4A63B

Crystal structure of the p73-aspp2 complex at 2.6a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
202
Chain Sequence
MRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUMOUR PROTEIN 73
publication title Structural Basis for Aspp2 Recognition by the Tumor Suppressor P73.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 59
structure length 202
sequence length 202
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
B PF00023 Ank Ankyrin repeat
B PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4a63B01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4a63B02
1UGVA 2DF6A 1GBQA 2W10A 1V1CA 1SHGA 4F17A 2LCSA 2KRMA 3PVQA 1K1ZA 1K1BA 3VRYA 1T0HA 2GGRA 2BKKB 2KE9A 5FWCA 3H41A 4OMLA 4RUGA 2HSPA 1K3ZD 1T0JA 1SW6A 5JMND 3SO8A 2EKHA 1BU9A 4RTYA 3U23A 4F16A 1SRMA 2YUNA 5FW9A 4D8DA 1TUDA 1OEBA 4N5QA 1QLYA 1GRIA 4RTWA 3HG0D 4X1VA 1AWCB 1ABQA 2FPDA 4AFSC 2BZ8A 3TWRA 1MYOA 2LNHB 1I07A 2YUQA 1QYMA 4DX5D 1CKAA 3B7BA 2KXDA 2YDLA 1G2BA 3I9QA 2V5QC 5ENTD 3ZNGA 1TR4A 1HSQA 4JJBA 2D0NA 2CT3A 1GCQA 3ZU7B 3TSZA 5EIDA 1SPKA 2HBWA 4LN2A 5IHKA 2RN8A 2OAWA 2QC9A 1WXTA 1I0CA 1IO6A 2X3WD 4F6RD 3EHRA 2E5KA 2BZYA 2EVRA 2CUDA 4EIKA 5AARA 1BD8A 4QFVA 4JB8P 5AQ9A 1X69A 1IKND 4HQDA 1PRLC 2X3XD 3THKA 3UF4A 3VS5A 1T3SA 2KBXA 1NLOC 5KWDA 1VA7A 1W70A 2A28A 2KYMA 5CEAA 2GTJA 1BB9A 2K7AA 3Q9UC 3C0CA 2RMOA 5ITZF 1QKXA 4AFUC 3UXGA 4E6RA 2MCNA 4OAVB 1ZUUA 2LJ3A 3ZUVB 1QKWA 1K4US 1GFCA 5ENSD 2O9SA 1IHBA 2LJ1A 2RFAA 1YMPA 2OJ2A 2MYOA 3M0UA 4HVUA 1PKSA 1X2QA 4HBDA 2FEIA 2RQTA 4AFZC 1AWJA 4WCIA 2XENA 5IHIA 5AQAA 1K1AA 2EGEA 1MX2A 3R6NA 1Z9QA 4HNAD 1GCQC 5KBAA 1MV0B 2ED0A 5D66A 3I5SA 5IH2A 1M27C 1AWWA 2I0NA 3NMZC 1RLPC 5HCKA 5BXUA 1X43A 2V1RA 5EC7A 1UJ0A 1E7OA 3DEOA 4CYMD 1N5ZA 2KT1A 2ROLA 1H8KA 2JS0A 2KBTA 3QWXX 1JXMA 1PKTA 4K5CA 1ZBJA 4OMQA 2DL3A 1AZEA 1FMKA 2JM9A 4DEXA 1S1NA 5JA4D 1OPKA 4BSZB 3V2OA 1WA7A 2EGAA 2JMCA 1UE9A 3VS1A 2J6KA 5EILA 1A0NB 2DM1A 4JJCA 2DL8A 3LH5A 4YDYA 5AQ7A 4QQIA 4AFQC 4O1PA 2KR3A 1JXOA 1OOTA 2MOXA 1WLPB 3QWYA 2FPEA 3NPFA 4HB5A 4JZ3A 2LMJA 2RNAA 5FWBA 4DX6D 1UJYA 3JXJA 1VYTA 3T8KA 2DNUA 2RQVA 4NIKA 3UA7A 2EYXA 1JEGA 3EGUA 2A08A 2K6DA 4BERA 4C48B 3H0HA 3KFVA 4TUMA 1PWTA 5CERB 3CQTA 2YSQA 3VS3A 1K9AA 1Y0MA 2JT4A 1ZUKA 2Y0BG 4U8YD 1NFIE 2ABLA 4J8YA 1W1FA 2CH4W 3VS2A 3JXIA 4A63B 4GBQA 1N11A 2L3QA 2EYYA 4Z88A 2QDLA 1QCFA 5IXBA 1WIEA 1UFFA 1UDLA 2L2PA 1ZSGA 2G6FX 5AQBA 2SRCA 1NEGA 4LNUD 1WDXA 2EBPA 5CBOA 1DC2A 4HVVA 1OT8A 3RBBB 1UG1A 4Z8AA 3PVLA 1XOVA 2MIOA 3EG0A 3NGPA 3UATA 3ZKJA 1WXBA 2V1QA 1T3LA 2ETAA 2ECZA 2NUZA 1NEBA 3REBB 1QWEA 2ETCA 2RF0A 5ENPD 1LCKA 3I5RA 2BKGA 2DZOA 3EHQA 1MJ0A 3SEMA 1UHCA 1ARKA 2RQRA 3RNJA 4RLYA 4K5BA 4DX2A 2JTEA 3V79K 2SEMA 1NYGA 4OMNA 1GBRA 4CZ2D 1X27A 2J05A 3VS0A 5FINA 2KXCA 4FSSA 1K0SA 3C5RA 3D9HA 2ZGGA 2IIMA 3M0TA 3TSWA 3VS4A 2EYZA 4KRTA 1D9SA 4LSZE 2LZ6B 1KSWA 5IXFA 2O31A 2JS2A 1UUEA 1KJWA 2DE0X 2OI3A 1H92A 3JV3A 1B07A 2CSIA 2DRKA 1NG2A 4LG6A 1YWOA 1YCSB 2DL5A 1E6GA 3VS6A 4O1OA 2FRYA 1ZX6A 2RPNA 2KRNA 1FYNA 1GL5A 3SHWA 3ZL7C 4ZHBA 3V30A 2L0AA 5KNHD 5EYPF 1MV3A 2KXPC 3VS7A 2YUOA 1K76A 4IIOA 2K3BA 2XZDG 2KROA 2DX1A 4J9BA 4HRMB 4CC7A 4Z89A 2AKKA 1GCPA 1BLXB 3O5ZA 3UTMA 2VGEA 2AZSA 2RQWA 5BXOA 1RUWA 3V2XA 3W9GA 4RTUA 2V4HC 2VVKA 2PZ1A 1OY3D 4BESA 3W9FA 1YNZA 1AWOA 4AG1C 1UOHA 2XZTG 3DEPA 2JM8A 4J9GA 2QYJA 1BK2A 4J9HA 4LUEA 2J7IA 1ZLMA 1CKBA 2A37A 2DLPA 1YWPA 2D1XA 4OMPA 2XEHA 4DX7D 1H3HA 4HRLA 5CBNA 1RI9A 4U95D 2F8XK 1G83A 1SHFA 2HE0A 2M51A 1B3QA 5HKPA 2KNBB 5EYLA 1Y57A 2KGTA 2DWZA 4J9CA 3IQLA 1JU5C 1PNJA 4JZ4A 4AG2C 1I1JA 1M30A 1YYHA 1ZUYA 2HDAA 5ENRD 2GNCA 3TWUA 2JW4A 2F8YA 4ATZD 4RTZA 4HXJA 3AJIA 2A36A 4ESRA 3TWSA 2EPDA 2FG0A 4G8LA 1AVZC 4CC2A 1MX4A 5AN8A 1IXVA 2KT8A 1OPLA 4HCKA 2F2XA 4BETA 1NM7A 2K9GA 1SRLA 1X6GA 2C0IA 1N0QA 4ZNXA 3FJ5A 2EW3A 1HD3A 2ED1A 4GMRA 1SEMA 2AZVA 2FO1E 2CDTA 3ULRB 3NOCD 2JABA 3Q9NC 2GBQA 4IIMA 1TG0A 2P4RA 1AZGB 2J6OA 1U06A 1WI7A 4M4ZA 1AP7A 1BU1A 1BI8B 2CT4A 2DRMA 5I22A 3TWQA 2YUPA 1M8MA 1HJDA 1UHFA 1BI7B 2PNIA 3TWVA 1UTIA 2O2OA 4LE9A 2F2WA 1WYXA 5AAOA 4JJDA 4RTTA 2W0ZA 2CSQA 3REAB 2K79A 1M3AA 1PHTA 1YP5A 2EYWA 2Y1LE 4O60A 2HCKA 1Z9ZA 2KEAA 1AEYA 5ENQD 3TVTA 1WG0A 2AKLA 2J06A 2KYBA 3IXEA 1PRMC 3NBNB 1WX6A 4ZFHA 1G3NB 2D8HA 3EG3A 2ZGDA 3EU9A 5FIOA 1CSKA 2VWFA 4HVWA 1S70B 4JPBW 1KFZA 2H8HA 2ROTA 4DUIA 2LQNA 4OAUC 1BBZA 2FO0A 2P2CP 5CEDB 2YT6A 1YN8A 4Y92A 1WFWA 1RLQC 5CECB 2F2VA 2LQWA 1U3OA 2B0OE 4HRNA 2ENMA 1DCQA 4CC3A 2CREA 1MUZA 3J5QB 2AK5A 1J3TA 2J8SD 3B95A 4GPMA 4J9EA 3NHNA 1GFDA 5HRYA 3EG2A 2D8JA 2FRWA 1N0RA 3T9KA 5ENOD 4DRXE 2O9VA 3TWWA 1EFNA 2GQIA 1ABOA 1VYUA 4F1PA 2B86A 3M0RA 2DA9A 5ECAA 2HEQA 1AWXA 2CUBA 2ETBA 2L3SA 2A5EA 5EN5D 1SSHA 2GTOA 1UECA 4U8VD 2DVJA 3LJNA 4HLLA 3HRAA 4HI8A 1KIKA 2L6BA 3GBQA 4J9IA 2JMAA 2M0YA 4QT7A 2DL7A 2NYJA 2DVWA 2DL4A 3M0QA 2XEEA 3H0FA 2EQIA 3TWTA 2PTKA 4LUDA 4K5AB 2C0TA 4RTXA 3F6QA 4BEPA 4UUCA 4Z68A 3I35A 1U5SA 1E6HA 2K2MA 3A98A 2FPFA 4J7WA 2KRSA 2VKNA 2DMOA 4OMOA 2DBMA 4DEYA 2RQUA 3NOGD 1M3CA 2CH4A 3TWXA 5GJWB 4GLMA 2DBKA 1W6XA 1WDYA 2DILA 1WXUA 3M0PA 3UA6A 4OMMA 2NWMA 4YDWA 1A5EA 4CC4B 5EIBE 3UI2A 5HS0A 2C0OA 3M0SA 4DX1A 5L23A 1MX6A 3KEAA 2L3PA 5GJVB 4RTVA 4J9DA 5I11A 3AAAC 1NYFA 2AJAA 1JQQA 1X2KA 4LNPA 1TUCA 3VRZA 4U96D 1QWFA 2BZXA 2LP5A 4K11A 2BTTA 1NLPC 5IHNA 2XMFA 2ESWA 4G8KA 1K0XA 1AOJA 2DZNA 2O88A 1M3BA 2LX7A 2RFMA 4HI9A 2EGCA 3PE0A 1SVXA 1X6BA 2LJ0A 3V31A 3JUEA 3H0IA 2F37A 1OV3A 2DYBA 2JXBA 3EG1A 5KNGA 2J6FA 3J5PA 1AD5A 2DJQA 1JO8A 4D8KA 4J9FA 4B93B 4R0KA 2PNNA 4F14A 4ORZA 1VYVA
chains in the Genus database with same CATH superfamily
2W10A 3JCKC 2K3YA 3E37A 4M77C 2MHKA 4DOWA 1VQ5A 2LCSA 4LCTA 1H2TC 2Z0WA 4PFPA 2GGRA 5J90A 3JAME 2H6IA 2X38A 5FWCA 2VGNA 3H8ZA 4OMLA 2BE7D 1K3ZD 1T0JA 1KC8C 1BU9A 2H6FA 3LEWA 3U23A 1OYXA 5GAOl 2OTJQ 2YUNA 2A0FB 5KE3A 1N4QA 2LCCA 2P9PG 3PEVB 4IURA 4XU0A 3JUIA 3D3MA 5EDSA 4GCNA 4PH4B 1DJ7B 3TU4K 1VQ9T 1VQLQ 4KULA 1OU9A 3KSLA 1VQ4Q 2P0QA 2LNHB 1I07A 1QYMA 1U3CA 3ML9A 4EPCA 1D0ZA 2KXDA 3KS2A 5FU7B 1U2VG 1B34A 3I9QA 3NB2A 5ENTD 4PFOA 1VQ5Q 3ZNGA 1ACMB 1TJFA 3RKVA 3OYMA 4N3AA 2D0NA 3MKDA 5M9OA 3JCMf 1WGSA 2DTOA 3CCSA 2LC4A 4BACA 4J83A 5IHKA 2HBWA 4LN2A 1P5QA 4JHRA 4G2VA 2RN8A 2P9NG 5A0DA 2ZPGB 3V7CA 4HXIA 1Y8MA 4EZKA 1I0CA 2JTMA 1YITA 4UQYA 2EVRA 3RERA 2WQHA 4JB8P 5AYWD 1R0BG 4A4HA 4CRIA 5AQ9A 4YVQC 1X69A 2MI6A 4MMLA 4NOYA 3DXKG 1NLOC 1W70A 3PNTB 5H7PA 3ZEFA 2A28A 2KYMA 1Q81C 3TREA 5CEAA 5FRMA 1VQMA 4ZN3A 3Q49B 2MRIA 4XI9A 4V3IA 1QQEA 3SZ7A 3CCVA 3GOXA 5G2NA 3MHXA 3CCSQ 5ITZF 1KPSB 3JCMV 3UXGA 3HRSA 4E6RA 4J6XA 3ASOE 4OAVB 3N71A 1QKWA 1KG1A 4D6WA 1VQKT 1K4US 1YITQ 1Q86U 3LS8A 2RFAA 4C0MA 1XJWB 2XG8D 1S72T 3TCJA 2MYOA 3D9IA 4AY6A 4J5YA 2LQKA 1MZCA 4RMOA 4KUDK 2EQJA 1GW6A 3VU3C 1YJWT 5AQAA 2DIWA 1RZ4A 3VUZA 3I56A 2GW1A 3R6NA 3SB2A 2ED0A 4JHKA 4M7DD 1AWWA 2PUKB 3NMZC 1RLPC 5BXUA 5G04C 4A1SA 1UJ0A 3EGXB 1E7OA 4NL3A 3KEZA 2KT1A 4CYMD 3AG3E 3U4TA 3EUVA 4XTUA 3A8MB 4I1MA 2WXFA 3BUAA 4HVBA 1WZOA 1OPKA 4LDYA 3V2OA 4AEZC 3UT8A 2EGAA 1F1BB 2JMCA 1UE9A 2JVVA 3JCMb 3VS1A 3QYGB 4C5HA 5ARFA 3BU8A 2DM1A 3LH5A 4C8QA 1VUBA 5AQ7A 1Y96A 4BD3A 4GB9A 2CG2A 3I56Q 2CKKA 2MWOA 3CQGB 1HS6A 1FX7A 1UGRB 4C92A 2O01E 1D09B 3DSUA 2QEXQ 2K4YA 3EDTB 4HB5A 2V4LA 2LMJA 4ZN1A 2O4XA 1IRXA 2YQ8A 4BX9A 2GRRB 3J81E 3AT1B 3INZA 4NIKA 2EIME 2XHEA 2K6DA 3ONLA 2ZPIB 2CP6A 4KVMA 4C48B 3RIBA 2PU9B 4JRIA 3CQTA 2P84A 3RSEG 2JT4A 2Y0BG 4I2ZA 5A23A 5CMWA 3RMSA 1NFIE 4J8YA 2ZXWE 2M1HA 3VS2A 4GBQA 4BT9A 2OTLA 4WWOA 1UFFA 4GMLA 1UEBA 2G6FX 2E64A 4LNUD 1WDXA 4EPZA 2L89A 3RAUA 3P8DA 1EF1C 1UG1A 2EJGA 4Z8AA 4C8QC 3A5ZB 4M7DB 3LYAA 4IYPA 4EMHA 2LVMA 3BFMA 1YHQQ 2NSZA 1D1BA 2V1QA 2YRVA 2WXLA 3ZYQA 2HMAA 4C92C 2ECZA 4CT0A 1ZSZA 3REBB 1KQ2A 2ETCA 3I5RA 2BKGA 3B7UX 4F3VA 1H641 4IRUA 2JZ2A 1O5MA 3ZN3A 5GAOn 1ARKA 2KCVA 4M77D 3U64A 2JTEA 2SEMA 3SF4A 4JLIA 2KMTA 2KZTA 3IHYA 2XHCA 2ONDA 4XKCA 4CZ2D 1X27A 5FINA 5A6CA 4HCCA 5GMKi 3M0TA 2ZGGA 3PZDA 3G1JA 3ESLA 1G3YA 4N0AA 2RI2A 2LZ6B 2MK5A 4QQ6A 5J39A 2EQUA 2O31A 4XEIG 1SSFA 1H92A 2RHXA 4I2WA 3Q4AB 2AHJB 3DB4A 3JV3A 3LYIA 4KH1B 4XTVA 4ILGA 4X9CA 1MMNA 1S63A 3QWVA 4LG6A 1NG2A 3HYMB 4KT0E 1O1TA 4M78B 4GTSA 2DK3A 1E6GA 2CP2A 3HFOA 4DPRA 2FRYA 3UT1A 2VJ8A 4JW1A 3HPWA 1UJJA 5KYXA 4A54A 1NBEB 2FO7A 4RG6A 5KNHD 5DY9A 3MEUA 5FRNA 3PUKA 3GIBA 1D8DA 5LJ5f 3DLLA 1K76A 4FLBA 3T8MA 2K3BA 4GY5A 4J9BA 2CFUA 1S0PA 4J8OA 3G4SA 3E9FA 2GGFA 5I2SA 3PT9A 3GW4A 4L9PA 3H6ZA 4ANXA 3A1PA 3UKRG 1I81A 1W3BA 3UTMA 2VGEA 3AS4A 1D1CA 5D2MC 5BXOA 4JXTA 5JHAA 3ZGQA 2V4HC 2QTVA 1U3DA 1AWOA 3QO3A 3W9FA 4BFRA 2X4XA 3HXEA 4AG1C 1FMWA 3LX7A 1NZNA 4J9HA 4N0AC 3CK8A 3ZFWA 4PK4A 2DLPA 4OMPA 1D8EA 3QJYA 4DX7D 3LGFA 3FDHA 1H3HA 1TNUA 1O1SA 1PD1A 5HQ8A 5CBNA 3DBSA 1G83A 3FU0A 3EGDB 3BE3A 2M51A 4HS2A 2KNBB 5CK9A 4GYOA 1O9SA 5KYWA 4NRHB 3IQLA 1JU5C 4AG2C 1VQPA 2MWPA 4N4IA 1N52A 1ZUYA 4GPKA 3MPUB 1OX8A 4L7TA 2CP7A 3KBGA 4JRPA 4IKFA 4PJOA 3QJZA 3GZ2A 1M5Q1 2P9IG 2RHZA 2EPDA 2HKNA 4G8LA 2YRCA 4CC2A 4JC8A 3ASKA 2YHCA 2LAIA 4ATOA 1OI1A 1OPLA 4HCKA 1HYOA 4BETA 3ZIMA 1YJ9T 2OVFA 3M55A 5EG2A 4II1A 2ED1A 2AXVA 3G2SA 2MPXC 1N8RC 1NA3A 2PQRA 1UB4A 2ZPEB 1K9MC 4NQ0A 2P4RA 1HE8A 1VQPQ 3PTAA 2DYRE 4UI9J 1U06A 5CKDA 2JJ9A 2FZCB 2X51A 2CT4A 4MRUA 2Y3AA 2VB6A 4KBQA 4QVCA 1RL2A 3CMAA 3UM2A 4FLHA 3CVUA 3CBMA 1U1TA 4XTXA 1UTIA 2F2WA 2R59A 5AT1B 3CEQA 5GAMj 4JJDA 3CCUT 3EIJA 4RTTA 4XU3A 3UINC 1K73C 2K79A 3HRUA 1W2BS 2EYWA 2NUPB 2HL5C 3MEWA 4E7SA 3TVTA 2YRDA 3OYJA 3RJVA 2AKLA 4PJOC 2KYBA 4DBFA 1WX6A 5LJ3j 3EG3A 3S7FA 3EU9A 1N95A 2HYZA 2VWFA 2R57A 2ZPFB 1MMDA 4DUIA 2WXKA 2Y69E 2MOWA 4OAUC 1VQ7A 2FO0A 3CMAQ 1MQSA 2YT6A 3MEVA 1NJIU 1B34B 4I1AA 4YDEA 5BPPA 4CDRA 1UJKA 1W4SA 5LL6S 3PREA 5CECB 4ZGJB 1U3OA 3MJWA 3APDA 2B0OE 4XI0A 3G6ET 1NE8A 2FHDA 1V29B 2KK4A 1MUZA 4C8QD 3JCMX 4HOUA 3CD6T 2AK5A 2CFZA 4UWHA 3B95A 3EAEA 4J9EA 4XTYA 1Q86R 2XS1A 5HRYA 1X75C 3EG2A 4GMJA 3WVEB 3JCMg 4AVXA 2VTBB 3OYIA 3TXNA 8ATCB 2J08A 1N0RA 3T9KA 5FU7C 4QW2A 3ABKE 1C0MA 4CCAA 4C92D 3J80E 4F1PA 1NL4A 2B86A 3A8OB 2HEQA 4C0DB 1AWXA 2CUBA 3FTUA 3Q7FA 5EN5D 2GTOA 2UWJG 5J3BA 2DD4A 1VQ7Q 2DIGA 4Q96A 4LDUA 2E6ZA 4M7AA 4HT9A 1WHJA 2IFUA 2VGMA 3FFLA 4G23A 4HI8A 2X9HA 3EGXA 5GANh 1KIKA 2L6BA 3M4YA 1H6KA 4UI9C 5D0QD 2J07A 2DD5A 5HK3A 1M90C 2JMAA 2E2EA 3FUNA 2K57A 3CCMQ 2ZCFB 3M0QA 4U0UA 2XEEA 3AG1E 1HH8A 4GTQA 4LNGA 1AT1B 2WXPA 2WQ7A 3F6QA 2CP3A 2DVEA 2YINA 4UUCA 4Z68A 4QQDA 1U5SA 1ELRA 1ZU2A 2RI3A 2IOSA 3D9NA 1RAFB 2Q7FA 5JHBA 5KJKA 3L54A 2DMOA 2JUFA 3NOGD 3GZSA 3P2BA 5GJWB 3V7RA 4HKEA 1VQOA 2DILA 3UT7A 2VC8A 3JB9I 1ZBXA 3UA6A 5KJMA 2P0KA 3CCJT 2QDYB 4AV7A 4YDWA 5CIUA 2FYKA 4WUYA 3JCMJ 4TV3A 4CC4B 1BI0A 4KMOA 5GANd 1U8RA 3GPLA 3UI2A 1Q95G 5HS0A 4J6IA 4U0ZA 4F7UE 5GAMg 4JS4A 1MX6A 4KBMB 3QG1A 2L3PA 2IPOB 1NYFA 1PSEA 2QYZA 3JB9G 1JQQA 1X2KA 1QVFS 5DLOA 5DBKA 1TUCA 3ASGA 5CCAA 4M7AC 3SGHA 4E7LA 3UMVA 1VQ8T 4RVBA 2ESWA 4G8KA 3T5VA 3FUKA 3QKYA 2O88A 5LJ3g 1K0XA 1M3BA 3PE0A 1JUQA 5G55A 2LDMA 1X6BA 1BIBA 2EWNA 4WF2A 4PS7A 1WHKA 3ZHEA 4ANVA 2JXBA 3ASNE 3D7SB 4BB7A 3DKMA 3S7JA 2GROB 3MV2B 1KK7A 2O4XB 1Q81U 4R0KA 2COWA 3UPVA 1IGUA 4ORZA 2WMNA 3MEAA 4DLQA 2XI9A 2E4HA 3AU5A 4JEUA 1KQSA 3QUIA 1V1CA 1SHGA 3L42A 4F17A 4C5EA 1YJNA 2QFCA 1N9AA 3PVQA 4NS5A 4TXQA 1HXDA 1K1ZA 4O6FA 3IHVA 1HU3A 2BKKB 3SY2A 2HQEA 4RUGA 2EKHA 3SO8A 4B94A 2CGHA 3CC7T 2NYSA 4F16A 5FW9A 1OEBA 1QLYA 3RUXA 4RTWA 4X1VA 2XPIA 3QSUA 5CCLA 1ZHIA 2FPDA 4G26A 2RJEA 4LD9K 3C4SA 4AFSC 3META 1K8AC 2BZ8A 3MCAB 2YUQA 3DSWA 4DLOA 3JRZA 4MZTA 4VUBA 3B7BA 3OS1A 4EBAA 2FBNA 2M9UA 3I5PA 2RK2A 2X4WA 3MCXA 1QP2A 1SA4A 4A4KA 4BDZA 4FSXA 1X81A 1HSQA 4JJBA 1YJNQ 1Q7YC 2BKDN 2KQWA 2QQBA 4LXCA 3OYKA 3OAWA 5EIDA 3E19A 1XGWA 2RHUA 1HF8A 3ZEHA 3SQVA 1ZSZB 1WXTA 5GANe 1D0YA 2CP0A 2X3WD 3EHRA 3QXEB 3FUDA 2CUDA 5AARA 2DBAA 3QYHB 4L6V5 4WNDA 2AVPA 1TOVA 3GLXA 3OXGA 3BQOA 3Q79A 3FUEA 4MMKA 1IKND 3ISMC 1M2VA 3FUIA 1IHVA 3OYBA 3UF4A 2GRLA 3VS5A 1T3SA 3UT4A 4DJAA 2JEKA 1LTXA 3Q5MA 3I55Q 3CPWS 1VA7A 1N6AA 3VLDA 2FVUA 4FYWB 1ZBPA 2F5KA 2K3XA 2A7YA 2LT4A 1MHNA 4PJOD 2RMOA 1PSFA 4E85A 2MCNA 3E34A 3C98A 3L08A 3TJPA 1UW4B 3ZUVB 3TQ7P 4GYYA 2O9SA 4B89A 1YA0A 3VYGA 1YMPA 2OJ2A 3T5XA 2GRPB 2WXIA 2FEIA 4GZ6A 2COYA 4AFZC 5A0GA 1RADB 2KSSA 1IQRA 4WCIA 2XENA 4X34A 3CCRA 3L17A 2KAFA 1K1AA 4M7DG 5KYXB 3R9MA 4G11A 1MX2A 1TNZA 4GA1A 3P8BB 3CC4A 1KD1C 1IXDA 4M78C 1ELKA 2NUTB 5HCKA 2J09A 1X43A 3HXBA 2E70A 1NI1A 2V1RA 2YHEA 5EC7A 3PE3A 2GF7A 4E7KA 3DEOA 2ROLA 5GAN7 5IT9E 4OMQA 2DYSE 3CCEA 2LXLA 4JDSA 3RKXA 2OTJT 2XCCA 4N2QA 2JM9A 2DPPB 4DEXA 5GAOm 4BSZB 1TN6A 3DSTA 1WA7A 1VQLT 2QQ9A 3UX4A 3CCRQ 5EILA 1VQ4T 4YDYA 3ULQA 3FH8A 3C3OA 2KM4A 1OZ2A 4AIFA 4GTPA 4AFQC 2KC7A 2VSOE 4O1PA 2F5TX 5KCMA 1VQ5T 1M1FA 2LRQA 4ANWA 1JXOA 3CVXA 3ABME 2IJGX 4AM9A 3CVWA 1WLPB 4MLPA 4UWKA 3CVQA 4R7LA 4MZPA 4DBHA 2RNAA 3HP9A 5FWBA 3UM1A 3JCMP 1VYTA 1JBMA 4F7UF 4I43A 5BNWA 3UA7A 2EYXA 1JEGA 2A08A 5KJLA 2HO1A 1MMGA 2FZKB 4BERA 1TN7A 2VV5A 3OW2S 1PWTA 2DEQA 4PJOB 2P9SG 1YBYA 3ZVVA 3SFMA 3VS3A 5EX0A 1K9AA 2QYUA 4K03A 1KQSP 4PLIA 4U8YD 1E8ZA 1W1FA 5KCHA 2NUPA 1OXJA 3PUJA 2DO3A 3PMIA 2WXGA 3CCST 1QVPA 4GTVA 2XRYA 4UQZA 1WIEA 4GZ3A 1M2OA 5LJ5d 2SRCA 4GYWA 1V76A 4ELYC 1KD1R 4M7AD 3HDXA 4FM4B 1YITT 3L2WA 2XGSA 1DC2A 3QPHA 3RBBB 2BF0X 3PVLA 1XOVA 3EG0A 3EHMA 1KQ1A 1LVKA 3ZKJA 1OWNA 1NJIR 1WXBA 1X6OA 3KXTA 3BG1B 4FULA 1QWEA 5C2YA 2DZCA 4FU6A 2HD0A 4M77G 1PC0A 2DETA 4OMFB 3EHQA 2HSEB 1G3TA 3MZLB 2RQRA 3NAWA 4K5BA 2VTBA 3OXFA 1IZ6A 1Z3XA 2HKQB 4J0UA 4YTLA 2L0TB 4QQGA 3PEUB 4CRWA 2JNGA 5GMKl 2WXMA 1K0SA 3C5RA 3RKWA 3QBYA 1I4K1 4OF1A 5HKCA 3CHQA 3M4GA 4P29A 1D9SA 1TTHB 4JA9A 4FT4A 5IXFA 2DERA 4QVZA 1FT2A 4P5NA 3B7SA 5C0MA 3I4RB 1SG5A 5CQXA 2OI3A 1KT1A 3GZ1A 4AT1B 3CK7A 2YXYA 5LOZA 3I56T 4C0FA 1JWGA 5ANRA 2WQ6A 2LUHA 5CKFA 2CSIA 1YWOA 4M75B 3OSVA 2QEXT 3DSSA 3UIOC 2DL5A 4CGVA 3VS6A 3VJPA 1ZX6A 2RPNA 4E7IA 1UN8A 4I9CA 4I9EA 1YCYA 3QDNA 4ZHBA 1KC8R 3FP3A 1IHGA 4C92E 3APCA 3FTYA 3FULA 3VS7A 1OWOA 5C1DA 3D9LA 2X6KA 1QBQA 4U07A 1U1SA 4Z02A 1K9MU 4LUNU 3LXUX 1VQMQ 2DX1A 2HBPA 5GAMf 3CBPA 1OWLA 4CC7A 3BY7A 4M7AB 2R5MA 4QVDA 2VASA 3MKQB 2H3JA 4JUVA 3O5ZA 3D9OA 2DXBA 3W9GA 4FP7A 4BE0A 2L3RA 2LTOA 2VVKA 5D0OD 2PZ1A 3APFA 4C0DC 2WACA 3QNKA 2VGXB 1JCQA 2ZGWA 4J9GA 5FZQA 5LJ3f 3CHMA 3OXLA 1BK2A 1YIJA 1XNIA 4LUEA 4RKUE 2A37A 1K73U 2D1XA 1YHQT 4N5CA 4HRLA 1VQKA 3OYHA 1PC2A 4WNEA 3KAEA 3E1SA 2KY9A 1S72A 2QI2A 4IUPA 3VYHB 5EYLA 1Y57A 3URZA 4LDVA 3GNFB 1YJWA 4F7AA 3LY7A 1PNJA 4J9CA 1Q81R 5D7UA 1I1JA 4HOTA 5J26A 5ENRD 2R5AA 1UGQB 2JW4A 6AT1B 4A3VA 1E8YA 4HXJA 1G5VA 4M78D 3PDNA 3F70A 4KZ0A 4ESRA 1AVZC 1YIJQ 2ZZDA 1MX4A 3CCQA 3QWPA 3HXDA 2KT8A 1DVPA 3OQ5A 3E4BA 3MA5A 1NM7A 4EQFA 1X6GA 2XEVA 2K2VA 4HLEA 4GMRA 3LWIA 2VSNA 4EECA 3ULRB 5EKQD 3OYAA 2GRQB 4C5GA 3S3NA 1WHLA 2C0MA 2P9LG 1TG0A 2RJCA 2EILE 3QK0A 4WWNA 3ZHEB 2WXRA 1LJOA 2WSFE 4JVSA 4PS8A 8AT1B 2WSEE 2VQ2A 3D9KA 2OEWA 4HCZA 5J08A 3S3MA 5IAYA 3JCMc 4XU1A 2YUPA 3SBSA 1FT1A 1SQMA 1M8MA 1M90U 3M58A 1BI7B 4JJNK 3AS8A 1WYXA 3C3QA 2DIQA 1N94A 3ONKA 2R58A 4C0EA 5D6WA 2EQKA 3REAB 2YLCA 4KGVB 5GAN4 1PHTA 2HCKA 1PAQA 2OTLQ 1HG5A 3IXEA 4AJWA 3L1AA 4ZFHA 1K8KG 2D6FA 4JPBW 2Y4XA 4HVWA 3N5BB 1OWPA 4N2SA 2ROTA 2LAHA 3EFRA 3UM3A 1BBZA 1IB8A 3HL8A 2P2CP 2I6HA 5GAN2 3P8HA 3G2UA 4OB3B 4Y92A 4C8QG 4F7UB 3Q7AA 3TG4A 5E75A 4HRNA 2PVDB 3ZYMA 2RA2A 2H6GA 1DCQA 3ZRHA 3MYVA 1GFDA 4C92G 5GAN6 3B7TA 3BEEA 1JB0E 2O9VA 1YI2A 2BUGA 3TWWA 2PL2A 2H6HA 1VYUA 2C06A 2B8AA 1M2VB 3NTHA 2OX7A 2L3SA 3V7SA 1E90A 4GZDA 1TEZA 2RB6A 5T3RA 3TXMA 2NUTA 2XIDA 1ZSZC 3HRAA 3T9NA 3SI5A 4K0RA 4HA8A 5CMYA 4J9IA 3ASFA 2WB2A 4QT7A 1JJ2S 2HQHA 2DL7A 3NQPA 3FTXA 5FQ8A 1AHJB 4PJLA 2IO3C 3VLFA 2EQIA 3CVVA 3SBTB 2PTKA 2OAUA 4C92F 1YI2Q 3IEGA 3R7RA 3HHMA 1VQPT 4F04B 1E6HA 2WXJA 2FPFA 3X25B 4J7WA 2KRSA 3I3NA 5CKEA 2RQUA 1M3CA 2CH4A 1QVFA 4M7CA 3TWXA 2QG9B 5I2MA 1OZ3A 2BTDA 3FIFA 3QKJA 4E6HA 3OMGA 4OGCA 5FLXE 1QCOA 1WDYA 3QHSA 3OYEA 1K8AU 3RDVA 1LD8A 3Q1JA 4MZMA 4EZJA 2NWMA 2F1LA 4URKA 3G4SQ 2QTXA 3ULYA 5JJTA 4MDXA 3DSVA 2RD1A 5EIBE 1VQNA 1Q7YU 2IOLA 1I5OB 3M0SA 5L23A 3CQCB 3KEAA 4N3CA 5AIJA 3A8GB 1TSFA 5GJVB 3AAAC 3PE4A 5GANj 3L2QA 1JRIA 3FTVA 4JD2G 4LNPA 4C0ZA 3VKIA 1N4PA 5B3SE 3VRZA 4B9XA 3G71A 3CV0A 3BDUA 3LLRA 4K11A 2XMFA 3CMAT 4AP2A 2LX7A 2RFMA 2EGCA 2J4BA 4FYVB 5AYFA 3FRNA 5LFAA 3V31A 3EFOB 3JUEA 2KVQG 2F37A 4I6EA 1FPPA 2DYBA 5KNGA 1R0CB 4D8KA 5KYYB 4LRZA 2PNNA 1VQNQ 1E7UA 1VYVA 1UGVA 1TYQG 4FJZA 2LT1A 5DM7R 1GBQA 4WNFA 1PCXA 2QA4A 2PM7A 1OCCE 4BT8A 3JB9H 2HAXA 3VTXA 4BX8A 2ZPBB 1K1BA 4LNBA 3VRYA 1T0HA 3BDLA 2KE9A 3X2QE 3G71Q 2HSPA 3WVDB 1SKUB 2J49A 3UQ3A 5B1BE 1VQ7T 4FHKA 3L82A 1MMAA 4RTYA 2R05A 4HOQA 3DRAA 1SRMA 1TUDA 4N5QA 2DXTA 2WM9A 4A3TA 3SD5A 3SDZA 1MHQA 1VDYA 1AWCB 4B9WA 2EYQA 2DEUA 3CCMT 4XAXB 2R2LA 3TWRA 4JRQA 4APOA 1E8XA 1KD1U 4DX5D 1CKAA 2YDLA 2L0IA 2QA4Q 3CPWA 1TR4A 3AU4A 3OYDA 3ZPJA 2CT3A 3ZU7B 2AIRB 4R56A 4A4GA 2UY1A 3ABLE 4M75A 2QC9A 3PRZA 1IO6A 2OCCE 4U04A 4FW2A 4B6MA 2BZYA 4EIKA 3CVPA 4UWLA 2FEZA 2VXFA 5CR2A 5IY5E 3FLGA 2EQXA 4J8EA 1TU0B 1FVFA 1Q2ZA 2ZAEA 3THKA 3QZ5B 2KBXA 3FEXA 5BT1A 2E0IA 2X6IA 5FZSA 1BYMA 4FU3A 3TG5A 4PJOG 1WY6A 2GTJA 1N8RR 2GFUA 2D0QB 4FCYA 1K9MR 1BB9A 1UGSB 2F0YA 3Q9UC 2CHZA 3FY4A 2AWIA 2VSYA 4B0ZA 3MKQA 1QKXA 2XKOC 3M54A 1VQ6A 1ZUUA 4J8DA 1RAEB 2GQVA 2LJ3A 5GANg 2X4YA 2XDDA 1H3ZA 1GFCA 5ENSD 4ILIA 4YNDA 2VXEA 4HVUA 4J6WA 1X2QA 4HBDA 5FTPA 2VGXA 3M57A 1E96B 4KUIA 4ABNA 1AWJA 4J8FA 4BSXA 1INZA 2M0OA 2YWWA 2VYTA 5IHIA 5L8RE 2EGEA 2EJFA 4BI3A 4EMKB 3CMEA 3G2VA 4DI4A 4MDWA 1KC8U 4LDXA 3ME9A 1K73R 3CCLA 3G6EA 4HNAD 1MV0B 5KBAA 1RAGB 2XD0A 5D66A 5IH2A 4E7JA 3CD6A 1M27C 1RAHB 2KI7A 5FROA 2CZ7B 4M75C 4M7DE 2K5LA 3RRMB 3QDRB 3RK6A 1KHCA 1QVFP 1H8KA 3L6AA 2R03A 3H9NA 3CXCS 1PKTA 1ZBJA 1Y07A 2PQWA 2XGMA 2DL3A 3L2UA 5JJ7A 1S1NA 3JCMd 5GMKh 3DB3A 4MKTA 1QVGS 3M59A 4EHMA 4JJCA 3CPFA 3OW2A 4UWFA 3CMEQ 2XGOA 4KYOB 5AJDA 3CCLQ 2P58C 4QQIA 3L2ZA 3URGA 1IREB 2KR3A 2E12A 4PS3A 1YJNT 3QWYA 3G2TA 1VQOQ 4WTOB 4F53A 2FPEA 2VYIA 3PZ4A 4PL6A 1TNBA 2FB7A 2XDBA 4DX6D 1UJYA 2DNUA 3T8KA 2RQVA 1C1AA 3CHPA 3M9QA 4OYSA 4TXPA 4FA6A 4M78E 1MGQA 5CERB 1M90R 1QQJA 3EG9B 1Q82C 3OYGA 3I55T 2KATA 5AJLA 1Y0MA 2GRMA 1ZUKA 2R02A 2OOEA 2V0PA 3JB9F 4LERA 5FWQA 4XQ3A 4Y28E 3EJNA 2ABLA 3JCMQ 1RABB 3JXIA 1N9RA 1N11A 1MNDA 2HNIA 4M7AG 3JQ0A 4Z88A 2QDLA 5IXBA 1EIFA 1UDLA 4MS6A 1ZSGA 4YDOA 5AQBA 2EBPA 5E76A 2V8IA 1UG3A 3ESKA 4PJNA 1RAIB 2FI7A 1OT8A 2J4DA 5GAMd 3NGPA 3FEYA 4BDYA 1KHIA 3FTSA 2DCPA 2XU8A 3CCVT 1SZAA 4IUUA 3WG7E 4F7UA 4BUGA 1T3LA 2CZ6B 4O5VA 4B8AA 4C5IA 3M56A 1EDUA 3UWNA 2HZYA 5IN1A 1BKBA 4MBGA 2RF0A 2LO6A 5ENPD 1LCKA 3CPWP 1MJ0A 3SEMA 3FUMA 1DNPA 4J8SA 1UHCA 2CYZB 2DXUA 5LJ3d 3X20B 4WAFA 3RNJA 3JCMW 3FUHA 3SWNB 1M1KC 2C2LA 2WXQA 3TEEA 1O75A 4DI3A 4FJYA 4M77E 9ATCB 1SZ9A 4CT4A 2J05A 1H2VC 2LNVA 3VS0A 3ZFJA 3SFZA 4C0GA 4DQ2A 1GBRA 4FSSA 3C72A 3LVQE 4JHJA 1TS9A 2Y90A 5CVIA 2DFUA 3VS4A 1SF9A 4M3OA 3QARA 3CC2A 5B1AE 3CCRT 1M1GA 2JS2A 1JCSA 1KJWA 1DCEA 5ARGA 2XPZA 2F69A 4WNGA 3RO2A 1UGPB 4DA4A 1A17A 1N4SA 3FEOA 1EPUA 2P0PA 4B8CB 1Q82R 3LKUA 5KYUB 3M5AA 3PFSA 1FYNA 1GL5A 3SHWA 5GMKe 3CCVQ 2L0AA 1RACB 4BE2A 5CRVA 2DTHA 4N4HA 3CHSA 2RI5A 3CC2Q 4KZCA 4IIOA 5GAN5 3Q73A 2XZDG 4Q5WA 1K8AR 2AW6A 1L5JA 1Y6IA 2GCXA 4Z89A 2AKKA 1BLXB 4FL6A 4FADA 4HFGA 2RQWA 1Q7YR 3R9AB 4RTUA 4G1TA 2RK1A 1OY3D 4BESA 3IV0A 1YNZA 1UOHA 2XZTG 4J6YA 2PVOB 3RRNB 2QYJA 3OBYA 3LJ3A 3RU0A 3ZXPA 2J7IA 1XTDA 2LXMA 4I1OB 1M1KR 4Y6CA 1YWPA 4EBAG 5ANLA 3CC4Q 3RO3A 2XDPA 1RI0A 1RI9A 4M7DF 3M53A 3EFOA 3OW2P 5HY6A 5LJ5h 4PFZA 4L23A 1B3QA 5HKPA 3HHTB 1X01A 2KGTA 2DWZA 1QMCA 5KYYA 3LY8A 4M78G 3RR6A 3NZSA 1M30A 1YYHA 1H6PA 2V5FA 4FW1A 1HG2A 3CCEQ 2ILRA 3OS0A 1NP7A 3FUJA 3RESA 2F8YA 2Y4UA 3AJIA 2CHXA 2EJ9A 4M75D 4E7ZA 3JQ1A 1TUGB 2FG0A 1WPYA 4TVRA 1FWZA 5GMKm 1IXVA 2QAZA 2F2XA 3V8LA 1WAO1 1SRLA 3EHNA 1N0QA 4ILHB 1YFNA 3FJ5A 1HD3A 4YVOA 1SEMA 2AZVA 2RHIA 2RJDA 1H19A 2JABA 1EX4A 2JOYA 3Q9NC 3OMCA 2IF4A 2V8KA 4AXHA 5CHEE 1AZGB 3P1UA 2J6OA 3C95A 3KD7A 1WHMA 3JSCA 3QJ6A 5GAN8 4A1GA 1LPLA 3R6OA 2WXHA 4M78F 2E6NA 2QZAA 3S7DA 1NPPA 3TWVA 5KH6A 3CVLA 3LDZA 4L2LA 3FU5A 3E2UA 2IO2C 1G3SA 3JYSA 1HX8A 2MMPA 3PZ2A 4PUCA 3MGBA 1VQMT 1M3AA 2KEAA 2Y1LE 4O60A 3E9GA 1Z9ZA 4AY5A 2QGGA 1WG0A 5G04J 2J06A 1KQSS 1PRMC 2QASA 3CEYA 2V26A 1G3NB 2D8HA 4U7EB 3X26B 4A4EA 5A7DB 3E30A 1V54E 2WSCE 2IU1A 5GANf 5CEDB 1YN8A 4IUQA 5EX3A 1WFWA 2OVBA 2L8DA 3HXFA 3BW1A 1VQ9A 2ENMA 4UI9K 1G8XA 1HZ4A 2IY0C 1O1RA 1XQHA 2UY1B 4GPMA 2QQAA 1J3TA 2PM6A 1N9SA 4M77F 4C8QE 3FDRA 1JJ2A 2XQ0A 2FRWA 4I17A 2EQMA 4XTWA 4OVUA 2QGFB 4EMKA 2YHTA 1EFNA 1ZA1B 2X35A 1KT0A 2ETBA 1SSHA 5FJYA 4AOFA 5I21A 5LX8A 1UECA 4U8HA 2DVJA 1WHHA 2ZISA 2EFIA 3HTRA 1N8RU 3LJNA 5BUZA 1YIJT 2FL7A 4HLLA 5FU6B 2EIKE 2Y4YA 4R55A 1Z3YA 3HSBA 4JPSA 5G05J 1LD7A 3SFYA 1VQ9Q 5LJ5e 3CVNA 3CKBA 4CDNA 1BI3A 1R8OB 4PNOA 3EFSA 1N27A 3NTKA 4UQXA 3H0FA 4DK5A 3TWTA 4LUDA 4XE0A 5CCMA 4K5AB 4RTXA 3FC3A 3I35A 4RSYA 3O8VA 3OSSC 4ANUA 3A98A 2K2MA 4KGZB 1KZPA 2FF4A 3D9JA 3X24B 1OUVA 4OMOA 2DBMA 3X28B 2WMOA 4GLMA 3ML8A 5A0LA 1OULA 2G3RA 2DBKA 3ASDA 1IYGA 1W6XA 1ZQ1A 2IG0A 2QEXA 3TL5A 4J7FA 3LY9A 3ZBDA 3AS5A 2LNIA 1WXUA 3QIIA 3CCQT 1WJQA 2MAMA 4OMMA 3OYCA 1IGQA 3PH0C 1VIFA 2M02A 5LCWJ 3DXMG 4CGWA 3C3RA 4EMKC 4I6JA 3HKSA 4FT2A 4RG2A 2OTLT 4J9DA 5I11A 3RKYA 3QWWA 2CP5A 3WXMB 3EG9A 2LSUA 4TRQA 1WM5A 5CAIA 3QOUA 4XIFA 2AXZA 4U96D 1QWFA 2BZXA 1FXXA 1HFAA 3FU6A 4ACLA 3OS2A 2GFAA 1VQKQ 2Y4TA 4FC8A 1TJCA 2PQNA 1LOJA 2CZ1B 3MP8A 4E47A 1S72Q 3ASHA 3H0IA 1OV3A 2WPVA 1OX9A 4ACKA 3DPYA 5T8IA 2HM8A 3J5PA 2P9KG 1AD5A 1JO8A 3FH7A 1NZ9A 3MX3A 2DJQA 4B93B 4J9FA 1YJWQ 1W2BA 1N54A 4F14A 2DF6A 1YHQA 2L6JA 4GTTA 2C0LA 4NACA 1V55E 2QXFA 2KRMA 2GRNB 2J9QA 1LNXA 2D9TA 1SA5A 5G05C 2A3LA 2CG3A 3NFCA 4CDMA 1FVHA 3CCQQ 3H41A 1E8WA 1SW6A 2X6HA 3NZUA 5JMND 3OBWA 4KH0B 4BY6B 3SWNA 1G3WA 4D8DA 1GRIA 3PIOA 3HG0D 1ABQA 2KDSA 3PNLB 5JJ6A 5CO7A 2BIVA 5LP0A 1MYOA 2LCLA 4PLLA 4JZYA 1D0XA 3A8LB 5DLQE 1G2BA 2V5QC 4Y91A 1KLXA 1Z5SC 1YI2T 1D1AA 2R5SA 4OVVA 2E3IA 3EIQC 1GCQA 3TSZA 5LCWC 5CKHA 2WVIA 1SPKA 3E33A 4ATGA 5KYNA 2OAWA 4IUVA 3MP1A 5ENNA 3PIPA 1IHWA 2RO0A 2DYIA 3MKRA 4F6RD 2E5KA 3SD4A 3LWHA 1BD8A 1Y7XA 5KYUA 3FU3A 4QFVA 1TWBA 3G4ST 2K5IA 1QW1A 1ZB1A 2PVGB 4HQDA 1PRLC 2X3XD 4BTAA 3CLJA 4GTRA 3UPUA 5KWDA 1JJ2P 3OA6A 2K5FA 3RMQA 4XKBA 1HXIA 2K7AA 4OVAA 4KGXB 4JA7A 3C0CA 2CHWA 1NA0A 4GTOA 3CGHA 3SWNC 4AFUC 3CSTA 1M9SA 4PJOE 5HK0A 3D9MA 3ZW3A 1M8VA 1D3BB 4KVOA 4C8QF 4IUTA 2FULA 3B13A 5M72A 1IHBA 2WXOA 2LJ1A 4OB2B 3CXCA 3M0UA 3HVEA 1PKSA 3C94A 4L1BA 1Q82U 2RQTA 2I1KA 2X3MA 1X5BA 3Q75A 5D6XA 1QVGA 3DSXA 2WXNA 1VQNT 4RCBA 2V8SE 2EIJE 4GCOA 5CKBA 4BWRA 1Z9QA 1GCQC 3MP6A 3I5SA 4IN3B 2I0NA 1QNFA 2NXPA 1WQ7A 2BE9B 3RRUA 5A2QE 2ZPHB 3G71T 1N5ZA 5C6SA 2JS0A 2KBTA 3QWXX 1JXMA 4K5CA 5GAOp 1R77A 1AZEA 1FMKA 2OV8A 4NURA 3QC1A 5JA4D 5KJNA 2J6KA 1A0NB 3O48A 4GZ5A 2DL8A 1JWFA 1RW2A 5AENA 4M77B 2QQSA 2QA4T 1M1KU 1WNLA 2I1JA 2E5QA 1OOTA 3C12A 2MOXA 3GYZA 1H0AA 2E41A 4RQIA 2KCKA 3NPFA 4JZ3A 3IKOB 2IONA 4BI4A 2EKOA 3SFXA 3JXJA 3MV3B 2DKGA 4GA2A 3D9PA 1JCRA 4L5GA 3EGUA 3WXXA 3TAXA 1EYHA 3FTWA 1BI2A 1HO8A 3GP8A 3H0HA 1VIEA 3KFVA 4TUMA 4M75E 1Q86C 1W2BP 3I4GA 2YSQA 3G7ZA 3OB9A 3Q47B 3GF5A 4EMGA 3EU5A 2X4JA 3QB2A 2L5QA 2XS8A 3AHUA 3B7RL 4KT6B 2IVWA 1QP3A 2CH4W 3V8JA 4RG8A 4A63B 2I2OA 4N39A 2L3QA 3DPDA 1H2UA 1FCHA 1P92A 4I6GA 2EYYA 5GMKj 3PZ3A 1QCFA 2HR2A 5HI7A 2L2PA 1WJSA 3VV0A 4A4FA 4DBRA 1NEGA 3ZYLA 1I8FA 3A8HB 3ZXSA 5CBOA 4ANJA 4HOSA 3LGLA 4HVVA 4M7AE 4D10C 4FYYB 4XK8E 1ELWA 2MIOA 4PDXA 1GXIE 3JB9J 2QK0A 3UATA 1YJ9A 1N4RA 1MNEA 4GU5A 4WWPA 1B89A 5GAOr 3MJXA 2ETAA 2NUZA 1NEBA 3S7BA 1C6VX 1BCOA 2DZOA 4GZCA 2B6CA 2LSVA 3V8KA 4RG9A 4RLYA 2E10A 1RAAB 4GA0A 1H6OA 4DX2A 1KZOA 3V79K 1VQ6T 3FTZA 2E65A 1NYGA 2QQRA 4OMNA 2LQ8A 2X6FA 4ZTFA 4XU2A 4ME2A 3U3WA 2KXCA 2ZU6B 5DIZA 4X8QA 3D9HA 2IIMA 4L2YA 3TSWA 3MO8A 1B7TA 2EIFA 2EYZA 4DOVA 3G2WA 4KRTA 5D6YA 3CCUA 4GLKA 4LSZE 1YJ9Q 1KSWA 4JL0A 4BE1A 2QY7A 4BI8B 4DBQA 1LF8A 3CMET 3PNWC 1UUEA 3ER0A 2DE0X 3CCLT 1HK9A 2ATCB 1XNFA 1B07A 3CCMA 4OB1B 2DRKA 1TXQA 3JCMh 4J7IA 2XCBA 3Q15A 1QCNA 1YCSB 2JTFA 4CEMA 1VQOT 4O1OA 5BV1A 3K9IA 1PD0A 4JEHA 2KRNA 1BI1A 4LD6A 3ZL7C 2XPYA 3V30A 4A55A 3EH2A 4TUUA 4E7HA 3CXCP 2MF2A 5EYPF 1MV3A 4FIBA 4TXRA 3S3OA 4OB0B 2KXPC 1QZ2A 3QZ9B 3GNGA 4E2FB 3ENEA 2LX9A 1OCOE 3CCUQ 2YUOA 4CI0C 4G25A 3DLMA 1QVGP 2E3HA 2KROA 4HRMB 2M16A 3HXCA 1WQWA 4PJOF 2YLBA 2PZIA 1Z6TA 4GAAA 3HRTA 1GCPA 1VQ6Q 3DWLG 3NTIA 3QDFA 2AZSA 4AMCA 1RUWA 3V2XA 1JPLA 4JRKA 4NL2A 2AT1B 5KE2A 3SNXA 3DEPA 2JM8A 2EINE 2OEVA 4JS5A 3QAQA 3RIRA 3L9TA 3ULEG 1ZLMA 1CKBA 2VSXE 5FU6C 4Q69A 3L22A 3LCAA 2VUBA 2XEHA 3G6EQ 3KUFA 4U95D 4Y6WA 3S2AA 2F8XK 3CD6Q 1SHFA 3FWVA 2HE0A 4XTZA 4EDUA 4OP0A 2P9UG 2CZ0B 3OYLA 4APFA 4H7XA 1WHGA 5KCOA 3CHOA 3CHRA 5T4YA 5GAMh 4JZ4A 2RG8A 4M75G 3AG2E 2HDAA 1PM3A 2GNCA 3TWUA 4RTZA 3ZYKA 4ATZD 1VOMA 2RM4A 3AG4E 2A36A 3TWSA 4X9DA 4XX5A 2DTIA 2AXUA 5AN8A 4C8QB 3CCJA 5LJ3h 4HORA 3FB9A 1Y96B 2K9GA 1OQKA 4BY6A 2C0IA 4ZNXA 2EW3A 3UUXA 2A4ZA 3OS5A 4C92B 2FO1E 2CDTA 4PJMA 3U9WA 3NOCD 5CQYA 4PKCC 4PJJA 4IULA 3E32A 2GBQA 4IIMA 4HCBA 2EAYA 2XICA 2I9CA 4M7DA 3NF1A 1EZZB 3BG0B 5FQ4A 4L59A 4LEUA 1WI7A 3L2VA 4ZGDB 2RKKA 1OCZE 4M4ZA 2NC9A 3PMTA 1AP7A 4UC4A 1NPRA 1BU1A 1BI8B 2DRMA 4M75F 1VQ8A 5I22A 3TWQA 4U63A 2IQCA 4V2SA 4KXKB 1UHFA 5LJ5j 1Y71A 1HJDA 2PNIA 2O2OA 4GTMA 3CCJQ 4LE9A 2V8JA 5AAOA 3OTNA 3IBEA 3KSQA 3CVYA 3CC2T 3J7AF 5BW8C 4HT8A 2W0ZA 2CSQA 5GAOq 2COZA 1OWMA 1YP5A 5FQ7A 3CK9A 5ENQD 3UDCA 3JCMe 1AEYA 2RH2A 2MYSA 4M7AF 3NBNB 3I55A 2ZGDA 5FIOA 1CSKA 3VTYA 1KFZA 1S70B 2H8HA 2LQNA 2CS7A 1VQ8Q 3CC7A 1TH7A 3LPZA 5FQ6A 2DZ9A 4BY6C 1RLQC 2F2VA 4M78A 2LQWA 1D3BA 1OCRE 4RCCA 1UN9A 3CC4T 4CC3A 2CREA 3J5QB 4QKUA 2J8SD 1WJRA 3NHNA 2JN0A 4M7DC 2D8JA 2IEJA 3OYYA 1IQUA 5ENOD 4DRXE 1S64A 2E1HA 2XRZA 2H3EB 2KZTB 1BIAA 2GQIA 1ABOA 4C9BB 3CCET 3M0RA 2X6JA 2DA9A 1I5LA 5ECAA 3R7QA 2XK0A 1OU8A 2FZGB 2A5EA 2RHYA 2RJFA 4EZLA 4U8VD 2DAQA 2DXCA 2A5UA 3CC7Q 2L9BA 5FZRA 2R17C 3O4ZA 5CRUA 1TNYA 3OYNA 1PG5B 3PZ1A 4W9RA 3GBQA 3HFNA 2M0YA 3L13A 2BEDA 4N3BA 3UIPC 1ZA2B 2HL3A 2NYJA 2DVWA 3TGOA 2DL4A 2RD0A 5GAMe 2ZIRA 3S6WA 2NLUA 3LH0A 1BCMA 2C0TA 4BEPA 3HVEB 2DJZA 3FJPA 3CR3A 4XZ4A 3VUBA 2JLBA 3LVRE 4M77A 4Q94A 2HQXA 2VKNA 1E7VA 2P4TA 4DEYA 1PY1A 3CBOA 1M4ZA 3EGDA 4N4GA 3MEKA 4UWGA 4BTBA 3PGGA 5LJ3e 2VGYA 4F1SA 4F7UG 3M0PA 3PS6A 1NJIC 1A5EA 3LW5E 3OY9A 5LJ5g 2PUOB 1BPOA 1TNOA 3FHEA 7AT1B 2C0OA 3CIAA 3SHFA 4DX1A 4H7YA 2BUDA 3OYFA 4ME7A 4O6JA 4A53A 4OGEA 4RTVA 3FH5A 2AJAA 2KCLA 2I2LA 4ZTJA 3UM0A 4G24A 3EH1A 2YNQA 3L2RA 3VLEA 2LP5A 1TN8A 2BTTA 1NLPC 5IHNA 3JB9D 4U0SA 3Q78A 1AOJA 2DZNA 4LDWA 5GAN3 2OTJA 5FT9A 4HI9A 1SVXA 3L16A 1FMVA 2LJ0A 3HIZA 2M63A 3U66A 4ZGEB 4ELZC 3EG1A 2J6FA 1VQLA 4FHJA 3CKCA 5BV0A 5KYWB 4FYXB 1VQ4A 3FUFA 4JLGA 3UKUG 3CSFA
chains in the Genus database with same CATH topology
1UGVA 2DF6A 1GBQA 2W10A 1V1CA 1SHGA 4F17A 2LCSA 2KRMA 3PVQA 1K1ZA 1K1BA 3VRYA 1T0HA 2GGRA 2BKKB 2KE9A 5FWCA 3H41A 4OMLA 4RUGA 2HSPA 1K3ZD 1T0JA 1SW6A 5JMND 3SO8A 2EKHA 1BU9A 4RTYA 3U23A 4F16A 1SRMA 2YUNA 5FW9A 4D8DA 1TUDA 1OEBA 4N5QA 1QLYA 1GRIA 4RTWA 3HG0D 4X1VA 1AWCB 1ABQA 2FPDA 4AFSC 2BZ8A 3TWRA 1MYOA 2LNHB 1I07A 2YUQA 1QYMA 4DX5D 1CKAA 3B7BA 2KXDA 2YDLA 1G2BA 3I9QA 2V5QC 5ENTD 3ZNGA 1TR4A 1HSQA 4JJBA 2D0NA 2CT3A 1GCQA 3ZU7B 3TSZA 5EIDA 1SPKA 2HBWA 4LN2A 5IHKA 2RN8A 2OAWA 2QC9A 1WXTA 1I0CA 1IO6A 2X3WD 4F6RD 3EHRA 2E5KA 2BZYA 2EVRA 2CUDA 4EIKA 5AARA 1BD8A 4QFVA 4JB8P 5AQ9A 1X69A 1IKND 4HQDA 1PRLC 2X3XD 3THKA 3UF4A 3VS5A 1T3SA 2KBXA 1NLOC 5KWDA 1VA7A 1W70A 2A28A 2KYMA 5CEAA 2GTJA 1BB9A 2K7AA 3Q9UC 3C0CA 2RMOA 5ITZF 1QKXA 4AFUC 3UXGA 4E6RA 2MCNA 4OAVB 1ZUUA 2LJ3A 3ZUVB 1QKWA 1K4US 1GFCA 5ENSD 2O9SA 1IHBA 2LJ1A 2RFAA 1YMPA 2OJ2A 2MYOA 3M0UA 4HVUA 1PKSA 1X2QA 4HBDA 2FEIA 2RQTA 4AFZC 1AWJA 4WCIA 2XENA 5IHIA 5AQAA 1K1AA 2EGEA 1MX2A 3R6NA 1Z9QA 4HNAD 1GCQC 5KBAA 1MV0B 2ED0A 5D66A 3I5SA 5IH2A 1M27C 1AWWA 2I0NA 3NMZC 1RLPC 5HCKA 5BXUA 1X43A 2V1RA 5EC7A 1UJ0A 1E7OA 3DEOA 4CYMD 1N5ZA 2KT1A 2ROLA 1H8KA 2JS0A 2KBTA 3QWXX 1JXMA 1PKTA 4K5CA 1ZBJA 4OMQA 2DL3A 1AZEA 1FMKA 2JM9A 4DEXA 1S1NA 5JA4D 1OPKA 4BSZB 3V2OA 1WA7A 2EGAA 2JMCA 1UE9A 3VS1A 2J6KA 5EILA 1A0NB 2DM1A 4JJCA 2DL8A 3LH5A 4YDYA 5AQ7A 4QQIA 4AFQC 4O1PA 2KR3A 1JXOA 1OOTA 2MOXA 1WLPB 3QWYA 2FPEA 3NPFA 4HB5A 4JZ3A 2LMJA 2RNAA 5FWBA 4DX6D 1UJYA 3JXJA 1VYTA 3T8KA 2DNUA 2RQVA 4NIKA 3UA7A 2EYXA 1JEGA 3EGUA 2A08A 2K6DA 4BERA 4C48B 3H0HA 3KFVA 4TUMA 1PWTA 5CERB 3CQTA 2YSQA 3VS3A 1K9AA 1Y0MA 2JT4A 1ZUKA 2Y0BG 4U8YD 1NFIE 2ABLA 4J8YA 1W1FA 2CH4W 3VS2A 3JXIA 4A63B 4GBQA 1N11A 2L3QA 2EYYA 4Z88A 2QDLA 1QCFA 5IXBA 1WIEA 1UFFA 1UDLA 2L2PA 1ZSGA 2G6FX 5AQBA 2SRCA 1NEGA 4LNUD 1WDXA 2EBPA 5CBOA 1DC2A 4HVVA 1OT8A 3RBBB 1UG1A 4Z8AA 3PVLA 1XOVA 2MIOA 3EG0A 3NGPA 3UATA 3ZKJA 1WXBA 2V1QA 1T3LA 2ETAA 2ECZA 2NUZA 1NEBA 3REBB 1QWEA 2ETCA 2RF0A 5ENPD 1LCKA 3I5RA 2BKGA 2DZOA 3EHQA 1MJ0A 3SEMA 1UHCA 1ARKA 2RQRA 3RNJA 4RLYA 4K5BA 4DX2A 2JTEA 3V79K 2SEMA 1NYGA 4OMNA 1GBRA 4CZ2D 1X27A 2J05A 3VS0A 5FINA 2KXCA 4FSSA 1K0SA 3C5RA 3D9HA 2ZGGA 2IIMA 3M0TA 3TSWA 3VS4A 2EYZA 4KRTA 1D9SA 4LSZE 2LZ6B 1KSWA 5IXFA 2O31A 2JS2A 1UUEA 1KJWA 2DE0X 2OI3A 1H92A 3JV3A 1B07A 2CSIA 2DRKA 1NG2A 4LG6A 1YWOA 1YCSB 2DL5A 1E6GA 3VS6A 4O1OA 2FRYA 1ZX6A 2RPNA 2KRNA 1FYNA 1GL5A 3SHWA 3ZL7C 4ZHBA 3V30A 2L0AA 5KNHD 5EYPF 1MV3A 2KXPC 3VS7A 2YUOA 1K76A 4IIOA 2K3BA 2XZDG 2KROA 2DX1A 4J9BA 4HRMB 4CC7A 4Z89A 2AKKA 1GCPA 1BLXB 3O5ZA 3UTMA 2VGEA 2AZSA 2RQWA 5BXOA 1RUWA 3V2XA 3W9GA 4RTUA 2V4HC 2VVKA 2PZ1A 1OY3D 4BESA 3W9FA 1YNZA 1AWOA 4AG1C 1UOHA 2XZTG 3DEPA 2JM8A 4J9GA 2QYJA 1BK2A 4J9HA 4LUEA 2J7IA 1ZLMA 1CKBA 2A37A 2DLPA 1YWPA 2D1XA 4OMPA 2XEHA 4DX7D 1H3HA 4HRLA 5CBNA 1RI9A 4U95D 2F8XK 1G83A 1SHFA 2HE0A 2M51A 1B3QA 5HKPA 2KNBB 5EYLA 1Y57A 2KGTA 2DWZA 4J9CA 3IQLA 1JU5C 1PNJA 4JZ4A 4AG2C 1I1JA 1M30A 1YYHA 1ZUYA 2HDAA 5ENRD 2GNCA 3TWUA 2JW4A 2F8YA 4ATZD 4RTZA 4HXJA 3AJIA 2A36A 4ESRA 3TWSA 2EPDA 2FG0A 4G8LA 1AVZC 4CC2A 1MX4A 5AN8A 1IXVA 2KT8A 1OPLA 4HCKA 2F2XA 4BETA 1NM7A 2K9GA 1SRLA 1X6GA 2C0IA 1N0QA 4ZNXA 3FJ5A 2EW3A 1HD3A 2ED1A 4GMRA 1SEMA 2AZVA 2FO1E 2CDTA 3ULRB 3NOCD 2JABA 3Q9NC 2GBQA 4IIMA 1TG0A 2P4RA 1AZGB 2J6OA 1U06A 1WI7A 4M4ZA 1AP7A 1BU1A 1BI8B 2CT4A 2DRMA 5I22A 3TWQA 2YUPA 1M8MA 1HJDA 1UHFA 1BI7B 2PNIA 3TWVA 1UTIA 2O2OA 4LE9A 2F2WA 1WYXA 5AAOA 4JJDA 4RTTA 2W0ZA 2CSQA 3REAB 2K79A 1M3AA 1PHTA 1YP5A 2EYWA 2Y1LE 4O60A 2HCKA 1Z9ZA 2KEAA 1AEYA 5ENQD 3TVTA 1WG0A 2AKLA 2J06A 2KYBA 3IXEA 1PRMC 3NBNB 1WX6A 4ZFHA 1G3NB 2D8HA 3EG3A 2ZGDA 3EU9A 5FIOA 1CSKA 2VWFA 4HVWA 1S70B 4JPBW 1KFZA 2H8HA 2ROTA 4DUIA 2LQNA 4OAUC 1BBZA 2FO0A 2P2CP 5CEDB 2YT6A 1YN8A 4Y92A 1WFWA 1RLQC 5CECB 2F2VA 2LQWA 1U3OA 2B0OE 4HRNA 2ENMA 1DCQA 4CC3A 2CREA 1MUZA 3J5QB 2AK5A 1J3TA 2J8SD 3B95A 4GPMA 4J9EA 3NHNA 1GFDA 5HRYA 3EG2A 2D8JA 2FRWA 1N0RA 3T9KA 5ENOD 4DRXE 2O9VA 3TWWA 1EFNA 2GQIA 1ABOA 1VYUA 4F1PA 2B86A 3M0RA 2DA9A 5ECAA 2HEQA 1AWXA 2CUBA 2ETBA 2L3SA 2A5EA 5EN5D 1SSHA 2GTOA 1UECA 4U8VD 2DVJA 3LJNA 4HLLA 3HRAA 4HI8A 1KIKA 2L6BA 3GBQA 4J9IA 2JMAA 2M0YA 4QT7A 2DL7A 2NYJA 2DVWA 2DL4A 3M0QA 2XEEA 3H0FA 2EQIA 3TWTA 2PTKA 4LUDA 4K5AB 2C0TA 4RTXA 3F6QA 4BEPA 4UUCA 4Z68A 3I35A 1U5SA 1E6HA 2K2MA 3A98A 2FPFA 4J7WA 2KRSA 2VKNA 2DMOA 4OMOA 2DBMA 4DEYA 2RQUA 3NOGD 1M3CA 2CH4A 3TWXA 5GJWB 4GLMA 2DBKA 1W6XA 1WDYA 2DILA 1WXUA 3M0PA 3UA6A 4OMMA 2NWMA 4YDWA 1A5EA 4CC4B 5EIBE 3UI2A 5HS0A 2C0OA 3M0SA 4DX1A 5L23A 1MX6A 3KEAA 2L3PA 5GJVB 4RTVA 4J9DA 5I11A 3AAAC 1NYFA 2AJAA 1JQQA 1X2KA 4LNPA 1TUCA 3VRZA 4U96D 1QWFA 2BZXA 2LP5A 4K11A 2BTTA 1NLPC 5IHNA 2XMFA 2ESWA 4G8KA 1K0XA 1AOJA 2DZNA 2O88A 1M3BA 2LX7A 2RFMA 4HI9A 2EGCA 3PE0A 1SVXA 1X6BA 2LJ0A 3V31A 3JUEA 3H0IA 2F37A 1OV3A 2DYBA 2JXBA 3EG1A 5KNGA 2J6FA 3J5PA 1AD5A 2DJQA 1JO8A 4D8KA 4J9FA 4B93B 4R0KA 2PNNA 4F14A 4ORZA 1VYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGV A;  2DF6 A;  1GBQ A;  2W10 A;  1V1C A;  1SHG A;  4F17 A;  2LCS A;  2KRM A;  3PVQ A;  1K1Z A;  1K1B A;  3VRY A;  1T0H A;  2GGR A;  2BKK B;  2KE9 A;  5FWC A;  3H41 A;  4OML A;  4RUG A;  2HSP A;  1K3Z D;  1T0J A;  1SW6 A;  5JMN D;  3SO8 A;  2EKH A;  1BU9 A;  4RTY A;  3U23 A;  4F16 A;  1SRM A;  2YUN A;  5FW9 A;  4D8D A;  1TUD A;  1OEB A;  4N5Q A;  1QLY A;  1GRI A;  4RTW A;  3HG0 D;  4X1V A;  1AWC B;  1ABQ A;  2FPD A;  4AFS C;  2BZ8 A;  3TWR A;  1MYO A;  2LNH B;  1I07 A;  2YUQ A;  1QYM A;  4DX5 D;  1CKA A;  3B7B A;  2KXD A;  2YDL A;  1G2B A;  3I9Q A;  2V5Q C;  5ENT D;  3ZNG A;  1TR4 A;  1HSQ A;  4JJB A;  2D0N A;  2CT3 A;  1GCQ A;  3ZU7 B;  3TSZ A;  5EID A;  1SPK A;  2HBW A;  4LN2 A;  5IHK A;  2RN8 A;  2OAW A;  2QC9 A;  1WXT A;  1I0C A;  1IO6 A;  2X3W D;  4F6R D;  3EHR A;  2E5K A;  2BZY A;  2EVR A;  2CUD A;  4EIK A;  5AAR A;  1BD8 A;  4QFV A;  4JB8 P;  5AQ9 A;  1X69 A;  1IKN D;  4HQD A;  1PRL C;  2X3X D;  3THK A;  3UF4 A;  3VS5 A;  1T3S A;  2KBX A;  1NLO C;  5KWD A;  1VA7 A;  1W70 A;  2A28 A;  2KYM A;  5CEA A;  2GTJ A;  1BB9 A;  2K7A A;  3Q9U C;  3C0C A;  2RMO A;  5ITZ F;  1QKX A;  4AFU C;  3UXG A;  4E6R A;  2MCN A;  4OAV B;  1ZUU A;  2LJ3 A;  3ZUV B;  1QKW A;  1K4U S;  1GFC A;  5ENS D;  2O9S A;  1IHB A;  2LJ1 A;  2RFA A;  1YMP A;  2OJ2 A;  2MYO A;  3M0U A;  4HVU A;  1PKS A;  1X2Q A;  4HBD A;  2FEI A;  2RQT A;  4AFZ C;  1AWJ A;  4WCI A;  2XEN A;  5IHI A;  5AQA A;  1K1A A;  2EGE A;  1MX2 A;  3R6N A;  1Z9Q A;  4HNA D;  1GCQ C;  5KBA A;  1MV0 B;  2ED0 A;  5D66 A;  3I5S A;  5IH2 A;  1M27 C;  1AWW A;  2I0N A;  3NMZ C;  1RLP C;  5HCK A;  5BXU A;  1X43 A;  2V1R A;  5EC7 A;  1UJ0 A;  1E7O A;  3DEO A;  4CYM D;  1N5Z A;  2KT1 A;  2ROL A;  1H8K A;  2JS0 A;  2KBT A;  3QWX X;  1JXM A;  1PKT A;  4K5C A;  1ZBJ A;  4OMQ A;  2DL3 A;  1AZE A;  1FMK A;  2JM9 A;  4DEX A;  1S1N A;  5JA4 D;  1OPK A;  4BSZ B;  3V2O A;  1WA7 A;  2EGA A;  2JMC A;  1UE9 A;  3VS1 A;  2J6K A;  5EIL A;  1A0N B;  2DM1 A;  4JJC A;  2DL8 A;  3LH5 A;  4YDY A;  5AQ7 A;  4QQI A;  4AFQ C;  4O1P A;  2KR3 A;  1JXO A;  1OOT A;  2MOX A;  1WLP B;  3QWY A;  2FPE A;  3NPF A;  4HB5 A;  4JZ3 A;  2LMJ A;  2RNA A;  5FWB A;  4DX6 D;  1UJY A;  3JXJ A;  1VYT A;  3T8K A;  2DNU A;  2RQV A;  4NIK A;  3UA7 A;  2EYX A;  1JEG A;  3EGU A;  2A08 A;  2K6D A;  4BER A;  4C48 B;  3H0H A;  3KFV A;  4TUM A;  1PWT A;  5CER B;  3CQT A;  2YSQ A;  3VS3 A;  1K9A A;  1Y0M A;  2JT4 A;  1ZUK A;  2Y0B G;  4U8Y D;  1NFI E;  2ABL A;  4J8Y A;  1W1F A;  2CH4 W;  3VS2 A;  3JXI A;  4A63 B;  4GBQ A;  1N11 A;  2L3Q A;  2EYY A;  4Z88 A;  2QDL A;  1QCF A;  5IXB A;  1WIE A;  1UFF A;  1UDL A;  2L2P A;  1ZSG A;  2G6F X;  5AQB A;  2SRC A;  1NEG A;  4LNU D;  1WDX A;  2EBP A;  5CBO A;  1DC2 A;  4HVV A;  1OT8 A;  3RBB B;  1UG1 A;  4Z8A A;  3PVL A;  1XOV A;  2MIO A;  3EG0 A;  3NGP A;  3UAT A;  3ZKJ A;  1WXB A;  2V1Q A;  1T3L A;  2ETA A;  2ECZ A;  2NUZ A;  1NEB A;  3REB B;  1QWE A;  2ETC A;  2RF0 A;  5ENP D;  1LCK A;  3I5R A;  2BKG A;  2DZO A;  3EHQ A;  1MJ0 A;  3SEM A;  1UHC A;  1ARK A;  2RQR A;  3RNJ A;  4RLY A;  4K5B A;  4DX2 A;  2JTE A;  3V79 K;  2SEM A;  1NYG A;  4OMN A;  1GBR A;  4CZ2 D;  1X27 A;  2J05 A;  3VS0 A;  5FIN A;  2KXC A;  4FSS A;  1K0S A;  3C5R A;  3D9H A;  2ZGG A;  2IIM A;  3M0T A;  3TSW A;  3VS4 A;  2EYZ A;  4KRT A;  1D9S A;  4LSZ E;  2LZ6 B;  1KSW A;  5IXF A;  2O31 A;  2JS2 A;  1UUE A;  1KJW A;  2DE0 X;  2OI3 A;  1H92 A;  3JV3 A;  1B07 A;  2CSI A;  2DRK A;  1NG2 A;  4LG6 A;  1YWO A;  1YCS B;  2DL5 A;  1E6G A;  3VS6 A;  4O1O A;  2FRY A;  1ZX6 A;  2RPN A;  2KRN A;  1FYN A;  1GL5 A;  3SHW A;  3ZL7 C;  4ZHB A;  3V30 A;  2L0A A;  5KNH D;  5EYP F;  1MV3 A;  2KXP C;  3VS7 A;  2YUO A;  1K76 A;  4IIO A;  2K3B A;  2XZD G;  2KRO A;  2DX1 A;  4J9B A;  4HRM B;  4CC7 A;  4Z89 A;  2AKK A;  1GCP A;  1BLX B;  3O5Z A;  3UTM A;  2VGE A;  2AZS A;  2RQW A;  5BXO A;  1RUW A;  3V2X A;  3W9G A;  4RTU A;  2V4H C;  2VVK A;  2PZ1 A;  1OY3 D;  4BES A;  3W9F A;  1YNZ A;  1AWO A;  4AG1 C;  1UOH A;  2XZT G;  3DEP A;  2JM8 A;  4J9G A;  2QYJ A;  1BK2 A;  4J9H A;  4LUE A;  2J7I A;  1ZLM A;  1CKB A;  2A37 A;  2DLP A;  1YWP A;  2D1X A;  4OMP A;  2XEH A;  4DX7 D;  1H3H A;  4HRL A;  5CBN A;  1RI9 A;  4U95 D;  2F8X K;  1G83 A;  1SHF A;  2HE0 A;  2M51 A;  1B3Q A;  5HKP A;  2KNB B;  5EYL A;  1Y57 A;  2KGT A;  2DWZ A;  4J9C A;  3IQL A;  1JU5 C;  1PNJ A;  4JZ4 A;  4AG2 C;  1I1J A;  1M30 A;  1YYH A;  1ZUY A;  2HDA A;  5ENR D;  2GNC A;  3TWU A;  2JW4 A;  2F8Y A;  4ATZ D;  4RTZ A;  4HXJ A;  3AJI A;  2A36 A;  4ESR A;  3TWS A;  2EPD A;  2FG0 A;  4G8L A;  1AVZ C;  4CC2 A;  1MX4 A;  5AN8 A;  1IXV A;  2KT8 A;  1OPL A;  4HCK A;  2F2X A;  4BET A;  1NM7 A;  2K9G A;  1SRL A;  1X6G A;  2C0I A;  1N0Q A;  4ZNX A;  3FJ5 A;  2EW3 A;  1HD3 A;  2ED1 A;  4GMR A;  1SEM A;  2AZV A;  2FO1 E;  2CDT A;  3ULR B;  3NOC D;  2JAB A;  3Q9N C;  2GBQ A;  4IIM A;  1TG0 A;  2P4R A;  1AZG B;  2J6O A;  1U06 A;  1WI7 A;  4M4Z A;  1AP7 A;  1BU1 A;  1BI8 B;  2CT4 A;  2DRM A;  5I22 A;  3TWQ A;  2YUP A;  1M8M A;  1HJD A;  1UHF A;  1BI7 B;  2PNI A;  3TWV A;  1UTI A;  2O2O A;  4LE9 A;  2F2W A;  1WYX A;  5AAO A;  4JJD A;  4RTT A;  2W0Z A;  2CSQ A;  3REA B;  2K79 A;  1M3A A;  1PHT A;  1YP5 A;  2EYW A;  2Y1L E;  4O60 A;  2HCK A;  1Z9Z A;  2KEA A;  1AEY A;  5ENQ D;  3TVT A;  1WG0 A;  2AKL A;  2J06 A;  2KYB A;  3IXE A;  1PRM C;  3NBN B;  1WX6 A;  4ZFH A;  1G3N B;  2D8H A;  3EG3 A;  2ZGD A;  3EU9 A;  5FIO A;  1CSK A;  2VWF A;  4HVW A;  1S70 B;  4JPB W;  1KFZ A;  2H8H A;  2ROT A;  4DUI A;  2LQN A;  4OAU C;  1BBZ A;  2FO0 A;  2P2C P;  5CED B;  2YT6 A;  1YN8 A;  4Y92 A;  1WFW A;  1RLQ C;  5CEC B;  2F2V A;  2LQW A;  1U3O A;  2B0O E;  4HRN A;  2ENM A;  1DCQ A;  4CC3 A;  2CRE A;  1MUZ A;  3J5Q B;  2AK5 A;  1J3T A;  2J8S D;  3B95 A;  4GPM A;  4J9E A;  3NHN A;  1GFD A;  5HRY A;  3EG2 A;  2D8J A;  2FRW A;  1N0R A;  3T9K A;  5ENO D;  4DRX E;  2O9V A;  3TWW A;  1EFN A;  2GQI A;  1ABO A;  1VYU A;  4F1P A;  2B86 A;  3M0R A;  2DA9 A;  5ECA A;  2HEQ A;  1AWX A;  2CUB A;  2ETB A;  2L3S A;  2A5E A;  5EN5 D;  1SSH A;  2GTO A;  1UEC A;  4U8V D;  2DVJ A;  3LJN A;  4HLL A;  3HRA A;  4HI8 A;  1KIK A;  2L6B A;  3GBQ A;  4J9I A;  2JMA A;  2M0Y A;  4QT7 A;  2DL7 A;  2NYJ A;  2DVW A;  2DL4 A;  3M0Q A;  2XEE A;  3H0F A;  2EQI A;  3TWT A;  2PTK A;  4LUD A;  4K5A B;  2C0T A;  4RTX A;  3F6Q A;  4BEP A;  4UUC A;  4Z68 A;  3I35 A;  1U5S A;  1E6H A;  2K2M A;  3A98 A;  2FPF A;  4J7W A;  2KRS A;  2VKN A;  2DMO A;  4OMO A;  2DBM A;  4DEY A;  2RQU A;  3NOG D;  1M3C A;  2CH4 A;  3TWX A;  5GJW B;  4GLM A;  2DBK A;  1W6X A;  1WDY A;  2DIL A;  1WXU A;  3M0P A;  3UA6 A;  4OMM A;  2NWM A;  4YDW A;  1A5E A;  4CC4 B;  5EIB E;  3UI2 A;  5HS0 A;  2C0O A;  3M0S A;  4DX1 A;  5L23 A;  1MX6 A;  3KEA A;  2L3P A;  5GJV B;  4RTV A;  4J9D A;  5I11 A;  3AAA C;  1NYF A;  2AJA A;  1JQQ A;  1X2K A;  4LNP A;  1TUC A;  3VRZ A;  4U96 D;  1QWF A;  2BZX A;  2LP5 A;  4K11 A;  2BTT A;  1NLP C;  5IHN A;  2XMF A;  2ESW A;  4G8K A;  1K0X A;  1AOJ A;  2DZN A;  2O88 A;  1M3B A;  2LX7 A;  2RFM A;  4HI9 A;  2EGC A;  3PE0 A;  1SVX A;  1X6B A;  2LJ0 A;  3V31 A;  3JUE A;  3H0I A;  2F37 A;  1OV3 A;  2DYB A;  2JXB A;  3EG1 A;  5KNG A;  2J6F A;  3J5P A;  1AD5 A;  2DJQ A;  1JO8 A;  4D8K A;  4J9F A;  4B93 B;  4R0K A;  2PNN A;  4F14 A;  4ORZ A;  1VYV A; 
#chains in the Genus database with same CATH topology
 2W10 A;  3JCK C;  2K3Y A;  3E37 A;  4M77 C;  2MHK A;  4DOW A;  1VQ5 A;  2LCS A;  4LCT A;  1H2T C;  2Z0W A;  4PFP A;  2GGR A;  5J90 A;  3JAM E;  2H6I A;  2X38 A;  5FWC A;  2VGN A;  3H8Z A;  4OML A;  2BE7 D;  1K3Z D;  1T0J A;  1KC8 C;  1BU9 A;  2H6F A;  3LEW A;  3U23 A;  1OYX A;  5GAO l;  2OTJ Q;  2YUN A;  2A0F B;  5KE3 A;  1N4Q A;  2LCC A;  2P9P G;  3PEV B;  4IUR A;  4XU0 A;  3JUI A;  3D3M A;  5EDS A;  4GCN A;  4PH4 B;  1DJ7 B;  3TU4 K;  1VQ9 T;  1VQL Q;  4KUL A;  1OU9 A;  3KSL A;  1VQ4 Q;  2P0Q A;  2LNH B;  1I07 A;  1QYM A;  1U3C A;  3ML9 A;  4EPC A;  1D0Z A;  2KXD A;  3KS2 A;  5FU7 B;  1U2V G;  1B34 A;  3I9Q A;  3NB2 A;  5ENT D;  4PFO A;  1VQ5 Q;  3ZNG A;  1ACM B;  1TJF A;  3RKV A;  3OYM A;  4N3A A;  2D0N A;  3MKD A;  5M9O A;  3JCM f;  1WGS A;  2DTO A;  3CCS A;  2LC4 A;  4BAC A;  4J83 A;  5IHK A;  2HBW A;  4LN2 A;  1P5Q A;  4JHR A;  4G2V A;  2RN8 A;  2P9N G;  5A0D A;  2ZPG B;  3V7C A;  4HXI A;  1Y8M A;  4EZK A;  1I0C A;  2JTM A;  1YIT A;  4UQY A;  2EVR A;  3RER A;  2WQH A;  4JB8 P;  5AYW D;  1R0B G;  4A4H A;  4CRI A;  5AQ9 A;  4YVQ C;  1X69 A;  2MI6 A;  4MML A;  4NOY A;  3DXK G;  1NLO C;  1W70 A;  3PNT B;  5H7P A;  3ZEF A;  2A28 A;  2KYM A;  1Q81 C;  3TRE A;  5CEA A;  5FRM A;  1VQM A;  4ZN3 A;  3Q49 B;  2MRI A;  4XI9 A;  4V3I A;  1QQE A;  3SZ7 A;  3CCV A;  3GOX A;  5G2N A;  3MHX A;  3CCS Q;  5ITZ F;  1KPS B;  3JCM V;  3UXG A;  3HRS A;  4E6R A;  4J6X A;  3ASO E;  4OAV B;  3N71 A;  1QKW A;  1KG1 A;  4D6W A;  1VQK T;  1K4U S;  1YIT Q;  1Q86 U;  3LS8 A;  2RFA A;  4C0M A;  1XJW B;  2XG8 D;  1S72 T;  3TCJ A;  2MYO A;  3D9I A;  4AY6 A;  4J5Y A;  2LQK A;  1MZC A;  4RMO A;  4KUD K;  2EQJ A;  1GW6 A;  3VU3 C;  1YJW T;  5AQA A;  2DIW A;  1RZ4 A;  3VUZ A;  3I56 A;  2GW1 A;  3R6N A;  3SB2 A;  2ED0 A;  4JHK A;  4M7D D;  1AWW A;  2PUK B;  3NMZ C;  1RLP C;  5BXU A;  5G04 C;  4A1S A;  1UJ0 A;  3EGX B;  1E7O A;  4NL3 A;  3KEZ A;  2KT1 A;  4CYM D;  3AG3 E;  3U4T A;  3EUV A;  4XTU A;  3A8M B;  4I1M A;  2WXF A;  3BUA A;  4HVB A;  1WZO A;  1OPK A;  4LDY A;  3V2O A;  4AEZ C;  3UT8 A;  2EGA A;  1F1B B;  2JMC A;  1UE9 A;  2JVV A;  3JCM b;  3VS1 A;  3QYG B;  4C5H A;  5ARF A;  3BU8 A;  2DM1 A;  3LH5 A;  4C8Q A;  1VUB A;  5AQ7 A;  1Y96 A;  4BD3 A;  4GB9 A;  2CG2 A;  3I56 Q;  2CKK A;  2MWO A;  3CQG B;  1HS6 A;  1FX7 A;  1UGR B;  4C92 A;  2O01 E;  1D09 B;  3DSU A;  2QEX Q;  2K4Y A;  3EDT B;  4HB5 A;  2V4L A;  2LMJ A;  4ZN1 A;  2O4X A;  1IRX A;  2YQ8 A;  4BX9 A;  2GRR B;  3J81 E;  3AT1 B;  3INZ A;  4NIK A;  2EIM E;  2XHE A;  2K6D A;  3ONL A;  2ZPI B;  2CP6 A;  4KVM A;  4C48 B;  3RIB A;  2PU9 B;  4JRI A;  3CQT A;  2P84 A;  3RSE G;  2JT4 A;  2Y0B G;  4I2Z A;  5A23 A;  5CMW A;  3RMS A;  1NFI E;  4J8Y A;  2ZXW E;  2M1H A;  3VS2 A;  4GBQ A;  4BT9 A;  2OTL A;  4WWO A;  1UFF A;  4GML A;  1UEB A;  2G6F X;  2E64 A;  4LNU D;  1WDX A;  4EPZ A;  2L89 A;  3RAU A;  3P8D A;  1EF1 C;  1UG1 A;  2EJG A;  4Z8A A;  4C8Q C;  3A5Z B;  4M7D B;  3LYA A;  4IYP A;  4EMH A;  2LVM A;  3BFM A;  1YHQ Q;  2NSZ A;  1D1B A;  2V1Q A;  2YRV A;  2WXL A;  3ZYQ A;  2HMA A;  4C92 C;  2ECZ A;  4CT0 A;  1ZSZ A;  3REB B;  1KQ2 A;  2ETC A;  3I5R A;  2BKG A;  3B7U X;  4F3V A;  1H64 1;  4IRU A;  2JZ2 A;  1O5M A;  3ZN3 A;  5GAO n;  1ARK A;  2KCV A;  4M77 D;  3U64 A;  2JTE A;  2SEM A;  3SF4 A;  4JLI A;  2KMT A;  2KZT A;  3IHY A;  2XHC A;  2OND A;  4XKC A;  4CZ2 D;  1X27 A;  5FIN A;  5A6C A;  4HCC A;  5GMK i;  3M0T A;  2ZGG A;  3PZD A;  3G1J A;  3ESL A;  1G3Y A;  4N0A A;  2RI2 A;  2LZ6 B;  2MK5 A;  4QQ6 A;  5J39 A;  2EQU A;  2O31 A;  4XEI G;  1SSF A;  1H92 A;  2RHX A;  4I2W A;  3Q4A B;  2AHJ B;  3DB4 A;  3JV3 A;  3LYI A;  4KH1 B;  4XTV A;  4ILG A;  4X9C A;  1MMN A;  1S63 A;  3QWV A;  4LG6 A;  1NG2 A;  3HYM B;  4KT0 E;  1O1T A;  4M78 B;  4GTS A;  2DK3 A;  1E6G A;  2CP2 A;  3HFO A;  4DPR A;  2FRY A;  3UT1 A;  2VJ8 A;  4JW1 A;  3HPW A;  1UJJ A;  5KYX A;  4A54 A;  1NBE B;  2FO7 A;  4RG6 A;  5KNH D;  5DY9 A;  3MEU A;  5FRN A;  3PUK A;  3GIB A;  1D8D A;  5LJ5 f;  3DLL A;  1K76 A;  4FLB A;  3T8M A;  2K3B A;  4GY5 A;  4J9B A;  2CFU A;  1S0P A;  4J8O A;  3G4S A;  3E9F A;  2GGF A;  5I2S A;  3PT9 A;  3GW4 A;  4L9P A;  3H6Z A;  4ANX A;  3A1P A;  3UKR G;  1I81 A;  1W3B A;  3UTM A;  2VGE A;  3AS4 A;  1D1C A;  5D2M C;  5BXO A;  4JXT A;  5JHA A;  3ZGQ A;  2V4H C;  2QTV A;  1U3D A;  1AWO A;  3QO3 A;  3W9F A;  4BFR A;  2X4X A;  3HXE A;  4AG1 C;  1FMW A;  3LX7 A;  1NZN A;  4J9H A;  4N0A C;  3CK8 A;  3ZFW A;  4PK4 A;  2DLP A;  4OMP A;  1D8E A;  3QJY A;  4DX7 D;  3LGF A;  3FDH A;  1H3H A;  1TNU A;  1O1S A;  1PD1 A;  5HQ8 A;  5CBN A;  3DBS A;  1G83 A;  3FU0 A;  3EGD B;  3BE3 A;  2M51 A;  4HS2 A;  2KNB B;  5CK9 A;  4GYO A;  1O9S A;  5KYW A;  4NRH B;  3IQL A;  1JU5 C;  4AG2 C;  1VQP A;  2MWP A;  4N4I A;  1N52 A;  1ZUY A;  4GPK A;  3MPU B;  1OX8 A;  4L7T A;  2CP7 A;  3KBG A;  4JRP A;  4IKF A;  4PJO A;  3QJZ A;  3GZ2 A;  1M5Q 1;  2P9I G;  2RHZ A;  2EPD A;  2HKN A;  4G8L A;  2YRC A;  4CC2 A;  4JC8 A;  3ASK A;  2YHC A;  2LAI A;  4ATO A;  1OI1 A;  1OPL A;  4HCK A;  1HYO A;  4BET A;  3ZIM A;  1YJ9 T;  2OVF A;  3M55 A;  5EG2 A;  4II1 A;  2ED1 A;  2AXV A;  3G2S A;  2MPX C;  1N8R C;  1NA3 A;  2PQR A;  1UB4 A;  2ZPE B;  1K9M C;  4NQ0 A;  2P4R A;  1HE8 A;  1VQP Q;  3PTA A;  2DYR E;  4UI9 J;  1U06 A;  5CKD A;  2JJ9 A;  2FZC B;  2X51 A;  2CT4 A;  4MRU A;  2Y3A A;  2VB6 A;  4KBQ A;  4QVC A;  1RL2 A;  3CMA A;  3UM2 A;  4FLH A;  3CVU A;  3CBM A;  1U1T A;  4XTX A;  1UTI A;  2F2W A;  2R59 A;  5AT1 B;  3CEQ A;  5GAM j;  4JJD A;  3CCU T;  3EIJ A;  4RTT A;  4XU3 A;  3UIN C;  1K73 C;  2K79 A;  3HRU A;  1W2B S;  2EYW A;  2NUP B;  2HL5 C;  3MEW A;  4E7S A;  3TVT A;  2YRD A;  3OYJ A;  3RJV A;  2AKL A;  4PJO C;  2KYB A;  4DBF A;  1WX6 A;  5LJ3 j;  3EG3 A;  3S7F A;  3EU9 A;  1N95 A;  2HYZ A;  2VWF A;  2R57 A;  2ZPF B;  1MMD A;  4DUI A;  2WXK A;  2Y69 E;  2MOW A;  4OAU C;  1VQ7 A;  2FO0 A;  3CMA Q;  1MQS A;  2YT6 A;  3MEV A;  1NJI U;  1B34 B;  4I1A A;  4YDE A;  5BPP A;  4CDR A;  1UJK A;  1W4S A;  5LL6 S;  3PRE A;  5CEC B;  4ZGJ B;  1U3O A;  3MJW A;  3APD A;  2B0O E;  4XI0 A;  3G6E T;  1NE8 A;  2FHD A;  1V29 B;  2KK4 A;  1MUZ A;  4C8Q D;  3JCM X;  4HOU A;  3CD6 T;  2AK5 A;  2CFZ A;  4UWH A;  3B95 A;  3EAE A;  4J9E A;  4XTY A;  1Q86 R;  2XS1 A;  5HRY A;  1X75 C;  3EG2 A;  4GMJ A;  3WVE B;  3JCM g;  4AVX A;  2VTB B;  3OYI A;  3TXN A;  8ATC B;  2J08 A;  1N0R A;  3T9K A;  5FU7 C;  4QW2 A;  3ABK E;  1C0M A;  4CCA A;  4C92 D;  3J80 E;  4F1P A;  1NL4 A;  2B86 A;  3A8O B;  2HEQ A;  4C0D B;  1AWX A;  2CUB A;  3FTU A;  3Q7F A;  5EN5 D;  2GTO A;  2UWJ G;  5J3B A;  2DD4 A;  1VQ7 Q;  2DIG A;  4Q96 A;  4LDU A;  2E6Z A;  4M7A A;  4HT9 A;  1WHJ A;  2IFU A;  2VGM A;  3FFL A;  4G23 A;  4HI8 A;  2X9H A;  3EGX A;  5GAN h;  1KIK A;  2L6B A;  3M4Y A;  1H6K A;  4UI9 C;  5D0Q D;  2J07 A;  2DD5 A;  5HK3 A;  1M90 C;  2JMA A;  2E2E A;  3FUN A;  2K57 A;  3CCM Q;  2ZCF B;  3M0Q A;  4U0U A;  2XEE A;  3AG1 E;  1HH8 A;  4GTQ A;  4LNG A;  1AT1 B;  2WXP A;  2WQ7 A;  3F6Q A;  2CP3 A;  2DVE A;  2YIN A;  4UUC A;  4Z68 A;  4QQD A;  1U5S A;  1ELR A;  1ZU2 A;  2RI3 A;  2IOS A;  3D9N A;  1RAF B;  2Q7F A;  5JHB A;  5KJK A;  3L54 A;  2DMO A;  2JUF A;  3NOG D;  3GZS A;  3P2B A;  5GJW B;  3V7R A;  4HKE A;  1VQO A;  2DIL A;  3UT7 A;  2VC8 A;  3JB9 I;  1ZBX A;  3UA6 A;  5KJM A;  2P0K A;  3CCJ T;  2QDY B;  4AV7 A;  4YDW A;  5CIU A;  2FYK A;  4WUY A;  3JCM J;  4TV3 A;  4CC4 B;  1BI0 A;  4KMO A;  5GAN d;  1U8R A;  3GPL A;  3UI2 A;  1Q95 G;  5HS0 A;  4J6I A;  4U0Z A;  4F7U E;  5GAM g;  4JS4 A;  1MX6 A;  4KBM B;  3QG1 A;  2L3P A;  2IPO B;  1NYF A;  1PSE A;  2QYZ A;  3JB9 G;  1JQQ A;  1X2K A;  1QVF S;  5DLO A;  5DBK A;  1TUC A;  3ASG A;  5CCA A;  4M7A C;  3SGH A;  4E7L A;  3UMV A;  1VQ8 T;  4RVB A;  2ESW A;  4G8K A;  3T5V A;  3FUK A;  3QKY A;  2O88 A;  5LJ3 g;  1K0X A;  1M3B A;  3PE0 A;  1JUQ A;  5G55 A;  2LDM A;  1X6B A;  1BIB A;  2EWN A;  4WF2 A;  4PS7 A;  1WHK A;  3ZHE A;  4ANV A;  2JXB A;  3ASN E;  3D7S B;  4BB7 A;  3DKM A;  3S7J A;  2GRO B;  3MV2 B;  1KK7 A;  2O4X B;  1Q81 U;  4R0K A;  2COW A;  3UPV A;  1IGU A;  4ORZ A;  2WMN A;  3MEA A;  4DLQ A;  2XI9 A;  2E4H A;  3AU5 A;  4JEU A;  1KQS A;  3QUI A;  1V1C A;  1SHG A;  3L42 A;  4F17 A;  4C5E A;  1YJN A;  2QFC A;  1N9A A;  3PVQ A;  4NS5 A;  4TXQ A;  1HXD A;  1K1Z A;  4O6F A;  3IHV A;  1HU3 A;  2BKK B;  3SY2 A;  2HQE A;  4RUG A;  2EKH A;  3SO8 A;  4B94 A;  2CGH A;  3CC7 T;  2NYS A;  4F16 A;  5FW9 A;  1OEB A;  1QLY A;  3RUX A;  4RTW A;  4X1V A;  2XPI A;  3QSU A;  5CCL A;  1ZHI A;  2FPD A;  4G26 A;  2RJE A;  4LD9 K;  3C4S A;  4AFS C;  3MET A;  1K8A C;  2BZ8 A;  3MCA B;  2YUQ A;  3DSW A;  4DLO A;  3JRZ A;  4MZT A;  4VUB A;  3B7B A;  3OS1 A;  4EBA A;  2FBN A;  2M9U A;  3I5P A;  2RK2 A;  2X4W A;  3MCX A;  1QP2 A;  1SA4 A;  4A4K A;  4BDZ A;  4FSX A;  1X81 A;  1HSQ A;  4JJB A;  1YJN Q;  1Q7Y C;  2BKD N;  2KQW A;  2QQB A;  4LXC A;  3OYK A;  3OAW A;  5EID A;  3E19 A;  1XGW A;  2RHU A;  1HF8 A;  3ZEH A;  3SQV A;  1ZSZ B;  1WXT A;  5GAN e;  1D0Y A;  2CP0 A;  2X3W D;  3EHR A;  3QXE B;  3FUD A;  2CUD A;  5AAR A;  2DBA A;  3QYH B;  4L6V 5;  4WND A;  2AVP A;  1TOV A;  3GLX A;  3OXG A;  3BQO A;  3Q79 A;  3FUE A;  4MMK A;  1IKN D;  3ISM C;  1M2V A;  3FUI A;  1IHV A;  3OYB A;  3UF4 A;  2GRL A;  3VS5 A;  1T3S A;  3UT4 A;  4DJA A;  2JEK A;  1LTX A;  3Q5M A;  3I55 Q;  3CPW S;  1VA7 A;  1N6A A;  3VLD A;  2FVU A;  4FYW B;  1ZBP A;  2F5K A;  2K3X A;  2A7Y A;  2LT4 A;  1MHN A;  4PJO D;  2RMO A;  1PSF A;  4E85 A;  2MCN A;  3E34 A;  3C98 A;  3L08 A;  3TJP A;  1UW4 B;  3ZUV B;  3TQ7 P;  4GYY A;  2O9S A;  4B89 A;  1YA0 A;  3VYG A;  1YMP A;  2OJ2 A;  3T5X A;  2GRP B;  2WXI A;  2FEI A;  4GZ6 A;  2COY A;  4AFZ C;  5A0G A;  1RAD B;  2KSS A;  1IQR A;  4WCI A;  2XEN A;  4X34 A;  3CCR A;  3L17 A;  2KAF A;  1K1A A;  4M7D G;  5KYX B;  3R9M A;  4G11 A;  1MX2 A;  1TNZ A;  4GA1 A;  3P8B B;  3CC4 A;  1KD1 C;  1IXD A;  4M78 C;  1ELK A;  2NUT B;  5HCK A;  2J09 A;  1X43 A;  3HXB A;  2E70 A;  1NI1 A;  2V1R A;  2YHE A;  5EC7 A;  3PE3 A;  2GF7 A;  4E7K A;  3DEO A;  2ROL A;  5GAN 7;  5IT9 E;  4OMQ A;  2DYS E;  3CCE A;  2LXL A;  4JDS A;  3RKX A;  2OTJ T;  2XCC A;  4N2Q A;  2JM9 A;  2DPP B;  4DEX A;  5GAO m;  4BSZ B;  1TN6 A;  3DST A;  1WA7 A;  1VQL T;  2QQ9 A;  3UX4 A;  3CCR Q;  5EIL A;  1VQ4 T;  4YDY A;  3ULQ A;  3FH8 A;  3C3O A;  2KM4 A;  1OZ2 A;  4AIF A;  4GTP A;  4AFQ C;  2KC7 A;  2VSO E;  4O1P A;  2F5T X;  5KCM A;  1VQ5 T;  1M1F A;  2LRQ A;  4ANW A;  1JXO A;  3CVX A;  3ABM E;  2IJG X;  4AM9 A;  3CVW A;  1WLP B;  4MLP A;  4UWK A;  3CVQ A;  4R7L A;  4MZP A;  4DBH A;  2RNA A;  3HP9 A;  5FWB A;  3UM1 A;  3JCM P;  1VYT A;  1JBM A;  4F7U F;  4I43 A;  5BNW A;  3UA7 A;  2EYX A;  1JEG A;  2A08 A;  5KJL A;  2HO1 A;  1MMG A;  2FZK B;  4BER A;  1TN7 A;  2VV5 A;  3OW2 S;  1PWT A;  2DEQ A;  4PJO B;  2P9S G;  1YBY A;  3ZVV A;  3SFM A;  3VS3 A;  5EX0 A;  1K9A A;  2QYU A;  4K03 A;  1KQS P;  4PLI A;  4U8Y D;  1E8Z A;  1W1F A;  5KCH A;  2NUP A;  1OXJ A;  3PUJ A;  2DO3 A;  3PMI A;  2WXG A;  3CCS T;  1QVP A;  4GTV A;  2XRY A;  4UQZ A;  1WIE A;  4GZ3 A;  1M2O A;  5LJ5 d;  2SRC A;  4GYW A;  1V76 A;  4ELY C;  1KD1 R;  4M7A D;  3HDX A;  4FM4 B;  1YIT T;  3L2W A;  2XGS A;  1DC2 A;  3QPH A;  3RBB B;  2BF0 X;  3PVL A;  1XOV A;  3EG0 A;  3EHM A;  1KQ1 A;  1LVK A;  3ZKJ A;  1OWN A;  1NJI R;  1WXB A;  1X6O A;  3KXT A;  3BG1 B;  4FUL A;  1QWE A;  5C2Y A;  2DZC A;  4FU6 A;  2HD0 A;  4M77 G;  1PC0 A;  2DET A;  4OMF B;  3EHQ A;  2HSE B;  1G3T A;  3MZL B;  2RQR A;  3NAW A;  4K5B A;  2VTB A;  3OXF A;  1IZ6 A;  1Z3X A;  2HKQ B;  4J0U A;  4YTL A;  2L0T B;  4QQG A;  3PEU B;  4CRW A;  2JNG A;  5GMK l;  2WXM A;  1K0S A;  3C5R A;  3RKW A;  3QBY A;  1I4K 1;  4OF1 A;  5HKC A;  3CHQ A;  3M4G A;  4P29 A;  1D9S A;  1TTH B;  4JA9 A;  4FT4 A;  5IXF A;  2DER A;  4QVZ A;  1FT2 A;  4P5N A;  3B7S A;  5C0M A;  3I4R B;  1SG5 A;  5CQX A;  2OI3 A;  1KT1 A;  3GZ1 A;  4AT1 B;  3CK7 A;  2YXY A;  5LOZ A;  3I56 T;  4C0F A;  1JWG A;  5ANR A;  2WQ6 A;  2LUH A;  5CKF A;  2CSI A;  1YWO A;  4M75 B;  3OSV A;  2QEX T;  3DSS A;  3UIO C;  2DL5 A;  4CGV A;  3VS6 A;  3VJP A;  1ZX6 A;  2RPN A;  4E7I A;  1UN8 A;  4I9C A;  4I9E A;  1YCY A;  3QDN A;  4ZHB A;  1KC8 R;  3FP3 A;  1IHG A;  4C92 E;  3APC A;  3FTY A;  3FUL A;  3VS7 A;  1OWO A;  5C1D A;  3D9L A;  2X6K A;  1QBQ A;  4U07 A;  1U1S A;  4Z02 A;  1K9M U;  4LUN U;  3LXU X;  1VQM Q;  2DX1 A;  2HBP A;  5GAM f;  3CBP A;  1OWL A;  4CC7 A;  3BY7 A;  4M7A B;  2R5M A;  4QVD A;  2VAS A;  3MKQ B;  2H3J A;  4JUV A;  3O5Z A;  3D9O A;  2DXB A;  3W9G A;  4FP7 A;  4BE0 A;  2L3R A;  2LTO A;  2VVK A;  5D0O D;  2PZ1 A;  3APF A;  4C0D C;  2WAC A;  3QNK A;  2VGX B;  1JCQ A;  2ZGW A;  4J9G A;  5FZQ A;  5LJ3 f;  3CHM A;  3OXL A;  1BK2 A;  1YIJ A;  1XNI A;  4LUE A;  4RKU E;  2A37 A;  1K73 U;  2D1X A;  1YHQ T;  4N5C A;  4HRL A;  1VQK A;  3OYH A;  1PC2 A;  4WNE A;  3KAE A;  3E1S A;  2KY9 A;  1S72 A;  2QI2 A;  4IUP A;  3VYH B;  5EYL A;  1Y57 A;  3URZ A;  4LDV A;  3GNF B;  1YJW A;  4F7A A;  3LY7 A;  1PNJ A;  4J9C A;  1Q81 R;  5D7U A;  1I1J A;  4HOT A;  5J26 A;  5ENR D;  2R5A A;  1UGQ B;  2JW4 A;  6AT1 B;  4A3V A;  1E8Y A;  4HXJ A;  1G5V A;  4M78 D;  3PDN A;  3F70 A;  4KZ0 A;  4ESR A;  1AVZ C;  1YIJ Q;  2ZZD A;  1MX4 A;  3CCQ A;  3QWP A;  3HXD A;  2KT8 A;  1DVP A;  3OQ5 A;  3E4B A;  3MA5 A;  1NM7 A;  4EQF A;  1X6G A;  2XEV A;  2K2V A;  4HLE A;  4GMR A;  3LWI A;  2VSN A;  4EEC A;  3ULR B;  5EKQ D;  3OYA A;  2GRQ B;  4C5G A;  3S3N A;  1WHL A;  2C0M A;  2P9L G;  1TG0 A;  2RJC A;  2EIL E;  3QK0 A;  4WWN A;  3ZHE B;  2WXR A;  1LJO A;  2WSF E;  4JVS A;  4PS8 A;  8AT1 B;  2WSE E;  2VQ2 A;  3D9K A;  2OEW A;  4HCZ A;  5J08 A;  3S3M A;  5IAY A;  3JCM c;  4XU1 A;  2YUP A;  3SBS A;  1FT1 A;  1SQM A;  1M8M A;  1M90 U;  3M58 A;  1BI7 B;  4JJN K;  3AS8 A;  1WYX A;  3C3Q A;  2DIQ A;  1N94 A;  3ONK A;  2R58 A;  4C0E A;  5D6W A;  2EQK A;  3REA B;  2YLC A;  4KGV B;  5GAN 4;  1PHT A;  2HCK A;  1PAQ A;  2OTL Q;  1HG5 A;  3IXE A;  4AJW A;  3L1A A;  4ZFH A;  1K8K G;  2D6F A;  4JPB W;  2Y4X A;  4HVW A;  3N5B B;  1OWP A;  4N2S A;  2ROT A;  2LAH A;  3EFR A;  3UM3 A;  1BBZ A;  1IB8 A;  3HL8 A;  2P2C P;  2I6H A;  5GAN 2;  3P8H A;  3G2U A;  4OB3 B;  4Y92 A;  4C8Q G;  4F7U B;  3Q7A A;  3TG4 A;  5E75 A;  4HRN A;  2PVD B;  3ZYM A;  2RA2 A;  2H6G A;  1DCQ A;  3ZRH A;  3MYV A;  1GFD A;  4C92 G;  5GAN 6;  3B7T A;  3BEE A;  1JB0 E;  2O9V A;  1YI2 A;  2BUG A;  3TWW A;  2PL2 A;  2H6H A;  1VYU A;  2C06 A;  2B8A A;  1M2V B;  3NTH A;  2OX7 A;  2L3S A;  3V7S A;  1E90 A;  4GZD A;  1TEZ A;  2RB6 A;  5T3R A;  3TXM A;  2NUT A;  2XID A;  1ZSZ C;  3HRA A;  3T9N A;  3SI5 A;  4K0R A;  4HA8 A;  5CMY A;  4J9I A;  3ASF A;  2WB2 A;  4QT7 A;  1JJ2 S;  2HQH A;  2DL7 A;  3NQP A;  3FTX A;  5FQ8 A;  1AHJ B;  4PJL A;  2IO3 C;  3VLF A;  2EQI A;  3CVV A;  3SBT B;  2PTK A;  2OAU A;  4C92 F;  1YI2 Q;  3IEG A;  3R7R A;  3HHM A;  1VQP T;  4F04 B;  1E6H A;  2WXJ A;  2FPF A;  3X25 B;  4J7W A;  2KRS A;  3I3N A;  5CKE A;  2RQU A;  1M3C A;  2CH4 A;  1QVF A;  4M7C A;  3TWX A;  2QG9 B;  5I2M A;  1OZ3 A;  2BTD A;  3FIF A;  3QKJ A;  4E6H A;  3OMG A;  4OGC A;  5FLX E;  1QCO A;  1WDY A;  3QHS A;  3OYE A;  1K8A U;  3RDV A;  1LD8 A;  3Q1J A;  4MZM A;  4EZJ A;  2NWM A;  2F1L A;  4URK A;  3G4S Q;  2QTX A;  3ULY A;  5JJT A;  4MDX A;  3DSV A;  2RD1 A;  5EIB E;  1VQN A;  1Q7Y U;  2IOL A;  1I5O B;  3M0S A;  5L23 A;  3CQC B;  3KEA A;  4N3C A;  5AIJ A;  3A8G B;  1TSF A;  5GJV B;  3AAA C;  3PE4 A;  5GAN j;  3L2Q A;  1JRI A;  3FTV A;  4JD2 G;  4LNP A;  4C0Z A;  3VKI A;  1N4P A;  5B3S E;  3VRZ A;  4B9X A;  3G71 A;  3CV0 A;  3BDU A;  3LLR A;  4K11 A;  2XMF A;  3CMA T;  4AP2 A;  2LX7 A;  2RFM A;  2EGC A;  2J4B A;  4FYV B;  5AYF A;  3FRN A;  5LFA A;  3V31 A;  3EFO B;  3JUE A;  2KVQ G;  2F37 A;  4I6E A;  1FPP A;  2DYB A;  5KNG A;  1R0C B;  4D8K A;  5KYY B;  4LRZ A;  2PNN A;  1VQN Q;  1E7U A;  1VYV A;  1UGV A;  1TYQ G;  4FJZ A;  2LT1 A;  5DM7 R;  1GBQ A;  4WNF A;  1PCX A;  2QA4 A;  2PM7 A;  1OCC E;  4BT8 A;  3JB9 H;  2HAX A;  3VTX A;  4BX8 A;  2ZPB B;  1K1B A;  4LNB A;  3VRY A;  1T0H A;  3BDL A;  2KE9 A;  3X2Q E;  3G71 Q;  2HSP A;  3WVD B;  1SKU B;  2J49 A;  3UQ3 A;  5B1B E;  1VQ7 T;  4FHK A;  3L82 A;  1MMA A;  4RTY A;  2R05 A;  4HOQ A;  3DRA A;  1SRM A;  1TUD A;  4N5Q A;  2DXT A;  2WM9 A;  4A3T A;  3SD5 A;  3SDZ A;  1MHQ A;  1VDY A;  1AWC B;  4B9W A;  2EYQ A;  2DEU A;  3CCM T;  4XAX B;  2R2L A;  3TWR A;  4JRQ A;  4APO A;  1E8X A;  1KD1 U;  4DX5 D;  1CKA A;  2YDL A;  2L0I A;  2QA4 Q;  3CPW A;  1TR4 A;  3AU4 A;  3OYD A;  3ZPJ A;  2CT3 A;  3ZU7 B;  2AIR B;  4R56 A;  4A4G A;  2UY1 A;  3ABL E;  4M75 A;  2QC9 A;  3PRZ A;  1IO6 A;  2OCC E;  4U04 A;  4FW2 A;  4B6M A;  2BZY A;  4EIK A;  3CVP A;  4UWL A;  2FEZ A;  2VXF A;  5CR2 A;  5IY5 E;  3FLG A;  2EQX A;  4J8E A;  1TU0 B;  1FVF A;  1Q2Z A;  2ZAE A;  3THK A;  3QZ5 B;  2KBX A;  3FEX A;  5BT1 A;  2E0I A;  2X6I A;  5FZS A;  1BYM A;  4FU3 A;  3TG5 A;  4PJO G;  1WY6 A;  2GTJ A;  1N8R R;  2GFU A;  2D0Q B;  4FCY A;  1K9M R;  1BB9 A;  1UGS B;  2F0Y A;  3Q9U C;  2CHZ A;  3FY4 A;  2AWI A;  2VSY A;  4B0Z A;  3MKQ A;  1QKX A;  2XKO C;  3M54 A;  1VQ6 A;  1ZUU A;  4J8D A;  1RAE B;  2GQV A;  2LJ3 A;  5GAN g;  2X4Y A;  2XDD A;  1H3Z A;  1GFC A;  5ENS D;  4ILI A;  4YND A;  2VXE A;  4HVU A;  4J6W A;  1X2Q A;  4HBD A;  5FTP A;  2VGX A;  3M57 A;  1E96 B;  4KUI A;  4ABN A;  1AWJ A;  4J8F A;  4BSX A;  1INZ A;  2M0O A;  2YWW A;  2VYT A;  5IHI A;  5L8R E;  2EGE A;  2EJF A;  4BI3 A;  4EMK B;  3CME A;  3G2V A;  4DI4 A;  4MDW A;  1KC8 U;  4LDX A;  3ME9 A;  1K73 R;  3CCL A;  3G6E A;  4HNA D;  1MV0 B;  5KBA A;  1RAG B;  2XD0 A;  5D66 A;  5IH2 A;  4E7J A;  3CD6 A;  1M27 C;  1RAH B;  2KI7 A;  5FRO A;  2CZ7 B;  4M75 C;  4M7D E;  2K5L A;  3RRM B;  3QDR B;  3RK6 A;  1KHC A;  1QVF P;  1H8K A;  3L6A A;  2R03 A;  3H9N A;  3CXC S;  1PKT A;  1ZBJ A;  1Y07 A;  2PQW A;  2XGM A;  2DL3 A;  3L2U A;  5JJ7 A;  1S1N A;  3JCM d;  5GMK h;  3DB3 A;  4MKT A;  1QVG S;  3M59 A;  4EHM A;  4JJC A;  3CPF A;  3OW2 A;  4UWF A;  3CME Q;  2XGO A;  4KYO B;  5AJD A;  3CCL Q;  2P58 C;  4QQI A;  3L2Z A;  3URG A;  1IRE B;  2KR3 A;  2E12 A;  4PS3 A;  1YJN T;  3QWY A;  3G2T A;  1VQO Q;  4WTO B;  4F53 A;  2FPE A;  2VYI A;  3PZ4 A;  4PL6 A;  1TNB A;  2FB7 A;  2XDB A;  4DX6 D;  1UJY A;  2DNU A;  3T8K A;  2RQV A;  1C1A A;  3CHP A;  3M9Q A;  4OYS A;  4TXP A;  4FA6 A;  4M78 E;  1MGQ A;  5CER B;  1M90 R;  1QQJ A;  3EG9 B;  1Q82 C;  3OYG A;  3I55 T;  2KAT A;  5AJL A;  1Y0M A;  2GRM A;  1ZUK A;  2R02 A;  2OOE A;  2V0P A;  3JB9 F;  4LER A;  5FWQ A;  4XQ3 A;  4Y28 E;  3EJN A;  2ABL A;  3JCM Q;  1RAB B;  3JXI A;  1N9R A;  1N11 A;  1MND A;  2HNI A;  4M7A G;  3JQ0 A;  4Z88 A;  2QDL A;  5IXB A;  1EIF A;  1UDL A;  4MS6 A;  1ZSG A;  4YDO A;  5AQB A;  2EBP A;  5E76 A;  2V8I A;  1UG3 A;  3ESK A;  4PJN A;  1RAI B;  2FI7 A;  1OT8 A;  2J4D A;  5GAM d;  3NGP A;  3FEY A;  4BDY A;  1KHI A;  3FTS A;  2DCP A;  2XU8 A;  3CCV T;  1SZA A;  4IUU A;  3WG7 E;  4F7U A;  4BUG A;  1T3L A;  2CZ6 B;  4O5V A;  4B8A A;  4C5I A;  3M56 A;  1EDU A;  3UWN A;  2HZY A;  5IN1 A;  1BKB A;  4MBG A;  2RF0 A;  2LO6 A;  5ENP D;  1LCK A;  3CPW P;  1MJ0 A;  3SEM A;  3FUM A;  1DNP A;  4J8S A;  1UHC A;  2CYZ B;  2DXU A;  5LJ3 d;  3X20 B;  4WAF A;  3RNJ A;  3JCM W;  3FUH A;  3SWN B;  1M1K C;  2C2L A;  2WXQ A;  3TEE A;  1O75 A;  4DI3 A;  4FJY A;  4M77 E;  9ATC B;  1SZ9 A;  4CT4 A;  2J05 A;  1H2V C;  2LNV A;  3VS0 A;  3ZFJ A;  3SFZ A;  4C0G A;  4DQ2 A;  1GBR A;  4FSS A;  3C72 A;  3LVQ E;  4JHJ A;  1TS9 A;  2Y90 A;  5CVI A;  2DFU A;  3VS4 A;  1SF9 A;  4M3O A;  3QAR A;  3CC2 A;  5B1A E;  3CCR T;  1M1G A;  2JS2 A;  1JCS A;  1KJW A;  1DCE A;  5ARG A;  2XPZ A;  2F69 A;  4WNG A;  3RO2 A;  1UGP B;  4DA4 A;  1A17 A;  1N4S A;  3FEO A;  1EPU A;  2P0P A;  4B8C B;  1Q82 R;  3LKU A;  5KYU B;  3M5A A;  3PFS A;  1FYN A;  1GL5 A;  3SHW A;  5GMK e;  3CCV Q;  2L0A A;  1RAC B;  4BE2 A;  5CRV A;  2DTH A;  4N4H A;  3CHS A;  2RI5 A;  3CC2 Q;  4KZC A;  4IIO A;  5GAN 5;  3Q73 A;  2XZD G;  4Q5W A;  1K8A R;  2AW6 A;  1L5J A;  1Y6I A;  2GCX A;  4Z89 A;  2AKK A;  1BLX B;  4FL6 A;  4FAD A;  4HFG A;  2RQW A;  1Q7Y R;  3R9A B;  4RTU A;  4G1T A;  2RK1 A;  1OY3 D;  4BES A;  3IV0 A;  1YNZ A;  1UOH A;  2XZT G;  4J6Y A;  2PVO B;  3RRN B;  2QYJ A;  3OBY A;  3LJ3 A;  3RU0 A;  3ZXP A;  2J7I A;  1XTD A;  2LXM A;  4I1O B;  1M1K R;  4Y6C A;  1YWP A;  4EBA G;  5ANL A;  3CC4 Q;  3RO3 A;  2XDP A;  1RI0 A;  1RI9 A;  4M7D F;  3M53 A;  3EFO A;  3OW2 P;  5HY6 A;  5LJ5 h;  4PFZ A;  4L23 A;  1B3Q A;  5HKP A;  3HHT B;  1X01 A;  2KGT A;  2DWZ A;  1QMC A;  5KYY A;  3LY8 A;  4M78 G;  3RR6 A;  3NZS A;  1M30 A;  1YYH A;  1H6P A;  2V5F A;  4FW1 A;  1HG2 A;  3CCE Q;  2ILR A;  3OS0 A;  1NP7 A;  3FUJ A;  3RES A;  2F8Y A;  2Y4U A;  3AJI A;  2CHX A;  2EJ9 A;  4M75 D;  4E7Z A;  3JQ1 A;  1TUG B;  2FG0 A;  1WPY A;  4TVR A;  1FWZ A;  5GMK m;  1IXV A;  2QAZ A;  2F2X A;  3V8L A;  1WAO 1;  1SRL A;  3EHN A;  1N0Q A;  4ILH B;  1YFN A;  3FJ5 A;  1HD3 A;  4YVO A;  1SEM A;  2AZV A;  2RHI A;  2RJD A;  1H19 A;  2JAB A;  1EX4 A;  2JOY A;  3Q9N C;  3OMC A;  2IF4 A;  2V8K A;  4AXH A;  5CHE E;  1AZG B;  3P1U A;  2J6O A;  3C95 A;  3KD7 A;  1WHM A;  3JSC A;  3QJ6 A;  5GAN 8;  4A1G A;  1LPL A;  3R6O A;  2WXH A;  4M78 F;  2E6N A;  2QZA A;  3S7D A;  1NPP A;  3TWV A;  5KH6 A;  3CVL A;  3LDZ A;  4L2L A;  3FU5 A;  3E2U A;  2IO2 C;  1G3S A;  3JYS A;  1HX8 A;  2MMP A;  3PZ2 A;  4PUC A;  3MGB A;  1VQM T;  1M3A A;  2KEA A;  2Y1L E;  4O60 A;  3E9G A;  1Z9Z A;  4AY5 A;  2QGG A;  1WG0 A;  5G04 J;  2J06 A;  1KQS S;  1PRM C;  2QAS A;  3CEY A;  2V26 A;  1G3N B;  2D8H A;  4U7E B;  3X26 B;  4A4E A;  5A7D B;  3E30 A;  1V54 E;  2WSC E;  2IU1 A;  5GAN f;  5CED B;  1YN8 A;  4IUQ A;  5EX3 A;  1WFW A;  2OVB A;  2L8D A;  3HXF A;  3BW1 A;  1VQ9 A;  2ENM A;  4UI9 K;  1G8X A;  1HZ4 A;  2IY0 C;  1O1R A;  1XQH A;  2UY1 B;  4GPM A;  2QQA A;  1J3T A;  2PM6 A;  1N9S A;  4M77 F;  4C8Q E;  3FDR A;  1JJ2 A;  2XQ0 A;  2FRW A;  4I17 A;  2EQM A;  4XTW A;  4OVU A;  2QGF B;  4EMK A;  2YHT A;  1EFN A;  1ZA1 B;  2X35 A;  1KT0 A;  2ETB A;  1SSH A;  5FJY A;  4AOF A;  5I21 A;  5LX8 A;  1UEC A;  4U8H A;  2DVJ A;  1WHH A;  2ZIS A;  2EFI A;  3HTR A;  1N8R U;  3LJN A;  5BUZ A;  1YIJ T;  2FL7 A;  4HLL A;  5FU6 B;  2EIK E;  2Y4Y A;  4R55 A;  1Z3Y A;  3HSB A;  4JPS A;  5G05 J;  1LD7 A;  3SFY A;  1VQ9 Q;  5LJ5 e;  3CVN A;  3CKB A;  4CDN A;  1BI3 A;  1R8O B;  4PNO A;  3EFS A;  1N27 A;  3NTK A;  4UQX A;  3H0F A;  4DK5 A;  3TWT A;  4LUD A;  4XE0 A;  5CCM A;  4K5A B;  4RTX A;  3FC3 A;  3I35 A;  4RSY A;  3O8V A;  3OSS C;  4ANU A;  3A98 A;  2K2M A;  4KGZ B;  1KZP A;  2FF4 A;  3D9J A;  3X24 B;  1OUV A;  4OMO A;  2DBM A;  3X28 B;  2WMO A;  4GLM A;  3ML8 A;  5A0L A;  1OUL A;  2G3R A;  2DBK A;  3ASD A;  1IYG A;  1W6X A;  1ZQ1 A;  2IG0 A;  2QEX A;  3TL5 A;  4J7F A;  3LY9 A;  3ZBD A;  3AS5 A;  2LNI A;  1WXU A;  3QII A;  3CCQ T;  1WJQ A;  2MAM A;  4OMM A;  3OYC A;  1IGQ A;  3PH0 C;  1VIF A;  2M02 A;  5LCW J;  3DXM G;  4CGW A;  3C3R A;  4EMK C;  4I6J A;  3HKS A;  4FT2 A;  4RG2 A;  2OTL T;  4J9D A;  5I11 A;  3RKY A;  3QWW A;  2CP5 A;  3WXM B;  3EG9 A;  2LSU A;  4TRQ A;  1WM5 A;  5CAI A;  3QOU A;  4XIF A;  2AXZ A;  4U96 D;  1QWF A;  2BZX A;  1FXX A;  1HFA A;  3FU6 A;  4ACL A;  3OS2 A;  2GFA A;  1VQK Q;  2Y4T A;  4FC8 A;  1TJC A;  2PQN A;  1LOJ A;  2CZ1 B;  3MP8 A;  4E47 A;  1S72 Q;  3ASH A;  3H0I A;  1OV3 A;  2WPV A;  1OX9 A;  4ACK A;  3DPY A;  5T8I A;  2HM8 A;  3J5P A;  2P9K G;  1AD5 A;  1JO8 A;  3FH7 A;  1NZ9 A;  3MX3 A;  2DJQ A;  4B93 B;  4J9F A;  1YJW Q;  1W2B A;  1N54 A;  4F14 A;  2DF6 A;  1YHQ A;  2L6J A;  4GTT A;  2C0L A;  4NAC A;  1V55 E;  2QXF A;  2KRM A;  2GRN B;  2J9Q A;  1LNX A;  2D9T A;  1SA5 A;  5G05 C;  2A3L A;  2CG3 A;  3NFC A;  4CDM A;  1FVH A;  3CCQ Q;  3H41 A;  1E8W A;  1SW6 A;  2X6H A;  3NZU A;  5JMN D;  3OBW A;  4KH0 B;  4BY6 B;  3SWN A;  1G3W A;  4D8D A;  1GRI A;  3PIO A;  3HG0 D;  1ABQ A;  2KDS A;  3PNL B;  5JJ6 A;  5CO7 A;  2BIV A;  5LP0 A;  1MYO A;  2LCL A;  4PLL A;  4JZY A;  1D0X A;  3A8L B;  5DLQ E;  1G2B A;  2V5Q C;  4Y91 A;  1KLX A;  1Z5S C;  1YI2 T;  1D1A A;  2R5S A;  4OVV A;  2E3I A;  3EIQ C;  1GCQ A;  3TSZ A;  5LCW C;  5CKH A;  2WVI A;  1SPK A;  3E33 A;  4ATG A;  5KYN A;  2OAW A;  4IUV A;  3MP1 A;  5ENN A;  3PIP A;  1IHW A;  2RO0 A;  2DYI A;  3MKR A;  4F6R D;  2E5K A;  3SD4 A;  3LWH A;  1BD8 A;  1Y7X A;  5KYU A;  3FU3 A;  4QFV A;  1TWB A;  3G4S T;  2K5I A;  1QW1 A;  1ZB1 A;  2PVG B;  4HQD A;  1PRL C;  2X3X D;  4BTA A;  3CLJ A;  4GTR A;  3UPU A;  5KWD A;  1JJ2 P;  3OA6 A;  2K5F A;  3RMQ A;  4XKB A;  1HXI A;  2K7A A;  4OVA A;  4KGX B;  4JA7 A;  3C0C A;  2CHW A;  1NA0 A;  4GTO A;  3CGH A;  3SWN C;  4AFU C;  3CST A;  1M9S A;  4PJO E;  5HK0 A;  3D9M A;  3ZW3 A;  1M8V A;  1D3B B;  4KVO A;  4C8Q F;  4IUT A;  2FUL A;  3B13 A;  5M72 A;  1IHB A;  2WXO A;  2LJ1 A;  4OB2 B;  3CXC A;  3M0U A;  3HVE A;  1PKS A;  3C94 A;  4L1B A;  1Q82 U;  2RQT A;  2I1K A;  2X3M A;  1X5B A;  3Q75 A;  5D6X A;  1QVG A;  3DSX A;  2WXN A;  1VQN T;  4RCB A;  2V8S E;  2EIJ E;  4GCO A;  5CKB A;  4BWR A;  1Z9Q A;  1GCQ C;  3MP6 A;  3I5S A;  4IN3 B;  2I0N A;  1QNF A;  2NXP A;  1WQ7 A;  2BE9 B;  3RRU A;  5A2Q E;  2ZPH B;  3G71 T;  1N5Z A;  5C6S A;  2JS0 A;  2KBT A;  3QWX X;  1JXM A;  4K5C A;  5GAO p;  1R77 A;  1AZE A;  1FMK A;  2OV8 A;  4NUR A;  3QC1 A;  5JA4 D;  5KJN A;  2J6K A;  1A0N B;  3O48 A;  4GZ5 A;  2DL8 A;  1JWF A;  1RW2 A;  5AEN A;  4M77 B;  2QQS A;  2QA4 T;  1M1K U;  1WNL A;  2I1J A;  2E5Q A;  1OOT A;  3C12 A;  2MOX A;  3GYZ A;  1H0A A;  2E41 A;  4RQI A;  2KCK A;  3NPF A;  4JZ3 A;  3IKO B;  2ION A;  4BI4 A;  2EKO A;  3SFX A;  3JXJ A;  3MV3 B;  2DKG A;  4GA2 A;  3D9P A;  1JCR A;  4L5G A;  3EGU A;  3WXX A;  3TAX A;  1EYH A;  3FTW A;  1BI2 A;  1HO8 A;  3GP8 A;  3H0H A;  1VIE A;  3KFV A;  4TUM A;  4M75 E;  1Q86 C;  1W2B P;  3I4G A;  2YSQ A;  3G7Z A;  3OB9 A;  3Q47 B;  3GF5 A;  4EMG A;  3EU5 A;  2X4J A;  3QB2 A;  2L5Q A;  2XS8 A;  3AHU A;  3B7R L;  4KT6 B;  2IVW A;  1QP3 A;  2CH4 W;  3V8J A;  4RG8 A;  4A63 B;  2I2O A;  4N39 A;  2L3Q A;  3DPD A;  1H2U A;  1FCH A;  1P92 A;  4I6G A;  2EYY A;  5GMK j;  3PZ3 A;  1QCF A;  2HR2 A;  5HI7 A;  2L2P A;  1WJS A;  3VV0 A;  4A4F A;  4DBR A;  1NEG A;  3ZYL A;  1I8F A;  3A8H B;  3ZXS A;  5CBO A;  4ANJ A;  4HOS A;  3LGL A;  4HVV A;  4M7A E;  4D10 C;  4FYY B;  4XK8 E;  1ELW A;  2MIO A;  4PDX A;  1GXI E;  3JB9 J;  2QK0 A;  3UAT A;  1YJ9 A;  1N4R A;  1MNE A;  4GU5 A;  4WWP A;  1B89 A;  5GAO r;  3MJX A;  2ETA A;  2NUZ A;  1NEB A;  3S7B A;  1C6V X;  1BCO A;  2DZO A;  4GZC A;  2B6C A;  2LSV A;  3V8K A;  4RG9 A;  4RLY A;  2E10 A;  1RAA B;  4GA0 A;  1H6O A;  4DX2 A;  1KZO A;  3V79 K;  1VQ6 T;  3FTZ A;  2E65 A;  1NYG A;  2QQR A;  4OMN A;  2LQ8 A;  2X6F A;  4ZTF A;  4XU2 A;  4ME2 A;  3U3W A;  2KXC A;  2ZU6 B;  5DIZ A;  4X8Q A;  3D9H A;  2IIM A;  4L2Y A;  3TSW A;  3MO8 A;  1B7T A;  2EIF A;  2EYZ A;  4DOV A;  3G2W A;  4KRT A;  5D6Y A;  3CCU A;  4GLK A;  4LSZ E;  1YJ9 Q;  1KSW A;  4JL0 A;  4BE1 A;  2QY7 A;  4BI8 B;  4DBQ A;  1LF8 A;  3CME T;  3PNW C;  1UUE A;  3ER0 A;  2DE0 X;  3CCL T;  1HK9 A;  2ATC B;  1XNF A;  1B07 A;  3CCM A;  4OB1 B;  2DRK A;  1TXQ A;  3JCM h;  4J7I A;  2XCB A;  3Q15 A;  1QCN A;  1YCS B;  2JTF A;  4CEM A;  1VQO T;  4O1O A;  5BV1 A;  3K9I A;  1PD0 A;  4JEH A;  2KRN A;  1BI1 A;  4LD6 A;  3ZL7 C;  2XPY A;  3V30 A;  4A55 A;  3EH2 A;  4TUU A;  4E7H A;  3CXC P;  2MF2 A;  5EYP F;  1MV3 A;  4FIB A;  4TXR A;  3S3O A;  4OB0 B;  2KXP C;  1QZ2 A;  3QZ9 B;  3GNG A;  4E2F B;  3ENE A;  2LX9 A;  1OCO E;  3CCU Q;  2YUO A;  4CI0 C;  4G25 A;  3DLM A;  1QVG P;  2E3H A;  2KRO A;  4HRM B;  2M16 A;  3HXC A;  1WQW A;  4PJO F;  2YLB A;  2PZI A;  1Z6T A;  4GAA A;  3HRT A;  1GCP A;  1VQ6 Q;  3DWL G;  3NTI A;  3QDF A;  2AZS A;  4AMC A;  1RUW A;  3V2X A;  1JPL A;  4JRK A;  4NL2 A;  2AT1 B;  5KE2 A;  3SNX A;  3DEP A;  2JM8 A;  2EIN E;  2OEV A;  4JS5 A;  3QAQ A;  3RIR A;  3L9T A;  3ULE G;  1ZLM A;  1CKB A;  2VSX E;  5FU6 C;  4Q69 A;  3L22 A;  3LCA A;  2VUB A;  2XEH A;  3G6E Q;  3KUF A;  4U95 D;  4Y6W A;  3S2A A;  2F8X K;  3CD6 Q;  1SHF A;  3FWV A;  2HE0 A;  4XTZ A;  4EDU A;  4OP0 A;  2P9U G;  2CZ0 B;  3OYL A;  4APF A;  4H7X A;  1WHG A;  5KCO A;  3CHO A;  3CHR A;  5T4Y A;  5GAM h;  4JZ4 A;  2RG8 A;  4M75 G;  3AG2 E;  2HDA A;  1PM3 A;  2GNC A;  3TWU A;  4RTZ A;  3ZYK A;  4ATZ D;  1VOM A;  2RM4 A;  3AG4 E;  2A36 A;  3TWS A;  4X9D A;  4XX5 A;  2DTI A;  2AXU A;  5AN8 A;  4C8Q B;  3CCJ A;  5LJ3 h;  4HOR A;  3FB9 A;  1Y96 B;  2K9G A;  1OQK A;  4BY6 A;  2C0I A;  4ZNX A;  2EW3 A;  3UUX A;  2A4Z A;  3OS5 A;  4C92 B;  2FO1 E;  2CDT A;  4PJM A;  3U9W A;  3NOC D;  5CQY A;  4PKC C;  4PJJ A;  4IUL A;  3E32 A;  2GBQ A;  4IIM A;  4HCB A;  2EAY A;  2XIC A;  2I9C A;  4M7D A;  3NF1 A;  1EZZ B;  3BG0 B;  5FQ4 A;  4L59 A;  4LEU A;  1WI7 A;  3L2V A;  4ZGD B;  2RKK A;  1OCZ E;  4M4Z A;  2NC9 A;  3PMT A;  1AP7 A;  4UC4 A;  1NPR A;  1BU1 A;  1BI8 B;  2DRM A;  4M75 F;  1VQ8 A;  5I22 A;  3TWQ A;  4U63 A;  2IQC A;  4V2S A;  4KXK B;  1UHF A;  5LJ5 j;  1Y71 A;  1HJD A;  2PNI A;  2O2O A;  4GTM A;  3CCJ Q;  4LE9 A;  2V8J A;  5AAO A;  3OTN A;  3IBE A;  3KSQ A;  3CVY A;  3CC2 T;  3J7A F;  5BW8 C;  4HT8 A;  2W0Z A;  2CSQ A;  5GAO q;  2COZ A;  1OWM A;  1YP5 A;  5FQ7 A;  3CK9 A;  5ENQ D;  3UDC A;  3JCM e;  1AEY A;  2RH2 A;  2MYS A;  4M7A F;  3NBN B;  3I55 A;  2ZGD A;  5FIO A;  1CSK A;  3VTY A;  1KFZ A;  1S70 B;  2H8H A;  2LQN A;  2CS7 A;  1VQ8 Q;  3CC7 A;  1TH7 A;  3LPZ A;  5FQ6 A;  2DZ9 A;  4BY6 C;  1RLQ C;  2F2V A;  4M78 A;  2LQW A;  1D3B A;  1OCR E;  4RCC A;  1UN9 A;  3CC4 T;  4CC3 A;  2CRE A;  3J5Q B;  4QKU A;  2J8S D;  1WJR A;  3NHN A;  2JN0 A;  4M7D C;  2D8J A;  2IEJ A;  3OYY A;  1IQU A;  5ENO D;  4DRX E;  1S64 A;  2E1H A;  2XRZ A;  2H3E B;  2KZT B;  1BIA A;  2GQI A;  1ABO A;  4C9B B;  3CCE T;  3M0R A;  2X6J A;  2DA9 A;  1I5L A;  5ECA A;  3R7Q A;  2XK0 A;  1OU8 A;  2FZG B;  2A5E A;  2RHY A;  2RJF A;  4EZL A;  4U8V D;  2DAQ A;  2DXC A;  2A5U A;  3CC7 Q;  2L9B A;  5FZR A;  2R17 C;  3O4Z A;  5CRU A;  1TNY A;  3OYN A;  1PG5 B;  3PZ1 A;  4W9R A;  3GBQ A;  3HFN A;  2M0Y A;  3L13 A;  2BED A;  4N3B A;  3UIP C;  1ZA2 B;  2HL3 A;  2NYJ A;  2DVW A;  3TGO A;  2DL4 A;  2RD0 A;  5GAM e;  2ZIR A;  3S6W A;  2NLU A;  3LH0 A;  1BCM A;  2C0T A;  4BEP A;  3HVE B;  2DJZ A;  3FJP A;  3CR3 A;  4XZ4 A;  3VUB A;  2JLB A;  3LVR E;  4M77 A;  4Q94 A;  2HQX A;  2VKN A;  1E7V A;  2P4T A;  4DEY A;  1PY1 A;  3CBO A;  1M4Z A;  3EGD A;  4N4G A;  3MEK A;  4UWG A;  4BTB A;  3PGG A;  5LJ3 e;  2VGY A;  4F1S A;  4F7U G;  3M0P A;  3PS6 A;  1NJI C;  1A5E A;  3LW5 E;  3OY9 A;  5LJ5 g;  2PUO B;  1BPO A;  1TNO A;  3FHE A;  7AT1 B;  2C0O A;  3CIA A;  3SHF A;  4DX1 A;  4H7Y A;  2BUD A;  3OYF A;  4ME7 A;  4O6J A;  4A53 A;  4OGE A;  4RTV A;  3FH5 A;  2AJA A;  2KCL A;  2I2L A;  4ZTJ A;  3UM0 A;  4G24 A;  3EH1 A;  2YNQ A;  3L2R A;  3VLE A;  2LP5 A;  1TN8 A;  2BTT A;  1NLP C;  5IHN A;  3JB9 D;  4U0S A;  3Q78 A;  1AOJ A;  2DZN A;  4LDW A;  5GAN 3;  2OTJ A;  5FT9 A;  4HI9 A;  1SVX A;  3L16 A;  1FMV A;  2LJ0 A;  3HIZ A;  2M63 A;  3U66 A;  4ZGE B;  4ELZ C;  3EG1 A;  2J6F A;  1VQL A;  4FHJ A;  3CKC A;  5BV0 A;  5KYW B;  4FYX B;  1VQ4 A;  3FUF A;  4JLG A;  3UKU G;  3CSF A; 
#chains in the Genus database with same CATH homology
 1UGV A;  2DF6 A;  1GBQ A;  2W10 A;  1V1C A;  1SHG A;  4F17 A;  2LCS A;  2KRM A;  3PVQ A;  1K1Z A;  1K1B A;  3VRY A;  1T0H A;  2GGR A;  2BKK B;  2KE9 A;  5FWC A;  3H41 A;  4OML A;  4RUG A;  2HSP A;  1K3Z D;  1T0J A;  1SW6 A;  5JMN D;  3SO8 A;  2EKH A;  1BU9 A;  4RTY A;  3U23 A;  4F16 A;  1SRM A;  2YUN A;  5FW9 A;  4D8D A;  1TUD A;  1OEB A;  4N5Q A;  1QLY A;  1GRI A;  4RTW A;  3HG0 D;  4X1V A;  1AWC B;  1ABQ A;  2FPD A;  4AFS C;  2BZ8 A;  3TWR A;  1MYO A;  2LNH B;  1I07 A;  2YUQ A;  1QYM A;  4DX5 D;  1CKA A;  3B7B A;  2KXD A;  2YDL A;  1G2B A;  3I9Q A;  2V5Q C;  5ENT D;  3ZNG A;  1TR4 A;  1HSQ A;  4JJB A;  2D0N A;  2CT3 A;  1GCQ A;  3ZU7 B;  3TSZ A;  5EID A;  1SPK A;  2HBW A;  4LN2 A;  5IHK A;  2RN8 A;  2OAW A;  2QC9 A;  1WXT A;  1I0C A;  1IO6 A;  2X3W D;  4F6R D;  3EHR A;  2E5K A;  2BZY A;  2EVR A;  2CUD A;  4EIK A;  5AAR A;  1BD8 A;  4QFV A;  4JB8 P;  5AQ9 A;  1X69 A;  1IKN D;  4HQD A;  1PRL C;  2X3X D;  3THK A;  3UF4 A;  3VS5 A;  1T3S A;  2KBX A;  1NLO C;  5KWD A;  1VA7 A;  1W70 A;  2A28 A;  2KYM A;  5CEA A;  2GTJ A;  1BB9 A;  2K7A A;  3Q9U C;  3C0C A;  2RMO A;  5ITZ F;  1QKX A;  4AFU C;  3UXG A;  4E6R A;  2MCN A;  4OAV B;  1ZUU A;  2LJ3 A;  3ZUV B;  1QKW A;  1K4U S;  1GFC A;  5ENS D;  2O9S A;  1IHB A;  2LJ1 A;  2RFA A;  1YMP A;  2OJ2 A;  2MYO A;  3M0U A;  4HVU A;  1PKS A;  1X2Q A;  4HBD A;  2FEI A;  2RQT A;  4AFZ C;  1AWJ A;  4WCI A;  2XEN A;  5IHI A;  5AQA A;  1K1A A;  2EGE A;  1MX2 A;  3R6N A;  1Z9Q A;  4HNA D;  1GCQ C;  5KBA A;  1MV0 B;  2ED0 A;  5D66 A;  3I5S A;  5IH2 A;  1M27 C;  1AWW A;  2I0N A;  3NMZ C;  1RLP C;  5HCK A;  5BXU A;  1X43 A;  2V1R A;  5EC7 A;  1UJ0 A;  1E7O A;  3DEO A;  4CYM D;  1N5Z A;  2KT1 A;  2ROL A;  1H8K A;  2JS0 A;  2KBT A;  3QWX X;  1JXM A;  1PKT A;  4K5C A;  1ZBJ A;  4OMQ A;  2DL3 A;  1AZE A;  1FMK A;  2JM9 A;  4DEX A;  1S1N A;  5JA4 D;  1OPK A;  4BSZ B;  3V2O A;  1WA7 A;  2EGA A;  2JMC A;  1UE9 A;  3VS1 A;  2J6K A;  5EIL A;  1A0N B;  2DM1 A;  4JJC A;  2DL8 A;  3LH5 A;  4YDY A;  5AQ7 A;  4QQI A;  4AFQ C;  4O1P A;  2KR3 A;  1JXO A;  1OOT A;  2MOX A;  1WLP B;  3QWY A;  2FPE A;  3NPF A;  4HB5 A;  4JZ3 A;  2LMJ A;  2RNA A;  5FWB A;  4DX6 D;  1UJY A;  3JXJ A;  1VYT A;  3T8K A;  2DNU A;  2RQV A;  4NIK A;  3UA7 A;  2EYX A;  1JEG A;  3EGU A;  2A08 A;  2K6D A;  4BER A;  4C48 B;  3H0H A;  3KFV A;  4TUM A;  1PWT A;  5CER B;  3CQT A;  2YSQ A;  3VS3 A;  1K9A A;  1Y0M A;  2JT4 A;  1ZUK A;  2Y0B G;  4U8Y D;  1NFI E;  2ABL A;  4J8Y A;  1W1F A;  2CH4 W;  3VS2 A;  3JXI A;  4A63 B;  4GBQ A;  1N11 A;  2L3Q A;  2EYY A;  4Z88 A;  2QDL A;  1QCF A;  5IXB A;  1WIE A;  1UFF A;  1UDL A;  2L2P A;  1ZSG A;  2G6F X;  5AQB A;  2SRC A;  1NEG A;  4LNU D;  1WDX A;  2EBP A;  5CBO A;  1DC2 A;  4HVV A;  1OT8 A;  3RBB B;  1UG1 A;  4Z8A A;  3PVL A;  1XOV A;  2MIO A;  3EG0 A;  3NGP A;  3UAT A;  3ZKJ A;  1WXB A;  2V1Q A;  1T3L A;  2ETA A;  2ECZ A;  2NUZ A;  1NEB A;  3REB B;  1QWE A;  2ETC A;  2RF0 A;  5ENP D;  1LCK A;  3I5R A;  2BKG A;  2DZO A;  3EHQ A;  1MJ0 A;  3SEM A;  1UHC A;  1ARK A;  2RQR A;  3RNJ A;  4RLY A;  4K5B A;  4DX2 A;  2JTE A;  3V79 K;  2SEM A;  1NYG A;  4OMN A;  1GBR A;  4CZ2 D;  1X27 A;  2J05 A;  3VS0 A;  5FIN A;  2KXC A;  4FSS A;  1K0S A;  3C5R A;  3D9H A;  2ZGG A;  2IIM A;  3M0T A;  3TSW A;  3VS4 A;  2EYZ A;  4KRT A;  1D9S A;  4LSZ E;  2LZ6 B;  1KSW A;  5IXF A;  2O31 A;  2JS2 A;  1UUE A;  1KJW A;  2DE0 X;  2OI3 A;  1H92 A;  3JV3 A;  1B07 A;  2CSI A;  2DRK A;  1NG2 A;  4LG6 A;  1YWO A;  1YCS B;  2DL5 A;  1E6G A;  3VS6 A;  4O1O A;  2FRY A;  1ZX6 A;  2RPN A;  2KRN A;  1FYN A;  1GL5 A;  3SHW A;  3ZL7 C;  4ZHB A;  3V30 A;  2L0A A;  5KNH D;  5EYP F;  1MV3 A;  2KXP C;  3VS7 A;  2YUO A;  1K76 A;  4IIO A;  2K3B A;  2XZD G;  2KRO A;  2DX1 A;  4J9B A;  4HRM B;  4CC7 A;  4Z89 A;  2AKK A;  1GCP A;  1BLX B;  3O5Z A;  3UTM A;  2VGE A;  2AZS A;  2RQW A;  5BXO A;  1RUW A;  3V2X A;  3W9G A;  4RTU A;  2V4H C;  2VVK A;  2PZ1 A;  1OY3 D;  4BES A;  3W9F A;  1YNZ A;  1AWO A;  4AG1 C;  1UOH A;  2XZT G;  3DEP A;  2JM8 A;  4J9G A;  2QYJ A;  1BK2 A;  4J9H A;  4LUE A;  2J7I A;  1ZLM A;  1CKB A;  2A37 A;  2DLP A;  1YWP A;  2D1X A;  4OMP A;  2XEH A;  4DX7 D;  1H3H A;  4HRL A;  5CBN A;  1RI9 A;  4U95 D;  2F8X K;  1G83 A;  1SHF A;  2HE0 A;  2M51 A;  1B3Q A;  5HKP A;  2KNB B;  5EYL A;  1Y57 A;  2KGT A;  2DWZ A;  4J9C A;  3IQL A;  1JU5 C;  1PNJ A;  4JZ4 A;  4AG2 C;  1I1J A;  1M30 A;  1YYH A;  1ZUY A;  2HDA A;  5ENR D;  2GNC A;  3TWU A;  2JW4 A;  2F8Y A;  4ATZ D;  4RTZ A;  4HXJ A;  3AJI A;  2A36 A;  4ESR A;  3TWS A;  2EPD A;  2FG0 A;  4G8L A;  1AVZ C;  4CC2 A;  1MX4 A;  5AN8 A;  1IXV A;  2KT8 A;  1OPL A;  4HCK A;  2F2X A;  4BET A;  1NM7 A;  2K9G A;  1SRL A;  1X6G A;  2C0I A;  1N0Q A;  4ZNX A;  3FJ5 A;  2EW3 A;  1HD3 A;  2ED1 A;  4GMR A;  1SEM A;  2AZV A;  2FO1 E;  2CDT A;  3ULR B;  3NOC D;  2JAB A;  3Q9N C;  2GBQ A;  4IIM A;  1TG0 A;  2P4R A;  1AZG B;  2J6O A;  1U06 A;  1WI7 A;  4M4Z A;  1AP7 A;  1BU1 A;  1BI8 B;  2CT4 A;  2DRM A;  5I22 A;  3TWQ A;  2YUP A;  1M8M A;  1HJD A;  1UHF A;  1BI7 B;  2PNI A;  3TWV A;  1UTI A;  2O2O A;  4LE9 A;  2F2W A;  1WYX A;  5AAO A;  4JJD A;  4RTT A;  2W0Z A;  2CSQ A;  3REA B;  2K79 A;  1M3A A;  1PHT A;  1YP5 A;  2EYW A;  2Y1L E;  4O60 A;  2HCK A;  1Z9Z A;  2KEA A;  1AEY A;  5ENQ D;  3TVT A;  1WG0 A;  2AKL A;  2J06 A;  2KYB A;  3IXE A;  1PRM C;  3NBN B;  1WX6 A;  4ZFH A;  1G3N B;  2D8H A;  3EG3 A;  2ZGD A;  3EU9 A;  5FIO A;  1CSK A;  2VWF A;  4HVW A;  1S70 B;  4JPB W;  1KFZ A;  2H8H A;  2ROT A;  4DUI A;  2LQN A;  4OAU C;  1BBZ A;  2FO0 A;  2P2C P;  5CED B;  2YT6 A;  1YN8 A;  4Y92 A;  1WFW A;  1RLQ C;  5CEC B;  2F2V A;  2LQW A;  1U3O A;  2B0O E;  4HRN A;  2ENM A;  1DCQ A;  4CC3 A;  2CRE A;  1MUZ A;  3J5Q B;  2AK5 A;  1J3T A;  2J8S D;  3B95 A;  4GPM A;  4J9E A;  3NHN A;  1GFD A;  5HRY A;  3EG2 A;  2D8J A;  2FRW A;  1N0R A;  3T9K A;  5ENO D;  4DRX E;  2O9V A;  3TWW A;  1EFN A;  2GQI A;  1ABO A;  1VYU A;  4F1P A;  2B86 A;  3M0R A;  2DA9 A;  5ECA A;  2HEQ A;  1AWX A;  2CUB A;  2ETB A;  2L3S A;  2A5E A;  5EN5 D;  1SSH A;  2GTO A;  1UEC A;  4U8V D;  2DVJ A;  3LJN A;  4HLL A;  3HRA A;  4HI8 A;  1KIK A;  2L6B A;  3GBQ A;  4J9I A;  2JMA A;  2M0Y A;  4QT7 A;  2DL7 A;  2NYJ A;  2DVW A;  2DL4 A;  3M0Q A;  2XEE A;  3H0F A;  2EQI A;  3TWT A;  2PTK A;  4LUD A;  4K5A B;  2C0T A;  4RTX A;  3F6Q A;  4BEP A;  4UUC A;  4Z68 A;  3I35 A;  1U5S A;  1E6H A;  2K2M A;  3A98 A;  2FPF A;  4J7W A;  2KRS A;  2VKN A;  2DMO A;  4OMO A;  2DBM A;  4DEY A;  2RQU A;  3NOG D;  1M3C A;  2CH4 A;  3TWX A;  5GJW B;  4GLM A;  2DBK A;  1W6X A;  1WDY A;  2DIL A;  1WXU A;  3M0P A;  3UA6 A;  4OMM A;  2NWM A;  4YDW A;  1A5E A;  4CC4 B;  5EIB E;  3UI2 A;  5HS0 A;  2C0O A;  3M0S A;  4DX1 A;  5L23 A;  1MX6 A;  3KEA A;  2L3P A;  5GJV B;  4RTV A;  4J9D A;  5I11 A;  3AAA C;  1NYF A;  2AJA A;  1JQQ A;  1X2K A;  4LNP A;  1TUC A;  3VRZ A;  4U96 D;  1QWF A;  2BZX A;  2LP5 A;  4K11 A;  2BTT A;  1NLP C;  5IHN A;  2XMF A;  2ESW A;  4G8K A;  1K0X A;  1AOJ A;  2DZN A;  2O88 A;  1M3B A;  2LX7 A;  2RFM A;  4HI9 A;  2EGC A;  3PE0 A;  1SVX A;  1X6B A;  2LJ0 A;  3V31 A;  3JUE A;  3H0I A;  2F37 A;  1OV3 A;  2DYB A;  2JXB A;  3EG1 A;  5KNG A;  2J6F A;  3J5P A;  1AD5 A;  2DJQ A;  1JO8 A;  4D8K A;  4J9F A;  4B93 B;  4R0K A;  2PNN A;  4F14 A;  4ORZ A;  1VYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...