2BF0X 1S0PA 2KCVA 1TNBA 2Y1LE 1OWPA 2XCBA 2ETBA 3B7RL 4K5CA 3CIAA 4U04A 3UT8A 4UQYA 3LJNA 3UPVA 4GA0A 2QC9A 3EJNA 5AN8A 3DPYA 2NYJA 2WB2A 5AAOA 3RJVA 4F7AA 3Q73A 4NRHB 2I2OA 2X38A 3SBSA 3ASFA 4FLBA 3OAWA 3ZFWA 2LSVA 3Q49B 1MZCA 3C3RA 4FHJA 3UTMA 4AVXA 2P9IG 4QQIA 4PS3A 1BLXB 2LO6A 2KATA 3EHRA 4TXPA 3EU5A 1QBQA 4I1OB 3ZXPA 3HXDA 2KBXA 1Z5SC 3TG4A 2HE0A 5FT9A 4JC8A 2LXLA 3ESKA 3CKBA 4UWFA 3EHQA 3CVVA 5B3SE 3E37A 2VSOE 4HVBA 3NF1A 1Z6TA 2OVFA 3R9MA 3B7UX 1JCRA 1MHQA 4HLLA 4EECA 3C72A 4GCOA 1OUVA 4U8VD 4JEUA 4HB5A 5A23A 3CKCA 2VSYA 3CQCB 1HZ4A 2EIKE 4C48B 5EX3A 4XKBA 4JD2G 4ATGA 4DPRA 4HBDA 2BKGA 5D66A 1IQRA 4DUIA 2VTBB 2RFAA 2KCLA 1NP7A 2KXPC 5D0QD 5KBAA 3P2BA 2HYZA 2H6HA 1H19A 4LNBA 2KZTB 4BT9A 3FU0A 4FP7A 2F8YA 3SO8A 4HRMB 4F1PA 2WXPA 4Z68A 2I9CA 3LY7A 4EQFA 1H6PA 4JHJA 1XNFA 2WXHA 2DIWA 3I4RB 4CT4A 3HXEA 3AS5A 3D9MA 1DVPA 3IXEA 2P9UG 2ZIRA 2ZXWE 5A7DB 5T3RA 3UKUG 4BX9A 3LCAA 1Z3YA 3TXNA 5ENNA 5D2MC 2OCCE 3CHPA 1JCSA 3D9NA 2GRPB
chains in the Genus database with same CATH topology
4R7LA 3LY9A 2FO7A 3CVNA 4URKA 4MRUA 1ELRA 5KCMA 5G04J 4BFRA 1HH8A 2L0IA 2XQ0A 3NQPA 4LCTA 2XRZA 3GZ1A 5CCMA 1WY6A 3HIZA 3RO2A 3ZPJA 5BW8C 3S7BA 3IKOB 4DK5A 4AIFA 3MZLB 3GYZA 5FJYA 5EDSA 4UI9J 4UI9C 2C0LA 1IYGA 3D3MA 5FZSA 4HOQA 4KT6B 3RKVA 3CK8A 3IBEA 2YHEA 5KJLA 3FUFA 1HS6A 4ILHB 3RU0A 4F3VA 3CHOA 3G2VA 2XRYA 3SD5A 4GYYA 3U66A 3QARA 2KCKA 3P1UA 2VSXE 2I6HA 4N39A 4A3TA 3UT7A 3LEWA 4UWKA 3UUXA 5DIZA 4FA6A 1NA3A 3ONLA 1N52A 4JHRA 1P5QA 3CGHA 1UN9A 2WVIA 2NSZA 3ZYLA 4Q96A 3T5XA 1JWGA 3FUMA 4C0EA 2AVPA 3MV3B 2KC7A 3HVEA 4EBAA 2V4LA 3PUKA 4JVSA 4L2YA 3R9AB 4K0RA 4LERA 4WWPA 3FHEA 2GRLA 2LSUA 3B13A 1XGWA 5G2NA 2I1KA 3SF4A 4KZCA 4RVBA 3FEYA 4AOFA 3CHQA 2WMOA 2DBAA 2AXUA 3HHMA 1IQUA 4G25A 5E75A 3O48A 4GAAA 2PM6A 3IHYA 4U8HA 3QB2A 4KBQA 2WXOA 3QAQA 3ULQA 4AM9A 3FUHA 3D9LA 4JEHA 5FQ6A 3CVPA 3PE3A 3CHMA 3UX4A 5AENA 4HS2A 3DBSA 4H7XA 4XZ4A 2WXJA 3AU5A 4HFGA 1ZBPA 2VGYA 4I6EA 1BPOA 3T8MA 2J08A 2KM4A 3AS4A 4QFVA 4I6JA 4UQZA 2AXVA 4JZYA 4HOTA 3S2AA 1JUQA 5HI7A 3GZSA 3PNLB 1A17A 2IQCA 1EYHA 3VTYA 4Y6CA 3FUDA 4MLPA 4AXHA 3SFZA 4JW1A 2WXIA 4IYPA 4J0UA 4J6IA 1KT1A 3EHNA 2X6JA 1LF8A 2C0MA 2IOSA 3EHMA 3PNTB 2GGFA 5KJNA 5G55A 4N3AA 4GB9A 2IU1A 4FHKA 4PS8A 3ZHEA 2XPZA 1PC2A 2CHXA 2WXRA 3ESLA 3FTYA 5ANLA 1E8XA 4BSXA 3FULA 2UY1B 3TG5A 3OXFA 2X3MA 3OTNA 4AJWA 4ANUA 4I9EA 4FJYA 3U4TA 2XPIA 4WNFA 3RRUA 3ZYKA 3EIQC 1SZAA 3URZA 3ZEFA 2BUGA 2Y4UA 3D9JA 1FVFA 4JPSA 3U64A 5BT1A 3U9WA 4J8DA 1IHGA 2CFUA 1ZU2A 2X6IA 4JA7A 3S7DA 5ARFA 3FWVA 3AU4A 3K9IA 4APFA 4OVVA 4YNDA 2IOLA 4XIFA 4LUNU 3S7FA 3TGOA 3CVUA 1U3CA 3MKRA 3TAXA 4G2VA 4PUCA 3BG0B 4FC8A 4IN3B 3MCXA 5AYWD 4G23A 4B8CB 2FEZA 2ILRA 4GPKA 2EQXA 3PVLA 2VSNA 4KXKB 4WNDA 2X6FA 3UT4A 4CDNA 4YVQC 4JL0A 3L22A 3ASHA 2Q7FA 3Q15A 3Q5MA 2MRIA 3CHRA 3SBTB 3ONKA 2WQ6A 2FBNA 4EZKA 5DBKA 4GYWA 3GZ2A 2XGOA 1L5JA 5ANRA 3FTVA 2E2EA 3HVEB 1GW6A 3VLDA 1NZNA 2J4BA 3PRZA 3SNXA 2YQ8A 4I9CA 3FH8A 1HFAA 5G04C 2V8SE 4EPZA 2IONA 3Q47B 4BWRA 4J8SA 2CG3A 2JEKA 3SI5A 3MV2B 4JHKA 4Q94A 2L6JA 1E96B 4IRUA 2R59A 3ML8A 4GU5A 1H0AA 3ZYQA 5CMWA 4CRWA 5LCWC 3QJZA 5LCWJ 2WPVA 1UW4B 5KJMA 3MJWA 4AEZC 2ONDA 1HE8A 1UJJA 3I3NA 3LVQE 2VGXA 3IV0A 3G2SA 4W9RA 1X5BA 3FDHA 2VJ8A 3MGBA 4GCNA 3RRMB 3G2TA 1E8YA 3O4ZA 3B7SA 4N5CA 5EKQD 4CGVA 3LVRE 3R7QA 4DLOA 3FUJA 4J8FA 4MKTA 1UG3A 2PM7A 4U63A 3DPDA 4M3OA 2RD0A 2RG8A 4L1BA 4UI9K 4DJAA 4WWOA 2CFZA 5BV0A 3PS6A 3CK9A 4NQ0A 4L2LA 3QOUA 3FUKA 3SZ7A 5JJTA 1PAQA 2PQRA 3ZGQA 4ACLA 3FUIA 2XCCA 4A1GA 2QY7A 2WQHA 4XKCA 3FU6A 3WXXA 5D0OD 3CSFA 3PEUB 3ZHEB 3FEXA 3IEGA 5FQ8A 3CVLA 3MYVA 4V3IA 2DCPA 4KVMA 4GMJA 5FTPA 2LAHA 4C0MA 4GA1A 4U0SA 4OYSA 5AIJA 3ZXSA 2YNQA 5LFAA 1OWMA 2BTDA 2AXZA 1OWLA 4L23A 5G05J 1E8ZA 5G05C 3UMVA 3D9OA 4WAFA 3CVQA 5T4YA 4PS7A 3C98A 4XE0A 4ABNA 2XGMA 3L54A 4O6FA 5A6CA 5CHEE 2WXGA 3FU5A 3JCKC 3FTZA 1VDYA 5JHBA 1E7VA 3CQGB 2CHZA 1INZA 4A1SA 4BTBA 5E76A 4HOSA 2YINA 1ELWA 2MHKA 5BPPA 1H2VC 4N3CA 3ZN3A 5J90A 4Y6WA 4BT8A 3D9PA 3R7RA 3PH0C 2FI7A 2VQ2A 2V5FA 1KLXA 3PUJA 4AV7A 4I2WA 4ACKA 3CR3A 3FUNA 2WXNA 3AS8A 5FQ7A 4N3BA 4CEMA 4EZLA 3CK7A 3TJPA 4WUYA 4DI4A 3ASGA 3L16A 2LAIA 1EDUA 4B94A 3L13A 1SZ9A 3FTSA 1B89A 1HG2A 3EDTB 4UWGA 5JJ6A 1Z3XA 3LKUA 1KT0A 3QWWA 4WWNA 4KVOA 3RK6A 5LX8A 5LOZA 5BNWA 1OWOA 3ZIMA 3U3WA 3G2WA 2PZIA 1HG5A 1Y6IA 4I43A 4OVUA 4U0ZA 2JLBA 3BG1B 4I1AA 3QK0A 3GW4A 3CVXA 3CHSA 4UWHA 4I2ZA 3FTUA 2OVBA 3PE4A 5AJLA 2VGXB 2Y3AA 2CG2A 2HR2A 3L08A 3JYSA 3I5PA 1TJCA 4XI9A 3FP3A 4BY6A 4AY6A 3LY8A 3QC1A 2PL2A 4CDRA 4FU3A 4P29A 1NA0A 3VTXA 3UQ3A 4E85A 5BUZA 4HLEA 4UWLA 4G1TA 3LDZA 2WMNA 3HDXA 5J08A 3JUIA 3ASDA 5CMYA 5JJ7A 3T5VA 4GYOA 2LNIA 2BF0X 2FULA 2WXLA 1S0PA 2GW1A 2R17C 4G11A 2KCVA 1TJFA 4GZ5A 2VTBA 4FJZA 3ZW3A 3CV0A 1OWPA 2XCBA 3CSTA 3B7RL 4I6GA 5FWQA 5JHAA 4CT0A 3CIAA 3S7JA 4U04A 4DI3A 4N2SA 3LS8A 2P58C 5ARGA 3UT8A 2IFUA 3PEVB 4UQYA 2A4ZA 3D9IA 1DNPA 3UPVA 4XX5A 4NURA 4RSYA 5FQ4A 4GA0A 2HM8A 4KZ0A 3EJNA 3RIBA 1HX8A 4GA2A 4H7YA 4BTAA 2KZTA 2WB2A 3RJVA 4F7AA 2HO1A 3APFA 4TRQA 4NRHB 4JA9A 3E4BA 4PH4B 2WXFA 2I2OA 2X38A 2V0PA 3KEZA 5T8IA 3SBSA 3ASFA 3FY4A 3OAWA 4FLBA 4TV3A 3ZFWA 4B0ZA 5BV1A 3SHFA 2LSVA 2X6HA 2WXQA 4J8EA 1W3BA 3Q49B 1HF8A 4FHJA 4AVXA 3ZRHA 1JPLA 2A5UA 4YVOA 2FF4A 3IHVA 4U07A 3SGHA 4PS3A 2LO6A 2WXKA 3RO3A 4B8AA 1ELKA 2KATA 3Q4AB 4CDMA 2PQNA 3MA5A 2OV8A 4WNGA 3LJ3A 4GZ6A 5C2YA 2MOWA 2XPYA 3RRNB 5LP0A 4N2QA 4I1OB 3CVYA 3TG4A 3MKQA 2J09A 4ILGA 1QZ2A 1JWFA 5KJKA 4G26A 4ANXA 3QKYA 2CHWA 5FT9A 3L6AA 4JC8A 3NZSA 3ESKA 4TUUA 3CKBA 3FFLA 4UWFA 4WNEA 4I1MA 2UWJG 3CVVA 2NC9A 2VSOE 4HVBA 4ANWA 3NF1A 5HQ8A 3QWVA 3CEQA 1Z6TA 2OVFA 4HXIA 4RG9A 3B7UX 4E6HA 3OXLA 4U0UA 4L7TA 3CLJA 1MHQA 4A3VA 5C1DA 1HO8A 2OOEA 4GZDA 4ILIA 1EF1C 2QFCA 2J9QA 3FTWA 1HU3A 4EECA 3PZDA 4GCOA 2XGSA 4FULA 1OUVA 4DLQA 2C2LA 3KS2A 5AJDA 3ZYMA 4JEUA 5A23A 1OWNA 3BEEA 4NACA 3QNKA 1WM5A 4IULA 4ME2A 1UN8A 3CKCA 1E90A 2AWIA 2VSYA 3CQCB 3JQ0A 1H2UA 4JXTA 1HZ4A 1SQMA 2R5SA 1MQSA 1E8WA 5EX3A 4HORA 4XI0A 4XKBA 4ANVA 2J07A 2L9BA 3KD7A 2E0IA 2YHCA 3LXUX 4ATGA 4DPRA 2L0TB 2Y4TA 3ENEA 3ML9A 3VLEA 4Q69A 1IQRA 4HOUA 2VTBB 3FUEA 1Y8MA 3HYMB 4GZ3A 3EIJA 2KCLA 1NP7A 3QWPA 4FLHA 5M72A 3MEKA 3L17A 2AW6A 3ZVVA 5D0QD 3P2BA 5CCLA 2HYZA 3MX3A 4RG6A 4CGWA 1H19A 1N54A 3JQ1A 4APOA 3LYAA 4AY5A 4C9BB 2KZTB 4UQXA 4BT9A 3FU0A 3QDNA 4FP7A 4B89A 2GRMA 4K03A 2WXPA 5FZQA 1E7UA 4KMOA 2I9CA 4KYOB 2XEVA 3LY7A 4EQFA 3D9KA 4I17A 1PY1A 1XNFA 2WXHA 4JHJA 3G2UA 2NXPA 3APCA 1HXIA 4EBAG 4PDXA 1EPUA 2DIWA 3I4RB 4BX8A 4CT4A 4LRZA 3AS5A 3FTXA 4F53A 1UJKA 3D9MA 1DVPA 1H6KA 3I4GA 3PDNA 3N71A 2WM9A 4MS6A 2J49A 1QQEA 3FH5A 1WAO1 3KAEA 3NZUA 4AP2A 1FVHA 4GMLA 2M63A 3PREA 4A55A 3LPZA 2XHEA 3OXGA 5A7DB 1QNFA 5T3RA 3MKQB 3CVWA 3TL5A 2IJGX 2WXMA 2IF4A 4BX9A 3APDA 4G24A 3LCAA 3TXMA 1Z3YA 5EX0A 3VLFA 1TEZA 4EZJA 4GZCA 3TXNA 1U3DA 3FU3A 5ENNA 1H2TC 2VYIA 4FADA 5FZRA 2J4DA 3FH7A 4CCAA 4F1SA 1FCHA 2I1JA 4LEUA 2WQ7A 3CHPA 2UY1A 3B7TA 2ZU6B 4D10C 3D9NA 1YA0A 2X6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LY9 A;  2FO7 A;  3CVN A;  1ELR A;  5G04 J;  1HH8 A;  3GZ1 A;  5CCM A;  3RO2 A;  3ZPJ A;  5BW8 C;  3S7B A;  4AIF A;  3GYZ A;  5FJY A;  1IYG A;  4UI9 J;  4UI9 C;  2C0L A;  5FZS A;  4HOQ A;  3RKV A;  3CK8 A;  5KJL A;  3RU0 A;  4F3V A;  4GYY A;  2KCK A;  2I6H A;  4N39 A;  3UUX A;  5DIZ A;  1NA3 A;  4JHR A;  1P5Q A;  2AVP A;  3MV3 B;  2KC7 A;  3R9A B;  2LSU A;  3SF4 A;  2DBA A;  4G25 A;  3O48 A;  4KBQ A;  3ULQ A;  4AM9 A;  3CVP A;  3PE3 A;  4H7X A;  1ZBP A;  2VGY A;  3AS4 A;  4UQZ A;  4HOT A;  5HI7 A;  1A17 A;  3VTY A;  4Y6C A;  4J0U A;  1KT1 A;  2C0M A;  5KJN A;  4N3A A;  3ZHE A;  1PC2 A;  2UY1 B;  3TG5 A;  3OXF A;  4I9E A;  3U4T A;  2XPI A;  4WNF A;  3URZ A;  2BUG A;  2Y4U A;  5BT1 A;  4J8D A;  1IHG A;  4JA7 A;  1ZU2 A;  3S7D A;  5ARF A;  3FWV A;  3K9I A;  4YND A;  4XIF A;  3TGO A;  3S7F A;  3MKR A;  3TAX A;  4G2V A;  4IN3 B;  5AYW D;  4G23 A;  2FEZ A;  4GPK A;  2VSN A;  4KXK B;  4WND A;  4YVQ C;  4JL0 A;  3ASH A;  2Q7F A;  3Q15 A;  3Q5M A;  2FBN A;  5DBK A;  4GYW A;  3GZ2 A;  2XGO A;  2E2E A;  1NZN A;  2YQ8 A;  4I9C A;  5G04 C;  3Q47 B;  4BWR A;  3MV2 B;  2L6J A;  1E96 B;  5LCW J;  5LCW C;  2WPV A;  5KJM A;  2OND A;  2VGX A;  4W9R A;  4GCN A;  4N5C A;  5EKQ D;  4CGV A;  4J8F A;  4UI9 K;  3CK9 A;  4NQ0 A;  3QOU A;  3SZ7 A;  5JJT A;  2PQR A;  3ZGQ A;  2XCC A;  2WQH A;  3WXX A;  5D0O D;  3ZHE B;  3IEG A;  3CVL A;  5FTP A;  4GA1 A;  4U0S A;  5G05 J;  5G05 C;  3CVQ A;  4ABN A;  2XGM A;  4O6F A;  5A6C A;  5CHE E;  4A1S A;  4BTB A;  4HOS A;  1ELW A;  2MHK A;  4N3C A;  3ZN3 A;  4Y6W A;  4BT8 A;  2FI7 A;  2VQ2 A;  2V5F A;  1KLX A;  4I2W A;  3AS8 A;  4N3B A;  3CK7 A;  4WUY A;  3ASG A;  4B94 A;  1B89 A;  3EDT B;  5JJ6 A;  3LKU A;  1KT0 A;  3QWW A;  5BNW A;  3U3W A;  2PZI A;  4U0Z A;  2JLB A;  4I1A A;  3GW4 A;  4I2Z A;  3PE4 A;  2VGX B;  2HR2 A;  3JYS A;  1TJC A;  4XI9 A;  3FP3 A;  4AY6 A;  3LY8 A;  2PL2 A;  4CDR A;  3VTX A;  1NA0 A;  3UQ3 A;  4G1T A;  3ASD A;  5JJ7 A;  4GYO A;  2LNI A;  2GW1 A;  2KCV A;  4GZ5 A;  3CV0 A;  2XCB A;  3S7J A;  4U04 A;  4N2S A;  2P58 C;  5ARG A;  2IFU A;  4UQY A;  3UPV A;  4GA0 A;  3RIB A;  4GA2 A;  4BTA A;  4H7Y A;  3RJV A;  2HO1 A;  4NRH B;  4JA9 A;  3E4B A;  3ASF A;  3ZFW A;  2LSV A;  4J8E A;  1W3B A;  3Q49 B;  4YVO A;  2FF4 A;  4U07 A;  3RO3 A;  3Q4A B;  2KAT A;  2PQN A;  3MA5 A;  4WNG A;  4GZ6 A;  4N2Q A;  3TG4 A;  1QZ2 A;  5KJK A;  4G26 A;  3QKY A;  5FT9 A;  3ESK A;  3CKB A;  3FFL A;  4WNE A;  2UWJ G;  2NC9 A;  3NF1 A;  5HQ8 A;  3QWV A;  3CEQ A;  4RG9 A;  3OXL A;  4U0U A;  5C1D A;  2OOE A;  2QFC A;  2J9Q A;  4GCO A;  2XGS A;  1OUV A;  2C2L A;  3KS2 A;  3BEE A;  1WM5 A;  4ME2 A;  3CKC A;  2VSY A;  1HZ4 A;  2R5S A;  5EX3 A;  4HOR A;  4XI0 A;  3KD7 A;  2YHC A;  2Y4T A;  4HOU A;  3HYM B;  1Y8M A;  4GZ3 A;  2KCL A;  3QWP A;  5M72 A;  3MEK A;  5D0Q D;  5CCL A;  2HYZ A;  4RG6 A;  4CGW A;  4APO A;  3LYA A;  4AY5 A;  4UQX A;  4BT9 A;  3QDN A;  5FZQ A;  4KYO B;  2XEV A;  3LY7 A;  4EQF A;  4I17 A;  1XNF A;  1HXI A;  3AS5 A;  3PDN A;  3N71 A;  1QQE A;  1WAO 1;  3KAE A;  3LPZ A;  5A7D B;  3OXG A;  2IF4 A;  4G24 A;  3LCA A;  5EX0 A;  2VYI A;  5FZR A;  1FCH A;  4LEU A;  2UY1 A;  1YA0 A; 
#chains in the Genus database with same CATH topology
 4R7L A;  4URK A;  2DVW A;  1HH8 A;  2L0I A;  2XQ0 A;  3NQP A;  5CCM A;  1IYG A;  3DSV A;  5FZS A;  4KT6 B;  4ZHB A;  3IBE A;  1QYM A;  5KJL A;  1LD7 A;  4F3V A;  3G2V A;  3SD5 A;  3U66 A;  3QAR A;  2P9P G;  5AAR A;  2VGE A;  2I6H A;  3UT7 A;  4UWK A;  3UUX A;  5CRU A;  4U96 D;  3ZNG A;  3CGH A;  3W9G A;  4Q96 A;  3T5X A;  1JWG A;  3JUE A;  3MV3 B;  2KC7 A;  3BQO A;  2ETC A;  2LSU A;  3B13 A;  4YDO A;  1IQU A;  3J5Q B;  4G25 A;  4U8H A;  2WXO A;  3D9L A;  4JEH A;  5FQ6 A;  3UX4 A;  2P9S G;  3DBS A;  4H7X A;  4U7E B;  3AS4 A;  2AXV A;  2XEN A;  3GZS A;  3PNL B;  3AG2 E;  3FUD A;  4TUM A;  2C0M A;  5FIO A;  2IU1 A;  2CHX A;  2WXR A;  1E8X A;  3AAA C;  1V55 E;  4AJW A;  1K1B A;  3ZYK A;  3EIQ C;  3ZEF A;  3E32 A;  4JPS A;  3UIN C;  1ZU2 A;  4LUN U;  3MKR A;  4PUC A;  3HG0 D;  4G23 A;  4B8C B;  2FEZ A;  3DXK G;  3UT4 A;  4YVQ C;  3ASH A;  3CHR A;  3SBT B;  1KZP A;  2FBN A;  4EZK A;  4BES A;  1IXV A;  5ANR A;  5EIL A;  2QYJ A;  2ZGG A;  1NZN A;  3PRZ A;  5B1B E;  4EPZ A;  4O1P A;  3SI5 A;  4Q94 A;  2L6J A;  3DSS A;  2V5Q C;  3ML8 A;  5LCW C;  4AEZ C;  3UIO C;  5H7P A;  5JA4 D;  3LVQ E;  3IV0 A;  3G2S A;  3FDH A;  4GCN A;  3RRM B;  3O4Z A;  1RW2 A;  3R7Q A;  3D9H A;  4L1B A;  2J8S D;  5BV0 A;  5JJT A;  5AQ9 A;  3ZGQ A;  2XCC A;  1MX6 A;  2QY7 A;  2WQH A;  3FU6 A;  3ZHE B;  4KVM A;  5AIJ A;  2GRR B;  1OWL A;  4L23 A;  1G3N B;  5G05 J;  2IO3 C;  3FU5 A;  4O1O A;  3CQG B;  2CHZ A;  1INZ A;  3C3O A;  4N3C A;  3ZN3 A;  3D9P A;  4HI9 A;  3PUJ A;  1KLX A;  5FQ7 A;  4WUY A;  4DI4 A;  3ASG A;  2LAI A;  3ZU7 B;  3L13 A;  3Q9U C;  3FTS A;  4LSZ E;  1Z3X A;  5EYP F;  2PZI A;  1Y6I A;  4I43 A;  4U0Z A;  2JLB A;  3FTU A;  2OVB A;  1V54 E;  5AJL A;  5EID A;  2VGX B;  3FP3 A;  3LY8 A;  1OT8 A;  1TN6 A;  4P29 A;  2RKK A;  3C5R A;  5BUZ A;  4HLE A;  4UWL A;  4G1T A;  3TWT A;  5CMY A;  1D8E A;  4G11 A;  3ISM C;  4GZ5 A;  3ZW3 A;  5JHA A;  4CT0 A;  3S7J A;  4DI3 A;  4N2S A;  3ZUV B;  3LS8 A;  2P58 C;  2IFU A;  2A4Z A;  4XX5 A;  3DEP A;  4KZ0 A;  3RIB A;  4GA2 A;  3PZ2 A;  1S70 B;  2HO1 A;  3HXF A;  3E4B A;  2V0P A;  1N4S A;  4HRL A;  3KEZ A;  4TV3 A;  1W3B A;  1U2V G;  3T9K A;  4GMR A;  3SGH A;  3E34 A;  2WXK A;  4B8A A;  5EIB E;  3ABM E;  3MA5 A;  2JAB A;  3LJ3 A;  2DYR E;  2MOW A;  2XPY A;  3RRN B;  2J09 A;  2ZIS A;  1QZ2 A;  1JWF A;  5KJK A;  1DCE A;  1OCO E;  3QKY A;  3L6A A;  3NZS A;  4TUU A;  4WNE A;  2UWJ G;  2NC9 A;  4UUC A;  3QWV A;  2F37 A;  4HXI A;  3OXL A;  3CLJ A;  5C1D A;  1HO8 A;  2OOE A;  4GZD A;  4ILI A;  1EF1 C;  1HU3 A;  3PZD A;  2XGS A;  4FUL A;  5AJD A;  3QNK A;  4ME2 A;  1UN8 A;  1E90 A;  3JQ0 A;  2R5S A;  1E8W A;  2YHC A;  1N4R A;  4Q69 A;  1TYQ G;  2R05 A;  1Y8M A;  3HYM B;  1H6O A;  4K5A B;  5M72 A;  3L17 A;  3SY2 A;  3L9T A;  4GTS A;  3MX3 A;  4RG6 A;  4CGW A;  1N54 A;  3LYA A;  4AY5 A;  4GTR A;  4UQX A;  3X2Q E;  4B89 A;  5FZQ A;  4KYO B;  5KNH D;  1PY1 A;  3G2U A;  3APC A;  4EBA G;  4BX8 A;  1H6K A;  3FH5 A;  4AP2 A;  4DX7 D;  1BI7 B;  3LPZ A;  3OXG A;  3CVW A;  2IJG X;  3TXM A;  3VLF A;  4EZJ A;  4GZC A;  1N94 A;  1H2T C;  2ZGD A;  4FAD A;  4F1S A;  4CCA A;  2UY1 A;  3B7T A;  4D10 C;  5HS0 A;  2FO7 A;  3CVN A;  3V31 A;  1MX4 A;  2DZN A;  2XRZ A;  4LNU D;  3ZPJ A;  1ZB1 A;  3IKO B;  4AIF A;  4UI9 C;  2C0L A;  4HOQ A;  3CK8 A;  3JXI A;  2YHE A;  4DRX E;  3RU0 A;  3CHO A;  2KCK A;  1K3Z D;  4N39 A;  3LEW A;  1RZ4 A;  1AWC B;  3ZYL A;  1LD8 A;  2AVP A;  2V4L A;  3PUK A;  4L2Y A;  3R9A B;  4K0R A;  4LER A;  3SF4 A;  4RVB A;  3FEY A;  1BI8 B;  2WMO A;  2DBA A;  1MYO A;  3DSX A;  5BXO A;  2DYS E;  3CVP A;  3PE3 A;  1O1S A;  5CBO A;  3T8M A;  3V2X A;  3ULE G;  2IO2 C;  4QFV A;  1JUQ A;  1TNY A;  5HI7 A;  4DX5 D;  4AXH A;  4U95 D;  4Y6C A;  3SFZ A;  4J6I A;  3UM3 A;  2X6J A;  2IOS A;  5KJN A;  4N3A A;  4GB9 A;  5IY5 E;  3FTY A;  4BSX A;  1BD8 A;  2X3M A;  1YMP A;  4I9E A;  4FJY A;  3U4T A;  2XPI A;  4WNF A;  3URZ A;  2Y4U A;  4J8D A;  1IHG A;  4TXR A;  4JA7 A;  4OVV A;  4XIF A;  1U3C A;  2R2L A;  4FC8 A;  5AYW D;  3PVL A;  2VSN A;  4KXK B;  2X6F A;  4CDN A;  2H6I A;  2MRI A;  2XGO A;  1SW6 A;  1HFA A;  5KNG A;  4J8S A;  2CG3 A;  1E96 B;  3ZYQ A;  5CMW A;  3QJZ A;  2WPV A;  4YDE A;  3PZ4 A;  1HE8 A;  2XS8 A;  2VJ8 A;  3G2T A;  3KEA A;  4CYM D;  3NOC D;  4U63 A;  4M3O A;  2RG8 A;  4UI9 K;  4WWO A;  4XEI G;  4NQ0 A;  3V30 A;  4XKC A;  3CSF A;  3MYV A;  2H6F A;  4C0M A;  3ZXS A;  3Q79 A;  3ASO E;  3KSQ A;  3DSW A;  2XGM A;  4O6F A;  5CHE E;  1TNO A;  2DZO A;  5JHB A;  1E7V A;  3L82 A;  5E76 A;  4HOS A;  2YIN A;  2MHK A;  1TR4 A;  4BT8 A;  2FI7 A;  2V5F A;  4AV7 A;  3CR3 A;  4CEM A;  3E33 A;  1EDU A;  1S64 A;  2XS1 A;  3EDT B;  5JJ6 A;  4F6R D;  4WWN A;  3HRA A;  3EUV A;  5LOZ A;  5BNW A;  3UM2 A;  3ZIM A;  2BKK B;  2V4H C;  5AQB A;  3GW4 A;  3CVX A;  3CHS A;  3I5P A;  2GRO B;  3QC1 A;  5CER B;  4FU3 A;  3UQ3 A;  1IKN D;  2WMN A;  5J08 A;  3ASD A;  1LTX A;  2RFM A;  5JJ7 A;  4GYO A;  2LNI A;  2XZT G;  2FUL A;  2GW1 A;  2R17 C;  1TJF A;  2OEW A;  4FJZ A;  1SA4 A;  3CV0 A;  4I6G A;  3PEV B;  3F6Q A;  4RSY A;  2GRN B;  4BTA A;  2WXF A;  5T8I A;  3FY4 A;  4B0Z A;  5BV1 A;  1Q2Z A;  2X6H A;  2WXQ A;  5CBN A;  1JPL A;  2A5U A;  3IHV A;  3TWQ A;  5CED B;  1ELK A;  1TNZ A;  3DEO A;  4CDM A;  3AJI A;  2PQN A;  2OV8 A;  4GZ6 A;  5C2Y A;  2EIJ E;  2EIL E;  3UI2 A;  4N2Q A;  3CVY A;  3MKQ A;  4GTP A;  4G26 A;  4ANX A;  1D9S A;  4GTM A;  3FFL A;  3PZ1 A;  2OEV A;  3CEQ A;  1KZO A;  2R03 A;  4RG9 A;  1YCS B;  4L7T A;  4YDW A;  2QFC A;  3FTW A;  4BSZ B;  3RSE G;  2C2L A;  3ZYM A;  2QZA A;  3BEE A;  4NAC A;  1WM5 A;  2QYU A;  1SVX A;  2AWI A;  1H2U A;  4JXT A;  1O1T A;  1MQS A;  2MYO A;  3WG7 E;  3LXU X;  3ML9 A;  3VLE A;  1D8D A;  4GPM A;  1TN7 A;  3FUE A;  5CRV A;  4GZ3 A;  4DX2 A;  3ZVV A;  4J7W A;  4C9B B;  3QDN A;  5EN5 D;  2GRM A;  4K03 A;  4HNA D;  3EU9 A;  4I17 A;  5AQ7 A;  2NXP A;  2P2C P;  3RAU A;  4PDX A;  4LRZ A;  1UJK A;  3PDN A;  2WM9 A;  4MS6 A;  2J49 A;  1WAO 1;  3KAE A;  3NZU A;  1FVH A;  1N95 A;  2M63 A;  3PRE A;  4A55 A;  2XHE A;  1QNF A;  1S63 A;  1TEZ A;  5FZR A;  3FH7 A;  2B6C A;  1FCH A;  2I1J A;  1N4P A;  4MRU A;  4HQD A;  4BFR A;  4LCT A;  4TXQ A;  1WY6 A;  4BER A;  3RO2 A;  3S7B A;  4DK5 A;  3GYZ A;  5FJY A;  5EDS A;  3D3M A;  3RKV A;  3V79 K;  4ILH B;  2XRY A;  5ENQ D;  4X8Q A;  4GYY A;  3P1U A;  2VSX E;  2BED A;  1OCR E;  5DIZ A;  4FA6 A;  1NA3 A;  1N52 A;  4JHR A;  2WVI A;  2NSZ A;  4MBG A;  2XEH A;  4C0E A;  3HVE A;  4JVS A;  5ENS D;  4OAV B;  4WWP A;  1XGW A;  5G2N A;  4KZC A;  4AOF A;  3Q7A A;  3BUA A;  5E75 A;  3BU8 A;  4BET A;  3IHY A;  3QB2 A;  4KBQ A;  3QAQ A;  4CZ2 D;  3ULQ A;  3J5P A;  3CHM A;  5AEN A;  4HS2 A;  3AU5 A;  4I6E A;  2KM4 A;  4I6J A;  4UQZ A;  1IHB A;  2IQC A;  3HXC A;  1EYH A;  3VTY A;  4JW1 A;  4IYP A;  1KT1 A;  3EHM A;  2GGF A;  5G55 A;  2XPZ A;  5ANL A;  3FUL A;  2UY1 B;  3TG5 A;  3OTN A;  1N9A A;  3ULY A;  2ETA A;  3W9F A;  2CFU A;  2F0Y A;  3S7D A;  3FWV A;  3K9I A;  3CVU A;  3S7F A;  1OCC E;  3BG0 B;  3Q78 A;  4GPK A;  2EQX A;  4JL0 A;  2Q7F A;  3Q15 A;  4GTV A;  3ONK A;  3GZ2 A;  1L5J A;  3V2O A;  3FTV A;  2E2E A;  1DC2 A;  3SNX A;  1WG0 A;  2YQ8 A;  3FH8 A;  5G04 C;  2V8S E;  2ION A;  4BWR A;  3TWV A;  3MV2 B;  4IRU A;  5LCW J;  1H0A A;  2OND A;  1UJJ A;  3I3N A;  1BU9 A;  2Y69 E;  1X5B A;  1E8Y A;  3B7S A;  4N5C A;  5EKQ D;  4CGV A;  1YYH A;  4MKT A;  2PM7 A;  2RD0 A;  1JCQ A;  3CK9 A;  3FUK A;  3SZ7 A;  2PQR A;  4ACL A;  3NB2 A;  5HKP A;  3DST A;  2DWZ A;  3PEU B;  3IEG A;  2B0O E;  2DCP A;  4GMJ A;  5FTP A;  2LXM A;  4GA1 A;  4OYS A;  5LFA A;  2BTD A;  2Y0B G;  2H6G A;  1E8Z A;  5G05 C;  3UMV A;  3CVQ A;  5T4Y A;  3L54 A;  5A6C A;  3ABK E;  3FTZ A;  1VDY A;  1A5E A;  1OXJ A;  4A1S A;  4BTB A;  1ELW A;  4Y6W A;  3R7R A;  3SQV A;  3PH0 C;  3NOG D;  4J8Y A;  2WXN A;  4EZL A;  3CK7 A;  5ENP D;  3L16 A;  4RLY A;  1SZ9 A;  5HRY A;  1KT0 A;  3AG3 E;  2A5E A;  1X81 A;  4KVO A;  3UKR G;  3AG4 E;  1OWO A;  1AP7 A;  3BG1 B;  4UWH A;  4I2Z A;  2Y3A A;  3JYS A;  3ZKJ A;  1TJC A;  4AY6 A;  4BY6 A;  4K5B A;  4U8Y D;  2PL2 A;  4YDY A;  3VTX A;  1NA0 A;  4E85 A;  3LDZ A;  3JUI A;  4DX6 D;  3T5V A;  3ABL E;  2EIN E;  4OAU C;  2WXL A;  1NL4 A;  2VTB A;  3CST A;  5FWQ A;  5ARG A;  3D9I A;  1DNP A;  4NUR A;  5FQ4 A;  2HM8 A;  1HX8 A;  4H7Y A;  2KZT A;  3APF A;  4TRQ A;  4JA9 A;  4PH4 B;  3SHF A;  4J8E A;  1HF8 A;  1OY3 D;  3ZRH A;  4YVO A;  2FF4 A;  4U07 A;  3RO3 A;  3Q4A B;  4WNG A;  3Q9N C;  5LP0 A;  3UM0 A;  4ILG A;  3B7B A;  2IY0 C;  2CHW A;  2EIM E;  4I1M A;  3DSU A;  4ANW A;  4ZFH A;  5HQ8 A;  3KSL A;  4E6H A;  4U0U A;  4A3V A;  4G8K A;  1O5M A;  4HI8 A;  2J9Q A;  4GTQ A;  3PZ3 A;  3TWR A;  4DLQ A;  3JXJ A;  3KS2 A;  1OWN A;  4IUL A;  5KWD A;  1SQM A;  4HOR A;  4XI0 A;  5CEC B;  4ANV A;  2J07 A;  2L9B A;  3KD7 A;  2E0I A;  2P9N G;  2L0T B;  2Y4T A;  3ENE A;  3DWL G;  4HOU A;  3EIJ A;  3E30 A;  3QWP A;  4FLH A;  3MEK A;  2AW6 A;  4EHM A;  5CCL A;  3JQ1 A;  4APO A;  4N5Q A;  1NFI E;  1E7U A;  4KMO A;  4HRN A;  2XEV A;  3D9K A;  1HXI A;  1EPU A;  3FTX A;  4F53 A;  5ENT D;  3I4G A;  3N71 A;  4NIK A;  5FIN A;  1QQE A;  3TWX A;  4GML A;  3MKQ B;  3TL5 A;  2WXM A;  2IF4 A;  3APD A;  4G24 A;  5EX0 A;  3TWU A;  1U3D A;  3FU3 A;  2VYI A;  2J4D A;  4LEU A;  2WQ7 A;  3ASN E;  2ZU6 B;  1YA0 A;  2X6K A;  3LY9 A;  2R02 A;  1ELR A;  5KCM A;  3Q75 A;  5G04 J;  3GZ1 A;  3HIZ A;  5BW8 C;  4DX1 A;  3MZL B;  3C3Q A;  4UI9 J;  3FUF A;  1SA5 A;  1HS6 A;  2LUH A;  5B1A E;  4A3T A;  3ONL A;  1P5Q A;  1N4Q A;  1UN9 A;  2L6B A;  4GTT A;  3FUM A;  4EBA A;  5ITZ F;  1FPP A;  2PNN A;  3FHE A;  2GRL A;  2I1K A;  3CHQ A;  2AXU A;  3HHM A;  3T8K A;  3O48 A;  4GAA A;  2PM6 A;  3DXM G;  4AM9 A;  3FUH A;  5ENR D;  4GTO A;  4XZ4 A;  2WXJ A;  4HFG A;  1ZBP A;  1DCQ A;  2VGY A;  1BPO A;  2J08 A;  3NBN B;  4JZY A;  4M7C A;  4HOT A;  3S2A A;  1A17 A;  4MLP A;  2WXI A;  4J0U A;  3EHN A;  1LF8 A;  3PNT B;  4FHK A;  4PS8 A;  5CEA A;  3TWS A;  3ZHE A;  5EYL A;  1PC2 A;  3ESL A;  2P9L G;  3OXF A;  2XEE A;  3DRA A;  4ANU A;  3RRU A;  1N0R A;  1SZA A;  2BUG A;  1N11 A;  3D9J A;  1FVF A;  3U64 A;  5BT1 A;  3U9W A;  2X6I A;  5ARF A;  4APF A;  3AU4 A;  4YND A;  2IOL A;  3TGO A;  5BXU A;  2P9K G;  3TAX A;  3UM1 A;  4G2V A;  4IN3 B;  3MCX A;  2ILR A;  4ATZ D;  4WND A;  3L22 A;  1N0Q A;  3Q5M A;  2WQ6 A;  1FT1 A;  5DBK A;  4GYW A;  4RQI A;  3HVE B;  1UOH A;  1GW6 A;  3VLD A;  2J4B A;  4I9C A;  3Q47 B;  2JEK A;  1MJ0 A;  4JHK A;  2R59 A;  4GU5 A;  3HXB A;  4CRW A;  1UW4 B;  5KJM A;  3MJW A;  2XZD G;  2VGX A;  4O60 A;  1TNU A;  4W9R A;  2F8X K;  3MGB A;  3LVR E;  4DLO A;  3FUJ A;  4J8F A;  1UG3 A;  3DPD A;  3SFX A;  4L9P A;  4DJA A;  2CFZ A;  2AJA A;  3PS6 A;  4L2L A;  3Q7F A;  3QOU A;  1PAQ A;  3FUI A;  4A1G A;  3B95 A;  4G8L A;  3WXX A;  5D0O D;  3FEX A;  5FQ8 A;  3CVL A;  4V3I A;  1NI1 A;  1OCZ E;  2GRQ B;  2LAH A;  2IEJ A;  4U0S A;  2YNQ A;  1OWM A;  2AXZ A;  5AQA A;  1WDY A;  2FO1 E;  3D9O A;  4WAF A;  4PS7 A;  3C98 A;  4XE0 A;  4ABN A;  2WXG A;  4JB8 P;  3JCK C;  3NAW A;  1O1R A;  5BPP A;  4LG6 A;  1H2V C;  5J90 A;  2VQ2 A;  3SFY A;  4I2W A;  4ACK A;  3FUN A;  1K8K G;  3AS8 A;  4N3B A;  3UXG A;  3TJP A;  3AG1 E;  4B94 A;  1B89 A;  1HG2 A;  1TN8 A;  4UWG A;  3LKU A;  3QWW A;  3RK6 A;  5LX8 A;  1MX2 A;  1FT2 A;  3U3W A;  5JMN D;  3G2W A;  4A63 B;  1HG5 A;  4OVU A;  4I1A A;  1K1A A;  3QK0 A;  3PE4 A;  3UIP C;  2HR2 A;  2CG2 A;  3L08 A;  5ENO D;  4LNG A;  4XI9 A;  4CDR A;  4B93 B;  3TWW A;  4BEP A;  3HDX A;  1KPS B;  2BF0 X;  1S0P A;  2KCV A;  1TNB A;  2Y1L E;  1OWP A;  2XCB A;  2ETB A;  3B7R L;  4K5C A;  3CIA A;  4U04 A;  3UT8 A;  4UQY A;  3LJN A;  3UPV A;  4GA0 A;  2QC9 A;  3EJN A;  5AN8 A;  3DPY A;  2NYJ A;  2WB2 A;  5AAO A;  3RJV A;  4F7A A;  3Q73 A;  4NRH B;  2I2O A;  2X38 A;  3SBS A;  3ASF A;  4FLB A;  3OAW A;  3ZFW A;  2LSV A;  3Q49 B;  1MZC A;  3C3R A;  4FHJ A;  3UTM A;  4AVX A;  2P9I G;  4QQI A;  4PS3 A;  1BLX B;  2LO6 A;  2KAT A;  3EHR A;  4TXP A;  3EU5 A;  1QBQ A;  4I1O B;  3ZXP A;  3HXD A;  2KBX A;  1Z5S C;  3TG4 A;  2HE0 A;  5FT9 A;  4JC8 A;  2LXL A;  3ESK A;  3CKB A;  4UWF A;  3EHQ A;  3CVV A;  5B3S E;  3E37 A;  2VSO E;  4HVB A;  3NF1 A;  1Z6T A;  2OVF A;  3R9M A;  3B7U X;  1JCR A;  1MHQ A;  4HLL A;  4EEC A;  3C72 A;  4GCO A;  1OUV A;  4U8V D;  4JEU A;  4HB5 A;  5A23 A;  3CKC A;  2VSY A;  3CQC B;  1HZ4 A;  2EIK E;  4C48 B;  5EX3 A;  4XKB A;  4JD2 G;  4ATG A;  4DPR A;  4HBD A;  2BKG A;  5D66 A;  1IQR A;  4DUI A;  2VTB B;  2RFA A;  2KCL A;  1NP7 A;  2KXP C;  5D0Q D;  5KBA A;  3P2B A;  2HYZ A;  2H6H A;  1H19 A;  4LNB A;  2KZT B;  4BT9 A;  3FU0 A;  4FP7 A;  2F8Y A;  3SO8 A;  4HRM B;  4F1P A;  2WXP A;  4Z68 A;  2I9C A;  3LY7 A;  4EQF A;  1H6P A;  4JHJ A;  1XNF A;  2WXH A;  2DIW A;  3I4R B;  4CT4 A;  3HXE A;  3AS5 A;  3D9M A;  1DVP A;  3IXE A;  2P9U G;  2ZIR A;  2ZXW E;  5A7D B;  5T3R A;  3UKU G;  4BX9 A;  3LCA A;  1Z3Y A;  3TXN A;  5ENN A;  5D2M C;  2OCC E;  3CHP A;  1JCS A;  3D9N A;  2GRP B; 
#chains in the Genus database with same CATH homology
 4R7L A;  3LY9 A;  2FO7 A;  3CVN A;  4URK A;  4MRU A;  1ELR A;  5KCM A;  5G04 J;  4BFR A;  1HH8 A;  2L0I A;  2XQ0 A;  3NQP A;  4LCT A;  2XRZ A;  3GZ1 A;  5CCM A;  1WY6 A;  3HIZ A;  3RO2 A;  3ZPJ A;  5BW8 C;  3S7B A;  3IKO B;  4DK5 A;  4AIF A;  3MZL B;  3GYZ A;  5FJY A;  5EDS A;  4UI9 J;  4UI9 C;  2C0L A;  1IYG A;  3D3M A;  5FZS A;  4HOQ A;  4KT6 B;  3RKV A;  3CK8 A;  3IBE A;  2YHE A;  5KJL A;  3FUF A;  1HS6 A;  4ILH B;  3RU0 A;  4F3V A;  3CHO A;  3G2V A;  2XRY A;  3SD5 A;  4GYY A;  3U66 A;  3QAR A;  2KCK A;  3P1U A;  2VSX E;  2I6H A;  4N39 A;  4A3T A;  3UT7 A;  3LEW A;  4UWK A;  3UUX A;  5DIZ A;  4FA6 A;  1NA3 A;  3ONL A;  1N52 A;  4JHR A;  1P5Q A;  3CGH A;  1UN9 A;  2WVI A;  2NSZ A;  3ZYL A;  4Q96 A;  3T5X A;  1JWG A;  3FUM A;  4C0E A;  2AVP A;  3MV3 B;  2KC7 A;  3HVE A;  4EBA A;  2V4L A;  3PUK A;  4JVS A;  4L2Y A;  3R9A B;  4K0R A;  4LER A;  4WWP A;  3FHE A;  2GRL A;  2LSU A;  3B13 A;  1XGW A;  5G2N A;  2I1K A;  3SF4 A;  4KZC A;  4RVB A;  3FEY A;  4AOF A;  3CHQ A;  2WMO A;  2DBA A;  2AXU A;  3HHM A;  1IQU A;  4G25 A;  5E75 A;  3O48 A;  4GAA A;  2PM6 A;  3IHY A;  4U8H A;  3QB2 A;  4KBQ A;  2WXO A;  3QAQ A;  3ULQ A;  4AM9 A;  3FUH A;  3D9L A;  4JEH A;  5FQ6 A;  3CVP A;  3PE3 A;  3CHM A;  3UX4 A;  5AEN A;  4HS2 A;  3DBS A;  4H7X A;  4XZ4 A;  2WXJ A;  3AU5 A;  4HFG A;  1ZBP A;  2VGY A;  4I6E A;  1BPO A;  3T8M A;  2J08 A;  2KM4 A;  3AS4 A;  4QFV A;  4I6J A;  4UQZ A;  2AXV A;  4JZY A;  4HOT A;  3S2A A;  1JUQ A;  5HI7 A;  3GZS A;  3PNL B;  1A17 A;  2IQC A;  1EYH A;  3VTY A;  4Y6C A;  3FUD A;  4MLP A;  4AXH A;  3SFZ A;  4JW1 A;  2WXI A;  4IYP A;  4J0U A;  4J6I A;  1KT1 A;  3EHN A;  2X6J A;  1LF8 A;  2C0M A;  2IOS A;  3EHM A;  3PNT B;  2GGF A;  5KJN A;  5G55 A;  4N3A A;  4GB9 A;  2IU1 A;  4FHK A;  4PS8 A;  3ZHE A;  2XPZ A;  1PC2 A;  2CHX A;  2WXR A;  3ESL A;  3FTY A;  5ANL A;  1E8X A;  4BSX A;  3FUL A;  2UY1 B;  3TG5 A;  3OXF A;  2X3M A;  3OTN A;  4AJW A;  4ANU A;  4I9E A;  4FJY A;  3U4T A;  2XPI A;  4WNF A;  3RRU A;  3ZYK A;  3EIQ C;  1SZA A;  3URZ A;  3ZEF A;  2BUG A;  2Y4U A;  3D9J A;  1FVF A;  4JPS A;  3U64 A;  5BT1 A;  3U9W A;  4J8D A;  1IHG A;  2CFU A;  1ZU2 A;  2X6I A;  4JA7 A;  3S7D A;  5ARF A;  3FWV A;  3AU4 A;  3K9I A;  4APF A;  4OVV A;  4YND A;  2IOL A;  4XIF A;  4LUN U;  3S7F A;  3TGO A;  3CVU A;  1U3C A;  3MKR A;  3TAX A;  4G2V A;  4PUC A;  3BG0 B;  4FC8 A;  4IN3 B;  3MCX A;  5AYW D;  4G23 A;  4B8C B;  2FEZ A;  2ILR A;  4GPK A;  2EQX A;  3PVL A;  2VSN A;  4KXK B;  4WND A;  2X6F A;  3UT4 A;  4CDN A;  4YVQ C;  4JL0 A;  3L22 A;  3ASH A;  2Q7F A;  3Q15 A;  3Q5M A;  2MRI A;  3CHR A;  3SBT B;  3ONK A;  2WQ6 A;  2FBN A;  4EZK A;  5DBK A;  4GYW A;  3GZ2 A;  2XGO A;  1L5J A;  5ANR A;  3FTV A;  2E2E A;  3HVE B;  1GW6 A;  3VLD A;  1NZN A;  2J4B A;  3PRZ A;  3SNX A;  2YQ8 A;  4I9C A;  3FH8 A;  1HFA A;  5G04 C;  2V8S E;  4EPZ A;  2ION A;  3Q47 B;  4BWR A;  4J8S A;  2CG3 A;  2JEK A;  3SI5 A;  3MV2 B;  4JHK A;  4Q94 A;  2L6J A;  1E96 B;  4IRU A;  2R59 A;  3ML8 A;  4GU5 A;  1H0A A;  3ZYQ A;  5CMW A;  4CRW A;  5LCW C;  3QJZ A;  5LCW J;  2WPV A;  1UW4 B;  5KJM A;  3MJW A;  4AEZ C;  2OND A;  1HE8 A;  1UJJ A;  3I3N A;  3LVQ E;  2VGX A;  3IV0 A;  3G2S A;  4W9R A;  1X5B A;  3FDH A;  2VJ8 A;  3MGB A;  4GCN A;  3RRM B;  3G2T A;  1E8Y A;  3O4Z A;  3B7S A;  4N5C A;  5EKQ D;  4CGV A;  3LVR E;  3R7Q A;  4DLO A;  3FUJ A;  4J8F A;  4MKT A;  1UG3 A;  2PM7 A;  4U63 A;  3DPD A;  4M3O A;  2RD0 A;  2RG8 A;  4L1B A;  4UI9 K;  4DJA A;  4WWO A;  2CFZ A;  5BV0 A;  3PS6 A;  3CK9 A;  4NQ0 A;  4L2L A;  3QOU A;  3FUK A;  3SZ7 A;  5JJT A;  1PAQ A;  2PQR A;  3ZGQ A;  4ACL A;  3FUI A;  2XCC A;  4A1G A;  2QY7 A;  2WQH A;  4XKC A;  3FU6 A;  3WXX A;  5D0O D;  3CSF A;  3PEU B;  3ZHE B;  3FEX A;  3IEG A;  5FQ8 A;  3CVL A;  3MYV A;  4V3I A;  2DCP A;  4KVM A;  4GMJ A;  5FTP A;  2LAH A;  4C0M A;  4GA1 A;  4U0S A;  4OYS A;  5AIJ A;  3ZXS A;  2YNQ A;  5LFA A;  1OWM A;  2BTD A;  2AXZ A;  1OWL A;  4L23 A;  5G05 J;  1E8Z A;  5G05 C;  3UMV A;  3D9O A;  4WAF A;  3CVQ A;  5T4Y A;  4PS7 A;  3C98 A;  4XE0 A;  4ABN A;  2XGM A;  3L54 A;  4O6F A;  5A6C A;  5CHE E;  2WXG A;  3FU5 A;  3JCK C;  3FTZ A;  1VDY A;  5JHB A;  1E7V A;  3CQG B;  2CHZ A;  1INZ A;  4A1S A;  4BTB A;  5E76 A;  4HOS A;  2YIN A;  1ELW A;  2MHK A;  5BPP A;  1H2V C;  4N3C A;  3ZN3 A;  5J90 A;  4Y6W A;  4BT8 A;  3D9P A;  3R7R A;  3PH0 C;  2FI7 A;  2VQ2 A;  2V5F A;  1KLX A;  3PUJ A;  4AV7 A;  4I2W A;  4ACK A;  3CR3 A;  3FUN A;  2WXN A;  3AS8 A;  5FQ7 A;  4N3B A;  4CEM A;  4EZL A;  3CK7 A;  3TJP A;  4WUY A;  4DI4 A;  3ASG A;  3L16 A;  2LAI A;  1EDU A;  4B94 A;  3L13 A;  1SZ9 A;  3FTS A;  1B89 A;  1HG2 A;  3EDT B;  4UWG A;  5JJ6 A;  1Z3X A;  3LKU A;  1KT0 A;  3QWW A;  4WWN A;  4KVO A;  3RK6 A;  5LX8 A;  5LOZ A;  5BNW A;  1OWO A;  3ZIM A;  3U3W A;  3G2W A;  2PZI A;  1HG5 A;  1Y6I A;  4I43 A;  4OVU A;  4U0Z A;  2JLB A;  3BG1 B;  4I1A A;  3QK0 A;  3GW4 A;  3CVX A;  3CHS A;  4UWH A;  4I2Z A;  3FTU A;  2OVB A;  3PE4 A;  5AJL A;  2VGX B;  2Y3A A;  2CG2 A;  2HR2 A;  3L08 A;  3JYS A;  3I5P A;  1TJC A;  4XI9 A;  3FP3 A;  4BY6 A;  4AY6 A;  3LY8 A;  3QC1 A;  2PL2 A;  4CDR A;  4FU3 A;  4P29 A;  1NA0 A;  3VTX A;  3UQ3 A;  4E85 A;  5BUZ A;  4HLE A;  4UWL A;  4G1T A;  3LDZ A;  2WMN A;  3HDX A;  5J08 A;  3JUI A;  3ASD A;  5CMY A;  5JJ7 A;  3T5V A;  4GYO A;  2LNI A;  2BF0 X;  2FUL A;  2WXL A;  1S0P A;  2GW1 A;  2R17 C;  4G11 A;  2KCV A;  1TJF A;  4GZ5 A;  2VTB A;  4FJZ A;  3ZW3 A;  3CV0 A;  1OWP A;  2XCB A;  3CST A;  3B7R L;  4I6G A;  5FWQ A;  5JHA A;  4CT0 A;  3CIA A;  3S7J A;  4U04 A;  4DI3 A;  4N2S A;  3LS8 A;  2P58 C;  5ARG A;  3UT8 A;  2IFU A;  3PEV B;  4UQY A;  2A4Z A;  3D9I A;  1DNP A;  3UPV A;  4XX5 A;  4NUR A;  4RSY A;  5FQ4 A;  4GA0 A;  2HM8 A;  4KZ0 A;  3EJN A;  3RIB A;  1HX8 A;  4GA2 A;  4H7Y A;  4BTA A;  2KZT A;  2WB2 A;  3RJV A;  4F7A A;  2HO1 A;  3APF A;  4TRQ A;  4NRH B;  4JA9 A;  3E4B A;  4PH4 B;  2WXF A;  2I2O A;  2X38 A;  2V0P A;  3KEZ A;  5T8I A;  3SBS A;  3ASF A;  3FY4 A;  3OAW A;  4FLB A;  4TV3 A;  3ZFW A;  4B0Z A;  5BV1 A;  3SHF A;  2LSV A;  2X6H A;  2WXQ A;  4J8E A;  1W3B A;  3Q49 B;  1HF8 A;  4FHJ A;  4AVX A;  3ZRH A;  1JPL A;  2A5U A;  4YVO A;  2FF4 A;  3IHV A;  4U07 A;  3SGH A;  4PS3 A;  2LO6 A;  2WXK A;  3RO3 A;  4B8A A;  1ELK A;  2KAT A;  3Q4A B;  4CDM A;  2PQN A;  3MA5 A;  2OV8 A;  4WNG A;  3LJ3 A;  4GZ6 A;  5C2Y A;  2MOW A;  2XPY A;  3RRN B;  5LP0 A;  4N2Q A;  4I1O B;  3CVY A;  3TG4 A;  3MKQ A;  2J09 A;  4ILG A;  1QZ2 A;  1JWF A;  5KJK A;  4G26 A;  4ANX A;  3QKY A;  2CHW A;  5FT9 A;  3L6A A;  4JC8 A;  3NZS A;  3ESK A;  4TUU A;  3CKB A;  3FFL A;  4UWF A;  4WNE A;  4I1M A;  2UWJ G;  3CVV A;  2NC9 A;  2VSO E;  4HVB A;  4ANW A;  3NF1 A;  5HQ8 A;  3QWV A;  3CEQ A;  1Z6T A;  2OVF A;  4HXI A;  4RG9 A;  3B7U X;  4E6H A;  3OXL A;  4U0U A;  4L7T A;  3CLJ A;  1MHQ A;  4A3V A;  5C1D A;  1HO8 A;  2OOE A;  4GZD A;  4ILI A;  1EF1 C;  2QFC A;  2J9Q A;  3FTW A;  1HU3 A;  4EEC A;  3PZD A;  4GCO A;  2XGS A;  4FUL A;  1OUV A;  4DLQ A;  2C2L A;  3KS2 A;  5AJD A;  3ZYM A;  4JEU A;  5A23 A;  1OWN A;  3BEE A;  4NAC A;  3QNK A;  1WM5 A;  4IUL A;  4ME2 A;  1UN8 A;  3CKC A;  1E90 A;  2AWI A;  2VSY A;  3CQC B;  3JQ0 A;  1H2U A;  4JXT A;  1HZ4 A;  1SQM A;  2R5S A;  1MQS A;  1E8W A;  5EX3 A;  4HOR A;  4XI0 A;  4XKB A;  4ANV A;  2J07 A;  2L9B A;  3KD7 A;  2E0I A;  2YHC A;  3LXU X;  4ATG A;  4DPR A;  2L0T B;  2Y4T A;  3ENE A;  3ML9 A;  3VLE A;  4Q69 A;  1IQR A;  4HOU A;  2VTB B;  3FUE A;  1Y8M A;  3HYM B;  4GZ3 A;  3EIJ A;  2KCL A;  1NP7 A;  3QWP A;  4FLH A;  5M72 A;  3MEK A;  3L17 A;  2AW6 A;  3ZVV A;  5D0Q D;  3P2B A;  5CCL A;  2HYZ A;  3MX3 A;  4RG6 A;  4CGW A;  1H19 A;  1N54 A;  3JQ1 A;  4APO A;  3LYA A;  4AY5 A;  4C9B B;  2KZT B;  4UQX A;  4BT9 A;  3FU0 A;  3QDN A;  4FP7 A;  4B89 A;  2GRM A;  4K03 A;  2WXP A;  5FZQ A;  1E7U A;  4KMO A;  2I9C A;  4KYO B;  2XEV A;  3LY7 A;  4EQF A;  3D9K A;  4I17 A;  1PY1 A;  1XNF A;  2WXH A;  4JHJ A;  3G2U A;  2NXP A;  3APC A;  1HXI A;  4EBA G;  4PDX A;  1EPU A;  2DIW A;  3I4R B;  4BX8 A;  4CT4 A;  4LRZ A;  3AS5 A;  3FTX A;  4F53 A;  1UJK A;  3D9M A;  1DVP A;  1H6K A;  3I4G A;  3PDN A;  3N71 A;  2WM9 A;  4MS6 A;  2J49 A;  1QQE A;  3FH5 A;  1WAO 1;  3KAE A;  3NZU A;  4AP2 A;  1FVH A;  4GML A;  2M63 A;  3PRE A;  4A55 A;  3LPZ A;  2XHE A;  3OXG A;  5A7D B;  1QNF A;  5T3R A;  3MKQ B;  3CVW A;  3TL5 A;  2IJG X;  2WXM A;  2IF4 A;  4BX9 A;  3APD A;  4G24 A;  3LCA A;  3TXM A;  1Z3Y A;  5EX0 A;  3VLF A;  1TEZ A;  4EZJ A;  4GZC A;  3TXN A;  1U3D A;  3FU3 A;  5ENN A;  1H2T C;  2VYI A;  4FAD A;  5FZR A;  2J4D A;  3FH7 A;  4CCA A;  4F1S A;  1FCH A;  2I1J A;  4LEU A;  2WQ7 A;  3CHP A;  2UY1 A;  3B7T A;  2ZU6 B;  4D10 C;  3D9N A;  1YA0 A;  2X6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...