4A63B

Crystal structure of the p73-aspp2 complex at 2.6a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
202
Chain Sequence
MRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords TUMOUR PROTEIN 73
publication title Structural Basis for Aspp2 Recognition by the Tumor Suppressor P73.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 202
sequence length 202
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
B PF00023 Ank Ankyrin repeat
B PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4a63B01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4a63B02
2K7AA 4DRXE 2BZYA 2A5EA 2J6FA 1GFCA 2JW4A 5GJWB 3REAB 2F8XK 3SHWA 4J9EA 2QYJA 2RFMA 3SO8A 2DMOA 2K79A 1S1NA 2K2MA 2A36A 5EYPF 1GFDA 1AZGB 3UF4A 3VS7A 3JV3A 3EG2A 4HVVA 2LJ3A 4RTWA 4HNAD 1XOVA 5CBOA 4K11A 2RMOA 2IIMA 3ZL7C 3TWVA 3EU9A 2FPDA 1BI7B 1W1FA 5IHNA 1JU5C 1T0HA 5CEDB 2DBMA 2ESWA 4F6RD 2DILA 2PNNA 1NEGA 4LNUD 1ZLMA 1LCKA 2FPFA 2JXBA 2BZ8A 1PKSA 3PVQA 3JXIA 4X1VA 1MX4A 4BERA 2XMFA 1UUEA 3TWTA 1QCFA 1X43A 2RQWA 3TVTA 3DEPA 4K5AB 2FPEA 1MV3A 4JZ3A 2YUNA 2DL7A 3M0QA 4ZNXA 3IXEA 4QFVA 1K76A 2EGAA 5CERB 1X6BA 5CEAA 1H8KA 3I5SA 4HB5A 2ZGGA 2RQRA 1VYUA 2JS2A 1YWPA 4O60A 2EQIA 2KR3A 1YYHA 1W70A 4OAUC 2D0NA 2VVKA 3VS5A 4HRNA 2FRYA 1UGVA 1K1BA 2DL4A 2KROA 2X3XD 3LJNA 2FRWA 1G2BA 1AWOA 2DE0X 1E6GA 5I11A 2DZOA 1X69A 4J9BA 4HVUA 3TWRA 5ENSD 4HRLA 4BEPA 2KEAA 1JO8A 3M0SA 4F17A 1H3HA 1QLYA 4QQIA 1BLXB 2D1XA 2V1RA 1G3NB 3NPFA 4ZHBA 5EIBE 1RI9A 3NMZC 1Y0MA 1OPKA 2QDLA 1CSKA 2A37A 1I1JA 1MX6A 3NHNA 4OAVB 4DEYA 4LE9A 1WLPB 4J9GA 2XENA 1GBRA 2MCNA 1J3TA 2LP5A 1MX2A 1MV0B 1MJ0A 2RQTA 4K5CA 4QT7A 2ED1A 2HSPA 3QWYA 2KE9A 4DX1A 2DL3A 2YUOA 2GTOA 4J9CA 2GTJA 4AFZC 2ABLA 3EHRA 5CBNA 2EGEA 1PRMC 2AZVA 1VYVA 2F2VA 3UXGA 5EC7A 2FEIA 2D8HA 2CUBA 2BKGA 1V1CA 2SRCA 4AFQC 5IHKA 4OMQA 2KT8A 4YDWA 2KRMA 3VS1A 2F8YA 2FG0A 2GNCA 2W0ZA 3EG3A 3O5ZA 5FIOA 3M0UA 2FO1E 3V2XA 1AWXA 4J8YA 3H0IA 1SEMA 4CC2A 5EIDA 2LNHB 3UATA 1BBZA 3NGPA 4D8DA 2AKKA 1OV3A 1ZUUA 4Z68A 2DLPA 1SW6A 1M27C 2KYMA 4DEXA 3NOGD 1VA7A 2DA9A 1AOJA 2O31A 2PZ1A 2O88A 3RNJA 4B93B 2J8SD 1HSQA 4G8KA 5JA4D 4LG6A 4RTVA 1D9SA 1IXVA 1SPKA 1K0XA 2DBKA 5FW9A 4J9HA 5HCKA 1UJ0A 2JS0A 1GCQA 1Z9QA 3T9KA 1NYGA 1IKND 1B3QA 1PWTA 5AQ9A 1NG2A 1X6GA 2CUDA 3V79K 2VKNA 3Q9UC 1SHFA 2MOXA 1QKWA 1W6XA 4AFUC 2PTKA 4JB8P 1SRLA 2LMJA 3VRYA 1AZEA 4FSSA 2OI3A 4DX2A 2C0TA 5FINA 3B95A 3VS2A 3I35A 1N0RA 3TSZA 3W9GA 2GQIA 1WXBA 3EHQA 2KNBB 2O9VA 5IHIA 2KRSA 2Y0BG 4BESA 4HXJA 5AARA 2ENMA 1TUCA 3VS0A 1OY3D 2DYBA 3ZNGA 2O9SA 3UI2A 3EGUA 2KXPC 1TG0A 1YWOA 4LUDA 3HRAA 2QC9A 1GRIA 2X3WD 4E6RA 4BETA 1BD8A 4J7WA 2A28A 1TR4A 4HBDA 2C0IA 2CT4A 3RBBB 2XEEA 2LX7A 2OAWA 3H0FA 5I22A 4RTYA 1G83A 2AZSA 2L2PA 1NYFA 5FWCA 2VGEA 4M4ZA 5ENQD 2M51A 1TUDA 2XZDG 2DRMA 2ECZA 5CECB 3VS3A 4YDYA 4DX5D 4RTXA 2W10A 2DVWA 3NOCD 2K6DA 1ZX6A 4IIMA 2GGRA 5JMND 1NLPC 1T3SA 2BZXA 1IHBA 2HBWA 1KIKA 1B07A 1I07A 1BI8B 3C5RA 5KBAA 3PE0A 1UG1A 1E7OA 2DX1A 2CREA 2EW3A 4LNPA 1UOHA 2HE0A 1IO6A 2KXCA 3J5QB 4U8YD 5EYLA 1QKXA 2HEQA 3H41A 3LH5A 2C0OA 4GMRA 4CC4B 2F2WA 4J9FA 3M0PA 2DF6A 5AQ7A 3TWXA 4ORZA 2JMAA 4LN2A 1N11A 2EYYA 3TSWA 2FO0A 5KNHD 4HRMB 2JABA 2LZ6B 5AAOA 2J05A 4U95D 2H8HA 2J6KA 5ENRD 2V1QA 1NLOC 3SEMA 3KEAA 3UA6A 1PKTA 2EKHA 4TUMA 4IIOA 2HDAA 3I5RA 1ABQA 1UTIA 3JUEA 4ZFHA 3W9FA 4HVWA 2EPDA 3NBNB 2YDLA 4AG2C 1SVXA 1AVZC 3Q9NC 2L3PA 5HS0A 1KSWA 3C0CA 4JZ4A 1U06A 2LQNA 5ENTD 4JJDA 1AWWA 1GBQA 1YNZA 2F37A 1HJDA 2EYXA 3ZUVB 2V5QC 1AD5A 1BB9A 5ENPD 2RNAA 4O1PA 1UECA 4Z8AA 4AG1C 1WG0A 4BSZB 2P2CP 2ETAA 1Y57A 3DEOA 4J9IA 3AJIA 1DC2A 1YP5A 2DL5A 3FJ5A 4U8VD 2EYZA 4HLLA 1M8MA 2CDTA 2DNUA 4HI9A 5ITZF 1BU1A 2YSQA 1U3OA 2HCKA 4OMPA 4GLMA 3GBQA 5GJVB 3F6QA 1FYNA 3THKA 2CSQA 1AWJA 2L0AA 1JXMA 4O1OA 2AK5A 1AEYA 2L3QA 4UUCA 2RFAA 5AN8A 1ZUYA 4Y92A 1S70B 1E6HA 1JXOA 3D9HA 2CSIA 1KJWA 2KXDA 4OMOA 1U5SA 2J7IA 2NWMA 4RTTA 2DVJA 1RLQC 5BXOA 2M0YA 1WFWA 1YN8A 1ZBJA 5L23A 4D8KA 2MYOA 4LSZE 1A0NB 2VWFA 3H0HA 1NM7A 3A98A 3U23A 1ZSGA 1N5ZA 1X2QA 4CZ2D 1GCPA 5IH2A 1T0JA 1ABOA 1X27A 1QYMA 1SHGA 1K0SA 1MUZA 4GBQA 1KFZA 4G8LA 3ZU7B 2PNIA 2V4HC 1T3LA 2DZNA 2KYBA 2KT1A 2DWZA 1UE9A 2YUPA 2JM8A 5BXUA 1K1AA 4N5QA 2ETCA 3ZKJA 4J9DA 4OMMA 2SEMA 2RF0A 3CQTA 2EBPA 1NFIE 5IXBA 2EGCA 2KBXA 2Y1LE 2B0OE 1EFNA 1QWFA 2J6OA 2EYWA 1K1ZA 2JM9A 2DJQA 2DL8A 5EILA 3T8KA 1SSHA 4OMNA 2DRKA 2CH4A 1A5EA 5AQBA 3M0TA 4RLYA 1X2KA 1GL5A 1CKBA 4CYMD 1WIEA 2E5KA 3V2OA 4Z88A 2LJ1A 3HG0D 2YT6A 4HI8A 1OPLA 3KFVA 4EIKA 4KRTA 2J06A 2MIOA 5FWBA 2O2OA 4HCKA 2L6BA 1PHTA 1K9AA 4ESRA 4K5BA 2AJAA 4C48B 1WDXA 2ETBA 2OJ2A 2P4RA 1YCSB 5HRYA 5KNGA 2F2XA 5D66A 4JPBW 5EN5D 3ULRB 2BTTA 1DCQA 2GBQA 2K9GA 1CKAA 1K4US 3TWSA 2ED0A 3TWWA 1PNJA 3TWUA 4U96D 1ZUKA 4R0KA 2ZGDA 3I9QA 1WYXA 1YMPA 3VRZA 1M30A 4NIKA 2NYJA 4ATZD 5ECAA 1RLPC 2AKLA 3VS6A 5HKPA 4A63B 4RTUA 2XEHA 1WI7A 1QWEA 3UA7A 1M3CA 2KGTA 1FMKA 5AQAA 1UDLA 3J5PA 1BU9A 1WDYA 3B7BA 1HD3A 1UHFA 4F14A 4HQDA 2KRNA 2NUZA 2G6FX 3VS4A 4CC7A 1PRLC 1UJYA 1WX6A 2JTEA 4RUGA 4WCIA 1ARKA 4GPMA 4JJCA 2D8JA 2JMCA 1MYOA 1Z9ZA 1OT8A 1SRMA 5KWDA 1NEBA 1UHCA 1H92A 1RUWA 3IQLA 4OMLA 2XZTG 2I0NA 1JEGA 4JJBA 3JXJA 2YUQA 3V31A 3REBB 2CH4W 2KBTA 1K3ZD 3EG1A 4DX6D 2RQVA 1WXTA 4LUEA 3R6NA 2RN8A 4DUIA 1AP7A 3EG0A 3V30A 1OEBA 1I0CA 2EVRA 1M3BA 2A08A 4F16A 4RTZA 1AWCB 1WXUA 4Z89A 4CC3A 3TWQA 1M3AA 2LQWA 3QWXX 5ENOD 1BK2A 2CT3A 1OOTA 1GCQC 1UFFA 1JQQA 1WA7A 3AAAC 1VYTA 2K3BA 3UTMA 3M0RA 2ROLA 3PVLA 2LJ0A 2BKKB 2RPNA 2L3SA 2JT4A 2RQUA 4DX7D 2LCSA 2B86A 1N0QA 4F1PA 5IXFA 2ROTA 4AFSC 2DM1A
chains in the Genus database with same CATH superfamily
2K7AA 4DRXE 2VSYA 2A5EA 5GJWB 1GFCA 3APDA 3WVDB 1JCSA 3REAB 2GFUA 2OCCE 3M4GA 3S6WA 2QYJA 3B7RL 3ER0A 3I4RB 5JJ6A 4KBMB 4C8QC 4C92E 3SO8A 3CCLT 4PJOC 1S1NA 1K9MC 2R05A 2A36A 5EYPF 2E1HA 1AZGB 1GFDA 1KQSS 4JPSA 2QA4T 3DSSA 3NTHA 4UWGA 3EGDB 2LJ3A 1D8EA 3FUEA 4HNAD 4OMFB 2EQKA 4IUTA 2IIMA 5G2NA 3ZL7C 4X8QA 4UWHA 2BEDA 2VTBB 3CCVA 3G4ST 5GAMg 5FU6C 1BI7B 3QXEB 4HFGA 4FCYA 1EPUA 2KCVA 2VC8A 4F6RD 3ZEHA 2Y90A 1SZ9A 4RG9A 3JCMJ 1NJIU 4LNGA 2ZGWA 4M3OA 4J8FA 2JXBA 2LQ8A 2BZ8A 4DLQA 3JXIA 1SKUB 1H6OA 4E7ZA 1MX4A 3EJNA 1QCFA 2WXFA 1X43A 2A3LA 4OB1B 3TVTA 3NF1A 3JB9I 4JZ3A 4K5AB 3OYAA 2ZPIB 4B9XA 3M0QA 4XQ3A 3IXEA 4QFVA 2XKOC 4DBFA 5DM7R 1M2VB 3I5SA 3QPHA 1YJWQ 4M78A 3E9FA 1M1FA 3OTNA 3D9OA 1M90R 2KR3A 4TUUA 4FW2A 1C0MA 4OAUC 1OX8A 3EGXA 4GZCA 2FRYA 3M59A 3JB9D 2PU9B 5G04J 2KROA 3OYNA 3OYLA 3PNWC 3ZBDA 3CVNA 2H6IA 1QCOA 4KVOA 2QY7A 3ABLE 2R57A 4OGCA 2DIGA 4UWKA 2J07A 3TWRA 1UB4A 4HRLA 4EMKC 3CCQA 5C6SA 3HYMB 3AU4A 1H3HA 4E85A 1R0BG 3APFA 4N0AA 4C8QE 2LX9A 1H6KA 3MO8A 1BLXB 4M7AF 3PZDA 2V1RA 1G3NB 3LY9A 3E2UA 4PJOE 1Q81R 3MEKA 2DPPB 3LWIA 2V0PA 2WXHA 4U0UA 2M1HA 2A37A 3EFSA 3CCET 1I1JA 4BDYA 5T8IA 1MX6A 4DEYA 1OWNA 3JQ0A 3CCSA 1J3TA 4JRKA 4U7EB 2LNVA 1VOMA 3LS8A 3FC3A 4QT7A 3ZFWA 3Q78A 2ED1A 4LDVA 1VQOA 3P8DA 3QWYA 4DX1A 4LDYA 2LT4A 2YUOA 3QDNA 2CHXA 3QWWA 1YJNT 4J9CA 3NAWA 3S3MA 1Q7YU 3CCRA 2ABLA 5CBNA 4GTQA 3EHNA 3UMVA 5HK3A 1ZA1B 2AZVA 4EHMA 5DIZA 1JUQA 2F2VA 2DTOA 3ZRHA 5EC7A 2FEIA 3MKDA 5IHKA 3OW2A 1D1AA 1UJKA 2KT8A 4HOQA 1HK9A 3VS1A 1WHMA 2P0KA 3JCMh 3FUNA 3TAXA 2FG0A 4ZGEB 5GAN6 1EDUA 3O5ZA 1YBYA 2FO1E 3V2XA 1AWXA 2QTVA 2DJZA 5GMKh 3PZ2A 2GROB 3DSXA 4JHKA 3RO3A 1K9MR 4FYWB 4D8DA 1OV3A 5KCOA 1QP3A 3R9MA 4EQFA 1M27C 2KYMA 4IKFA 1VA7A 1W2BA 1TU0B 3PIPA 4AM9A 4GMJA 4JW1A 2O31A 2VGMA 5J08A 4QQDA 4C92F 4XTVA 1OU9A 2PZ1A 3CCVQ 5JA4D 1YJWT 2CKKA 2DTIA 1BI3A 1UJ0A 2HD0A 5D7UA 2VYTA 5BNWA 2L89A 3T9KA 3QSUA 2R17C 1PWTA 2CUDA 1NG2A 3D7SB 2EILE 2DEUA 2MOXA 2QTXA 4F3VA 4JB8P 2LMJA 2X4XA 3VS2A 2EJGA 4UQXA 2Y4UA 1BKBA 1Y71A 3FFLA 6AT1B 3W9GA 4BFRA 5AENA 2R5MA 5CK9A 2KRSA 2KZTB 3Q4AB 5AARA 4G26A 2ENMA 2VSNA 2DYBA 1BI0A 2O9SA 1ELWA 1V76A 4BD3A 2E0IA 4E7JA 2F5TX 4LUDA 4GYOA 4FADA 2QC9A 2AIRB 2PQNA 1GRIA 4IUQA 4E6RA 4JEHA 2IONA 1MQSA 3HL8A 1BD8A 2IF4A 2HNIA 3HVEA 4IRUA 3V8LA 3CEYA 4RTYA 1R77A 3J80E 5D0OD 4FM4B 2IJGX 3HXDA 4M7AB 4HVBA 3RKYA 4C5IA 4RMOA 3CC4A 4M4ZA 3CCQQ 2CZ1B 4QVCA 1TXQA 5KH6A 4KXKB 2ECZA 2BTDA 3EFRA 2K2VA 4DX5D 3WVEB 1PD1A 2DVWA 3MKQA 4PFPA 4M7DD 3KBGA 2K6DA 1RAFB 1ZX6A 4IIMA 3FP3A 3PZ4A 4J7FA 4Y28E 1UGQB 5LJ5e 2PQWA 1KIKA 5FQ7A 1GW6A 1S0PA 2OV8A 3AG2E 1B07A 1I07A 1RAGB 2M0OA 2YRDA 4NOYA 2HBPA 3JCMb 2RKKA 1E7OA 2CREA 2IVWA 3GLXA 4LNPA 2K5IA 3L82A 3CCSQ 4RG8A 4GZ3A 3DPYA 1IO6A 1E8WA 2HEQA 4U8YD 3DPDA 5EYLA 1QKXA 3LH5A 5CKBA 1PCXA 1RABB 5M72A 1VQOQ 4J9FA 4JS4A 3UQ3A 1K73C 4XAXB 4APOA 2FO7A 5GAN8 1HX8A 3QJ6A 3INZA 3CCRQ 3C95A 4MZTA 1N4PA 5KNHD 4HRMB 3OS2A 4OVUA 2LZ6B 3QDRB 2J05A 3JQ1A 4JS5A 4XEIG 4EZJA 4U95D 1G3YA 4UC4A 2GRQB 1QP2A 1ZBPA 3MP1A 2J6KA 5ENRD 3CPFA 3X28B 4KZ0A 3FDHA 4IYPA 3IHVA 4CDMA 3CPWP 5C1DA 3OXGA 4H7XA 1EIFA 3EIJA 2HDAA 3L2QA 3R7QA 3C12A 4ZFHA 4URKA 1NPRA 2RJEA 4HVWA 3OAWA 1QQEA 4M75G 3VYHB 1MMNA 3HRSA 3NBNB 3ASOE 8AT1B 1HH8A 4TV3A 5HS0A 3SZ7A 2OEWA 3ZEFA 2QI2A 3R7RA 4WWPA 1JPLA 3EG9B 2F37A 4Y6CA 1UEBA 4Q96A 2EYXA 1IQRA 1V54E 2XQ0A 3CVVA 3CVPA 2RNAA 4M75A 4Z8AA 3SGHA 5KYNA 3GZSA 3CHPA 1Y57A 4Y91A 4LDWA 3ZHEB 3KSLA 4PH4B 4E7KA 3AJIA 3GF5A 1K8AR 2DL5A 2X9HA 3FJ5A 2BUGA 3APCA 2COYA 3PMTA 4HLLA 4JUVA 1TNYA 2PM6A 4AJWA 3JB9J 1EX4A 4XU3A 3CMEA 2QQBA 1LVKA 5ITZF 1BU1A 3PDNA 4L59A 3GBQA 3CC2T 1FYNA 1D09B 1FVHA 1WJSA 3FEOA 1AWJA 5JJTA 2FZKB 4J6IA 2OTJT 1JXMA 2JUFA 2AK5A 3JCKC 4YVQC 8ATCB 2UY1B 4UUCA 3CHRA 5LL6S 3LY8A 4BTBA 1I4K1 4LDXA 3CHQA 3CVYA 4G1TA 4OB3B 2LNIA 1ZUYA 1WZOA 3CCST 1YITT 1M1KU 4Y92A 1UN8A 3G2SA 3QOUA 1KD1C 2X4JA 4HXIA 1JXOA 2VTBA 4J0UA 2NWMA 3PGGA 1VQOT 3FUIA 4V3IA 4TXRA 4FIBA 3CC4Q 1RLQC 3S3NA 3CBMA 3QYGB 3QWPA 1BI2A 3MKRA 1Y7XA 3RMQA 4QKUA 2X6JA 2D9TA 2VWFA 3LGFA 3CCRT 1NM7A 4C5HA 4M7DC 4E47A 1N5ZA 3PUJA 2LSUA 4CZ2D 2YXYA 1TEZA 4KUIA 3QKJA 4MZPA 2E41A 1K0SA 3X2QE 1KFZA 4GBQA 4R55A 2V4HC 1DJ7B 3CSTA 2WSCE 3V8JA 2DZNA 1QVPA 2DWZA 1UE9A 1G5VA 5KJKA 1K1AA 2ETCA 4FSXA 4J9DA 1N54A 1KZPA 2FB7A 2RF0A 2F0YA 2QK0A 2EBPA 2DVEA 3OYDA 3ZYLA 5GANd 4IUPA 1M2VA 3FTXA 3TQ7P 1BIBA 2Y1LE 3A8LB 2B0OE 4ANWA 1QWFA 2FZCB 2R59A 1K1ZA 2EYWA 1U1TA 2DJQA 1SSFA 5EILA 3T8KA 4JVSA 1JJ2S 1K73R 2KDSA 4KYOB 3Q47B 1S64A 1A5EA 1QMCA 5AQBA 2WSEE 1KQ1A 4FL6A 1X2KA 1GL5A 5FU6B 4I17A 4CYMD 5LX8A 4XTWA 2YNQA 1IXDA 4XI9A 2E4HA 1H2VC 5FZRA 5BV0A 3ESKA 4JLIA 1VQKT 3FTVA 3FTSA 4GA1A 2V4LA 3OS5A 3LH0A 5FWBA 3PRZA 4HCKA 5EG2A 4PS7A 1K9AA 1TNBA 2NUPA 2YQ8A 4K5BA 2DXBA 3VYGA 1TN6A 2L9BA 1H2UA 1DCQA 2LRQA 2Y69E 2WMNA 1G3TA 1PNJA 4U96D 3LVRE 2ZGDA 1WYXA 1YMPA 1O5MA 3CCLA 4FYXB 2LCLA 5CMWA 1KC8U 2QA4A 3VS6A 3CBOA 2DAQA 2XEHA 3UA7A 2MRIA 1M3CA 3R6OA 1IHWA 3A8GB 2KGTA 2EWNA 3DSUA 4JL0A 4C0DB 2CFUA 5J26A 1XTDA 1U2VG 1WDYA 2JNGA 3M55A 1UHFA 3PEUB 3TCJA 1ZBXA 2Z0WA 4F14A 2KRNA 1Y6IA 3FU6A 4GTRA 3G4SA 4XIFA 1ARKA 3P1UA 3ASGA 1N52A 2IEJA 2IY0C 4XKCA 5CQYA 5LJ5f 4M7DE 5KWDA 2RO0A 5GMKj 3BFMA 3IQLA 5CVIA 3CMEQ 2ONDA 3D9IA 2CP5A 3CC4T 1H0AA 1FMWA 4PS8A 2I6HA 2LO6A 4PUCA 4UWFA 1L5JA 1K3ZD 2HO1A 5J90A 3EG1A 2OTLT 1U1SA 2RQVA 2GFAA 2FBNA 2EYQA 2RN8A 3LDZA 3NFCA 4NL3A 4F53A 2WMOA 2OX7A 2LQWA 1M3AA 1H2TC 2ILRA 3LX7A 4QVZA 1IGUA 3ZW3A 1GCQC 4ILGA 1UFFA 5GAOq 4JJNK 1PSFA 1WA7A 3AAAC 4GTPA 3PVLA 4MKTA 2LJ0A 2DXTA 2BKKB 4JHRA 4ZTJA 1KG1A 3OA6A 1N94A 2I9CA 4AFSC 4J8EA 1IHVA 1F1BB 4B89A 3HP9A 4N4GA 3P8BB 2BZYA 4XTUA 4E2FB 3JCMW 5KCMA 4GZ6A 3HXEA 2AXUA 2P58C 4GA0A 4EECA 1M2OA 3LVQE 4JRIA 9ATCB 3RO2A 3RAUA 4HVVA 5FWQA 5T4YA 1VQ4T 4E6HA 2JN0A 1NP7A 3NTKA 4A54A 4WF2A 4QVDA 4N3CA 2XEVA 4RTWA 3DKMA 1VQ5Q 3CCEA 4K11A 2KZTA 2XPYA 3HHMA 1V29B 4GYWA 2E3IA 4JRQA 3IEGA 3LW5E 4XTXA 4A53A 1WJRA 3TWVA 4FYVB 2JTMA 1RI0A 4A4EA 5IHNA 1NI1A 4LNBA 2V8KA 3L17A 2DBMA 3FEYA 2O4XB 3H8ZA 2DILA 1YJNA 2PNNA 3QAQA 1PD0A 2L0TB 4LNUD 1R8OB 1LCKA 2DYIA 4HOTA 3OXLA 4F1SA 3QJYA 2LXLA 4BY6C 3ZGQA 2ZPBB 3L1AA 3PVQA 5E76A 2ZU6B 2WXRA 4BERA 4DJAA 2V26A 2XMFA 4KMOA 2WXNA 3FULA 3FU3A 2Y3AA 3ZXSA 4F7AA 2DL7A 3WXXA 3CCLQ 2KQWA 1X6BA 3CMET 2QZAA 4NURA 1H8KA 7AT1B 4HB5A 5A0LA 2HYZA 3U9WA 3AS4A 2RQRA 2QA4Q 3RESA 1ACMB 1YWPA 4DI3A 4GLKA 4O60A 1YYHA 1X5BA 3AU5A 3CCMT 2A4ZA 4HRNA 1QW1A 1K1BA 4LEUA 1OXJA 1G8XA 3LJNA 2IG0A 4Z02A 2FRWA 1G2BA 4M78D 2DE0X 4I9CA 1E6GA 4FJZA 2PUOB 2EQMA 4YVOA 4A1SA 1FCHA 1X69A 3G4SQ 2C06A 4C92G 2CHZA 4IN3B 1JO8A 3M0SA 1QLYA 4QQIA 2ATCB 2QDYB 2RK1A 4XTYA 3FTUA 3NPFA 1Y0MA 4AOFA 2QDLA 1CSKA 2YLCA 2NSZA 1OUVA 1LD7A 3NHNA 3QHSA 5CCMA 2WXKA 3JCMX 2J08A 4C92A 4CGVA 4CT0A 2HL5C 3KSQA 5A2QE 3Q5MA 3DB4A 4K5CA 3B7SA 3LY7A 5GMKl 2ZZDA 2COWA 2NUTB 3CCJA 4BT8A 5LJ3f 2QXFA 3OSVA 5G04C 2KC7A 4GTSA 1VQ8T 4PJJA 3OW2S 2VASA 2EGEA 1PRMC 1VYVA 4GY5A 2GRMA 3UXGA 2YWWA 4EBAG 3ASKA 4AFQC 2ZAEA 4ANXA 1TN8A 3ASNE 3I55T 4ME7A 3OBWA 1FXXA 4W9RA 2GNCA 1NPPA 1HXIA 4A4FA 4RQIA 2DYSE 4J8YA 2DETA 5FU7C 4EBAA 3CCEQ 1KLXA 3ONLA 4B0ZA 1SW6A 1N95A 2RJCA 4DPRA 1ZSZC 2DA9A 2QQRA 2RG8A 3ZYQA 5GANe 5GAN5 1K8KG 3FTYA 4AY6A 2UY1A 4MMKA 4U0ZA 3RUXA 4MRUA 4M77D 1HSQA 3BG0B 2JEKA 1D9SA 3L08A 5HCKA 3LXUX 1FMVA 4C8QG 1YJNQ 1IKND 1B3QA 5LJ3j 3PE3A 5AQ9A 4PJOG 3Q9UC 4FJYA 1KQ2A 3T5XA 3ZN3A 2PTKA 5LJ5g 3VRYA 1AZEA 2OI3A 2H6HA 4TXQA 4DX2A 4C5GA 2C0TA 5FINA 3IHYA 3ESLA 3VTYA 2XG8D 1NJIR 1O1SA 3CV0A 3DB3A 2O9VA 1WXBA 2KNBB 4OGEA 4C8QA 5KYWB 2AVPA 2Y0BG 1N4SA 3ABME 1HF8A 2XDDA 4PJOA 2ZIRA 1TUCA 2OTLQ 3KEZA 4I6GA 3X25B 3DXMG 4O6JA 2ZPFB 2K3YA 4GCNA 2X3WD 1VQMT 5FRMA 5HI7A 4BETA 4I1AA 3J81E 4J7WA 1WHHA 1OU8A 4HBDA 2VGYA 2C0IA 2WPVA 4EZKA 4C0EA 4LERA 2EJFA 2OAWA 5I22A 2L2PA 1E8XA 3MJWA 1NYFA 2QFCA 5KCHA 1E7UA 3UX4A 3U3WA 2O01E 2YHCA 4F7UF 2DRMA 3OYFA 4YDYA 2W10A 2ZPGB 2HZYA 4AMCA 1N9SA 4J83A 4HA8A 2P0QA 1O75A 4YTLA 5BW8C 2BZXA 2RM4A 4FA6A 3T5VA 5GAOn 3OXFA 3FTWA 4RSYA 3EFOA 2EW3A 1FPPA 3N5BB 2AW6A 2JLBA 5KJNA 3QUIA 1U3CA 3MJXA 2NUPB 2C0OA 1JJ2P 1UW4B 3CC2A 3ULQA 2XDPA 2DF6A 3UM3A 3CCJQ 1WHLA 3ULEG 2IFUA 2JMAA 2OTJA 4FW1A 3E34A 3CCUT 1MMDA 1ZQ1A 3TEEA 3PMIA 4FU6A 3CHOA 2FO0A 3QYHB 2JABA 2XGSA 3MGBA 2L3RA 1YITA 3HTRA 3PFSA 2RK2A 2ZPHB 4PK4A 3JCMV 2GCXA 4NL2A 3CPWA 2ZXWE 3SEMA 1M1GA 5J39A 3DLMA 3JCMP 1Q7YR 1PKTA 5KYXB 4EMKA 4TUMA 3QBYA 3I5RA 2OEVA 5LJ3d 1ABQA 1A17A 2DD4A 5EDSA 1QVFP 2DD5A 4AG2C 5GAOr 5ANRA 4PJLA 1SVXA 3ZIMA 3QG1A 1KSWA 3EAEA 4PS3A 3C0CA 4JZ4A 4G23A 5ENTD 1AWWA 1GBQA 1YNZA 4E7IA 1KPSB 1HJDA 2X3MA 4M77C 4E7LA 3ZUVB 3Q75A 4M78E 2XK0A 1BB9A 1UECA 3CHMA 1M9SA 2QASA 3GPLA 2E2EA 2X35A 1JCQA 4BSZB 2P2CP 2ETAA 3VKIA 3N71A 2K57A 3VTXA 1VDYA 4J9IA 3ZFJA 4KUDK 1YP5A 1UN9A 1I5OB 3BG1B 2M16A 2DZCA 2HL3A 3M58A 3TG5A 4CT4A 4CEMA 1M8MA 1UGRB 2CDTA 1VQKA 4HT8A 4M75D 5D6YA 3SBTB 3KS2A 2PVDB 2WQ7A 5GJVB 2R58A 4AP2A 4JDSA 2CSQA 2L0AA 5CQXA 4O1OA 3CQCB 3PZ1A 5IT9E 2DO3A 1AEYA 5GMKe 2RFAA 3TGOA 1WHGA 3RDVA 3M9QA 4F7UB 2H6FA 5LJ3g 1S70B 1E6HA 4EDUA 2CSIA 5A7DB 1TTHB 2KXDA 2LQKA 2H6GA 4RTTA 1TNZA 4UI9K 3DLLA 5D6XA 3CCJT 2BE7D 1YN8A 1ZBJA 1M1KC 5L23A 2O4XA 2GRPB 3C94A 3TXNA 1ZU2A 3T8MA 3B13A 2LTOA 3EU5A 5IH2A 5FLXE 1ABOA 3RK6A 2EIJE 1JRIA 3MP6A 2RD1A 2GRLA 1NL4A 1HO8A 4UI9J 1JBMA 4TRQA 5DLOA 1MHNA 2H3JA 4GYYA 2KYBA 3NB2A 3UKUG 2L8DA 3GNFB 3VJPA 1OQKA 5BXUA 1YFNA 5GANf 3JB9G 2E6NA 2HSEB 1HFAA 3E33A 4OMMA 3MEAA 3PUKA 2SEMA 3LGLA 3CC2Q 2XRYA 2EGCA 2KATA 5LJ5h 3VLDA 2OTLA 2X6KA 3FH7A 5LFAA 4ILHB 2X6IA 1EFNA 2OTJQ 4KT0E 1IZ6A 4M77E 4I2ZA 4U04A 1SSHA 2CHWA 1NA0A 2K5FA 2RD0A 2DRKA 5DLQE 3T9NA 2CH4A 1WQWA 4DOWA 4MMLA 2MMPA 4DK5A 1CKBA 1YITQ 3D9JA 2R5SA 4KH1B 3MV3B 2XIDA 4Z88A 2WM9A 3PZ3A 1OPLA 4EIKA 5I2MA 3SQVA 5JHAA 4C8QF 2O2OA 4G11A 1PHTA 4PJOF 4IUVA 4NQ0A 1WDXA 2OJ2A 3META 4TVRA 1YHQA 5HY6A 1OWPA 5D66A 1KT1A 3L42A 2GBQA 1CKAA 3TWSA 2RJFA 1YJ9A 3TWWA 1WHJA 4ATOA 2XS1A 2G3RA 4IULA 4KVMA 3I9QA 4L5GA 3VRZA 3OYIA 2COZA 2CYZB 3OS1A 4GCOA 2CP6A 3NTIA 1BPOA 4BWRA 4RTUA 3LLRA 2LCCA 2DYRE 5GANj 1VQ4A 1UJJA 3GP8A 1NA3A 4G24A 2QEXA 1ZA2B 3CK8A 2NUTA 3J5PA 3CXCA 2XCCA 3LYAA 1PSEA 1KC8C 5KJMA 5CKFA 1RACB 3B7BA 4C92B 4AY5A 2B6CA 4RUGA 1WX6A 3FUKA 3G2VA 3GOXA 4GPMA 4NACA 4JJCA 2JMCA 4WTOB 5I21A 2DFUA 1Z9ZA 2HKQB 4J6WA 4FU3A 4F04B 5FJYA 1H92A 1RUWA 1VQKQ 2CZ7B 2XZTG 4OMLA 4JJBA 2RB6A 2CP0A 5C2YA 4VUBA 3V7RA 2KI7A 1WXTA 4LUEA 3RKWA 3OY9A 3CLJA 3S7JA 1N8RU 1AP7A 3V30A 1BIAA 3E19A 2A08A 1TUGB 4WUYA 4RTZA 3O8VA 3RSEG 4ANVA 1WXUA 3TWQA 4Z89A 5IAYA 3OW2P 5ENOD 2CT3A 2OVBA 1OOTA 5B1AE 3LJ3A 1SG5A 5B1BE 1JQQA 1VYTA 2K3BA 3FIFA 1OCRE 1PC2A 4RKUE 4RG2A 2RPNA 3CK7A 2JT4A 2L3SA 2RH2A 2RQUA 4YDOA 4A4GA 4DX7D 3CCMA 1N0QA 2P9NG 4F1PA 2V8JA 2HQEA 4HOSA 1OWOA 1E8ZA 1S72T 2JW4A 4HLEA 1M1KR 2F8XK 3C3QA 3HXCA 4FHJA 1V55E 2RFMA 5CRUA 3R9AB 4J9EA 1VQ7T 3FUDA 3ONKA 3M57A 1VQLA 1WHKA 2RI5A 3EG2A 2DKGA 2HR2A 3U64A 2CP2A 1N27A 5KYWA 2E10A 3SBSA 3ASDA 3GZ1A 5CBOA 2CFZA 3FEXA 3FRNA 5CIUA 5HKCA 2RMOA 5FU7B 3SWNC 1KQSP 3OQ5A 3O48A 1D1BA 3QNKA 3EU9A 1HYOA 1ZSZB 1M5Q1 4MDWA 2FPDA 4FHKA 1VQ6A 4DQ2A 4C8QB 5KYYB 3A5ZB 4M7DG 3FHEA 3BE3A 1JU5C 1T0HA 3EHMA 4PJOB 4ME2A 5LOZA 5CEDB 4WNDA 4I6EA 2A7YA 3UT8A 4HT9A 1NEGA 5GAOm 1VQ8A 4BT9A 5LCWC 1Z3YA 2AWIA 3PH0C 2FPFA 5A6CA 4YNDA 4XK8E 1PKSA 4M75E 4WNFA 1QNFA 1YHQQ 4LDUA 5I2SA 2VGXB 4O5VA 3KXTA 3Q7FA 3TWTA 4OF1A 1QVGA 3IV0A 2FPEA 4M7DA 1N4QA 3BDUA 1YJ9Q 4M7AD 2YHEA 2I2LA 5LJ3e 1Y8MA 3I55A 3BW1A 4ZNXA 1K76A 2CZ6B 3CVQA 4L2LA 3V7SA 4CDRA 5CEAA 1VYUA 2JS2A 3FWVA 5FZQA 1VQ4Q 1PY1A 1UGSB 2QEXQ 2PM7A 2D0NA 3VS5A 3VUZA 3EFOB 2KY9A 1EYHA 2DL4A 2DIWA 2X3XD 3WG7E 3I4GA 3HPWA 2P9PG 5I11A 4AEZC 2HKNA 3EH2A 3SB2A 2DZOA 3LCAA 4I1MA 3JCMc 4ZTFA 4B9WA 1KC8R 2YLBA 2WVIA 4F17A 4UWLA 2J49A 2A0FB 3NZUA 1D0YA 2JVVA 3EDTB 2NLUA 4ZHBA 5EIBE 3NMZC 3OYMA 4E7SA 2MWOA 1WPYA 3QDFA 3ZXPA 5KYXA 3G71T 2C0LA 4U8HA 4JRPA 4FP7A 2XENA 5CKHA 5GANg 4CRWA 1LPLA 2MCNA 3MP8A 3G2WA 2LP5A 3IBEA 3OBYA 2RQTA 4EMKB 3JB9F 3TJPA 1KZOA 2KE9A 1G3SA 2DL3A 1LJOA 2GTJA 4ANJA 4XX5A 2QGGA 3U66A 2BIVA 3CCMQ 3SFZA 1VQMA 1KHIA 3VV0A 3SNXA 2D8HA 2CUBA 2BKGA 4OVVA 1V1CA 2SRCA 2FZGB 1OCOE 1EZZB 4OMQA 5D6WA 2V5FA 4BB7A 1QZ2A 2F8YA 1P92A 5KYUB 5EKQD 2WXOA 2W0ZA 1JCRA 1RAIB 1VQLQ 4HCCA 3UDCA 4HOUA 3OYCA 1H641 4BDZA 5FIOA 4F7UG 1ELKA 4DBHA 1VQNT 1I8FA 1ZHIA 3CGHA 4WWNA 3H0IA 1KD1R 2LNHB 4XU0A 2FYKA 2XCBA 5FQ6A 1YHQT 4M7CA 2RHUA 5LCWJ 2DLPA 4QW2A 5CCLA 4PKCC 4B6MA 1AOJA 1YJ9T 2CP7A 4Q94A 4XU1A 3Q1JA 1VQ6Q 3CKBA 5JHBA 4B93B 2PVGB 2J8SD 2GF7A 3UT1A 2VUBA 4LG6A 3V8KA 3G7ZA 1IXVA 4F7UA 5FW9A 4GZDA 2JS0A 1GCQA 2LT1A 1OCZE 1Z9QA 3SD4A 1NYGA 2QEXT 1X6GA 4ELYC 3RRMB 4XU2A 1VQ8Q 3E4BA 3V79K 2VKNA 3CCUA 5JJ7A 1QKWA 1W6XA 2FF4A 4OYSA 1Q86C 1H6PA 4L7TA 3SFYA 1E96B 2MPXC 3HRTA 5G05J 3TL5A 2WXQA 3B95A 3RMSA 2UWJG 3EH1A 3X20B 2KM4A 4QQ6A 3I55Q 4M7AC 3FB9A 3M5AA 2GQIA 2OVFA 1RADB 2KK4A 4OB0B 5IHIA 1NBEB 4EPCA 4HXJA 1JB0E 5GAMj 3VS0A 3PNLB 3ZNGA 3UI2A 3SD5A 3DSTA 2C2LA 4GTMA 5DY9A 3EGUA 2RJDA 1N6AA 2KXPC 1HS6A 1TG0A 1W4SA 4E7HA 3HRAA 3TG4A 3L2UA 3JCMd 4CRIA 3ISMC 1WY6A 1TR4A 1TYQG 3HDXA 2M63A 4TXPA 2YHTA 4V2SA 2X6HA 3JRZA 2XS8A 5FWCA 3OYGA 5ENQD 1TUDA 2XZDG 2XGOA 3AT1B 3ZYKA 2JOYA 4U07A 4H7YA 2GGRA 5ARFA 4DBRA 2XU8A 1IHBA 4XI0A 1Q82U 2WQHA 1BI8B 5IY5E 5KBAA 3PE0A 1UG1A 4KZCA 2DX1A 2HAXA 1IHGA 1UOHA 5AIJA 5EX0A 3SF4A 1I81A 4JA9A 2HE0A 3C3RA 3J5QB 3H41A 4LUNU 4GMRA 2WXGA 4CC4B 1VQLT 4N5CA 3M0PA 5AQ7A 3S7BA 2VB6A 3TWXA 4N4IA 2MI6A 4ORZA 2NXPA 3D9NA 4LN2A 4ACKA 2EYYA 2LDMA 4ZGDB 2XPIA 4AIFA 1VQMQ 3MHXA 1WGSA 3OMGA 5AAOA 4L9PA 1IRXA 4M7DF 2H8HA 2WXLA 1VQ6T 1NZ9A 3URGA 3MZLB 3SFXA 1D0ZA 4I2WA 2V1QA 4N4HA 4ELZC 2EKOA 3C72A 3A8OB 2J9QA 3UA6A 1OCCE 3JCMg 3D9PA 4DBQA 3HFNA 4PNOA 2X6FA 2VQ2A 2EKHA 4IIOA 4BTAA 1BCOA 5ARGA 4BE1A 4M7AE 3E30A 3GIBA 1VQ9A 3Q15A 1O1TA 3I56A 4AVXA 1R0CB 2QG9B 1MZCA 1QVFA 2EPDA 2YDLA 2FEZA 3MEWA 2H3EB 4DI4A 1AVZC 2L3PA 2IO2C 3FTZA 2L5QA 3L13A 3UIPC 1D0XA 2LQNA 3FY4A 1U3DA 1INZA 3UUXA 2X4YA 2RA2A 1MNDA 4X9DA 5AYFA 4G2VA 4GB9A 5GAMd 5ENPD 2RHXA 1W2BS 1TJFA 3GZ2A 1W3BA 2YINA 1BCMA 2EAYA 5GAMh 3MA5A 3CCUQ 3O4ZA 2XHEA 2R02A 2KAFA 3QB2A 3DEOA 4I9EA 1DC2A 3KAEA 3MYVA 4U8VD 1XNFA 3DBSA 1OZ3A 4R7LA 2XD0A 2L0IA 1NE8A 2JZ2A 2KCLA 4HCZA 5L8RE 5G55A 3DSVA 3URZA 4OMPA 4N3BA 1RAEB 4GLMA 1Q86U 1DCEA 3B7TA 3F6QA 3HKSA 2XHCA 4X34A 1AT1B 4BI4A 5T3RA 2PL2A 2L3QA 2QAZA 4ZN3A 2EINE 1FT1A 2A5UA 1N9RA 2E12A 1TH7A 5AN8A 1D3BB 5CKEA 3G2UA 4C0GA 3D9HA 3VLFA 1ZSZA 4IURA 4OMOA 2IQCA 1U5SA 2J7IA 3QARA 5KYYA 3G6ET 3BU8A 2BF0X 2DVJA 1YA0A 4PJMA 2M0YA 3G1JA 3DWLG 3QK0A 1PAQA 3L2ZA 3H0HA 1A0NB 3U23A 3S7FA 2QQAA 1UGPB 1X2QA 1T0JA 2MAMA 5IN1A 1QYMA 3QC1A 3PS6A 1SHGA 3Q79A 3GYZA 3ME9A 5FT9A 2VJ8A 3D9KA 3ZU7B 2PNIA 4M78C 1HG2A 2VGXA 1ZB1A 2MWPA 3VU3C 3OYYA 2YUPA 2JM8A 3ASHA 3RJVA 1HZ4A 1QCNA 2CG3A 3CQTA 1NFIE 3D9MA 4J7IA 1EF1C 4M78G 4PLLA 5GAN2 3OB9A 4I6JA 1KT0A 2YRVA 5HQ8A 2KBXA 2J6OA 4M7DB 4EZLA 4YDEA 2DL8A 3SWNB 5FTPA 3F70A 2E5QA 3S7DA 3CHSA 3ULYA 4C0MA 1H19A 3UM2A 5ENNA 3HIZA 4BX9A 2E3HA 4N0AC 4P5NA 3RIRA 2EIFA 3CK9A 2Y4TA 2YT6A 2V8SE 3KFVA 2WXPA 1HXDA 4KRTA 2DBAA 2MIOA 4MBGA 1DNPA 1IYGA 4XKBA 1WQ7A 4LD9K 1TJCA 3JCMQ 4IUUA 1TS9A 3ML9A 4ESRA 3CMAT 4HS2A 1IREB 2E6ZA 2AJAA 2HMAA 4C48B 4C0DC 1M90U 4GA2A 4UI9C 5E75A 1RL2A 2F2XA 1VQ9Q 4WNGA 1S72A 3I56Q 5EN5D 1D8DA 3X26B 3J7AF 4MDXA 3B7UX 2BTTA 5CKDA 1K4US 4Y6WA 3MEVA 3RRNB 3CSFA 2ED0A 2X4WA 2QQSA 3JAME 4A55A 1VQ7A 3HHTB 3CVUA 3PE4A 1D1CA 1M30A 1QBQA 2Q7FA 3CXCS 1RLPC 2AKLA 3SY2A 4J6XA 5HKPA 4A63B 5FQ4A 1WI7A 1QWEA 1OWMA 3L2VA 3E32A 3GW4A 1FMKA 2XPZA 3AG1E 5AQAA 2LAIA 1UDLA 2E64A 2HQHA 1QQJA 1WNLA 3UWNA 4DA4A 3S3OA 1Q81U 1KHCA 1TOVA 4A3VA 4HQDA 1B34B 2G6FX 4OP0A 2WXJA 2JTEA 1TNUA 3S2AA 1MYOA 1OT8A 1IGQA 1SRMA 2K4YA 2VV5A 5J3BA 2PUKB 3DSWA 4BI3A 1XJWB 2I0NA 1JEGA 4FT4A 2F69A 3JXJA 2QQ9A 2YUQA 3REBB 2CH4W 5KYUA 2CP3A 4C9BB 3MCXA 2VSXE 4AXHA 3UKRG 4DX6D 1PC0A 1RAAB 2J4BA 4M77G 4DUIA 2NC9A 1P5QA 3LYIA 2IOLA 1SF9A 1I0CA 2EVRA 3FH5A 1M3BA 4F16A 1AWCB 4RVBA 3M54A 2F5KA 3M56A 4CC3A 1KK7A 3UM0A 3C4SA 4JA7A 1N8RC 1FVFA 3CVWA 2E65A 1MHQA 3FU0A 2D6FA 3BY7A 3M0RA 3UTMA 1TWBA 2ROLA 3JCMe 3ML8A 2ZISA 5B3SE 4HKEA 3ZPJA 1OULA 1HE8A 3AS8A 3RKVA 4J8SA 2EIKE 2LCSA 2B86A 4M77A 2ROTA 4CDNA 5A0DA 2DM1A 4FYYB 1K9MU 2J6FA 2P9LG 3FH8A 4FULA 1IQUA 1TNOA 4UQZA 3SHWA 4A4KA 2DMOA 2K79A 2RHZA 2K2MA 3UF4A 3VS7A 4PFZA 1FT2A 3JV3A 3A8MB 1K8AC 2XICA 1OWLA 2FL7A 2JTFA 4X9CA 4JHJA 1MMGA 4A4HA 4AT1B 2CS7A 1XOVA 1KQSA 3G71A 4WNEA 1VQ9T 3I56T 2KMTA 4XE0A 3LPZA 4N39A 3E9GA 4NS5A 4JZYA 4I1OB 5EX3A 4GPKA 3H6ZA 1SZAA 5AJLA 1W1FA 3LKUA 1E8YA 3M53A 2ESWA 2DZ9A 3AS5A 3D9LA 4JC8A 2RI2A 1YCYA 4LXCA 3AG4E 3UINC 2J4DA 1ZLMA 3QZ5B 4A1GA 1QVGS 2D0QB 3QO3A 4KULA 3FJPA 2DTHA 5A0GA 4X1VA 3PREA 1UUEA 1S72Q 2RQWA 1Z3XA 5M9OA 3DEPA 1MV3A 2YUNA 1LTXA 1VQ7Q 2WB2A 1OX9A 2EGAA 5CERB 2P9SG 3KUFA 4BI8B 5BUZA 2VXEA 2ZGGA 4L2YA 3PIOA 1WJQA 3BUAA 4KBQA 3RRUA 4B94A 4BSXA 4PLIA 1VQNA 1O1RA 1X6OA 4U63A 2EQIA 3C98A 4J5YA 1W70A 2VVKA 3VLEA 4ATGA 4BY6B 1UGVA 1MNEA 1M4ZA 1M8VA 2QGFB 1SA5A 4GMLA 1AWOA 1XGWA 5GAMe 5GAOp 4J9BA 3I5PA 4B8AA 4BX8A 4HVUA 5ENSD 4BEPA 2KEAA 3CKCA 2Y4YA 3MX3A 2FHDA 1C1AA 3CR3A 2LC4A 2D1XA 4PJNA 1N4RA 3A8HB 1RI9A 3I3NA 4BUGA 5KE2A 1OPKA 1Y96B 3P8HA 4U0SA 2VYIA 3P2BA 4OAVB 4MLPA 4L1BA 4LE9A 3CBPA 1WLPB 4J9GA 1LOJA 2EIME 1GBRA 3CCVT 2KSSA 1MX2A 1MV0B 1YIJA 1HG5A 1MJ0A 3JYSA 2MK5A 3MEUA 1WAO1 2HSPA 2LXMA 4CCAA 4M75C 2I1KA 2GTOA 4M78F 4RCBA 2PZIA 4AFZC 3EHRA 1N8RR 2IOSA 4R56A 3JB9H 4PFOA 1MMAA 3D3MA 4FLBA 2K5LA 4YDWA 1N9AA 4LD6A 2KRMA 4JLGA 3CEQA 1TN7A 2M02A 1LNXA 2KCKA 2WACA 3EG3A 2C0MA 4GTTA 4N3AA 4Q5WA 5CO7A 5CMYA 1OI1A 3M0UA 2DK3A 4CC2A 2DIQA 4XTZA 3HXBA 1SEMA 5BPPA 3C3OA 2LSVA 5EIDA 3OSSC 3UATA 3AHUA 5GAN3 1BBZA 4FLHA 3NGPA 4OVAA 2AKKA 5CAIA 3G71Q 3CD6A 2CG2A 1TSFA 4Z68A 1ZUUA 4DEXA 4D10C 2ZPEB 3NOGD 2R2LA 4RCCA 1W2BP 3RIBA 2MF2A 3G2TA 1K8AU 2DXUA 2O88A 3HSBA 3RNJA 1D3BA 4G8KA 3CCQT 4RTVA 2R03A 1K0XA 4LRZA 1SPKA 2DBKA 3HFOA 3JSCA 2BKDN 4J9HA 5FRNA 2VXFA 5DBKA 1SHFA 1SQMA 1B7TA 3A1PA 4AFUC 3EGDA 2AXZA 3UM1A 1SRLA 4FSSA 2PQRA 2EQUA 1X75C 2EFIA 3FLGA 1BI1A 4JXTA 3FUJA 1Q95G 1S63A 3I35A 1N0RA 3TSZA 3K9IA 3CVLA 3EHQA 1UG3A 3FUFA 4GTVA 4JD2G 4PDXA 1Y07A 4KGZB 3RERA 5H7PA 4BESA 4O6FA 1VQNQ 1OY3D 3JCMf 4M77F 1YWOA 1JWGA 2B8AA 3OYBA 2M9UA 1NZNA 3AG3E 5LJ3h 2P4TA 4K03A 2A28A 2CT4A 5GAN4 1RZ4A 3SWNA 3RBBB 2XEEA 4FC8A 3TXMA 2OOEA 2LX7A 3H0FA 5AT1B 1X81A 1G83A 4BE2A 2AZSA 2K3XA 4J6YA 2VGEA 3QWVA 1WM5A 1FWZA 4GZ5A 2M51A 4FT2A 1YI2A 2AXVA 1B89A 5CECB 3VS3A 4RTXA 1VQ5A 2PVOB 4N2QA 3NOCD 3PTAA 5G05C 5JMND 3RR6A 4AV7A 1NLPC 1T3SA 3BQOA 3SHFA 2HBWA 3ENEA 3SDZA 3C5RA 2F1LA 3CC7A 2XGMA 1VQPA 2RHYA 1K73U 3Q49B 1IB8A 4M78B 1Q82C 3WXMB 2KXCA 2XI9A 4C5EA 2LAHA 5D2MC 4OB2B 1YIJQ 3UPUA 2F2WA 2QYZA 3EGXB 4UQYA 2EQXA 3Q7AA 4K0RA 2FVUA 3FU5A 4J8OA 5AYWD 2HQXA 4ZGJB 1N11A 2GW1A 2Y4XA 1OZ2A 3TSWA 3V7CA 4CGWA 1AHJB 2FI7A 1B34A 1E90A 3U4TA 3G6EA 1X01A 1NLOC 4QQGA 2X38A 3KEAA 1PM3A 1HU3A 1QVFS 4KGVB 4C92D 3UPVA 3Q73A 3RU0A 1E7VA 1UTIA 3CXCP 3JUEA 5CRVA 4WAFA 3W9FA 4HCBA 3CD6Q 4APFA 3Q9NC 2BUDA 2E70A 5GAOl 4KT6B 1U06A 3MCAB 4EMHA 4LCTA 4JJDA 3L22A 3HRUA 2DEQA 2IPOB 2GQVA 5GAMf 5GAN7 2WQ6A 3BDLA 2V5QC 1AD5A 4ZN1A 5D0QD 4O1PA 2DERA 1LF8A 3QIIA 4AG1C 4A3TA 2BE9B 1WG0A 4B8CB 4JEUA 4MS6A 1GXIE 3PNTB 3QZ9B 4II1A 2VSOE 4NRHB 3LWHA 4I43A 4L23A 2EYZA 1H3ZA 3MPUB 2CZ0B 1O9SA 4ACLA 2QYUA 2DNUA 2DXCA 4PL6A 4HI9A 3L2WA 4DOVA 2YSQA 1U3OA 2HCKA 1BYMA 4M77B 3M4YA 3CMAA 2HM8A 3THKA 2MHKA 4N2SA 1XNIA 1KD1U 3DXKG 1VIEA 2LVMA 5FQ8A 4EMGA 5C0MA 4D6WA 4ILIA 3ASFA 3E1SA 1Z5SC 4RG6A 3UT7A 4MZMA 3FDRA 5BV1A 5GMKi 4Q69A 1KJWA 1YIJT 5LJ5j 3SFMA 4GU5A 5KE3A 1RAHB 1I5LA 5HK0A 4GTOA 1U8RA 5BXOA 3TU4K 2P9UG 1WFWA 1YI2Q 3SI5A 4ABNA 2OAUA 2ZCFB 2MYOA 4D8KA 4LSZE 5CCAA 4L6V5 4M7AG 3GNGA 1Q2ZA 2YRCA 3A98A 1JWFA 3UT4A 4M75F 5GMKm 1ZSGA 1GCPA 2J09A 2MYSA 1X27A 2GRNB 4C8QD 2RI3A 3RKXA 2VGNA 3CC7Q 1MUZA 4PJOD 4G8LA 1MGQA 2DCPA 1VQPQ 4J8DA 1T3LA 2XDBA 4KGXB 2KT1A 5AJDA 3CIAA 2V8IA 4C0FA 3ZVVA 4N5QA 3ZKJA 2GRRB 3FUHA 4M7AA 5IXBA 4ANUA 2JJ9A 3L6AA 4KH0B 1Q82R 1FX7A 3MV2B 3UIOC 2JM9A 2LUHA 1NJIC 3OYJA 2X51A 3HVEB 3CD6T 4OMNA 1VIFA 4BE0A 3OYKA 1QVGP 5FZSA 4BY6A 3M0TA 4RLYA 1WIEA 2E5KA 3V2OA 2NYSA 2LJ1A 3HG0D 3IKOB 1JJ2A 2L6JA 4HI8A 3MKQB 3QKYA 2J06A 3QJZA 1RW2A 3G6EQ 3L9TA 2KVQG 1XQHA 2L6BA 4F7UE 3ABKE 3OYEA 2ETBA 3H9NA 2P4RA 1YCSB 5HRYA 2I1JA 5KNGA 2GGFA 2IU1A 4C92C 4JPBW 3ULRB 3BEEA 3VUBA 2K9GA 3L2RA 1M90C 3CPWS 1Y96A 3TWUA 5LP0A 5A23A 1ZUKA 4R0KA 3OS0A 2MOWA 4NIKA 2NYJA 4ATZD 5ECAA 4GAAA 1YJWA 2P9KG 4BACA 1ELRA 1PG5B 2P9IG 4C0ZA 2R5AA 1BU9A 3HXFA 1HD3A 2RHIA 2XRZA 3ZYMA 2NUZA 3OMCA 3CVXA 3JUIA 3VS4A 4CC7A 3KD7A 4EPZA 1SA4A 1PRLC 1UJYA 1LD8A 5CR2A 4WCIA 3PEVB 1C6VX 5KJLA 2D8JA 3TREA 3EIQC 1Q81C 3CQGB 1NEBA 1UHCA 2EJ9A 3LEWA 4HORA 5LJ5d 3X24B 2WXIA 3NQPA 1YI2T 3EG9A 3V31A 4CI0C 3DRAA 3CMAQ 1G3WA 3EUVA 2AT1B 2KBTA 5ANLA 3OYHA 1VQ5T 3PT9A 2I2OA 3R6NA 4DLOA 5GANh 4P29A 2P84A 3EG0A 1OEBA 2AHJB 2IO3C 1Q7YC 1VUBA 3NZSA 3CC7T 3L54A 3QWXX 1DVPA 1BK2A 3FUMA 1VQPT 3ZHEA 3E37A 2EQJA 4WWOA 2P0PA 1Q86R 2WSFE 3L16A 4M75B 4G25A 2CGHA 5BT1A 2WXMA 4XZ4A 5IXFA 5FROA 1Z6TA 2FULA 1OYXA 5CHEE
chains in the Genus database with same CATH topology
2K7AA 4DRXE 2BZYA 2A5EA 2J6FA 1GFCA 2JW4A 5GJWB 3REAB 2F8XK 3SHWA 4J9EA 2QYJA 2RFMA 3SO8A 2DMOA 2K79A 1S1NA 2K2MA 2A36A 5EYPF 1GFDA 1AZGB 3UF4A 3VS7A 3JV3A 3EG2A 4HVVA 2LJ3A 4RTWA 4HNAD 1XOVA 5CBOA 4K11A 2RMOA 2IIMA 3ZL7C 3TWVA 3EU9A 2FPDA 1BI7B 1W1FA 5IHNA 1JU5C 1T0HA 5CEDB 2DBMA 2ESWA 4F6RD 2DILA 2PNNA 1NEGA 4LNUD 1ZLMA 1LCKA 2FPFA 2JXBA 2BZ8A 1PKSA 3PVQA 3JXIA 4X1VA 1MX4A 4BERA 2XMFA 1UUEA 3TWTA 1QCFA 1X43A 2RQWA 3TVTA 3DEPA 4K5AB 2FPEA 1MV3A 4JZ3A 2YUNA 2DL7A 3M0QA 4ZNXA 3IXEA 4QFVA 1K76A 2EGAA 5CERB 1X6BA 5CEAA 1H8KA 3I5SA 4HB5A 2ZGGA 2RQRA 1VYUA 2JS2A 1YWPA 4O60A 2EQIA 2KR3A 1YYHA 1W70A 4OAUC 2D0NA 2VVKA 3VS5A 4HRNA 2FRYA 1UGVA 1K1BA 2DL4A 2KROA 2X3XD 3LJNA 2FRWA 1G2BA 1AWOA 2DE0X 1E6GA 5I11A 2DZOA 1X69A 4J9BA 4HVUA 3TWRA 5ENSD 4HRLA 4BEPA 2KEAA 1JO8A 3M0SA 4F17A 1H3HA 1QLYA 4QQIA 1BLXB 2D1XA 2V1RA 1G3NB 3NPFA 4ZHBA 5EIBE 1RI9A 3NMZC 1Y0MA 1OPKA 2QDLA 1CSKA 2A37A 1I1JA 1MX6A 3NHNA 4OAVB 4DEYA 4LE9A 1WLPB 4J9GA 2XENA 1GBRA 2MCNA 1J3TA 2LP5A 1MX2A 1MV0B 1MJ0A 2RQTA 4K5CA 4QT7A 2ED1A 2HSPA 3QWYA 2KE9A 4DX1A 2DL3A 2YUOA 2GTOA 4J9CA 2GTJA 4AFZC 2ABLA 3EHRA 5CBNA 2EGEA 1PRMC 2AZVA 1VYVA 2F2VA 3UXGA 5EC7A 2FEIA 2D8HA 2CUBA 2BKGA 1V1CA 2SRCA 4AFQC 5IHKA 4OMQA 2KT8A 4YDWA 2KRMA 3VS1A 2F8YA 2FG0A 2GNCA 2W0ZA 3EG3A 3O5ZA 5FIOA 3M0UA 2FO1E 3V2XA 1AWXA 4J8YA 3H0IA 1SEMA 4CC2A 5EIDA 2LNHB 3UATA 1BBZA 3NGPA 4D8DA 2AKKA 1OV3A 1ZUUA 4Z68A 2DLPA 1SW6A 1M27C 2KYMA 4DEXA 3NOGD 1VA7A 2DA9A 1AOJA 2O31A 2PZ1A 2O88A 3RNJA 4B93B 2J8SD 1HSQA 4G8KA 5JA4D 4LG6A 4RTVA 1D9SA 1IXVA 1SPKA 1K0XA 2DBKA 5FW9A 4J9HA 5HCKA 1UJ0A 2JS0A 1GCQA 1Z9QA 3T9KA 1NYGA 1IKND 1B3QA 1PWTA 5AQ9A 1NG2A 1X6GA 2CUDA 3V79K 2VKNA 3Q9UC 1SHFA 2MOXA 1QKWA 1W6XA 4AFUC 2PTKA 4JB8P 1SRLA 2LMJA 3VRYA 1AZEA 4FSSA 2OI3A 4DX2A 2C0TA 5FINA 3B95A 3VS2A 3I35A 1N0RA 3TSZA 3W9GA 2GQIA 1WXBA 3EHQA 2KNBB 2O9VA 5IHIA 2KRSA 2Y0BG 4BESA 4HXJA 5AARA 2ENMA 1TUCA 3VS0A 1OY3D 2DYBA 3ZNGA 2O9SA 3UI2A 3EGUA 2KXPC 1TG0A 1YWOA 4LUDA 3HRAA 2QC9A 1GRIA 2X3WD 4E6RA 4BETA 1BD8A 4J7WA 2A28A 1TR4A 4HBDA 2C0IA 2CT4A 3RBBB 2XEEA 2LX7A 2OAWA 3H0FA 5I22A 4RTYA 1G83A 2AZSA 2L2PA 1NYFA 5FWCA 2VGEA 4M4ZA 5ENQD 2M51A 1TUDA 2XZDG 2DRMA 2ECZA 5CECB 3VS3A 4YDYA 4DX5D 4RTXA 2W10A 2DVWA 3NOCD 2K6DA 1ZX6A 4IIMA 2GGRA 5JMND 1NLPC 1T3SA 2BZXA 1IHBA 2HBWA 1KIKA 1B07A 1I07A 1BI8B 3C5RA 5KBAA 3PE0A 1UG1A 1E7OA 2DX1A 2CREA 2EW3A 4LNPA 1UOHA 2HE0A 1IO6A 2KXCA 3J5QB 4U8YD 5EYLA 1QKXA 2HEQA 3H41A 3LH5A 2C0OA 4GMRA 4CC4B 2F2WA 4J9FA 3M0PA 2DF6A 5AQ7A 3TWXA 4ORZA 2JMAA 4LN2A 1N11A 2EYYA 3TSWA 2FO0A 5KNHD 4HRMB 2JABA 2LZ6B 5AAOA 2J05A 4U95D 2H8HA 2J6KA 5ENRD 2V1QA 1NLOC 3SEMA 3KEAA 3UA6A 1PKTA 2EKHA 4TUMA 4IIOA 2HDAA 3I5RA 1ABQA 1UTIA 3JUEA 4ZFHA 3W9FA 4HVWA 2EPDA 3NBNB 2YDLA 4AG2C 1SVXA 1AVZC 3Q9NC 2L3PA 5HS0A 1KSWA 3C0CA 4JZ4A 1U06A 2LQNA 5ENTD 4JJDA 1AWWA 1GBQA 1YNZA 2F37A 1HJDA 2EYXA 3ZUVB 2V5QC 1AD5A 1BB9A 5ENPD 2RNAA 4O1PA 1UECA 4Z8AA 4AG1C 1WG0A 4BSZB 2P2CP 2ETAA 1Y57A 3DEOA 4J9IA 3AJIA 1DC2A 1YP5A 2DL5A 3FJ5A 4U8VD 2EYZA 4HLLA 1M8MA 2CDTA 2DNUA 4HI9A 5ITZF 1BU1A 2YSQA 1U3OA 2HCKA 4OMPA 4GLMA 3GBQA 5GJVB 3F6QA 1FYNA 3THKA 2CSQA 1AWJA 2L0AA 1JXMA 4O1OA 2AK5A 1AEYA 2L3QA 4UUCA 2RFAA 5AN8A 1ZUYA 4Y92A 1S70B 1E6HA 1JXOA 3D9HA 2CSIA 1KJWA 2KXDA 4OMOA 1U5SA 2J7IA 2NWMA 4RTTA 2DVJA 1RLQC 5BXOA 2M0YA 1WFWA 1YN8A 1ZBJA 5L23A 4D8KA 2MYOA 4LSZE 1A0NB 2VWFA 3H0HA 1NM7A 3A98A 3U23A 1ZSGA 1N5ZA 1X2QA 4CZ2D 1GCPA 5IH2A 1T0JA 1ABOA 1X27A 1QYMA 1SHGA 1K0SA 1MUZA 4GBQA 1KFZA 4G8LA 3ZU7B 2PNIA 2V4HC 1T3LA 2DZNA 2KYBA 2KT1A 2DWZA 1UE9A 2YUPA 2JM8A 5BXUA 1K1AA 4N5QA 2ETCA 3ZKJA 4J9DA 4OMMA 2SEMA 2RF0A 3CQTA 2EBPA 1NFIE 5IXBA 2EGCA 2KBXA 2Y1LE 2B0OE 1EFNA 1QWFA 2J6OA 2EYWA 1K1ZA 2JM9A 2DJQA 2DL8A 5EILA 3T8KA 1SSHA 4OMNA 2DRKA 2CH4A 1A5EA 5AQBA 3M0TA 4RLYA 1X2KA 1GL5A 1CKBA 4CYMD 1WIEA 2E5KA 3V2OA 4Z88A 2LJ1A 3HG0D 2YT6A 4HI8A 1OPLA 3KFVA 4EIKA 4KRTA 2J06A 2MIOA 5FWBA 2O2OA 4HCKA 2L6BA 1PHTA 1K9AA 4ESRA 4K5BA 2AJAA 4C48B 1WDXA 2ETBA 2OJ2A 2P4RA 1YCSB 5HRYA 5KNGA 2F2XA 5D66A 4JPBW 5EN5D 3ULRB 2BTTA 1DCQA 2GBQA 2K9GA 1CKAA 1K4US 3TWSA 2ED0A 3TWWA 1PNJA 3TWUA 4U96D 1ZUKA 4R0KA 2ZGDA 3I9QA 1WYXA 1YMPA 3VRZA 1M30A 4NIKA 2NYJA 4ATZD 5ECAA 1RLPC 2AKLA 3VS6A 5HKPA 4A63B 4RTUA 2XEHA 1WI7A 1QWEA 3UA7A 1M3CA 2KGTA 1FMKA 5AQAA 1UDLA 3J5PA 1BU9A 1WDYA 3B7BA 1HD3A 1UHFA 4F14A 4HQDA 2KRNA 2NUZA 2G6FX 3VS4A 4CC7A 1PRLC 1UJYA 1WX6A 2JTEA 4RUGA 4WCIA 1ARKA 4GPMA 4JJCA 2D8JA 2JMCA 1MYOA 1Z9ZA 1OT8A 1SRMA 5KWDA 1NEBA 1UHCA 1H92A 1RUWA 3IQLA 4OMLA 2XZTG 2I0NA 1JEGA 4JJBA 3JXJA 2YUQA 3V31A 3REBB 2CH4W 2KBTA 1K3ZD 3EG1A 4DX6D 2RQVA 1WXTA 4LUEA 3R6NA 2RN8A 4DUIA 1AP7A 3EG0A 3V30A 1OEBA 1I0CA 2EVRA 1M3BA 2A08A 4F16A 4RTZA 1AWCB 1WXUA 4Z89A 4CC3A 3TWQA 1M3AA 2LQWA 3QWXX 5ENOD 1BK2A 2CT3A 1OOTA 1GCQC 1UFFA 1JQQA 1WA7A 3AAAC 1VYTA 2K3BA 3UTMA 3M0RA 2ROLA 3PVLA 2LJ0A 2BKKB 2RPNA 2L3SA 2JT4A 2RQUA 4DX7D 2LCSA 2B86A 1N0QA 4F1PA 5IXFA 2ROTA 4AFSC 2DM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7A A;  4DRX E;  2BZY A;  2A5E A;  2J6F A;  1GFC A;  2JW4 A;  5GJW B;  3REA B;  2F8X K;  3SHW A;  4J9E A;  2QYJ A;  2RFM A;  3SO8 A;  2DMO A;  2K79 A;  1S1N A;  2K2M A;  2A36 A;  5EYP F;  1GFD A;  1AZG B;  3UF4 A;  3VS7 A;  3JV3 A;  3EG2 A;  4HVV A;  2LJ3 A;  4RTW A;  4HNA D;  1XOV A;  5CBO A;  4K11 A;  2RMO A;  2IIM A;  3ZL7 C;  3TWV A;  3EU9 A;  2FPD A;  1BI7 B;  1W1F A;  5IHN A;  1JU5 C;  1T0H A;  5CED B;  2DBM A;  2ESW A;  4F6R D;  2DIL A;  2PNN A;  1NEG A;  4LNU D;  1ZLM A;  1LCK A;  2FPF A;  2JXB A;  2BZ8 A;  1PKS A;  3PVQ A;  3JXI A;  4X1V A;  1MX4 A;  4BER A;  2XMF A;  1UUE A;  3TWT A;  1QCF A;  1X43 A;  2RQW A;  3TVT A;  3DEP A;  4K5A B;  2FPE A;  1MV3 A;  4JZ3 A;  2YUN A;  2DL7 A;  3M0Q A;  4ZNX A;  3IXE A;  4QFV A;  1K76 A;  2EGA A;  5CER B;  1X6B A;  5CEA A;  1H8K A;  3I5S A;  4HB5 A;  2ZGG A;  2RQR A;  1VYU A;  2JS2 A;  1YWP A;  4O60 A;  2EQI A;  2KR3 A;  1YYH A;  1W70 A;  4OAU C;  2D0N A;  2VVK A;  3VS5 A;  4HRN A;  2FRY A;  1UGV A;  1K1B A;  2DL4 A;  2KRO A;  2X3X D;  3LJN A;  2FRW A;  1G2B A;  1AWO A;  2DE0 X;  1E6G A;  5I11 A;  2DZO A;  1X69 A;  4J9B A;  4HVU A;  3TWR A;  5ENS D;  4HRL A;  4BEP A;  2KEA A;  1JO8 A;  3M0S A;  4F17 A;  1H3H A;  1QLY A;  4QQI A;  1BLX B;  2D1X A;  2V1R A;  1G3N B;  3NPF A;  4ZHB A;  5EIB E;  1RI9 A;  3NMZ C;  1Y0M A;  1OPK A;  2QDL A;  1CSK A;  2A37 A;  1I1J A;  1MX6 A;  3NHN A;  4OAV B;  4DEY A;  4LE9 A;  1WLP B;  4J9G A;  2XEN A;  1GBR A;  2MCN A;  1J3T A;  2LP5 A;  1MX2 A;  1MV0 B;  1MJ0 A;  2RQT A;  4K5C A;  4QT7 A;  2ED1 A;  2HSP A;  3QWY A;  2KE9 A;  4DX1 A;  2DL3 A;  2YUO A;  2GTO A;  4J9C A;  2GTJ A;  4AFZ C;  2ABL A;  3EHR A;  5CBN A;  2EGE A;  1PRM C;  2AZV A;  1VYV A;  2F2V A;  3UXG A;  5EC7 A;  2FEI A;  2D8H A;  2CUB A;  2BKG A;  1V1C A;  2SRC A;  4AFQ C;  5IHK A;  4OMQ A;  2KT8 A;  4YDW A;  2KRM A;  3VS1 A;  2F8Y A;  2FG0 A;  2GNC A;  2W0Z A;  3EG3 A;  3O5Z A;  5FIO A;  3M0U A;  2FO1 E;  3V2X A;  1AWX A;  4J8Y A;  3H0I A;  1SEM A;  4CC2 A;  5EID A;  2LNH B;  3UAT A;  1BBZ A;  3NGP A;  4D8D A;  2AKK A;  1OV3 A;  1ZUU A;  4Z68 A;  2DLP A;  1SW6 A;  1M27 C;  2KYM A;  4DEX A;  3NOG D;  1VA7 A;  2DA9 A;  1AOJ A;  2O31 A;  2PZ1 A;  2O88 A;  3RNJ A;  4B93 B;  2J8S D;  1HSQ A;  4G8K A;  5JA4 D;  4LG6 A;  4RTV A;  1D9S A;  1IXV A;  1SPK A;  1K0X A;  2DBK A;  5FW9 A;  4J9H A;  5HCK A;  1UJ0 A;  2JS0 A;  1GCQ A;  1Z9Q A;  3T9K A;  1NYG A;  1IKN D;  1B3Q A;  1PWT A;  5AQ9 A;  1NG2 A;  1X6G A;  2CUD A;  3V79 K;  2VKN A;  3Q9U C;  1SHF A;  2MOX A;  1QKW A;  1W6X A;  4AFU C;  2PTK A;  4JB8 P;  1SRL A;  2LMJ A;  3VRY A;  1AZE A;  4FSS A;  2OI3 A;  4DX2 A;  2C0T A;  5FIN A;  3B95 A;  3VS2 A;  3I35 A;  1N0R A;  3TSZ A;  3W9G A;  2GQI A;  1WXB A;  3EHQ A;  2KNB B;  2O9V A;  5IHI A;  2KRS A;  2Y0B G;  4BES A;  4HXJ A;  5AAR A;  2ENM A;  1TUC A;  3VS0 A;  1OY3 D;  2DYB A;  3ZNG A;  2O9S A;  3UI2 A;  3EGU A;  2KXP C;  1TG0 A;  1YWO A;  4LUD A;  3HRA A;  2QC9 A;  1GRI A;  2X3W D;  4E6R A;  4BET A;  1BD8 A;  4J7W A;  2A28 A;  1TR4 A;  4HBD A;  2C0I A;  2CT4 A;  3RBB B;  2XEE A;  2LX7 A;  2OAW A;  3H0F A;  5I22 A;  4RTY A;  1G83 A;  2AZS A;  2L2P A;  1NYF A;  5FWC A;  2VGE A;  4M4Z A;  5ENQ D;  2M51 A;  1TUD A;  2XZD G;  2DRM A;  2ECZ A;  5CEC B;  3VS3 A;  4YDY A;  4DX5 D;  4RTX A;  2W10 A;  2DVW A;  3NOC D;  2K6D A;  1ZX6 A;  4IIM A;  2GGR A;  5JMN D;  1NLP C;  1T3S A;  2BZX A;  1IHB A;  2HBW A;  1KIK A;  1B07 A;  1I07 A;  1BI8 B;  3C5R A;  5KBA A;  3PE0 A;  1UG1 A;  1E7O A;  2DX1 A;  2CRE A;  2EW3 A;  4LNP A;  1UOH A;  2HE0 A;  1IO6 A;  2KXC A;  3J5Q B;  4U8Y D;  5EYL A;  1QKX A;  2HEQ A;  3H41 A;  3LH5 A;  2C0O A;  4GMR A;  4CC4 B;  2F2W A;  4J9F A;  3M0P A;  2DF6 A;  5AQ7 A;  3TWX A;  4ORZ A;  2JMA A;  4LN2 A;  1N11 A;  2EYY A;  3TSW A;  2FO0 A;  5KNH D;  4HRM B;  2JAB A;  2LZ6 B;  5AAO A;  2J05 A;  4U95 D;  2H8H A;  2J6K A;  5ENR D;  2V1Q A;  1NLO C;  3SEM A;  3KEA A;  3UA6 A;  1PKT A;  2EKH A;  4TUM A;  4IIO A;  2HDA A;  3I5R A;  1ABQ A;  1UTI A;  3JUE A;  4ZFH A;  3W9F A;  4HVW A;  2EPD A;  3NBN B;  2YDL A;  4AG2 C;  1SVX A;  1AVZ C;  3Q9N C;  2L3P A;  5HS0 A;  1KSW A;  3C0C A;  4JZ4 A;  1U06 A;  2LQN A;  5ENT D;  4JJD A;  1AWW A;  1GBQ A;  1YNZ A;  2F37 A;  1HJD A;  2EYX A;  3ZUV B;  2V5Q C;  1AD5 A;  1BB9 A;  5ENP D;  2RNA A;  4O1P A;  1UEC A;  4Z8A A;  4AG1 C;  1WG0 A;  4BSZ B;  2P2C P;  2ETA A;  1Y57 A;  3DEO A;  4J9I A;  3AJI A;  1DC2 A;  1YP5 A;  2DL5 A;  3FJ5 A;  4U8V D;  2EYZ A;  4HLL A;  1M8M A;  2CDT A;  2DNU A;  4HI9 A;  5ITZ F;  1BU1 A;  2YSQ A;  1U3O A;  2HCK A;  4OMP A;  4GLM A;  3GBQ A;  5GJV B;  3F6Q A;  1FYN A;  3THK A;  2CSQ A;  1AWJ A;  2L0A A;  1JXM A;  4O1O A;  2AK5 A;  1AEY A;  2L3Q A;  4UUC A;  2RFA A;  5AN8 A;  1ZUY A;  4Y92 A;  1S70 B;  1E6H A;  1JXO A;  3D9H A;  2CSI A;  1KJW A;  2KXD A;  4OMO A;  1U5S A;  2J7I A;  2NWM A;  4RTT A;  2DVJ A;  1RLQ C;  5BXO A;  2M0Y A;  1WFW A;  1YN8 A;  1ZBJ A;  5L23 A;  4D8K A;  2MYO A;  4LSZ E;  1A0N B;  2VWF A;  3H0H A;  1NM7 A;  3A98 A;  3U23 A;  1ZSG A;  1N5Z A;  1X2Q A;  4CZ2 D;  1GCP A;  5IH2 A;  1T0J A;  1ABO A;  1X27 A;  1QYM A;  1SHG A;  1K0S A;  1MUZ A;  4GBQ A;  1KFZ A;  4G8L A;  3ZU7 B;  2PNI A;  2V4H C;  1T3L A;  2DZN A;  2KYB A;  2KT1 A;  2DWZ A;  1UE9 A;  2YUP A;  2JM8 A;  5BXU A;  1K1A A;  4N5Q A;  2ETC A;  3ZKJ A;  4J9D A;  4OMM A;  2SEM A;  2RF0 A;  3CQT A;  2EBP A;  1NFI E;  5IXB A;  2EGC A;  2KBX A;  2Y1L E;  2B0O E;  1EFN A;  1QWF A;  2J6O A;  2EYW A;  1K1Z A;  2JM9 A;  2DJQ A;  2DL8 A;  5EIL A;  3T8K A;  1SSH A;  4OMN A;  2DRK A;  2CH4 A;  1A5E A;  5AQB A;  3M0T A;  4RLY A;  1X2K A;  1GL5 A;  1CKB A;  4CYM D;  1WIE A;  2E5K A;  3V2O A;  4Z88 A;  2LJ1 A;  3HG0 D;  2YT6 A;  4HI8 A;  1OPL A;  3KFV A;  4EIK A;  4KRT A;  2J06 A;  2MIO A;  5FWB A;  2O2O A;  4HCK A;  2L6B A;  1PHT A;  1K9A A;  4ESR A;  4K5B A;  2AJA A;  4C48 B;  1WDX A;  2ETB A;  2OJ2 A;  2P4R A;  1YCS B;  5HRY A;  5KNG A;  2F2X A;  5D66 A;  4JPB W;  5EN5 D;  3ULR B;  2BTT A;  1DCQ A;  2GBQ A;  2K9G A;  1CKA A;  1K4U S;  3TWS A;  2ED0 A;  3TWW A;  1PNJ A;  3TWU A;  4U96 D;  1ZUK A;  4R0K A;  2ZGD A;  3I9Q A;  1WYX A;  1YMP A;  3VRZ A;  1M30 A;  4NIK A;  2NYJ A;  4ATZ D;  5ECA A;  1RLP C;  2AKL A;  3VS6 A;  5HKP A;  4A63 B;  4RTU A;  2XEH A;  1WI7 A;  1QWE A;  3UA7 A;  1M3C A;  2KGT A;  1FMK A;  5AQA A;  1UDL A;  3J5P A;  1BU9 A;  1WDY A;  3B7B A;  1HD3 A;  1UHF A;  4F14 A;  4HQD A;  2KRN A;  2NUZ A;  2G6F X;  3VS4 A;  4CC7 A;  1PRL C;  1UJY A;  1WX6 A;  2JTE A;  4RUG A;  4WCI A;  1ARK A;  4GPM A;  4JJC A;  2D8J A;  2JMC A;  1MYO A;  1Z9Z A;  1OT8 A;  1SRM A;  5KWD A;  1NEB A;  1UHC A;  1H92 A;  1RUW A;  3IQL A;  4OML A;  2XZT G;  2I0N A;  1JEG A;  4JJB A;  3JXJ A;  2YUQ A;  3V31 A;  3REB B;  2CH4 W;  2KBT A;  1K3Z D;  3EG1 A;  4DX6 D;  2RQV A;  1WXT A;  4LUE A;  3R6N A;  2RN8 A;  4DUI A;  1AP7 A;  3EG0 A;  3V30 A;  1OEB A;  1I0C A;  2EVR A;  1M3B A;  2A08 A;  4F16 A;  4RTZ A;  1AWC B;  1WXU A;  4Z89 A;  4CC3 A;  3TWQ A;  1M3A A;  2LQW A;  3QWX X;  5ENO D;  1BK2 A;  2CT3 A;  1OOT A;  1GCQ C;  1UFF A;  1JQQ A;  1WA7 A;  3AAA C;  1VYT A;  2K3B A;  3UTM A;  3M0R A;  2ROL A;  3PVL A;  2LJ0 A;  2BKK B;  2RPN A;  2L3S A;  2JT4 A;  2RQU A;  4DX7 D;  2LCS A;  2B86 A;  1N0Q A;  4F1P A;  5IXF A;  2ROT A;  4AFS C;  2DM1 A; 
#chains in the Genus database with same CATH topology
 2K7A A;  4DRX E;  2VSY A;  2A5E A;  5GJW B;  1GFC A;  3APD A;  3WVD B;  1JCS A;  3REA B;  2GFU A;  2OCC E;  3M4G A;  3S6W A;  2QYJ A;  3B7R L;  3ER0 A;  3I4R B;  5JJ6 A;  4KBM B;  4C8Q C;  4C92 E;  3SO8 A;  3CCL T;  4PJO C;  1S1N A;  1K9M C;  2R05 A;  2A36 A;  5EYP F;  2E1H A;  1AZG B;  1GFD A;  1KQS S;  4JPS A;  2QA4 T;  3DSS A;  3NTH A;  4UWG A;  3EGD B;  2LJ3 A;  1D8E A;  3FUE A;  4HNA D;  4OMF B;  2EQK A;  4IUT A;  2IIM A;  5G2N A;  3ZL7 C;  4X8Q A;  4UWH A;  2BED A;  2VTB B;  3CCV A;  3G4S T;  5GAM g;  5FU6 C;  1BI7 B;  3QXE B;  4HFG A;  4FCY A;  1EPU A;  2KCV A;  2VC8 A;  4F6R D;  3ZEH A;  2Y90 A;  1SZ9 A;  4RG9 A;  3JCM J;  1NJI U;  4LNG A;  2ZGW A;  4M3O A;  4J8F A;  2JXB A;  2LQ8 A;  2BZ8 A;  4DLQ A;  3JXI A;  1SKU B;  1H6O A;  4E7Z A;  1MX4 A;  3EJN A;  1QCF A;  2WXF A;  1X43 A;  2A3L A;  4OB1 B;  3TVT A;  3NF1 A;  3JB9 I;  4JZ3 A;  4K5A B;  3OYA A;  2ZPI B;  4B9X A;  3M0Q A;  4XQ3 A;  3IXE A;  4QFV A;  2XKO C;  4DBF A;  5DM7 R;  1M2V B;  3I5S A;  3QPH A;  1YJW Q;  4M78 A;  3E9F A;  1M1F A;  3OTN A;  3D9O A;  1M90 R;  2KR3 A;  4TUU A;  4FW2 A;  1C0M A;  4OAU C;  1OX8 A;  3EGX A;  4GZC A;  2FRY A;  3M59 A;  3JB9 D;  2PU9 B;  5G04 J;  2KRO A;  3OYN A;  3OYL A;  3PNW C;  3ZBD A;  3CVN A;  2H6I A;  1QCO A;  4KVO A;  2QY7 A;  3ABL E;  2R57 A;  4OGC A;  2DIG A;  4UWK A;  2J07 A;  3TWR A;  1UB4 A;  4HRL A;  4EMK C;  3CCQ A;  5C6S A;  3HYM B;  3AU4 A;  1H3H A;  4E85 A;  1R0B G;  3APF A;  4N0A A;  4C8Q E;  2LX9 A;  1H6K A;  3MO8 A;  1BLX B;  4M7A F;  3PZD A;  2V1R A;  1G3N B;  3LY9 A;  3E2U A;  4PJO E;  1Q81 R;  3MEK A;  2DPP B;  3LWI A;  2V0P A;  2WXH A;  4U0U A;  2M1H A;  2A37 A;  3EFS A;  3CCE T;  1I1J A;  4BDY A;  5T8I A;  1MX6 A;  4DEY A;  1OWN A;  3JQ0 A;  3CCS A;  1J3T A;  4JRK A;  4U7E B;  2LNV A;  1VOM A;  3LS8 A;  3FC3 A;  4QT7 A;  3ZFW A;  3Q78 A;  2ED1 A;  4LDV A;  1VQO A;  3P8D A;  3QWY A;  4DX1 A;  4LDY A;  2LT4 A;  2YUO A;  3QDN A;  2CHX A;  3QWW A;  1YJN T;  4J9C A;  3NAW A;  3S3M A;  1Q7Y U;  3CCR A;  2ABL A;  5CBN A;  4GTQ A;  3EHN A;  3UMV A;  5HK3 A;  1ZA1 B;  2AZV A;  4EHM A;  5DIZ A;  1JUQ A;  2F2V A;  2DTO A;  3ZRH A;  5EC7 A;  2FEI A;  3MKD A;  5IHK A;  3OW2 A;  1D1A A;  1UJK A;  2KT8 A;  4HOQ A;  1HK9 A;  3VS1 A;  1WHM A;  2P0K A;  3JCM h;  3FUN A;  3TAX A;  2FG0 A;  4ZGE B;  5GAN 6;  1EDU A;  3O5Z A;  1YBY A;  2FO1 E;  3V2X A;  1AWX A;  2QTV A;  2DJZ A;  5GMK h;  3PZ2 A;  2GRO B;  3DSX A;  4JHK A;  3RO3 A;  1K9M R;  4FYW B;  4D8D A;  1OV3 A;  5KCO A;  1QP3 A;  3R9M A;  4EQF A;  1M27 C;  2KYM A;  4IKF A;  1VA7 A;  1W2B A;  1TU0 B;  3PIP A;  4AM9 A;  4GMJ A;  4JW1 A;  2O31 A;  2VGM A;  5J08 A;  4QQD A;  4C92 F;  4XTV A;  1OU9 A;  2PZ1 A;  3CCV Q;  5JA4 D;  1YJW T;  2CKK A;  2DTI A;  1BI3 A;  1UJ0 A;  2HD0 A;  5D7U A;  2VYT A;  5BNW A;  2L89 A;  3T9K A;  3QSU A;  2R17 C;  1PWT A;  2CUD A;  1NG2 A;  3D7S B;  2EIL E;  2DEU A;  2MOX A;  2QTX A;  4F3V A;  4JB8 P;  2LMJ A;  2X4X A;  3VS2 A;  2EJG A;  4UQX A;  2Y4U A;  1BKB A;  1Y71 A;  3FFL A;  6AT1 B;  3W9G A;  4BFR A;  5AEN A;  2R5M A;  5CK9 A;  2KRS A;  2KZT B;  3Q4A B;  5AAR A;  4G26 A;  2ENM A;  2VSN A;  2DYB A;  1BI0 A;  2O9S A;  1ELW A;  1V76 A;  4BD3 A;  2E0I A;  4E7J A;  2F5T X;  4LUD A;  4GYO A;  4FAD A;  2QC9 A;  2AIR B;  2PQN A;  1GRI A;  4IUQ A;  4E6R A;  4JEH A;  2ION A;  1MQS A;  3HL8 A;  1BD8 A;  2IF4 A;  2HNI A;  3HVE A;  4IRU A;  3V8L A;  3CEY A;  4RTY A;  1R77 A;  3J80 E;  5D0O D;  4FM4 B;  2IJG X;  3HXD A;  4M7A B;  4HVB A;  3RKY A;  4C5I A;  4RMO A;  3CC4 A;  4M4Z A;  3CCQ Q;  2CZ1 B;  4QVC A;  1TXQ A;  5KH6 A;  4KXK B;  2ECZ A;  2BTD A;  3EFR A;  2K2V A;  4DX5 D;  3WVE B;  1PD1 A;  2DVW A;  3MKQ A;  4PFP A;  4M7D D;  3KBG A;  2K6D A;  1RAF B;  1ZX6 A;  4IIM A;  3FP3 A;  3PZ4 A;  4J7F A;  4Y28 E;  1UGQ B;  5LJ5 e;  2PQW A;  1KIK A;  5FQ7 A;  1GW6 A;  1S0P A;  2OV8 A;  3AG2 E;  1B07 A;  1I07 A;  1RAG B;  2M0O A;  2YRD A;  4NOY A;  2HBP A;  3JCM b;  2RKK A;  1E7O A;  2CRE A;  2IVW A;  3GLX A;  4LNP A;  2K5I A;  3L82 A;  3CCS Q;  4RG8 A;  4GZ3 A;  3DPY A;  1IO6 A;  1E8W A;  2HEQ A;  4U8Y D;  3DPD A;  5EYL A;  1QKX A;  3LH5 A;  5CKB A;  1PCX A;  1RAB B;  5M72 A;  1VQO Q;  4J9F A;  4JS4 A;  3UQ3 A;  1K73 C;  4XAX B;  4APO A;  2FO7 A;  5GAN 8;  1HX8 A;  3QJ6 A;  3INZ A;  3CCR Q;  3C95 A;  4MZT A;  1N4P A;  5KNH D;  4HRM B;  3OS2 A;  4OVU A;  2LZ6 B;  3QDR B;  2J05 A;  3JQ1 A;  4JS5 A;  4XEI G;  4EZJ A;  4U95 D;  1G3Y A;  4UC4 A;  2GRQ B;  1QP2 A;  1ZBP A;  3MP1 A;  2J6K A;  5ENR D;  3CPF A;  3X28 B;  4KZ0 A;  3FDH A;  4IYP A;  3IHV A;  4CDM A;  3CPW P;  5C1D A;  3OXG A;  4H7X A;  1EIF A;  3EIJ A;  2HDA A;  3L2Q A;  3R7Q A;  3C12 A;  4ZFH A;  4URK A;  1NPR A;  2RJE A;  4HVW A;  3OAW A;  1QQE A;  4M75 G;  3VYH B;  1MMN A;  3HRS A;  3NBN B;  3ASO E;  8AT1 B;  1HH8 A;  4TV3 A;  5HS0 A;  3SZ7 A;  2OEW A;  3ZEF A;  2QI2 A;  3R7R A;  4WWP A;  1JPL A;  3EG9 B;  2F37 A;  4Y6C A;  1UEB A;  4Q96 A;  2EYX A;  1IQR A;  1V54 E;  2XQ0 A;  3CVV A;  3CVP A;  2RNA A;  4M75 A;  4Z8A A;  3SGH A;  5KYN A;  3GZS A;  3CHP A;  1Y57 A;  4Y91 A;  4LDW A;  3ZHE B;  3KSL A;  4PH4 B;  4E7K A;  3AJI A;  3GF5 A;  1K8A R;  2DL5 A;  2X9H A;  3FJ5 A;  2BUG A;  3APC A;  2COY A;  3PMT A;  4HLL A;  4JUV A;  1TNY A;  2PM6 A;  4AJW A;  3JB9 J;  1EX4 A;  4XU3 A;  3CME A;  2QQB A;  1LVK A;  5ITZ F;  1BU1 A;  3PDN A;  4L59 A;  3GBQ A;  3CC2 T;  1FYN A;  1D09 B;  1FVH A;  1WJS A;  3FEO A;  1AWJ A;  5JJT A;  2FZK B;  4J6I A;  2OTJ T;  1JXM A;  2JUF A;  2AK5 A;  3JCK C;  4YVQ C;  8ATC B;  2UY1 B;  4UUC A;  3CHR A;  5LL6 S;  3LY8 A;  4BTB A;  1I4K 1;  4LDX A;  3CHQ A;  3CVY A;  4G1T A;  4OB3 B;  2LNI A;  1ZUY A;  1WZO A;  3CCS T;  1YIT T;  1M1K U;  4Y92 A;  1UN8 A;  3G2S A;  3QOU A;  1KD1 C;  2X4J A;  4HXI A;  1JXO A;  2VTB A;  4J0U A;  2NWM A;  3PGG A;  1VQO T;  3FUI A;  4V3I A;  4TXR A;  4FIB A;  3CC4 Q;  1RLQ C;  3S3N A;  3CBM A;  3QYG B;  3QWP A;  1BI2 A;  3MKR A;  1Y7X A;  3RMQ A;  4QKU A;  2X6J A;  2D9T A;  2VWF A;  3LGF A;  3CCR T;  1NM7 A;  4C5H A;  4M7D C;  4E47 A;  1N5Z A;  3PUJ A;  2LSU A;  4CZ2 D;  2YXY A;  1TEZ A;  4KUI A;  3QKJ A;  4MZP A;  2E41 A;  1K0S A;  3X2Q E;  1KFZ A;  4GBQ A;  4R55 A;  2V4H C;  1DJ7 B;  3CST A;  2WSC E;  3V8J A;  2DZN A;  1QVP A;  2DWZ A;  1UE9 A;  1G5V A;  5KJK A;  1K1A A;  2ETC A;  4FSX A;  4J9D A;  1N54 A;  1KZP A;  2FB7 A;  2RF0 A;  2F0Y A;  2QK0 A;  2EBP A;  2DVE A;  3OYD A;  3ZYL A;  5GAN d;  4IUP A;  1M2V A;  3FTX A;  3TQ7 P;  1BIB A;  2Y1L E;  3A8L B;  2B0O E;  4ANW A;  1QWF A;  2FZC B;  2R59 A;  1K1Z A;  2EYW A;  1U1T A;  2DJQ A;  1SSF A;  5EIL A;  3T8K A;  4JVS A;  1JJ2 S;  1K73 R;  2KDS A;  4KYO B;  3Q47 B;  1S64 A;  1A5E A;  1QMC A;  5AQB A;  2WSE E;  1KQ1 A;  4FL6 A;  1X2K A;  1GL5 A;  5FU6 B;  4I17 A;  4CYM D;  5LX8 A;  4XTW A;  2YNQ A;  1IXD A;  4XI9 A;  2E4H A;  1H2V C;  5FZR A;  5BV0 A;  3ESK A;  4JLI A;  1VQK T;  3FTV A;  3FTS A;  4GA1 A;  2V4L A;  3OS5 A;  3LH0 A;  5FWB A;  3PRZ A;  4HCK A;  5EG2 A;  4PS7 A;  1K9A A;  1TNB A;  2NUP A;  2YQ8 A;  4K5B A;  2DXB A;  3VYG A;  1TN6 A;  2L9B A;  1H2U A;  1DCQ A;  2LRQ A;  2Y69 E;  2WMN A;  1G3T A;  1PNJ A;  4U96 D;  3LVR E;  2ZGD A;  1WYX A;  1YMP A;  1O5M A;  3CCL A;  4FYX B;  2LCL A;  5CMW A;  1KC8 U;  2QA4 A;  3VS6 A;  3CBO A;  2DAQ A;  2XEH A;  3UA7 A;  2MRI A;  1M3C A;  3R6O A;  1IHW A;  3A8G B;  2KGT A;  2EWN A;  3DSU A;  4JL0 A;  4C0D B;  2CFU A;  5J26 A;  1XTD A;  1U2V G;  1WDY A;  2JNG A;  3M55 A;  1UHF A;  3PEU B;  3TCJ A;  1ZBX A;  2Z0W A;  4F14 A;  2KRN A;  1Y6I A;  3FU6 A;  4GTR A;  3G4S A;  4XIF A;  1ARK A;  3P1U A;  3ASG A;  1N52 A;  2IEJ A;  2IY0 C;  4XKC A;  5CQY A;  5LJ5 f;  4M7D E;  5KWD A;  2RO0 A;  5GMK j;  3BFM A;  3IQL A;  5CVI A;  3CME Q;  2OND A;  3D9I A;  2CP5 A;  3CC4 T;  1H0A A;  1FMW A;  4PS8 A;  2I6H A;  2LO6 A;  4PUC A;  4UWF A;  1L5J A;  1K3Z D;  2HO1 A;  5J90 A;  3EG1 A;  2OTL T;  1U1S A;  2RQV A;  2GFA A;  2FBN A;  2EYQ A;  2RN8 A;  3LDZ A;  3NFC A;  4NL3 A;  4F53 A;  2WMO A;  2OX7 A;  2LQW A;  1M3A A;  1H2T C;  2ILR A;  3LX7 A;  4QVZ A;  1IGU A;  3ZW3 A;  1GCQ C;  4ILG A;  1UFF A;  5GAO q;  4JJN K;  1PSF A;  1WA7 A;  3AAA C;  4GTP A;  3PVL A;  4MKT A;  2LJ0 A;  2DXT A;  2BKK B;  4JHR A;  4ZTJ A;  1KG1 A;  3OA6 A;  1N94 A;  2I9C A;  4AFS C;  4J8E A;  1IHV A;  1F1B B;  4B89 A;  3HP9 A;  4N4G A;  3P8B B;  2BZY A;  4XTU A;  4E2F B;  3JCM W;  5KCM A;  4GZ6 A;  3HXE A;  2AXU A;  2P58 C;  4GA0 A;  4EEC A;  1M2O A;  3LVQ E;  4JRI A;  9ATC B;  3RO2 A;  3RAU A;  4HVV A;  5FWQ A;  5T4Y A;  1VQ4 T;  4E6H A;  2JN0 A;  1NP7 A;  3NTK A;  4A54 A;  4WF2 A;  4QVD A;  4N3C A;  2XEV A;  4RTW A;  3DKM A;  1VQ5 Q;  3CCE A;  4K11 A;  2KZT A;  2XPY A;  3HHM A;  1V29 B;  4GYW A;  2E3I A;  4JRQ A;  3IEG A;  3LW5 E;  4XTX A;  4A53 A;  1WJR A;  3TWV A;  4FYV B;  2JTM A;  1RI0 A;  4A4E A;  5IHN A;  1NI1 A;  4LNB A;  2V8K A;  3L17 A;  2DBM A;  3FEY A;  2O4X B;  3H8Z A;  2DIL A;  1YJN A;  2PNN A;  3QAQ A;  1PD0 A;  2L0T B;  4LNU D;  1R8O B;  1LCK A;  2DYI A;  4HOT A;  3OXL A;  4F1S A;  3QJY A;  2LXL A;  4BY6 C;  3ZGQ A;  2ZPB B;  3L1A A;  3PVQ A;  5E76 A;  2ZU6 B;  2WXR A;  4BER A;  4DJA A;  2V26 A;  2XMF A;  4KMO A;  2WXN A;  3FUL A;  3FU3 A;  2Y3A A;  3ZXS A;  4F7A A;  2DL7 A;  3WXX A;  3CCL Q;  2KQW A;  1X6B A;  3CME T;  2QZA A;  4NUR A;  1H8K A;  7AT1 B;  4HB5 A;  5A0L A;  2HYZ A;  3U9W A;  3AS4 A;  2RQR A;  2QA4 Q;  3RES A;  1ACM B;  1YWP A;  4DI3 A;  4GLK A;  4O60 A;  1YYH A;  1X5B A;  3AU5 A;  3CCM T;  2A4Z A;  4HRN A;  1QW1 A;  1K1B A;  4LEU A;  1OXJ A;  1G8X A;  3LJN A;  2IG0 A;  4Z02 A;  2FRW A;  1G2B A;  4M78 D;  2DE0 X;  4I9C A;  1E6G A;  4FJZ A;  2PUO B;  2EQM A;  4YVO A;  4A1S A;  1FCH A;  1X69 A;  3G4S Q;  2C06 A;  4C92 G;  2CHZ A;  4IN3 B;  1JO8 A;  3M0S A;  1QLY A;  4QQI A;  2ATC B;  2QDY B;  2RK1 A;  4XTY A;  3FTU A;  3NPF A;  1Y0M A;  4AOF A;  2QDL A;  1CSK A;  2YLC A;  2NSZ A;  1OUV A;  1LD7 A;  3NHN A;  3QHS A;  5CCM A;  2WXK A;  3JCM X;  2J08 A;  4C92 A;  4CGV A;  4CT0 A;  2HL5 C;  3KSQ A;  5A2Q E;  3Q5M A;  3DB4 A;  4K5C A;  3B7S A;  3LY7 A;  5GMK l;  2ZZD A;  2COW A;  2NUT B;  3CCJ A;  4BT8 A;  5LJ3 f;  2QXF A;  3OSV A;  5G04 C;  2KC7 A;  4GTS A;  1VQ8 T;  4PJJ A;  3OW2 S;  2VAS A;  2EGE A;  1PRM C;  1VYV A;  4GY5 A;  2GRM A;  3UXG A;  2YWW A;  4EBA G;  3ASK A;  4AFQ C;  2ZAE A;  4ANX A;  1TN8 A;  3ASN E;  3I55 T;  4ME7 A;  3OBW A;  1FXX A;  4W9R A;  2GNC A;  1NPP A;  1HXI A;  4A4F A;  4RQI A;  2DYS E;  4J8Y A;  2DET A;  5FU7 C;  4EBA A;  3CCE Q;  1KLX A;  3ONL A;  4B0Z A;  1SW6 A;  1N95 A;  2RJC A;  4DPR A;  1ZSZ C;  2DA9 A;  2QQR A;  2RG8 A;  3ZYQ A;  5GAN e;  5GAN 5;  1K8K G;  3FTY A;  4AY6 A;  2UY1 A;  4MMK A;  4U0Z A;  3RUX A;  4MRU A;  4M77 D;  1HSQ A;  3BG0 B;  2JEK A;  1D9S A;  3L08 A;  5HCK A;  3LXU X;  1FMV A;  4C8Q G;  1YJN Q;  1IKN D;  1B3Q A;  5LJ3 j;  3PE3 A;  5AQ9 A;  4PJO G;  3Q9U C;  4FJY A;  1KQ2 A;  3T5X A;  3ZN3 A;  2PTK A;  5LJ5 g;  3VRY A;  1AZE A;  2OI3 A;  2H6H A;  4TXQ A;  4DX2 A;  4C5G A;  2C0T A;  5FIN A;  3IHY A;  3ESL A;  3VTY A;  2XG8 D;  1NJI R;  1O1S A;  3CV0 A;  3DB3 A;  2O9V A;  1WXB A;  2KNB B;  4OGE A;  4C8Q A;  5KYW B;  2AVP A;  2Y0B G;  1N4S A;  3ABM E;  1HF8 A;  2XDD A;  4PJO A;  2ZIR A;  1TUC A;  2OTL Q;  3KEZ A;  4I6G A;  3X25 B;  3DXM G;  4O6J A;  2ZPF B;  2K3Y A;  4GCN A;  2X3W D;  1VQM T;  5FRM A;  5HI7 A;  4BET A;  4I1A A;  3J81 E;  4J7W A;  1WHH A;  1OU8 A;  4HBD A;  2VGY A;  2C0I A;  2WPV A;  4EZK A;  4C0E A;  4LER A;  2EJF A;  2OAW A;  5I22 A;  2L2P A;  1E8X A;  3MJW A;  1NYF A;  2QFC A;  5KCH A;  1E7U A;  3UX4 A;  3U3W A;  2O01 E;  2YHC A;  4F7U F;  2DRM A;  3OYF A;  4YDY A;  2W10 A;  2ZPG B;  2HZY A;  4AMC A;  1N9S A;  4J83 A;  4HA8 A;  2P0Q A;  1O75 A;  4YTL A;  5BW8 C;  2BZX A;  2RM4 A;  4FA6 A;  3T5V A;  5GAO n;  3OXF A;  3FTW A;  4RSY A;  3EFO A;  2EW3 A;  1FPP A;  3N5B B;  2AW6 A;  2JLB A;  5KJN A;  3QUI A;  1U3C A;  3MJX A;  2NUP B;  2C0O A;  1JJ2 P;  1UW4 B;  3CC2 A;  3ULQ A;  2XDP A;  2DF6 A;  3UM3 A;  3CCJ Q;  1WHL A;  3ULE G;  2IFU A;  2JMA A;  2OTJ A;  4FW1 A;  3E34 A;  3CCU T;  1MMD A;  1ZQ1 A;  3TEE A;  3PMI A;  4FU6 A;  3CHO A;  2FO0 A;  3QYH B;  2JAB A;  2XGS A;  3MGB A;  2L3R A;  1YIT A;  3HTR A;  3PFS A;  2RK2 A;  2ZPH B;  4PK4 A;  3JCM V;  2GCX A;  4NL2 A;  3CPW A;  2ZXW E;  3SEM A;  1M1G A;  5J39 A;  3DLM A;  3JCM P;  1Q7Y R;  1PKT A;  5KYX B;  4EMK A;  4TUM A;  3QBY A;  3I5R A;  2OEV A;  5LJ3 d;  1ABQ A;  1A17 A;  2DD4 A;  5EDS A;  1QVF P;  2DD5 A;  4AG2 C;  5GAO r;  5ANR A;  4PJL A;  1SVX A;  3ZIM A;  3QG1 A;  1KSW A;  3EAE A;  4PS3 A;  3C0C A;  4JZ4 A;  4G23 A;  5ENT D;  1AWW A;  1GBQ A;  1YNZ A;  4E7I A;  1KPS B;  1HJD A;  2X3M A;  4M77 C;  4E7L A;  3ZUV B;  3Q75 A;  4M78 E;  2XK0 A;  1BB9 A;  1UEC A;  3CHM A;  1M9S A;  2QAS A;  3GPL A;  2E2E A;  2X35 A;  1JCQ A;  4BSZ B;  2P2C P;  2ETA A;  3VKI A;  3N71 A;  2K57 A;  3VTX A;  1VDY A;  4J9I A;  3ZFJ A;  4KUD K;  1YP5 A;  1UN9 A;  1I5O B;  3BG1 B;  2M16 A;  2DZC A;  2HL3 A;  3M58 A;  3TG5 A;  4CT4 A;  4CEM A;  1M8M A;  1UGR B;  2CDT A;  1VQK A;  4HT8 A;  4M75 D;  5D6Y A;  3SBT B;  3KS2 A;  2PVD B;  2WQ7 A;  5GJV B;  2R58 A;  4AP2 A;  4JDS A;  2CSQ A;  2L0A A;  5CQX A;  4O1O A;  3CQC B;  3PZ1 A;  5IT9 E;  2DO3 A;  1AEY A;  5GMK e;  2RFA A;  3TGO A;  1WHG A;  3RDV A;  3M9Q A;  4F7U B;  2H6F A;  5LJ3 g;  1S70 B;  1E6H A;  4EDU A;  2CSI A;  5A7D B;  1TTH B;  2KXD A;  2LQK A;  2H6G A;  4RTT A;  1TNZ A;  4UI9 K;  3DLL A;  5D6X A;  3CCJ T;  2BE7 D;  1YN8 A;  1ZBJ A;  1M1K C;  5L23 A;  2O4X A;  2GRP B;  3C94 A;  3TXN A;  1ZU2 A;  3T8M A;  3B13 A;  2LTO A;  3EU5 A;  5IH2 A;  5FLX E;  1ABO A;  3RK6 A;  2EIJ E;  1JRI A;  3MP6 A;  2RD1 A;  2GRL A;  1NL4 A;  1HO8 A;  4UI9 J;  1JBM A;  4TRQ A;  5DLO A;  1MHN A;  2H3J A;  4GYY A;  2KYB A;  3NB2 A;  3UKU G;  2L8D A;  3GNF B;  3VJP A;  1OQK A;  5BXU A;  1YFN A;  5GAN f;  3JB9 G;  2E6N A;  2HSE B;  1HFA A;  3E33 A;  4OMM A;  3MEA A;  3PUK A;  2SEM A;  3LGL A;  3CC2 Q;  2XRY A;  2EGC A;  2KAT A;  5LJ5 h;  3VLD A;  2OTL A;  2X6K A;  3FH7 A;  5LFA A;  4ILH B;  2X6I A;  1EFN A;  2OTJ Q;  4KT0 E;  1IZ6 A;  4M77 E;  4I2Z A;  4U04 A;  1SSH A;  2CHW A;  1NA0 A;  2K5F A;  2RD0 A;  2DRK A;  5DLQ E;  3T9N A;  2CH4 A;  1WQW A;  4DOW A;  4MML A;  2MMP A;  4DK5 A;  1CKB A;  1YIT Q;  3D9J A;  2R5S A;  4KH1 B;  3MV3 B;  2XID A;  4Z88 A;  2WM9 A;  3PZ3 A;  1OPL A;  4EIK A;  5I2M A;  3SQV A;  5JHA A;  4C8Q F;  2O2O A;  4G11 A;  1PHT A;  4PJO F;  4IUV A;  4NQ0 A;  1WDX A;  2OJ2 A;  3MET A;  4TVR A;  1YHQ A;  5HY6 A;  1OWP A;  5D66 A;  1KT1 A;  3L42 A;  2GBQ A;  1CKA A;  3TWS A;  2RJF A;  1YJ9 A;  3TWW A;  1WHJ A;  4ATO A;  2XS1 A;  2G3R A;  4IUL A;  4KVM A;  3I9Q A;  4L5G A;  3VRZ A;  3OYI A;  2COZ A;  2CYZ B;  3OS1 A;  4GCO A;  2CP6 A;  3NTI A;  1BPO A;  4BWR A;  4RTU A;  3LLR A;  2LCC A;  2DYR E;  5GAN j;  1VQ4 A;  1UJJ A;  3GP8 A;  1NA3 A;  4G24 A;  2QEX A;  1ZA2 B;  3CK8 A;  2NUT A;  3J5P A;  3CXC A;  2XCC A;  3LYA A;  1PSE A;  1KC8 C;  5KJM A;  5CKF A;  1RAC B;  3B7B A;  4C92 B;  4AY5 A;  2B6C A;  4RUG A;  1WX6 A;  3FUK A;  3G2V A;  3GOX A;  4GPM A;  4NAC A;  4JJC A;  2JMC A;  4WTO B;  5I21 A;  2DFU A;  1Z9Z A;  2HKQ B;  4J6W A;  4FU3 A;  4F04 B;  5FJY A;  1H92 A;  1RUW A;  1VQK Q;  2CZ7 B;  2XZT G;  4OML A;  4JJB A;  2RB6 A;  2CP0 A;  5C2Y A;  4VUB A;  3V7R A;  2KI7 A;  1WXT A;  4LUE A;  3RKW A;  3OY9 A;  3CLJ A;  3S7J A;  1N8R U;  1AP7 A;  3V30 A;  1BIA A;  3E19 A;  2A08 A;  1TUG B;  4WUY A;  4RTZ A;  3O8V A;  3RSE G;  4ANV A;  1WXU A;  3TWQ A;  4Z89 A;  5IAY A;  3OW2 P;  5ENO D;  2CT3 A;  2OVB A;  1OOT A;  5B1A E;  3LJ3 A;  1SG5 A;  5B1B E;  1JQQ A;  1VYT A;  2K3B A;  3FIF A;  1OCR E;  1PC2 A;  4RKU E;  4RG2 A;  2RPN A;  3CK7 A;  2JT4 A;  2L3S A;  2RH2 A;  2RQU A;  4YDO A;  4A4G A;  4DX7 D;  3CCM A;  1N0Q A;  2P9N G;  4F1P A;  2V8J A;  2HQE A;  4HOS A;  1OWO A;  1E8Z A;  1S72 T;  2JW4 A;  4HLE A;  1M1K R;  2F8X K;  3C3Q A;  3HXC A;  4FHJ A;  1V55 E;  2RFM A;  5CRU A;  3R9A B;  4J9E A;  1VQ7 T;  3FUD A;  3ONK A;  3M57 A;  1VQL A;  1WHK A;  2RI5 A;  3EG2 A;  2DKG A;  2HR2 A;  3U64 A;  2CP2 A;  1N27 A;  5KYW A;  2E10 A;  3SBS A;  3ASD A;  3GZ1 A;  5CBO A;  2CFZ A;  3FEX A;  3FRN A;  5CIU A;  5HKC A;  2RMO A;  5FU7 B;  3SWN C;  1KQS P;  3OQ5 A;  3O48 A;  1D1B A;  3QNK A;  3EU9 A;  1HYO A;  1ZSZ B;  1M5Q 1;  4MDW A;  2FPD A;  4FHK A;  1VQ6 A;  4DQ2 A;  4C8Q B;  5KYY B;  3A5Z B;  4M7D G;  3FHE A;  3BE3 A;  1JU5 C;  1T0H A;  3EHM A;  4PJO B;  4ME2 A;  5LOZ A;  5CED B;  4WND A;  4I6E A;  2A7Y A;  3UT8 A;  4HT9 A;  1NEG A;  5GAO m;  1VQ8 A;  4BT9 A;  5LCW C;  1Z3Y A;  2AWI A;  3PH0 C;  2FPF A;  5A6C A;  4YND A;  4XK8 E;  1PKS A;  4M75 E;  4WNF A;  1QNF A;  1YHQ Q;  4LDU A;  5I2S A;  2VGX B;  4O5V A;  3KXT A;  3Q7F A;  3TWT A;  4OF1 A;  1QVG A;  3IV0 A;  2FPE A;  4M7D A;  1N4Q A;  3BDU A;  1YJ9 Q;  4M7A D;  2YHE A;  2I2L A;  5LJ3 e;  1Y8M A;  3I55 A;  3BW1 A;  4ZNX A;  1K76 A;  2CZ6 B;  3CVQ A;  4L2L A;  3V7S A;  4CDR A;  5CEA A;  1VYU A;  2JS2 A;  3FWV A;  5FZQ A;  1VQ4 Q;  1PY1 A;  1UGS B;  2QEX Q;  2PM7 A;  2D0N A;  3VS5 A;  3VUZ A;  3EFO B;  2KY9 A;  1EYH A;  2DL4 A;  2DIW A;  2X3X D;  3WG7 E;  3I4G A;  3HPW A;  2P9P G;  5I11 A;  4AEZ C;  2HKN A;  3EH2 A;  3SB2 A;  2DZO A;  3LCA A;  4I1M A;  3JCM c;  4ZTF A;  4B9W A;  1KC8 R;  2YLB A;  2WVI A;  4F17 A;  4UWL A;  2J49 A;  2A0F B;  3NZU A;  1D0Y A;  2JVV A;  3EDT B;  2NLU A;  4ZHB A;  5EIB E;  3NMZ C;  3OYM A;  4E7S A;  2MWO A;  1WPY A;  3QDF A;  3ZXP A;  5KYX A;  3G71 T;  2C0L A;  4U8H A;  4JRP A;  4FP7 A;  2XEN A;  5CKH A;  5GAN g;  4CRW A;  1LPL A;  2MCN A;  3MP8 A;  3G2W A;  2LP5 A;  3IBE A;  3OBY A;  2RQT A;  4EMK B;  3JB9 F;  3TJP A;  1KZO A;  2KE9 A;  1G3S A;  2DL3 A;  1LJO A;  2GTJ A;  4ANJ A;  4XX5 A;  2QGG A;  3U66 A;  2BIV A;  3CCM Q;  3SFZ A;  1VQM A;  1KHI A;  3VV0 A;  3SNX A;  2D8H A;  2CUB A;  2BKG A;  4OVV A;  1V1C A;  2SRC A;  2FZG B;  1OCO E;  1EZZ B;  4OMQ A;  5D6W A;  2V5F A;  4BB7 A;  1QZ2 A;  2F8Y A;  1P92 A;  5KYU B;  5EKQ D;  2WXO A;  2W0Z A;  1JCR A;  1RAI B;  1VQL Q;  4HCC A;  3UDC A;  4HOU A;  3OYC A;  1H64 1;  4BDZ A;  5FIO A;  4F7U G;  1ELK A;  4DBH A;  1VQN T;  1I8F A;  1ZHI A;  3CGH A;  4WWN A;  3H0I A;  1KD1 R;  2LNH B;  4XU0 A;  2FYK A;  2XCB A;  5FQ6 A;  1YHQ T;  4M7C A;  2RHU A;  5LCW J;  2DLP A;  4QW2 A;  5CCL A;  4PKC C;  4B6M A;  1AOJ A;  1YJ9 T;  2CP7 A;  4Q94 A;  4XU1 A;  3Q1J A;  1VQ6 Q;  3CKB A;  5JHB A;  4B93 B;  2PVG B;  2J8S D;  2GF7 A;  3UT1 A;  2VUB A;  4LG6 A;  3V8K A;  3G7Z A;  1IXV A;  4F7U A;  5FW9 A;  4GZD A;  2JS0 A;  1GCQ A;  2LT1 A;  1OCZ E;  1Z9Q A;  3SD4 A;  1NYG A;  2QEX T;  1X6G A;  4ELY C;  3RRM B;  4XU2 A;  1VQ8 Q;  3E4B A;  3V79 K;  2VKN A;  3CCU A;  5JJ7 A;  1QKW A;  1W6X A;  2FF4 A;  4OYS A;  1Q86 C;  1H6P A;  4L7T A;  3SFY A;  1E96 B;  2MPX C;  3HRT A;  5G05 J;  3TL5 A;  2WXQ A;  3B95 A;  3RMS A;  2UWJ G;  3EH1 A;  3X20 B;  2KM4 A;  4QQ6 A;  3I55 Q;  4M7A C;  3FB9 A;  3M5A A;  2GQI A;  2OVF A;  1RAD B;  2KK4 A;  4OB0 B;  5IHI A;  1NBE B;  4EPC A;  4HXJ A;  1JB0 E;  5GAM j;  3VS0 A;  3PNL B;  3ZNG A;  3UI2 A;  3SD5 A;  3DST A;  2C2L A;  4GTM A;  5DY9 A;  3EGU A;  2RJD A;  1N6A A;  2KXP C;  1HS6 A;  1TG0 A;  1W4S A;  4E7H A;  3HRA A;  3TG4 A;  3L2U A;  3JCM d;  4CRI A;  3ISM C;  1WY6 A;  1TR4 A;  1TYQ G;  3HDX A;  2M63 A;  4TXP A;  2YHT A;  4V2S A;  2X6H A;  3JRZ A;  2XS8 A;  5FWC A;  3OYG A;  5ENQ D;  1TUD A;  2XZD G;  2XGO A;  3AT1 B;  3ZYK A;  2JOY A;  4U07 A;  4H7Y A;  2GGR A;  5ARF A;  4DBR A;  2XU8 A;  1IHB A;  4XI0 A;  1Q82 U;  2WQH A;  1BI8 B;  5IY5 E;  5KBA A;  3PE0 A;  1UG1 A;  4KZC A;  2DX1 A;  2HAX A;  1IHG A;  1UOH A;  5AIJ A;  5EX0 A;  3SF4 A;  1I81 A;  4JA9 A;  2HE0 A;  3C3R A;  3J5Q B;  3H41 A;  4LUN U;  4GMR A;  2WXG A;  4CC4 B;  1VQL T;  4N5C A;  3M0P A;  5AQ7 A;  3S7B A;  2VB6 A;  3TWX A;  4N4I A;  2MI6 A;  4ORZ A;  2NXP A;  3D9N A;  4LN2 A;  4ACK A;  2EYY A;  2LDM A;  4ZGD B;  2XPI A;  4AIF A;  1VQM Q;  3MHX A;  1WGS A;  3OMG A;  5AAO A;  4L9P A;  1IRX A;  4M7D F;  2H8H A;  2WXL A;  1VQ6 T;  1NZ9 A;  3URG A;  3MZL B;  3SFX A;  1D0Z A;  4I2W A;  2V1Q A;  4N4H A;  4ELZ C;  2EKO A;  3C72 A;  3A8O B;  2J9Q A;  3UA6 A;  1OCC E;  3JCM g;  3D9P A;  4DBQ A;  3HFN A;  4PNO A;  2X6F A;  2VQ2 A;  2EKH A;  4IIO A;  4BTA A;  1BCO A;  5ARG A;  4BE1 A;  4M7A E;  3E30 A;  3GIB A;  1VQ9 A;  3Q15 A;  1O1T A;  3I56 A;  4AVX A;  1R0C B;  2QG9 B;  1MZC A;  1QVF A;  2EPD A;  2YDL A;  2FEZ A;  3MEW A;  2H3E B;  4DI4 A;  1AVZ C;  2L3P A;  2IO2 C;  3FTZ A;  2L5Q A;  3L13 A;  3UIP C;  1D0X A;  2LQN A;  3FY4 A;  1U3D A;  1INZ A;  3UUX A;  2X4Y A;  2RA2 A;  1MND A;  4X9D A;  5AYF A;  4G2V A;  4GB9 A;  5GAM d;  5ENP D;  2RHX A;  1W2B S;  1TJF A;  3GZ2 A;  1W3B A;  2YIN A;  1BCM A;  2EAY A;  5GAM h;  3MA5 A;  3CCU Q;  3O4Z A;  2XHE A;  2R02 A;  2KAF A;  3QB2 A;  3DEO A;  4I9E A;  1DC2 A;  3KAE A;  3MYV A;  4U8V D;  1XNF A;  3DBS A;  1OZ3 A;  4R7L A;  2XD0 A;  2L0I A;  1NE8 A;  2JZ2 A;  2KCL A;  4HCZ A;  5L8R E;  5G55 A;  3DSV A;  3URZ A;  4OMP A;  4N3B A;  1RAE B;  4GLM A;  1Q86 U;  1DCE A;  3B7T A;  3F6Q A;  3HKS A;  2XHC A;  4X34 A;  1AT1 B;  4BI4 A;  5T3R A;  2PL2 A;  2L3Q A;  2QAZ A;  4ZN3 A;  2EIN E;  1FT1 A;  2A5U A;  1N9R A;  2E12 A;  1TH7 A;  5AN8 A;  1D3B B;  5CKE A;  3G2U A;  4C0G A;  3D9H A;  3VLF A;  1ZSZ A;  4IUR A;  4OMO A;  2IQC A;  1U5S A;  2J7I A;  3QAR A;  5KYY A;  3G6E T;  3BU8 A;  2BF0 X;  2DVJ A;  1YA0 A;  4PJM A;  2M0Y A;  3G1J A;  3DWL G;  3QK0 A;  1PAQ A;  3L2Z A;  3H0H A;  1A0N B;  3U23 A;  3S7F A;  2QQA A;  1UGP B;  1X2Q A;  1T0J A;  2MAM A;  5IN1 A;  1QYM A;  3QC1 A;  3PS6 A;  1SHG A;  3Q79 A;  3GYZ A;  3ME9 A;  5FT9 A;  2VJ8 A;  3D9K A;  3ZU7 B;  2PNI A;  4M78 C;  1HG2 A;  2VGX A;  1ZB1 A;  2MWP A;  3VU3 C;  3OYY A;  2YUP A;  2JM8 A;  3ASH A;  3RJV A;  1HZ4 A;  1QCN A;  2CG3 A;  3CQT A;  1NFI E;  3D9M A;  4J7I A;  1EF1 C;  4M78 G;  4PLL A;  5GAN 2;  3OB9 A;  4I6J A;  1KT0 A;  2YRV A;  5HQ8 A;  2KBX A;  2J6O A;  4M7D B;  4EZL A;  4YDE A;  2DL8 A;  3SWN B;  5FTP A;  3F70 A;  2E5Q A;  3S7D A;  3CHS A;  3ULY A;  4C0M A;  1H19 A;  3UM2 A;  5ENN A;  3HIZ A;  4BX9 A;  2E3H A;  4N0A C;  4P5N A;  3RIR A;  2EIF A;  3CK9 A;  2Y4T A;  2YT6 A;  2V8S E;  3KFV A;  2WXP A;  1HXD A;  4KRT A;  2DBA A;  2MIO A;  4MBG A;  1DNP A;  1IYG A;  4XKB A;  1WQ7 A;  4LD9 K;  1TJC A;  3JCM Q;  4IUU A;  1TS9 A;  3ML9 A;  4ESR A;  3CMA T;  4HS2 A;  1IRE B;  2E6Z A;  2AJA A;  2HMA A;  4C48 B;  4C0D C;  1M90 U;  4GA2 A;  4UI9 C;  5E75 A;  1RL2 A;  2F2X A;  1VQ9 Q;  4WNG A;  1S72 A;  3I56 Q;  5EN5 D;  1D8D A;  3X26 B;  3J7A F;  4MDX A;  3B7U X;  2BTT A;  5CKD A;  1K4U S;  4Y6W A;  3MEV A;  3RRN B;  3CSF A;  2ED0 A;  2X4W A;  2QQS A;  3JAM E;  4A55 A;  1VQ7 A;  3HHT B;  3CVU A;  3PE4 A;  1D1C A;  1M30 A;  1QBQ A;  2Q7F A;  3CXC S;  1RLP C;  2AKL A;  3SY2 A;  4J6X A;  5HKP A;  4A63 B;  5FQ4 A;  1WI7 A;  1QWE A;  1OWM A;  3L2V A;  3E32 A;  3GW4 A;  1FMK A;  2XPZ A;  3AG1 E;  5AQA A;  2LAI A;  1UDL A;  2E64 A;  2HQH A;  1QQJ A;  1WNL A;  3UWN A;  4DA4 A;  3S3O A;  1Q81 U;  1KHC A;  1TOV A;  4A3V A;  4HQD A;  1B34 B;  2G6F X;  4OP0 A;  2WXJ A;  2JTE A;  1TNU A;  3S2A A;  1MYO A;  1OT8 A;  1IGQ A;  1SRM A;  2K4Y A;  2VV5 A;  5J3B A;  2PUK B;  3DSW A;  4BI3 A;  1XJW B;  2I0N A;  1JEG A;  4FT4 A;  2F69 A;  3JXJ A;  2QQ9 A;  2YUQ A;  3REB B;  2CH4 W;  5KYU A;  2CP3 A;  4C9B B;  3MCX A;  2VSX E;  4AXH A;  3UKR G;  4DX6 D;  1PC0 A;  1RAA B;  2J4B A;  4M77 G;  4DUI A;  2NC9 A;  1P5Q A;  3LYI A;  2IOL A;  1SF9 A;  1I0C A;  2EVR A;  3FH5 A;  1M3B A;  4F16 A;  1AWC B;  4RVB A;  3M54 A;  2F5K A;  3M56 A;  4CC3 A;  1KK7 A;  3UM0 A;  3C4S A;  4JA7 A;  1N8R C;  1FVF A;  3CVW A;  2E65 A;  1MHQ A;  3FU0 A;  2D6F A;  3BY7 A;  3M0R A;  3UTM A;  1TWB A;  2ROL A;  3JCM e;  3ML8 A;  2ZIS A;  5B3S E;  4HKE A;  3ZPJ A;  1OUL A;  1HE8 A;  3AS8 A;  3RKV A;  4J8S A;  2EIK E;  2LCS A;  2B86 A;  4M77 A;  2ROT A;  4CDN A;  5A0D A;  2DM1 A;  4FYY B;  1K9M U;  2J6F A;  2P9L G;  3FH8 A;  4FUL A;  1IQU A;  1TNO A;  4UQZ A;  3SHW A;  4A4K A;  2DMO A;  2K79 A;  2RHZ A;  2K2M A;  3UF4 A;  3VS7 A;  4PFZ A;  1FT2 A;  3JV3 A;  3A8M B;  1K8A C;  2XIC A;  1OWL A;  2FL7 A;  2JTF A;  4X9C A;  4JHJ A;  1MMG A;  4A4H A;  4AT1 B;  2CS7 A;  1XOV A;  1KQS A;  3G71 A;  4WNE A;  1VQ9 T;  3I56 T;  2KMT A;  4XE0 A;  3LPZ A;  4N39 A;  3E9G A;  4NS5 A;  4JZY A;  4I1O B;  5EX3 A;  4GPK A;  3H6Z A;  1SZA A;  5AJL A;  1W1F A;  3LKU A;  1E8Y A;  3M53 A;  2ESW A;  2DZ9 A;  3AS5 A;  3D9L A;  4JC8 A;  2RI2 A;  1YCY A;  4LXC A;  3AG4 E;  3UIN C;  2J4D A;  1ZLM A;  3QZ5 B;  4A1G A;  1QVG S;  2D0Q B;  3QO3 A;  4KUL A;  3FJP A;  2DTH A;  5A0G A;  4X1V A;  3PRE A;  1UUE A;  1S72 Q;  2RQW A;  1Z3X A;  5M9O A;  3DEP A;  1MV3 A;  2YUN A;  1LTX A;  1VQ7 Q;  2WB2 A;  1OX9 A;  2EGA A;  5CER B;  2P9S G;  3KUF A;  4BI8 B;  5BUZ A;  2VXE A;  2ZGG A;  4L2Y A;  3PIO A;  1WJQ A;  3BUA A;  4KBQ A;  3RRU A;  4B94 A;  4BSX A;  4PLI A;  1VQN A;  1O1R A;  1X6O A;  4U63 A;  2EQI A;  3C98 A;  4J5Y A;  1W70 A;  2VVK A;  3VLE A;  4ATG A;  4BY6 B;  1UGV A;  1MNE A;  1M4Z A;  1M8V A;  2QGF B;  1SA5 A;  4GML A;  1AWO A;  1XGW A;  5GAM e;  5GAO p;  4J9B A;  3I5P A;  4B8A A;  4BX8 A;  4HVU A;  5ENS D;  4BEP A;  2KEA A;  3CKC A;  2Y4Y A;  3MX3 A;  2FHD A;  1C1A A;  3CR3 A;  2LC4 A;  2D1X A;  4PJN A;  1N4R A;  3A8H B;  1RI9 A;  3I3N A;  4BUG A;  5KE2 A;  1OPK A;  1Y96 B;  3P8H A;  4U0S A;  2VYI A;  3P2B A;  4OAV B;  4MLP A;  4L1B A;  4LE9 A;  3CBP A;  1WLP B;  4J9G A;  1LOJ A;  2EIM E;  1GBR A;  3CCV T;  2KSS A;  1MX2 A;  1MV0 B;  1YIJ A;  1HG5 A;  1MJ0 A;  3JYS A;  2MK5 A;  3MEU A;  1WAO 1;  2HSP A;  2LXM A;  4CCA A;  4M75 C;  2I1K A;  2GTO A;  4M78 F;  4RCB A;  2PZI A;  4AFZ C;  3EHR A;  1N8R R;  2IOS A;  4R56 A;  3JB9 H;  4PFO A;  1MMA A;  3D3M A;  4FLB A;  2K5L A;  4YDW A;  1N9A A;  4LD6 A;  2KRM A;  4JLG A;  3CEQ A;  1TN7 A;  2M02 A;  1LNX A;  2KCK A;  2WAC A;  3EG3 A;  2C0M A;  4GTT A;  4N3A A;  4Q5W A;  5CO7 A;  5CMY A;  1OI1 A;  3M0U A;  2DK3 A;  4CC2 A;  2DIQ A;  4XTZ A;  3HXB A;  1SEM A;  5BPP A;  3C3O A;  2LSV A;  5EID A;  3OSS C;  3UAT A;  3AHU A;  5GAN 3;  1BBZ A;  4FLH A;  3NGP A;  4OVA A;  2AKK A;  5CAI A;  3G71 Q;  3CD6 A;  2CG2 A;  1TSF A;  4Z68 A;  1ZUU A;  4DEX A;  4D10 C;  2ZPE B;  3NOG D;  2R2L A;  4RCC A;  1W2B P;  3RIB A;  2MF2 A;  3G2T A;  1K8A U;  2DXU A;  2O88 A;  3HSB A;  3RNJ A;  1D3B A;  4G8K A;  3CCQ T;  4RTV A;  2R03 A;  1K0X A;  4LRZ A;  1SPK A;  2DBK A;  3HFO A;  3JSC A;  2BKD N;  4J9H A;  5FRN A;  2VXF A;  5DBK A;  1SHF A;  1SQM A;  1B7T A;  3A1P A;  4AFU C;  3EGD A;  2AXZ A;  3UM1 A;  1SRL A;  4FSS A;  2PQR A;  2EQU A;  1X75 C;  2EFI A;  3FLG A;  1BI1 A;  4JXT A;  3FUJ A;  1Q95 G;  1S63 A;  3I35 A;  1N0R A;  3TSZ A;  3K9I A;  3CVL A;  3EHQ A;  1UG3 A;  3FUF A;  4GTV A;  4JD2 G;  4PDX A;  1Y07 A;  4KGZ B;  3RER A;  5H7P A;  4BES A;  4O6F A;  1VQN Q;  1OY3 D;  3JCM f;  4M77 F;  1YWO A;  1JWG A;  2B8A A;  3OYB A;  2M9U A;  1NZN A;  3AG3 E;  5LJ3 h;  2P4T A;  4K03 A;  2A28 A;  2CT4 A;  5GAN 4;  1RZ4 A;  3SWN A;  3RBB B;  2XEE A;  4FC8 A;  3TXM A;  2OOE A;  2LX7 A;  3H0F A;  5AT1 B;  1X81 A;  1G83 A;  4BE2 A;  2AZS A;  2K3X A;  4J6Y A;  2VGE A;  3QWV A;  1WM5 A;  1FWZ A;  4GZ5 A;  2M51 A;  4FT2 A;  1YI2 A;  2AXV A;  1B89 A;  5CEC B;  3VS3 A;  4RTX A;  1VQ5 A;  2PVO B;  4N2Q A;  3NOC D;  3PTA A;  5G05 C;  5JMN D;  3RR6 A;  4AV7 A;  1NLP C;  1T3S A;  3BQO A;  3SHF A;  2HBW A;  3ENE A;  3SDZ A;  3C5R A;  2F1L A;  3CC7 A;  2XGM A;  1VQP A;  2RHY A;  1K73 U;  3Q49 B;  1IB8 A;  4M78 B;  1Q82 C;  3WXM B;  2KXC A;  2XI9 A;  4C5E A;  2LAH A;  5D2M C;  4OB2 B;  1YIJ Q;  3UPU A;  2F2W A;  2QYZ A;  3EGX B;  4UQY A;  2EQX A;  3Q7A A;  4K0R A;  2FVU A;  3FU5 A;  4J8O A;  5AYW D;  2HQX A;  4ZGJ B;  1N11 A;  2GW1 A;  2Y4X A;  1OZ2 A;  3TSW A;  3V7C A;  4CGW A;  1AHJ B;  2FI7 A;  1B34 A;  1E90 A;  3U4T A;  3G6E A;  1X01 A;  1NLO C;  4QQG A;  2X38 A;  3KEA A;  1PM3 A;  1HU3 A;  1QVF S;  4KGV B;  4C92 D;  3UPV A;  3Q73 A;  3RU0 A;  1E7V A;  1UTI A;  3CXC P;  3JUE A;  5CRV A;  4WAF A;  3W9F A;  4HCB A;  3CD6 Q;  4APF A;  3Q9N C;  2BUD A;  2E70 A;  5GAO l;  4KT6 B;  1U06 A;  3MCA B;  4EMH A;  4LCT A;  4JJD A;  3L22 A;  3HRU A;  2DEQ A;  2IPO B;  2GQV A;  5GAM f;  5GAN 7;  2WQ6 A;  3BDL A;  2V5Q C;  1AD5 A;  4ZN1 A;  5D0Q D;  4O1P A;  2DER A;  1LF8 A;  3QII A;  4AG1 C;  4A3T A;  2BE9 B;  1WG0 A;  4B8C B;  4JEU A;  4MS6 A;  1GXI E;  3PNT B;  3QZ9 B;  4II1 A;  2VSO E;  4NRH B;  3LWH A;  4I43 A;  4L23 A;  2EYZ A;  1H3Z A;  3MPU B;  2CZ0 B;  1O9S A;  4ACL A;  2QYU A;  2DNU A;  2DXC A;  4PL6 A;  4HI9 A;  3L2W A;  4DOV A;  2YSQ A;  1U3O A;  2HCK A;  1BYM A;  4M77 B;  3M4Y A;  3CMA A;  2HM8 A;  3THK A;  2MHK A;  4N2S A;  1XNI A;  1KD1 U;  3DXK G;  1VIE A;  2LVM A;  5FQ8 A;  4EMG A;  5C0M A;  4D6W A;  4ILI A;  3ASF A;  3E1S A;  1Z5S C;  4RG6 A;  3UT7 A;  4MZM A;  3FDR A;  5BV1 A;  5GMK i;  4Q69 A;  1KJW A;  1YIJ T;  5LJ5 j;  3SFM A;  4GU5 A;  5KE3 A;  1RAH B;  1I5L A;  5HK0 A;  4GTO A;  1U8R A;  5BXO A;  3TU4 K;  2P9U G;  1WFW A;  1YI2 Q;  3SI5 A;  4ABN A;  2OAU A;  2ZCF B;  2MYO A;  4D8K A;  4LSZ E;  5CCA A;  4L6V 5;  4M7A G;  3GNG A;  1Q2Z A;  2YRC A;  3A98 A;  1JWF A;  3UT4 A;  4M75 F;  5GMK m;  1ZSG A;  1GCP A;  2J09 A;  2MYS A;  1X27 A;  2GRN B;  4C8Q D;  2RI3 A;  3RKX A;  2VGN A;  3CC7 Q;  1MUZ A;  4PJO D;  4G8L A;  1MGQ A;  2DCP A;  1VQP Q;  4J8D A;  1T3L A;  2XDB A;  4KGX B;  2KT1 A;  5AJD A;  3CIA A;  2V8I A;  4C0F A;  3ZVV A;  4N5Q A;  3ZKJ A;  2GRR B;  3FUH A;  4M7A A;  5IXB A;  4ANU A;  2JJ9 A;  3L6A A;  4KH0 B;  1Q82 R;  1FX7 A;  3MV2 B;  3UIO C;  2JM9 A;  2LUH A;  1NJI C;  3OYJ A;  2X51 A;  3HVE B;  3CD6 T;  4OMN A;  1VIF A;  4BE0 A;  3OYK A;  1QVG P;  5FZS A;  4BY6 A;  3M0T A;  4RLY A;  1WIE A;  2E5K A;  3V2O A;  2NYS A;  2LJ1 A;  3HG0 D;  3IKO B;  1JJ2 A;  2L6J A;  4HI8 A;  3MKQ B;  3QKY A;  2J06 A;  3QJZ A;  1RW2 A;  3G6E Q;  3L9T A;  2KVQ G;  1XQH A;  2L6B A;  4F7U E;  3ABK E;  3OYE A;  2ETB A;  3H9N A;  2P4R A;  1YCS B;  5HRY A;  2I1J A;  5KNG A;  2GGF A;  2IU1 A;  4C92 C;  4JPB W;  3ULR B;  3BEE A;  3VUB A;  2K9G A;  3L2R A;  1M90 C;  3CPW S;  1Y96 A;  3TWU A;  5LP0 A;  5A23 A;  1ZUK A;  4R0K A;  3OS0 A;  2MOW A;  4NIK A;  2NYJ A;  4ATZ D;  5ECA A;  4GAA A;  1YJW A;  2P9K G;  4BAC A;  1ELR A;  1PG5 B;  2P9I G;  4C0Z A;  2R5A A;  1BU9 A;  3HXF A;  1HD3 A;  2RHI A;  2XRZ A;  3ZYM A;  2NUZ A;  3OMC A;  3CVX A;  3JUI A;  3VS4 A;  4CC7 A;  3KD7 A;  4EPZ A;  1SA4 A;  1PRL C;  1UJY A;  1LD8 A;  5CR2 A;  4WCI A;  3PEV B;  1C6V X;  5KJL A;  2D8J A;  3TRE A;  3EIQ C;  1Q81 C;  3CQG B;  1NEB A;  1UHC A;  2EJ9 A;  3LEW A;  4HOR A;  5LJ5 d;  3X24 B;  2WXI A;  3NQP A;  1YI2 T;  3EG9 A;  3V31 A;  4CI0 C;  3DRA A;  3CMA Q;  1G3W A;  3EUV A;  2AT1 B;  2KBT A;  5ANL A;  3OYH A;  1VQ5 T;  3PT9 A;  2I2O A;  3R6N A;  4DLO A;  5GAN h;  4P29 A;  2P84 A;  3EG0 A;  1OEB A;  2AHJ B;  2IO3 C;  1Q7Y C;  1VUB A;  3NZS A;  3CC7 T;  3L54 A;  3QWX X;  1DVP A;  1BK2 A;  3FUM A;  1VQP T;  3ZHE A;  3E37 A;  2EQJ A;  4WWO A;  2P0P A;  1Q86 R;  2WSF E;  3L16 A;  4M75 B;  4G25 A;  2CGH A;  5BT1 A;  2WXM A;  4XZ4 A;  5IXF A;  5FRO A;  1Z6T A;  2FUL A;  1OYX A;  5CHE E; 
#chains in the Genus database with same CATH homology
 2K7A A;  4DRX E;  2BZY A;  2A5E A;  2J6F A;  1GFC A;  2JW4 A;  5GJW B;  3REA B;  2F8X K;  3SHW A;  4J9E A;  2QYJ A;  2RFM A;  3SO8 A;  2DMO A;  2K79 A;  1S1N A;  2K2M A;  2A36 A;  5EYP F;  1GFD A;  1AZG B;  3UF4 A;  3VS7 A;  3JV3 A;  3EG2 A;  4HVV A;  2LJ3 A;  4RTW A;  4HNA D;  1XOV A;  5CBO A;  4K11 A;  2RMO A;  2IIM A;  3ZL7 C;  3TWV A;  3EU9 A;  2FPD A;  1BI7 B;  1W1F A;  5IHN A;  1JU5 C;  1T0H A;  5CED B;  2DBM A;  2ESW A;  4F6R D;  2DIL A;  2PNN A;  1NEG A;  4LNU D;  1ZLM A;  1LCK A;  2FPF A;  2JXB A;  2BZ8 A;  1PKS A;  3PVQ A;  3JXI A;  4X1V A;  1MX4 A;  4BER A;  2XMF A;  1UUE A;  3TWT A;  1QCF A;  1X43 A;  2RQW A;  3TVT A;  3DEP A;  4K5A B;  2FPE A;  1MV3 A;  4JZ3 A;  2YUN A;  2DL7 A;  3M0Q A;  4ZNX A;  3IXE A;  4QFV A;  1K76 A;  2EGA A;  5CER B;  1X6B A;  5CEA A;  1H8K A;  3I5S A;  4HB5 A;  2ZGG A;  2RQR A;  1VYU A;  2JS2 A;  1YWP A;  4O60 A;  2EQI A;  2KR3 A;  1YYH A;  1W70 A;  4OAU C;  2D0N A;  2VVK A;  3VS5 A;  4HRN A;  2FRY A;  1UGV A;  1K1B A;  2DL4 A;  2KRO A;  2X3X D;  3LJN A;  2FRW A;  1G2B A;  1AWO A;  2DE0 X;  1E6G A;  5I11 A;  2DZO A;  1X69 A;  4J9B A;  4HVU A;  3TWR A;  5ENS D;  4HRL A;  4BEP A;  2KEA A;  1JO8 A;  3M0S A;  4F17 A;  1H3H A;  1QLY A;  4QQI A;  1BLX B;  2D1X A;  2V1R A;  1G3N B;  3NPF A;  4ZHB A;  5EIB E;  1RI9 A;  3NMZ C;  1Y0M A;  1OPK A;  2QDL A;  1CSK A;  2A37 A;  1I1J A;  1MX6 A;  3NHN A;  4OAV B;  4DEY A;  4LE9 A;  1WLP B;  4J9G A;  2XEN A;  1GBR A;  2MCN A;  1J3T A;  2LP5 A;  1MX2 A;  1MV0 B;  1MJ0 A;  2RQT A;  4K5C A;  4QT7 A;  2ED1 A;  2HSP A;  3QWY A;  2KE9 A;  4DX1 A;  2DL3 A;  2YUO A;  2GTO A;  4J9C A;  2GTJ A;  4AFZ C;  2ABL A;  3EHR A;  5CBN A;  2EGE A;  1PRM C;  2AZV A;  1VYV A;  2F2V A;  3UXG A;  5EC7 A;  2FEI A;  2D8H A;  2CUB A;  2BKG A;  1V1C A;  2SRC A;  4AFQ C;  5IHK A;  4OMQ A;  2KT8 A;  4YDW A;  2KRM A;  3VS1 A;  2F8Y A;  2FG0 A;  2GNC A;  2W0Z A;  3EG3 A;  3O5Z A;  5FIO A;  3M0U A;  2FO1 E;  3V2X A;  1AWX A;  4J8Y A;  3H0I A;  1SEM A;  4CC2 A;  5EID A;  2LNH B;  3UAT A;  1BBZ A;  3NGP A;  4D8D A;  2AKK A;  1OV3 A;  1ZUU A;  4Z68 A;  2DLP A;  1SW6 A;  1M27 C;  2KYM A;  4DEX A;  3NOG D;  1VA7 A;  2DA9 A;  1AOJ A;  2O31 A;  2PZ1 A;  2O88 A;  3RNJ A;  4B93 B;  2J8S D;  1HSQ A;  4G8K A;  5JA4 D;  4LG6 A;  4RTV A;  1D9S A;  1IXV A;  1SPK A;  1K0X A;  2DBK A;  5FW9 A;  4J9H A;  5HCK A;  1UJ0 A;  2JS0 A;  1GCQ A;  1Z9Q A;  3T9K A;  1NYG A;  1IKN D;  1B3Q A;  1PWT A;  5AQ9 A;  1NG2 A;  1X6G A;  2CUD A;  3V79 K;  2VKN A;  3Q9U C;  1SHF A;  2MOX A;  1QKW A;  1W6X A;  4AFU C;  2PTK A;  4JB8 P;  1SRL A;  2LMJ A;  3VRY A;  1AZE A;  4FSS A;  2OI3 A;  4DX2 A;  2C0T A;  5FIN A;  3B95 A;  3VS2 A;  3I35 A;  1N0R A;  3TSZ A;  3W9G A;  2GQI A;  1WXB A;  3EHQ A;  2KNB B;  2O9V A;  5IHI A;  2KRS A;  2Y0B G;  4BES A;  4HXJ A;  5AAR A;  2ENM A;  1TUC A;  3VS0 A;  1OY3 D;  2DYB A;  3ZNG A;  2O9S A;  3UI2 A;  3EGU A;  2KXP C;  1TG0 A;  1YWO A;  4LUD A;  3HRA A;  2QC9 A;  1GRI A;  2X3W D;  4E6R A;  4BET A;  1BD8 A;  4J7W A;  2A28 A;  1TR4 A;  4HBD A;  2C0I A;  2CT4 A;  3RBB B;  2XEE A;  2LX7 A;  2OAW A;  3H0F A;  5I22 A;  4RTY A;  1G83 A;  2AZS A;  2L2P A;  1NYF A;  5FWC A;  2VGE A;  4M4Z A;  5ENQ D;  2M51 A;  1TUD A;  2XZD G;  2DRM A;  2ECZ A;  5CEC B;  3VS3 A;  4YDY A;  4DX5 D;  4RTX A;  2W10 A;  2DVW A;  3NOC D;  2K6D A;  1ZX6 A;  4IIM A;  2GGR A;  5JMN D;  1NLP C;  1T3S A;  2BZX A;  1IHB A;  2HBW A;  1KIK A;  1B07 A;  1I07 A;  1BI8 B;  3C5R A;  5KBA A;  3PE0 A;  1UG1 A;  1E7O A;  2DX1 A;  2CRE A;  2EW3 A;  4LNP A;  1UOH A;  2HE0 A;  1IO6 A;  2KXC A;  3J5Q B;  4U8Y D;  5EYL A;  1QKX A;  2HEQ A;  3H41 A;  3LH5 A;  2C0O A;  4GMR A;  4CC4 B;  2F2W A;  4J9F A;  3M0P A;  2DF6 A;  5AQ7 A;  3TWX A;  4ORZ A;  2JMA A;  4LN2 A;  1N11 A;  2EYY A;  3TSW A;  2FO0 A;  5KNH D;  4HRM B;  2JAB A;  2LZ6 B;  5AAO A;  2J05 A;  4U95 D;  2H8H A;  2J6K A;  5ENR D;  2V1Q A;  1NLO C;  3SEM A;  3KEA A;  3UA6 A;  1PKT A;  2EKH A;  4TUM A;  4IIO A;  2HDA A;  3I5R A;  1ABQ A;  1UTI A;  3JUE A;  4ZFH A;  3W9F A;  4HVW A;  2EPD A;  3NBN B;  2YDL A;  4AG2 C;  1SVX A;  1AVZ C;  3Q9N C;  2L3P A;  5HS0 A;  1KSW A;  3C0C A;  4JZ4 A;  1U06 A;  2LQN A;  5ENT D;  4JJD A;  1AWW A;  1GBQ A;  1YNZ A;  2F37 A;  1HJD A;  2EYX A;  3ZUV B;  2V5Q C;  1AD5 A;  1BB9 A;  5ENP D;  2RNA A;  4O1P A;  1UEC A;  4Z8A A;  4AG1 C;  1WG0 A;  4BSZ B;  2P2C P;  2ETA A;  1Y57 A;  3DEO A;  4J9I A;  3AJI A;  1DC2 A;  1YP5 A;  2DL5 A;  3FJ5 A;  4U8V D;  2EYZ A;  4HLL A;  1M8M A;  2CDT A;  2DNU A;  4HI9 A;  5ITZ F;  1BU1 A;  2YSQ A;  1U3O A;  2HCK A;  4OMP A;  4GLM A;  3GBQ A;  5GJV B;  3F6Q A;  1FYN A;  3THK A;  2CSQ A;  1AWJ A;  2L0A A;  1JXM A;  4O1O A;  2AK5 A;  1AEY A;  2L3Q A;  4UUC A;  2RFA A;  5AN8 A;  1ZUY A;  4Y92 A;  1S70 B;  1E6H A;  1JXO A;  3D9H A;  2CSI A;  1KJW A;  2KXD A;  4OMO A;  1U5S A;  2J7I A;  2NWM A;  4RTT A;  2DVJ A;  1RLQ C;  5BXO A;  2M0Y A;  1WFW A;  1YN8 A;  1ZBJ A;  5L23 A;  4D8K A;  2MYO A;  4LSZ E;  1A0N B;  2VWF A;  3H0H A;  1NM7 A;  3A98 A;  3U23 A;  1ZSG A;  1N5Z A;  1X2Q A;  4CZ2 D;  1GCP A;  5IH2 A;  1T0J A;  1ABO A;  1X27 A;  1QYM A;  1SHG A;  1K0S A;  1MUZ A;  4GBQ A;  1KFZ A;  4G8L A;  3ZU7 B;  2PNI A;  2V4H C;  1T3L A;  2DZN A;  2KYB A;  2KT1 A;  2DWZ A;  1UE9 A;  2YUP A;  2JM8 A;  5BXU A;  1K1A A;  4N5Q A;  2ETC A;  3ZKJ A;  4J9D A;  4OMM A;  2SEM A;  2RF0 A;  3CQT A;  2EBP A;  1NFI E;  5IXB A;  2EGC A;  2KBX A;  2Y1L E;  2B0O E;  1EFN A;  1QWF A;  2J6O A;  2EYW A;  1K1Z A;  2JM9 A;  2DJQ A;  2DL8 A;  5EIL A;  3T8K A;  1SSH A;  4OMN A;  2DRK A;  2CH4 A;  1A5E A;  5AQB A;  3M0T A;  4RLY A;  1X2K A;  1GL5 A;  1CKB A;  4CYM D;  1WIE A;  2E5K A;  3V2O A;  4Z88 A;  2LJ1 A;  3HG0 D;  2YT6 A;  4HI8 A;  1OPL A;  3KFV A;  4EIK A;  4KRT A;  2J06 A;  2MIO A;  5FWB A;  2O2O A;  4HCK A;  2L6B A;  1PHT A;  1K9A A;  4ESR A;  4K5B A;  2AJA A;  4C48 B;  1WDX A;  2ETB A;  2OJ2 A;  2P4R A;  1YCS B;  5HRY A;  5KNG A;  2F2X A;  5D66 A;  4JPB W;  5EN5 D;  3ULR B;  2BTT A;  1DCQ A;  2GBQ A;  2K9G A;  1CKA A;  1K4U S;  3TWS A;  2ED0 A;  3TWW A;  1PNJ A;  3TWU A;  4U96 D;  1ZUK A;  4R0K A;  2ZGD A;  3I9Q A;  1WYX A;  1YMP A;  3VRZ A;  1M30 A;  4NIK A;  2NYJ A;  4ATZ D;  5ECA A;  1RLP C;  2AKL A;  3VS6 A;  5HKP A;  4A63 B;  4RTU A;  2XEH A;  1WI7 A;  1QWE A;  3UA7 A;  1M3C A;  2KGT A;  1FMK A;  5AQA A;  1UDL A;  3J5P A;  1BU9 A;  1WDY A;  3B7B A;  1HD3 A;  1UHF A;  4F14 A;  4HQD A;  2KRN A;  2NUZ A;  2G6F X;  3VS4 A;  4CC7 A;  1PRL C;  1UJY A;  1WX6 A;  2JTE A;  4RUG A;  4WCI A;  1ARK A;  4GPM A;  4JJC A;  2D8J A;  2JMC A;  1MYO A;  1Z9Z A;  1OT8 A;  1SRM A;  5KWD A;  1NEB A;  1UHC A;  1H92 A;  1RUW A;  3IQL A;  4OML A;  2XZT G;  2I0N A;  1JEG A;  4JJB A;  3JXJ A;  2YUQ A;  3V31 A;  3REB B;  2CH4 W;  2KBT A;  1K3Z D;  3EG1 A;  4DX6 D;  2RQV A;  1WXT A;  4LUE A;  3R6N A;  2RN8 A;  4DUI A;  1AP7 A;  3EG0 A;  3V30 A;  1OEB A;  1I0C A;  2EVR A;  1M3B A;  2A08 A;  4F16 A;  4RTZ A;  1AWC B;  1WXU A;  4Z89 A;  4CC3 A;  3TWQ A;  1M3A A;  2LQW A;  3QWX X;  5ENO D;  1BK2 A;  2CT3 A;  1OOT A;  1GCQ C;  1UFF A;  1JQQ A;  1WA7 A;  3AAA C;  1VYT A;  2K3B A;  3UTM A;  3M0R A;  2ROL A;  3PVL A;  2LJ0 A;  2BKK B;  2RPN A;  2L3S A;  2JT4 A;  2RQU A;  4DX7 D;  2LCS A;  2B86 A;  1N0Q A;  4F1P A;  5IXF A;  2ROT A;  4AFS C;  2DM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...