4A63B

Crystal structure of the p73-aspp2 complex at 2.6a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
202
Chain Sequence
MRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Aspp2 Recognition by the Tumor Suppressor P73.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords TUMOUR PROTEIN 73
total genus 59
structure length 202
sequence length 202
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
B PF00023 Ank Ankyrin repeat
B PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4a63B01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4a63B02
4K5AB 1Z9ZA 4HVWA 2RMOA 5ENSD 1FYNA 3VS5A 4RTXA 5IH2A 5FWCA 1YMPA 2DZNA 1GBQA 2DE0X 4JPBW 2L0AA 2AKLA 2X3WD 3M0UA 3VRYA 2DZOA 4TUMA 1M8MA 2AJAA 3V79K 1SHGA 4YDYA 2JMAA 2LZ6B 2OAWA 1NYGA 4HRMB 3SO8A 2J05A 4J9IA 4HLLA 3V30A 3R6NA 1QCFA 4HVUA 4OMOA 4RTTA 2EVRA 5IHKA 3M0QA 2BKKB 4O60A 2P4RA 4HNAD 1GFDA 2DL4A 1G83A 3VS4A 1X69A 1IKND 2F8XK 2KXPC 4CYMD 4F14A 4YDWA 1E6HA 1UGVA 2KE9A 2JM8A 3I9QA 1NLPC 1UHFA 2DVJA 3J5QB 4K5CA 3A98A 5HCKA 2O31A 3UI2A 2ETCA 3W9GA 1ZBJA 1BLXB 3UXGA 2QDLA 4IIOA 3PVQA 2KT1A 4K5BA 2ENMA 5CEAA 3M0TA 4DX1A 4RTYA 3TWXA 2OJ2A 1UHCA 2BZ8A 1I1JA 2KXDA 2D8JA 4LNUD 1SEMA 1UJYA 1OPLA 2DM1A 3EHQA 1MX2A 4F6RD 4J8YA 2L6BA 3EGUA 4GBQA 5ECAA 2L3QA 2VKNA 2KRMA 1WX6A 5JMND 2GQIA 2FO1E 1S1NA 1GFCA 2EW3A 4C48B 2DL8A 2KGTA 1YNZA 2MYOA 3TWVA 3THKA 1T3LA 2L3SA 1G2BA 1OOTA 3JUEA 4ZHBA 2JM9A 1JXOA 3H41A 4DX5D 3FJ5A 2FG0A 3M0PA 2EGEA 2CT3A 2EBPA 5FINA 3TWSA 1PRMC 3NGPA 1UECA 1YYHA 1AD5A 3GBQA 3LJNA 3LH5A 3ZKJA 2KRNA 1PWTA 2O9VA 2G6FX 1N5ZA 2J6FA 2V5QC 1TUCA 5AN8A 3T9KA 2M51A 2LMJA 1PHTA 1NLOC 2K2MA 2GTJA 2JS0A 1OPKA 1SSHA 1M3CA 4JJCA 5AQ9A 4OMPA 4WCIA 3M0SA 1K1ZA 1JEGA 5CERB 4ZNXA 3RNJA 1U5SA 1J3TA 1UOHA 3C0CA 1NG2A 1K9AA 1TG0A 4OAVB 4K11A 5FW9A 1H8KA 1ZSGA 1TR4A 2D8HA 3EG2A 4Z8AA 2OI3A 2KYBA 4CC2A 2CH4A 1QKWA 2DL5A 2FEIA 2J6OA 2NYJA 1E7OA 1MYOA 2JXBA 2VVKA 1WDXA 1UDLA 1ZUUA 3REAB 2F2VA 2BZXA 2QYJA 1QWFA 2ECZA 1WIEA 1EFNA 4LNPA 4HB5A 2LJ1A 3IQLA 2PZ1A 3PE0A 5I22A 2XZTG 5AQBA 2XZDG 2DL3A 2YUOA 1U06A 2PNIA 3AJIA 2C0OA 2KR3A 4J9HA 2ZGGA 2O9SA 3V2OA 1UFFA 5AAOA 2CT4A 2YDLA 1K0XA 2KRSA 3M0RA 2ABLA 2ED0A 5ENTD 1PKTA 2J06A 1MJ0A 1X2QA 4HRLA 3NHNA 3Q9NC 1AWOA 2AZVA 2JS2A 1JO8A 1QLYA 2LJ3A 1MV0B 2H8HA 1GCPA 4JJBA 4BERA 4HRNA 4RTZA 2DWZA 1AVZC 2DYBA 2X3XD 2MCNA 4CC7A 2DMOA 2DX1A 2PTKA 3NPFA 5CBOA 2J7IA 3H0FA 5AARA 2YSQA 2HDAA 1ABQA 4Z68A 4BSZB 1DCQA 3HG0D 1MV3A 2KROA 1HSQA 4OMLA 2HBWA 1T0JA 2CSIA 5ENOD 2DF6A 5HRYA 1W1FA 4AG1C 1S70B 1U3OA 1I0CA 2A28A 5EN5D 2HE0A 1UE9A 4HI8A 1XOVA 3QWXX 1WG0A 1YP5A 2YT6A 4DEYA 1ZUYA 2RQTA 2DBMA 2EGCA 4CC3A 3NOGD 5CEDB 1BK2A 2HEQA 1GL5A 3O5ZA 1VYVA 2GNCA 2J8SD 3H0HA 2CDTA 1AP7A 5GJWB 4JZ3A 2JMCA 3JXJA 2RQRA 4AFUC 4IIMA 4GPMA 3PVLA 1BB9A 1KSWA 1KJWA 4JJDA 5D66A 5CECB 4F16A 2FPEA 2CUDA 2W0ZA 4J9DA 1AOJA 2A36A 1N11A 2ED1A 1M30A 1WDYA 4LG6A 2DRKA 3UF4A 2ROTA 5AQAA 3UTMA 3F6QA 4OAUC 2E5KA 5AQ7A 4HCKA 3SEMA 1WXTA 2ESWA 4HVVA 5EYPF 3UA7A 2V1QA 5KNHD 2MIOA 1I07A 4Z88A 5JA4D 1CSKA 5BXOA 4GMRA 1JXMA 3REBB 2A37A 5HKPA 4UUCA 2DRMA 1FMKA 3I5RA 3TSZA 5IHNA 4FSSA 4LUEA 5I11A 4J9FA 5ITZF 5FIOA 3ZNGA 2EYZA 2FRWA 2KBXA 4BESA 4OMQA 3NMZC 1A0NB 3DEOA 1PNJA 4F1PA 5KBAA 1BBZA 2C0TA 2JT4A 2BKGA 2HCKA 2W10A 3C5RA 2L3PA 2DILA 2QC9A 1IXVA 1PRLC 5FWBA 1VYUA 2P2CP 2GBQA 5KNGA 2ETAA 1KIKA 1ZLMA 2F8YA 4J9EA 1OEBA 4HBDA 5L23A 2RFAA 5ENRD 2K3BA 4KRTA 3TWTA 3TWRA 2O2OA 2O88A 1Z9QA 2KNBB 1BU9A 1ZUKA 1BU1A 4Y92A 2KT8A 1UG1A 3I35A 2DVWA 2KXCA 2NUZA 1CKBA 1HD3A 2CH4W 2K7AA 4J7WA 4O1PA 3HRAA 3VS6A 1SVXA 3ULRB 2BZYA 2VGEA 1KFZA 4ZFHA 4DRXE 2EKHA 4AFQC 2XEEA 5KWDA 2BTTA 4JB8P 1UUEA 4DX2A 2FPDA 3TVTA 3T8KA 3NOCD 2B0OE 1OV3A 3J5PA 1ABOA 5EIBE 3CQTA 2JABA 2L2PA 4J9CA 3RBBB 2IIMA 3IXEA 2M0YA 3V2XA 5IXBA 1H92A 1YCSB 2F37A 4B93B 3VS1A 1IO6A 1NEGA 1NFIE 3EU9A 3KFVA 1K0SA 4RUGA 3KEAA 4BEPA 1M3BA 2DNUA 4GLMA 1NEBA 2C0IA 5IHIA 3UATA 2EYWA 1PKSA 1SRMA 1G3NB 2DLPA 2YUPA 2SRCA 3VS3A 1D9SA 1AWWA 4G8LA 1CKAA 5ENPD 2ROLA 2KBTA 4CC4B 4JZ4A 2RQVA 1AEYA 4ORZA 1YN8A 4F17A 2AZSA 3TWWA 1RLQC 1WXUA 1WI7A 2YUNA 1K1BA 2LJ0A 3NBNB 1LCKA 2XENA 3EHRA 1M3AA 3EG0A 1X2KA 4CZ2D 4U95D 3U23A 1WLPB 2EGAA 1GBRA 5HS0A 1AWCB 1WFWA 2EYYA 1B07A 3VS2A 4U8YD 1OT8A 1GCQA 2J6KA 2NWMA 2AK5A 1BI8B 1SHFA 2RN8A 2A5EA 1X27A 4J9BA 4G8KA 1AWJA 2DL7A 2JTEA 3TWUA 2RQUA 4HXJA 1WA7A 4RTWA 4LN2A 2K79A 3JXIA 1BD8A 1SRLA 2B86A 3SHWA 2FPFA 3UA6A 4BETA 4LSZE 4AG2C 1H3HA 4ATZD 2F2XA 1A5EA 3B7BA 4OMMA 2XEHA 4D8KA 1GRIA 2EYXA 1DC2A 4E6RA 2CSQA 2JW4A 2EPDA 4OMNA 1ARKA 1QYMA 1YWPA 3TWQA 2LQNA 4DX7D 1YWOA 2PNNA 4QFVA 1T0HA 1OY3D 1K1AA 3ZU7B 4O1OA 2LNHB 4D8DA 4EIKA 2ZGDA 1QWEA 2KEAA 1RI9A 1T3SA 4ESRA 1NYFA 3QWYA 2RQWA 3JV3A 2RFMA 2V4HC 5EIDA 1MX4A 1VYTA 4X1VA 2EQIA 1GCQC 2D0NA 1MUZA 3V31A 3VS7A 2LCSA 2FO0A 4NIKA 2LX7A 1SW6A 4DUIA 3VRZA 4RLYA 4LUDA 1WYXA 2GTOA 2RNAA 3AAAC 2K6DA 1RLPC 2RF0A 1UJ0A 4U8VD 1N0QA 2HSPA 4Z89A 1AZGB 2LQWA 2RPNA 4RTUA 5IXFA 1W70A 2XMFA 2GGRA 2CREA 1ZX6A 4HQDA 4J9GA 1M27C 2VWFA 2KYMA 3VS0A 2I0NA 2YUQA 4DX6D 5EILA 1AWXA 2K9GA 2Y0BG 3H0IA 2MOXA 2CUBA 1QKXA 2SEMA 3EG3A 5EC7A 3ZUVB 3TSWA 4HI9A 4AFZC 2DA9A 1AZEA 4AFSC 4N5QA 1E6GA 1K4US 1HJDA 1NM7A 3ZL7C 2AKKA 1SPKA 1X43A 4QQIA 1VA7A 4M4ZA 1MX6A 4R0KA 1BI7B 2DBKA 5GJVB 1TUDA 4DEXA 4U96D 1Y57A 1V1CA 1Y0MA 2ETBA 2Y1LE 3D9HA 1WXBA 1K3ZD 1RUWA 2D1XA 1IHBA 2DJQA 3EG1A 3B95A 3I5SA 4A63B 1JQQA 5EYLA 5ENQD 2FRYA 1X6GA 4LE9A 3DEPA 1B3QA 2A08A 4QT7A 2LP5A 1JU5C 2V1RA 5BXUA 5CBNA 1N0RA 1K76A 3Q9UC 2F2WA 1W6XA 1X6BA 4RTVA 1UTIA 3W9FA
chains in the Genus database with same CATH superfamily
3CCQT 4HVWA 5DIZA 3C3RA 1FYNA 3LYIA 2GRPB 2HO1A 2H6IA 3OYYA 1N8RU 2DE0X 1GBQA 5FROA 4JPBW 4EMKB 2L0AA 2YWWA 3TCJA 2DZOA 5JJ7A 1M8MA 2DPPB 1OCOE 4UWFA 2OAWA 3EHMA 2MRIA 4GYWA 4HRMB 2QQAA 3CC2T 3SO8A 5BNWA 4HLLA 3JB9D 4YVOA 1HG5A 5KYNA 3ASNE 3CBOA 4OMOA 5D0OD 2EVRA 1N4PA 4O5VA 4C92A 1D1BA 5A23A 3SGHA 1VIFA 4OVVA 3P2BA 3S7BA 1K8AC 4I17A 4BY6A 4FW1A 2KE9A 2EQUA 2VUBA 2COYA 1G3YA 5D6XA 3EGXA 1ZBJA 1D8DA 1BLXB 4NACA 2QDLA 4IIOA 3PVQA 4FLHA 4PLLA 3I3NA 2P9KG 1H0AA 2RHYA 2X6HA 2CGHA 3Q79A 1BI1A 4D10C 4MZTA 1Y7XA 1JRIA 4B8AA 2D8JA 4HT9A 3TAXA 4E85A 2LSUA 4XKCA 1UJYA 1OPLA 3EHQA 1MNDA 3AG3E 3MEAA 1Y6IA 4YDOA 5ECAA 4F7UB 2L89A 1WX6A 5JMND 4MDWA 2PVDB 1GFCA 3LDZA 1VQ8Q 3EDTB 1VQOT 3OBWA 3OYLA 3CEYA 3HXFA 4Q96A 4B6MA 1FT2A 4I2ZA 3RO3A 3C12A 1OOTA 3H41A 4ZHBA 1TU0B 1OWNA 4Q5WA 5J39A 4DX5D 3M0PA 4C5GA 3LY9A 2EGEA 2CT3A 2DK3A 1UGSB 4M7DE 4GPKA 1PRMC 5GMKj 4BI4A 4G2VA 1AD5A 4BT9A 3LJNA 4ANVA 3LH5A 4X9DA 4U7EB 3LWHA 2WXLA 4FL6A 2HM8A 4A1SA 4UWHA 2OEWA 1N5ZA 2J6FA 2V5QC 2CP6A 4LCTA 1FVHA 3OW2S 2WSEE 1PHTA 3IHYA 1NP7A 2GTJA 2JS0A 4X9CA 5FZRA 4HCBA 1HFAA 1M1GA 2MWOA 1QZ2A 1QP3A 3WXMB 4J6IA 3JAME 2X4YA 1N9SA 5AQ9A 3V7SA 3M0SA 4JRIA 1Q86C 1K1ZA 2XS1A 3NQPA 3OYKA 1P5QA 2PM6A 4E6HA 2EFIA 2DTIA 1MQSA 1M1KR 2XI9A 2CG3A 2RHIA 1ZBXA 3WG7E 2R03A 2UY1A 3EG2A 4JPSA 4Z8AA 2KYBA 3G4SQ 4C5IA 3ABKE 2DL5A 4DI4A 4KGZB 8AT1B 1I5LA 1MYOA 1WDXA 1XTDA 3REAB 3A8GB 2XD0A 3DXKG 5KYXB 3ZRHA 3RESA 4GAAA 2QEXT 4GZ6A 4PFOA 5IN1A 4C8QE 3M59A 3Q7FA 2MK5A 3AJIA 2C0OA 2AXUA 2ZGGA 4JL0A 4X8QA 1XNFA 3V2OA 1IHVA 1M4ZA 3MKDA 2H6GA 1UEBA 4IYPA 1OUVA 3ZEFA 5HQ8A 3CC4T 4DBFA 5ANRA 1RL2A 2ED0A 1N95A 5ENTD 3GZ2A 2O4XA 2GRRB 3INZA 4PDXA 1X2QA 3MEWA 3ASGA 1VQ8T 1X5BA 2ZISA 2AZVA 2JS2A 4N0AA 3OS1A 4FYXB 2P9IG 3S7JA 3LLRA 3M54A 2VGYA 4HS2A 4MLPA 4HRNA 4M78A 4M7AC 2F5KA 2XDBA 3UM1A 3M9QA 5GMKe 2Y90A 5BV0A 2DX1A 2QFCA 3NPFA 5CBOA 2R59A 2J7IA 4IUQA 4DK5A 3ML9A 3JB9H 2BKDN 2HDAA 3CVVA 5CCLA 2LXLA 3SF4A 1MV3A 3OSSC 4OMLA 2BUDA 4C8QA 1VUBA 2JN0A 4UQZA 4OB2B 4PJOD 3O8VA 2M02A 1E7UA 3M55A 2HE0A 1N54A 4N5CA 2WXRA 2QTXA 2OTLQ 1YA0A 5BW8C 2NSZA 1SQMA 3HXBA 3QARA 2YT6A 2RQTA 2E41A 1VQ6Q 4CC3A 5IY5E 2MMPA 3UKRG 3SI5A 3ZFJA 3GW4A 4I6EA 2J8SD 3RDVA 1RAAB 3FTVA 2CDTA 1AP7A 1TS9A 5GAMj 2LDMA 3MA5A 4XE0A 1QVGS 2X3MA 2LQ8A 2WB2A 3JCMQ 4IIMA 1BB9A 1KSWA 4GYOA 3ULYA 3OYGA 4JHRA 3OBYA 4M75A 3H6ZA 1ZB1A 4JJDA 2V0PA 5D66A 3NB2A 2FPEA 3DPDA 3CIAA 4GTRA 3KAEA 5HK0A 2OEVA 3C98A 2ED1A 3QUIA 1WDYA 4LG6A 3ASHA 1D3BA 2D0QB 2PVGB 1YIJA 1B7TA 4Y91A 3E9FA 3F6QA 4M75F 3IV0A 3SEMA 1N4SA 2XDPA 2CFUA 3D9LA 5AJLA 1SG5A 1SSFA 5GAMd 3PNTB 2H6HA 4XTYA 5BXOA 4GMRA 1K8AR 2VC8A 3TSZA 4J83A 4J9FA 2COWA 5FIOA 3CCQQ 5GAOr 3L2UA 2FRWA 4OMQA 4BESA 2RKKA 4UQYA 4WAFA 4GTSA 2YRCA 4N0AC 2QEXA 3NMZC 3CVWA 3MV3B 2AT1B 3URZA 1PNJA 3JQ1A 1TH7A 2HCKA 1YI2A 4P29A 3TG5A 2W10A 4FYYB 4C92E 2L3PA 1PRLC 1XNIA 3G6ET 1KZPA 1VYUA 4GU5A 2DTOA 5T8IA 2AHJB 2GBQA 2ETAA 2VJ8A 2R05A 1O75A 3U3WA 2LQKA 4J9EA 3CHSA 3OA6A 4A4EA 2YRDA 4M7DC 4EMGA 5L23A 5ENRD 3TWTA 5KYWA 3TWRA 1NJIC 2O2OA 4HXIA 1ZSZA 2VYTA 2P58C 2MHKA 3R7QA 2RI5A 2K5IA 3FTYA 4N3AA 2DVWA 2KXCA 2ZPGB 1CKBA 1HD3A 3ABLE 1VQMQ 3JCMf 1TJFA 1NE8A 4IUPA 1KD1C 2V8IA 2I2OA 1FPPA 2MPXC 3M4YA 3EH2A 4DRXE 5IT9E 2EQXA 3L42A 4A3TA 4M78E 2ZXWE 1NI1A 3T8MA 3C3OA 5EDSA 1QW1A 3JRZA 2KZTA 2DZCA 3D9NA 1X75C 3D3MA 2DYIA 3E1SA 2PL2A 4J9CA 2V8JA 5D7UA 2MWPA 2IIMA 5CKBA 5GANd 4J8FA 2RA2A 2IY0C 1XGWA 1H6PA 3META 4IUTA 1VQNQ 4I1AA 1VQ6T 3S7FA 3CCRT 3EU9A 5GANf 3CBMA 1V55E 2IF4A 3P8BB 2NC9A 3KEAA 5HK3A 2OVBA 4BEPA 1M3BA 4G23A 3DB3A 3CCLA 3FU0A 4HKEA 1YHQT 1WJSA 5I2MA 4IUUA 4O6FA 2E12A 1SRMA 2HL3A 3UDCA 1G3NB 3OW2A 4B89A 1HYOA 2YUPA 2SRCA 4FT4A 2P9UG 1NJIU 4JUVA 3LJ3A 3EFOA 2KBTA 3GLXA 2COZA 2RQVA 2VB6A 2OTLT 2AZSA 3TWWA 2BE7D 2F1LA 2E2EA 2LT1A 4DI3A 2YUNA 3S7DA 1UGPB 2MOWA 2XENA 3RJVA 3LH0A 3NTHA 5KJNA 4U95D 5GAOp 1TSFA 1WLPB 4LRZA 5HS0A 2K5FA 4OGCA 3E2UA 4ILIA 2M1HA 2EYYA 4R55A 1EF1C 3VS2A 4OVUA 2J6KA 4MMLA 4BDZA 2A5EA 4J9BA 2JTEA 2K3YA 2HQXA 3H9NA 3TWUA 3QO3A 5J90A 1WA7A 2EILE 4LN2A 4N3CA 4M77G 2B86A 1VQ7A 2J49A 2X6KA 4J8SA 2FPFA 4LSZE 1IRXA 2P0QA 2ZPFB 1PD1A 4OMMA 5GAOn 5LJ3e 1WM5A 3PT9A 3CMEQ 4ILGA 1HZ4A 1QYMA 4CGWA 4DX7D 5BPPA 1K73C 4UWLA 1YWOA 2GCXA 2MF2A 3J80E 1YJNA 3UINC 3ZU7B 3S3MA 1QWEA 1W4SA 3ABME 1L5JA 2VSXE 1RI9A 1NJIR 3LS8A 3UM0A 3HFNA 3QWYA 3AS5A 3ASOE 1YIJT 3U64A 4GZCA 1HG2A 3CVQA 1FMWA 3I56Q 3L22A 3QB2A 3CEQA 4WWNA 2D0NA 2QDYB 3C94A 3E9GA 2FO0A 2LX7A 1WY6A 1AHJB 2DD5A 4DPRA 2RK2A 3B7SA 3CPWP 2DIWA 4CRWA 2X4WA 4XU0A 1YJ9T 1YJWA 3CKBA 5DLOA 2RF0A 4U8VD 2E64A 2R58A 2HSPA 1U2VG 4C0ZA 3ZBDA 2EIFA 3HSBA 3R6OA 4RKUE 4RTUA 2OCCE 2OTJA 1N8RR 4F7AA 4JC8A 2KYMA 4DX6D 5EILA 1U1SA 1HH8A 3FLGA 5GMKm 3ZXPA 3EG3A 5EC7A 2QY7A 4GTMA 3ZUVB 5GAMg 4HI9A 2HYZA 4ZGJB 4P5NA 2HMAA 4KT0E 1VDYA 2RI2A 4QW2A 1X43A 4QQIA 4EZJA 1VA7A 1MX6A 2GFUA 1BI7B 4R0KA 5GJVB 1VQ4T 4LDUA 4U96D 1QCOA 2XGOA 4EECA 3D9HA 1WXBA 1K3ZD 1RUWA 3D9OA 1XJWB 2I9CA 3EG1A 2LVMA 1IZ6A 4ME7A 3SWNB 2L8DA 2P84A 4KUIA 4L1BA 4XKBA 4ELZC 1X6GA 2IPOB 3E19A 3V7RA 5KYYA 3DB4A 3FH8A 4JVSA 1JU5C 1VQNA 4M78G 4ILHB 2GFAA 4C92G 1N0RA 3KSLA 2F2WA 1MGQA 1JWFA 1UTIA 3W9FA 3X2QE 5B3SE 1FVFA 4K5AB 1KT0A 1Z9ZA 3M57A 2RMOA 3VS5A 2X4XA 2OV8A 3SY2A 2LCCA 4RTXA 3P1UA 1VQOQ 5FWCA 1YMPA 1PG5B 2CHXA 2JTMA 4N2QA 1MHQA 2VGXA 2AKLA 5GAMh 2Q7FA 4TUMA 1JCQA 3V79K 1WQ7A 2LZ6B 3FC3A 3DXMG 4RG8A 5LJ3h 1VQKA 2LCLA 4YNDA 2XG8D 1B34A 2IO3C 4FCYA 1QVGA 4PJOB 2BKKB 4O60A 3LGLA 2P4RA 3AG1E 4HNAD 2YQ8A 4JW1A 2DL4A 4FIBA 5DLQE 1GFDA 3BY7A 1YHQA 2WSCE 4CYMD 2DTHA 1WJRA 3CXCP 4YDWA 1TNUA 4M3OA 1E6HA 2DVJA 3J5QB 1HU3A 4JRQA 3A98A 4HOTA 3EU5A 2O31A 3UI2A 2ETCA 4A4FA 3UXGA 3E30A 3C95A 3SZ7A 4JHJA 2KT1A 4F7UF 4LNBA 1RAGB 2QQRA 5CEAA 1UW4B 4HFGA 4F04B 3Q4AB 4NURA 1I1JA 3S6WA 2XK0A 1QVPA 3RMSA 1YJNQ 3OXFA 4CEMA 3AG2E 1RAHB 4J8YA 3OW2P 2QXFA 4APOA 2L6BA 2O01E 3EGUA 4M7DG 1NZ9A 3HTRA 3PZ4A 2L3QA 2VKNA 2NUTA 3UUXA 2IOLA 2R02A 1LTXA 2RD0A 2AWIA 4CDMA 2IONA 2PU9B 1S1NA 2EW3A 4C48B 2DL8A 3ER0A 4ANJA 2MYOA 3ISMC 1W2BA 3G6EQ 3FU3A 1PSEA 4M78F 2E6NA 2OX7A 1JXOA 4IUVA 3T5VA 2XHCA 5GANh 4LNGA 5FZSA 3D9PA 1N9RA 3EH1A 4JA7A 1WZOA 4FU6A 5EG2A 4TRQA 1FCHA 1YYHA 1G3WA 1H6KA 1DCEA 5E76A 1MHNA 4JRPA 4BWRA 4I6GA 1O5MA 3I56T 2RI3A 2EQJA 4OMFB 1H2TC 3CLJA 5CO7A 3HXEA 3QWWA 3OYNA 5LX8A 1MNEA 5A0DA 4FU3A 1Q86U 2OOEA 1M90R 1VQ5Q 3BUAA 4KXKB 3X25B 3JSCA 4AT1B 3QJYA 4C0DB 5M9OA 2O4XB 1OPKA 3DSXA 1SSHA 3A8LB 1G3TA 4GZ3A 1M3CA 2XQ0A 2EYQA 3CCLQ 3CXCA 3I4GA 5HI7A 2WQ7A 1I4K1 5A0GA 2ZIRA 4WCIA 3LXUX 5A7DB 1JEGA 3OYEA 4ZNXA 2R5MA 2JTFA 1UOHA 3C0CA 1VQ9Q 1J3TA 4FM4B 4OAVB 4L7TA 3OYMA 4RQIA 4LUNU 1LOJA 2QQSA 1TR4A 1S72T 2DFUA 2OI3A 3OYBA 3EUVA 3LGFA 4DLQA 1FMVA 2CH4A 3MP1A 3D9KA 2RHUA 4EMHA 1Q81U 2WM9A 1E7OA 2ZPBB 4WNEA 2OTJQ 3MEKA 1UDLA 3AT1B 4MDXA 3WXXA 2ECZA 1WIEA 1WHKA 4HB5A 4KBQA 3FUNA 2LJ1A 4C92F 5C0MA 1ZU2A 1VQMA 4M78D 1NPRA 4CI0C 4WNDA 2PNIA 4M75G 5CQXA 2HKQB 3ZHEA 3L54A 4WUYA 4M77A 2LX9A 2VYIA 4H7YA 2GGFA 3OYIA 3M56A 3FUHA 3T5XA 2ABLA 1PKTA 4CT4A 2P4TA 1MJ0A 3JB9F 4QQDA 3QBYA 4HRLA 3BE3A 4MZMA 3S3NA 3APFA 1AWOA 1JO8A 2KK4A 2KSSA 2LJ3A 4GMLA 4UI9C 1MV0B 3EIQC 1GCPA 2MYSA 4RTZA 3G2WA 2MCNA 3GZ1A 2R5SA 3PE4A 2DMOA 3CSFA 6AT1B 2GRNB 5AARA 1E8XA 2YSQA 1ABQA 3PMTA 2AXVA 1DCQA 4ABNA 2C0MA 1DVPA 4PNOA 1VQ7Q 1TN7A 3HIZA 5G55A 3U66A 1HSQA 1Y71A 3M53A 3J81E 1N94A 3IBEA 3S3OA 4UQXA 5CRVA 4AG1C 1VQLA 1VQMT 1S70B 2EJGA 1OX9A 4BSXA 4EDUA 3SD4A 3MEVA 3I55Q 1Q7YC 1G8XA 4HI8A 1HS6A 1YP5A 4HLEA 3E4BA 4EZKA 3NOGD 1Z3XA 1OU8A 3T9NA 4WWOA 1V76A 2MAMA 3OYJA 4NQ0A 5KCHA 4AP2A 3RERA 3H0HA 1O1SA 1UJJA 1JWGA 2JMCA 4A53A 1H3ZA 4KVMA 2RQRA 2JJ9A 3CQGB 4AFUC 2X6JA 4I2WA 1OYXA 3DLLA 3JB9J 4EMKC 1JPLA 3FTZA 4PUCA 2YHTA 3ZYQA 1OZ3A 1KJWA 3CMAQ 1WHJA 5CECB 4CRIA 4F16A 3CCUT 5FQ7A 4JXTA 2A36A 5C6SA 5KYYB 1M30A 2GW1A 3JCMb 2XICA 3PTAA 5KE2A 3UTMA 3EGXB 4OAUC 2NUPA 3OXGA 4HCKA 1KC8R 3QJZA 2ESWA 3Q73A 2V1QA 1KG1A 2FULA 5I2SA 2J9QA 5KNHD 2ZPEB 4Z88A 4QQGA 3TU4K 1JXMA 1INZA 1S0PA 2FB7A 2A37A 4TV3A 5HKPA 2M16A 5LJ3f 4C92C 4W9RA 4UUCA 3OYDA 5IHNA 1TOVA 5I11A 3VTYA 1DNPA 2KCLA 2EYZA 2DIGA 3ZN3A 3A8MB 4CT0A 1B34B 2PVOB 4F1PA 5FU6B 2C0TA 1KT1A 1JCSA 1OQKA 4PL6A 5LJ5f 3O48A 3KUFA 2P9LG 1IXVA 1A17A 2QC9A 1MMNA 3OSVA 1UGRB 1ACMB 4U8HA 2P2CP 3HP9A 4XU2A 5KNGA 4N2SA 2F8YA 2QGGA 4ZTJA 4B9XA 2IVWA 4ME2A 4KYOB 2DXTA 3CC7T 2O88A 2KNBB 5CR2A 2XHEA 1KHIA 1ZUKA 1BU1A 4HOUA 2KT8A 4L23A 3JCMP 2H3JA 3I35A 3CGHA 2D6FA 2NUZA 4F53A 4J7WA 4O1PA 1RADB 3APDA 2YINA 2NYSA 4A4KA 3EJNA 5LJ3g 4UWGA 1PC2A 2WXNA 4AFQC 5GAMe 2UWJG 2BTTA 1PY1A 2P9NG 1W2BS 1UUEA 3RKYA 3TEEA 3NOCD 2B0OE 3RAUA 4OYSA 4TXRA 3OS5A 5EIBE 2CHZA 2L2PA 1BI3A 4E7SA 4JS4A 4I43A 3IXEA 2M0YA 2XRYA 5FU7C 1YCSB 2EINE 2EIME 2IQCA 1HXDA 3CVUA 1PD0A 4F1SA 1OULA 3EG9A 1NFIE 5G2NA 3KFVA 1IGUA 2IG0A 1N52A 1E8ZA 3HRTA 5H7PA 5GAMf 1K0SA 3ZPJA 4RUGA 4GLMA 5KE3A 3TXMA 5IHIA 3CCQA 4XTWA 4XTXA 4II1A 2EYWA 2AW6A 3JUIA 1PKSA 4J7IA 2DLPA 4JJNK 2FEZA 3VS3A 1D9SA 2DKGA 4GCNA 4IN3B 2VASA 2WXHA 4CC4B 1FT1A 2EQMA 4JZ4A 3CCMA 1KQSP 1AEYA 1E90A 1NA3A 1RLQC 1WPYA 4J8DA 1LD7A 2WXPA 4L9PA 1YJ9A 5GAN4 1K1BA 1E96B 3ZW3A 1M3AA 3EG0A 1X2KA 1VQ6A 2V26A 3PZ2A 5KJLA 1M90C 1OXJA 4U8YD 1M1FA 3KSQA 3FY4A 1BI8B 1N4RA 4G8KA 2DAQA 4BE2A 4HXJA 4M7AA 4PJOG 3NAWA 1K73R 2YRVA 4FLBA 2F2XA 1TTHB 2XCBA 5B1BE 4HCCA 2XEHA 2X9HA 1TN8A 3FU6A 2DXBA 2EYXA 1ELKA 3HXDA 2JW4A 2EPDA 5LOZA 1YWPA 2I1KA 3DBSA 4AIFA 3UM3A 2QZAA 4J8EA 4QFVA 1T0HA 4IURA 2OTLA 4D8DA 4IULA 5CKDA 3BDUA 3CCET 3HDXA 1NYFA 2RQWA 4NRHB 2RFMA 1JJ2S 2WXQA 3TJPA 3E33A 1GCQC 3R7RA 2J4DA 4KGXB 2LCSA 3CVXA 2VGMA 4AEZC 2RJCA 3L6AA 3QOUA 4KZ0A 4UI9K 1OX8A 4UC4A 4ZN3A 4LUDA 1WYXA 4ANWA 1HF8A 2DD4A 2QK0A 4KGVB 2E4HA 2B8AA 3ESKA 4HA8A 3CPWS 1P92A 2HQHA 1N0QA 1OU9A 3LX7A 4PJNA 2CKKA 4K03A 5IXFA 2XMFA 3FUFA 1YITT 2GGRA 2CREA 2GRLA 1KK7A 1M27C 3ME9A 3MO8A 3VS0A 4HVBA 2I0NA 1AWXA 3CCSQ 3H8ZA 2AIRB 2Y0BG 2A3LA 3MX3A 4XI0A 3C4SA 4KUDK 3QK0A 1ELWA 4AFZC 3PS6A 2RM4A 4EPCA 4AFSC 4N5QA 1IHWA 1E6GA 1NM7A 2AKKA 3CSTA 2GRQB 4JD2G 1FWZA 4EHMA 5LJ3j 4FYWB 1Y96A 4C5EA 2DIQA 3UPVA 3E34A 2XKOC 2XGSA 2KQWA 2YHCA 1V1CA 3ZYLA 1Y0MA 4F7UG 1O1TA 5AIJA 2XS8A 4LERA 1VQKQ 2DJZA 3EIJA 1IHBA 2DJQA 3P8DA 4PJMA 3HVEB 2WXKA 3NTIA 1UJKA 2VSYA 3ZYKA 1D1AA 4CGVA 3SWNC 1BI2A 3FULA 5ENQD 2A08A 1X6OA 2LP5A 3CCRQ 3PZ1A 1PAQA 5BXUA 1HXIA 2WQ6A 5CBNA 4B8CB 4BY6C 4M78C 5GMKh 3Q9UC 1RACB 3QPHA 3LWIA 2CP3A 2Z0WA 2CZ7B 3FHEA 3CV0A 5JHAA 4EBAG 3ZVVA 1VIEA 4HOQA 2DZNA 3O4ZA 2BE9B 1KC8U 5KYWB 2X3WD 3VRYA 4R56A 1S72A 4KMOA 2CZ1B 3CD6A 1QMCA 1MZCA 4YDYA 5LFAA 2DXCA 2ZAEA 4C8QC 4GTQA 3CCLT 2J05A 4J9IA 3BG0B 3V30A 3MCAB 1QCFA 2LSVA 4HVUA 4WWPA 1E8WA 4RTTA 4WF2A 4FJZA 3BW1A 3OYCA 3DSUA 1LJOA 1TJCA 3M0QA 5CKEA 1VQ4Q 3BQOA 3HPWA 4ATOA 4Y6CA 1G83A 3VS4A 4M7DF 3SHFA 3WVEB 3FUEA 1IKND 2F8XK 5GAN5 5CCAA 3I5PA 4OGEA 4FA6A 2JM8A 3RO2A 4FYVB 3KXTA 4XEIG 4K5CA 4ANXA 5CQYA 3AU4A 1UGQB 5GAOm 1MMGA 3G71T 3ENEA 1KQ1A 4OB3B 2DYRE 3UKUG 1TNZA 3Q78A 4C8QD 2ENMA 3FUKA 2E70A 4DX1A 4RTYA 3CC7A 3GYZA 2OJ2A 1UHCA 3OYFA 3RRNB 4AOFA 3OYHA 1KD1R 2KXDA 4VUBA 3JCMh 4BX9A 3AS8A 4LNUD 2OAUA 3GOXA 1SEMA 1PC0A 2X51A 3G2TA 2DM1A 1OZ2A 1MX2A 2YLCA 3DLMA 4HCZA 3CHPA 1BYMA 3TXNA 2XRZA 3EFOB 4EZLA 2GQIA 1G5VA 2FO1E 2QYZA 4DLOA 4TXPA 3DSWA 3NFCA 3TWVA 1M2VA 1T3LA 1JJ2P 5CRUA 4N4HA 3JUEA 3G2VA 2L5QA 5G04C 2FG0A 4GY5A 4TXQA 2H3EB 5FINA 3TWSA 3NGPA 3OYAA 3CCMQ 5FT9A 3IEGA 2K4YA 2ZCFB 1N27A 4WTOB 3UQ3A 2MI6A 4G25A 1RAFB 3HHTB 2KRNA 2J4BA 5FZQA 4N39A 1PWTA 1H6OA 3VLDA 2G6FX 5CVIA 1SF9A 2A7YA 3OB9A 4F3VA 1TUCA 3JCMg 5AN8A 4UI9J 3T9KA 2M51A 2LMJA 3M4GA 1R0BG 1OWOA 5G04J 4QVDA 1QVGP 1NLOC 4UWKA 4BB7A 1MMAA 4GA1A 1ZSZC 3MJWA 5LJ5h 2YHEA 1UN8A 1KPSB 1VQOA 3PEVB 2RHZA 1NBEB 3CCJT 1LPLA 3D9JA 1Q81R 3U4TA 4OMPA 1ZHIA 3HYMB 3JCKC 3FP3A 1U5SA 3VJPA 3OS2A 1NG2A 3D9IA 3CCJQ 4BFRA 1U1TA 5FW9A 4C92B 4PJOF 1VQLQ 1ZQ1A 1H8KA 2D8HA 3G2SA 2GF7A 4FSXA 4MZPA 9ATCB 4M75B 1EYHA 1QKWA 2LRQA 5FU7B 2J6OA 1VQNT 1VQLT 2FZCB 3MJXA 4PKCC 2NYJA 2R17C 4AXHA 2KMTA 2FF4A 3EHNA 1K9MU 4M7DA 2VVKA 5KH6A 4GB9A 1ZUUA 2QYJA 1EFNA 4LNPA 2EIJE 5I22A 1KQSA 4GA2A 4A3VA 2V8SE 2IO2C 2YUOA 3DKMA 1U06A 3DSVA 4KZCA 1SA4A 4J9HA 3CC4Q 2K5LA 2M9UA 3APCA 5AAOA 4M7AG 4C0DC 4RCBA 1H2VC 3EFSA 2YDLA 3CC7Q 2KRSA 2PQWA 2PUOB 5LL6S 1O1RA 1M1KC 4Z02A 3RIRA 1RABB 2KM4A 4F7UA 3CHMA 3B13A 1H19A 3CC2A 1OWLA 4AY5A 2JOYA 3NHNA 5T4YA 4CDRA 3Q9NC 4V2SA 3X20B 1QLYA 2WXOA 2PQRA 1S63A 4U07A 3N71A 5ARGA 3RUXA 2VQ2A 2DWZA 3KEZA 4XTUA 3PGGA 2V5FA 3JCMc 4GYYA 3QJ6A 2PTKA 4JZYA 4FT2A 3L82A 3SWNA 4QVCA 1YI2T 3BEEA 2C06A 1OCRE 3KD7A 4M75E 3OY9A 1WHLA 3ZGQA 1QVFA 1N4QA 3HG0D 4ACLA 3JCMV 5J3BA 4J7FA 2HBWA 3G4ST 4JLIA 3PREA 1T0JA 4FW2A 5ENOD 3KS2A 5HRYA 4EPZA 2DF6A 1YJ9Q 4MKTA 2AVPA 2P9SG 5EN5D 1TEZA 1KQSS 3QYHB 3RMQA 3SFZA 4M77C 4PJJA 5D6WA 3EGDB 2ZPIB 1ZUYA 4RG6A 3UT8A 2EGCA 3PNWC 3ZEHA 2KZTB 3L2ZA 2E6ZA 2HEQA 1GL5A 3O5ZA 1VYVA 1Y07A 5EX3A 3BDLA 2GNCA 1IREB 4DOVA 4JZ3A 1RZ4A 2JLBA 5CK9A 3SFYA 2JUFA 4DBHA 4C0FA 4GPMA 1ZA1B 2ZU6B 3Q15A 2JNGA 3A5ZB 4M7AE 3HVEA 3VV0A 3JQ0A 5KCOA 1D8EA 3LVRE 3CHQA 4ZN1A 2W0ZA 5KYUB 3RU0A 3R9MA 3QDFA 1AOJA 3SBSA 3CCJA 1N11A 3U9WA 2DRKA 4OP0A 4JA9A 4L2YA 4BE0A 2RO0A 2E5KA 5AQ7A 1U3CA 4HVVA 3UM2A 3PDNA 2BUGA 3UPUA 1D0ZA 3FTWA 5AYFA 1TN6A 3S2AA 5JA4D 1IGQA 1NZNA 5GAOl 3FTSA 4WNFA 2QA4T 2HAXA 2ATCB 3LW5E 5DBKA 4BACA 3QSUA 3ML8A 1TXQA 3TGOA 2DRMA 1FMKA 5FRMA 2FHDA 3I5RA 5FTPA 1KQ2A 3CQCB 4M75D 4FSSA 1VQKT 2Y69E 3LVQE 1W2BP 3ZNGA 4PK4A 3HKSA 1TWBA 4FJYA 2LT4A 2WPVA 3FTUA 2RJDA 1C0MA 4B94A 5KBAA 1BBZA 2JT4A 1QVFP 2FZKB 1QNFA 3L16A 2QYUA 2XPYA 1I8FA 2DILA 3BFMA 4C8QG 4E2FB 5GANg 2HD0A 1JJ2A 1KZOA 3CBPA 1KIKA 3QAQA 1ZLMA 1QP2A 1OEBA 4J5YA 4M7AF 5CMYA 2YXYA 3Q49B 2RFAA 2K3BA 2OVFA 4GLKA 1Z9QA 5GAN7 5LP0A 2PM7A 3CK7A 2Y4TA 1Y8MA 3FRNA 4I6JA 4XX5A 3QKJA 4C8QB 5FLXE 4U63A 4RMOA 2K7AA 4AVXA 3HRAA 1X01A 3VS6A 4I9EA 4U0UA 1YBYA 4V3IA 2F5TX 2L9BA 4ELYC 1SVXA 2BZYA 1OWPA 2BEDA 2VGEA 1KFZA 4ZFHA 3GIBA 4PS7A 2EWNA 5KWDA 3DWLG 4JB8P 4APFA 3SBTB 4DX2A 2FPDA 3TVTA 2ZPHB 3V8LA 3PZ3A 3CPFA 1OV3A 3CQTA 1NL4A 4LDYA 1VQPA 3ZXSA 4GTVA 2AXZA 4DBRA 1M2VB 3V2XA 3QZ9B 4GZDA 1H92A 1D1CA 4LDWA 2V4LA 4XQ3A 4B93B 4M7AB 3VS1A 2X35A 4DBQA 2NLUA 3HFOA 4L5GA 1UN9A 1FX7A 4BE1A 3G6EA 4ACKA 3ZFWA 1NEBA 2QEXQ 3MKRA 5LJ5e 1JCRA 3SFXA 3UATA 4ATGA 4HT8A 2X6FA 3CD6T 3L9TA 1AWWA 5E75A 2ROLA 5A2QE 4KVOA 3I55A 5JJ6A 3CD6Q 1SZAA 4ORZA 1MMDA 1YN8A 4L2LA 4F17A 2QAZA 3JCMX 4BT8A 4BTAA 3CCVQ 2XIDA 5LJ5d 3NBNB 1LCKA 3R9AB 1LF8A 2PQNA 2WXFA 3SFMA 3U23A 2EGAA 4PJOE 1TNBA 1AWCB 1WFWA 3Q5MA 4GZ5A 4NL2A 3L2QA 3PEUB 3QNKA 1OT8A 2QG9B 4BUGA 2NWMA 1YJNT 3NZUA 1X27A 2FZGB 3RKXA 2DL7A 4MS6A 3V8KA 4EQFA 3CCEA 5M72A 4RTWA 3K9IA 2JZ2A 2JEKA 1SRLA 3SHWA 3UA6A 4AG2C 3FWVA 4PJOC 2DVEA 4PFPA 3B7BA 1JBMA 3QXEB 4D8KA 2LO6A 4KULA 2CSQA 2CP2A 1Q86R 3FTXA 3SB2A 2WXJA 3TWQA 3FU5A 1ZSZB 2PNNA 3A1PA 4C0MA 4O1OA 2F0YA 2LNHB 1NA0A 2DXUA 4KH0B 3RKVA 2FVUA 2KEAA 2M0OA 4OB0B 3MP6A 2E1HA 1DJ7B 4ESRA 2DZ9A 4E7KA 3D7SB 3JV3A 2V4HC 5EIDA 1MX4A 1R77A 1VYTA 4BI3A 3LPZA 2QQBA 2LAHA 2RHXA 2UY1B 4GTTA 5D2MC 3TL5A 1EX4A 4ZGEB 1Q7YU 1MUZA 3V31A 1H2UA 1C1AA 2WXMA 4I9CA 1VQ8A 3VS7A 3PFSA 4N3BA 2QQ9A 4OVAA 4YTLA 3UMVA 2CZ0B 3MP8A 3VRZA 4D6WA 4RLYA 3CC4A 3DSSA 2DEQA 5GAOq 3Q47B 1YJWQ 3URGA 1XQHA 1YFNA 3AAAC 3MZLB 3VUZA 3G4SA 4R7LA 4MBGA 3OXLA 1AZGB 5FQ6A 2LQWA 2RPNA 1W70A 1ZX6A 1OCCE 4HQDA 4DQ2A 4J9GA 2VWFA 3LYAA 4U0SA 5CMWA 4GCOA 3QHSA 5DM7R 2WXGA 5FQ8A 1JB0E 1QKXA 5EX0A 3FB9A 3QIIA 5ANLA 3HL8A 2NUPB 2DA9A 3CCST 1K4US 2NUTB 2E3HA 1HJDA 4MMKA 5GMKl 4M7AD 4G26A 5G05J 4M4ZA 3RIBA 1K8KG 4Q94A 2DERA 2DBKA 1IQUA 4PFZA 2RK1A 4DEXA 2ZZDA 4M78B 1UG3A 3LCAA 4BX8A 2Y1LE 5KJKA 2E65A 2FBNA 2YNQA 4XZ4A 5EKQD 2BTDA 2D1XA 3JB9I 2XPIA 3I5SA 4Y28E 1M1KU 1ELRA 4PS8A 5EYLA 2FRYA 5CAIA 4MRUA 1BIBA 2V1RA 4F7UE 1Q7YR 1BKBA 4G1TA 3X24B 3UWNA 1K76A 2CP7A 3HHMA 1BCMA 1W6XA 1X6BA 1Q81C 4RTVA 3HRUA 1Z3YA 4M77E 3HRSA 2WMOA 2K3XA 3EFRA 1PM3A 5IH2A 5ENSD 2PUKB 4GA0A 3D9MA 4E7LA 1W3BA 1QQEA 5CCMA 3M0UA 1Q82C 4X34A 2AJAA 1SHGA 2JMAA 2KI7A 2QGFB 5BUZA 1NYGA 4XK8E 5A6CA 3CCVT 3CMEA 1I81A 4XI9A 3R6NA 4Q69A 3VLEA 3JCMe 4RG2A 5IHKA 2KVQG 2EJFA 3CCUQ 4QVZA 1X69A 3PE3A 2KXPC 5JHBA 1EIFA 2FYKA 4F14A 1WQWA 1UGVA 3I9QA 1SZ9A 4RSYA 3NF1A 4C0GA 1NLPC 1UHFA 1UB4A 5HCKA 3NZSA 1ZA2B 2XEVA 5GANe 2HZYA 4GMJA 3W9GA 3SNXA 5CIUA 3G1JA 3L13A 3SD5A 2HBPA 1G3SA 3AS4A 4K5BA 4XTZA 2FO7A 3ULEG 3MEUA 1VQ7T 3M0TA 4LD9K 2ILRA 3TWXA 2J07A 2BZ8A 4RVBA 2FL7A 1V54E 3QYGB 3CK8A 4M77B 5I21A 4RCCA 4E7JA 4F6RD 4A1GA 4GBQA 1AT1B 5LJ5g 2KRMA 1HE8A 3FUMA 3SQVA 3Q1JA 3X26B 5D0QD 4DJAA 3FUDA 2KGTA 1YNZA 3V7CA 3E37A 4GTOA 4N4IA 3THKA 2LNVA 4C92D 2JVVA 3I56A 3J7AF 2L3SA 1G2BA 3QKYA 1PCXA 2VGNA 2BIVA 1RW2A 4EBAA 3QDNA 2JM9A 5IAYA 4LD6A 4J0UA 3FJ5A 4RG9A 3CMAA 1E8YA 1YJWT 2EBPA 1K9MC 2KC7A 4O6JA 1UECA 1SA5A 4AV7A 3GNGA 3CVPA 5ARFA 2X38A 4XIFA 1TUGB 3GBQA 2HKNA 3UIPC 3ZKJA 5ENNA 2XPZA 2RH2A 3A8OB 2O9VA 2RJEA 1N8RC 2QTVA 3CCRA 2FI7A 4URKA 3ZYMA 3ASDA 3WVDB 5AYWD 3LY7A 2LXMA 4CDNA 5GAN3 3CPWA 2EJ9A 3IKOB 4U04A 2K2MA 4LDVA 2WQHA 4I1MA 3CCMT 3CHRA 4M77D 2VTBB 3VU3C 4JJCA 3RRMB 3OMGA 3LKUA 3CVNA 3OMCA 2DCPA 2L0TB 4XU1A 4AMCA 5CERB 3RNJA 3A8HB 1D09B 4JEHA 1K9AA 1TG0A 7AT1B 4K11A 4PJOA 4IRUA 3GNFB 4M77F 1ZSGA 2L3RA 1IXDA 4E47A 2Y4UA 1Q2ZA 2CS7A 2X6IA 4CC2A 1D0XA 2KAFA 5DY9A 2DETA 2J09A 3LY8A 2WMNA 2FEIA 3MV2B 4H7XA 4N4GA 4C5HA 4I1OB 4FP7A 2JXBA 3FEYA 5C1DA 2DO3A 2F2VA 1EPUA 2BZXA 2LC4A 1QWFA 3FIFA 3FEXA 4E7HA 4PS3A 3BG1B 3IQLA 3FH5A 4J6YA 2PZ1A 2VSNA 3PE0A 2CG2A 2I6HA 2KCVA 2XZTG 5AQBA 2XZDG 2DL3A 3G7ZA 4JHKA 3CMAT 2KR3A 4ZGDB 4NL3A 2O9SA 3EGDA 1UFFA 2HNIA 1X81A 3RSEG 3QC1A 2EQKA 2CT4A 3TG4A 3P8HA 1K0XA 1VQ9A 2QASA 1N6AA 2DBAA 3FJPA 1WJQA 3M0RA 1YI2Q 2I1JA 3JCMW 2J06A 1YIJQ 2IU1A 3B7TA 3TREA 2VXFA 1HX8A 4AM9A 2KATA 4AJWA 1KC8C 2VV5A 4PLIA 5AT1B 2H8HA 3PUKA 2WSFE 4JJBA 4BERA 5HY6A 3TQ7P 4IKFA 1AVZC 2DYBA 2X3XD 4CC7A 5KYUA 3CMET 5FU6C 3VUBA 3JYSA 5GAN2 2HQEA 2E3IA 3ONKA 2I2LA 3H0FA 4J6WA 5HKCA 3GP8A 4ZTFA 4Z68A 4BSZB 3DPYA 5CHEE 4KH1B 3E32A 2KROA 2H6FA 4XU3A 3CVLA 1RAIB 4BD3A 4BI8B 5KYXA 3I55T 2CSIA 1RAEB 1U8RA 1W1FA 2KCKA 2G3RA 1U3OA 1I0CA 2A28A 3L2VA 1K9MR 5T3RA 1WHMA 1UE9A 3X28B 1XOVA 3L17A 3QWXX 1WG0A 5L8RE 2IJGX 5FQ4A 4DEYA 3V8JA 2DBMA 3CCUA 1VOMA 1VQ4A 4AY6A 2CP0A 2XGMA 4M7DD 4A55A 1QCNA 1TNYA 5CEDB 1BK2A 1ZBPA 3I4RB 4M7CA 3PH0C 1Z6TA 2R57A 2IOSA 3MKQA 3PRZA 2C2LA 3FDRA 1WHGA 2A0FB 1M9SA 5GJWB 4B0ZA 3JXJA 1LNXA 1KLXA 2IFUA 2E0IA 3PVLA 2R5AA 3CHOA 4HORA 3ESLA 3VKIA 1M5Q1 2C0LA 1RI0A 1OI1A 5C2YA 2HR2A 1F1BB 2CUDA 4J9DA 3M5AA 1K8AU 4TVRA 1BIAA 3UF4A 2ROTA 5AQAA 4G24A 3OAWA 4EMKA 2Y3AA 3NTKA 1NPPA 2X4JA 3UT1A 1Q82U 1WXTA 3CCVA 5EYPF 4J8OA 4BTBA 5CKFA 2XCCA 3UA7A 2MIOA 1I07A 1CSKA 4PH4B 2E10A 3REBB 5FJYA 1YHQQ 2OTJT 1HO8A 5KJMA 3CK9A 5B1AE 1FXXA 1U3DA 3ULQA 1R8OB 4LUEA 5LJ3d 2QA4Q 1YCYA 5ITZF 4U0ZA 2L6JA 2WXIA 3ASFA 1OWMA 3UIOC 2LTOA 2KBXA 4JDSA 5LCWJ 4DOWA 4YDEA 2K57A 1A0NB 3DEOA 3F70A 4BY6B 3UT7A 3FH7A 3Q7AA 2CHWA 2XDDA 2BKGA 1WHHA 2F69A 3JB9G 3C5RA 2VSOE 2GRMA 1S72Q 5J08A 1VQ5T 5FWBA 3RRUA 1PSFA 1VQ9T 3MHXA 3UT4A 4OF1A 2LAIA 4XAXB 4HBDA 2K2VA 3VYGA 5LJ5j 1VQPQ 3MYVA 1JUQA 2DEUA 4KRTA 1WAO1 5FRNA 2A4ZA 2VGXB 1TNOA 4A54A 5LCWC 1BU9A 4Y92A 3JCMd 3KBGA 2CZ6B 3UX4A 2QA4A 1OCZE 1UG1A 1SKUB 3DSTA 3ONLA 2CH4W 1IQRA 3PNLB 3FDHA 2VXEA 3ASKA 5JJTA 3CCEQ 1QQJA 4B9WA 3ULRB 2EIKE 5G05C 2EKHA 4FC8A 2DYSE 1Q95G 2XEEA 4JEUA 2RD1A 4XTVA 2QI2A 3FUIA 3T8KA 1V29B 3L2RA 3AHUA 3J5PA 1ABOA 3CR3A 4L59A 1M2OA 2JABA 3PIOA 3FUJA 4QKUA 1WNLA 1BI0A 3RBBB 3SDZA 5IXBA 2F37A 4M75C 1IO6A 4Y6WA 3B7RL 1NEGA 2P0PA 3CCSA 4PJLA 1VQ5A 3L1AA 4KT6B 2DNUA 2CP5A 2LNIA 2C0IA 2P0KA 1C6VX 1M90U 4M7DB 1IHGA 2WVIA 2B6CA 4WNGA 4G8LA 1CKAA 5A0LA 5ENPD 4LDXA 5GAN8 3L2WA 3GPLA 3BU8A 3PMIA 1VQPT 3LEWA 3JCMJ 1WXUA 3VLFA 1WI7A 2V8KA 4QQ6A 1QVFS 2LJ0A 1Y96B 4FHJA 3C3QA 4A4GA 5GAN6 3EHRA 4YVQC 5CKHA 2VTBA 2E5QA 4CZ2D 2PZIA 4JRKA 1GBRA 1K73U 1R0CB 3HXCA 1B07A 1IYGA 4FHKA 1LD8A 4TUUA 1GCQA 2AK5A 3L08A 1SHFA 4NOYA 2RN8A 4C0EA 4L6V5 3PZDA 2GQVA 1AWJA 5BT1A 3RK6A 5AJDA 1N9AA 2RQUA 2D9TA 2K79A 3JXIA 1BD8A 2KDSA 2L0IA 5J26A 4BETA 8ATCB 2EAYA 1H3HA 4ATZD 3G71A 4J6XA 1A5EA 4LEUA 1BPOA 1GRIA 5GMKi 1DC2A 4E6RA 3OTNA 2KY9A 4NS5A 4KBMB 4OMNA 1ARKA 1YITA 1GW6A 1M8VA 2HSEB 2LQNA 2XU8A 2RJFA 1OY3D 1K1AA 4EIKA 2ZGDA 3QZ5B 2IEJA 3AG4E 2M63A 2ZGWA 2J08A 4LXCA 1T3SA 5BV1A 2GROB 3PUJA 3OQ5A 3QDRB 3MGBA 1QBQA 3ZIMA 4FADA 1GXIE 4X1VA 1Q82R 1EDUA 2EQIA 1WGSA 3EAEA 3C72A 2R2LA 1BCOA 4NIKA 1D0YA 1S64A 5KCMA 2LUHA 1I5OB 1SW6A 3IHVA 4CCAA 4DUIA 1IB8A 3DRAA 3FEOA 4G11A 3QWVA 3GF5A 1KHCA 2GTOA 2RNAA 3MPUB 2RB6A 1YITQ 2K6DA 1RLPC 1UJ0A 4C9BB 3EG9B 2RG8A 5FWQA 4Z89A 3Q75A 1LVKA 4OB1B 3PIPA 3QWPA 3RKWA 2CYZB 5D6YA 3RR6A 4GTPA 3CC2Q 3ZHEB 2A5UA 3FFLA 3B7UX 2EKOA 2YUQA 4JLGA 2CFZA 2K9GA 3G2UA 3H0IA 2MOXA 2CUBA 2Y4XA 2SEMA 4BDYA 3N5BB 3TSWA 2ONDA 3CVYA 1AZEA 3MCXA 4DA4A 1H641 2WACA 2HL5C 3ZL7C 4E7ZA 1SPKA 1HK9A 3OS0A 4E7IA 2Y4YA 4C8QF 1TYQG 1TUDA 1Y57A 1B89A 3G71Q 2ETBA 4FULA 4ANUA 5AENA 3AU5A 1O9SA 1EZZB 5GANj 3B95A 3MKQB 4A63B 3QG1A 3CKCA 1JQQA 4HOSA 2P9PG 4K0RA 1E7VA 4LE9A 4JS5A 3DEPA 1B3QA 4QT7A 3CXCS 1D3BB 3M58A 3GZSA 3VYHB 2YLBA 4A4HA 1KD1U 1Z5SC 3VTXA 2NXPA 2BF0X
chains in the Genus database with same CATH topology
4K5AB 1Z9ZA 4HVWA 2RMOA 5ENSD 1FYNA 3VS5A 4RTXA 5IH2A 5FWCA 1YMPA 2DZNA 1GBQA 2DE0X 4JPBW 2L0AA 2AKLA 2X3WD 3M0UA 3VRYA 2DZOA 4TUMA 1M8MA 2AJAA 3V79K 1SHGA 4YDYA 2JMAA 2LZ6B 2OAWA 1NYGA 4HRMB 3SO8A 2J05A 4J9IA 4HLLA 3V30A 3R6NA 1QCFA 4HVUA 4OMOA 4RTTA 2EVRA 5IHKA 3M0QA 2BKKB 4O60A 2P4RA 4HNAD 1GFDA 2DL4A 1G83A 3VS4A 1X69A 1IKND 2F8XK 2KXPC 4CYMD 4F14A 4YDWA 1E6HA 1UGVA 2KE9A 2JM8A 3I9QA 1NLPC 1UHFA 2DVJA 3J5QB 4K5CA 3A98A 5HCKA 2O31A 3UI2A 2ETCA 3W9GA 1ZBJA 1BLXB 3UXGA 2QDLA 4IIOA 3PVQA 2KT1A 4K5BA 2ENMA 5CEAA 3M0TA 4DX1A 4RTYA 3TWXA 2OJ2A 1UHCA 2BZ8A 1I1JA 2KXDA 2D8JA 4LNUD 1SEMA 1UJYA 1OPLA 2DM1A 3EHQA 1MX2A 4F6RD 4J8YA 2L6BA 3EGUA 4GBQA 5ECAA 2L3QA 2VKNA 2KRMA 1WX6A 5JMND 2GQIA 2FO1E 1S1NA 1GFCA 2EW3A 4C48B 2DL8A 2KGTA 1YNZA 2MYOA 3TWVA 3THKA 1T3LA 2L3SA 1G2BA 1OOTA 3JUEA 4ZHBA 2JM9A 1JXOA 3H41A 4DX5D 3FJ5A 2FG0A 3M0PA 2EGEA 2CT3A 2EBPA 5FINA 3TWSA 1PRMC 3NGPA 1UECA 1YYHA 1AD5A 3GBQA 3LJNA 3LH5A 3ZKJA 2KRNA 1PWTA 2O9VA 2G6FX 1N5ZA 2J6FA 2V5QC 1TUCA 5AN8A 3T9KA 2M51A 2LMJA 1PHTA 1NLOC 2K2MA 2GTJA 2JS0A 1OPKA 1SSHA 1M3CA 4JJCA 5AQ9A 4OMPA 4WCIA 3M0SA 1K1ZA 1JEGA 5CERB 4ZNXA 3RNJA 1U5SA 1J3TA 1UOHA 3C0CA 1NG2A 1K9AA 1TG0A 4OAVB 4K11A 5FW9A 1H8KA 1ZSGA 1TR4A 2D8HA 3EG2A 4Z8AA 2OI3A 2KYBA 4CC2A 2CH4A 1QKWA 2DL5A 2FEIA 2J6OA 2NYJA 1E7OA 1MYOA 2JXBA 2VVKA 1WDXA 1UDLA 1ZUUA 3REAB 2F2VA 2BZXA 2QYJA 1QWFA 2ECZA 1WIEA 1EFNA 4LNPA 4HB5A 2LJ1A 3IQLA 2PZ1A 3PE0A 5I22A 2XZTG 5AQBA 2XZDG 2DL3A 2YUOA 1U06A 2PNIA 3AJIA 2C0OA 2KR3A 4J9HA 2ZGGA 2O9SA 3V2OA 1UFFA 5AAOA 2CT4A 2YDLA 1K0XA 2KRSA 3M0RA 2ABLA 2ED0A 5ENTD 1PKTA 2J06A 1MJ0A 1X2QA 4HRLA 3NHNA 3Q9NC 1AWOA 2AZVA 2JS2A 1JO8A 1QLYA 2LJ3A 1MV0B 2H8HA 1GCPA 4JJBA 4BERA 4HRNA 4RTZA 2DWZA 1AVZC 2DYBA 2X3XD 2MCNA 4CC7A 2DMOA 2DX1A 2PTKA 3NPFA 5CBOA 2J7IA 3H0FA 5AARA 2YSQA 2HDAA 1ABQA 4Z68A 4BSZB 1DCQA 3HG0D 1MV3A 2KROA 1HSQA 4OMLA 2HBWA 1T0JA 2CSIA 5ENOD 2DF6A 5HRYA 1W1FA 4AG1C 1S70B 1U3OA 1I0CA 2A28A 5EN5D 2HE0A 1UE9A 4HI8A 1XOVA 3QWXX 1WG0A 1YP5A 2YT6A 4DEYA 1ZUYA 2RQTA 2DBMA 2EGCA 4CC3A 3NOGD 5CEDB 1BK2A 2HEQA 1GL5A 3O5ZA 1VYVA 2GNCA 2J8SD 3H0HA 2CDTA 1AP7A 5GJWB 4JZ3A 2JMCA 3JXJA 2RQRA 4AFUC 4IIMA 4GPMA 3PVLA 1BB9A 1KSWA 1KJWA 4JJDA 5D66A 5CECB 4F16A 2FPEA 2CUDA 2W0ZA 4J9DA 1AOJA 2A36A 1N11A 2ED1A 1M30A 1WDYA 4LG6A 2DRKA 3UF4A 2ROTA 5AQAA 3UTMA 3F6QA 4OAUC 2E5KA 5AQ7A 4HCKA 3SEMA 1WXTA 2ESWA 4HVVA 5EYPF 3UA7A 2V1QA 5KNHD 2MIOA 1I07A 4Z88A 5JA4D 1CSKA 5BXOA 4GMRA 1JXMA 3REBB 2A37A 5HKPA 4UUCA 2DRMA 1FMKA 3I5RA 3TSZA 5IHNA 4FSSA 4LUEA 5I11A 4J9FA 5ITZF 5FIOA 3ZNGA 2EYZA 2FRWA 2KBXA 4BESA 4OMQA 3NMZC 1A0NB 3DEOA 1PNJA 4F1PA 5KBAA 1BBZA 2C0TA 2JT4A 2BKGA 2HCKA 2W10A 3C5RA 2L3PA 2DILA 2QC9A 1IXVA 1PRLC 5FWBA 1VYUA 2P2CP 2GBQA 5KNGA 2ETAA 1KIKA 1ZLMA 2F8YA 4J9EA 1OEBA 4HBDA 5L23A 2RFAA 5ENRD 2K3BA 4KRTA 3TWTA 3TWRA 2O2OA 2O88A 1Z9QA 2KNBB 1BU9A 1ZUKA 1BU1A 4Y92A 2KT8A 1UG1A 3I35A 2DVWA 2KXCA 2NUZA 1CKBA 1HD3A 2CH4W 2K7AA 4J7WA 4O1PA 3HRAA 3VS6A 1SVXA 3ULRB 2BZYA 2VGEA 1KFZA 4ZFHA 4DRXE 2EKHA 4AFQC 2XEEA 5KWDA 2BTTA 4JB8P 1UUEA 4DX2A 2FPDA 3TVTA 3T8KA 3NOCD 2B0OE 1OV3A 3J5PA 1ABOA 5EIBE 3CQTA 2JABA 2L2PA 4J9CA 3RBBB 2IIMA 3IXEA 2M0YA 3V2XA 5IXBA 1H92A 1YCSB 2F37A 4B93B 3VS1A 1IO6A 1NEGA 1NFIE 3EU9A 3KFVA 1K0SA 4RUGA 3KEAA 4BEPA 1M3BA 2DNUA 4GLMA 1NEBA 2C0IA 5IHIA 3UATA 2EYWA 1PKSA 1SRMA 1G3NB 2DLPA 2YUPA 2SRCA 3VS3A 1D9SA 1AWWA 4G8LA 1CKAA 5ENPD 2ROLA 2KBTA 4CC4B 4JZ4A 2RQVA 1AEYA 4ORZA 1YN8A 4F17A 2AZSA 3TWWA 1RLQC 1WXUA 1WI7A 2YUNA 1K1BA 2LJ0A 3NBNB 1LCKA 2XENA 3EHRA 1M3AA 3EG0A 1X2KA 4CZ2D 4U95D 3U23A 1WLPB 2EGAA 1GBRA 5HS0A 1AWCB 1WFWA 2EYYA 1B07A 3VS2A 4U8YD 1OT8A 1GCQA 2J6KA 2NWMA 2AK5A 1BI8B 1SHFA 2RN8A 2A5EA 1X27A 4J9BA 4G8KA 1AWJA 2DL7A 2JTEA 3TWUA 2RQUA 4HXJA 1WA7A 4RTWA 4LN2A 2K79A 3JXIA 1BD8A 1SRLA 2B86A 3SHWA 2FPFA 3UA6A 4BETA 4LSZE 4AG2C 1H3HA 4ATZD 2F2XA 1A5EA 3B7BA 4OMMA 2XEHA 4D8KA 1GRIA 2EYXA 1DC2A 4E6RA 2CSQA 2JW4A 2EPDA 4OMNA 1ARKA 1QYMA 1YWPA 3TWQA 2LQNA 4DX7D 1YWOA 2PNNA 4QFVA 1T0HA 1OY3D 1K1AA 3ZU7B 4O1OA 2LNHB 4D8DA 4EIKA 2ZGDA 1QWEA 2KEAA 1RI9A 1T3SA 4ESRA 1NYFA 3QWYA 2RQWA 3JV3A 2RFMA 2V4HC 5EIDA 1MX4A 1VYTA 4X1VA 2EQIA 1GCQC 2D0NA 1MUZA 3V31A 3VS7A 2LCSA 2FO0A 4NIKA 2LX7A 1SW6A 4DUIA 3VRZA 4RLYA 4LUDA 1WYXA 2GTOA 2RNAA 3AAAC 2K6DA 1RLPC 2RF0A 1UJ0A 4U8VD 1N0QA 2HSPA 4Z89A 1AZGB 2LQWA 2RPNA 4RTUA 5IXFA 1W70A 2XMFA 2GGRA 2CREA 1ZX6A 4HQDA 4J9GA 1M27C 2VWFA 2KYMA 3VS0A 2I0NA 2YUQA 4DX6D 5EILA 1AWXA 2K9GA 2Y0BG 3H0IA 2MOXA 2CUBA 1QKXA 2SEMA 3EG3A 5EC7A 3ZUVB 3TSWA 4HI9A 4AFZC 2DA9A 1AZEA 4AFSC 4N5QA 1E6GA 1K4US 1HJDA 1NM7A 3ZL7C 2AKKA 1SPKA 1X43A 4QQIA 1VA7A 4M4ZA 1MX6A 4R0KA 1BI7B 2DBKA 5GJVB 1TUDA 4DEXA 4U96D 1Y57A 1V1CA 1Y0MA 2ETBA 2Y1LE 3D9HA 1WXBA 1K3ZD 1RUWA 2D1XA 1IHBA 2DJQA 3EG1A 3B95A 3I5SA 4A63B 1JQQA 5EYLA 5ENQD 2FRYA 1X6GA 4LE9A 3DEPA 1B3QA 2A08A 4QT7A 2LP5A 1JU5C 2V1RA 5BXUA 5CBNA 1N0RA 1K76A 3Q9UC 2F2WA 1W6XA 1X6BA 4RTVA 1UTIA 3W9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5A B;  1Z9Z A;  4HVW A;  2RMO A;  5ENS D;  1FYN A;  3VS5 A;  4RTX A;  5IH2 A;  5FWC A;  1YMP A;  2DZN A;  1GBQ A;  2DE0 X;  4JPB W;  2L0A A;  2AKL A;  2X3W D;  3M0U A;  3VRY A;  2DZO A;  4TUM A;  1M8M A;  2AJA A;  3V79 K;  1SHG A;  4YDY A;  2JMA A;  2LZ6 B;  2OAW A;  1NYG A;  4HRM B;  3SO8 A;  2J05 A;  4J9I A;  4HLL A;  3V30 A;  3R6N A;  1QCF A;  4HVU A;  4OMO A;  4RTT A;  2EVR A;  5IHK A;  3M0Q A;  2BKK B;  4O60 A;  2P4R A;  4HNA D;  1GFD A;  2DL4 A;  1G83 A;  3VS4 A;  1X69 A;  1IKN D;  2F8X K;  2KXP C;  4CYM D;  4F14 A;  4YDW A;  1E6H A;  1UGV A;  2KE9 A;  2JM8 A;  3I9Q A;  1NLP C;  1UHF A;  2DVJ A;  3J5Q B;  4K5C A;  3A98 A;  5HCK A;  2O31 A;  3UI2 A;  2ETC A;  3W9G A;  1ZBJ A;  1BLX B;  3UXG A;  2QDL A;  4IIO A;  3PVQ A;  2KT1 A;  4K5B A;  2ENM A;  5CEA A;  3M0T A;  4DX1 A;  4RTY A;  3TWX A;  2OJ2 A;  1UHC A;  2BZ8 A;  1I1J A;  2KXD A;  2D8J A;  4LNU D;  1SEM A;  1UJY A;  1OPL A;  2DM1 A;  3EHQ A;  1MX2 A;  4F6R D;  4J8Y A;  2L6B A;  3EGU A;  4GBQ A;  5ECA A;  2L3Q A;  2VKN A;  2KRM A;  1WX6 A;  5JMN D;  2GQI A;  2FO1 E;  1S1N A;  1GFC A;  2EW3 A;  4C48 B;  2DL8 A;  2KGT A;  1YNZ A;  2MYO A;  3TWV A;  3THK A;  1T3L A;  2L3S A;  1G2B A;  1OOT A;  3JUE A;  4ZHB A;  2JM9 A;  1JXO A;  3H41 A;  4DX5 D;  3FJ5 A;  2FG0 A;  3M0P A;  2EGE A;  2CT3 A;  2EBP A;  5FIN A;  3TWS A;  1PRM C;  3NGP A;  1UEC A;  1YYH A;  1AD5 A;  3GBQ A;  3LJN A;  3LH5 A;  3ZKJ A;  2KRN A;  1PWT A;  2O9V A;  2G6F X;  1N5Z A;  2J6F A;  2V5Q C;  1TUC A;  5AN8 A;  3T9K A;  2M51 A;  2LMJ A;  1PHT A;  1NLO C;  2K2M A;  2GTJ A;  2JS0 A;  1OPK A;  1SSH A;  1M3C A;  4JJC A;  5AQ9 A;  4OMP A;  4WCI A;  3M0S A;  1K1Z A;  1JEG A;  5CER B;  4ZNX A;  3RNJ A;  1U5S A;  1J3T A;  1UOH A;  3C0C A;  1NG2 A;  1K9A A;  1TG0 A;  4OAV B;  4K11 A;  5FW9 A;  1H8K A;  1ZSG A;  1TR4 A;  2D8H A;  3EG2 A;  4Z8A A;  2OI3 A;  2KYB A;  4CC2 A;  2CH4 A;  1QKW A;  2DL5 A;  2FEI A;  2J6O A;  2NYJ A;  1E7O A;  1MYO A;  2JXB A;  2VVK A;  1WDX A;  1UDL A;  1ZUU A;  3REA B;  2F2V A;  2BZX A;  2QYJ A;  1QWF A;  2ECZ A;  1WIE A;  1EFN A;  4LNP A;  4HB5 A;  2LJ1 A;  3IQL A;  2PZ1 A;  3PE0 A;  5I22 A;  2XZT G;  5AQB A;  2XZD G;  2DL3 A;  2YUO A;  1U06 A;  2PNI A;  3AJI A;  2C0O A;  2KR3 A;  4J9H A;  2ZGG A;  2O9S A;  3V2O A;  1UFF A;  5AAO A;  2CT4 A;  2YDL A;  1K0X A;  2KRS A;  3M0R A;  2ABL A;  2ED0 A;  5ENT D;  1PKT A;  2J06 A;  1MJ0 A;  1X2Q A;  4HRL A;  3NHN A;  3Q9N C;  1AWO A;  2AZV A;  2JS2 A;  1JO8 A;  1QLY A;  2LJ3 A;  1MV0 B;  2H8H A;  1GCP A;  4JJB A;  4BER A;  4HRN A;  4RTZ A;  2DWZ A;  1AVZ C;  2DYB A;  2X3X D;  2MCN A;  4CC7 A;  2DMO A;  2DX1 A;  2PTK A;  3NPF A;  5CBO A;  2J7I A;  3H0F A;  5AAR A;  2YSQ A;  2HDA A;  1ABQ A;  4Z68 A;  4BSZ B;  1DCQ A;  3HG0 D;  1MV3 A;  2KRO A;  1HSQ A;  4OML A;  2HBW A;  1T0J A;  2CSI A;  5ENO D;  2DF6 A;  5HRY A;  1W1F A;  4AG1 C;  1S70 B;  1U3O A;  1I0C A;  2A28 A;  5EN5 D;  2HE0 A;  1UE9 A;  4HI8 A;  1XOV A;  3QWX X;  1WG0 A;  1YP5 A;  2YT6 A;  4DEY A;  1ZUY A;  2RQT A;  2DBM A;  2EGC A;  4CC3 A;  3NOG D;  5CED B;  1BK2 A;  2HEQ A;  1GL5 A;  3O5Z A;  1VYV A;  2GNC A;  2J8S D;  3H0H A;  2CDT A;  1AP7 A;  5GJW B;  4JZ3 A;  2JMC A;  3JXJ A;  2RQR A;  4AFU C;  4IIM A;  4GPM A;  3PVL A;  1BB9 A;  1KSW A;  1KJW A;  4JJD A;  5D66 A;  5CEC B;  4F16 A;  2FPE A;  2CUD A;  2W0Z A;  4J9D A;  1AOJ A;  2A36 A;  1N11 A;  2ED1 A;  1M30 A;  1WDY A;  4LG6 A;  2DRK A;  3UF4 A;  2ROT A;  5AQA A;  3UTM A;  3F6Q A;  4OAU C;  2E5K A;  5AQ7 A;  4HCK A;  3SEM A;  1WXT A;  2ESW A;  4HVV A;  5EYP F;  3UA7 A;  2V1Q A;  5KNH D;  2MIO A;  1I07 A;  4Z88 A;  5JA4 D;  1CSK A;  5BXO A;  4GMR A;  1JXM A;  3REB B;  2A37 A;  5HKP A;  4UUC A;  2DRM A;  1FMK A;  3I5R A;  3TSZ A;  5IHN A;  4FSS A;  4LUE A;  5I11 A;  4J9F A;  5ITZ F;  5FIO A;  3ZNG A;  2EYZ A;  2FRW A;  2KBX A;  4BES A;  4OMQ A;  3NMZ C;  1A0N B;  3DEO A;  1PNJ A;  4F1P A;  5KBA A;  1BBZ A;  2C0T A;  2JT4 A;  2BKG A;  2HCK A;  2W10 A;  3C5R A;  2L3P A;  2DIL A;  2QC9 A;  1IXV A;  1PRL C;  5FWB A;  1VYU A;  2P2C P;  2GBQ A;  5KNG A;  2ETA A;  1KIK A;  1ZLM A;  2F8Y A;  4J9E A;  1OEB A;  4HBD A;  5L23 A;  2RFA A;  5ENR D;  2K3B A;  4KRT A;  3TWT A;  3TWR A;  2O2O A;  2O88 A;  1Z9Q A;  2KNB B;  1BU9 A;  1ZUK A;  1BU1 A;  4Y92 A;  2KT8 A;  1UG1 A;  3I35 A;  2DVW A;  2KXC A;  2NUZ A;  1CKB A;  1HD3 A;  2CH4 W;  2K7A A;  4J7W A;  4O1P A;  3HRA A;  3VS6 A;  1SVX A;  3ULR B;  2BZY A;  2VGE A;  1KFZ A;  4ZFH A;  4DRX E;  2EKH A;  4AFQ C;  2XEE A;  5KWD A;  2BTT A;  4JB8 P;  1UUE A;  4DX2 A;  2FPD A;  3TVT A;  3T8K A;  3NOC D;  2B0O E;  1OV3 A;  3J5P A;  1ABO A;  5EIB E;  3CQT A;  2JAB A;  2L2P A;  4J9C A;  3RBB B;  2IIM A;  3IXE A;  2M0Y A;  3V2X A;  5IXB A;  1H92 A;  1YCS B;  2F37 A;  4B93 B;  3VS1 A;  1IO6 A;  1NEG A;  1NFI E;  3EU9 A;  3KFV A;  1K0S A;  4RUG A;  3KEA A;  4BEP A;  1M3B A;  2DNU A;  4GLM A;  1NEB A;  2C0I A;  5IHI A;  3UAT A;  2EYW A;  1PKS A;  1SRM A;  1G3N B;  2DLP A;  2YUP A;  2SRC A;  3VS3 A;  1D9S A;  1AWW A;  4G8L A;  1CKA A;  5ENP D;  2ROL A;  2KBT A;  4CC4 B;  4JZ4 A;  2RQV A;  1AEY A;  4ORZ A;  1YN8 A;  4F17 A;  2AZS A;  3TWW A;  1RLQ C;  1WXU A;  1WI7 A;  2YUN A;  1K1B A;  2LJ0 A;  3NBN B;  1LCK A;  2XEN A;  3EHR A;  1M3A A;  3EG0 A;  1X2K A;  4CZ2 D;  4U95 D;  3U23 A;  1WLP B;  2EGA A;  1GBR A;  5HS0 A;  1AWC B;  1WFW A;  2EYY A;  1B07 A;  3VS2 A;  4U8Y D;  1OT8 A;  1GCQ A;  2J6K A;  2NWM A;  2AK5 A;  1BI8 B;  1SHF A;  2RN8 A;  2A5E A;  1X27 A;  4J9B A;  4G8K A;  1AWJ A;  2DL7 A;  2JTE A;  3TWU A;  2RQU A;  4HXJ A;  1WA7 A;  4RTW A;  4LN2 A;  2K79 A;  3JXI A;  1BD8 A;  1SRL A;  2B86 A;  3SHW A;  2FPF A;  3UA6 A;  4BET A;  4LSZ E;  4AG2 C;  1H3H A;  4ATZ D;  2F2X A;  1A5E A;  3B7B A;  4OMM A;  2XEH A;  4D8K A;  1GRI A;  2EYX A;  1DC2 A;  4E6R A;  2CSQ A;  2JW4 A;  2EPD A;  4OMN A;  1ARK A;  1QYM A;  1YWP A;  3TWQ A;  2LQN A;  4DX7 D;  1YWO A;  2PNN A;  4QFV A;  1T0H A;  1OY3 D;  1K1A A;  3ZU7 B;  4O1O A;  2LNH B;  4D8D A;  4EIK A;  2ZGD A;  1QWE A;  2KEA A;  1RI9 A;  1T3S A;  4ESR A;  1NYF A;  3QWY A;  2RQW A;  3JV3 A;  2RFM A;  2V4H C;  5EID A;  1MX4 A;  1VYT A;  4X1V A;  2EQI A;  1GCQ C;  2D0N A;  1MUZ A;  3V31 A;  3VS7 A;  2LCS A;  2FO0 A;  4NIK A;  2LX7 A;  1SW6 A;  4DUI A;  3VRZ A;  4RLY A;  4LUD A;  1WYX A;  2GTO A;  2RNA A;  3AAA C;  2K6D A;  1RLP C;  2RF0 A;  1UJ0 A;  4U8V D;  1N0Q A;  2HSP A;  4Z89 A;  1AZG B;  2LQW A;  2RPN A;  4RTU A;  5IXF A;  1W70 A;  2XMF A;  2GGR A;  2CRE A;  1ZX6 A;  4HQD A;  4J9G A;  1M27 C;  2VWF A;  2KYM A;  3VS0 A;  2I0N A;  2YUQ A;  4DX6 D;  5EIL A;  1AWX A;  2K9G A;  2Y0B G;  3H0I A;  2MOX A;  2CUB A;  1QKX A;  2SEM A;  3EG3 A;  5EC7 A;  3ZUV B;  3TSW A;  4HI9 A;  4AFZ C;  2DA9 A;  1AZE A;  4AFS C;  4N5Q A;  1E6G A;  1K4U S;  1HJD A;  1NM7 A;  3ZL7 C;  2AKK A;  1SPK A;  1X43 A;  4QQI A;  1VA7 A;  4M4Z A;  1MX6 A;  4R0K A;  1BI7 B;  2DBK A;  5GJV B;  1TUD A;  4DEX A;  4U96 D;  1Y57 A;  1V1C A;  1Y0M A;  2ETB A;  2Y1L E;  3D9H A;  1WXB A;  1K3Z D;  1RUW A;  2D1X A;  1IHB A;  2DJQ A;  3EG1 A;  3B95 A;  3I5S A;  4A63 B;  1JQQ A;  5EYL A;  5ENQ D;  2FRY A;  1X6G A;  4LE9 A;  3DEP A;  1B3Q A;  2A08 A;  4QT7 A;  2LP5 A;  1JU5 C;  2V1R A;  5BXU A;  5CBN A;  1N0R A;  1K76 A;  3Q9U C;  2F2W A;  1W6X A;  1X6B A;  4RTV A;  1UTI A;  3W9F A; 
#chains in the Genus database with same CATH topology
 3CCQ T;  4HVW A;  5DIZ A;  3C3R A;  1FYN A;  3LYI A;  2GRP B;  2HO1 A;  2H6I A;  3OYY A;  1N8R U;  2DE0 X;  1GBQ A;  5FRO A;  4JPB W;  4EMK B;  2L0A A;  2YWW A;  3TCJ A;  2DZO A;  5JJ7 A;  1M8M A;  2DPP B;  1OCO E;  4UWF A;  2OAW A;  3EHM A;  2MRI A;  4GYW A;  4HRM B;  2QQA A;  3CC2 T;  3SO8 A;  5BNW A;  4HLL A;  3JB9 D;  4YVO A;  1HG5 A;  5KYN A;  3ASN E;  3CBO A;  4OMO A;  5D0O D;  2EVR A;  1N4P A;  4O5V A;  4C92 A;  1D1B A;  5A23 A;  3SGH A;  1VIF A;  4OVV A;  3P2B A;  3S7B A;  1K8A C;  4I17 A;  4BY6 A;  4FW1 A;  2KE9 A;  2EQU A;  2VUB A;  2COY A;  1G3Y A;  5D6X A;  3EGX A;  1ZBJ A;  1D8D A;  1BLX B;  4NAC A;  2QDL A;  4IIO A;  3PVQ A;  4FLH A;  4PLL A;  3I3N A;  2P9K G;  1H0A A;  2RHY A;  2X6H A;  2CGH A;  3Q79 A;  1BI1 A;  4D10 C;  4MZT A;  1Y7X A;  1JRI A;  4B8A A;  2D8J A;  4HT9 A;  3TAX A;  4E85 A;  2LSU A;  4XKC A;  1UJY A;  1OPL A;  3EHQ A;  1MND A;  3AG3 E;  3MEA A;  1Y6I A;  4YDO A;  5ECA A;  4F7U B;  2L89 A;  1WX6 A;  5JMN D;  4MDW A;  2PVD B;  1GFC A;  3LDZ A;  1VQ8 Q;  3EDT B;  1VQO T;  3OBW A;  3OYL A;  3CEY A;  3HXF A;  4Q96 A;  4B6M A;  1FT2 A;  4I2Z A;  3RO3 A;  3C12 A;  1OOT A;  3H41 A;  4ZHB A;  1TU0 B;  1OWN A;  4Q5W A;  5J39 A;  4DX5 D;  3M0P A;  4C5G A;  3LY9 A;  2EGE A;  2CT3 A;  2DK3 A;  1UGS B;  4M7D E;  4GPK A;  1PRM C;  5GMK j;  4BI4 A;  4G2V A;  1AD5 A;  4BT9 A;  3LJN A;  4ANV A;  3LH5 A;  4X9D A;  4U7E B;  3LWH A;  2WXL A;  4FL6 A;  2HM8 A;  4A1S A;  4UWH A;  2OEW A;  1N5Z A;  2J6F A;  2V5Q C;  2CP6 A;  4LCT A;  1FVH A;  3OW2 S;  2WSE E;  1PHT A;  3IHY A;  1NP7 A;  2GTJ A;  2JS0 A;  4X9C A;  5FZR A;  4HCB A;  1HFA A;  1M1G A;  2MWO A;  1QZ2 A;  1QP3 A;  3WXM B;  4J6I A;  3JAM E;  2X4Y A;  1N9S A;  5AQ9 A;  3V7S A;  3M0S A;  4JRI A;  1Q86 C;  1K1Z A;  2XS1 A;  3NQP A;  3OYK A;  1P5Q A;  2PM6 A;  4E6H A;  2EFI A;  2DTI A;  1MQS A;  1M1K R;  2XI9 A;  2CG3 A;  2RHI A;  1ZBX A;  3WG7 E;  2R03 A;  2UY1 A;  3EG2 A;  4JPS A;  4Z8A A;  2KYB A;  3G4S Q;  4C5I A;  3ABK E;  2DL5 A;  4DI4 A;  4KGZ B;  8AT1 B;  1I5L A;  1MYO A;  1WDX A;  1XTD A;  3REA B;  3A8G B;  2XD0 A;  3DXK G;  5KYX B;  3ZRH A;  3RES A;  4GAA A;  2QEX T;  4GZ6 A;  4PFO A;  5IN1 A;  4C8Q E;  3M59 A;  3Q7F A;  2MK5 A;  3AJI A;  2C0O A;  2AXU A;  2ZGG A;  4JL0 A;  4X8Q A;  1XNF A;  3V2O A;  1IHV A;  1M4Z A;  3MKD A;  2H6G A;  1UEB A;  4IYP A;  1OUV A;  3ZEF A;  5HQ8 A;  3CC4 T;  4DBF A;  5ANR A;  1RL2 A;  2ED0 A;  1N95 A;  5ENT D;  3GZ2 A;  2O4X A;  2GRR B;  3INZ A;  4PDX A;  1X2Q A;  3MEW A;  3ASG A;  1VQ8 T;  1X5B A;  2ZIS A;  2AZV A;  2JS2 A;  4N0A A;  3OS1 A;  4FYX B;  2P9I G;  3S7J A;  3LLR A;  3M54 A;  2VGY A;  4HS2 A;  4MLP A;  4HRN A;  4M78 A;  4M7A C;  2F5K A;  2XDB A;  3UM1 A;  3M9Q A;  5GMK e;  2Y90 A;  5BV0 A;  2DX1 A;  2QFC A;  3NPF A;  5CBO A;  2R59 A;  2J7I A;  4IUQ A;  4DK5 A;  3ML9 A;  3JB9 H;  2BKD N;  2HDA A;  3CVV A;  5CCL A;  2LXL A;  3SF4 A;  1MV3 A;  3OSS C;  4OML A;  2BUD A;  4C8Q A;  1VUB A;  2JN0 A;  4UQZ A;  4OB2 B;  4PJO D;  3O8V A;  2M02 A;  1E7U A;  3M55 A;  2HE0 A;  1N54 A;  4N5C A;  2WXR A;  2QTX A;  2OTL Q;  1YA0 A;  5BW8 C;  2NSZ A;  1SQM A;  3HXB A;  3QAR A;  2YT6 A;  2RQT A;  2E41 A;  1VQ6 Q;  4CC3 A;  5IY5 E;  2MMP A;  3UKR G;  3SI5 A;  3ZFJ A;  3GW4 A;  4I6E A;  2J8S D;  3RDV A;  1RAA B;  3FTV A;  2CDT A;  1AP7 A;  1TS9 A;  5GAM j;  2LDM A;  3MA5 A;  4XE0 A;  1QVG S;  2X3M A;  2LQ8 A;  2WB2 A;  3JCM Q;  4IIM A;  1BB9 A;  1KSW A;  4GYO A;  3ULY A;  3OYG A;  4JHR A;  3OBY A;  4M75 A;  3H6Z A;  1ZB1 A;  4JJD A;  2V0P A;  5D66 A;  3NB2 A;  2FPE A;  3DPD A;  3CIA A;  4GTR A;  3KAE A;  5HK0 A;  2OEV A;  3C98 A;  2ED1 A;  3QUI A;  1WDY A;  4LG6 A;  3ASH A;  1D3B A;  2D0Q B;  2PVG B;  1YIJ A;  1B7T A;  4Y91 A;  3E9F A;  3F6Q A;  4M75 F;  3IV0 A;  3SEM A;  1N4S A;  2XDP A;  2CFU A;  3D9L A;  5AJL A;  1SG5 A;  1SSF A;  5GAM d;  3PNT B;  2H6H A;  4XTY A;  5BXO A;  4GMR A;  1K8A R;  2VC8 A;  3TSZ A;  4J83 A;  4J9F A;  2COW A;  5FIO A;  3CCQ Q;  5GAO r;  3L2U A;  2FRW A;  4OMQ A;  4BES A;  2RKK A;  4UQY A;  4WAF A;  4GTS A;  2YRC A;  4N0A C;  2QEX A;  3NMZ C;  3CVW A;  3MV3 B;  2AT1 B;  3URZ A;  1PNJ A;  3JQ1 A;  1TH7 A;  2HCK A;  1YI2 A;  4P29 A;  3TG5 A;  2W10 A;  4FYY B;  4C92 E;  2L3P A;  1PRL C;  1XNI A;  3G6E T;  1KZP A;  1VYU A;  4GU5 A;  2DTO A;  5T8I A;  2AHJ B;  2GBQ A;  2ETA A;  2VJ8 A;  2R05 A;  1O75 A;  3U3W A;  2LQK A;  4J9E A;  3CHS A;  3OA6 A;  4A4E A;  2YRD A;  4M7D C;  4EMG A;  5L23 A;  5ENR D;  3TWT A;  5KYW A;  3TWR A;  1NJI C;  2O2O A;  4HXI A;  1ZSZ A;  2VYT A;  2P58 C;  2MHK A;  3R7Q A;  2RI5 A;  2K5I A;  3FTY A;  4N3A A;  2DVW A;  2KXC A;  2ZPG B;  1CKB A;  1HD3 A;  3ABL E;  1VQM Q;  3JCM f;  1TJF A;  1NE8 A;  4IUP A;  1KD1 C;  2V8I A;  2I2O A;  1FPP A;  2MPX C;  3M4Y A;  3EH2 A;  4DRX E;  5IT9 E;  2EQX A;  3L42 A;  4A3T A;  4M78 E;  2ZXW E;  1NI1 A;  3T8M A;  3C3O A;  5EDS A;  1QW1 A;  3JRZ A;  2KZT A;  2DZC A;  3D9N A;  1X75 C;  3D3M A;  2DYI A;  3E1S A;  2PL2 A;  4J9C A;  2V8J A;  5D7U A;  2MWP A;  2IIM A;  5CKB A;  5GAN d;  4J8F A;  2RA2 A;  2IY0 C;  1XGW A;  1H6P A;  3MET A;  4IUT A;  1VQN Q;  4I1A A;  1VQ6 T;  3S7F A;  3CCR T;  3EU9 A;  5GAN f;  3CBM A;  1V55 E;  2IF4 A;  3P8B B;  2NC9 A;  3KEA A;  5HK3 A;  2OVB A;  4BEP A;  1M3B A;  4G23 A;  3DB3 A;  3CCL A;  3FU0 A;  4HKE A;  1YHQ T;  1WJS A;  5I2M A;  4IUU A;  4O6F A;  2E12 A;  1SRM A;  2HL3 A;  3UDC A;  1G3N B;  3OW2 A;  4B89 A;  1HYO A;  2YUP A;  2SRC A;  4FT4 A;  2P9U G;  1NJI U;  4JUV A;  3LJ3 A;  3EFO A;  2KBT A;  3GLX A;  2COZ A;  2RQV A;  2VB6 A;  2OTL T;  2AZS A;  3TWW A;  2BE7 D;  2F1L A;  2E2E A;  2LT1 A;  4DI3 A;  2YUN A;  3S7D A;  1UGP B;  2MOW A;  2XEN A;  3RJV A;  3LH0 A;  3NTH A;  5KJN A;  4U95 D;  5GAO p;  1TSF A;  1WLP B;  4LRZ A;  5HS0 A;  2K5F A;  4OGC A;  3E2U A;  4ILI A;  2M1H A;  2EYY A;  4R55 A;  1EF1 C;  3VS2 A;  4OVU A;  2J6K A;  4MML A;  4BDZ A;  2A5E A;  4J9B A;  2JTE A;  2K3Y A;  2HQX A;  3H9N A;  3TWU A;  3QO3 A;  5J90 A;  1WA7 A;  2EIL E;  4LN2 A;  4N3C A;  4M77 G;  2B86 A;  1VQ7 A;  2J49 A;  2X6K A;  4J8S A;  2FPF A;  4LSZ E;  1IRX A;  2P0Q A;  2ZPF B;  1PD1 A;  4OMM A;  5GAO n;  5LJ3 e;  1WM5 A;  3PT9 A;  3CME Q;  4ILG A;  1HZ4 A;  1QYM A;  4CGW A;  4DX7 D;  5BPP A;  1K73 C;  4UWL A;  1YWO A;  2GCX A;  2MF2 A;  3J80 E;  1YJN A;  3UIN C;  3ZU7 B;  3S3M A;  1QWE A;  1W4S A;  3ABM E;  1L5J A;  2VSX E;  1RI9 A;  1NJI R;  3LS8 A;  3UM0 A;  3HFN A;  3QWY A;  3AS5 A;  3ASO E;  1YIJ T;  3U64 A;  4GZC A;  1HG2 A;  3CVQ A;  1FMW A;  3I56 Q;  3L22 A;  3QB2 A;  3CEQ A;  4WWN A;  2D0N A;  2QDY B;  3C94 A;  3E9G A;  2FO0 A;  2LX7 A;  1WY6 A;  1AHJ B;  2DD5 A;  4DPR A;  2RK2 A;  3B7S A;  3CPW P;  2DIW A;  4CRW A;  2X4W A;  4XU0 A;  1YJ9 T;  1YJW A;  3CKB A;  5DLO A;  2RF0 A;  4U8V D;  2E64 A;  2R58 A;  2HSP A;  1U2V G;  4C0Z A;  3ZBD A;  2EIF A;  3HSB A;  3R6O A;  4RKU E;  4RTU A;  2OCC E;  2OTJ A;  1N8R R;  4F7A A;  4JC8 A;  2KYM A;  4DX6 D;  5EIL A;  1U1S A;  1HH8 A;  3FLG A;  5GMK m;  3ZXP A;  3EG3 A;  5EC7 A;  2QY7 A;  4GTM A;  3ZUV B;  5GAM g;  4HI9 A;  2HYZ A;  4ZGJ B;  4P5N A;  2HMA A;  4KT0 E;  1VDY A;  2RI2 A;  4QW2 A;  1X43 A;  4QQI A;  4EZJ A;  1VA7 A;  1MX6 A;  2GFU A;  1BI7 B;  4R0K A;  5GJV B;  1VQ4 T;  4LDU A;  4U96 D;  1QCO A;  2XGO A;  4EEC A;  3D9H A;  1WXB A;  1K3Z D;  1RUW A;  3D9O A;  1XJW B;  2I9C A;  3EG1 A;  2LVM A;  1IZ6 A;  4ME7 A;  3SWN B;  2L8D A;  2P84 A;  4KUI A;  4L1B A;  4XKB A;  4ELZ C;  1X6G A;  2IPO B;  3E19 A;  3V7R A;  5KYY A;  3DB4 A;  3FH8 A;  4JVS A;  1JU5 C;  1VQN A;  4M78 G;  4ILH B;  2GFA A;  4C92 G;  1N0R A;  3KSL A;  2F2W A;  1MGQ A;  1JWF A;  1UTI A;  3W9F A;  3X2Q E;  5B3S E;  1FVF A;  4K5A B;  1KT0 A;  1Z9Z A;  3M57 A;  2RMO A;  3VS5 A;  2X4X A;  2OV8 A;  3SY2 A;  2LCC A;  4RTX A;  3P1U A;  1VQO Q;  5FWC A;  1YMP A;  1PG5 B;  2CHX A;  2JTM A;  4N2Q A;  1MHQ A;  2VGX A;  2AKL A;  5GAM h;  2Q7F A;  4TUM A;  1JCQ A;  3V79 K;  1WQ7 A;  2LZ6 B;  3FC3 A;  3DXM G;  4RG8 A;  5LJ3 h;  1VQK A;  2LCL A;  4YND A;  2XG8 D;  1B34 A;  2IO3 C;  4FCY A;  1QVG A;  4PJO B;  2BKK B;  4O60 A;  3LGL A;  2P4R A;  3AG1 E;  4HNA D;  2YQ8 A;  4JW1 A;  2DL4 A;  4FIB A;  5DLQ E;  1GFD A;  3BY7 A;  1YHQ A;  2WSC E;  4CYM D;  2DTH A;  1WJR A;  3CXC P;  4YDW A;  1TNU A;  4M3O A;  1E6H A;  2DVJ A;  3J5Q B;  1HU3 A;  4JRQ A;  3A98 A;  4HOT A;  3EU5 A;  2O31 A;  3UI2 A;  2ETC A;  4A4F A;  3UXG A;  3E30 A;  3C95 A;  3SZ7 A;  4JHJ A;  2KT1 A;  4F7U F;  4LNB A;  1RAG B;  2QQR A;  5CEA A;  1UW4 B;  4HFG A;  4F04 B;  3Q4A B;  4NUR A;  1I1J A;  3S6W A;  2XK0 A;  1QVP A;  3RMS A;  1YJN Q;  3OXF A;  4CEM A;  3AG2 E;  1RAH B;  4J8Y A;  3OW2 P;  2QXF A;  4APO A;  2L6B A;  2O01 E;  3EGU A;  4M7D G;  1NZ9 A;  3HTR A;  3PZ4 A;  2L3Q A;  2VKN A;  2NUT A;  3UUX A;  2IOL A;  2R02 A;  1LTX A;  2RD0 A;  2AWI A;  4CDM A;  2ION A;  2PU9 B;  1S1N A;  2EW3 A;  4C48 B;  2DL8 A;  3ER0 A;  4ANJ A;  2MYO A;  3ISM C;  1W2B A;  3G6E Q;  3FU3 A;  1PSE A;  4M78 F;  2E6N A;  2OX7 A;  1JXO A;  4IUV A;  3T5V A;  2XHC A;  5GAN h;  4LNG A;  5FZS A;  3D9P A;  1N9R A;  3EH1 A;  4JA7 A;  1WZO A;  4FU6 A;  5EG2 A;  4TRQ A;  1FCH A;  1YYH A;  1G3W A;  1H6K A;  1DCE A;  5E76 A;  1MHN A;  4JRP A;  4BWR A;  4I6G A;  1O5M A;  3I56 T;  2RI3 A;  2EQJ A;  4OMF B;  1H2T C;  3CLJ A;  5CO7 A;  3HXE A;  3QWW A;  3OYN A;  5LX8 A;  1MNE A;  5A0D A;  4FU3 A;  1Q86 U;  2OOE A;  1M90 R;  1VQ5 Q;  3BUA A;  4KXK B;  3X25 B;  3JSC A;  4AT1 B;  3QJY A;  4C0D B;  5M9O A;  2O4X B;  1OPK A;  3DSX A;  1SSH A;  3A8L B;  1G3T A;  4GZ3 A;  1M3C A;  2XQ0 A;  2EYQ A;  3CCL Q;  3CXC A;  3I4G A;  5HI7 A;  2WQ7 A;  1I4K 1;  5A0G A;  2ZIR A;  4WCI A;  3LXU X;  5A7D B;  1JEG A;  3OYE A;  4ZNX A;  2R5M A;  2JTF A;  1UOH A;  3C0C A;  1VQ9 Q;  1J3T A;  4FM4 B;  4OAV B;  4L7T A;  3OYM A;  4RQI A;  4LUN U;  1LOJ A;  2QQS A;  1TR4 A;  1S72 T;  2DFU A;  2OI3 A;  3OYB A;  3EUV A;  3LGF A;  4DLQ A;  1FMV A;  2CH4 A;  3MP1 A;  3D9K A;  2RHU A;  4EMH A;  1Q81 U;  2WM9 A;  1E7O A;  2ZPB B;  4WNE A;  2OTJ Q;  3MEK A;  1UDL A;  3AT1 B;  4MDX A;  3WXX A;  2ECZ A;  1WIE A;  1WHK A;  4HB5 A;  4KBQ A;  3FUN A;  2LJ1 A;  4C92 F;  5C0M A;  1ZU2 A;  1VQM A;  4M78 D;  1NPR A;  4CI0 C;  4WND A;  2PNI A;  4M75 G;  5CQX A;  2HKQ B;  3ZHE A;  3L54 A;  4WUY A;  4M77 A;  2LX9 A;  2VYI A;  4H7Y A;  2GGF A;  3OYI A;  3M56 A;  3FUH A;  3T5X A;  2ABL A;  1PKT A;  4CT4 A;  2P4T A;  1MJ0 A;  3JB9 F;  4QQD A;  3QBY A;  4HRL A;  3BE3 A;  4MZM A;  3S3N A;  3APF A;  1AWO A;  1JO8 A;  2KK4 A;  2KSS A;  2LJ3 A;  4GML A;  4UI9 C;  1MV0 B;  3EIQ C;  1GCP A;  2MYS A;  4RTZ A;  3G2W A;  2MCN A;  3GZ1 A;  2R5S A;  3PE4 A;  2DMO A;  3CSF A;  6AT1 B;  2GRN B;  5AAR A;  1E8X A;  2YSQ A;  1ABQ A;  3PMT A;  2AXV A;  1DCQ A;  4ABN A;  2C0M A;  1DVP A;  4PNO A;  1VQ7 Q;  1TN7 A;  3HIZ A;  5G55 A;  3U66 A;  1HSQ A;  1Y71 A;  3M53 A;  3J81 E;  1N94 A;  3IBE A;  3S3O A;  4UQX A;  5CRV A;  4AG1 C;  1VQL A;  1VQM T;  1S70 B;  2EJG A;  1OX9 A;  4BSX A;  4EDU A;  3SD4 A;  3MEV A;  3I55 Q;  1Q7Y C;  1G8X A;  4HI8 A;  1HS6 A;  1YP5 A;  4HLE A;  3E4B A;  4EZK A;  3NOG D;  1Z3X A;  1OU8 A;  3T9N A;  4WWO A;  1V76 A;  2MAM A;  3OYJ A;  4NQ0 A;  5KCH A;  4AP2 A;  3RER A;  3H0H A;  1O1S A;  1UJJ A;  1JWG A;  2JMC A;  4A53 A;  1H3Z A;  4KVM A;  2RQR A;  2JJ9 A;  3CQG B;  4AFU C;  2X6J A;  4I2W A;  1OYX A;  3DLL A;  3JB9 J;  4EMK C;  1JPL A;  3FTZ A;  4PUC A;  2YHT A;  3ZYQ A;  1OZ3 A;  1KJW A;  3CMA Q;  1WHJ A;  5CEC B;  4CRI A;  4F16 A;  3CCU T;  5FQ7 A;  4JXT A;  2A36 A;  5C6S A;  5KYY B;  1M30 A;  2GW1 A;  3JCM b;  2XIC A;  3PTA A;  5KE2 A;  3UTM A;  3EGX B;  4OAU C;  2NUP A;  3OXG A;  4HCK A;  1KC8 R;  3QJZ A;  2ESW A;  3Q73 A;  2V1Q A;  1KG1 A;  2FUL A;  5I2S A;  2J9Q A;  5KNH D;  2ZPE B;  4Z88 A;  4QQG A;  3TU4 K;  1JXM A;  1INZ A;  1S0P A;  2FB7 A;  2A37 A;  4TV3 A;  5HKP A;  2M16 A;  5LJ3 f;  4C92 C;  4W9R A;  4UUC A;  3OYD A;  5IHN A;  1TOV A;  5I11 A;  3VTY A;  1DNP A;  2KCL A;  2EYZ A;  2DIG A;  3ZN3 A;  3A8M B;  4CT0 A;  1B34 B;  2PVO B;  4F1P A;  5FU6 B;  2C0T A;  1KT1 A;  1JCS A;  1OQK A;  4PL6 A;  5LJ5 f;  3O48 A;  3KUF A;  2P9L G;  1IXV A;  1A17 A;  2QC9 A;  1MMN A;  3OSV A;  1UGR B;  1ACM B;  4U8H A;  2P2C P;  3HP9 A;  4XU2 A;  5KNG A;  4N2S A;  2F8Y A;  2QGG A;  4ZTJ A;  4B9X A;  2IVW A;  4ME2 A;  4KYO B;  2DXT A;  3CC7 T;  2O88 A;  2KNB B;  5CR2 A;  2XHE A;  1KHI A;  1ZUK A;  1BU1 A;  4HOU A;  2KT8 A;  4L23 A;  3JCM P;  2H3J A;  3I35 A;  3CGH A;  2D6F A;  2NUZ A;  4F53 A;  4J7W A;  4O1P A;  1RAD B;  3APD A;  2YIN A;  2NYS A;  4A4K A;  3EJN A;  5LJ3 g;  4UWG A;  1PC2 A;  2WXN A;  4AFQ C;  5GAM e;  2UWJ G;  2BTT A;  1PY1 A;  2P9N G;  1W2B S;  1UUE A;  3RKY A;  3TEE A;  3NOC D;  2B0O E;  3RAU A;  4OYS A;  4TXR A;  3OS5 A;  5EIB E;  2CHZ A;  2L2P A;  1BI3 A;  4E7S A;  4JS4 A;  4I43 A;  3IXE A;  2M0Y A;  2XRY A;  5FU7 C;  1YCS B;  2EIN E;  2EIM E;  2IQC A;  1HXD A;  3CVU A;  1PD0 A;  4F1S A;  1OUL A;  3EG9 A;  1NFI E;  5G2N A;  3KFV A;  1IGU A;  2IG0 A;  1N52 A;  1E8Z A;  3HRT A;  5H7P A;  5GAM f;  1K0S A;  3ZPJ A;  4RUG A;  4GLM A;  5KE3 A;  3TXM A;  5IHI A;  3CCQ A;  4XTW A;  4XTX A;  4II1 A;  2EYW A;  2AW6 A;  3JUI A;  1PKS A;  4J7I A;  2DLP A;  4JJN K;  2FEZ A;  3VS3 A;  1D9S A;  2DKG A;  4GCN A;  4IN3 B;  2VAS A;  2WXH A;  4CC4 B;  1FT1 A;  2EQM A;  4JZ4 A;  3CCM A;  1KQS P;  1AEY A;  1E90 A;  1NA3 A;  1RLQ C;  1WPY A;  4J8D A;  1LD7 A;  2WXP A;  4L9P A;  1YJ9 A;  5GAN 4;  1K1B A;  1E96 B;  3ZW3 A;  1M3A A;  3EG0 A;  1X2K A;  1VQ6 A;  2V26 A;  3PZ2 A;  5KJL A;  1M90 C;  1OXJ A;  4U8Y D;  1M1F A;  3KSQ A;  3FY4 A;  1BI8 B;  1N4R A;  4G8K A;  2DAQ A;  4BE2 A;  4HXJ A;  4M7A A;  4PJO G;  3NAW A;  1K73 R;  2YRV A;  4FLB A;  2F2X A;  1TTH B;  2XCB A;  5B1B E;  4HCC A;  2XEH A;  2X9H A;  1TN8 A;  3FU6 A;  2DXB A;  2EYX A;  1ELK A;  3HXD A;  2JW4 A;  2EPD A;  5LOZ A;  1YWP A;  2I1K A;  3DBS A;  4AIF A;  3UM3 A;  2QZA A;  4J8E A;  4QFV A;  1T0H A;  4IUR A;  2OTL A;  4D8D A;  4IUL A;  5CKD A;  3BDU A;  3CCE T;  3HDX A;  1NYF A;  2RQW A;  4NRH B;  2RFM A;  1JJ2 S;  2WXQ A;  3TJP A;  3E33 A;  1GCQ C;  3R7R A;  2J4D A;  4KGX B;  2LCS A;  3CVX A;  2VGM A;  4AEZ C;  2RJC A;  3L6A A;  3QOU A;  4KZ0 A;  4UI9 K;  1OX8 A;  4UC4 A;  4ZN3 A;  4LUD A;  1WYX A;  4ANW A;  1HF8 A;  2DD4 A;  2QK0 A;  4KGV B;  2E4H A;  2B8A A;  3ESK A;  4HA8 A;  3CPW S;  1P92 A;  2HQH A;  1N0Q A;  1OU9 A;  3LX7 A;  4PJN A;  2CKK A;  4K03 A;  5IXF A;  2XMF A;  3FUF A;  1YIT T;  2GGR A;  2CRE A;  2GRL A;  1KK7 A;  1M27 C;  3ME9 A;  3MO8 A;  3VS0 A;  4HVB A;  2I0N A;  1AWX A;  3CCS Q;  3H8Z A;  2AIR B;  2Y0B G;  2A3L A;  3MX3 A;  4XI0 A;  3C4S A;  4KUD K;  3QK0 A;  1ELW A;  4AFZ C;  3PS6 A;  2RM4 A;  4EPC A;  4AFS C;  4N5Q A;  1IHW A;  1E6G A;  1NM7 A;  2AKK A;  3CST A;  2GRQ B;  4JD2 G;  1FWZ A;  4EHM A;  5LJ3 j;  4FYW B;  1Y96 A;  4C5E A;  2DIQ A;  3UPV A;  3E34 A;  2XKO C;  2XGS A;  2KQW A;  2YHC A;  1V1C A;  3ZYL A;  1Y0M A;  4F7U G;  1O1T A;  5AIJ A;  2XS8 A;  4LER A;  1VQK Q;  2DJZ A;  3EIJ A;  1IHB A;  2DJQ A;  3P8D A;  4PJM A;  3HVE B;  2WXK A;  3NTI A;  1UJK A;  2VSY A;  3ZYK A;  1D1A A;  4CGV A;  3SWN C;  1BI2 A;  3FUL A;  5ENQ D;  2A08 A;  1X6O A;  2LP5 A;  3CCR Q;  3PZ1 A;  1PAQ A;  5BXU A;  1HXI A;  2WQ6 A;  5CBN A;  4B8C B;  4BY6 C;  4M78 C;  5GMK h;  3Q9U C;  1RAC B;  3QPH A;  3LWI A;  2CP3 A;  2Z0W A;  2CZ7 B;  3FHE A;  3CV0 A;  5JHA A;  4EBA G;  3ZVV A;  1VIE A;  4HOQ A;  2DZN A;  3O4Z A;  2BE9 B;  1KC8 U;  5KYW B;  2X3W D;  3VRY A;  4R56 A;  1S72 A;  4KMO A;  2CZ1 B;  3CD6 A;  1QMC A;  1MZC A;  4YDY A;  5LFA A;  2DXC A;  2ZAE A;  4C8Q C;  4GTQ A;  3CCL T;  2J05 A;  4J9I A;  3BG0 B;  3V30 A;  3MCA B;  1QCF A;  2LSV A;  4HVU A;  4WWP A;  1E8W A;  4RTT A;  4WF2 A;  4FJZ A;  3BW1 A;  3OYC A;  3DSU A;  1LJO A;  1TJC A;  3M0Q A;  5CKE A;  1VQ4 Q;  3BQO A;  3HPW A;  4ATO A;  4Y6C A;  1G83 A;  3VS4 A;  4M7D F;  3SHF A;  3WVE B;  3FUE A;  1IKN D;  2F8X K;  5GAN 5;  5CCA A;  3I5P A;  4OGE A;  4FA6 A;  2JM8 A;  3RO2 A;  4FYV B;  3KXT A;  4XEI G;  4K5C A;  4ANX A;  5CQY A;  3AU4 A;  1UGQ B;  5GAO m;  1MMG A;  3G71 T;  3ENE A;  1KQ1 A;  4OB3 B;  2DYR E;  3UKU G;  1TNZ A;  3Q78 A;  4C8Q D;  2ENM A;  3FUK A;  2E70 A;  4DX1 A;  4RTY A;  3CC7 A;  3GYZ A;  2OJ2 A;  1UHC A;  3OYF A;  3RRN B;  4AOF A;  3OYH A;  1KD1 R;  2KXD A;  4VUB A;  3JCM h;  4BX9 A;  3AS8 A;  4LNU D;  2OAU A;  3GOX A;  1SEM A;  1PC0 A;  2X51 A;  3G2T A;  2DM1 A;  1OZ2 A;  1MX2 A;  2YLC A;  3DLM A;  4HCZ A;  3CHP A;  1BYM A;  3TXN A;  2XRZ A;  3EFO B;  4EZL A;  2GQI A;  1G5V A;  2FO1 E;  2QYZ A;  4DLO A;  4TXP A;  3DSW A;  3NFC A;  3TWV A;  1M2V A;  1T3L A;  1JJ2 P;  5CRU A;  4N4H A;  3JUE A;  3G2V A;  2L5Q A;  5G04 C;  2FG0 A;  4GY5 A;  4TXQ A;  2H3E B;  5FIN A;  3TWS A;  3NGP A;  3OYA A;  3CCM Q;  5FT9 A;  3IEG A;  2K4Y A;  2ZCF B;  1N27 A;  4WTO B;  3UQ3 A;  2MI6 A;  4G25 A;  1RAF B;  3HHT B;  2KRN A;  2J4B A;  5FZQ A;  4N39 A;  1PWT A;  1H6O A;  3VLD A;  2G6F X;  5CVI A;  1SF9 A;  2A7Y A;  3OB9 A;  4F3V A;  1TUC A;  3JCM g;  5AN8 A;  4UI9 J;  3T9K A;  2M51 A;  2LMJ A;  3M4G A;  1R0B G;  1OWO A;  5G04 J;  4QVD A;  1QVG P;  1NLO C;  4UWK A;  4BB7 A;  1MMA A;  4GA1 A;  1ZSZ C;  3MJW A;  5LJ5 h;  2YHE A;  1UN8 A;  1KPS B;  1VQO A;  3PEV B;  2RHZ A;  1NBE B;  3CCJ T;  1LPL A;  3D9J A;  1Q81 R;  3U4T A;  4OMP A;  1ZHI A;  3HYM B;  3JCK C;  3FP3 A;  1U5S A;  3VJP A;  3OS2 A;  1NG2 A;  3D9I A;  3CCJ Q;  4BFR A;  1U1T A;  5FW9 A;  4C92 B;  4PJO F;  1VQL Q;  1ZQ1 A;  1H8K A;  2D8H A;  3G2S A;  2GF7 A;  4FSX A;  4MZP A;  9ATC B;  4M75 B;  1EYH A;  1QKW A;  2LRQ A;  5FU7 B;  2J6O A;  1VQN T;  1VQL T;  2FZC B;  3MJX A;  4PKC C;  2NYJ A;  2R17 C;  4AXH A;  2KMT A;  2FF4 A;  3EHN A;  1K9M U;  4M7D A;  2VVK A;  5KH6 A;  4GB9 A;  1ZUU A;  2QYJ A;  1EFN A;  4LNP A;  2EIJ E;  5I22 A;  1KQS A;  4GA2 A;  4A3V A;  2V8S E;  2IO2 C;  2YUO A;  3DKM A;  1U06 A;  3DSV A;  4KZC A;  1SA4 A;  4J9H A;  3CC4 Q;  2K5L A;  2M9U A;  3APC A;  5AAO A;  4M7A G;  4C0D C;  4RCB A;  1H2V C;  3EFS A;  2YDL A;  3CC7 Q;  2KRS A;  2PQW A;  2PUO B;  5LL6 S;  1O1R A;  1M1K C;  4Z02 A;  3RIR A;  1RAB B;  2KM4 A;  4F7U A;  3CHM A;  3B13 A;  1H19 A;  3CC2 A;  1OWL A;  4AY5 A;  2JOY A;  3NHN A;  5T4Y A;  4CDR A;  3Q9N C;  4V2S A;  3X20 B;  1QLY A;  2WXO A;  2PQR A;  1S63 A;  4U07 A;  3N71 A;  5ARG A;  3RUX A;  2VQ2 A;  2DWZ A;  3KEZ A;  4XTU A;  3PGG A;  2V5F A;  3JCM c;  4GYY A;  3QJ6 A;  2PTK A;  4JZY A;  4FT2 A;  3L82 A;  3SWN A;  4QVC A;  1YI2 T;  3BEE A;  2C06 A;  1OCR E;  3KD7 A;  4M75 E;  3OY9 A;  1WHL A;  3ZGQ A;  1QVF A;  1N4Q A;  3HG0 D;  4ACL A;  3JCM V;  5J3B A;  4J7F A;  2HBW A;  3G4S T;  4JLI A;  3PRE A;  1T0J A;  4FW2 A;  5ENO D;  3KS2 A;  5HRY A;  4EPZ A;  2DF6 A;  1YJ9 Q;  4MKT A;  2AVP A;  2P9S G;  5EN5 D;  1TEZ A;  1KQS S;  3QYH B;  3RMQ A;  3SFZ A;  4M77 C;  4PJJ A;  5D6W A;  3EGD B;  2ZPI B;  1ZUY A;  4RG6 A;  3UT8 A;  2EGC A;  3PNW C;  3ZEH A;  2KZT B;  3L2Z A;  2E6Z A;  2HEQ A;  1GL5 A;  3O5Z A;  1VYV A;  1Y07 A;  5EX3 A;  3BDL A;  2GNC A;  1IRE B;  4DOV A;  4JZ3 A;  1RZ4 A;  2JLB A;  5CK9 A;  3SFY A;  2JUF A;  4DBH A;  4C0F A;  4GPM A;  1ZA1 B;  2ZU6 B;  3Q15 A;  2JNG A;  3A5Z B;  4M7A E;  3HVE A;  3VV0 A;  3JQ0 A;  5KCO A;  1D8E A;  3LVR E;  3CHQ A;  4ZN1 A;  2W0Z A;  5KYU B;  3RU0 A;  3R9M A;  3QDF A;  1AOJ A;  3SBS A;  3CCJ A;  1N11 A;  3U9W A;  2DRK A;  4OP0 A;  4JA9 A;  4L2Y A;  4BE0 A;  2RO0 A;  2E5K A;  5AQ7 A;  1U3C A;  4HVV A;  3UM2 A;  3PDN A;  2BUG A;  3UPU A;  1D0Z A;  3FTW A;  5AYF A;  1TN6 A;  3S2A A;  5JA4 D;  1IGQ A;  1NZN A;  5GAO l;  3FTS A;  4WNF A;  2QA4 T;  2HAX A;  2ATC B;  3LW5 E;  5DBK A;  4BAC A;  3QSU A;  3ML8 A;  1TXQ A;  3TGO A;  2DRM A;  1FMK A;  5FRM A;  2FHD A;  3I5R A;  5FTP A;  1KQ2 A;  3CQC B;  4M75 D;  4FSS A;  1VQK T;  2Y69 E;  3LVQ E;  1W2B P;  3ZNG A;  4PK4 A;  3HKS A;  1TWB A;  4FJY A;  2LT4 A;  2WPV A;  3FTU A;  2RJD A;  1C0M A;  4B94 A;  5KBA A;  1BBZ A;  2JT4 A;  1QVF P;  2FZK B;  1QNF A;  3L16 A;  2QYU A;  2XPY A;  1I8F A;  2DIL A;  3BFM A;  4C8Q G;  4E2F B;  5GAN g;  2HD0 A;  1JJ2 A;  1KZO A;  3CBP A;  1KIK A;  3QAQ A;  1ZLM A;  1QP2 A;  1OEB A;  4J5Y A;  4M7A F;  5CMY A;  2YXY A;  3Q49 B;  2RFA A;  2K3B A;  2OVF A;  4GLK A;  1Z9Q A;  5GAN 7;  5LP0 A;  2PM7 A;  3CK7 A;  2Y4T A;  1Y8M A;  3FRN A;  4I6J A;  4XX5 A;  3QKJ A;  4C8Q B;  5FLX E;  4U63 A;  4RMO A;  2K7A A;  4AVX A;  3HRA A;  1X01 A;  3VS6 A;  4I9E A;  4U0U A;  1YBY A;  4V3I A;  2F5T X;  2L9B A;  4ELY C;  1SVX A;  2BZY A;  1OWP A;  2BED A;  2VGE A;  1KFZ A;  4ZFH A;  3GIB A;  4PS7 A;  2EWN A;  5KWD A;  3DWL G;  4JB8 P;  4APF A;  3SBT B;  4DX2 A;  2FPD A;  3TVT A;  2ZPH B;  3V8L A;  3PZ3 A;  3CPF A;  1OV3 A;  3CQT A;  1NL4 A;  4LDY A;  1VQP A;  3ZXS A;  4GTV A;  2AXZ A;  4DBR A;  1M2V B;  3V2X A;  3QZ9 B;  4GZD A;  1H92 A;  1D1C A;  4LDW A;  2V4L A;  4XQ3 A;  4B93 B;  4M7A B;  3VS1 A;  2X35 A;  4DBQ A;  2NLU A;  3HFO A;  4L5G A;  1UN9 A;  1FX7 A;  4BE1 A;  3G6E A;  4ACK A;  3ZFW A;  1NEB A;  2QEX Q;  3MKR A;  5LJ5 e;  1JCR A;  3SFX A;  3UAT A;  4ATG A;  4HT8 A;  2X6F A;  3CD6 T;  3L9T A;  1AWW A;  5E75 A;  2ROL A;  5A2Q E;  4KVO A;  3I55 A;  5JJ6 A;  3CD6 Q;  1SZA A;  4ORZ A;  1MMD A;  1YN8 A;  4L2L A;  4F17 A;  2QAZ A;  3JCM X;  4BT8 A;  4BTA A;  3CCV Q;  2XID A;  5LJ5 d;  3NBN B;  1LCK A;  3R9A B;  1LF8 A;  2PQN A;  2WXF A;  3SFM A;  3U23 A;  2EGA A;  4PJO E;  1TNB A;  1AWC B;  1WFW A;  3Q5M A;  4GZ5 A;  4NL2 A;  3L2Q A;  3PEU B;  3QNK A;  1OT8 A;  2QG9 B;  4BUG A;  2NWM A;  1YJN T;  3NZU A;  1X27 A;  2FZG B;  3RKX A;  2DL7 A;  4MS6 A;  3V8K A;  4EQF A;  3CCE A;  5M72 A;  4RTW A;  3K9I A;  2JZ2 A;  2JEK A;  1SRL A;  3SHW A;  3UA6 A;  4AG2 C;  3FWV A;  4PJO C;  2DVE A;  4PFP A;  3B7B A;  1JBM A;  3QXE B;  4D8K A;  2LO6 A;  4KUL A;  2CSQ A;  2CP2 A;  1Q86 R;  3FTX A;  3SB2 A;  2WXJ A;  3TWQ A;  3FU5 A;  1ZSZ B;  2PNN A;  3A1P A;  4C0M A;  4O1O A;  2F0Y A;  2LNH B;  1NA0 A;  2DXU A;  4KH0 B;  3RKV A;  2FVU A;  2KEA A;  2M0O A;  4OB0 B;  3MP6 A;  2E1H A;  1DJ7 B;  4ESR A;  2DZ9 A;  4E7K A;  3D7S B;  3JV3 A;  2V4H C;  5EID A;  1MX4 A;  1R77 A;  1VYT A;  4BI3 A;  3LPZ A;  2QQB A;  2LAH A;  2RHX A;  2UY1 B;  4GTT A;  5D2M C;  3TL5 A;  1EX4 A;  4ZGE B;  1Q7Y U;  1MUZ A;  3V31 A;  1H2U A;  1C1A A;  2WXM A;  4I9C A;  1VQ8 A;  3VS7 A;  3PFS A;  4N3B A;  2QQ9 A;  4OVA A;  4YTL A;  3UMV A;  2CZ0 B;  3MP8 A;  3VRZ A;  4D6W A;  4RLY A;  3CC4 A;  3DSS A;  2DEQ A;  5GAO q;  3Q47 B;  1YJW Q;  3URG A;  1XQH A;  1YFN A;  3AAA C;  3MZL B;  3VUZ A;  3G4S A;  4R7L A;  4MBG A;  3OXL A;  1AZG B;  5FQ6 A;  2LQW A;  2RPN A;  1W70 A;  1ZX6 A;  1OCC E;  4HQD A;  4DQ2 A;  4J9G A;  2VWF A;  3LYA A;  4U0S A;  5CMW A;  4GCO A;  3QHS A;  5DM7 R;  2WXG A;  5FQ8 A;  1JB0 E;  1QKX A;  5EX0 A;  3FB9 A;  3QII A;  5ANL A;  3HL8 A;  2NUP B;  2DA9 A;  3CCS T;  1K4U S;  2NUT B;  2E3H A;  1HJD A;  4MMK A;  5GMK l;  4M7A D;  4G26 A;  5G05 J;  4M4Z A;  3RIB A;  1K8K G;  4Q94 A;  2DER A;  2DBK A;  1IQU A;  4PFZ A;  2RK1 A;  4DEX A;  2ZZD A;  4M78 B;  1UG3 A;  3LCA A;  4BX8 A;  2Y1L E;  5KJK A;  2E65 A;  2FBN A;  2YNQ A;  4XZ4 A;  5EKQ D;  2BTD A;  2D1X A;  3JB9 I;  2XPI A;  3I5S A;  4Y28 E;  1M1K U;  1ELR A;  4PS8 A;  5EYL A;  2FRY A;  5CAI A;  4MRU A;  1BIB A;  2V1R A;  4F7U E;  1Q7Y R;  1BKB A;  4G1T A;  3X24 B;  3UWN A;  1K76 A;  2CP7 A;  3HHM A;  1BCM A;  1W6X A;  1X6B A;  1Q81 C;  4RTV A;  3HRU A;  1Z3Y A;  4M77 E;  3HRS A;  2WMO A;  2K3X A;  3EFR A;  1PM3 A;  5IH2 A;  5ENS D;  2PUK B;  4GA0 A;  3D9M A;  4E7L A;  1W3B A;  1QQE A;  5CCM A;  3M0U A;  1Q82 C;  4X34 A;  2AJA A;  1SHG A;  2JMA A;  2KI7 A;  2QGF B;  5BUZ A;  1NYG A;  4XK8 E;  5A6C A;  3CCV T;  3CME A;  1I81 A;  4XI9 A;  3R6N A;  4Q69 A;  3VLE A;  3JCM e;  4RG2 A;  5IHK A;  2KVQ G;  2EJF A;  3CCU Q;  4QVZ A;  1X69 A;  3PE3 A;  2KXP C;  5JHB A;  1EIF A;  2FYK A;  4F14 A;  1WQW A;  1UGV A;  3I9Q A;  1SZ9 A;  4RSY A;  3NF1 A;  4C0G A;  1NLP C;  1UHF A;  1UB4 A;  5HCK A;  3NZS A;  1ZA2 B;  2XEV A;  5GAN e;  2HZY A;  4GMJ A;  3W9G A;  3SNX A;  5CIU A;  3G1J A;  3L13 A;  3SD5 A;  2HBP A;  1G3S A;  3AS4 A;  4K5B A;  4XTZ A;  2FO7 A;  3ULE G;  3MEU A;  1VQ7 T;  3M0T A;  4LD9 K;  2ILR A;  3TWX A;  2J07 A;  2BZ8 A;  4RVB A;  2FL7 A;  1V54 E;  3QYG B;  3CK8 A;  4M77 B;  5I21 A;  4RCC A;  4E7J A;  4F6R D;  4A1G A;  4GBQ A;  1AT1 B;  5LJ5 g;  2KRM A;  1HE8 A;  3FUM A;  3SQV A;  3Q1J A;  3X26 B;  5D0Q D;  4DJA A;  3FUD A;  2KGT A;  1YNZ A;  3V7C A;  3E37 A;  4GTO A;  4N4I A;  3THK A;  2LNV A;  4C92 D;  2JVV A;  3I56 A;  3J7A F;  2L3S A;  1G2B A;  3QKY A;  1PCX A;  2VGN A;  2BIV A;  1RW2 A;  4EBA A;  3QDN A;  2JM9 A;  5IAY A;  4LD6 A;  4J0U A;  3FJ5 A;  4RG9 A;  3CMA A;  1E8Y A;  1YJW T;  2EBP A;  1K9M C;  2KC7 A;  4O6J A;  1UEC A;  1SA5 A;  4AV7 A;  3GNG A;  3CVP A;  5ARF A;  2X38 A;  4XIF A;  1TUG B;  3GBQ A;  2HKN A;  3UIP C;  3ZKJ A;  5ENN A;  2XPZ A;  2RH2 A;  3A8O B;  2O9V A;  2RJE A;  1N8R C;  2QTV A;  3CCR A;  2FI7 A;  4URK A;  3ZYM A;  3ASD A;  3WVD B;  5AYW D;  3LY7 A;  2LXM A;  4CDN A;  5GAN 3;  3CPW A;  2EJ9 A;  3IKO B;  4U04 A;  2K2M A;  4LDV A;  2WQH A;  4I1M A;  3CCM T;  3CHR A;  4M77 D;  2VTB B;  3VU3 C;  4JJC A;  3RRM B;  3OMG A;  3LKU A;  3CVN A;  3OMC A;  2DCP A;  2L0T B;  4XU1 A;  4AMC A;  5CER B;  3RNJ A;  3A8H B;  1D09 B;  4JEH A;  1K9A A;  1TG0 A;  7AT1 B;  4K11 A;  4PJO A;  4IRU A;  3GNF B;  4M77 F;  1ZSG A;  2L3R A;  1IXD A;  4E47 A;  2Y4U A;  1Q2Z A;  2CS7 A;  2X6I A;  4CC2 A;  1D0X A;  2KAF A;  5DY9 A;  2DET A;  2J09 A;  3LY8 A;  2WMN A;  2FEI A;  3MV2 B;  4H7X A;  4N4G A;  4C5H A;  4I1O B;  4FP7 A;  2JXB A;  3FEY A;  5C1D A;  2DO3 A;  2F2V A;  1EPU A;  2BZX A;  2LC4 A;  1QWF A;  3FIF A;  3FEX A;  4E7H A;  4PS3 A;  3BG1 B;  3IQL A;  3FH5 A;  4J6Y A;  2PZ1 A;  2VSN A;  3PE0 A;  2CG2 A;  2I6H A;  2KCV A;  2XZT G;  5AQB A;  2XZD G;  2DL3 A;  3G7Z A;  4JHK A;  3CMA T;  2KR3 A;  4ZGD B;  4NL3 A;  2O9S A;  3EGD A;  1UFF A;  2HNI A;  1X81 A;  3RSE G;  3QC1 A;  2EQK A;  2CT4 A;  3TG4 A;  3P8H A;  1K0X A;  1VQ9 A;  2QAS A;  1N6A A;  2DBA A;  3FJP A;  1WJQ A;  3M0R A;  1YI2 Q;  2I1J A;  3JCM W;  2J06 A;  1YIJ Q;  2IU1 A;  3B7T A;  3TRE A;  2VXF A;  1HX8 A;  4AM9 A;  2KAT A;  4AJW A;  1KC8 C;  2VV5 A;  4PLI A;  5AT1 B;  2H8H A;  3PUK A;  2WSF E;  4JJB A;  4BER A;  5HY6 A;  3TQ7 P;  4IKF A;  1AVZ C;  2DYB A;  2X3X D;  4CC7 A;  5KYU A;  3CME T;  5FU6 C;  3VUB A;  3JYS A;  5GAN 2;  2HQE A;  2E3I A;  3ONK A;  2I2L A;  3H0F A;  4J6W A;  5HKC A;  3GP8 A;  4ZTF A;  4Z68 A;  4BSZ B;  3DPY A;  5CHE E;  4KH1 B;  3E32 A;  2KRO A;  2H6F A;  4XU3 A;  3CVL A;  1RAI B;  4BD3 A;  4BI8 B;  5KYX A;  3I55 T;  2CSI A;  1RAE B;  1U8R A;  1W1F A;  2KCK A;  2G3R A;  1U3O A;  1I0C A;  2A28 A;  3L2V A;  1K9M R;  5T3R A;  1WHM A;  1UE9 A;  3X28 B;  1XOV A;  3L17 A;  3QWX X;  1WG0 A;  5L8R E;  2IJG X;  5FQ4 A;  4DEY A;  3V8J A;  2DBM A;  3CCU A;  1VOM A;  1VQ4 A;  4AY6 A;  2CP0 A;  2XGM A;  4M7D D;  4A55 A;  1QCN A;  1TNY A;  5CED B;  1BK2 A;  1ZBP A;  3I4R B;  4M7C A;  3PH0 C;  1Z6T A;  2R57 A;  2IOS A;  3MKQ A;  3PRZ A;  2C2L A;  3FDR A;  1WHG A;  2A0F B;  1M9S A;  5GJW B;  4B0Z A;  3JXJ A;  1LNX A;  1KLX A;  2IFU A;  2E0I A;  3PVL A;  2R5A A;  3CHO A;  4HOR A;  3ESL A;  3VKI A;  1M5Q 1;  2C0L A;  1RI0 A;  1OI1 A;  5C2Y A;  2HR2 A;  1F1B B;  2CUD A;  4J9D A;  3M5A A;  1K8A U;  4TVR A;  1BIA A;  3UF4 A;  2ROT A;  5AQA A;  4G24 A;  3OAW A;  4EMK A;  2Y3A A;  3NTK A;  1NPP A;  2X4J A;  3UT1 A;  1Q82 U;  1WXT A;  3CCV A;  5EYP F;  4J8O A;  4BTB A;  5CKF A;  2XCC A;  3UA7 A;  2MIO A;  1I07 A;  1CSK A;  4PH4 B;  2E10 A;  3REB B;  5FJY A;  1YHQ Q;  2OTJ T;  1HO8 A;  5KJM A;  3CK9 A;  5B1A E;  1FXX A;  1U3D A;  3ULQ A;  1R8O B;  4LUE A;  5LJ3 d;  2QA4 Q;  1YCY A;  5ITZ F;  4U0Z A;  2L6J A;  2WXI A;  3ASF A;  1OWM A;  3UIO C;  2LTO A;  2KBX A;  4JDS A;  5LCW J;  4DOW A;  4YDE A;  2K57 A;  1A0N B;  3DEO A;  3F70 A;  4BY6 B;  3UT7 A;  3FH7 A;  3Q7A A;  2CHW A;  2XDD A;  2BKG A;  1WHH A;  2F69 A;  3JB9 G;  3C5R A;  2VSO E;  2GRM A;  1S72 Q;  5J08 A;  1VQ5 T;  5FWB A;  3RRU A;  1PSF A;  1VQ9 T;  3MHX A;  3UT4 A;  4OF1 A;  2LAI A;  4XAX B;  4HBD A;  2K2V A;  3VYG A;  5LJ5 j;  1VQP Q;  3MYV A;  1JUQ A;  2DEU A;  4KRT A;  1WAO 1;  5FRN A;  2A4Z A;  2VGX B;  1TNO A;  4A54 A;  5LCW C;  1BU9 A;  4Y92 A;  3JCM d;  3KBG A;  2CZ6 B;  3UX4 A;  2QA4 A;  1OCZ E;  1UG1 A;  1SKU B;  3DST A;  3ONL A;  2CH4 W;  1IQR A;  3PNL B;  3FDH A;  2VXE A;  3ASK A;  5JJT A;  3CCE Q;  1QQJ A;  4B9W A;  3ULR B;  2EIK E;  5G05 C;  2EKH A;  4FC8 A;  2DYS E;  1Q95 G;  2XEE A;  4JEU A;  2RD1 A;  4XTV A;  2QI2 A;  3FUI A;  3T8K A;  1V29 B;  3L2R A;  3AHU A;  3J5P A;  1ABO A;  3CR3 A;  4L59 A;  1M2O A;  2JAB A;  3PIO A;  3FUJ A;  4QKU A;  1WNL A;  1BI0 A;  3RBB B;  3SDZ A;  5IXB A;  2F37 A;  4M75 C;  1IO6 A;  4Y6W A;  3B7R L;  1NEG A;  2P0P A;  3CCS A;  4PJL A;  1VQ5 A;  3L1A A;  4KT6 B;  2DNU A;  2CP5 A;  2LNI A;  2C0I A;  2P0K A;  1C6V X;  1M90 U;  4M7D B;  1IHG A;  2WVI A;  2B6C A;  4WNG A;  4G8L A;  1CKA A;  5A0L A;  5ENP D;  4LDX A;  5GAN 8;  3L2W A;  3GPL A;  3BU8 A;  3PMI A;  1VQP T;  3LEW A;  3JCM J;  1WXU A;  3VLF A;  1WI7 A;  2V8K A;  4QQ6 A;  1QVF S;  2LJ0 A;  1Y96 B;  4FHJ A;  3C3Q A;  4A4G A;  5GAN 6;  3EHR A;  4YVQ C;  5CKH A;  2VTB A;  2E5Q A;  4CZ2 D;  2PZI A;  4JRK A;  1GBR A;  1K73 U;  1R0C B;  3HXC A;  1B07 A;  1IYG A;  4FHK A;  1LD8 A;  4TUU A;  1GCQ A;  2AK5 A;  3L08 A;  1SHF A;  4NOY A;  2RN8 A;  4C0E A;  4L6V 5;  3PZD A;  2GQV A;  1AWJ A;  5BT1 A;  3RK6 A;  5AJD A;  1N9A A;  2RQU A;  2D9T A;  2K79 A;  3JXI A;  1BD8 A;  2KDS A;  2L0I A;  5J26 A;  4BET A;  8ATC B;  2EAY A;  1H3H A;  4ATZ D;  3G71 A;  4J6X A;  1A5E A;  4LEU A;  1BPO A;  1GRI A;  5GMK i;  1DC2 A;  4E6R A;  3OTN A;  2KY9 A;  4NS5 A;  4KBM B;  4OMN A;  1ARK A;  1YIT A;  1GW6 A;  1M8V A;  2HSE B;  2LQN A;  2XU8 A;  2RJF A;  1OY3 D;  1K1A A;  4EIK A;  2ZGD A;  3QZ5 B;  2IEJ A;  3AG4 E;  2M63 A;  2ZGW A;  2J08 A;  4LXC A;  1T3S A;  5BV1 A;  2GRO B;  3PUJ A;  3OQ5 A;  3QDR B;  3MGB A;  1QBQ A;  3ZIM A;  4FAD A;  1GXI E;  4X1V A;  1Q82 R;  1EDU A;  2EQI A;  1WGS A;  3EAE A;  3C72 A;  2R2L A;  1BCO A;  4NIK A;  1D0Y A;  1S64 A;  5KCM A;  2LUH A;  1I5O B;  1SW6 A;  3IHV A;  4CCA A;  4DUI A;  1IB8 A;  3DRA A;  3FEO A;  4G11 A;  3QWV A;  3GF5 A;  1KHC A;  2GTO A;  2RNA A;  3MPU B;  2RB6 A;  1YIT Q;  2K6D A;  1RLP C;  1UJ0 A;  4C9B B;  3EG9 B;  2RG8 A;  5FWQ A;  4Z89 A;  3Q75 A;  1LVK A;  4OB1 B;  3PIP A;  3QWP A;  3RKW A;  2CYZ B;  5D6Y A;  3RR6 A;  4GTP A;  3CC2 Q;  3ZHE B;  2A5U A;  3FFL A;  3B7U X;  2EKO A;  2YUQ A;  4JLG A;  2CFZ A;  2K9G A;  3G2U A;  3H0I A;  2MOX A;  2CUB A;  2Y4X A;  2SEM A;  4BDY A;  3N5B B;  3TSW A;  2OND A;  3CVY A;  1AZE A;  3MCX A;  4DA4 A;  1H64 1;  2WAC A;  2HL5 C;  3ZL7 C;  4E7Z A;  1SPK A;  1HK9 A;  3OS0 A;  4E7I A;  2Y4Y A;  4C8Q F;  1TYQ G;  1TUD A;  1Y57 A;  1B89 A;  3G71 Q;  2ETB A;  4FUL A;  4ANU A;  5AEN A;  3AU5 A;  1O9S A;  1EZZ B;  5GAN j;  3B95 A;  3MKQ B;  4A63 B;  3QG1 A;  3CKC A;  1JQQ A;  4HOS A;  2P9P G;  4K0R A;  1E7V A;  4LE9 A;  4JS5 A;  3DEP A;  1B3Q A;  4QT7 A;  3CXC S;  1D3B B;  3M58 A;  3GZS A;  3VYH B;  2YLB A;  4A4H A;  1KD1 U;  1Z5S C;  3VTX A;  2NXP A;  2BF0 X; 
#chains in the Genus database with same CATH homology
 4K5A B;  1Z9Z A;  4HVW A;  2RMO A;  5ENS D;  1FYN A;  3VS5 A;  4RTX A;  5IH2 A;  5FWC A;  1YMP A;  2DZN A;  1GBQ A;  2DE0 X;  4JPB W;  2L0A A;  2AKL A;  2X3W D;  3M0U A;  3VRY A;  2DZO A;  4TUM A;  1M8M A;  2AJA A;  3V79 K;  1SHG A;  4YDY A;  2JMA A;  2LZ6 B;  2OAW A;  1NYG A;  4HRM B;  3SO8 A;  2J05 A;  4J9I A;  4HLL A;  3V30 A;  3R6N A;  1QCF A;  4HVU A;  4OMO A;  4RTT A;  2EVR A;  5IHK A;  3M0Q A;  2BKK B;  4O60 A;  2P4R A;  4HNA D;  1GFD A;  2DL4 A;  1G83 A;  3VS4 A;  1X69 A;  1IKN D;  2F8X K;  2KXP C;  4CYM D;  4F14 A;  4YDW A;  1E6H A;  1UGV A;  2KE9 A;  2JM8 A;  3I9Q A;  1NLP C;  1UHF A;  2DVJ A;  3J5Q B;  4K5C A;  3A98 A;  5HCK A;  2O31 A;  3UI2 A;  2ETC A;  3W9G A;  1ZBJ A;  1BLX B;  3UXG A;  2QDL A;  4IIO A;  3PVQ A;  2KT1 A;  4K5B A;  2ENM A;  5CEA A;  3M0T A;  4DX1 A;  4RTY A;  3TWX A;  2OJ2 A;  1UHC A;  2BZ8 A;  1I1J A;  2KXD A;  2D8J A;  4LNU D;  1SEM A;  1UJY A;  1OPL A;  2DM1 A;  3EHQ A;  1MX2 A;  4F6R D;  4J8Y A;  2L6B A;  3EGU A;  4GBQ A;  5ECA A;  2L3Q A;  2VKN A;  2KRM A;  1WX6 A;  5JMN D;  2GQI A;  2FO1 E;  1S1N A;  1GFC A;  2EW3 A;  4C48 B;  2DL8 A;  2KGT A;  1YNZ A;  2MYO A;  3TWV A;  3THK A;  1T3L A;  2L3S A;  1G2B A;  1OOT A;  3JUE A;  4ZHB A;  2JM9 A;  1JXO A;  3H41 A;  4DX5 D;  3FJ5 A;  2FG0 A;  3M0P A;  2EGE A;  2CT3 A;  2EBP A;  5FIN A;  3TWS A;  1PRM C;  3NGP A;  1UEC A;  1YYH A;  1AD5 A;  3GBQ A;  3LJN A;  3LH5 A;  3ZKJ A;  2KRN A;  1PWT A;  2O9V A;  2G6F X;  1N5Z A;  2J6F A;  2V5Q C;  1TUC A;  5AN8 A;  3T9K A;  2M51 A;  2LMJ A;  1PHT A;  1NLO C;  2K2M A;  2GTJ A;  2JS0 A;  1OPK A;  1SSH A;  1M3C A;  4JJC A;  5AQ9 A;  4OMP A;  4WCI A;  3M0S A;  1K1Z A;  1JEG A;  5CER B;  4ZNX A;  3RNJ A;  1U5S A;  1J3T A;  1UOH A;  3C0C A;  1NG2 A;  1K9A A;  1TG0 A;  4OAV B;  4K11 A;  5FW9 A;  1H8K A;  1ZSG A;  1TR4 A;  2D8H A;  3EG2 A;  4Z8A A;  2OI3 A;  2KYB A;  4CC2 A;  2CH4 A;  1QKW A;  2DL5 A;  2FEI A;  2J6O A;  2NYJ A;  1E7O A;  1MYO A;  2JXB A;  2VVK A;  1WDX A;  1UDL A;  1ZUU A;  3REA B;  2F2V A;  2BZX A;  2QYJ A;  1QWF A;  2ECZ A;  1WIE A;  1EFN A;  4LNP A;  4HB5 A;  2LJ1 A;  3IQL A;  2PZ1 A;  3PE0 A;  5I22 A;  2XZT G;  5AQB A;  2XZD G;  2DL3 A;  2YUO A;  1U06 A;  2PNI A;  3AJI A;  2C0O A;  2KR3 A;  4J9H A;  2ZGG A;  2O9S A;  3V2O A;  1UFF A;  5AAO A;  2CT4 A;  2YDL A;  1K0X A;  2KRS A;  3M0R A;  2ABL A;  2ED0 A;  5ENT D;  1PKT A;  2J06 A;  1MJ0 A;  1X2Q A;  4HRL A;  3NHN A;  3Q9N C;  1AWO A;  2AZV A;  2JS2 A;  1JO8 A;  1QLY A;  2LJ3 A;  1MV0 B;  2H8H A;  1GCP A;  4JJB A;  4BER A;  4HRN A;  4RTZ A;  2DWZ A;  1AVZ C;  2DYB A;  2X3X D;  2MCN A;  4CC7 A;  2DMO A;  2DX1 A;  2PTK A;  3NPF A;  5CBO A;  2J7I A;  3H0F A;  5AAR A;  2YSQ A;  2HDA A;  1ABQ A;  4Z68 A;  4BSZ B;  1DCQ A;  3HG0 D;  1MV3 A;  2KRO A;  1HSQ A;  4OML A;  2HBW A;  1T0J A;  2CSI A;  5ENO D;  2DF6 A;  5HRY A;  1W1F A;  4AG1 C;  1S70 B;  1U3O A;  1I0C A;  2A28 A;  5EN5 D;  2HE0 A;  1UE9 A;  4HI8 A;  1XOV A;  3QWX X;  1WG0 A;  1YP5 A;  2YT6 A;  4DEY A;  1ZUY A;  2RQT A;  2DBM A;  2EGC A;  4CC3 A;  3NOG D;  5CED B;  1BK2 A;  2HEQ A;  1GL5 A;  3O5Z A;  1VYV A;  2GNC A;  2J8S D;  3H0H A;  2CDT A;  1AP7 A;  5GJW B;  4JZ3 A;  2JMC A;  3JXJ A;  2RQR A;  4AFU C;  4IIM A;  4GPM A;  3PVL A;  1BB9 A;  1KSW A;  1KJW A;  4JJD A;  5D66 A;  5CEC B;  4F16 A;  2FPE A;  2CUD A;  2W0Z A;  4J9D A;  1AOJ A;  2A36 A;  1N11 A;  2ED1 A;  1M30 A;  1WDY A;  4LG6 A;  2DRK A;  3UF4 A;  2ROT A;  5AQA A;  3UTM A;  3F6Q A;  4OAU C;  2E5K A;  5AQ7 A;  4HCK A;  3SEM A;  1WXT A;  2ESW A;  4HVV A;  5EYP F;  3UA7 A;  2V1Q A;  5KNH D;  2MIO A;  1I07 A;  4Z88 A;  5JA4 D;  1CSK A;  5BXO A;  4GMR A;  1JXM A;  3REB B;  2A37 A;  5HKP A;  4UUC A;  2DRM A;  1FMK A;  3I5R A;  3TSZ A;  5IHN A;  4FSS A;  4LUE A;  5I11 A;  4J9F A;  5ITZ F;  5FIO A;  3ZNG A;  2EYZ A;  2FRW A;  2KBX A;  4BES A;  4OMQ A;  3NMZ C;  1A0N B;  3DEO A;  1PNJ A;  4F1P A;  5KBA A;  1BBZ A;  2C0T A;  2JT4 A;  2BKG A;  2HCK A;  2W10 A;  3C5R A;  2L3P A;  2DIL A;  2QC9 A;  1IXV A;  1PRL C;  5FWB A;  1VYU A;  2P2C P;  2GBQ A;  5KNG A;  2ETA A;  1KIK A;  1ZLM A;  2F8Y A;  4J9E A;  1OEB A;  4HBD A;  5L23 A;  2RFA A;  5ENR D;  2K3B A;  4KRT A;  3TWT A;  3TWR A;  2O2O A;  2O88 A;  1Z9Q A;  2KNB B;  1BU9 A;  1ZUK A;  1BU1 A;  4Y92 A;  2KT8 A;  1UG1 A;  3I35 A;  2DVW A;  2KXC A;  2NUZ A;  1CKB A;  1HD3 A;  2CH4 W;  2K7A A;  4J7W A;  4O1P A;  3HRA A;  3VS6 A;  1SVX A;  3ULR B;  2BZY A;  2VGE A;  1KFZ A;  4ZFH A;  4DRX E;  2EKH A;  4AFQ C;  2XEE A;  5KWD A;  2BTT A;  4JB8 P;  1UUE A;  4DX2 A;  2FPD A;  3TVT A;  3T8K A;  3NOC D;  2B0O E;  1OV3 A;  3J5P A;  1ABO A;  5EIB E;  3CQT A;  2JAB A;  2L2P A;  4J9C A;  3RBB B;  2IIM A;  3IXE A;  2M0Y A;  3V2X A;  5IXB A;  1H92 A;  1YCS B;  2F37 A;  4B93 B;  3VS1 A;  1IO6 A;  1NEG A;  1NFI E;  3EU9 A;  3KFV A;  1K0S A;  4RUG A;  3KEA A;  4BEP A;  1M3B A;  2DNU A;  4GLM A;  1NEB A;  2C0I A;  5IHI A;  3UAT A;  2EYW A;  1PKS A;  1SRM A;  1G3N B;  2DLP A;  2YUP A;  2SRC A;  3VS3 A;  1D9S A;  1AWW A;  4G8L A;  1CKA A;  5ENP D;  2ROL A;  2KBT A;  4CC4 B;  4JZ4 A;  2RQV A;  1AEY A;  4ORZ A;  1YN8 A;  4F17 A;  2AZS A;  3TWW A;  1RLQ C;  1WXU A;  1WI7 A;  2YUN A;  1K1B A;  2LJ0 A;  3NBN B;  1LCK A;  2XEN A;  3EHR A;  1M3A A;  3EG0 A;  1X2K A;  4CZ2 D;  4U95 D;  3U23 A;  1WLP B;  2EGA A;  1GBR A;  5HS0 A;  1AWC B;  1WFW A;  2EYY A;  1B07 A;  3VS2 A;  4U8Y D;  1OT8 A;  1GCQ A;  2J6K A;  2NWM A;  2AK5 A;  1BI8 B;  1SHF A;  2RN8 A;  2A5E A;  1X27 A;  4J9B A;  4G8K A;  1AWJ A;  2DL7 A;  2JTE A;  3TWU A;  2RQU A;  4HXJ A;  1WA7 A;  4RTW A;  4LN2 A;  2K79 A;  3JXI A;  1BD8 A;  1SRL A;  2B86 A;  3SHW A;  2FPF A;  3UA6 A;  4BET A;  4LSZ E;  4AG2 C;  1H3H A;  4ATZ D;  2F2X A;  1A5E A;  3B7B A;  4OMM A;  2XEH A;  4D8K A;  1GRI A;  2EYX A;  1DC2 A;  4E6R A;  2CSQ A;  2JW4 A;  2EPD A;  4OMN A;  1ARK A;  1QYM A;  1YWP A;  3TWQ A;  2LQN A;  4DX7 D;  1YWO A;  2PNN A;  4QFV A;  1T0H A;  1OY3 D;  1K1A A;  3ZU7 B;  4O1O A;  2LNH B;  4D8D A;  4EIK A;  2ZGD A;  1QWE A;  2KEA A;  1RI9 A;  1T3S A;  4ESR A;  1NYF A;  3QWY A;  2RQW A;  3JV3 A;  2RFM A;  2V4H C;  5EID A;  1MX4 A;  1VYT A;  4X1V A;  2EQI A;  1GCQ C;  2D0N A;  1MUZ A;  3V31 A;  3VS7 A;  2LCS A;  2FO0 A;  4NIK A;  2LX7 A;  1SW6 A;  4DUI A;  3VRZ A;  4RLY A;  4LUD A;  1WYX A;  2GTO A;  2RNA A;  3AAA C;  2K6D A;  1RLP C;  2RF0 A;  1UJ0 A;  4U8V D;  1N0Q A;  2HSP A;  4Z89 A;  1AZG B;  2LQW A;  2RPN A;  4RTU A;  5IXF A;  1W70 A;  2XMF A;  2GGR A;  2CRE A;  1ZX6 A;  4HQD A;  4J9G A;  1M27 C;  2VWF A;  2KYM A;  3VS0 A;  2I0N A;  2YUQ A;  4DX6 D;  5EIL A;  1AWX A;  2K9G A;  2Y0B G;  3H0I A;  2MOX A;  2CUB A;  1QKX A;  2SEM A;  3EG3 A;  5EC7 A;  3ZUV B;  3TSW A;  4HI9 A;  4AFZ C;  2DA9 A;  1AZE A;  4AFS C;  4N5Q A;  1E6G A;  1K4U S;  1HJD A;  1NM7 A;  3ZL7 C;  2AKK A;  1SPK A;  1X43 A;  4QQI A;  1VA7 A;  4M4Z A;  1MX6 A;  4R0K A;  1BI7 B;  2DBK A;  5GJV B;  1TUD A;  4DEX A;  4U96 D;  1Y57 A;  1V1C A;  1Y0M A;  2ETB A;  2Y1L E;  3D9H A;  1WXB A;  1K3Z D;  1RUW A;  2D1X A;  1IHB A;  2DJQ A;  3EG1 A;  3B95 A;  3I5S A;  4A63 B;  1JQQ A;  5EYL A;  5ENQ D;  2FRY A;  1X6G A;  4LE9 A;  3DEP A;  1B3Q A;  2A08 A;  4QT7 A;  2LP5 A;  1JU5 C;  2V1R A;  5BXU A;  5CBN A;  1N0R A;  1K76 A;  3Q9U C;  2F2W A;  1W6X A;  1X6B A;  4RTV A;  1UTI A;  3W9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...