4A63B

Crystal structure of the p73-aspp2 complex at 2.6a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
202
Chain Sequence
MRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Aspp2 Recognition by the Tumor Suppressor P73.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords TUMOUR PROTEIN 73
total genus 59
structure length 202
sequence length 202
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
B PF00023 Ank Ankyrin repeat
B PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4a63B01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4a63B02
4ATZD 4RTVA 2BZYA 2M0YA 4RTZA 2FPFA 3SO8A 1HJDA 4Z89A 1WDYA 2KT8A 4RTYA 3I5SA 4EIKA 1WDXA 3HG0D 3C0CA 3TSWA 1N5ZA 1UJYA 1ZUYA 2CSIA 5EYPF 3JV3A 3TWXA 5AN8A 3T8KA 1T0JA 5L23A 3JXJA 2J8SD 4DUIA 3NPFA 1UECA 2KXPC 2F2VA 3F6QA 1JXMA 4FSSA 1MX6A 2A08A 2CSQA 4JZ4A 2L0AA 3V30A 5FWCA 1UDLA 3V2XA 5ENOD 4Z8AA 2JMAA 1K1AA 2BTTA 1J3TA 4G8KA 2C0OA 5AQ7A 1NG2A 2RPNA 2J6OA 2AJAA 2KRNA 1AWCB 4LE9A 1S1NA 5ENQD 1WFWA 3SHWA 4BETA 2K79A 3D9HA 2ETCA 2ZGDA 1HD3A 2FO1E 1YWOA 2VKNA 4IIOA 4GPMA 2DVWA 2DILA 1RLPC 2LNHB 2O2OA 2SEMA 2YT6A 4U8VD 5AQ9A 2HCKA 4C48B 3QWXX 2J05A 4O60A 3VS3A 1WI7A 2AKLA 3ZNGA 1SHGA 4X1VA 2BKKB 4U96D 2DYBA 4GLMA 2A36A 4LNUD 1UUEA 1T3SA 1YMPA 1PKTA 2JW4A 3W9FA 1U5SA 1OT8A 4J9BA 3REBB 2HBWA 1AEYA 2XENA 4ZNXA 1H3HA 1QLYA 1JXOA 2F37A 3TWSA 2JM9A 3B7BA 1X69A 4BEPA 1IO6A 4NIKA 2RNAA 2EQIA 2RF0A 1OOTA 2BZ8A 2YUPA 2DLPA 4J9FA 5ENTD 3GBQA 5JMND 4OMLA 3VS7A 1U3OA 1YWPA 4DEYA 3R6NA 1FMKA 5EYLA 3UF4A 1E6HA 4OAUC 2MOXA 1ZUUA 2YUNA 5IH2A 4WCIA 1NFIE 1IKND 5AQBA 2AZVA 2F2WA 2DX1A 2DL8A 1GCQC 4AFUC 2RN8A 2OJ2A 1AD5A 1WYXA 2HEQA 4U8YD 4CC2A 5CEDB 1WG0A 1CKBA 1KIKA 1MX4A 4RUGA 3SEMA 1NYFA 2D0NA 2H8HA 4K5CA 1N0QA 2DE0X 2HE0A 2L6BA 3EHQA 5D66A 2KNBB 5CECB 1N0RA 4HI9A 1PRLC 2GBQA 1YYHA 5EC7A 4CZ2D 5CBOA 4CYMD 2X3XD 1T3LA 1SEMA 5ECAA 1WIEA 3VS2A 4J7WA 2LJ3A 4J9CA 2EBPA 3I9QA 4OAVB 5ENRD 2CUDA 2DF6A 2K3BA 2QC9A 5FIOA 3UA6A 1BK2A 4O1PA 2KR3A 1UHFA 2JTEA 2P4RA 4HRLA 1JQQA 2RFMA 5AARA 1D9SA 2PNNA 1SPKA 1V1CA 4OMMA 2CH4W 4K11A 3ZUVB 2KGTA 4ORZA 1OPKA 1BBZA 1VA7A 3ZL7C 4DX2A 2XEHA 4DX5D 4Z68A 1YNZA 2VVKA 1OPLA 2FPDA 1LCKA 1Z9QA 1AWWA 2X3WD 3EG0A 1GBRA 1MV3A 1VYUA 1M3CA 1YCSB 1KJWA 2J06A 4F14A 4M4ZA 5FW9A 4J8YA 4OMQA 1NLPC 1G3NB 2E5KA 2KT1A 1NEGA 3NMZC 1G2BA 2NWMA 2V1QA 2AK5A 1YP5A 4F16A 4YDYA 2DBMA 2KBXA 2JABA 1ZUKA 3TWQA 3LH5A 1K76A 4DEXA 3TWUA 1UFFA 4F6RD 2OAWA 1XOVA 4JB8P 1IXVA 2JT4A 4DX6D 4RLYA 4GMRA 3NBNB 4HRNA 1MUZA 3M0TA 2EW3A 2W0ZA 3Q9NC 4N5QA 2EYYA 1A5EA 5I22A 2P2CP 1AOJA 4AFSC 2PZ1A 3VS5A 1M27C 3FJ5A 2EGCA 2I0NA 5ENPD 2F2XA 4HVUA 3THKA 3Q9UC 5AAOA 3U23A 3EG1A 3QWYA 3VS1A 2KXDA 2JMCA 1QKWA 2KRSA 3AJIA 4J9EA 2DNUA 1K0XA 2CH4A 4LUDA 2NYJA 1TUDA 1X6GA 1GFCA 1X2QA 3UATA 2FO0A 4QFVA 3UTMA 2QDLA 2GTJA 2YUOA 1B07A 2SRCA 1UOHA 4AFZC 1VYVA 4HVWA 1TUCA 3EHRA 5KNHD 2XEEA 3TWWA 2DRKA 2BZXA 4UUCA 3JUEA 3EGUA 1SRMA 2C0IA 1UGVA 1X43A 1QCFA 3I35A 4HVVA 3TWTA 2JXBA 2LQWA 1PRMC 1OEBA 4JJDA 2O9SA 2K2MA 4LNPA 2M51A 1SVXA 1K1ZA 2KE9A 1ZX6A 2YDLA 5CBNA 5IXBA 4R0KA 3RBBB 1X27A 1K1BA 3H41A 5CEAA 2ENMA 1GCQA 3NOCD 2OI3A 3UXGA 2MCNA 3M0PA 2EYWA 1UTIA 4DX7D 3PVLA 2RQTA 5IXFA 4F1PA 2RQVA 4O1OA 3VS4A 3JXIA 2ETAA 3O5ZA 2V1RA 3HRAA 4ESRA 4HXJA 5EIBE 1RUWA 2L3PA 1AVZC 2DZNA 4RTTA 1QWFA 4JPBW 1N11A 3NGPA 2FRWA 1TG0A 3J5QB 2EGAA 5EILA 5AQAA 4ZFHA 1OV3A 4BESA 1AZGB 3TWVA 2K6DA 2J6KA 2LJ1A 3V79K 1VYTA 2ED1A 3ZKJA 2LCSA 1BU9A 4CC3A 1GFDA 1QWEA 2DMOA 1GL5A 2F8XK 3V2OA 1I07A 1BI8B 5GJVB 2NUZA 1TR4A 3TSZA 2G6FX 2FEIA 4Z88A 1EFNA 1UE9A 4J9IA 1I1JA 3EU9A 2DJQA 2W10A 3VRYA 1M8MA 1PHTA 1PNJA 2KBTA 2L3SA 2V5QC 3C5RA 2RQUA 1WX6A 2KXCA 3VRZA 2BKGA 1SRLA 4HI8A 2LJ0A 2MYOA 4JJBA 2JS0A 2Y1LE 1ZBJA 2EPDA 2ESWA 4RTUA 3REAB 2O9VA 5HS0A 1WLPB 4RTXA 4HCKA 2J6FA 2JS2A 1GCPA 1Y57A 3TWRA 1I0CA 2RQWA 2C0TA 1M3AA 3NOGD 2LX7A 5IHIA 1MJ0A 4DX1A 1K9AA 2ED0A 3M0UA 5EN5D 4J9HA 1UJ0A 2L3QA 1G83A 1M30A 3H0HA 1KSWA 4JJCA 4YDWA 2K7AA 2DVJA 1W70A 2LMJA 4TUMA 1K0SA 2RFAA 1ZSGA 3DEOA 2MIOA 1QYMA 4D8KA 2CT4A 5JA4D 3T9KA 2EYZA 2DL3A 2O31A 1JO8A 1MV0B 2DM1A 1YN8A 1AWJA 3KFVA 4J9DA 5IHKA 4BSZB 2D8HA 4K5AB 1H92A 4A63B 2DWZA 3IQLA 5KWDA 4HRMB 1DC2A 5GJWB 1K3ZD 4LUEA 3LJNA 4B93B 1Y0MA 1RI9A 2DA9A 5KNGA 2J7IA 1JEGA 1T0HA 1ABOA 1B3QA 1UHCA 4DRXE 1W1FA 3NHNA 2B0OE 4QT7A 4ZHBA 1OY3D 1AP7A 1MYOA 3UI2A 2PTKA 4KRTA 2KRMA 3TVTA 4BERA 3UA7A 2DL4A 2RQRA 4GBQA 5EIDA 1X2KA 4AFQC 1KFZA 2L2PA 3KEAA 4JZ3A 3DEPA 1PWTA 3A98A 2CUBA 2DL7A 1NYGA 2B86A 4OMPA 1CKAA 2CDTA 1PKSA 1WXTA 2RMOA 4RTWA 5CERB 2ETBA 2EGEA 2ZGGA 3H0FA 4HQDA 2XZTG 1WXUA 1ZLMA 2F8YA 3W9GA 5KBAA 5BXUA 4CC4B 3B95A 2GQIA 2VGEA 5HKPA 3CQTA 4CC7A 1RLQC 2LQNA 2KEAA 5IHNA 1BI7B 1BB9A 2AZSA 1S70B 2EVRA 4LG6A 2A5EA 2HDAA 3ULRB 1K4US 1ABQA 2GNCA 1NEBA 2EKHA 2D8JA 1AWOA 3PE0A 1GBQA 2QYJA 2EYXA 2LZ6B 5ENSD 2XMFA 1WXBA 2FPEA 1DCQA 2FG0A 4AG2C 1SSHA 2D1XA 5FWBA 4OMOA 1E6GA 1FYNA 2DL5A 2K9GA 4LSZE 1UG1A 2LP5A 2ECZA 1U06A 3V31A 1SW6A 2JM8A 2VWFA 3IXEA 2YSQA 1A0NB 1M3BA 2ROLA 2ABLA 3PVQA 1E7OA 1ARKA 3AAAC 2Y0BG 1CSKA 1AWXA 2PNIA 2KROA 2A37A 2FRYA 4IIMA 3RNJA 2GGRA 3J5PA 3VS0A 4U95D 1GRIA 3EG2A 4G8LA 4OMNA 5HRYA 2KYBA 3EG3A 3M0SA 3VS6A 4HNAD 1MX2A 2V4HC 2DBKA 1QKXA 4AG1C 1BLXB 2XZDG 1JU5C 3I5RA 1NLOC 5ITZF 2HSPA 4QQIA 4HB5A 1HSQA 4HLLA 2DZOA 1W6XA 4J9GA 5FINA 2GTOA 2YUQA 1BD8A 1SHFA 3ZU7B 1Z9ZA 1AZEA 1WA7A 2CT3A 4K5BA 5I11A 1NM7A 4HBDA 1IHBA 2CREA 3M0QA 2KYMA 3M0RA 4E6RA 2IIMA 4LN2A 2O88A 5HCKA 1BU1A 3H0IA 4D8DA 2ROTA 4F17A 2AKKA 1X6BA 1H8KA 4Y92A 2DRMA 5BXOA 2A28A
chains in the Genus database with same CATH superfamily
2DTOA 4ATZD 1WQ7A 4EZLA 2GRQB 2QG9B 2FPFA 2LX9A 3CVNA 4TV3A 3SBTB 2MK5A 2VGXB 1HH8A 3I5SA 3C0CA 4FYVB 1QCNA 1LD7A 1Y8MA 1ZUYA 5EYPF 3QIIA 1YJWQ 3G6ET 2G3RA 1U8RA 3T8KA 3CC7A 1WHMA 4KXKB 5L23A 2X4WA 3JCMX 3JXJA 4ATGA 3HHTB 5FU6B 4B0ZA 1MHNA 2XG8D 2KXPC 3CCST 2Y90A 3EH1A 3F6QA 1JXMA 1TXQA 1I4K1 2A08A 2FF4A 2R03A 2L0AA 1G8XA 2WXQA 4YNDA 4FM4B 1RAFB 3M53A 2ZGWA 3NTHA 4G8KA 4MDWA 2C0OA 3VKIA 1NG2A 2RPNA 3I56A 1N8RR 2X9HA 2WM9A 2KCKA 2CS7A 2XHEA 3NZUA 4KGXB 3QZ5B 1N94A 3FU6A 1S1NA 4BETA 3HTRA 1VQLQ 3DSVA 3PZ3A 2FO1E 4A3VA 3QDNA 4GPMA 5GMKh 4BFRA 3ASKA 5LCWJ 2MPXC 2JJ9A 2WSEE 2LNHB 5LJ5d 3CC7T 2HCKA 5CKBA 1RAHB 3SFMA 2PM7A 4HOSA 3HXCA 5DM7R 2XDBA 3GOXA 4GLMA 4GZDA 3MCAB 3AU4A 1T3SA 1YMPA 3UQ3A 3W9FA 2V8SE 4J9BA 1H3HA 3K9IA 2JTMA 1IZ6A 2EIME 1MMNA 5CKEA 2WPVA 3QPHA 3SFXA 3OW2P 4RMOA 2JEKA 1Y96A 1R77A 1R0CB 4I1OB 3PNTB 4ZTFA 3FUIA 1O75A 1ZHIA 2RF0A 3JB9G 3CCUA 2DLPA 4J9FA 4BY6C 3TXMA 4DEYA 3Q1JA 1NZNA 5EYLA 1WHGA 1Q95G 4H7XA 3RRUA 1YBYA 5IH2A 3MHXA 2FO7A 2QXFA 3ASHA 2MYSA 3L2VA 3HP9A 5CVIA 3D9IA 1X5BA 3CSTA 2YXYA 4XTVA 1UGPB 3CCRQ 2HL5C 3B7UX 1Y6IA 4Q5WA 4JD2G 4B9WA 1KIKA 4A4HA 1NYFA 1Q81U 2L6BA 5D66A 5M72A 4U8HA 4QW2A 2KNBB 4HI9A 3DSXA 1TN8A 2BUGA 4KUDK 5CBOA 5GANd 4IUQA 2WXKA 5FZQA 1PG5B 5GAN5 4J9CA 2EBPA 3QKYA 2K3BA 4E7KA 2RH2A 4JC8A 3HRSA 2QC9A 1ZB1A 3SB2A 1MGQA 3UA6A 2VJ8A 4RVBA 4EDUA 1GW6A 1BK2A 3V7RA 4EPCA 1KZOA 1VQ4A 2JTEA 2H6IA 2YHCA 3RJVA 4HCZA 1SPKA 2RHYA 4OMMA 1Z3YA 2V0PA 5FRNA 4PLLA 4K11A 4KBMB 2CHXA 4XKBA 1YCYA 1BBZA 3PS6A 5KYYB 4Z68A 1FT1A 1Z9QA 2YINA 1H641 1AWWA 2DYRE 4YDEA 2O4XA 4KVOA 1M3CA 1PD0A 2X6KA 1KJWA 4UWGA 2J06A 4F14A 3B7SA 1TSFA 1OYXA 5FW9A 4J8YA 1YJ9A 4OMQA 3SD4A 3KUFA 4PL6A 2NYSA 1BPOA 3PEVB 3V7SA 2AK5A 1S72A 3S7FA 1PCXA 2DBMA 4JLGA 1ZUKA 4L59A 3CMEA 3TWQA 3SBSA 4XKCA 3OSSC 4DEXA 3FH5A 2AW6A 4ANXA 1UFFA 4ZTJA 3PTAA 4ZGDB 2JT4A 2J4BA 2HQHA 4J6YA 4PK4A 3MA5A 1M2VA 1MUZA 5G55A 4HOUA 4N4GA 3VYHB 3U66A 5GAOq 4M7AG 4DPRA 2RG8A 3AG1E 2E2EA 3FJ5A 2WQ6A 2EGCA 3D9KA 4FADA 1X81A 2F2XA 4HVUA 2EQMA 2C0MA 2KI7A 2RB6A 4TVRA 2KXDA 3OXLA 4PFZA 2YNQA 2WACA 4J9EA 2EKOA 3FIFA 5HKCA 2DBAA 1KQSP 1ELRA 4M75E 1H6OA 2CH4A 2NYJA 1TUDA 1X6GA 5GAMg 3U64A 2CGHA 2LO6A 1GFCA 2DXUA 5CQYA 3UATA 4EZJA 4QFVA 2CFUA 4HT9A 3HXEA 2I1JA 4M7DB 4UWHA 1B07A 3FY4A 3QO3A 1YJ9T 2FBNA 1M4ZA 3OYCA 2IFUA 4PJOC 4XTXA 5KNHD 3OYJA 2XEEA 4ANWA 3CHRA 3RMQA 1KQSA 3EGUA 3FH8A 4UQZA 1X43A 3T5XA 4MZTA 5GAN4 2JUFA 2X6FA 4HVVA 8ATCB 1OEBA 4JJDA 3P8HA 4APFA 3OYEA 2ONDA 1UN8A 3P8DA 2M51A 3C72A 1E7UA 2WXJA 2ZPHB 1R8OB 1HK9A 3NB2A 4P5NA 5IXBA 1K1BA 3EH2A 1FPPA 5CEAA 2K57A 2ENMA 3D9LA 3UXGA 3E1SA 2DIWA 4X9DA 4DX7D 3CEQA 1HE8A 3CMAA 5D7UA 1WJSA 1WQWA 3JB9J 2RQVA 4FIBA 2V5FA 1INZA 4PS8A 2H6HA 2WQHA 3JXIA 2ETAA 3O5ZA 3FTYA 4OB1B 2CG3A 4ATOA 2FZKB 3PREA 2BE7D 5EIBE 1RUWA 3C12A 4MZPA 3G71A 1OI1A 3D9PA 1Y07A 7AT1B 1QCOA 3KBGA 2XRYA 2VGMA 4A3TA 1N11A 2PVGB 2EGAA 3URGA 1VQOQ 4RG6A 1N9RA 1W3BA 1VQ7A 2K6DA 3O8VA 5AENA 4R55A 4ELYC 4FW2A 4C92B 2PQRA 1RADB 3ULQA 2P9IG 2LCSA 2D9TA 3Q47B 3UM0A 2YLBA 4DJAA 2M9UA 1I5LA 5D6YA 4CC3A 4C0EA 1GFDA 4C8QA 3VUBA 2FB7A 1I07A 1BI8B 1NJIC 3LJ3A 1VQ9Q 2NUZA 4XX5A 2FEIA 3E30A 4Z88A 4DA4A 1Q86C 4RCBA 3EU9A 2W10A 1YJWT 4JPSA 3H8ZA 1M8MA 3QUIA 2L3SA 3EGXB 1VQLT 4A1GA 3RK6A 2HKQB 3E9GA 6AT1B 1JJ2A 3LGFA 1ZA2B 1ZBJA 1SF9A 1D8EA 4L2YA 1L5JA 3R9AB 1WLPB 4RTXA 4C8QE 1UW4B 3CVXA 4BI4A 3Q7FA 3KAEA 2MWOA 4EMKC 1OWPA 2LX7A 5CAIA 4FSXA 4NL2A 4ACKA 4APOA 3S6WA 4HVBA 2FHDA 2QTXA 4RG2A 4J7FA 1QQJA 1WM5A 1NI1A 1NPRA 2DCPA 3JUIA 1G83A 4JJCA 3FU0A 3VJPA 2C0LA 5FROA 3JCMP 2CZ1B 2DVJA 4J83A 2P9NG 2RFAA 3S2AA 2OOEA 2P0QA 3A8OB 2RK2A 4GTOA 3OYIA 1KC8R 5LJ5j 3T9KA 2AHJB 1K73C 5GAMj 2KATA 4J9DA 3EU5A 3KFVA 2XGSA 4XQ3A 4C8QD 1H92A 4A63B 5GANh 3UPUA 3CCSA 3OYMA 1YIJQ 3S7JA 1XNIA 2DA9A 1QVFS 3JCMW 3BE3A 3IV0A 3MX3A 3E19A 2CP2A 5KYYA 1B3QA 3HFOA 4WNFA 5KE2A 5JJTA 3QWPA 2RJFA 4BT9A 2FZGB 2KRMA 4KULA 1EX4A 5CHEE 3TVTA 4BERA 2HKNA 2CHZA 4GBQA 4AFQC 5DLOA 2P9LG 2QYZA 5GAMe 3L2ZA 1KFZA 3CCQQ 2OAUA 4BWRA 4TUUA 2CUBA 4E7HA 3WXXA 2DL7A 4JDSA 3PT9A 4OGCA 1BIBA 1PKSA 1WXTA 4L5GA 4O6JA 3D7SB 3H0FA 2ZGGA 3E34A 4HQDA 4DOVA 2RD0A 5KJLA 3W9GA 3M55A 3B95A 3FU3A 3S3NA 4YVOA 2VGEA 2LQ8A 4EMKB 2LXLA 3VLFA 3ZYMA 4Y91A 1BI7B 2AZSA 2B8AA 3FUJA 3OBYA 1O5MA 3A8MB 4J6XA 4LG6A 4OP0A 4UWFA 1K4US 3SWNC 3JSCA 4I2WA 3NQPA 1OWLA 1GBQA 1RL2A 2EYXA 4C5EA 1KC8U 4FU3A 1G3SA 2FPEA 1DCQA 1JWFA 5D0OD 5C1DA 1W2BS 2CP5A 5CRVA 3MEAA 3JCMV 3O48A 3CCUQ 3ZYLA 1MMGA 4M7CA 4HOTA 3V31A 1G3TA 4OYSA 5D6WA 2EFIA 2OCCE 3FP3A 4UI9K 4ZGEB 5EX0A 2ABLA 3QYGB 4OB3B 3CCLA 1ARKA 2X6HA 5C6SA 2XGOA 2EQUA 5JHBA 1CSKA 1OX8A 2PNIA 2KROA 2HYZA 4IIMA 3RNJA 3MO8A 3QK0A 5GAOm 3J5PA 4U95D 3EG2A 3BEEA 3G1JA 4CCAA 1TJCA 2X35A 3P2BA 3EG3A 3VS6A 3SFYA 3CCRA 1UG3A 2R05A 1GXIE 2V4HC 2DBKA 1QKXA 4N2QA 4J5YA 4XTWA 2X38A 1BLXB 4LDXA 1N52A 5FZRA 3RSEG 2R57A 4PUCA 2XS8A 5AJLA 1OCRE 2HNIA 5LJ3h 5D2MC 3SD5A 1HSQA 4KZ0A 2DZOA 1W6XA 3CC4T 1VDYA 3PNLB 2ZAEA 5AYFA 2CT3A 2VC8A 2CREA 2KQWA 4NL3A 3RESA 3JCKC 2O88A 4XU2A 3CLJA 1BU1A 3H0IA 4M75D 2DAQA 4F17A 4IRUA 2MHKA 1H8KA 5T4YA 2WXHA 3KXTA 1RZ4A 1XQHA 3X25B 4F7UB 3L9TA 2IU1A 2QQBA 4RTVA 1ELKA 4RTZA 3PFSA 3SO8A 4FL6A 1HJDA 2F0YA 4B89A 3HSBA 3CQGB 1UGQB 4OVUA 4RTYA 3G2SA 4BI8B 2CG2A 1B34A 1NBEB 3JV3A 5BPPA 4CGWA 2ZPEB 1C6VX 3EG9A 1QVPA 4J8FA 4X9CA 2EQXA 2XD0A 5HK3A 4A4GA 4DUIA 1YITQ 2DVEA 2XEVA 2CSQA 2I2LA 4BX8A 3FEYA 1YJ9Q 4JZYA 3V30A 3UT4A 1UDLA 3JB9D 4C92D 4M78A 2OTLT 4CI0C 2KZTA 1K1AA 5C2YA 4PKCC 2HR2A 1ZU2A 8AT1B 5AQ7A 3X24B 4L7TA 1S72Q 1D0ZA 4N4HA 2A4ZA 3SFZA 2KRNA 1IHVA 3HVEA 1N8RC 3N71A 4LE9A 2BKDN 1ZBXA 3UKRG 1LF8A 3GZ2A 2VASA 3D9HA 3QWVA 3DSSA 4Y6CA 1HD3A 4F7UG 2VKNA 2DTIA 4IIOA 5LJ3j 2DILA 3CHSA 4V3IA 3WVDB 2YT6A 5FJYA 4C92G 1VQ4Q 1WI7A 2AKLA 1ACMB 3FLGA 3PE3A 1OZ3A 1LVKA 4X1VA 4C0DB 2BKKB 3X2QE 3CGHA 3EGDB 2VYTA 3WXMB 2UWJG 4YDOA 4M78E 2M02A 1PKTA 1UGRB 1OT8A 3QKJA 3REBB 4ZNXA 3SQVA 3HRTA 1YJNA 3CCET 2AIRB 2KK4A 5KJMA 3CC2T 3E37A 2VSXE 1KHCA 4BEPA 1X69A 3KD7A 3TCJA 4K0RA 3OS1A 4NIKA 4LCTA 4BTAA 4TXPA 4C0MA 5LFAA 2VGYA 2BZ8A 4TXQA 1JCSA 1MZCA 2YUPA 2KY9A 3EDTB 2XDDA 3GBQA 5JMND 5KYWB 5GANf 4NOYA 2XCCA 5LCWC 4UWLA 1KK7A 3UF4A 5M9OA 1E6HA 2MOXA 3CMEQ 3UIPC 1EDUA 3QWWA 4GTPA 2RJDA 3T5VA 1I8FA 5EX3A 4JW1A 4PJJA 3WVEB 2PZIA 1AD5A 2E5QA 2KSSA 1P92A 5CEDB 4B8CB 4FU6A 2R5AA 2FI7A 4RCCA 2LSVA 1IYGA 4GCOA 1MX4A 2NUPA 1VQPA 3LY9A 2DE0X 1N0QA 3EHQA 3CMAT 4XK8E 2PVOB 5IY5E 1YYHA 2OX7A 2GROB 2R2LA 4XU1A 4C92F 1YITT 4M77D 3TAXA 1T3LA 2QTVA 1QVGA 1N27A 1G3WA 5HI7A 1YHQT 1WIEA 4HLEA 2LJ3A 4OAVB 5ENRD 2CUDA 2DF6A 4FYYB 2F69A 3G4SA 5FIOA 3CPWS 2KR3A 5KYXB 2QEXQ 3G71T 5AARA 2PNNA 1V1CA 2QASA 4M75F 2DIQA 3ZUVB 3OYFA 2KGTA 4DBFA 2Y4UA 4HOQA 1KQ2A 3ZL7C 4DX2A 4DX5D 3ASOE 1YNZA 2VVKA 3R6OA 2GRPB 1VIEA 1A17A 2FPDA 2LQKA 1VQOT 3LVRE 2M63A 3LXUX 1F1BB 2X3WD 3EG0A 3I4GA 1MV3A 4BY6B 3CHPA 5EDSA 2WMNA 1YCSB 3KS2A 4J0UA 4BB7A 4AM9A 4EECA 1W2BA 1G3NB 2KT1A 3FTUA 4XAXB 3NMZC 1G2BA 2NWMA 3MKDA 1YP5A 3DKMA 1YA0A 5C0MA 2DO3A 1K8AC 1E90A 3TWUA 2BF0X 2OAWA 1H3ZA 3DXKG 1N9SA 3EIJA 1XOVA 1QW1A 3OSVA 1K8AR 1IXVA 3FRNA 2HQXA 2Q7FA 4RLYA 4DI3A 3NBNB 4GMRA 4HRNA 3TXNA 5L8RE 3M0TA 4AP2A 4FULA 2WSCE 2EYYA 2NLUA 2GQVA 2K2VA 4GTQA 4J6IA 2WXFA 5I22A 4AFSC 2PZ1A 2HQEA 2Y4YA 5AAOA 3B7RL 1E8ZA 5KCMA 4MS6A 2OVBA 3EG1A 2EIKE 3VS1A 3Q75A 4KBQA 1M1FA 2MWPA 2KM4A 3QAQA 2DNUA 1HO8A 1K0XA 4M77C 1W2BP 4C0ZA 2NSZA 4M75G 3LX7A 2VUBA 3PMIA 1HU3A 3HIZA 2FO0A 2J4DA 4N5CA 2QDLA 2GTJA 4XU3A 4KH0B 3CHOA 2SRCA 4LDWA 3JCMQ 1HS6A 1UOHA 4PJOD 3CVUA 4J8OA 1VYVA 4F1SA 2X6JA 1NZ9A 2OEWA 5GAMf 4IYPA 3ML8A 2CFZA 4ANJA 3TWWA 3CCVA 2DRKA 5J3BA 4BD3A 4CT0A 2CZ7B 3JUEA 4FJZA 1B34B 1SRMA 1V55E 2C0IA 5KCOA 4N4IA 3EG9B 3CCQT 1OZ2A 3ZEHA 3I35A 2X3MA 3ZXSA 1MHQA 3OW2A 4U0SA 5B1AE 2K2MA 5BV1A 2QGFB 2M1HA 4LNPA 1K1ZA 1RABB 2KE9A 1ZX6A 5FU7B 1PSFA 4JEHA 2MCNA 2OI3A 2GF7A 3G2WA 3M0PA 3SWNA 4IUVA 5T3RA 2XU8A 2RQTA 5IXFA 4F1PA 3JQ1A 3LDZA 3S3OA 4DBQA 3CD6Q 1QP3A 3VS4A 4PJNA 5CR2A 1M1GA 3RKYA 1G5VA 2V1RA 2Y4TA 3G2TA 2ATCB 3PGGA 3G2UA 4ESRA 4IURA 4HXJA 2V26A 4WNGA 3DLMA 4LDYA 1UJJA 2L0IA 2L3PA 4KH1B 1AVZC 4JHJA 2VB6A 4GY5A 4XU0A 3QJZA 1QWFA 3QG1A 3RKXA 5EILA 5AQAA 1VQLA 1LD8A 2P9PG 3SI5A 4HA8A 3ONLA 3L08A 4LUNU 3ULYA 1IHWA 3JYSA 4B6MA 1YFNA 2ED1A 2V8IA 3ZKJA 3ESKA 1BU9A 2LCCA 4M78C 3QJ6A 2WXRA 2DMOA 2XICA 4U7EB 3S3MA 1RAIB 1BYMA 3MV2B 4A53A 1D3BA 5LJ5f 1Z5SC 1B89A 3UMVA 4YVQC 2AXZA 4F3VA 3CCLQ 5A23A 2PUOB 1PC0A 3LY8A 5GAOn 2CZ6B 3C94A 1I1JA 1M8VA 3VRYA 3G4ST 2E70A 4E7IA 1N9AA 2V5QC 3C5RA 3MKRA 3CBOA 4GZCA 4U07A 4HXIA 2NC9A 4ABNA 1WX6A 2K5IA 2KXCA 2BKGA 4U0ZA 4LERA 3VV0A 4JJBA 3RDVA 3LH0A 4RTUA 4LRZA 2K3YA 4OGEA 3L1AA 4HCKA 1IRXA 2JS2A 1Y57A 3OB9A 3TWRA 3QJYA 2C0TA 3NOGD 1XTDA 2DD5A 5BV0A 3TL5A 2ED0A 2NUPB 3M0UA 2IPOB 5DIZA 4J9HA 2YRCA 4Q96A 2L3QA 1P5QA 2WXNA 4B8AA 2VV5A 3ZGQA 1Q82C 3META 1KD1U 2GW1A 1D1CA 2R5MA 5CKFA 2IJGX 2ZISA 2COZA 1U2VG 3CHMA 4ANVA 3JCMg 4TUMA 3RRNB 1BIAA 4PJOG 3DEOA 4X8QA 5E76A 1QYMA 4BDYA 3PEUB 3C4SA 1IREB 3VLDA 2UY1A 1AHJB 3PIPA 1JO8A 3EFOB 3OYBA 3FFLA 4KMOA 4BSZB 3LEWA 4E7JA 2D8HA 4K5AB 2VXEA 3IQLA 4JA9A 1OU9A 1K3ZD 3CHQA 3CVPA 4LUEA 3FTXA 2K4YA 2XIDA 5KNGA 3JCMc 1JEGA 3TJPA 1D3BB 4GLKA 1ABOA 4XI9A 2AVPA 4DRXE 1UHCA 2B0OE 4ZHBA 1M2VB 1AP7A 3UI2A 2LT1A 3FH7A 1RAEB 2PTKA 2QAZA 3VTYA 4KRTA 4C0DC 3R7RA 3MEVA 4PS3A 2DL4A 4RKUE 5EIDA 1X2KA 1WGSA 4TXRA 3G6EQ 3FUHA 2L2PA 5GAN8 3MCXA 3KEAA 4JZ3A 3C3OA 3BDUA 1PWTA 5FQ7A 5KJKA 4JS4A 3OXGA 1JRIA 4LEUA 2B86A 4XE0A 2IONA 1CKAA 3RO2A 2CDTA 3ABKE 4I6JA 4GB9A 3ZHEB 2RMOA 3V8KA 2YHTA 3LWIA 2EGEA 4M7DF 2IF4A 1WHHA 3GF5A 4CC4B 4J8SA 3A5ZB 5GAOl 4M7AF 1K8KG 1Y71A 3PDNA 4A54A 2LQNA 5IHNA 3ZPJA 5H7PA 5JJ7A 1BB9A 1VQMA 4MRUA 2HDAA 3ULRB 1QZ2A 1VQ5Q 2XQ0A 2GNCA 2EKHA 2D8JA 1YJNQ 1AWOA 3PE0A 2QYJA 4HS2A 2LZ6B 3PIOA 3VU3C 2FG0A 4M3OA 2EIJE 1Q86R 4AG2C 1JWGA 2XRZA 1E6GA 2MRIA 2DL5A 5GAN6 1YITA 1H2UA 1D09B 2WXPA 3X26B 3LKUA 4IUPA 1N6AA 2KDSA 4G25A 4ACLA 2JM8A 2DZ9A 3CCLT 5DLQE 1M1KC 3FC3A 3CCJQ 4BSXA 2CKKA 1Y7XA 4ZN3A 2DXCA 1A0NB 4I43A 1M3BA 2ROLA 3BW1A 3PVQA 5E75A 2GRRB 3SGHA 4E7LA 1FVFA 3CCMQ 4NRHB 3GNGA 4LD9K 2A37A 3IEGA 4GTSA 3VS0A 2IEJA 3FUNA 1GRIA 4G8LA 5HRYA 2KYBA 4E7SA 3URZA 2OTLA 1VQ6T 2MAMA 4E2FB 1WHLA 2O4XB 4CRWA 4JLIA 2J07A 1NLOC 5FT9A 3QDRB 4QQIA 2AXUA 4HB5A 1I81A 2PVDB 4AVXA 2GTOA 1KC8C 1BD8A 3ULEG 2XHCA 2E6NA 3AT1B 1AZEA 1WA7A 2LRQA 1VQ8A 1VIFA 1FWZA 2DD4A 4WWOA 3ZHEA 2KYMA 3QB2A 2IO2C 2IIMA 3UWNA 4E6RA 5HCKA 4IUUA 3CVVA 3ME9A 2ROTA 4AV7A 1TEZA 1X6BA 2PUKB 5FTPA 2DRMA 3WG7E 2A28A 2VGNA 3JQ0A 4E7ZA 4GU5A 3U4TA 3I55Q 3LWHA 2A5UA 4Z89A 1WDYA 2V8JA 2LUHA 2A7YA 2C2LA 4RSYA 5J08A 2YWWA 2EWNA 4EIKA 1V76A 3TSWA 1QVGS 4M7AD 5KYWA 4M7DE 1IB8A 1UJYA 2CSIA 4GCNA 1JJ2S 4N3CA 3OMGA 3TWXA 5AN8A 3FDHA 3LS8A 2MF2A 2IG0A 1JUQA 2FEZA 2J8SD 3SNXA 2RI5A 3OXFA 4OVAA 4C92A 3TEEA 2F2VA 2AT1B 4FSSA 1VQ7Q 1MX6A 3QSUA 2D0QB 3AS4A 5FWCA 1NJIU 3BG1B 2CHWA 1XJWB 3DB3A 3N5BB 1VQKA 5ENOD 1XNFA 2BTTA 1VQPQ 1J3TA 1FXXA 4I9CA 2GRNB 2J6OA 3TREA 4MBGA 1YI2T 1VQKT 4UC4A 4OMFB 2P4TA 2RKKA 2EILE 2QY7A 3Q15A 2K79A 1VQ9A 4FC8A 1YWOA 5I21A 2DVWA 2XK0A 5CIUA 1N95A 4UQYA 1RLPC 1TH7A 2SEMA 2E4HA 4C48B 3BFMA 3VS3A 3PE4A 2QEXA 1N4RA 5J90A 2XDPA 2VQ2A 4M78G 1LPLA 4U96D 1W4SA 2DYBA 2P0KA 2LNIA 4FCYA 4LNUD 1TNZA 1UUEA 3FDRA 2JW4A 4MMLA 5IT9E 1U5SA 1AEYA 2HBWA 4BUGA 2XENA 1QLYA 2QQ9A 3ZEFA 5GAMd 3TWSA 2JM9A 2OTJT 3B7BA 4PFOA 1QMCA 2J9QA 4M7DG 2DETA 1M2OA 1IO6A 2DKGA 3DRAA 1V54E 4AY5A 4M7DD 1OWNA 1IGUA 2A0FB 4M7AE 2J49A 3CK9A 2DYIA 2P0PA 4F7UE 3HXBA 4WUYA 4OMLA 1MMAA 1U3OA 3CCVQ 1VUBA 3SZ7A 4Q69A 4JEUA 1FMKA 3R6NA 3JCMh 4GZ3A 4OAUC 2YUNA 2RHXA 4WCIA 3ASFA 1MQSA 2AZVA 3CVYA 4C9BB 1BI2A 1RI0A 2DL8A 4GTTA 3QYHB 1GCQC 3DB4A 1KPSB 1Q2ZA 1YIJT 2OTJQ 2ILRA 2OJ2A 1WYXA 4EBAA 3EHNA 4CC2A 4XI0A 1CKBA 3J7AF 3SEMA 3OYKA 3D3MA 3F70A 2QEXT 4K5CA 2BEDA 2HE0A 3P8BB 2NXPA 5CECB 1KT0A 2GBQA 2DK3A 4BE1A 2DXTA 4NACA 4CZ2D 3O4ZA 5EC7A 3CD6A 1FCHA 3G4SQ 1C1AA 2LT4A 3NFCA 3SHFA 5LJ3e 3CK7A 3L17A 5DBKA 5ECAA 3MP1A 2JLBA 4J7WA 2K5LA 2V4LA 3CCQA 3HHMA 4N2SA 2CP3A 4O1PA 2GFAA 1UHFA 3PUKA 2VSNA 2P4RA 4HRLA 4QVDA 3JCMJ 1D9SA 1WAO1 1JQQA 3CD6T 1N4SA 5FU7C 2E0IA 4UQXA 1O1TA 1RAGB 5KCHA 4WTOB 1NPPA 3M56A 1ELWA 3CBMA 3T8MA 1SZ9A 1AT1B 1DJ7B 4ORZA 3MJXA 5AYWD 1VA7A 2J08A 4NQ0A 4EHMA 1QQEA 2XEHA 4LD6A 3DXMG 1UEBA 1OPLA 1M90C 3Q78A 1SA4A 4JRIA 3VLEA 4PNOA 1Q81C 1GBRA 1N4PA 1G3YA 4Y28E 5KYUA 1RW2A 4M4ZA 1ZSZC 1M5Q1 3NTKA 1ZSZA 4FHJA 2LDMA 2IOSA 4N0AC 4R7LA 4F04B 4G1TA 2KBXA 4K03A 1WJQA 1K73U 3GPLA 2MI6A 3CKCA 4PJLA 2BE9B 4F6RD 1N54A 4QQGA 2WMOA 1ZA1B 3GZ1A 2EYQA 5D6XA 2P9SG 2COYA 4DX6D 3D9MA 5FU6C 5IAYA 2ZXWE 1SSFA 1D0YA 2W0ZA 3OS0A 4BE0A 5GAOr 1A5EA 4A1SA 4GTRA 4URKA 4QQ6A 1AOJA 5GMKe 3VS5A 2E1HA 3JB9H 2I0NA 2FL7A 3THKA 1S0PA 3QARA 3Q9UC 1UN9A 3MV3B 3U23A 3UPVA 3P1UA 1VQNQ 2BUDA 3QWYA 1I5OB 2JMCA 1QKWA 1D0XA 1O1SA 3EFRA 4QVCA 2GRLA 4L23A 4KVMA 4AOFA 1N4QA 1H6KA 3E33A 1TNYA 4LUDA 3ASDA 4AEZC 4C0GA 1MNEA 2ZU6B 4YTLA 2R17C 3UTMA 4E6HA 4EMKA 2YUOA 4M78B 2COWA 3B13A 4HVWA 1TUCA 1NA0A 2H3EB 2GRMA 1HXIA 4M77B 4FHKA 3UM2A 2F5KA 2QA4Q 3Q5MA 3FTWA 1UGVA 2BTDA 2OEVA 2O01E 3NTIA 4FJYA 1HG2A 3FWVA 4XTUA 1KQSS 2X6IA 2I1KA 2HO1A 2O9SA 5GANg 4PDXA 4ME2A 3PRZA 1Q7YC 3PZDA 4F7UF 2EIFA 1EPUA 3G6EA 2WQ7A 2HSEB 2YDLA 3KSQA 3M54A 4R0KA 1C0MA 1X27A 3H41A 1EIFA 3JRZA 3RBBB 5LJ3d 3FUMA 4KT6B 4DOWA 1V29B 1N8RU 3Q49B 2XPYA 3PVLA 4MLPA 3C98A 3AS8A 2QGGA 3CPWP 2VTBA 1Z3XA 2RI2A 4BTBA 3C3RA 2LAHA 1Y96B 3Q73A 3EAEA 4A4KA 2DEUA 4C5HA 1VQNT 2YRVA 5FWQA 3OTNA 1WY6A 2DZNA 3AG2E 5GMKi 1D8DA 3CC7Q 4RTTA 4R56A 2E12A 5CRUA 1VQMQ 2IY0C 1OX9A 3VTXA 2FRWA 1TG0A 4A55A 4ZFHA 2UY1B 1OV3A 1AZGB 3TWVA 1OULA 5CK9A 2H6GA 3J80E 3BY7A 3VYGA 3MZLB 3UDCA 2LJ1A 3FEXA 3MYVA 1VYTA 2M0OA 3OYLA 3CSFA 2IVWA 3ZXPA 2K5FA 4C8QB 3QDFA 1QWEA 3V2OA 1HXDA 5I2SA 1HF8A 3FB9A 3CCJA 3HPWA 1Q82R 1SG5A 4I2ZA 4OB0B 4HCBA 2DERA 2R59A 1TR4A 4F7AA 1PY1A 4N0AA 2G6FX 3CMET 4KGVB 3CCUT 2DJQA 2KMTA 2K3XA 1DNPA 5D0QD 2JTFA 2KBTA 2L89A 2RQUA 3E4BA 3GYZA 5DY9A 3DLLA 3FHEA 5KJNA 3VRZA 4FW1A 1H0AA 4U04A 4HI8A 1SRLA 2FULA 5LJ5e 2VXFA 3ZFJA 3I55T 5CCLA 3CC2Q 3REAB 3OA6A 1SKUB 4MKTA 3AG3E 2R02A 1H2VC 5HS0A 2O9VA 1GCPA 3H6ZA 1I0CA 4C0FA 2RQWA 1M3AA 3H9NA 4E47A 1VQ8Q 5IHIA 3CVQA 4DX1A 4C5IA 1K9AA 3D9JA 1VQ5A 1IXDA 3OY9A 3OS5A 2ZIRA 4MZMA 1NJIR 4AY6A 1M30A 1QVFP 4RG8A 1VQ4T 4AIFA 2K7AA 2RD1A 4N3BA 2LMJA 3SY2A 2R5SA 1ZSGA 3T9NA 2MIOA 4D6WA 2P9KG 4D8KA 2QQAA 2ZPFB 2CT4A 5JA4D 4GPKA 3CC4A 1JCQA 2O31A 2WXMA 3EJNA 3EGDA 3LCAA 2PM6A 4GA0A 1HZ4A 1YN8A 2DM1A 2ZZDA 3TU4K 4M78D 4NURA 5IHKA 3UUXA 1QVGP 1X6OA 1DC2A 3MJWA 2RHUA 5GJWB 2KVQG 1TYQG 3LYIA 3CCMA 4I9EA 2L6JA 5GANe 3LJNA 4B93B 3FU5A 1RI9A 1BI3A 4L6V5 2OTLQ 1WJRA 3NZSA 1T0HA 3SDZA 4PH4B 5LL6S 1K9MR 1IQRA 3UT7A 1TUGB 4G23A 5GMKm 1OY3D 4A4EA 1MYOA 4AMCA 3GW4A 2XKOC 2E3HA 3ZFWA 2LCLA 5FLXE 3DEPA 3OYAA 3HDXA 3BG0B 1VQ5T 2XPIA 4XEIG 3VUZA 4A4FA 2DYSE 5LX8A 4ILHB 2VSOE 1UGSB 1VOMA 4RTWA 4IN3B 1S72T 5CERB 2ETBA 1PD1A 3FUDA 2R58A 3CCMT 2I6HA 1SA5A 2XZTG 1WXUA 4BE2A 1PM3A 3C95A 1OCZE 5AJDA 3BUAA 1ZQ1A 2L9BA 1SQMA 4KZCA 5BXUA 2P9UG 1D1AA 2L0TB 2GQIA 5HY6A 3I55A 4H7YA 4M7DA 4JUVA 2CP6A 2KEAA 1TOVA 2GCXA 4M7AA 1S70B 4JHRA 1K9MC 2LTOA 2A5EA 4E85A 1ABQA 1NEBA 2H6FA 4C92E 1HYOA 1X01A 3ONKA 1WXBA 2HMAA 5FQ6A 5CMWA 1DVPA 1WPYA 2LNVA 2D1XA 4GA1A 2K9GA 4G24A 1YJNT 4GZ5A 4LSZE 4Y6WA 2JNGA 1YHQA 2PL2A 2DTHA 1M1KR 2DJZA 4Q94A 3M57A 1SW6A 4GA2A 2XGMA 1VQKQ 4ZN1A 2FZCB 5JHAA 4B94A 4I6EA 4J7IA 3CKBA 4UI9J 1XGWA 4C8QF 4I6GA 3ZIMA 3APCA 5HQ8A 5A2QE 1VQPT 2DEQA 2YRDA 1E7OA 3KEZA 1K9MU 3Q4AB 3AAAC 2Y0BG 4QKUA 5CKDA 1AWXA 4JRQA 2X4YA 4M77A 2GGFA 3UINC 1K8AU 4OMNA 2JVVA 3CEYA 2EAYA 4HNAD 1RAAB 4L1BA 4F53A 2XZDG 3HFNA 3NF1A 3E2UA 2HSPA 1EF1C 1WZOA 3FUKA 3MEKA 1SHFA 3ZU7B 4GAAA 3M4GA 3HXFA 1YI2Q 3QZ9B 1M9SA 1WHKA 3M0RA 1IHBA 4GTVA 3ZYKA 3LLRA 4LN2A 4BDZA 4QQDA 4D8DA 2FYKA 1FT2A 3ENEA 3RKVA 2AKKA 3ESLA 3FJPA 2P84A 4Y92A 3JCMf 5BXOA 3BU8A 1ZBPA 2X4JA 4F7UA 1E8XA 3MEUA 4M77E 3J81E 3L2QA 2QQSA 2RK1A 1VQ7T 1TN7A 4M75A 1NL4A 2BZYA 2M0YA 1TTHB 3RMSA 1O1RA 5A0DA 2KT8A 4RG9A 5LJ5g 2VGXA 3DPDA 3HG0D 1B7TA 1N5ZA 1WDXA 4J8EA 3RIRA 2D6FA 3AS5A 4D10C 4JA7A 1IQUA 1T0JA 2LAIA 5G05J 3GIBA 3A1PA 4M77F 3HYMB 2PQNA 2L5QA 3PNWC 5GAN2 3NPFA 1UECA 2EQKA 4XTZA 2C06A 1LJOA 5T8IA 5A0LA 4JZ4A 1E96B 3CCEQ 3CMAQ 1VQ6A 2CP7A 2IO3C 3RKWA 1KD1R 3V2XA 3L2UA 4Z8AA 3ZYQA 3CIAA 2EQJA 2JMAA 4DBRA 4ILGA 2HD0A 2KAFA 4CT4A 4M77G 1KD1C 2AJAA 3FTVA 4EZKA 3JB9I 3G71Q 1AWCB 1QP2A 2LVMA 3HVEB 3CVWA 1WFWA 2I2OA 5ENQD 3SHWA 2IQCA 4WNDA 2ETCA 2ZGDA 2DIGA 3ML9A 2O2OA 4U8VD 5AQ9A 2GFUA 1U3DA 3L2RA 2KCLA 2J05A 4O60A 3QWXX 3ZNGA 2MOWA 3Q79A 1SHGA 3LVQE 3UIOC 2VSYA 3ABLE 2A36A 2WXGA 1VQNA 4IKFA 3FEOA 1KG1A 4HCCA 2PU9B 5ANLA 3IHYA 2HBPA 3L82A 1JXOA 2F37A 3CCJT 3OYYA 1BCOA 2HL3A 1U3CA 3SF4A 2RNAA 2EQIA 1OOTA 2YLCA 4KYOB 4GMJA 2QI2A 1UJKA 3A8GB 3TG5A 1TJFA 4W9RA 5ENTD 3VS7A 5KYUB 3QXEB 3ZBDA 2XCBA 1YWPA 2Y4XA 4NS5A 4XTYA 1Q81R 4II1A 1ZSZB 1ZUUA 1NFIE 1IKND 5AQBA 3CBPA 2F2WA 2DX1A 4AXHA 4JL0A 4ILIA 2B6CA 4P29A 3MEWA 5LJ3f 2PQWA 4AFUC 2RN8A 2HEQA 4U8YD 2FVUA 1KLXA 1WG0A 3I3NA 4RUGA 3G2VA 2D0NA 2H8HA 1UB4A 3I56Q 1PRLC 1N0RA 1IHGA 2XI9A 3EUVA 3QOUA 4CYMD 2X3XD 3LW5E 3CV0A 2RM4A 4MMKA 5A7DB 3M5AA 5AIJA 1SEMA 1Q82U 3VS2A 3BQOA 1E8WA 3L13A 2A3LA 5ARGA 3PMTA 1FVHA 4FT4A 3I9QA 2YQ8A 4XZ4A 4OF1A 1D1BA 9ATCB 2L8DA 3HL8A 4PJOA 3RUXA 2EINE 3EIQC 4ANUA 1E7VA 2RFMA 3ASNE 3M59A 3X20B 2J09A 2CH4W 4CGVA 5GAMh 1HFAA 3UKUG 1JB0E 2IOLA 1OPKA 3G7ZA 5KE3A 3U9WA 1YJWA 4LNGA 1HG5A 1FMVA 2E64A 3CPFA 3V8JA 2QFCA 1FMWA 1X75C 1LCKA 2M16A 4GYOA 4EPZA 2WB2A 1VYUA 1VQMT 1WNLA 1M1KU 3CCVT 1JBMA 3UM3A 4FLHA 2WXOA 4EMHA 4LDUA 3OYGA 2HM8A 3IBEA 1NLPC 3R7QA 3JCMd 1DCEA 3EFOA 1PSEA 2E5KA 1NEGA 5CO7A 2I9CA 2V1QA 3L22A 4M78F 1MNDA 4F16A 4YDYA 4TRQA 1QVFA 2JABA 3OQ5A 4FT2A 4BACA 3LH5A 1K76A 3ER0A 4GTMA 4U63A 5ENNA 3UM1A 1JPLA 3DSWA 4JB8P 1BI1A 3CR3A 2E10A 3QHSA 3CC2A 1TNBA 3UX4A 4WWNA 2LXMA 2EW3A 3OAWA 4DQ2A 3Q9NC 4N5QA 2EJGA 4I1MA 4PS7A 4I17A 2P2CP 4WNEA 5CMYA 1M27C 1TWBA 4AT1B 2RHZA 2Y69E 3IKOB 2E3IA 3C3QA 5ENPD 4C5GA 1M90U 2QA4T 3L6AA 3NAWA 4KT0E 4CEMA 2KC7A 1Q86U 2KRSA 3AJIA 4FYWB 4OB2B 5BNWA 4FYXB 5KYNA 1R0BG 1E8YA 4CDNA 1X2QA 1U1TA 3V7CA 5GAN7 3IHVA 3MKQA 2KZTB 3APFA 2BIVA 4M75B 4AFZC 4DI4A 4FP7A 1BKBA 2ZPGB 3D9NA 3EHRA 1FX7A 5J39A 1OWOA 5G04J 2BZXA 4UUCA 3GNFB 3AHUA 3MP8A 4UI9C 4ME7A 4WWPA 5CCAA 4Z02A 2OV8A 5FZSA 1QCFA 5B1BE 3TWTA 2JXBA 2LQWA 4JJNK 1PRMC 3OYHA 5LOZA 1JJ2P 3A8HB 1SVXA 1OCOE 5CBNA 1S63A 1GCQA 3NOCD 3SWNB 4O6FA 1HX8A 3PZ4A 2EYWA 3OYDA 1UTIA 3M4YA 4M7AC 4O1OA 3DBSA 4HT8A 4WF2A 5FRMA 1NP7A 3DSTA 5EG2A 2WSFE 3HRAA 2HZYA 4C92C 3LY7A 1M90R 4PJMA 5IN1A 1OWMA 1BCMA 2DZCA 5GMKj 3KSLA 4JPBW 1NA3A 4CDRA 3NGPA 3J5QB 2E41A 2CP0A 4LDVA 3FUEA 4BESA 3L42A 4O5VA 4C8QG 3ISMC 2J6KA 4BT8A 3I5PA 4BX9A 3V79K 2ZPBB 1O9SA 1VQOA 5A0GA 2WXIA 3V8LA 4HORA 2ZCFB 1Q7YU 1OU8A 2EJ9A 2EJFA 1GL5A 3CCRT 2F8XK 3DPYA 5JJ6A 3RU0A 3ASGA 4U0UA 2XS1A 3L16A 5GJVB 5J26A 1PAQA 5G05C 3GP8A 5CQXA 2NUTA 5BT1A 3AU5A 2YHEA 2L3RA 5ARFA 4J8DA 1TNOA 3TSZA 1LTXA 1EFNA 5G04C 1UE9A 4J9IA 4G2VA 4L9PA 2QZAA 3PH0C 4PFPA 1LNXA 4B9XA 5GMKl 1PNJA 1PHTA 5EKQD 1U1SA 3UT8A 3HRUA 3L54A 2P58C 4N3AA 3QBYA 3MPUB 4JXTA 3PZ1A 3ZN3A 2LJ0A 4DLOA 2MYOA 3D9OA 2RJEA 2JS0A 4LNBA 2Y1LE 3AG4E 2EPDA 2ESWA 4AJWA 1BI0A 3JAME 1VQ9T 4LXCA 3S7BA 2AWIA 2AXVA 3OYNA 3RERA 3MGBA 5BUZA 2J6FA 1QNFA 3RR6A 4M7DC 4EQFA 1VQ8T 3S7DA 2E6ZA 3L2WA 1MJ0A 4HFGA 3PUJA 2X51A 2CZ0B 5EN5D 2OTJA 4EMGA 5AT1B 1UJ0A 4M7AB 2DFUA 4KGZB 1KZPA 5LJ3g 5LJ5h 3H0HA 1KSWA 3CXCS 4YDWA 3CC4Q 3M9QA 3OBWA 3CXCP 1W70A 1YHQQ 3QC1A 4OVVA 1K0SA 4FLBA 4JHKA 2RHIA 1K73R 4BY6A 3ZRHA 3BDLA 4PLIA 4DK5A 2EYZA 3RAUA 2DL3A 3LYAA 2WXLA 3QNKA 1MV0B 1S64A 1AWJA 4PJOB 4JS5A 2Z0WA 5A6CA 1Q7YR 2DWZA 5KWDA 4HRMB 3X28B 4BI3A 2RJCA 4C8QC 5B3SE 1Y0MA 3Q7AA 1QBQA 3FTSA 2DPPB 1OUVA 4JRKA 2J7IA 5ANRA 3OMCA 4N39A 4PJOF 3CCEA 2OVFA 3ABME 4QVZA 4QT7A 1W1FA 3NHNA 2NUTB 3CCSQ 5GAOp 3CQCB 3EHMA 1PC2A 4GYYA 3DSUA 2JZ2A 3UA7A 5FQ8A 2RQRA 3ZW3A 3E32A 1Z6TA 2E65A 2VYIA 3R9MA 3EGXA 3OW2S 3A98A 1IGQA 3RRMB 1NYGA 4IUTA 3JB9F 4OMPA 2F1LA 2QQRA 2QYUA 2JN0A 5KYXA 1ZLMA 4G11A 1LOJA 2F8YA 1TU0B 4J6WA 5HK0A 3GZSA 5KBAA 1JCRA 4DBHA 4FA6A 2LC4A 2QK0A 1MMDA 1TN6A 3FUFA 3HXDA 3UT1A 5HKPA 3CQTA 4CC7A 4GMLA 1RLQC 5LP0A 2JOYA 4VUBA 4JRPA 3CXCA 5FQ4A 2EVRA 2RA2A 5CKHA 4CRIA 3HKSA 4HKEA 4JVSA 1TNUA 4UWKA 3JCMb 2F5TX 3DWLG 1TS9A 1H6PA 3B7TA 1OQKA 5ENSD 2XMFA 4X34A 1SSHA 5FWBA 4V2SA 4OMOA 3CPWA 1FYNA 2XPZA 3GLXA 1UG1A 2RO0A 2LP5A 2ECZA 1VQ6Q 1U06A 3CVLA 3JCMe 2CYZB 3I4RB 2VWFA 1WHJA 3IXEA 2HAXA 3I56T 2YSQA 4ZGJB 4RQIA 4MDXA 3MKQB 3INZA 1SZAA 2DXBA 5GANj 3TQ7P 3ZVVA 2FRYA 2QDYB 2GGRA 2X4XA 2VTBB 4ELZC 1OXJA 1YIJA 4DLQA 3M0SA 3OS2A 4L2LA 5BW8C 4EBAG 1MX2A 5G2NA 5KH6A 4GZ6A 4AG1C 3U3WA 1JU5C 3I5RA 3MP6A 1OCCE 1YI2A 3FTZA 5ITZF 4XIFA 2ZPIB 4CDMA 1KQ1A 1H19A 5CCMA 2QA4A 3CK8A 3TGOA 1KT1A 4HLLA 1NE8A 1H2TC 4GYWA 3A8LB 5FINA 4J9GA 2WVIA 4I1AA 3RIBA 2YUQA 4PJOE 1Z9ZA 3M58A 5I2MA 3PZ2A 3EFSA 2MMPA 4K5BA 2Y3AA 1NM7A 4HBDA 1EYHA 5I11A 4G26A 3M0QA 5GAN3 3LPZA 2H3JA 3E9FA 2LSUA 2V8KA 4IULA 4KUIA 3FULA 1RACB 3LGLA 4WAFA 2RI3A 3APDA 1KHIA 3TG4A 4M75C 2KCVA 1EZZB 3RO3A
chains in the Genus database with same CATH topology
4ATZD 4RTVA 2BZYA 2M0YA 4RTZA 2FPFA 3SO8A 1HJDA 4Z89A 1WDYA 2KT8A 4RTYA 3I5SA 4EIKA 1WDXA 3HG0D 3C0CA 3TSWA 1N5ZA 1UJYA 1ZUYA 2CSIA 5EYPF 3JV3A 3TWXA 5AN8A 3T8KA 1T0JA 5L23A 3JXJA 2J8SD 4DUIA 3NPFA 1UECA 2KXPC 2F2VA 3F6QA 1JXMA 4FSSA 1MX6A 2A08A 2CSQA 4JZ4A 2L0AA 3V30A 5FWCA 1UDLA 3V2XA 5ENOD 4Z8AA 2JMAA 1K1AA 2BTTA 1J3TA 4G8KA 2C0OA 5AQ7A 1NG2A 2RPNA 2J6OA 2AJAA 2KRNA 1AWCB 4LE9A 1S1NA 5ENQD 1WFWA 3SHWA 4BETA 2K79A 3D9HA 2ETCA 2ZGDA 1HD3A 2FO1E 1YWOA 2VKNA 4IIOA 4GPMA 2DVWA 2DILA 1RLPC 2LNHB 2O2OA 2SEMA 2YT6A 4U8VD 5AQ9A 2HCKA 4C48B 3QWXX 2J05A 4O60A 3VS3A 1WI7A 2AKLA 3ZNGA 1SHGA 4X1VA 2BKKB 4U96D 2DYBA 4GLMA 2A36A 4LNUD 1UUEA 1T3SA 1YMPA 1PKTA 2JW4A 3W9FA 1U5SA 1OT8A 4J9BA 3REBB 2HBWA 1AEYA 2XENA 4ZNXA 1H3HA 1QLYA 1JXOA 2F37A 3TWSA 2JM9A 3B7BA 1X69A 4BEPA 1IO6A 4NIKA 2RNAA 2EQIA 2RF0A 1OOTA 2BZ8A 2YUPA 2DLPA 4J9FA 5ENTD 3GBQA 5JMND 4OMLA 3VS7A 1U3OA 1YWPA 4DEYA 3R6NA 1FMKA 5EYLA 3UF4A 1E6HA 4OAUC 2MOXA 1ZUUA 2YUNA 5IH2A 4WCIA 1NFIE 1IKND 5AQBA 2AZVA 2F2WA 2DX1A 2DL8A 1GCQC 4AFUC 2RN8A 2OJ2A 1AD5A 1WYXA 2HEQA 4U8YD 4CC2A 5CEDB 1WG0A 1CKBA 1KIKA 1MX4A 4RUGA 3SEMA 1NYFA 2D0NA 2H8HA 4K5CA 1N0QA 2DE0X 2HE0A 2L6BA 3EHQA 5D66A 2KNBB 5CECB 1N0RA 4HI9A 1PRLC 2GBQA 1YYHA 5EC7A 4CZ2D 5CBOA 4CYMD 2X3XD 1T3LA 1SEMA 5ECAA 1WIEA 3VS2A 4J7WA 2LJ3A 4J9CA 2EBPA 3I9QA 4OAVB 5ENRD 2CUDA 2DF6A 2K3BA 2QC9A 5FIOA 3UA6A 1BK2A 4O1PA 2KR3A 1UHFA 2JTEA 2P4RA 4HRLA 1JQQA 2RFMA 5AARA 1D9SA 2PNNA 1SPKA 1V1CA 4OMMA 2CH4W 4K11A 3ZUVB 2KGTA 4ORZA 1OPKA 1BBZA 1VA7A 3ZL7C 4DX2A 2XEHA 4DX5D 4Z68A 1YNZA 2VVKA 1OPLA 2FPDA 1LCKA 1Z9QA 1AWWA 2X3WD 3EG0A 1GBRA 1MV3A 1VYUA 1M3CA 1YCSB 1KJWA 2J06A 4F14A 4M4ZA 5FW9A 4J8YA 4OMQA 1NLPC 1G3NB 2E5KA 2KT1A 1NEGA 3NMZC 1G2BA 2NWMA 2V1QA 2AK5A 1YP5A 4F16A 4YDYA 2DBMA 2KBXA 2JABA 1ZUKA 3TWQA 3LH5A 1K76A 4DEXA 3TWUA 1UFFA 4F6RD 2OAWA 1XOVA 4JB8P 1IXVA 2JT4A 4DX6D 4RLYA 4GMRA 3NBNB 4HRNA 1MUZA 3M0TA 2EW3A 2W0ZA 3Q9NC 4N5QA 2EYYA 1A5EA 5I22A 2P2CP 1AOJA 4AFSC 2PZ1A 3VS5A 1M27C 3FJ5A 2EGCA 2I0NA 5ENPD 2F2XA 4HVUA 3THKA 3Q9UC 5AAOA 3U23A 3EG1A 3QWYA 3VS1A 2KXDA 2JMCA 1QKWA 2KRSA 3AJIA 4J9EA 2DNUA 1K0XA 2CH4A 4LUDA 2NYJA 1TUDA 1X6GA 1GFCA 1X2QA 3UATA 2FO0A 4QFVA 3UTMA 2QDLA 2GTJA 2YUOA 1B07A 2SRCA 1UOHA 4AFZC 1VYVA 4HVWA 1TUCA 3EHRA 5KNHD 2XEEA 3TWWA 2DRKA 2BZXA 4UUCA 3JUEA 3EGUA 1SRMA 2C0IA 1UGVA 1X43A 1QCFA 3I35A 4HVVA 3TWTA 2JXBA 2LQWA 1PRMC 1OEBA 4JJDA 2O9SA 2K2MA 4LNPA 2M51A 1SVXA 1K1ZA 2KE9A 1ZX6A 2YDLA 5CBNA 5IXBA 4R0KA 3RBBB 1X27A 1K1BA 3H41A 5CEAA 2ENMA 1GCQA 3NOCD 2OI3A 3UXGA 2MCNA 3M0PA 2EYWA 1UTIA 4DX7D 3PVLA 2RQTA 5IXFA 4F1PA 2RQVA 4O1OA 3VS4A 3JXIA 2ETAA 3O5ZA 2V1RA 3HRAA 4ESRA 4HXJA 5EIBE 1RUWA 2L3PA 1AVZC 2DZNA 4RTTA 1QWFA 4JPBW 1N11A 3NGPA 2FRWA 1TG0A 3J5QB 2EGAA 5EILA 5AQAA 4ZFHA 1OV3A 4BESA 1AZGB 3TWVA 2K6DA 2J6KA 2LJ1A 3V79K 1VYTA 2ED1A 3ZKJA 2LCSA 1BU9A 4CC3A 1GFDA 1QWEA 2DMOA 1GL5A 2F8XK 3V2OA 1I07A 1BI8B 5GJVB 2NUZA 1TR4A 3TSZA 2G6FX 2FEIA 4Z88A 1EFNA 1UE9A 4J9IA 1I1JA 3EU9A 2DJQA 2W10A 3VRYA 1M8MA 1PHTA 1PNJA 2KBTA 2L3SA 2V5QC 3C5RA 2RQUA 1WX6A 2KXCA 3VRZA 2BKGA 1SRLA 4HI8A 2LJ0A 2MYOA 4JJBA 2JS0A 2Y1LE 1ZBJA 2EPDA 2ESWA 4RTUA 3REAB 2O9VA 5HS0A 1WLPB 4RTXA 4HCKA 2J6FA 2JS2A 1GCPA 1Y57A 3TWRA 1I0CA 2RQWA 2C0TA 1M3AA 3NOGD 2LX7A 5IHIA 1MJ0A 4DX1A 1K9AA 2ED0A 3M0UA 5EN5D 4J9HA 1UJ0A 2L3QA 1G83A 1M30A 3H0HA 1KSWA 4JJCA 4YDWA 2K7AA 2DVJA 1W70A 2LMJA 4TUMA 1K0SA 2RFAA 1ZSGA 3DEOA 2MIOA 1QYMA 4D8KA 2CT4A 5JA4D 3T9KA 2EYZA 2DL3A 2O31A 1JO8A 1MV0B 2DM1A 1YN8A 1AWJA 3KFVA 4J9DA 5IHKA 4BSZB 2D8HA 4K5AB 1H92A 4A63B 2DWZA 3IQLA 5KWDA 4HRMB 1DC2A 5GJWB 1K3ZD 4LUEA 3LJNA 4B93B 1Y0MA 1RI9A 2DA9A 5KNGA 2J7IA 1JEGA 1T0HA 1ABOA 1B3QA 1UHCA 4DRXE 1W1FA 3NHNA 2B0OE 4QT7A 4ZHBA 1OY3D 1AP7A 1MYOA 3UI2A 2PTKA 4KRTA 2KRMA 3TVTA 4BERA 3UA7A 2DL4A 2RQRA 4GBQA 5EIDA 1X2KA 4AFQC 1KFZA 2L2PA 3KEAA 4JZ3A 3DEPA 1PWTA 3A98A 2CUBA 2DL7A 1NYGA 2B86A 4OMPA 1CKAA 2CDTA 1PKSA 1WXTA 2RMOA 4RTWA 5CERB 2ETBA 2EGEA 2ZGGA 3H0FA 4HQDA 2XZTG 1WXUA 1ZLMA 2F8YA 3W9GA 5KBAA 5BXUA 4CC4B 3B95A 2GQIA 2VGEA 5HKPA 3CQTA 4CC7A 1RLQC 2LQNA 2KEAA 5IHNA 1BI7B 1BB9A 2AZSA 1S70B 2EVRA 4LG6A 2A5EA 2HDAA 3ULRB 1K4US 1ABQA 2GNCA 1NEBA 2EKHA 2D8JA 1AWOA 3PE0A 1GBQA 2QYJA 2EYXA 2LZ6B 5ENSD 2XMFA 1WXBA 2FPEA 1DCQA 2FG0A 4AG2C 1SSHA 2D1XA 5FWBA 4OMOA 1E6GA 1FYNA 2DL5A 2K9GA 4LSZE 1UG1A 2LP5A 2ECZA 1U06A 3V31A 1SW6A 2JM8A 2VWFA 3IXEA 2YSQA 1A0NB 1M3BA 2ROLA 2ABLA 3PVQA 1E7OA 1ARKA 3AAAC 2Y0BG 1CSKA 1AWXA 2PNIA 2KROA 2A37A 2FRYA 4IIMA 3RNJA 2GGRA 3J5PA 3VS0A 4U95D 1GRIA 3EG2A 4G8LA 4OMNA 5HRYA 2KYBA 3EG3A 3M0SA 3VS6A 4HNAD 1MX2A 2V4HC 2DBKA 1QKXA 4AG1C 1BLXB 2XZDG 1JU5C 3I5RA 1NLOC 5ITZF 2HSPA 4QQIA 4HB5A 1HSQA 4HLLA 2DZOA 1W6XA 4J9GA 5FINA 2GTOA 2YUQA 1BD8A 1SHFA 3ZU7B 1Z9ZA 1AZEA 1WA7A 2CT3A 4K5BA 5I11A 1NM7A 4HBDA 1IHBA 2CREA 3M0QA 2KYMA 3M0RA 4E6RA 2IIMA 4LN2A 2O88A 5HCKA 1BU1A 3H0IA 4D8DA 2ROTA 4F17A 2AKKA 1X6BA 1H8KA 4Y92A 2DRMA 5BXOA 2A28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ATZ D;  4RTV A;  2BZY A;  2M0Y A;  4RTZ A;  2FPF A;  3SO8 A;  1HJD A;  4Z89 A;  1WDY A;  2KT8 A;  4RTY A;  3I5S A;  4EIK A;  1WDX A;  3HG0 D;  3C0C A;  3TSW A;  1N5Z A;  1UJY A;  1ZUY A;  2CSI A;  5EYP F;  3JV3 A;  3TWX A;  5AN8 A;  3T8K A;  1T0J A;  5L23 A;  3JXJ A;  2J8S D;  4DUI A;  3NPF A;  1UEC A;  2KXP C;  2F2V A;  3F6Q A;  1JXM A;  4FSS A;  1MX6 A;  2A08 A;  2CSQ A;  4JZ4 A;  2L0A A;  3V30 A;  5FWC A;  1UDL A;  3V2X A;  5ENO D;  4Z8A A;  2JMA A;  1K1A A;  2BTT A;  1J3T A;  4G8K A;  2C0O A;  5AQ7 A;  1NG2 A;  2RPN A;  2J6O A;  2AJA A;  2KRN A;  1AWC B;  4LE9 A;  1S1N A;  5ENQ D;  1WFW A;  3SHW A;  4BET A;  2K79 A;  3D9H A;  2ETC A;  2ZGD A;  1HD3 A;  2FO1 E;  1YWO A;  2VKN A;  4IIO A;  4GPM A;  2DVW A;  2DIL A;  1RLP C;  2LNH B;  2O2O A;  2SEM A;  2YT6 A;  4U8V D;  5AQ9 A;  2HCK A;  4C48 B;  3QWX X;  2J05 A;  4O60 A;  3VS3 A;  1WI7 A;  2AKL A;  3ZNG A;  1SHG A;  4X1V A;  2BKK B;  4U96 D;  2DYB A;  4GLM A;  2A36 A;  4LNU D;  1UUE A;  1T3S A;  1YMP A;  1PKT A;  2JW4 A;  3W9F A;  1U5S A;  1OT8 A;  4J9B A;  3REB B;  2HBW A;  1AEY A;  2XEN A;  4ZNX A;  1H3H A;  1QLY A;  1JXO A;  2F37 A;  3TWS A;  2JM9 A;  3B7B A;  1X69 A;  4BEP A;  1IO6 A;  4NIK A;  2RNA A;  2EQI A;  2RF0 A;  1OOT A;  2BZ8 A;  2YUP A;  2DLP A;  4J9F A;  5ENT D;  3GBQ A;  5JMN D;  4OML A;  3VS7 A;  1U3O A;  1YWP A;  4DEY A;  3R6N A;  1FMK A;  5EYL A;  3UF4 A;  1E6H A;  4OAU C;  2MOX A;  1ZUU A;  2YUN A;  5IH2 A;  4WCI A;  1NFI E;  1IKN D;  5AQB A;  2AZV A;  2F2W A;  2DX1 A;  2DL8 A;  1GCQ C;  4AFU C;  2RN8 A;  2OJ2 A;  1AD5 A;  1WYX A;  2HEQ A;  4U8Y D;  4CC2 A;  5CED B;  1WG0 A;  1CKB A;  1KIK A;  1MX4 A;  4RUG A;  3SEM A;  1NYF A;  2D0N A;  2H8H A;  4K5C A;  1N0Q A;  2DE0 X;  2HE0 A;  2L6B A;  3EHQ A;  5D66 A;  2KNB B;  5CEC B;  1N0R A;  4HI9 A;  1PRL C;  2GBQ A;  1YYH A;  5EC7 A;  4CZ2 D;  5CBO A;  4CYM D;  2X3X D;  1T3L A;  1SEM A;  5ECA A;  1WIE A;  3VS2 A;  4J7W A;  2LJ3 A;  4J9C A;  2EBP A;  3I9Q A;  4OAV B;  5ENR D;  2CUD A;  2DF6 A;  2K3B A;  2QC9 A;  5FIO A;  3UA6 A;  1BK2 A;  4O1P A;  2KR3 A;  1UHF A;  2JTE A;  2P4R A;  4HRL A;  1JQQ A;  2RFM A;  5AAR A;  1D9S A;  2PNN A;  1SPK A;  1V1C A;  4OMM A;  2CH4 W;  4K11 A;  3ZUV B;  2KGT A;  4ORZ A;  1OPK A;  1BBZ A;  1VA7 A;  3ZL7 C;  4DX2 A;  2XEH A;  4DX5 D;  4Z68 A;  1YNZ A;  2VVK A;  1OPL A;  2FPD A;  1LCK A;  1Z9Q A;  1AWW A;  2X3W D;  3EG0 A;  1GBR A;  1MV3 A;  1VYU A;  1M3C A;  1YCS B;  1KJW A;  2J06 A;  4F14 A;  4M4Z A;  5FW9 A;  4J8Y A;  4OMQ A;  1NLP C;  1G3N B;  2E5K A;  2KT1 A;  1NEG A;  3NMZ C;  1G2B A;  2NWM A;  2V1Q A;  2AK5 A;  1YP5 A;  4F16 A;  4YDY A;  2DBM A;  2KBX A;  2JAB A;  1ZUK A;  3TWQ A;  3LH5 A;  1K76 A;  4DEX A;  3TWU A;  1UFF A;  4F6R D;  2OAW A;  1XOV A;  4JB8 P;  1IXV A;  2JT4 A;  4DX6 D;  4RLY A;  4GMR A;  3NBN B;  4HRN A;  1MUZ A;  3M0T A;  2EW3 A;  2W0Z A;  3Q9N C;  4N5Q A;  2EYY A;  1A5E A;  5I22 A;  2P2C P;  1AOJ A;  4AFS C;  2PZ1 A;  3VS5 A;  1M27 C;  3FJ5 A;  2EGC A;  2I0N A;  5ENP D;  2F2X A;  4HVU A;  3THK A;  3Q9U C;  5AAO A;  3U23 A;  3EG1 A;  3QWY A;  3VS1 A;  2KXD A;  2JMC A;  1QKW A;  2KRS A;  3AJI A;  4J9E A;  2DNU A;  1K0X A;  2CH4 A;  4LUD A;  2NYJ A;  1TUD A;  1X6G A;  1GFC A;  1X2Q A;  3UAT A;  2FO0 A;  4QFV A;  3UTM A;  2QDL A;  2GTJ A;  2YUO A;  1B07 A;  2SRC A;  1UOH A;  4AFZ C;  1VYV A;  4HVW A;  1TUC A;  3EHR A;  5KNH D;  2XEE A;  3TWW A;  2DRK A;  2BZX A;  4UUC A;  3JUE A;  3EGU A;  1SRM A;  2C0I A;  1UGV A;  1X43 A;  1QCF A;  3I35 A;  4HVV A;  3TWT A;  2JXB A;  2LQW A;  1PRM C;  1OEB A;  4JJD A;  2O9S A;  2K2M A;  4LNP A;  2M51 A;  1SVX A;  1K1Z A;  2KE9 A;  1ZX6 A;  2YDL A;  5CBN A;  5IXB A;  4R0K A;  3RBB B;  1X27 A;  1K1B A;  3H41 A;  5CEA A;  2ENM A;  1GCQ A;  3NOC D;  2OI3 A;  3UXG A;  2MCN A;  3M0P A;  2EYW A;  1UTI A;  4DX7 D;  3PVL A;  2RQT A;  5IXF A;  4F1P A;  2RQV A;  4O1O A;  3VS4 A;  3JXI A;  2ETA A;  3O5Z A;  2V1R A;  3HRA A;  4ESR A;  4HXJ A;  5EIB E;  1RUW A;  2L3P A;  1AVZ C;  2DZN A;  4RTT A;  1QWF A;  4JPB W;  1N11 A;  3NGP A;  2FRW A;  1TG0 A;  3J5Q B;  2EGA A;  5EIL A;  5AQA A;  4ZFH A;  1OV3 A;  4BES A;  1AZG B;  3TWV A;  2K6D A;  2J6K A;  2LJ1 A;  3V79 K;  1VYT A;  2ED1 A;  3ZKJ A;  2LCS A;  1BU9 A;  4CC3 A;  1GFD A;  1QWE A;  2DMO A;  1GL5 A;  2F8X K;  3V2O A;  1I07 A;  1BI8 B;  5GJV B;  2NUZ A;  1TR4 A;  3TSZ A;  2G6F X;  2FEI A;  4Z88 A;  1EFN A;  1UE9 A;  4J9I A;  1I1J A;  3EU9 A;  2DJQ A;  2W10 A;  3VRY A;  1M8M A;  1PHT A;  1PNJ A;  2KBT A;  2L3S A;  2V5Q C;  3C5R A;  2RQU A;  1WX6 A;  2KXC A;  3VRZ A;  2BKG A;  1SRL A;  4HI8 A;  2LJ0 A;  2MYO A;  4JJB A;  2JS0 A;  2Y1L E;  1ZBJ A;  2EPD A;  2ESW A;  4RTU A;  3REA B;  2O9V A;  5HS0 A;  1WLP B;  4RTX A;  4HCK A;  2J6F A;  2JS2 A;  1GCP A;  1Y57 A;  3TWR A;  1I0C A;  2RQW A;  2C0T A;  1M3A A;  3NOG D;  2LX7 A;  5IHI A;  1MJ0 A;  4DX1 A;  1K9A A;  2ED0 A;  3M0U A;  5EN5 D;  4J9H A;  1UJ0 A;  2L3Q A;  1G83 A;  1M30 A;  3H0H A;  1KSW A;  4JJC A;  4YDW A;  2K7A A;  2DVJ A;  1W70 A;  2LMJ A;  4TUM A;  1K0S A;  2RFA A;  1ZSG A;  3DEO A;  2MIO A;  1QYM A;  4D8K A;  2CT4 A;  5JA4 D;  3T9K A;  2EYZ A;  2DL3 A;  2O31 A;  1JO8 A;  1MV0 B;  2DM1 A;  1YN8 A;  1AWJ A;  3KFV A;  4J9D A;  5IHK A;  4BSZ B;  2D8H A;  4K5A B;  1H92 A;  4A63 B;  2DWZ A;  3IQL A;  5KWD A;  4HRM B;  1DC2 A;  5GJW B;  1K3Z D;  4LUE A;  3LJN A;  4B93 B;  1Y0M A;  1RI9 A;  2DA9 A;  5KNG A;  2J7I A;  1JEG A;  1T0H A;  1ABO A;  1B3Q A;  1UHC A;  4DRX E;  1W1F A;  3NHN A;  2B0O E;  4QT7 A;  4ZHB A;  1OY3 D;  1AP7 A;  1MYO A;  3UI2 A;  2PTK A;  4KRT A;  2KRM A;  3TVT A;  4BER A;  3UA7 A;  2DL4 A;  2RQR A;  4GBQ A;  5EID A;  1X2K A;  4AFQ C;  1KFZ A;  2L2P A;  3KEA A;  4JZ3 A;  3DEP A;  1PWT A;  3A98 A;  2CUB A;  2DL7 A;  1NYG A;  2B86 A;  4OMP A;  1CKA A;  2CDT A;  1PKS A;  1WXT A;  2RMO A;  4RTW A;  5CER B;  2ETB A;  2EGE A;  2ZGG A;  3H0F A;  4HQD A;  2XZT G;  1WXU A;  1ZLM A;  2F8Y A;  3W9G A;  5KBA A;  5BXU A;  4CC4 B;  3B95 A;  2GQI A;  2VGE A;  5HKP A;  3CQT A;  4CC7 A;  1RLQ C;  2LQN A;  2KEA A;  5IHN A;  1BI7 B;  1BB9 A;  2AZS A;  1S70 B;  2EVR A;  4LG6 A;  2A5E A;  2HDA A;  3ULR B;  1K4U S;  1ABQ A;  2GNC A;  1NEB A;  2EKH A;  2D8J A;  1AWO A;  3PE0 A;  1GBQ A;  2QYJ A;  2EYX A;  2LZ6 B;  5ENS D;  2XMF A;  1WXB A;  2FPE A;  1DCQ A;  2FG0 A;  4AG2 C;  1SSH A;  2D1X A;  5FWB A;  4OMO A;  1E6G A;  1FYN A;  2DL5 A;  2K9G A;  4LSZ E;  1UG1 A;  2LP5 A;  2ECZ A;  1U06 A;  3V31 A;  1SW6 A;  2JM8 A;  2VWF A;  3IXE A;  2YSQ A;  1A0N B;  1M3B A;  2ROL A;  2ABL A;  3PVQ A;  1E7O A;  1ARK A;  3AAA C;  2Y0B G;  1CSK A;  1AWX A;  2PNI A;  2KRO A;  2A37 A;  2FRY A;  4IIM A;  3RNJ A;  2GGR A;  3J5P A;  3VS0 A;  4U95 D;  1GRI A;  3EG2 A;  4G8L A;  4OMN A;  5HRY A;  2KYB A;  3EG3 A;  3M0S A;  3VS6 A;  4HNA D;  1MX2 A;  2V4H C;  2DBK A;  1QKX A;  4AG1 C;  1BLX B;  2XZD G;  1JU5 C;  3I5R A;  1NLO C;  5ITZ F;  2HSP A;  4QQI A;  4HB5 A;  1HSQ A;  4HLL A;  2DZO A;  1W6X A;  4J9G A;  5FIN A;  2GTO A;  2YUQ A;  1BD8 A;  1SHF A;  3ZU7 B;  1Z9Z A;  1AZE A;  1WA7 A;  2CT3 A;  4K5B A;  5I11 A;  1NM7 A;  4HBD A;  1IHB A;  2CRE A;  3M0Q A;  2KYM A;  3M0R A;  4E6R A;  2IIM A;  4LN2 A;  2O88 A;  5HCK A;  1BU1 A;  3H0I A;  4D8D A;  2ROT A;  4F17 A;  2AKK A;  1X6B A;  1H8K A;  4Y92 A;  2DRM A;  5BXO A;  2A28 A; 
#chains in the Genus database with same CATH topology
 2DTO A;  4ATZ D;  1WQ7 A;  4EZL A;  2GRQ B;  2QG9 B;  2FPF A;  2LX9 A;  3CVN A;  4TV3 A;  3SBT B;  2MK5 A;  2VGX B;  1HH8 A;  3I5S A;  3C0C A;  4FYV B;  1QCN A;  1LD7 A;  1Y8M A;  1ZUY A;  5EYP F;  3QII A;  1YJW Q;  3G6E T;  2G3R A;  1U8R A;  3T8K A;  3CC7 A;  1WHM A;  4KXK B;  5L23 A;  2X4W A;  3JCM X;  3JXJ A;  4ATG A;  3HHT B;  5FU6 B;  4B0Z A;  1MHN A;  2XG8 D;  2KXP C;  3CCS T;  2Y90 A;  3EH1 A;  3F6Q A;  1JXM A;  1TXQ A;  1I4K 1;  2A08 A;  2FF4 A;  2R03 A;  2L0A A;  1G8X A;  2WXQ A;  4YND A;  4FM4 B;  1RAF B;  3M53 A;  2ZGW A;  3NTH A;  4G8K A;  4MDW A;  2C0O A;  3VKI A;  1NG2 A;  2RPN A;  3I56 A;  1N8R R;  2X9H A;  2WM9 A;  2KCK A;  2CS7 A;  2XHE A;  3NZU A;  4KGX B;  3QZ5 B;  1N94 A;  3FU6 A;  1S1N A;  4BET A;  3HTR A;  1VQL Q;  3DSV A;  3PZ3 A;  2FO1 E;  4A3V A;  3QDN A;  4GPM A;  5GMK h;  4BFR A;  3ASK A;  5LCW J;  2MPX C;  2JJ9 A;  2WSE E;  2LNH B;  5LJ5 d;  3CC7 T;  2HCK A;  5CKB A;  1RAH B;  3SFM A;  2PM7 A;  4HOS A;  3HXC A;  5DM7 R;  2XDB A;  3GOX A;  4GLM A;  4GZD A;  3MCA B;  3AU4 A;  1T3S A;  1YMP A;  3UQ3 A;  3W9F A;  2V8S E;  4J9B A;  1H3H A;  3K9I A;  2JTM A;  1IZ6 A;  2EIM E;  1MMN A;  5CKE A;  2WPV A;  3QPH A;  3SFX A;  3OW2 P;  4RMO A;  2JEK A;  1Y96 A;  1R77 A;  1R0C B;  4I1O B;  3PNT B;  4ZTF A;  3FUI A;  1O75 A;  1ZHI A;  2RF0 A;  3JB9 G;  3CCU A;  2DLP A;  4J9F A;  4BY6 C;  3TXM A;  4DEY A;  3Q1J A;  1NZN A;  5EYL A;  1WHG A;  1Q95 G;  4H7X A;  3RRU A;  1YBY A;  5IH2 A;  3MHX A;  2FO7 A;  2QXF A;  3ASH A;  2MYS A;  3L2V A;  3HP9 A;  5CVI A;  3D9I A;  1X5B A;  3CST A;  2YXY A;  4XTV A;  1UGP B;  3CCR Q;  2HL5 C;  3B7U X;  1Y6I A;  4Q5W A;  4JD2 G;  4B9W A;  1KIK A;  4A4H A;  1NYF A;  1Q81 U;  2L6B A;  5D66 A;  5M72 A;  4U8H A;  4QW2 A;  2KNB B;  4HI9 A;  3DSX A;  1TN8 A;  2BUG A;  4KUD K;  5CBO A;  5GAN d;  4IUQ A;  2WXK A;  5FZQ A;  1PG5 B;  5GAN 5;  4J9C A;  2EBP A;  3QKY A;  2K3B A;  4E7K A;  2RH2 A;  4JC8 A;  3HRS A;  2QC9 A;  1ZB1 A;  3SB2 A;  1MGQ A;  3UA6 A;  2VJ8 A;  4RVB A;  4EDU A;  1GW6 A;  1BK2 A;  3V7R A;  4EPC A;  1KZO A;  1VQ4 A;  2JTE A;  2H6I A;  2YHC A;  3RJV A;  4HCZ A;  1SPK A;  2RHY A;  4OMM A;  1Z3Y A;  2V0P A;  5FRN A;  4PLL A;  4K11 A;  4KBM B;  2CHX A;  4XKB A;  1YCY A;  1BBZ A;  3PS6 A;  5KYY B;  4Z68 A;  1FT1 A;  1Z9Q A;  2YIN A;  1H64 1;  1AWW A;  2DYR E;  4YDE A;  2O4X A;  4KVO A;  1M3C A;  1PD0 A;  2X6K A;  1KJW A;  4UWG A;  2J06 A;  4F14 A;  3B7S A;  1TSF A;  1OYX A;  5FW9 A;  4J8Y A;  1YJ9 A;  4OMQ A;  3SD4 A;  3KUF A;  4PL6 A;  2NYS A;  1BPO A;  3PEV B;  3V7S A;  2AK5 A;  1S72 A;  3S7F A;  1PCX A;  2DBM A;  4JLG A;  1ZUK A;  4L59 A;  3CME A;  3TWQ A;  3SBS A;  4XKC A;  3OSS C;  4DEX A;  3FH5 A;  2AW6 A;  4ANX A;  1UFF A;  4ZTJ A;  3PTA A;  4ZGD B;  2JT4 A;  2J4B A;  2HQH A;  4J6Y A;  4PK4 A;  3MA5 A;  1M2V A;  1MUZ A;  5G55 A;  4HOU A;  4N4G A;  3VYH B;  3U66 A;  5GAO q;  4M7A G;  4DPR A;  2RG8 A;  3AG1 E;  2E2E A;  3FJ5 A;  2WQ6 A;  2EGC A;  3D9K A;  4FAD A;  1X81 A;  2F2X A;  4HVU A;  2EQM A;  2C0M A;  2KI7 A;  2RB6 A;  4TVR A;  2KXD A;  3OXL A;  4PFZ A;  2YNQ A;  2WAC A;  4J9E A;  2EKO A;  3FIF A;  5HKC A;  2DBA A;  1KQS P;  1ELR A;  4M75 E;  1H6O A;  2CH4 A;  2NYJ A;  1TUD A;  1X6G A;  5GAM g;  3U64 A;  2CGH A;  2LO6 A;  1GFC A;  2DXU A;  5CQY A;  3UAT A;  4EZJ A;  4QFV A;  2CFU A;  4HT9 A;  3HXE A;  2I1J A;  4M7D B;  4UWH A;  1B07 A;  3FY4 A;  3QO3 A;  1YJ9 T;  2FBN A;  1M4Z A;  3OYC A;  2IFU A;  4PJO C;  4XTX A;  5KNH D;  3OYJ A;  2XEE A;  4ANW A;  3CHR A;  3RMQ A;  1KQS A;  3EGU A;  3FH8 A;  4UQZ A;  1X43 A;  3T5X A;  4MZT A;  5GAN 4;  2JUF A;  2X6F A;  4HVV A;  8ATC B;  1OEB A;  4JJD A;  3P8H A;  4APF A;  3OYE A;  2OND A;  1UN8 A;  3P8D A;  2M51 A;  3C72 A;  1E7U A;  2WXJ A;  2ZPH B;  1R8O B;  1HK9 A;  3NB2 A;  4P5N A;  5IXB A;  1K1B A;  3EH2 A;  1FPP A;  5CEA A;  2K57 A;  2ENM A;  3D9L A;  3UXG A;  3E1S A;  2DIW A;  4X9D A;  4DX7 D;  3CEQ A;  1HE8 A;  3CMA A;  5D7U A;  1WJS A;  1WQW A;  3JB9 J;  2RQV A;  4FIB A;  2V5F A;  1INZ A;  4PS8 A;  2H6H A;  2WQH A;  3JXI A;  2ETA A;  3O5Z A;  3FTY A;  4OB1 B;  2CG3 A;  4ATO A;  2FZK B;  3PRE A;  2BE7 D;  5EIB E;  1RUW A;  3C12 A;  4MZP A;  3G71 A;  1OI1 A;  3D9P A;  1Y07 A;  7AT1 B;  1QCO A;  3KBG A;  2XRY A;  2VGM A;  4A3T A;  1N11 A;  2PVG B;  2EGA A;  3URG A;  1VQO Q;  4RG6 A;  1N9R A;  1W3B A;  1VQ7 A;  2K6D A;  3O8V A;  5AEN A;  4R55 A;  4ELY C;  4FW2 A;  4C92 B;  2PQR A;  1RAD B;  3ULQ A;  2P9I G;  2LCS A;  2D9T A;  3Q47 B;  3UM0 A;  2YLB A;  4DJA A;  2M9U A;  1I5L A;  5D6Y A;  4CC3 A;  4C0E A;  1GFD A;  4C8Q A;  3VUB A;  2FB7 A;  1I07 A;  1BI8 B;  1NJI C;  3LJ3 A;  1VQ9 Q;  2NUZ A;  4XX5 A;  2FEI A;  3E30 A;  4Z88 A;  4DA4 A;  1Q86 C;  4RCB A;  3EU9 A;  2W10 A;  1YJW T;  4JPS A;  3H8Z A;  1M8M A;  3QUI A;  2L3S A;  3EGX B;  1VQL T;  4A1G A;  3RK6 A;  2HKQ B;  3E9G A;  6AT1 B;  1JJ2 A;  3LGF A;  1ZA2 B;  1ZBJ A;  1SF9 A;  1D8E A;  4L2Y A;  1L5J A;  3R9A B;  1WLP B;  4RTX A;  4C8Q E;  1UW4 B;  3CVX A;  4BI4 A;  3Q7F A;  3KAE A;  2MWO A;  4EMK C;  1OWP A;  2LX7 A;  5CAI A;  4FSX A;  4NL2 A;  4ACK A;  4APO A;  3S6W A;  4HVB A;  2FHD A;  2QTX A;  4RG2 A;  4J7F A;  1QQJ A;  1WM5 A;  1NI1 A;  1NPR A;  2DCP A;  3JUI A;  1G83 A;  4JJC A;  3FU0 A;  3VJP A;  2C0L A;  5FRO A;  3JCM P;  2CZ1 B;  2DVJ A;  4J83 A;  2P9N G;  2RFA A;  3S2A A;  2OOE A;  2P0Q A;  3A8O B;  2RK2 A;  4GTO A;  3OYI A;  1KC8 R;  5LJ5 j;  3T9K A;  2AHJ B;  1K73 C;  5GAM j;  2KAT A;  4J9D A;  3EU5 A;  3KFV A;  2XGS A;  4XQ3 A;  4C8Q D;  1H92 A;  4A63 B;  5GAN h;  3UPU A;  3CCS A;  3OYM A;  1YIJ Q;  3S7J A;  1XNI A;  2DA9 A;  1QVF S;  3JCM W;  3BE3 A;  3IV0 A;  3MX3 A;  3E19 A;  2CP2 A;  5KYY A;  1B3Q A;  3HFO A;  4WNF A;  5KE2 A;  5JJT A;  3QWP A;  2RJF A;  4BT9 A;  2FZG B;  2KRM A;  4KUL A;  1EX4 A;  5CHE E;  3TVT A;  4BER A;  2HKN A;  2CHZ A;  4GBQ A;  4AFQ C;  5DLO A;  2P9L G;  2QYZ A;  5GAM e;  3L2Z A;  1KFZ A;  3CCQ Q;  2OAU A;  4BWR A;  4TUU A;  2CUB A;  4E7H A;  3WXX A;  2DL7 A;  4JDS A;  3PT9 A;  4OGC A;  1BIB A;  1PKS A;  1WXT A;  4L5G A;  4O6J A;  3D7S B;  3H0F A;  2ZGG A;  3E34 A;  4HQD A;  4DOV A;  2RD0 A;  5KJL A;  3W9G A;  3M55 A;  3B95 A;  3FU3 A;  3S3N A;  4YVO A;  2VGE A;  2LQ8 A;  4EMK B;  2LXL A;  3VLF A;  3ZYM A;  4Y91 A;  1BI7 B;  2AZS A;  2B8A A;  3FUJ A;  3OBY A;  1O5M A;  3A8M B;  4J6X A;  4LG6 A;  4OP0 A;  4UWF A;  1K4U S;  3SWN C;  3JSC A;  4I2W A;  3NQP A;  1OWL A;  1GBQ A;  1RL2 A;  2EYX A;  4C5E A;  1KC8 U;  4FU3 A;  1G3S A;  2FPE A;  1DCQ A;  1JWF A;  5D0O D;  5C1D A;  1W2B S;  2CP5 A;  5CRV A;  3MEA A;  3JCM V;  3O48 A;  3CCU Q;  3ZYL A;  1MMG A;  4M7C A;  4HOT A;  3V31 A;  1G3T A;  4OYS A;  5D6W A;  2EFI A;  2OCC E;  3FP3 A;  4UI9 K;  4ZGE B;  5EX0 A;  2ABL A;  3QYG B;  4OB3 B;  3CCL A;  1ARK A;  2X6H A;  5C6S A;  2XGO A;  2EQU A;  5JHB A;  1CSK A;  1OX8 A;  2PNI A;  2KRO A;  2HYZ A;  4IIM A;  3RNJ A;  3MO8 A;  3QK0 A;  5GAO m;  3J5P A;  4U95 D;  3EG2 A;  3BEE A;  3G1J A;  4CCA A;  1TJC A;  2X35 A;  3P2B A;  3EG3 A;  3VS6 A;  3SFY A;  3CCR A;  1UG3 A;  2R05 A;  1GXI E;  2V4H C;  2DBK A;  1QKX A;  4N2Q A;  4J5Y A;  4XTW A;  2X38 A;  1BLX B;  4LDX A;  1N52 A;  5FZR A;  3RSE G;  2R57 A;  4PUC A;  2XS8 A;  5AJL A;  1OCR E;  2HNI A;  5LJ3 h;  5D2M C;  3SD5 A;  1HSQ A;  4KZ0 A;  2DZO A;  1W6X A;  3CC4 T;  1VDY A;  3PNL B;  2ZAE A;  5AYF A;  2CT3 A;  2VC8 A;  2CRE A;  2KQW A;  4NL3 A;  3RES A;  3JCK C;  2O88 A;  4XU2 A;  3CLJ A;  1BU1 A;  3H0I A;  4M75 D;  2DAQ A;  4F17 A;  4IRU A;  2MHK A;  1H8K A;  5T4Y A;  2WXH A;  3KXT A;  1RZ4 A;  1XQH A;  3X25 B;  4F7U B;  3L9T A;  2IU1 A;  2QQB A;  4RTV A;  1ELK A;  4RTZ A;  3PFS A;  3SO8 A;  4FL6 A;  1HJD A;  2F0Y A;  4B89 A;  3HSB A;  3CQG B;  1UGQ B;  4OVU A;  4RTY A;  3G2S A;  4BI8 B;  2CG2 A;  1B34 A;  1NBE B;  3JV3 A;  5BPP A;  4CGW A;  2ZPE B;  1C6V X;  3EG9 A;  1QVP A;  4J8F A;  4X9C A;  2EQX A;  2XD0 A;  5HK3 A;  4A4G A;  4DUI A;  1YIT Q;  2DVE A;  2XEV A;  2CSQ A;  2I2L A;  4BX8 A;  3FEY A;  1YJ9 Q;  4JZY A;  3V30 A;  3UT4 A;  1UDL A;  3JB9 D;  4C92 D;  4M78 A;  2OTL T;  4CI0 C;  2KZT A;  1K1A A;  5C2Y A;  4PKC C;  2HR2 A;  1ZU2 A;  8AT1 B;  5AQ7 A;  3X24 B;  4L7T A;  1S72 Q;  1D0Z A;  4N4H A;  2A4Z A;  3SFZ A;  2KRN A;  1IHV A;  3HVE A;  1N8R C;  3N71 A;  4LE9 A;  2BKD N;  1ZBX A;  3UKR G;  1LF8 A;  3GZ2 A;  2VAS A;  3D9H A;  3QWV A;  3DSS A;  4Y6C A;  1HD3 A;  4F7U G;  2VKN A;  2DTI A;  4IIO A;  5LJ3 j;  2DIL A;  3CHS A;  4V3I A;  3WVD B;  2YT6 A;  5FJY A;  4C92 G;  1VQ4 Q;  1WI7 A;  2AKL A;  1ACM B;  3FLG A;  3PE3 A;  1OZ3 A;  1LVK A;  4X1V A;  4C0D B;  2BKK B;  3X2Q E;  3CGH A;  3EGD B;  2VYT A;  3WXM B;  2UWJ G;  4YDO A;  4M78 E;  2M02 A;  1PKT A;  1UGR B;  1OT8 A;  3QKJ A;  3REB B;  4ZNX A;  3SQV A;  3HRT A;  1YJN A;  3CCE T;  2AIR B;  2KK4 A;  5KJM A;  3CC2 T;  3E37 A;  2VSX E;  1KHC A;  4BEP A;  1X69 A;  3KD7 A;  3TCJ A;  4K0R A;  3OS1 A;  4NIK A;  4LCT A;  4BTA A;  4TXP A;  4C0M A;  5LFA A;  2VGY A;  2BZ8 A;  4TXQ A;  1JCS A;  1MZC A;  2YUP A;  2KY9 A;  3EDT B;  2XDD A;  3GBQ A;  5JMN D;  5KYW B;  5GAN f;  4NOY A;  2XCC A;  5LCW C;  4UWL A;  1KK7 A;  3UF4 A;  5M9O A;  1E6H A;  2MOX A;  3CME Q;  3UIP C;  1EDU A;  3QWW A;  4GTP A;  2RJD A;  3T5V A;  1I8F A;  5EX3 A;  4JW1 A;  4PJJ A;  3WVE B;  2PZI A;  1AD5 A;  2E5Q A;  2KSS A;  1P92 A;  5CED B;  4B8C B;  4FU6 A;  2R5A A;  2FI7 A;  4RCC A;  2LSV A;  1IYG A;  4GCO A;  1MX4 A;  2NUP A;  1VQP A;  3LY9 A;  2DE0 X;  1N0Q A;  3EHQ A;  3CMA T;  4XK8 E;  2PVO B;  5IY5 E;  1YYH A;  2OX7 A;  2GRO B;  2R2L A;  4XU1 A;  4C92 F;  1YIT T;  4M77 D;  3TAX A;  1T3L A;  2QTV A;  1QVG A;  1N27 A;  1G3W A;  5HI7 A;  1YHQ T;  1WIE A;  4HLE A;  2LJ3 A;  4OAV B;  5ENR D;  2CUD A;  2DF6 A;  4FYY B;  2F69 A;  3G4S A;  5FIO A;  3CPW S;  2KR3 A;  5KYX B;  2QEX Q;  3G71 T;  5AAR A;  2PNN A;  1V1C A;  2QAS A;  4M75 F;  2DIQ A;  3ZUV B;  3OYF A;  2KGT A;  4DBF A;  2Y4U A;  4HOQ A;  1KQ2 A;  3ZL7 C;  4DX2 A;  4DX5 D;  3ASO E;  1YNZ A;  2VVK A;  3R6O A;  2GRP B;  1VIE A;  1A17 A;  2FPD A;  2LQK A;  1VQO T;  3LVR E;  2M63 A;  3LXU X;  1F1B B;  2X3W D;  3EG0 A;  3I4G A;  1MV3 A;  4BY6 B;  3CHP A;  5EDS A;  2WMN A;  1YCS B;  3KS2 A;  4J0U A;  4BB7 A;  4AM9 A;  4EEC A;  1W2B A;  1G3N B;  2KT1 A;  3FTU A;  4XAX B;  3NMZ C;  1G2B A;  2NWM A;  3MKD A;  1YP5 A;  3DKM A;  1YA0 A;  5C0M A;  2DO3 A;  1K8A C;  1E90 A;  3TWU A;  2BF0 X;  2OAW A;  1H3Z A;  3DXK G;  1N9S A;  3EIJ A;  1XOV A;  1QW1 A;  3OSV A;  1K8A R;  1IXV A;  3FRN A;  2HQX A;  2Q7F A;  4RLY A;  4DI3 A;  3NBN B;  4GMR A;  4HRN A;  3TXN A;  5L8R E;  3M0T A;  4AP2 A;  4FUL A;  2WSC E;  2EYY A;  2NLU A;  2GQV A;  2K2V A;  4GTQ A;  4J6I A;  2WXF A;  5I22 A;  4AFS C;  2PZ1 A;  2HQE A;  2Y4Y A;  5AAO A;  3B7R L;  1E8Z A;  5KCM A;  4MS6 A;  2OVB A;  3EG1 A;  2EIK E;  3VS1 A;  3Q75 A;  4KBQ A;  1M1F A;  2MWP A;  2KM4 A;  3QAQ A;  2DNU A;  1HO8 A;  1K0X A;  4M77 C;  1W2B P;  4C0Z A;  2NSZ A;  4M75 G;  3LX7 A;  2VUB A;  3PMI A;  1HU3 A;  3HIZ A;  2FO0 A;  2J4D A;  4N5C A;  2QDL A;  2GTJ A;  4XU3 A;  4KH0 B;  3CHO A;  2SRC A;  4LDW A;  3JCM Q;  1HS6 A;  1UOH A;  4PJO D;  3CVU A;  4J8O A;  1VYV A;  4F1S A;  2X6J A;  1NZ9 A;  2OEW A;  5GAM f;  4IYP A;  3ML8 A;  2CFZ A;  4ANJ A;  3TWW A;  3CCV A;  2DRK A;  5J3B A;  4BD3 A;  4CT0 A;  2CZ7 B;  3JUE A;  4FJZ A;  1B34 B;  1SRM A;  1V55 E;  2C0I A;  5KCO A;  4N4I A;  3EG9 B;  3CCQ T;  1OZ2 A;  3ZEH A;  3I35 A;  2X3M A;  3ZXS A;  1MHQ A;  3OW2 A;  4U0S A;  5B1A E;  2K2M A;  5BV1 A;  2QGF B;  2M1H A;  4LNP A;  1K1Z A;  1RAB B;  2KE9 A;  1ZX6 A;  5FU7 B;  1PSF A;  4JEH A;  2MCN A;  2OI3 A;  2GF7 A;  3G2W A;  3M0P A;  3SWN A;  4IUV A;  5T3R A;  2XU8 A;  2RQT A;  5IXF A;  4F1P A;  3JQ1 A;  3LDZ A;  3S3O A;  4DBQ A;  3CD6 Q;  1QP3 A;  3VS4 A;  4PJN A;  5CR2 A;  1M1G A;  3RKY A;  1G5V A;  2V1R A;  2Y4T A;  3G2T A;  2ATC B;  3PGG A;  3G2U A;  4ESR A;  4IUR A;  4HXJ A;  2V26 A;  4WNG A;  3DLM A;  4LDY A;  1UJJ A;  2L0I A;  2L3P A;  4KH1 B;  1AVZ C;  4JHJ A;  2VB6 A;  4GY5 A;  4XU0 A;  3QJZ A;  1QWF A;  3QG1 A;  3RKX A;  5EIL A;  5AQA A;  1VQL A;  1LD8 A;  2P9P G;  3SI5 A;  4HA8 A;  3ONL A;  3L08 A;  4LUN U;  3ULY A;  1IHW A;  3JYS A;  4B6M A;  1YFN A;  2ED1 A;  2V8I A;  3ZKJ A;  3ESK A;  1BU9 A;  2LCC A;  4M78 C;  3QJ6 A;  2WXR A;  2DMO A;  2XIC A;  4U7E B;  3S3M A;  1RAI B;  1BYM A;  3MV2 B;  4A53 A;  1D3B A;  5LJ5 f;  1Z5S C;  1B89 A;  3UMV A;  4YVQ C;  2AXZ A;  4F3V A;  3CCL Q;  5A23 A;  2PUO B;  1PC0 A;  3LY8 A;  5GAO n;  2CZ6 B;  3C94 A;  1I1J A;  1M8V A;  3VRY A;  3G4S T;  2E70 A;  4E7I A;  1N9A A;  2V5Q C;  3C5R A;  3MKR A;  3CBO A;  4GZC A;  4U07 A;  4HXI A;  2NC9 A;  4ABN A;  1WX6 A;  2K5I A;  2KXC A;  2BKG A;  4U0Z A;  4LER A;  3VV0 A;  4JJB A;  3RDV A;  3LH0 A;  4RTU A;  4LRZ A;  2K3Y A;  4OGE A;  3L1A A;  4HCK A;  1IRX A;  2JS2 A;  1Y57 A;  3OB9 A;  3TWR A;  3QJY A;  2C0T A;  3NOG D;  1XTD A;  2DD5 A;  5BV0 A;  3TL5 A;  2ED0 A;  2NUP B;  3M0U A;  2IPO B;  5DIZ A;  4J9H A;  2YRC A;  4Q96 A;  2L3Q A;  1P5Q A;  2WXN A;  4B8A A;  2VV5 A;  3ZGQ A;  1Q82 C;  3MET A;  1KD1 U;  2GW1 A;  1D1C A;  2R5M A;  5CKF A;  2IJG X;  2ZIS A;  2COZ A;  1U2V G;  3CHM A;  4ANV A;  3JCM g;  4TUM A;  3RRN B;  1BIA A;  4PJO G;  3DEO A;  4X8Q A;  5E76 A;  1QYM A;  4BDY A;  3PEU B;  3C4S A;  1IRE B;  3VLD A;  2UY1 A;  1AHJ B;  3PIP A;  1JO8 A;  3EFO B;  3OYB A;  3FFL A;  4KMO A;  4BSZ B;  3LEW A;  4E7J A;  2D8H A;  4K5A B;  2VXE A;  3IQL A;  4JA9 A;  1OU9 A;  1K3Z D;  3CHQ A;  3CVP A;  4LUE A;  3FTX A;  2K4Y A;  2XID A;  5KNG A;  3JCM c;  1JEG A;  3TJP A;  1D3B B;  4GLK A;  1ABO A;  4XI9 A;  2AVP A;  4DRX E;  1UHC A;  2B0O E;  4ZHB A;  1M2V B;  1AP7 A;  3UI2 A;  2LT1 A;  3FH7 A;  1RAE B;  2PTK A;  2QAZ A;  3VTY A;  4KRT A;  4C0D C;  3R7R A;  3MEV A;  4PS3 A;  2DL4 A;  4RKU E;  5EID A;  1X2K A;  1WGS A;  4TXR A;  3G6E Q;  3FUH A;  2L2P A;  5GAN 8;  3MCX A;  3KEA A;  4JZ3 A;  3C3O A;  3BDU A;  1PWT A;  5FQ7 A;  5KJK A;  4JS4 A;  3OXG A;  1JRI A;  4LEU A;  2B86 A;  4XE0 A;  2ION A;  1CKA A;  3RO2 A;  2CDT A;  3ABK E;  4I6J A;  4GB9 A;  3ZHE B;  2RMO A;  3V8K A;  2YHT A;  3LWI A;  2EGE A;  4M7D F;  2IF4 A;  1WHH A;  3GF5 A;  4CC4 B;  4J8S A;  3A5Z B;  5GAO l;  4M7A F;  1K8K G;  1Y71 A;  3PDN A;  4A54 A;  2LQN A;  5IHN A;  3ZPJ A;  5H7P A;  5JJ7 A;  1BB9 A;  1VQM A;  4MRU A;  2HDA A;  3ULR B;  1QZ2 A;  1VQ5 Q;  2XQ0 A;  2GNC A;  2EKH A;  2D8J A;  1YJN Q;  1AWO A;  3PE0 A;  2QYJ A;  4HS2 A;  2LZ6 B;  3PIO A;  3VU3 C;  2FG0 A;  4M3O A;  2EIJ E;  1Q86 R;  4AG2 C;  1JWG A;  2XRZ A;  1E6G A;  2MRI A;  2DL5 A;  5GAN 6;  1YIT A;  1H2U A;  1D09 B;  2WXP A;  3X26 B;  3LKU A;  4IUP A;  1N6A A;  2KDS A;  4G25 A;  4ACL A;  2JM8 A;  2DZ9 A;  3CCL T;  5DLQ E;  1M1K C;  3FC3 A;  3CCJ Q;  4BSX A;  2CKK A;  1Y7X A;  4ZN3 A;  2DXC A;  1A0N B;  4I43 A;  1M3B A;  2ROL A;  3BW1 A;  3PVQ A;  5E75 A;  2GRR B;  3SGH A;  4E7L A;  1FVF A;  3CCM Q;  4NRH B;  3GNG A;  4LD9 K;  2A37 A;  3IEG A;  4GTS A;  3VS0 A;  2IEJ A;  3FUN A;  1GRI A;  4G8L A;  5HRY A;  2KYB A;  4E7S A;  3URZ A;  2OTL A;  1VQ6 T;  2MAM A;  4E2F B;  1WHL A;  2O4X B;  4CRW A;  4JLI A;  2J07 A;  1NLO C;  5FT9 A;  3QDR B;  4QQI A;  2AXU A;  4HB5 A;  1I81 A;  2PVD B;  4AVX A;  2GTO A;  1KC8 C;  1BD8 A;  3ULE G;  2XHC A;  2E6N A;  3AT1 B;  1AZE A;  1WA7 A;  2LRQ A;  1VQ8 A;  1VIF A;  1FWZ A;  2DD4 A;  4WWO A;  3ZHE A;  2KYM A;  3QB2 A;  2IO2 C;  2IIM A;  3UWN A;  4E6R A;  5HCK A;  4IUU A;  3CVV A;  3ME9 A;  2ROT A;  4AV7 A;  1TEZ A;  1X6B A;  2PUK B;  5FTP A;  2DRM A;  3WG7 E;  2A28 A;  2VGN A;  3JQ0 A;  4E7Z A;  4GU5 A;  3U4T A;  3I55 Q;  3LWH A;  2A5U A;  4Z89 A;  1WDY A;  2V8J A;  2LUH A;  2A7Y A;  2C2L A;  4RSY A;  5J08 A;  2YWW A;  2EWN A;  4EIK A;  1V76 A;  3TSW A;  1QVG S;  4M7A D;  5KYW A;  4M7D E;  1IB8 A;  1UJY A;  2CSI A;  4GCN A;  1JJ2 S;  4N3C A;  3OMG A;  3TWX A;  5AN8 A;  3FDH A;  3LS8 A;  2MF2 A;  2IG0 A;  1JUQ A;  2FEZ A;  2J8S D;  3SNX A;  2RI5 A;  3OXF A;  4OVA A;  4C92 A;  3TEE A;  2F2V A;  2AT1 B;  4FSS A;  1VQ7 Q;  1MX6 A;  3QSU A;  2D0Q B;  3AS4 A;  5FWC A;  1NJI U;  3BG1 B;  2CHW A;  1XJW B;  3DB3 A;  3N5B B;  1VQK A;  5ENO D;  1XNF A;  2BTT A;  1VQP Q;  1J3T A;  1FXX A;  4I9C A;  2GRN B;  2J6O A;  3TRE A;  4MBG A;  1YI2 T;  1VQK T;  4UC4 A;  4OMF B;  2P4T A;  2RKK A;  2EIL E;  2QY7 A;  3Q15 A;  2K79 A;  1VQ9 A;  4FC8 A;  1YWO A;  5I21 A;  2DVW A;  2XK0 A;  5CIU A;  1N95 A;  4UQY A;  1RLP C;  1TH7 A;  2SEM A;  2E4H A;  4C48 B;  3BFM A;  3VS3 A;  3PE4 A;  2QEX A;  1N4R A;  5J90 A;  2XDP A;  2VQ2 A;  4M78 G;  1LPL A;  4U96 D;  1W4S A;  2DYB A;  2P0K A;  2LNI A;  4FCY A;  4LNU D;  1TNZ A;  1UUE A;  3FDR A;  2JW4 A;  4MML A;  5IT9 E;  1U5S A;  1AEY A;  2HBW A;  4BUG A;  2XEN A;  1QLY A;  2QQ9 A;  3ZEF A;  5GAM d;  3TWS A;  2JM9 A;  2OTJ T;  3B7B A;  4PFO A;  1QMC A;  2J9Q A;  4M7D G;  2DET A;  1M2O A;  1IO6 A;  2DKG A;  3DRA A;  1V54 E;  4AY5 A;  4M7D D;  1OWN A;  1IGU A;  2A0F B;  4M7A E;  2J49 A;  3CK9 A;  2DYI A;  2P0P A;  4F7U E;  3HXB A;  4WUY A;  4OML A;  1MMA A;  1U3O A;  3CCV Q;  1VUB A;  3SZ7 A;  4Q69 A;  4JEU A;  1FMK A;  3R6N A;  3JCM h;  4GZ3 A;  4OAU C;  2YUN A;  2RHX A;  4WCI A;  3ASF A;  1MQS A;  2AZV A;  3CVY A;  4C9B B;  1BI2 A;  1RI0 A;  2DL8 A;  4GTT A;  3QYH B;  1GCQ C;  3DB4 A;  1KPS B;  1Q2Z A;  1YIJ T;  2OTJ Q;  2ILR A;  2OJ2 A;  1WYX A;  4EBA A;  3EHN A;  4CC2 A;  4XI0 A;  1CKB A;  3J7A F;  3SEM A;  3OYK A;  3D3M A;  3F70 A;  2QEX T;  4K5C A;  2BED A;  2HE0 A;  3P8B B;  2NXP A;  5CEC B;  1KT0 A;  2GBQ A;  2DK3 A;  4BE1 A;  2DXT A;  4NAC A;  4CZ2 D;  3O4Z A;  5EC7 A;  3CD6 A;  1FCH A;  3G4S Q;  1C1A A;  2LT4 A;  3NFC A;  3SHF A;  5LJ3 e;  3CK7 A;  3L17 A;  5DBK A;  5ECA A;  3MP1 A;  2JLB A;  4J7W A;  2K5L A;  2V4L A;  3CCQ A;  3HHM A;  4N2S A;  2CP3 A;  4O1P A;  2GFA A;  1UHF A;  3PUK A;  2VSN A;  2P4R A;  4HRL A;  4QVD A;  3JCM J;  1D9S A;  1WAO 1;  1JQQ A;  3CD6 T;  1N4S A;  5FU7 C;  2E0I A;  4UQX A;  1O1T A;  1RAG B;  5KCH A;  4WTO B;  1NPP A;  3M56 A;  1ELW A;  3CBM A;  3T8M A;  1SZ9 A;  1AT1 B;  1DJ7 B;  4ORZ A;  3MJX A;  5AYW D;  1VA7 A;  2J08 A;  4NQ0 A;  4EHM A;  1QQE A;  2XEH A;  4LD6 A;  3DXM G;  1UEB A;  1OPL A;  1M90 C;  3Q78 A;  1SA4 A;  4JRI A;  3VLE A;  4PNO A;  1Q81 C;  1GBR A;  1N4P A;  1G3Y A;  4Y28 E;  5KYU A;  1RW2 A;  4M4Z A;  1ZSZ C;  1M5Q 1;  3NTK A;  1ZSZ A;  4FHJ A;  2LDM A;  2IOS A;  4N0A C;  4R7L A;  4F04 B;  4G1T A;  2KBX A;  4K03 A;  1WJQ A;  1K73 U;  3GPL A;  2MI6 A;  3CKC A;  4PJL A;  2BE9 B;  4F6R D;  1N54 A;  4QQG A;  2WMO A;  1ZA1 B;  3GZ1 A;  2EYQ A;  5D6X A;  2P9S G;  2COY A;  4DX6 D;  3D9M A;  5FU6 C;  5IAY A;  2ZXW E;  1SSF A;  1D0Y A;  2W0Z A;  3OS0 A;  4BE0 A;  5GAO r;  1A5E A;  4A1S A;  4GTR A;  4URK A;  4QQ6 A;  1AOJ A;  5GMK e;  3VS5 A;  2E1H A;  3JB9 H;  2I0N A;  2FL7 A;  3THK A;  1S0P A;  3QAR A;  3Q9U C;  1UN9 A;  3MV3 B;  3U23 A;  3UPV A;  3P1U A;  1VQN Q;  2BUD A;  3QWY A;  1I5O B;  2JMC A;  1QKW A;  1D0X A;  1O1S A;  3EFR A;  4QVC A;  2GRL A;  4L23 A;  4KVM A;  4AOF A;  1N4Q A;  1H6K A;  3E33 A;  1TNY A;  4LUD A;  3ASD A;  4AEZ C;  4C0G A;  1MNE A;  2ZU6 B;  4YTL A;  2R17 C;  3UTM A;  4E6H A;  4EMK A;  2YUO A;  4M78 B;  2COW A;  3B13 A;  4HVW A;  1TUC A;  1NA0 A;  2H3E B;  2GRM A;  1HXI A;  4M77 B;  4FHK A;  3UM2 A;  2F5K A;  2QA4 Q;  3Q5M A;  3FTW A;  1UGV A;  2BTD A;  2OEV A;  2O01 E;  3NTI A;  4FJY A;  1HG2 A;  3FWV A;  4XTU A;  1KQS S;  2X6I A;  2I1K A;  2HO1 A;  2O9S A;  5GAN g;  4PDX A;  4ME2 A;  3PRZ A;  1Q7Y C;  3PZD A;  4F7U F;  2EIF A;  1EPU A;  3G6E A;  2WQ7 A;  2HSE B;  2YDL A;  3KSQ A;  3M54 A;  4R0K A;  1C0M A;  1X27 A;  3H41 A;  1EIF A;  3JRZ A;  3RBB B;  5LJ3 d;  3FUM A;  4KT6 B;  4DOW A;  1V29 B;  1N8R U;  3Q49 B;  2XPY A;  3PVL A;  4MLP A;  3C98 A;  3AS8 A;  2QGG A;  3CPW P;  2VTB A;  1Z3X A;  2RI2 A;  4BTB A;  3C3R A;  2LAH A;  1Y96 B;  3Q73 A;  3EAE A;  4A4K A;  2DEU A;  4C5H A;  1VQN T;  2YRV A;  5FWQ A;  3OTN A;  1WY6 A;  2DZN A;  3AG2 E;  5GMK i;  1D8D A;  3CC7 Q;  4RTT A;  4R56 A;  2E12 A;  5CRU A;  1VQM Q;  2IY0 C;  1OX9 A;  3VTX A;  2FRW A;  1TG0 A;  4A55 A;  4ZFH A;  2UY1 B;  1OV3 A;  1AZG B;  3TWV A;  1OUL A;  5CK9 A;  2H6G A;  3J80 E;  3BY7 A;  3VYG A;  3MZL B;  3UDC A;  2LJ1 A;  3FEX A;  3MYV A;  1VYT A;  2M0O A;  3OYL A;  3CSF A;  2IVW A;  3ZXP A;  2K5F A;  4C8Q B;  3QDF A;  1QWE A;  3V2O A;  1HXD A;  5I2S A;  1HF8 A;  3FB9 A;  3CCJ A;  3HPW A;  1Q82 R;  1SG5 A;  4I2Z A;  4OB0 B;  4HCB A;  2DER A;  2R59 A;  1TR4 A;  4F7A A;  1PY1 A;  4N0A A;  2G6F X;  3CME T;  4KGV B;  3CCU T;  2DJQ A;  2KMT A;  2K3X A;  1DNP A;  5D0Q D;  2JTF A;  2KBT A;  2L89 A;  2RQU A;  3E4B A;  3GYZ A;  5DY9 A;  3DLL A;  3FHE A;  5KJN A;  3VRZ A;  4FW1 A;  1H0A A;  4U04 A;  4HI8 A;  1SRL A;  2FUL A;  5LJ5 e;  2VXF A;  3ZFJ A;  3I55 T;  5CCL A;  3CC2 Q;  3REA B;  3OA6 A;  1SKU B;  4MKT A;  3AG3 E;  2R02 A;  1H2V C;  5HS0 A;  2O9V A;  1GCP A;  3H6Z A;  1I0C A;  4C0F A;  2RQW A;  1M3A A;  3H9N A;  4E47 A;  1VQ8 Q;  5IHI A;  3CVQ A;  4DX1 A;  4C5I A;  1K9A A;  3D9J A;  1VQ5 A;  1IXD A;  3OY9 A;  3OS5 A;  2ZIR A;  4MZM A;  1NJI R;  4AY6 A;  1M30 A;  1QVF P;  4RG8 A;  1VQ4 T;  4AIF A;  2K7A A;  2RD1 A;  4N3B A;  2LMJ A;  3SY2 A;  2R5S A;  1ZSG A;  3T9N A;  2MIO A;  4D6W A;  2P9K G;  4D8K A;  2QQA A;  2ZPF B;  2CT4 A;  5JA4 D;  4GPK A;  3CC4 A;  1JCQ A;  2O31 A;  2WXM A;  3EJN A;  3EGD A;  3LCA A;  2PM6 A;  4GA0 A;  1HZ4 A;  1YN8 A;  2DM1 A;  2ZZD A;  3TU4 K;  4M78 D;  4NUR A;  5IHK A;  3UUX A;  1QVG P;  1X6O A;  1DC2 A;  3MJW A;  2RHU A;  5GJW B;  2KVQ G;  1TYQ G;  3LYI A;  3CCM A;  4I9E A;  2L6J A;  5GAN e;  3LJN A;  4B93 B;  3FU5 A;  1RI9 A;  1BI3 A;  4L6V 5;  2OTL Q;  1WJR A;  3NZS A;  1T0H A;  3SDZ A;  4PH4 B;  5LL6 S;  1K9M R;  1IQR A;  3UT7 A;  1TUG B;  4G23 A;  5GMK m;  1OY3 D;  4A4E A;  1MYO A;  4AMC A;  3GW4 A;  2XKO C;  2E3H A;  3ZFW A;  2LCL A;  5FLX E;  3DEP A;  3OYA A;  3HDX A;  3BG0 B;  1VQ5 T;  2XPI A;  4XEI G;  3VUZ A;  4A4F A;  2DYS E;  5LX8 A;  4ILH B;  2VSO E;  1UGS B;  1VOM A;  4RTW A;  4IN3 B;  1S72 T;  5CER B;  2ETB A;  1PD1 A;  3FUD A;  2R58 A;  3CCM T;  2I6H A;  1SA5 A;  2XZT G;  1WXU A;  4BE2 A;  1PM3 A;  3C95 A;  1OCZ E;  5AJD A;  3BUA A;  1ZQ1 A;  2L9B A;  1SQM A;  4KZC A;  5BXU A;  2P9U G;  1D1A A;  2L0T B;  2GQI A;  5HY6 A;  3I55 A;  4H7Y A;  4M7D A;  4JUV A;  2CP6 A;  2KEA A;  1TOV A;  2GCX A;  4M7A A;  1S70 B;  4JHR A;  1K9M C;  2LTO A;  2A5E A;  4E85 A;  1ABQ A;  1NEB A;  2H6F A;  4C92 E;  1HYO A;  1X01 A;  3ONK A;  1WXB A;  2HMA A;  5FQ6 A;  5CMW A;  1DVP A;  1WPY A;  2LNV A;  2D1X A;  4GA1 A;  2K9G A;  4G24 A;  1YJN T;  4GZ5 A;  4LSZ E;  4Y6W A;  2JNG A;  1YHQ A;  2PL2 A;  2DTH A;  1M1K R;  2DJZ A;  4Q94 A;  3M57 A;  1SW6 A;  4GA2 A;  2XGM A;  1VQK Q;  4ZN1 A;  2FZC B;  5JHA A;  4B94 A;  4I6E A;  4J7I A;  3CKB A;  4UI9 J;  1XGW A;  4C8Q F;  4I6G A;  3ZIM A;  3APC A;  5HQ8 A;  5A2Q E;  1VQP T;  2DEQ A;  2YRD A;  1E7O A;  3KEZ A;  1K9M U;  3Q4A B;  3AAA C;  2Y0B G;  4QKU A;  5CKD A;  1AWX A;  4JRQ A;  2X4Y A;  4M77 A;  2GGF A;  3UIN C;  1K8A U;  4OMN A;  2JVV A;  3CEY A;  2EAY A;  4HNA D;  1RAA B;  4L1B A;  4F53 A;  2XZD G;  3HFN A;  3NF1 A;  3E2U A;  2HSP A;  1EF1 C;  1WZO A;  3FUK A;  3MEK A;  1SHF A;  3ZU7 B;  4GAA A;  3M4G A;  3HXF A;  1YI2 Q;  3QZ9 B;  1M9S A;  1WHK A;  3M0R A;  1IHB A;  4GTV A;  3ZYK A;  3LLR A;  4LN2 A;  4BDZ A;  4QQD A;  4D8D A;  2FYK A;  1FT2 A;  3ENE A;  3RKV A;  2AKK A;  3ESL A;  3FJP A;  2P84 A;  4Y92 A;  3JCM f;  5BXO A;  3BU8 A;  1ZBP A;  2X4J A;  4F7U A;  1E8X A;  3MEU A;  4M77 E;  3J81 E;  3L2Q A;  2QQS A;  2RK1 A;  1VQ7 T;  1TN7 A;  4M75 A;  1NL4 A;  2BZY A;  2M0Y A;  1TTH B;  3RMS A;  1O1R A;  5A0D A;  2KT8 A;  4RG9 A;  5LJ5 g;  2VGX A;  3DPD A;  3HG0 D;  1B7T A;  1N5Z A;  1WDX A;  4J8E A;  3RIR A;  2D6F A;  3AS5 A;  4D10 C;  4JA7 A;  1IQU A;  1T0J A;  2LAI A;  5G05 J;  3GIB A;  3A1P A;  4M77 F;  3HYM B;  2PQN A;  2L5Q A;  3PNW C;  5GAN 2;  3NPF A;  1UEC A;  2EQK A;  4XTZ A;  2C06 A;  1LJO A;  5T8I A;  5A0L A;  4JZ4 A;  1E96 B;  3CCE Q;  3CMA Q;  1VQ6 A;  2CP7 A;  2IO3 C;  3RKW A;  1KD1 R;  3V2X A;  3L2U A;  4Z8A A;  3ZYQ A;  3CIA A;  2EQJ A;  2JMA A;  4DBR A;  4ILG A;  2HD0 A;  2KAF A;  4CT4 A;  4M77 G;  1KD1 C;  2AJA A;  3FTV A;  4EZK A;  3JB9 I;  3G71 Q;  1AWC B;  1QP2 A;  2LVM A;  3HVE B;  3CVW A;  1WFW A;  2I2O A;  5ENQ D;  3SHW A;  2IQC A;  4WND A;  2ETC A;  2ZGD A;  2DIG A;  3ML9 A;  2O2O A;  4U8V D;  5AQ9 A;  2GFU A;  1U3D A;  3L2R A;  2KCL A;  2J05 A;  4O60 A;  3QWX X;  3ZNG A;  2MOW A;  3Q79 A;  1SHG A;  3LVQ E;  3UIO C;  2VSY A;  3ABL E;  2A36 A;  2WXG A;  1VQN A;  4IKF A;  3FEO A;  1KG1 A;  4HCC A;  2PU9 B;  5ANL A;  3IHY A;  2HBP A;  3L82 A;  1JXO A;  2F37 A;  3CCJ T;  3OYY A;  1BCO A;  2HL3 A;  1U3C A;  3SF4 A;  2RNA A;  2EQI A;  1OOT A;  2YLC A;  4KYO B;  4GMJ A;  2QI2 A;  1UJK A;  3A8G B;  3TG5 A;  1TJF A;  4W9R A;  5ENT D;  3VS7 A;  5KYU B;  3QXE B;  3ZBD A;  2XCB A;  1YWP A;  2Y4X A;  4NS5 A;  4XTY A;  1Q81 R;  4II1 A;  1ZSZ B;  1ZUU A;  1NFI E;  1IKN D;  5AQB A;  3CBP A;  2F2W A;  2DX1 A;  4AXH A;  4JL0 A;  4ILI A;  2B6C A;  4P29 A;  3MEW A;  5LJ3 f;  2PQW A;  4AFU C;  2RN8 A;  2HEQ A;  4U8Y D;  2FVU A;  1KLX A;  1WG0 A;  3I3N A;  4RUG A;  3G2V A;  2D0N A;  2H8H A;  1UB4 A;  3I56 Q;  1PRL C;  1N0R A;  1IHG A;  2XI9 A;  3EUV A;  3QOU A;  4CYM D;  2X3X D;  3LW5 E;  3CV0 A;  2RM4 A;  4MMK A;  5A7D B;  3M5A A;  5AIJ A;  1SEM A;  1Q82 U;  3VS2 A;  3BQO A;  1E8W A;  3L13 A;  2A3L A;  5ARG A;  3PMT A;  1FVH A;  4FT4 A;  3I9Q A;  2YQ8 A;  4XZ4 A;  4OF1 A;  1D1B A;  9ATC B;  2L8D A;  3HL8 A;  4PJO A;  3RUX A;  2EIN E;  3EIQ C;  4ANU A;  1E7V A;  2RFM A;  3ASN E;  3M59 A;  3X20 B;  2J09 A;  2CH4 W;  4CGV A;  5GAM h;  1HFA A;  3UKU G;  1JB0 E;  2IOL A;  1OPK A;  3G7Z A;  5KE3 A;  3U9W A;  1YJW A;  4LNG A;  1HG5 A;  1FMV A;  2E64 A;  3CPF A;  3V8J A;  2QFC A;  1FMW A;  1X75 C;  1LCK A;  2M16 A;  4GYO A;  4EPZ A;  2WB2 A;  1VYU A;  1VQM T;  1WNL A;  1M1K U;  3CCV T;  1JBM A;  3UM3 A;  4FLH A;  2WXO A;  4EMH A;  4LDU A;  3OYG A;  2HM8 A;  3IBE A;  1NLP C;  3R7Q A;  3JCM d;  1DCE A;  3EFO A;  1PSE A;  2E5K A;  1NEG A;  5CO7 A;  2I9C A;  2V1Q A;  3L22 A;  4M78 F;  1MND A;  4F16 A;  4YDY A;  4TRQ A;  1QVF A;  2JAB A;  3OQ5 A;  4FT2 A;  4BAC A;  3LH5 A;  1K76 A;  3ER0 A;  4GTM A;  4U63 A;  5ENN A;  3UM1 A;  1JPL A;  3DSW A;  4JB8 P;  1BI1 A;  3CR3 A;  2E10 A;  3QHS A;  3CC2 A;  1TNB A;  3UX4 A;  4WWN A;  2LXM A;  2EW3 A;  3OAW A;  4DQ2 A;  3Q9N C;  4N5Q A;  2EJG A;  4I1M A;  4PS7 A;  4I17 A;  2P2C P;  4WNE A;  5CMY A;  1M27 C;  1TWB A;  4AT1 B;  2RHZ A;  2Y69 E;  3IKO B;  2E3I A;  3C3Q A;  5ENP D;  4C5G A;  1M90 U;  2QA4 T;  3L6A A;  3NAW A;  4KT0 E;  4CEM A;  2KC7 A;  1Q86 U;  2KRS A;  3AJI A;  4FYW B;  4OB2 B;  5BNW A;  4FYX B;  5KYN A;  1R0B G;  1E8Y A;  4CDN A;  1X2Q A;  1U1T A;  3V7C A;  5GAN 7;  3IHV A;  3MKQ A;  2KZT B;  3APF A;  2BIV A;  4M75 B;  4AFZ C;  4DI4 A;  4FP7 A;  1BKB A;  2ZPG B;  3D9N A;  3EHR A;  1FX7 A;  5J39 A;  1OWO A;  5G04 J;  2BZX A;  4UUC A;  3GNF B;  3AHU A;  3MP8 A;  4UI9 C;  4ME7 A;  4WWP A;  5CCA A;  4Z02 A;  2OV8 A;  5FZS A;  1QCF A;  5B1B E;  3TWT A;  2JXB A;  2LQW A;  4JJN K;  1PRM C;  3OYH A;  5LOZ A;  1JJ2 P;  3A8H B;  1SVX A;  1OCO E;  5CBN A;  1S63 A;  1GCQ A;  3NOC D;  3SWN B;  4O6F A;  1HX8 A;  3PZ4 A;  2EYW A;  3OYD A;  1UTI A;  3M4Y A;  4M7A C;  4O1O A;  3DBS A;  4HT8 A;  4WF2 A;  5FRM A;  1NP7 A;  3DST A;  5EG2 A;  2WSF E;  3HRA A;  2HZY A;  4C92 C;  3LY7 A;  1M90 R;  4PJM A;  5IN1 A;  1OWM A;  1BCM A;  2DZC A;  5GMK j;  3KSL A;  4JPB W;  1NA3 A;  4CDR A;  3NGP A;  3J5Q B;  2E41 A;  2CP0 A;  4LDV A;  3FUE A;  4BES A;  3L42 A;  4O5V A;  4C8Q G;  3ISM C;  2J6K A;  4BT8 A;  3I5P A;  4BX9 A;  3V79 K;  2ZPB B;  1O9S A;  1VQO A;  5A0G A;  2WXI A;  3V8L A;  4HOR A;  2ZCF B;  1Q7Y U;  1OU8 A;  2EJ9 A;  2EJF A;  1GL5 A;  3CCR T;  2F8X K;  3DPY A;  5JJ6 A;  3RU0 A;  3ASG A;  4U0U A;  2XS1 A;  3L16 A;  5GJV B;  5J26 A;  1PAQ A;  5G05 C;  3GP8 A;  5CQX A;  2NUT A;  5BT1 A;  3AU5 A;  2YHE A;  2L3R A;  5ARF A;  4J8D A;  1TNO A;  3TSZ A;  1LTX A;  1EFN A;  5G04 C;  1UE9 A;  4J9I A;  4G2V A;  4L9P A;  2QZA A;  3PH0 C;  4PFP A;  1LNX A;  4B9X A;  5GMK l;  1PNJ A;  1PHT A;  5EKQ D;  1U1S A;  3UT8 A;  3HRU A;  3L54 A;  2P58 C;  4N3A A;  3QBY A;  3MPU B;  4JXT A;  3PZ1 A;  3ZN3 A;  2LJ0 A;  4DLO A;  2MYO A;  3D9O A;  2RJE A;  2JS0 A;  4LNB A;  2Y1L E;  3AG4 E;  2EPD A;  2ESW A;  4AJW A;  1BI0 A;  3JAM E;  1VQ9 T;  4LXC A;  3S7B A;  2AWI A;  2AXV A;  3OYN A;  3RER A;  3MGB A;  5BUZ A;  2J6F A;  1QNF A;  3RR6 A;  4M7D C;  4EQF A;  1VQ8 T;  3S7D A;  2E6Z A;  3L2W A;  1MJ0 A;  4HFG A;  3PUJ A;  2X51 A;  2CZ0 B;  5EN5 D;  2OTJ A;  4EMG A;  5AT1 B;  1UJ0 A;  4M7A B;  2DFU A;  4KGZ B;  1KZP A;  5LJ3 g;  5LJ5 h;  3H0H A;  1KSW A;  3CXC S;  4YDW A;  3CC4 Q;  3M9Q A;  3OBW A;  3CXC P;  1W70 A;  1YHQ Q;  3QC1 A;  4OVV A;  1K0S A;  4FLB A;  4JHK A;  2RHI A;  1K73 R;  4BY6 A;  3ZRH A;  3BDL A;  4PLI A;  4DK5 A;  2EYZ A;  3RAU A;  2DL3 A;  3LYA A;  2WXL A;  3QNK A;  1MV0 B;  1S64 A;  1AWJ A;  4PJO B;  4JS5 A;  2Z0W A;  5A6C A;  1Q7Y R;  2DWZ A;  5KWD A;  4HRM B;  3X28 B;  4BI3 A;  2RJC A;  4C8Q C;  5B3S E;  1Y0M A;  3Q7A A;  1QBQ A;  3FTS A;  2DPP B;  1OUV A;  4JRK A;  2J7I A;  5ANR A;  3OMC A;  4N39 A;  4PJO F;  3CCE A;  2OVF A;  3ABM E;  4QVZ A;  4QT7 A;  1W1F A;  3NHN A;  2NUT B;  3CCS Q;  5GAO p;  3CQC B;  3EHM A;  1PC2 A;  4GYY A;  3DSU A;  2JZ2 A;  3UA7 A;  5FQ8 A;  2RQR A;  3ZW3 A;  3E32 A;  1Z6T A;  2E65 A;  2VYI A;  3R9M A;  3EGX A;  3OW2 S;  3A98 A;  1IGQ A;  3RRM B;  1NYG A;  4IUT A;  3JB9 F;  4OMP A;  2F1L A;  2QQR A;  2QYU A;  2JN0 A;  5KYX A;  1ZLM A;  4G11 A;  1LOJ A;  2F8Y A;  1TU0 B;  4J6W A;  5HK0 A;  3GZS A;  5KBA A;  1JCR A;  4DBH A;  4FA6 A;  2LC4 A;  2QK0 A;  1MMD A;  1TN6 A;  3FUF A;  3HXD A;  3UT1 A;  5HKP A;  3CQT A;  4CC7 A;  4GML A;  1RLQ C;  5LP0 A;  2JOY A;  4VUB A;  4JRP A;  3CXC A;  5FQ4 A;  2EVR A;  2RA2 A;  5CKH A;  4CRI A;  3HKS A;  4HKE A;  4JVS A;  1TNU A;  4UWK A;  3JCM b;  2F5T X;  3DWL G;  1TS9 A;  1H6P A;  3B7T A;  1OQK A;  5ENS D;  2XMF A;  4X34 A;  1SSH A;  5FWB A;  4V2S A;  4OMO A;  3CPW A;  1FYN A;  2XPZ A;  3GLX A;  1UG1 A;  2RO0 A;  2LP5 A;  2ECZ A;  1VQ6 Q;  1U06 A;  3CVL A;  3JCM e;  2CYZ B;  3I4R B;  2VWF A;  1WHJ A;  3IXE A;  2HAX A;  3I56 T;  2YSQ A;  4ZGJ B;  4RQI A;  4MDX A;  3MKQ B;  3INZ A;  1SZA A;  2DXB A;  5GAN j;  3TQ7 P;  3ZVV A;  2FRY A;  2QDY B;  2GGR A;  2X4X A;  2VTB B;  4ELZ C;  1OXJ A;  1YIJ A;  4DLQ A;  3M0S A;  3OS2 A;  4L2L A;  5BW8 C;  4EBA G;  1MX2 A;  5G2N A;  5KH6 A;  4GZ6 A;  4AG1 C;  3U3W A;  1JU5 C;  3I5R A;  3MP6 A;  1OCC E;  1YI2 A;  3FTZ A;  5ITZ F;  4XIF A;  2ZPI B;  4CDM A;  1KQ1 A;  1H19 A;  5CCM A;  2QA4 A;  3CK8 A;  3TGO A;  1KT1 A;  4HLL A;  1NE8 A;  1H2T C;  4GYW A;  3A8L B;  5FIN A;  4J9G A;  2WVI A;  4I1A A;  3RIB A;  2YUQ A;  4PJO E;  1Z9Z A;  3M58 A;  5I2M A;  3PZ2 A;  3EFS A;  2MMP A;  4K5B A;  2Y3A A;  1NM7 A;  4HBD A;  1EYH A;  5I11 A;  4G26 A;  3M0Q A;  5GAN 3;  3LPZ A;  2H3J A;  3E9F A;  2LSU A;  2V8K A;  4IUL A;  4KUI A;  3FUL A;  1RAC B;  3LGL A;  4WAF A;  2RI3 A;  3APD A;  1KHI A;  3TG4 A;  4M75 C;  2KCV A;  1EZZ B;  3RO3 A; 
#chains in the Genus database with same CATH homology
 4ATZ D;  4RTV A;  2BZY A;  2M0Y A;  4RTZ A;  2FPF A;  3SO8 A;  1HJD A;  4Z89 A;  1WDY A;  2KT8 A;  4RTY A;  3I5S A;  4EIK A;  1WDX A;  3HG0 D;  3C0C A;  3TSW A;  1N5Z A;  1UJY A;  1ZUY A;  2CSI A;  5EYP F;  3JV3 A;  3TWX A;  5AN8 A;  3T8K A;  1T0J A;  5L23 A;  3JXJ A;  2J8S D;  4DUI A;  3NPF A;  1UEC A;  2KXP C;  2F2V A;  3F6Q A;  1JXM A;  4FSS A;  1MX6 A;  2A08 A;  2CSQ A;  4JZ4 A;  2L0A A;  3V30 A;  5FWC A;  1UDL A;  3V2X A;  5ENO D;  4Z8A A;  2JMA A;  1K1A A;  2BTT A;  1J3T A;  4G8K A;  2C0O A;  5AQ7 A;  1NG2 A;  2RPN A;  2J6O A;  2AJA A;  2KRN A;  1AWC B;  4LE9 A;  1S1N A;  5ENQ D;  1WFW A;  3SHW A;  4BET A;  2K79 A;  3D9H A;  2ETC A;  2ZGD A;  1HD3 A;  2FO1 E;  1YWO A;  2VKN A;  4IIO A;  4GPM A;  2DVW A;  2DIL A;  1RLP C;  2LNH B;  2O2O A;  2SEM A;  2YT6 A;  4U8V D;  5AQ9 A;  2HCK A;  4C48 B;  3QWX X;  2J05 A;  4O60 A;  3VS3 A;  1WI7 A;  2AKL A;  3ZNG A;  1SHG A;  4X1V A;  2BKK B;  4U96 D;  2DYB A;  4GLM A;  2A36 A;  4LNU D;  1UUE A;  1T3S A;  1YMP A;  1PKT A;  2JW4 A;  3W9F A;  1U5S A;  1OT8 A;  4J9B A;  3REB B;  2HBW A;  1AEY A;  2XEN A;  4ZNX A;  1H3H A;  1QLY A;  1JXO A;  2F37 A;  3TWS A;  2JM9 A;  3B7B A;  1X69 A;  4BEP A;  1IO6 A;  4NIK A;  2RNA A;  2EQI A;  2RF0 A;  1OOT A;  2BZ8 A;  2YUP A;  2DLP A;  4J9F A;  5ENT D;  3GBQ A;  5JMN D;  4OML A;  3VS7 A;  1U3O A;  1YWP A;  4DEY A;  3R6N A;  1FMK A;  5EYL A;  3UF4 A;  1E6H A;  4OAU C;  2MOX A;  1ZUU A;  2YUN A;  5IH2 A;  4WCI A;  1NFI E;  1IKN D;  5AQB A;  2AZV A;  2F2W A;  2DX1 A;  2DL8 A;  1GCQ C;  4AFU C;  2RN8 A;  2OJ2 A;  1AD5 A;  1WYX A;  2HEQ A;  4U8Y D;  4CC2 A;  5CED B;  1WG0 A;  1CKB A;  1KIK A;  1MX4 A;  4RUG A;  3SEM A;  1NYF A;  2D0N A;  2H8H A;  4K5C A;  1N0Q A;  2DE0 X;  2HE0 A;  2L6B A;  3EHQ A;  5D66 A;  2KNB B;  5CEC B;  1N0R A;  4HI9 A;  1PRL C;  2GBQ A;  1YYH A;  5EC7 A;  4CZ2 D;  5CBO A;  4CYM D;  2X3X D;  1T3L A;  1SEM A;  5ECA A;  1WIE A;  3VS2 A;  4J7W A;  2LJ3 A;  4J9C A;  2EBP A;  3I9Q A;  4OAV B;  5ENR D;  2CUD A;  2DF6 A;  2K3B A;  2QC9 A;  5FIO A;  3UA6 A;  1BK2 A;  4O1P A;  2KR3 A;  1UHF A;  2JTE A;  2P4R A;  4HRL A;  1JQQ A;  2RFM A;  5AAR A;  1D9S A;  2PNN A;  1SPK A;  1V1C A;  4OMM A;  2CH4 W;  4K11 A;  3ZUV B;  2KGT A;  4ORZ A;  1OPK A;  1BBZ A;  1VA7 A;  3ZL7 C;  4DX2 A;  2XEH A;  4DX5 D;  4Z68 A;  1YNZ A;  2VVK A;  1OPL A;  2FPD A;  1LCK A;  1Z9Q A;  1AWW A;  2X3W D;  3EG0 A;  1GBR A;  1MV3 A;  1VYU A;  1M3C A;  1YCS B;  1KJW A;  2J06 A;  4F14 A;  4M4Z A;  5FW9 A;  4J8Y A;  4OMQ A;  1NLP C;  1G3N B;  2E5K A;  2KT1 A;  1NEG A;  3NMZ C;  1G2B A;  2NWM A;  2V1Q A;  2AK5 A;  1YP5 A;  4F16 A;  4YDY A;  2DBM A;  2KBX A;  2JAB A;  1ZUK A;  3TWQ A;  3LH5 A;  1K76 A;  4DEX A;  3TWU A;  1UFF A;  4F6R D;  2OAW A;  1XOV A;  4JB8 P;  1IXV A;  2JT4 A;  4DX6 D;  4RLY A;  4GMR A;  3NBN B;  4HRN A;  1MUZ A;  3M0T A;  2EW3 A;  2W0Z A;  3Q9N C;  4N5Q A;  2EYY A;  1A5E A;  5I22 A;  2P2C P;  1AOJ A;  4AFS C;  2PZ1 A;  3VS5 A;  1M27 C;  3FJ5 A;  2EGC A;  2I0N A;  5ENP D;  2F2X A;  4HVU A;  3THK A;  3Q9U C;  5AAO A;  3U23 A;  3EG1 A;  3QWY A;  3VS1 A;  2KXD A;  2JMC A;  1QKW A;  2KRS A;  3AJI A;  4J9E A;  2DNU A;  1K0X A;  2CH4 A;  4LUD A;  2NYJ A;  1TUD A;  1X6G A;  1GFC A;  1X2Q A;  3UAT A;  2FO0 A;  4QFV A;  3UTM A;  2QDL A;  2GTJ A;  2YUO A;  1B07 A;  2SRC A;  1UOH A;  4AFZ C;  1VYV A;  4HVW A;  1TUC A;  3EHR A;  5KNH D;  2XEE A;  3TWW A;  2DRK A;  2BZX A;  4UUC A;  3JUE A;  3EGU A;  1SRM A;  2C0I A;  1UGV A;  1X43 A;  1QCF A;  3I35 A;  4HVV A;  3TWT A;  2JXB A;  2LQW A;  1PRM C;  1OEB A;  4JJD A;  2O9S A;  2K2M A;  4LNP A;  2M51 A;  1SVX A;  1K1Z A;  2KE9 A;  1ZX6 A;  2YDL A;  5CBN A;  5IXB A;  4R0K A;  3RBB B;  1X27 A;  1K1B A;  3H41 A;  5CEA A;  2ENM A;  1GCQ A;  3NOC D;  2OI3 A;  3UXG A;  2MCN A;  3M0P A;  2EYW A;  1UTI A;  4DX7 D;  3PVL A;  2RQT A;  5IXF A;  4F1P A;  2RQV A;  4O1O A;  3VS4 A;  3JXI A;  2ETA A;  3O5Z A;  2V1R A;  3HRA A;  4ESR A;  4HXJ A;  5EIB E;  1RUW A;  2L3P A;  1AVZ C;  2DZN A;  4RTT A;  1QWF A;  4JPB W;  1N11 A;  3NGP A;  2FRW A;  1TG0 A;  3J5Q B;  2EGA A;  5EIL A;  5AQA A;  4ZFH A;  1OV3 A;  4BES A;  1AZG B;  3TWV A;  2K6D A;  2J6K A;  2LJ1 A;  3V79 K;  1VYT A;  2ED1 A;  3ZKJ A;  2LCS A;  1BU9 A;  4CC3 A;  1GFD A;  1QWE A;  2DMO A;  1GL5 A;  2F8X K;  3V2O A;  1I07 A;  1BI8 B;  5GJV B;  2NUZ A;  1TR4 A;  3TSZ A;  2G6F X;  2FEI A;  4Z88 A;  1EFN A;  1UE9 A;  4J9I A;  1I1J A;  3EU9 A;  2DJQ A;  2W10 A;  3VRY A;  1M8M A;  1PHT A;  1PNJ A;  2KBT A;  2L3S A;  2V5Q C;  3C5R A;  2RQU A;  1WX6 A;  2KXC A;  3VRZ A;  2BKG A;  1SRL A;  4HI8 A;  2LJ0 A;  2MYO A;  4JJB A;  2JS0 A;  2Y1L E;  1ZBJ A;  2EPD A;  2ESW A;  4RTU A;  3REA B;  2O9V A;  5HS0 A;  1WLP B;  4RTX A;  4HCK A;  2J6F A;  2JS2 A;  1GCP A;  1Y57 A;  3TWR A;  1I0C A;  2RQW A;  2C0T A;  1M3A A;  3NOG D;  2LX7 A;  5IHI A;  1MJ0 A;  4DX1 A;  1K9A A;  2ED0 A;  3M0U A;  5EN5 D;  4J9H A;  1UJ0 A;  2L3Q A;  1G83 A;  1M30 A;  3H0H A;  1KSW A;  4JJC A;  4YDW A;  2K7A A;  2DVJ A;  1W70 A;  2LMJ A;  4TUM A;  1K0S A;  2RFA A;  1ZSG A;  3DEO A;  2MIO A;  1QYM A;  4D8K A;  2CT4 A;  5JA4 D;  3T9K A;  2EYZ A;  2DL3 A;  2O31 A;  1JO8 A;  1MV0 B;  2DM1 A;  1YN8 A;  1AWJ A;  3KFV A;  4J9D A;  5IHK A;  4BSZ B;  2D8H A;  4K5A B;  1H92 A;  4A63 B;  2DWZ A;  3IQL A;  5KWD A;  4HRM B;  1DC2 A;  5GJW B;  1K3Z D;  4LUE A;  3LJN A;  4B93 B;  1Y0M A;  1RI9 A;  2DA9 A;  5KNG A;  2J7I A;  1JEG A;  1T0H A;  1ABO A;  1B3Q A;  1UHC A;  4DRX E;  1W1F A;  3NHN A;  2B0O E;  4QT7 A;  4ZHB A;  1OY3 D;  1AP7 A;  1MYO A;  3UI2 A;  2PTK A;  4KRT A;  2KRM A;  3TVT A;  4BER A;  3UA7 A;  2DL4 A;  2RQR A;  4GBQ A;  5EID A;  1X2K A;  4AFQ C;  1KFZ A;  2L2P A;  3KEA A;  4JZ3 A;  3DEP A;  1PWT A;  3A98 A;  2CUB A;  2DL7 A;  1NYG A;  2B86 A;  4OMP A;  1CKA A;  2CDT A;  1PKS A;  1WXT A;  2RMO A;  4RTW A;  5CER B;  2ETB A;  2EGE A;  2ZGG A;  3H0F A;  4HQD A;  2XZT G;  1WXU A;  1ZLM A;  2F8Y A;  3W9G A;  5KBA A;  5BXU A;  4CC4 B;  3B95 A;  2GQI A;  2VGE A;  5HKP A;  3CQT A;  4CC7 A;  1RLQ C;  2LQN A;  2KEA A;  5IHN A;  1BI7 B;  1BB9 A;  2AZS A;  1S70 B;  2EVR A;  4LG6 A;  2A5E A;  2HDA A;  3ULR B;  1K4U S;  1ABQ A;  2GNC A;  1NEB A;  2EKH A;  2D8J A;  1AWO A;  3PE0 A;  1GBQ A;  2QYJ A;  2EYX A;  2LZ6 B;  5ENS D;  2XMF A;  1WXB A;  2FPE A;  1DCQ A;  2FG0 A;  4AG2 C;  1SSH A;  2D1X A;  5FWB A;  4OMO A;  1E6G A;  1FYN A;  2DL5 A;  2K9G A;  4LSZ E;  1UG1 A;  2LP5 A;  2ECZ A;  1U06 A;  3V31 A;  1SW6 A;  2JM8 A;  2VWF A;  3IXE A;  2YSQ A;  1A0N B;  1M3B A;  2ROL A;  2ABL A;  3PVQ A;  1E7O A;  1ARK A;  3AAA C;  2Y0B G;  1CSK A;  1AWX A;  2PNI A;  2KRO A;  2A37 A;  2FRY A;  4IIM A;  3RNJ A;  2GGR A;  3J5P A;  3VS0 A;  4U95 D;  1GRI A;  3EG2 A;  4G8L A;  4OMN A;  5HRY A;  2KYB A;  3EG3 A;  3M0S A;  3VS6 A;  4HNA D;  1MX2 A;  2V4H C;  2DBK A;  1QKX A;  4AG1 C;  1BLX B;  2XZD G;  1JU5 C;  3I5R A;  1NLO C;  5ITZ F;  2HSP A;  4QQI A;  4HB5 A;  1HSQ A;  4HLL A;  2DZO A;  1W6X A;  4J9G A;  5FIN A;  2GTO A;  2YUQ A;  1BD8 A;  1SHF A;  3ZU7 B;  1Z9Z A;  1AZE A;  1WA7 A;  2CT3 A;  4K5B A;  5I11 A;  1NM7 A;  4HBD A;  1IHB A;  2CRE A;  3M0Q A;  2KYM A;  3M0R A;  4E6R A;  2IIM A;  4LN2 A;  2O88 A;  5HCK A;  1BU1 A;  3H0I A;  4D8D A;  2ROT A;  4F17 A;  2AKK A;  1X6B A;  1H8K A;  4Y92 A;  2DRM A;  5BXO A;  2A28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...