4A63B

Crystal structure of the p73-aspp2 complex at 2.6a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
202
Chain Sequence
MRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUMOUR PROTEIN 73
publication title Structural Basis for Aspp2 Recognition by the Tumor Suppressor P73.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 59
structure length 202
sequence length 202
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
B PF00023 Ank Ankyrin repeat
B PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4a63B01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4a63B02
2ETBA 3D9HA 5KNGA 3I5SA 4IIOA 3O5ZA 5CEDB 4D8KA 1JEGA 2DBKA 1UOHA 4R0KA 2ABLA 3JUEA 4YDWA 2C0OA 5BXOA 1QKXA 2QC9A 2IIMA 1TR4A 1X2QA 1X6BA 2JABA 1NEGA 1MV0B 4JB8P 2L6BA 3Q9NC 3JV3A 1T3LA 4BERA 5CBNA 5IHNA 1Y57A 2KRMA 3IXEA 2CT3A 1BI8B 1UE9A 1WXBA 2KRSA 2KGTA 2FPDA 3TWVA 5AAOA 4LG6A 5I11A 3QWXX 1A0NB 3TWXA 3V31A 2RQTA 4DX7D 3EHQA 2MIOA 4HI9A 3M0SA 4O1PA 1N11A 4RLYA 1M3CA 2D0NA 3UATA 2HCKA 2P4RA 3LH5A 2PZ1A 4EIKA 1DCQA 1SRLA 1W1FA 2OI3A 1X69A 5HS0A 5EIDA 2F2WA 4JZ3A 4RTVA 3EG2A 4CYMD 2EYYA 2LJ3A 1NYFA 3B95A 4FSSA 1QCFA 2RNAA 1IXVA 1BU1A 1UDLA 1ZSGA 4AFZC 2XZTG 3TWTA 1UHFA 1ZUYA 2NYJA 3J5QB 2F37A 1JXOA 2EGAA 3SHWA 3U23A 4HBDA 2EYWA 3LJNA 2V5QC 1BK2A 4JJDA 2XENA 5FWCA 4J8YA 3VRYA 5EC7A 3VS1A 3J5PA 1H8KA 2BZYA 4CZ2D 2RQRA 1TUCA 2YSQA 1T3SA 2LQNA 2FO1E 4J9CA 1Z9QA 1B07A 1G3NB 2FPFA 4HVUA 1U06A 1VYVA 2A28A 4G8LA 1NYGA 4J9EA 3VS4A 3RBBB 1UHCA 4RUGA 1M27C 1SSHA 5GJWB 2L3SA 4LUEA 2JT4A 5EIBE 4LNUD 5AQ9A 1Z9ZA 2CT4A 3RNJA 4RTYA 2O31A 3UTMA 3V2OA 1X2KA 5HKPA 2BKKB 2Y0BG 4J9GA 1U5SA 4DX5D 1IO6A 1WDXA 2H8HA 3EU9A 2P2CP 2PNIA 3TSWA 4J9IA 2OAWA 1KFZA 2HBWA 4DRXE 3SO8A 5IHKA 1MYOA 3KEAA 4GPMA 4GMRA 4U8YD 5HRYA 1SRMA 2RQVA 2L3QA 1E7OA 4DX6D 2ETAA 2VKNA 2F2VA 1K9AA 2I0NA 2O9SA 4O1OA 5CERB 4QT7A 1NM7A 3ZUVB 1KIKA 2MYOA 4HQDA 1WFWA 2J8SD 3NPFA 1BD8A 5FW9A 2OJ2A 3NHNA 2ECZA 1WA7A 2J6FA 2BKGA 2J6OA 1IKND 1SW6A 1CKAA 2LCSA 4O60A 2DL8A 2X3XD 1IHBA 1FYNA 5L23A 3THKA 3NGPA 4J9BA 1MX6A 2F8YA 1PRMC 4HNAD 1AZEA 1GFDA 1KSWA 4U96D 1ZX6A 1WI7A 1N0RA 4AFSC 2XEEA 3T8KA 2XMFA 4U95D 4CC4B 2CSQA 1YYHA 4A63B 1CSKA 1G2BA 5IHIA 1MX2A 2FEIA 1WXUA 2O2OA 2BTTA 2GTOA 2DBMA 4JJCA 2VWFA 3ZNGA 2KYMA 2KXPC 1ZBJA 1GL5A 2DWZA 4CC7A 3QWYA 1RLQC 1H92A 3UF4A 4AFQC 1GBRA 4DX2A 1UGVA 1UUEA 5IXFA 1AWOA 1K0XA 4UUCA 2JXBA 2FRYA 5FIOA 2D1XA 3CQTA 3ULRB 5ITZF 2LJ0A 1ARKA 1E6GA 3JXIA 1AWJA 2CDTA 2LX7A 2AKKA 4E6RA 3PE0A 3M0QA 2KBTA 2DNUA 1MX4A 1ZUUA 3TWWA 1M3BA 4OMLA 2K6DA 1B3QA 4LNPA 2EW3A 5HCKA 3I5RA 3VS2A 1AEYA 1BI7B 5I22A 2RQWA 2KXCA 2KEAA 2JTEA 1QWFA 3H41A 3F6QA 1X43A 1WX6A 5IH2A 4GBQA 4OAUC 2KR3A 2PNNA 1N0QA 2DL4A 3TWRA 2C0TA 1JU5C 1NLOC 3C0CA 1ABOA 2XEHA 5KBAA 2D8JA 2CUBA 3DEPA 3PVLA 2DRMA 4J7WA 1SHFA 4C48B 2LMJA 1UJ0A 1X27A 2PTKA 5FWBA 3TVTA 3HG0D 1T0HA 2ED1A 2DE0X 2DZOA 2KT1A 4LN2A 1GFCA 2CH4W 1NG2A 1QWEA 2K7AA 4OMNA 1AVZC 2DF6A 3REBB 4TUMA 2AJAA 4J9DA 3ZU7B 4HVWA 1AWCB 3H0HA 3Q9UC 5KNHD 2RMOA 2DRKA 1HJDA 1VYUA 4BETA 4ATZD 2W0ZA 4Z89A 1KJWA 1PNJA 2A08A 2RN8A 3H0IA 1OPLA 1SEMA 3AJIA 5EYLA 2A37A 2AK5A 2DJQA 5ECAA 2AKLA 2A5EA 2L0AA 5ENQD 1ZLMA 5CECB 2K3BA 2VVKA 1V1CA 1I0CA 2EGEA 2DL3A 2LNHB 5AQAA 5AARA 2G6FX 4JPBW 1SVXA 1QKWA 2BZXA 3VS6A 2YDLA 5FINA 2ETCA 2L3PA 5D66A 1YMPA 4AG2C 3NMZC 2DL5A 2ZGDA 5ENTD 3ZKJA 4RTTA 4DUIA 1PWTA 3KFVA 2FPEA 4KRTA 1TG0A 2RQUA 3EGUA 2XZDG 3UA6A 1PHTA 1RUWA 1NLPC 4OAVB 3SEMA 2K9GA 4CC3A 5ENRD 1K1ZA 4BEPA 3R6NA 4BESA 4Y92A 1WIEA 1PKSA 2RF0A 1I07A 1U3OA 4HRNA 2D8HA 3FJ5A 2EQIA 4HRLA 1HD3A 3IQLA 2FRWA 3VS3A 5ENPD 4ESRA 5EN5D 1OV3A 3T9KA 1AOJA 1YWOA 2LQWA 4Z88A 1K3ZD 4CC2A 4J9FA 1W70A 2J06A 4F16A 4OMMA 4HI8A 4K11A 1UG1A 2EGCA 2ENMA 1HSQA 5ENSD 2EPDA 1DC2A 2NWMA 4F17A 4LSZE 2SRCA 2KBXA 4RTWA 1K1AA 1MJ0A 2M0YA 4OMPA 2HSPA 4F1PA 2AZSA 4K5AB 1UTIA 2J05A 4YDYA 2SEMA 1AP7A 1BLXB 2DZNA 3B7BA 1GCQC 1UECA 4WCIA 2DILA 2ROLA 4G8KA 2ROTA 1YP5A 2HE0A 3HRAA 3VS7A 1K76A 1AD5A 1JO8A 1YNZA 1BU9A 2ESWA 2V1RA 1GCPA 5IXBA 1S70B 2EYXA 2ZGGA 4Z68A 1WDYA 3C5RA 2EVRA 1G83A 2JS2A 2V4HC 4K5CA 1BB9A 4HRMB 3UXGA 2KYBA 1YCSB 1M3AA 3W9GA 1K0SA 4B93B 3M0PA 4OMQA 1FMKA 1BBZA 2ED0A 3VRZA 2M51A 3REAB 2F2XA 4AFUC 1WXTA 4HXJA 2J7IA 2GNCA 3EG1A 4F14A 1VA7A 1H3HA 2B86A 2AZVA 3I9QA 4ZNXA 1PRLC 5CBOA 3AAAC 2DX1A 5AQ7A 1JXMA 2KRNA 1QLYA 2F8XK 3EG3A 2GGRA 2E5KA 4F6RD 2KROA 5GJVB 2O88A 2C0IA 5ENOD 4D8DA 1W6XA 4ZFHA 1AWWA 2JMAA 2LP5A 4N5QA 2JMCA 1OPKA 2DA9A 3M0RA 4HB5A 1N5ZA 3VS0A 1NFIE 2DYBA 4J9HA 2JS0A 2RFAA 4DEXA 1Y0MA 2K2MA 2EBPA 1QYMA 2O9VA 4U8VD 1OOTA 2MOXA 3TWUA 2YUQA 4JJBA 4RTUA 2L2PA 2V1QA 2QYJA 2FO0A 2KE9A 4X1VA 2B0OE 1T0JA 4GLMA 2DL7A 2BZ8A 1UJYA 3I35A 2W10A 4Z8AA 5AN8A 3EHRA 3TWSA 1X6GA 2KT8A 4ORZA 2DLPA 1NEBA 1GRIA 1E6HA 1MUZA 1UFFA 3TWQA 1M30A 1OEBA 3H0FA 3NOCD 2QDLA 3NOGD 4QFVA 5JMND 1MV3A 2DM1A 4RTXA 1J3TA 2Y1LE 1YN8A 1CKBA 2GQIA 4OMOA 1A5EA 3ZL7C 2MCNA 1PKTA 3UI2A 2CH4A 1D9SA 4HVVA 4BSZB 4RTZA 3V79K 2A36A 2GTJA 2YUNA 4AG1C 3W9FA 1K1BA 1LCKA 4ZHBA 4QQIA 3JXJA 2DMOA 5KWDA 4HCKA 3V2XA 2JM8A 1VYTA 2CSIA 5EILA 1WYXA 1GBQA 1WLPB 2FG0A 4IIMA 1JQQA 2DVWA 5JA4D 1GCQA 1M8MA 2HEQA 2VGEA 2EYZA 2HDAA 3VS5A 2CUDA 2K79A 1K4US 2KNBB 3NBNB 2GBQA 5BXUA 2EKHA 4M4ZA 4HLLA 3M0UA 5EYPF 2RPNA 1YWPA 1ABQA 2RFMA 2DVJA 2JM9A 3TSZA 2YT6A 2NUZA 1SHGA 4LUDA 4JZ4A 1WG0A 3UA7A 3V30A 1S1NA 3DEOA 4DEYA 1ZUKA 1AZGB 1I1JA 2J6KA 2JW4A 4LE9A 3GBQA 4K5BA 1SPKA 5AQBA 2LJ1A 1EFNA 2X3WD 3A98A 1OY3D 3EG0A 5CEAA 3PVQA 3M0TA 2YUPA 2CREA 4NIKA 1AWXA 1XOVA 1RI9A 2YUOA 2LZ6B 4DX1A 1RLPC 1OT8A 2KXDA 1TUDA
chains in the Genus database with same CATH superfamily
3ZRHA 2ETBA 3D9HA 4MZMA 4IIOA 4BX9A 4IURA 4QQ6A 4CCAA 2XPYA 2OTJT 4GMLA 3OYBA 1XJWB 3FDHA 2EJGA 2EIFA 4FJZA 1I8FA 2I2LA 2XRZA 2QC9A 1TR4A 2XHEA 2CZ0B 1X6BA 3EGDA 2YINA 3P8DA 4JS4A 4JB8P 1Q95G 2VGMA 1YJWQ 1T3LA 3Q75A 2RJDA 5KYXA 4NURA 2OTLQ 4M7AG 5IHNA 4A1SA 1IGQA 2XGSA 3CMAT 3CD6Q 4KZ0A 1BI8B 1UE9A 2KRSA 5D0OD 2KGTA 4M78G 3DXMG 1HG2A 3JAME 1Q86U 5AAOA 4LG6A 4J5YA 3LGFA 3ASOE 4OVVA 2CZ6B 4M7AB 3RKYA 3DSXA 3EHQA 2CZ7B 1Q7YR 3ZFWA 4O1PA 4M78B 2YHCA 3IHVA 3BDLA 4L6V5 1VQ9Q 1WGSA 3FTXA 2MOWA 2UY1A 3MKQB 4U0SA 4EIKA 1DCQA 1SRLA 1W1FA 3I55A 3CCUT 3V8JA 1OYXA 2RM4A 3FP3A 2F2WA 2RHYA 3M9QA 4CT0A 2RJFA 1PY1A 4JRKA 2KMTA 4RTVA 2EYYA 5T4YA 1NYFA 3D3MA 2FB7A 3C4SA 1ZSGA 3CCLT 4AFZC 2QEXA 2XZTG 1YI2T 2HYZA 1UHFA 2CHWA 2NYJA 5LJ5f 3J5QB 2DYRE 2ZIRA 2C06A 1V54E 5IY5E 1OCCE 4HBDA 4I17A 4ABNA 1LNXA 2EYWA 4JJDA 4AEZC 1OZ3A 4WF2A 1QVFS 3VRYA 4GZDA 4V3IA 2EKOA 3CXCP 4E7IA 4BUGA 1HG5A 3CBPA 5LCWC 3FY4A 3VS1A 4F7UE 4CDRA 4HT8A 3OSVA 1N94A 3LY9A 5CK9A 3SNXA 2YSQA 3HRSA 4LD9K 2LQNA 3RK6A 4J9CA 1Z9QA 5LL6S 1IZ6A 2XS1A 1VYVA 2A28A 4BDYA 2B6CA 3ZXSA 4JUVA 4U8HA 3CCQT 1KHCA 2JOYA 1HO8A 2V8IA 2XI9A 4C92A 2CP5A 1Z9ZA 3G71Q 1Y6IA 1PCXA 3VKIA 2R58A 3LEWA 1VUBA 2JN0A 1E8ZA 3ZYKA 3ZBDA 3CHMA 3R7QA 1U5SA 3R9AB 4DX5D 1IO6A 3QHSA 5CKHA 1HFAA 3LYIA 1NE8A 3UPVA 2P2CP 4I1AA 2CZ1B 2OAWA 1KFZA 2V0PA 4UWFA 3CK9A 3PH0C 4E7KA 2VGYA 1Y71A 2KM4A 4OGEA 1MYOA 5IHKA 1MNEA 2RJCA 2KCKA 1EDUA 2IEJA 4C8QA 4I9CA 1QVGA 2F2VA 3MPUB 4C92D 4O1OA 4QT7A 2C0MA 3PE4A 1TEZA 4RKUE 4I6JA 3LWHA 1KIKA 1MMAA 5HK3A 3RO2A 3GPLA 4HQDA 1WFWA 2J8SD 4JHKA 2YHTA 2WXOA 2J6OA 1SW6A 2KCLA 3OS5A 3EIQC 2DL8A 4AIFA 2GCXA 1FYNA 2JTMA 3J80E 4QKUA 2X6JA 4IUVA 1VQMT 1I4K1 1AZEA 1YJ9A 2QA4A 1IHVA 3OYEA 1OWPA 1ZX6A 1K8AU 4GTQA 1VQ6Q 2XEEA 1Z3XA 1RADB 2CSQA 2Y90A 3OW2P 1VQLT 5GAOp 5G04J 3JCMf 3U9WA 2VWFA 5G05C 3ZNGA 2KXPC 2DXBA 1GL5A 1FX7A 1Q86R 1YIJA 3FULA 4CC7A 1Q82C 2XDBA 3HIZA 1HX8A 1QMCA 3GLXA 1RLQC 2GRNB 1YHQT 1H92A 2X6IA 1FWZA 2BTDA 1KK7A 3WVEB 5GAOq 3QDNA 3DWLG 2IU1A 3CCMQ 4JXTA 3NF1A 1ELKA 3N5BB 2DFUA 1UUEA 4AY5A 3OS2A 1K0XA 5FIOA 4BSXA 4BY6A 3SWNA 3CVXA 2E10A 3CQTA 2QQAA 5DY9A 3ULRB 5ITZF 2LJ0A 1VQ7T 3FLGA 5CIUA 1ARKA 3ASHA 1YJNA 4V2SA 3V8KA 3KAEA 4E6RA 4CRWA 1D09B 3JQ0A 4PFOA 1M3BA 2EFIA 3ISMC 1MZCA 4C0FA 4ZGEB 4M77E 3AG3E 4JLIA 1BI7B 3C72A 1SA4A 2DPPB 5AYFA 2IO3C 3T8MA 3I4RB 4L2YA 3ZIMA 1WJSA 1NJIU 3KD7A 5T3RA 3TREA 4XKCA 2C0TA 4XTVA 4FT4A 5KBAA 3M54A 1W2BP 3SFYA 3LXUX 3H9NA 3EGXA 3RR6A 3CXCS 4J7WA 1M90U 4J0UA 4C48B 3UIPC 5KJNA 1D1CA 1EIFA 3G1JA 3GIBA 3TVTA 4PJOC 1T0HA 2VGXA 2ONDA 2E6NA 1Q81U 3A8HB 5KYYB 4GTVA 3HRTA 5J08A 3L9TA 4PJNA 1O5MA 1YFNA 2CH4W 1QWEA 4OMNA 2EINE 1AVZC 3OYMA 2V5FA 2DTIA 3OMCA 3PMTA 5I2MA 3DXKG 5IN1A 1WHLA 2BF0X 3RAUA 1TTHB 4BE1A 4BETA 2DYSE 5AJLA 3SY2A 1TJCA 1WHMA 2F69A 2RN8A 2X38A 3INZA 1VQOT 3CCEQ 3BG1B 4FLHA 2AK5A 5EYLA 4AXHA 4YVOA 2E4HA 2AKLA 4BI3A 1D8DA 4PS8A 5ENQD 1ZLMA 2DVEA 2K3BA 4PNOA 4C5GA 2E1HA 1V1CA 4LNBA 5AARA 3DB3A 1SVXA 4KT6B 2BZXA 2HQEA 2YDLA 1NA3A 3JB9D 5D66A 2DXTA 4AG2C 3OYKA 4ILHB 3HTRA 2VSNA 2DEUA 4XQ3A 4DUIA 3KFVA 4J8DA 4GTPA 5KCHA 1NP7A 2BE9B 2XPIA 1TG0A 1LD7A 5D6WA 3S2AA 4PDXA 3C98A 1PHTA 1R77A 1RUWA 4FYVB 5JJTA 1SZAA 3OXLA 4K0RA 1K8AR 2K9GA 2QAZA 4MMKA 1WHJA 3AT1B 3DPDA 3L2QA 5GAMh 3LX7A 2CKKA 1I07A 3H8ZA 5KCMA 1WPYA 2X6HA 3FIFA 5FQ4A 3BUAA 4HRLA 3IQLA 4LEUA 3I56A 4ESRA 3AG2E 3PZ2A 1OV3A 1Y07A 1YWOA 4Z88A 4LDXA 1K3ZD 3FUMA 2ATCB 5LJ5j 2EQKA 3TQ7P 3ME9A 4B89A 3L08A 2P9SG 2RHZA 3OW2S 4L5GA 2Y69E 3GZ1A 3ZVVA 2EGCA 2ENMA 5T8IA 3I55Q 4BTBA 1NZ9A 2NWMA 1OQKA 1DCEA 2SRCA 3CPFA 2E41A 4WWNA 2NUPA 2NC9A 3CVVA 1WAO1 4OB3B 2KQWA 2HSPA 1JBMA 4F1PA 4M75A 2QEXQ 4BT9A 4D10C 5CKDA 2OVBA 2LCLA 4AMCA 1BLXB 3ABME 3UM3A 1HXDA 1MGQA 5LJ3g 1QBQA 1QVPA 2JEKA 1YP5A 2HE0A 4J8SA 2CYZB 2KK4A 4HKEA 3VS7A 4RSYA 3MKDA 5CKEA 1GW6A 1WQ7A 5C6SA 3CC2A 3HHMA 2ESWA 3M53A 1WJRA 3L42A 4C8QF 1NJIR 1IHGA 1BI1A 4M7DD 1S70B 1WHGA 4M75D 3QJYA 1WDYA 3PNLB 1G83A 2FYKA 2L9BA 2HD0A 2PQRA 3Q78A 1M1KU 1X6OA 2P0PA 4G24A 4F7UG 1M90R 2VTBB 3VLFA 1YCSB 5L8RE 1M3AA 4B93B 4OMQA 4NOYA 1M4ZA 4MMLA 5KYWA 1Q81R 3LW5E 2YQ8A 4FJYA 4EDUA 3VRZA 3MYVA 2F2XA 1VQ8A 4F7UB 2CP2A 3EG1A 4F14A 1X01A 2B86A 3I9QA 4IUTA 4ZNXA 3VV0A 2X4WA 4L2LA 4GYWA 4I6EA 4M78E 2H6IA 5CBOA 3MJXA 1ELWA 1H19A 4N5CA 3OTNA 3FUEA 1TU0B 3MGBA 1JXMA 2CP0A 3EG3A 1HK9A 2XD0A 2E5KA 2CG2A 1VQ4T 1KHIA 3WG7E 1N8RC 2OV8A 3TGOA 4JHRA 4WAFA 4A3TA 4F53A 2JMAA 2FVUA 3CCJA 4CDNA 2DA9A 2E3HA 4XEIG 4MDWA 4EMKC 4DEXA 1KC8C 2CGHA 4BD3A 3SFMA 3OYCA 1SA5A 2OOEA 4U8VD 5FZRA 3TWUA 3NZSA 4A4EA 1OULA 2L2PA 2V1QA 1HH8A 6AT1B 1JCQA 8AT1B 2DKGA 3B7UX 3E9GA 3FFLA 3APFA 5C2YA 1T0JA 2CS7A 3S3MA 2HL3A 2BZ8A 4A54A 1UJYA 3I35A 1K9MC 1YJ9Q 4GMJA 1S72A 2QA4Q 4NRHB 3OYLA 1GRIA 1UFFA 2QQ9A 3FU0A 3TWQA 2X4XA 2GRPB 1OEBA 4KBMB 3NOCD 3UWNA 3NOGD 3ER0A 3APCA 5JMND 4BI4A 5GAN5 1J3TA 3CPWS 2WB2A 4PK4A 2V4LA 3BW1A 5GAN6 1PKTA 2CH4A 2HBPA 4B9XA 1S63A 2YUNA 1O1TA 5G04C 3W9FA 1LCKA 1I5LA 2RK1A 4G25A 3CMET 1YIJQ 3SZ7A 2DMOA 5KWDA 4URKA 1VYTA 2CSIA 2WQHA 3IEGA 3S7DA 2GFAA 1WLPB 2XU8A 4EMGA 2FG0A 4DK5A 5GAMj 1M8MA 1GCQA 3FTUA 3PZ1A 3LS8A 4PUCA 2LVMA 2WPVA 4P29A 2HDAA 3CHQA 2O01E 3D9PA 5M9OA 3V7CA 3UPUA 1K4US 4HA8A 2D6FA 2K3YA 2GBQA 4WNGA 2A4ZA 2X4YA 4HLLA 4QVDA 2CP6A 3QUIA 3QAQA 2DVJA 3MZLB 2YT6A 2NUZA 1LJOA 1SHGA 3CGHA 4OP0A 3MKQA 4FA6A 3PZ4A 3DEOA 1XTDA 1AZGB 3S7JA 2JW4A 3CLJA 4WWOA 3HXBA 4AJWA 2LJ1A 3A98A 2J08A 1PSFA 1KG1A 3RDVA 5HI7A 3CKBA 4M77G 2OTLT 4DBQA 5JJ6A 4A4GA 1TUDA 5GAN3 2IG0A 4JDSA 4D8KA 1JEGA 2DBKA 3PRZA 3DB4A 1UGQB 1UOHA 2UWJG 1D3BA 4M77B 1FMVA 3ULEG 4GYYA 1TS9A 4M78C 2XGOA 3B13A 3MHXA 1M1GA 2HZYA 4NQ0A 1WXBA 3JCMV 4KGVB 2MMPA 2FPDA 4Y28E 3A8MB 3QWXX 1RI0A 4J6YA 5HK0A 1MMNA 1EX4A 1OUVA 4J8EA 2WSEE 3G4SA 4CI0C 3FB9A 1Q2ZA 3IKOB 3M0SA 4PFPA 2WMOA 1TUGB 2F5TX 2HM8A 2M0OA 1PSEA 2IFUA 3S6WA 3HFNA 4GTOA 3FUFA 4HS2A 4YDEA 1ZSZA 3CBMA 4CYMD 1BIAA 4ZGJB 2IOLA 2LJ3A 3B95A 3P2BA 2LXLA 2P9IG 2RKKA 1TSFA 1KQ1A 2RNAA 4RG2A 5I21A 1ZUYA 4JVSA 3EFOB 3E33A 1VQPA 2QQRA 2VJ8A 1JXOA 3U23A 3CC4A 2IONA 4UQZA 3VYHB 5GMKi 4B6MA 2HQXA 5FWCA 5M72A 4J8YA 2XEVA 4JL0A 2ZPHB 4Z02A 3LY8A 1FPPA 4WNFA 1VIFA 4XKBA 2DO3A 3CVNA 1H8KA 1QW1A 2BZYA 1Z3YA 2RQRA 2WXRA 4TUUA 1TUCA 1UGPB 2DTHA 4GB9A 3ABLE 1T3SA 2M1HA 4FYWB 1XNIA 2FPFA 4HVUA 5GMKm 4N2SA 3HVEA 1U06A 3FTYA 4G8LA 3JCMW 4PL6A 4J6IA 2OTJA 2O4XB 2Z0WA 4G11A 4ZTFA 3EG9B 3C3QA 1BIBA 3K9IA 4EMKB 2PM7A 1M27C 1SSHA 5GJWB 4DA4A 4J7IA 2JT4A 2FHDA 5AYWD 2CT4A 4B0ZA 2O31A 5DM7R 2IY0C 3UTMA 3QZ9B 3ASKA 2WXNA 5FU7C 2BKKB 1QQJA 4QQGA 3CMAA 2L0TB 2IPOB 3EH2A 3M55A 3X28B 4J9IA 4U07A 4O6FA 2HBWA 2WQ7A 4DRXE 2PVGB 2ZGWA 3KEAA 3LCAA 4GMRA 5CHEE 2RQVA 5I2SA 3SD4A 3CHPA 4KUDK 2ETAA 2VKNA 2I0NA 4J8FA 2O9SA 3CCUA 5HKCA 1VQ6T 2I1JA 1QCOA 4WNDA 3TXNA 3CC2Q 4FCYA 3QXEB 5FW9A 2OJ2A 2ECZA 3FEXA 1IKND 2X4JA 3CCLA 5LJ3f 1IHBA 3DSSA 3E9FA 5E75A 3MEWA 4C5IA 1YITT 1JCSA 4LXCA 3GNFB 1MX6A 1KLXA 2F8YA 1PRMC 3CCVQ 1GFDA 2EQJA 3CR3A 4U96D 5J39A 4EPZA 1LF8A 2RK2A 4U95D 4GPKA 2EJ9A 3ZN3A 1YYHA 1G2BA 5IHIA 2G3RA 2NLUA 2HO1A 2FEIA 2BTTA 2NYSA 4C0GA 1UB4A 3GZ2A 2DWZA 4DOVA 1HF8A 5KYYA 2DXCA 4E6HA 4WTOB 4FM4B 2KI7A 3A5ZB 3UDCA 3CCQA 3M57A 3FH5A 5LJ3e 1AWOA 2JXBA 3M56A 3JB9I 4GTSA 2FRYA 1RAHB 5FRMA 3BDUA 2WQ6A 2XIDA 3E4BA 3JB9J 4HCBA 3CCJQ 5GANh 1E6GA 3C95A 3PIOA 2IOSA 2VXFA 1SKUB 2RI2A 2MWPA 3ABKE 3PE0A 2OEWA 3A8LB 3Q5MA 4A55A 4C92E 3I4GA 1B3QA 3ZPJA 5FU6C 3GP8A 2YRCA 3DLLA 3Q15A 2PQWA 3CCST 3QSUA 3UX4A 4M7AF 3VS2A 3QIIA 2KXCA 3TAXA 2KEAA 3UM1A 2JTEA 4UWLA 1X5BA 3CIAA 3JSCA 2MI6A 2MHKA 3MEVA 1S72Q 2GGFA 2EJFA 1F1BB 5D2MC 1O1RA 1WX6A 4GBQA 5IH2A 4OAUC 1JRIA 4Y6WA 4LUNU 2FEZA 4UWKA 5BNWA 5BUZA 1N0QA 4C0EA 1TN6A 5LP0A 4EQFA 2HQHA 3MO8A 3UINC 1M2OA 4QVZA 4Y91A 4TXRA 4ELYC 4APFA 1JU5C 1NLOC 3NQPA 1ABOA 2XEHA 3ZXPA 3PVLA 1M2VA 2DRMA 1SHFA 3Q4AB 5CVIA 1VQMA 2PTKA 3RKVA 5FWBA 4C5HA 1NPRA 2ED1A 2VXEA 2DE0X 2KT1A 2KC7A 2VSYA 3BY7A 1W4SA 3UT1A 4QVCA 4FW2A 4A1GA 1KQSP 3QKYA 2ZISA 4GZ6A 5FQ6A 3REBB 2XDDA 1VQLA 4UI9K 3FU6A 3MV2B 4XX5A 1RACB 3S7FA 5KNHD 3LKUA 4C0MA 2M16A 2JTFA 1OWOA 2BE7D 4ATZD 3C94A 1KJWA 1PNJA 3QARA 2A5UA 4HLEA 3HXFA 1YHQA 4MZPA 4Q69A 3MCAB 1BI2A 3L2UA 4ME7A 2A37A 1FVHA 4FHJA 4JRIA 2DTOA 2QY7A 5CECB 2KY9A 2VVKA 2EIME 1VQ7A 1TXQA 5A7DB 2EGEA 1JJ2A 3OB9A 1OCOE 3LVRE 3L2ZA 2ETCA 1N9RA 2L3PA 2RJEA 3LLRA 2DL5A 2ZGDA 3ZKJA 3ZHEB 2NXPA 3EHMA 1PWTA 1JPLA 5D6YA 3E34A 3EJNA 3FHEA 5KYUA 4GA2A 2CHZA 2RQUA 5FU7B 3UA6A 2AWIA 2IQCA 3URZA 4K03A 3DLMA 4KZCA 2HMAA 2E65A 2P4TA 2PVDB 1WIEA 3PNTB 5FRNA 4DBFA 1PKSA 2RF0A 1OU9A 2J4DA 3M4YA 3FJ5A 5GAN8 2KZTB 4HXIA 4C8QD 3ZYQA 3VS3A 5ENPD 5EN5D 3T9KA 3LDZA 2LQWA 3U64A 5LJ5h 3G4SQ 3OQ5A 2LC4A 4OMMA 5IT9E 2J07A 4OVUA 1UG1A 4C92C 2E12A 3TCJA 1EZZB 1HSQA 4MZTA 3E30A 2JLBA 1BKBA 3RESA 4OB2B 2L6JA 3MV3B 3PGGA 4F17A 3HSBA 1K73C 4EECA 1E90A 4RTWA 1K1AA 1MJ0A 2MF2A 1AT1B 3HRUA 4OMPA 2GRRB 2VSOE 2AZSA 3OA6A 3PNWC 4K5AB 1B7TA 1UTIA 3ZEHA 3PZ3A 2OX7A 1Y8MA 2J05A 3MP6A 1VQPQ 4YDYA 3IV0A 3CC4Q 1AP7A 5HQ8A 3FRNA 1UECA 3SBTB 2K2VA 3AU5A 2DILA 1N9SA 4KXKB 3G6EQ 2Y4XA 5GMKe 3CVUA 3HRAA 5GANj 4PJOA 3S7BA 3B7TA 4J8OA 3GOXA 3QWWA 1D8EA 1BU9A 2C0LA 3H6ZA 3PUKA 1NI1A 1Z5SC 3QYHB 5ENNA 3QG1A 2EYXA 2ZGGA 2IVWA 3CBOA 3UQ3A 2JS2A 2EVRA 3SHFA 4J6WA 4K5CA 1BB9A 8ATCB 2OTJQ 4OYSA 4BE0A 1M1KC 1XNFA 1U2VG 3PEUB 1INZA 4EMHA 5FZQA 3D9JA 4ILGA 3FEYA 3BG0B 4PJOD 5AJDA 1D1AA 4AY6A 3MEAA 3L16A 2J7IA 1VA7A 1OWMA 3QJZA 1Y96B 4AVXA 5FU6B 4ATGA 2C2LA 3CMAQ 2WXMA 4AT1B 4OF1A 1PD0A 2F8XK 4CRIA 2AXZA 4ZGDB 1KD1R 4F6RD 2HNIA 2KROA 3Q7FA 2YLCA 2OCCE 2RHXA 1KQSS 2QASA 4D8DA 1VQ5T 4ZFHA 5GAMd 4G26A 2R5SA 4BACA 3OXGA 4HB5A 1N6AA 3VS0A 4BY6C 4J9HA 3SWNC 3CCUQ 2JS0A 3T9NA 4WUYA 2I1KA 2XICA 3PTAA 3O4ZA 2K2MA 4F04B 3JCMh 2O9VA 4NS5A 1QVFA 1OOTA 2COWA 3TG5A 3VTYA 1EF1C 4JJBA 3D9MA 3RKXA 2EQUA 2FO0A 1IGUA 3EGDB 3CHOA 4GLMA 3AG4E 1KZOA 5G55A 5KYXB 3NAWA 4PJMA 1MQSA 5CCAA 4EPCA 5AN8A 5FQ7A 4M7DE 3TWSA 4ORZA 1NEBA 5FTPA 3EH1A 3ONKA 4M75E 1UN9A 4RMOA 4RTXA 4ZN1A 2Y1LE 3D9LA 4BWRA 2GQIA 5CR2A 1QCNA 2VYIA 4A4KA 4OMFB 3UI2A 4HVVA 1D9SA 2E0IA 1JUQA 3FTVA 3VTXA 3T5VA 5ARFA 4ZHBA 4QQIA 2UY1B 4I1MA 4HCKA 3V2XA 3CC7T 3MX3A 5EILA 2VV5A 1GBQA 2DCPA 3RMSA 4IIMA 1JQQA 4E7ZA 1BPOA 2HEQA 2VGEA 4Y6CA 2HL5C 4IKFA 2EYZA 5KYNA 3VS5A 1VQNT 2L8DA 2K79A 1G5VA 1BCMA 3NTIA 5FJYA 2DAQA 2EKHA 3OMGA 3OY9A 1D0ZA 5EYPF 2RFMA 1NBEB 3LGLA 4LUDA 3QO3A 4J6XA 3V30A 1HS6A 4F7AA 2WM9A 4BDZA 2GFUA 1I1JA 1S64A 4M77C 1BI3A 3GBQA 4K5BA 1EFNA 2E64A 5CEAA 4KT0E 1AHJB 4N3BA 2WXLA 3NB2A 4CGWA 3QBYA 5CMWA 2YUPA 4C92G 2HKQB 2ZAEA 2HSEB 1AWXA 1XOVA 3NTHA 3SDZA 1N9AA 5KE2A 2QYZA 1VQKT 4G23A 5KNGA 3I5SA 1TYQG 4HOQA 2CG3A 3EDTB 2V8JA 3O5ZA 4C92B 1Q82U 1EPUA 3CCRT 2GF7A 3EFSA 3FUHA 2WMNA 1MMDA 4TV3A 1VQMQ 1RAFB 2AVPA 2ABLA 2NUTB 3JUEA 4YDWA 2C0OA 2R02A 1QKXA 3UKRG 1I81A 2OVFA 1X2QA 3Q1JA 4C8QG 5CCMA 1NEGA 2R57A 1MV0B 2RD1A 5BPPA 3Q9NC 4E85A 1P5QA 5JHAA 4MDXA 4HORA 4X8QA 1Y57A 2V8KA 3IXEA 3LJ3A 5CAIA 4WNEA 4ANXA 4C8QB 2WXGA 2RA2A 5I11A 3S3OA 3PS6A 9ATCB 3TWXA 3V7SA 4JZYA 4B8CB 4DLQA 4DX7D 4ME2A 1I5OB 5CO7A 2K57A 3J81E 4GTMA 4GZCA 2P9KG 3PDNA 4RLYA 1M3CA 2Y4YA 2WACA 1YHQQ 4DBRA 1W2BS 3UATA 2HCKA 2P4RA 3LH5A 2PZ1A 3CK7A 3ZW3A 3RIRA 1X69A 3CVYA 5HS0A 1D1BA 1TNZA 2KSSA 2IF4A 3OYJA 3L13A 1VQ7Q 2QZAA 2X6KA 1D0XA 2P0QA 4MKTA 1QCFA 4M7DC 1B34A 1BU1A 3TWTA 1Q7YC 4M75C 3C3OA 3FC3A 3DSWA 2F37A 2EGAA 3SHWA 3CHSA 3FH7A 1P92A 1V55E 5B1AE 4KUIA 2ZPGB 3LJNA 2XENA 2DEQA 1WNLA 4BI8B 2RD0A 3PUJA 5EC7A 3BU8A 4I6GA 4EBAA 4VUBA 1X81A 2WXJA 4GCOA 4XU2A 3JCMQ 1NZNA 1E7UA 3J5PA 2CFUA 2XHCA 3CXCA 3X2QE 4CZ2D 2XCBA 2LSVA 2LUHA 3HP9A 3L54A 3C12A 1BI0A 2V26A 2OTLA 5A0GA 4PJOF 1NYGA 4RG8A 2DIQA 2FO7A 2VC8A 4BY6B 2XDPA 4J9EA 3SWNB 3SFXA 1TJFA 2VQ2A 4RUGA 1LD8A 3L2WA 2L3SA 3RNJA 4LNUD 5AQ9A 4RTYA 2JNGA 4XK8E 3JCMX 3SGHA 4N3CA 4GCNA 5HKPA 1E7VA 1KT1A 2QFCA 1UW4B 2Y0BG 5LFAA 4AV7A 1R0CB 2LDMA 1IHWA 3TSWA 3D9KA 1SSFA 3ENEA 3DKMA 1QVGP 2X3MA 5DLOA 2GQVA 5HRYA 4U8YD 3FEOA 4II1A 2L3QA 1OCZE 2HAXA 2VYTA 4DX6D 1H2UA 3MJWA 1NA0A 1TNYA 1K9AA 3E19A 3CCVT 4M7AA 4XIFA 1YJNQ 3LWIA 2JUFA 3L17A 3ZUVB 4M78A 2A7YA 2MYOA 3EGXB 3NHNA 1WA7A 2J6FA 2BKGA 4TVRA 4G1TA 2VGXB 3UM0A 2X3XD 5L23A 3OXFA 3JB9G 3AS8A 1Q82R 3V7RA 3NGPA 4J9BA 3EIJA 1DVPA 5B3SE 3LH0A 4XTYA 3ML8A 4PFZA 4I43A 4FU3A 4N2QA 3OS0A 1N0RA 1YJWT 3T8KA 1PD1A 4M7AD 4ELZC 1UGRB 4GZ3A 2Y4TA 3CD6T 4GA1A 1MX2A 1WXUA 4JJCA 2KCVA 3QB2A 3RUXA 4APOA 2KYMA 1ZBJA 2FULA 1OX9A 4NL3A 1L5JA 3OW2A 5FT9A 2MWOA 3P8BB 4UWHA 3CEQA 3HYMB 1VQ9T 4AFQC 4DX2A 3L2VA 4IYPA 5KCOA 4U0UA 1C1AA 1O75A 3META 5IXFA 1U1TA 5CKBA 2X9HA 3HKSA 3Q73A 5A0LA 4RCBA 2CDTA 1HYOA 5H7PA 2LX7A 3UT7A 2M63A 2AKKA 2LNVA 1Q86C 2FBNA 2AW6A 1MX4A 1ZUUA 2MAMA 5GAN2 2L0IA 3JCKC 4OMLA 2K6DA 2FZGB 3PEVB 4C0DC 3R9MA 4LNPA 4NACA 4UQYA 2LAHA 3I5RA 2L89A 4GU5A 5I22A 1HE8A 4EZJA 3OYFA 4GAAA 1QWFA 4E47A 3F6QA 2JVVA 2J49A 1X43A 2DYIA 2LX9A 3Q47B 2KR3A 2PNNA 3EAEA 4FL6A 3UT8A 4FYYB 3RKWA 1QP3A 5GMKl 2XRYA 5G05J 3M5AA 2DL4A 2OAUA 2J4BA 2D8JA 4JHJA 4XTUA 5JJ7A 2CUBA 3DEPA 4M7DG 2P84A 3ZYMA 2LMJA 1YITA 1WM5A 1X27A 4M75G 3X26B 3SBSA 3HPWA 4KVOA 2DZOA 1M8VA 3ZEFA 2CP3A 4LN2A 3G71T 1GFCA 1N8RU 2NUPB 2DJZA 4M7DB 2K7AA 4M75B 2DF6A 4TUMA 2AJAA 3HDXA 4QW2A 3RSEG 5EKQD 3ZU7B 2YWWA 4J9DA 4E7JA 4UQXA 3I56Q 3Q49B 3Q9UC 5GAMg 2RMOA 2ZPEB 1HJDA 2Y4UA 2W0ZA 4Z89A 4XI9A 5BV0A 2X51A 1N95A 1EYHA 4NL2A 2GRLA 3SFZA 1WQWA 4A3VA 4I9EA 1K9MU 1M1FA 4Q96A 3AJIA 4TXPA 3D9IA 5ECAA 2DJQA 4C0ZA 2J09A 4KYOB 3M4GA 2A5EA 3SI5A 2DETA 3JUIA 1TN8A 4C9BB 2XG8D 3QKJA 1SF9A 2MK5A 1I0CA 2DL3A 2LNHB 5AQAA 1ZSZC 5FINA 1QVGS 1YMPA 5C0MA 2JZ2A 1RW2A 4XTXA 3G7ZA 2D0QB 4RTTA 1HU3A 4KGZB 2LQ8A 5KYWB 4BT8A 2J9QA 3CKCA 3L82A 2E70A 3CPWA 3RU0A 3CCSA 4R7LA 1FCHA 2FF4A 3EGUA 4JA7A 2H3JA 2VB6A 5GANd 4OAVB 2K4YA 1N4SA 4U7EB 5DBKA 2YNQA 3CSTA 5GAOm 4OGCA 3R6NA 1YI2A 3NTKA 1E96B 4MLPA 3JCMb 3OYGA 4PKCC 4A4FA 2D8HA 2QGGA 4ATOA 1MHNA 2FRWA 2WXFA 2KAFA 3IHYA 1AOJA 3E2UA 2DIGA 3CCMT 4LDUA 5CQYA 4L23A 5FZSA 1W70A 3KUFA 4F16A 2EQMA 4E7SA 1K8AC 3FH8A 1H6OA 4P5NA 1VQ8Q 4UC4A 2R05A 1N4PA 5KJMA 4K11A 2WSCE 5E76A 3X20B 2PZIA 3G6ET 4RQIA 4ANVA 1MHQA 5ENSD 1DC2A 3NZUA 4LSZE 2D9TA 2BEDA 2M0YA 2P9LG 2KDSA 2R5MA 2YRVA 3R6OA 3RIBA 2K5FA 5A2QE 4L1BA 3X25B 4N0AC 2DZNA 3ESLA 5CQXA 4WCIA 4XE0A 2L3RA 2ROLA 3SD5A 4DPRA 4GTRA 4GYOA 4XU0A 3RO3A 4OB0B 5BW8C 2WXKA 1K76A 3ZYLA 1RAAB 1JO8A 1YNZA 2XKOC 4AP2A 1TNBA 3DSUA 5KJLA 4LDWA 5IXBA 4XI0A 3EFRA 2JJ9A 3KEZA 1DNPA 2EILE 4Z68A 4O5VA 3PZDA 1FT1A 4DI3A 2X35A 4M78F 2QTXA 4JS5A 2WXPA 3UXGA 1PG5B 5FQ8A 2RH2A 1ZBXA 3M0PA 3UUXA 2ED0A 5J90A 2M9UA 3REAB 1N8RR 4C8QE 1IQUA 3KBGA 1NJIC 4EZKA 3JQ1A 2QQBA 4KH0B 2BIVA 4C0DB 1PRLC 2VSXE 3GNGA 2H6GA 1KC8R 3OYIA 2AIRB 3RRUA 2DX1A 1M90C 4DJAA 3CCET 3P8HA 5LJ3h 4HT9A 4U0ZA 2DERA 3MEKA 2RO0A 2GGRA 1HXIA 2ZPBB 3PREA 1Q81C 3VUBA 5GJVB 4FADA 2C0IA 3VLEA 3MKRA 3Q7AA 4AM9A 4R55A 1K9MR 3AHUA 4N5QA 3CQGB 3FDRA 3U4TA 2QK0A 3M0RA 1N5ZA 2PVOB 2DYBA 2HKNA 2WSFE 4PLIA 3VYGA 1Y0MA 3CVWA 3FU5A 2EBPA 2DZCA 3QOUA 3F70A 1KD1U 2YUQA 5LJ5d 3CVLA 1D0YA 1D3BB 4RTUA 2QI2A 4YTLA 2QYJA 1Z6TA 4UI9J 2KE9A 3TXMA 3QJ6A 2B0OE 4H7XA 2P58C 2DL7A 1KQ2A 3FUDA 4HCCA 4HOTA 2W10A 4Z8AA 2P0KA 4A53A 3EHRA 1X6GA 1U8RA 2DBAA 4ACLA 4MS6A 1TWBA 1DJ7B 1E6HA 1MUZA 1M30A 3H0FA 3I3NA 2DZ9A 4QFVA 2QDLA 1W3BA 2YLBA 1MV3A 5LJ5e 3WXMB 3A1PA 2E5QA 2MCNA 2NUTA 1YCYA 4BSZB 1V76A 3V79K 2A36A 2GTJA 5A0DA 4AG1C 5EG2A 2XPZA 2YXYA 4XU1A 1K1BA 4PJOE 2LCCA 2JM8A 2RHUA 2F1LA 4OB1B 1WYXA 1ZSZB 4ZN3A 3PIPA 2X6FA 3I55T 5CRVA 2VTBA 3FUJA 4N39A 4FU6A 3UIOC 2KNBB 1A17A 3FJPA 5GAN7 5DIZA 3NBNB 4PLLA 5BXUA 1XQHA 4A4HA 2RPNA 2QEXT 1YA0A 1ABQA 4F7UA 1YBYA 4DLOA 2EYQA 3URGA 4N4IA 5KE3A 4JZ4A 1WG0A 4EZLA 2Y3AA 4KH1B 3OYAA 4IULA 5CCLA 3UA7A 1BYMA 1QP2A 3QDFA 2LTOA 1S1NA 2EIJE 3G2VA 1OWNA 4LE9A 5D6XA 3CEYA 1SG5A 2X3WD 1VQ5A 2VGNA 3QWVA 4ILIA 3AU4A 4G2VA 1UGSB 2CREA 2LRQA 3HVEB 3U66A 4N3AA 1H641 1VQOA 1RLPC 3QNKA 4C8QC 3RRNB 3LVQE 4FHKA 1IXDA 3KXTA 5CEDB 3QPHA 3IBEA 1MMGA 2BKDN 2F5KA 5A23A 4R0KA 1JWGA 1YITQ 1FVFA 5BXOA 2IIMA 1KZPA 2JABA 3RRMB 3JCMd 2L6BA 5DLQE 1G3TA 3JV3A 3ZGQA 4BERA 5CBNA 2DD4A 2KRMA 2CT3A 4KMOA 4FULA 3TWVA 2MYSA 1A0NB 3GYZA 5ANLA 3V31A 2RQTA 3VJPA 2ZPIB 5AIJA 2MIOA 4HI9A 2COZA 1TN7A 3CC7A 1OWLA 3D9OA 1N11A 1IYGA 3EHNA 2D0NA 4R56A 3OYNA 4KGXB 2AXVA 2K5IA 3JCMe 3KSLA 4PS7A 2R03A 2FI7A 2OI3A 1SZ9A 5GAMf 5EIDA 2DK3A 1VQNA 4JZ3A 2LO6A 4M7CA 1BCOA 3E1SA 4PS3A 3EG2A 4J7FA 4M3OA 4OVAA 1U1SA 5LJ3j 4FSSA 3KSQA 1IXVA 1UDLA 4FP7A 1G8XA 4ZTJA 2A3LA 4I2ZA 1E8WA 5GMKh 4I1OB 4B9WA 2V8SE 1ZBPA 3UMVA 1N54A 2V5QC 1BK2A 3WVDB 2A0FB 1YJ9T 2MRIA 3ASFA 1H2TC 2QA4T 3L22A 1WHKA 3CCSQ 2CFZA 2GROB 1QQEA 4Q94A 5EX0A 2RI5A 5D0QD 4HCZA 4B94A 1UJJA 3SB2A 3CCLQ 1LPLA 3AG1E 1V29B 2PM6A 3B7RL 4X9DA 2ZU6B 1YI2Q 2QG9B 1RZ4A 3WXXA 2FO1E 3PT9A 3PMIA 3APDA 3BQOA 1LVKA 3BE3A 1B07A 5GAMe 1G3NB 1YIJT 3JCMc 1VQKA 4X34A 3BFMA 5KJKA 3CCRA 3J7AF 2XCCA 3VS4A 4XTWA 3RBBB 1UHCA 1PC2A 4X9CA 3RMQA 1G3SA 4LUEA 5EIBE 4M77A 4CEMA 3GZSA 3V2OA 1X2KA 1YJNT 4J9GA 1K8KG 1WDXA 3OS1A 3L2RA 2PUOB 2H8HA 3EU9A 4JJNK 3OYDA 4ANJA 2PNIA 3JRZA 5FWQA 3CCQQ 2XS8A 3S3NA 3SO8A 4GPMA 4LDVA 1SRMA 3RERA 3CPWP 3U3WA 1E7OA 3N71A 4IRUA 2PU9B 3OSSC 2P9UG 3G2TA 4LRZA 5CERB 1NM7A 4BX8A 4GLKA 3TG4A 1IRXA 4M77D 5IAYA 4N4HA 4UWGA 2E6ZA 3NPFA 1M2VB 4RCCA 1BD8A 3LYAA 5B1BE 5GANg 1CKAA 3A8OB 3R7RA 3QWPA 1IQRA 2LCSA 4O60A 1VQ4A 1ZA1B 2DIWA 4MBGA 1KPSB 3CV0A 2QTVA 3THKA 3RJVA 1LTXA 2HR2A 4HNAD 3EFOA 1KSWA 3O48A 2MPXC 2ILRA 4B8AA 1WI7A 2K3XA 4AFSC 3FWVA 2KATA 2XMFA 1B89A 1O1SA 4CC4B 3DPYA 2LT1A 4RG9A 4A63B 3CVQA 1CSKA 2LSUA 4PJLA 1WZOA 3HXDA 4DQ2A 2O2OA 2GTOA 2DBMA 1X75C 3LY7A 1TOVA 1K73U 2IJGX 4ACKA 4RG6A 2I6HA 1UJKA 3Q79A 1RAEB 2M02A 3DSVA 1RABB 3QWYA 4CT4A 4QQDA 3UM2A 3X24B 4IUUA 3DSTA 4M7DA 2PL2A 3UF4A 1GBRA 4C92F 2LXMA 1UGVA 3OYHA 4F1SA 2P9PG 4JLGA 1RL2A 4UUCA 3CSFA 5CRUA 5ANRA 2O4XA 1M5Q1 1VQLQ 3EG9A 3NFCA 2D1XA 1NPPA 4EMKA 4TRQA 3VLDA 3JXIA 1AWJA 3CMEA 2FL7A 3M0QA 2COYA 2DNUA 2KBTA 3TU4K 3TWWA 5LOZA 5KYUB 1O9SA 1H3ZA 3ASGA 3QZ5B 4ANWA 5KH6A 4GY5A 3B7SA 2EW3A 5HCKA 1RAIB 3V8LA 1AEYA 1IREB 4JEHA 4UI9C 1WY6A 2RQWA 4RVBA 1N4QA 1GXIE 4I2WA 4PH4B 4IUPA 4F7UF 3CCVA 3H41A 5J3BA 4HVBA 4LNGA 3UKUG 4D6WA 1H6PA 3TEEA 5G2NA 3VU3C 1C0MA 2GRQB 2B8AA 3TWRA 2VUBA 5GMKj 5LX8A 2AXUA 3C0CA 3QYGB 3I56T 5BT1A 1MNDA 1JB0E 4M7AE 4AOFA 1UJ0A 4IUQA 3HG0D 2RI3A 4BFRA 2CHXA 3QDRB 2QXFA 1FXXA 4EHMA 2FZCB 3C3RA 4U04A 1YJWA 1NG2A 1TNOA 5GAOr 1ZQ1A 1R8OB 2E3IA 3CD6A 3MCXA 4PJOG 4HFGA 4HVWA 1AWCB 1Y7XA 3H0HA 2QQSA 2K5LA 1VDYA 1KQSA 2DRKA 3SF4A 1VYUA 4FYXB 2A08A 4PJOB 5D7UA 3H0IA 1N4RA 2WXQA 1VQ9A 5EDSA 1IB8A 5LJ5g 3OAWA 3SQVA 1OPLA 1SEMA 5AENA 1JJ2P 4GA0A 1U3CA 2ZCFB 2EIKE 1VQ5Q 2L0AA 3G2UA 4L7TA 4ANUA 4FIBA 4KULA 3VUZA 3CC2T 3ULYA 1OX8A 2P9NG 5JHBA 4N4GA 2G6FX 4JPBW 4JA9A 1QKWA 3VS6A 2Q7FA 3CHRA 3OYYA 3O8VA 2DD5A 1G3WA 3NMZC 1VQOQ 5ENTD 3ULQA 3EUVA 2PUKB 2L5QA 2GW1A 1OCRE 1ZB1A 2YHEA 3P1UA 4PJJA 2I2OA 2FPEA 4KRTA 3JCMP 5LCWJ 1PAQA 1VOMA 2XZDG 5HY6A 4LD6A 3M59A 2LT4A 1NLPC 2QDYB 3SEMA 4WWPA 4Q5WA 4CC3A 1H0AA 1N27A 1VQ8T 5ENRD 1K1ZA 4BEPA 4BESA 4Y92A 1S0PA 1VIEA 3OBWA 2WXIA 2PQNA 3QC1A 4YDOA 4CDMA 1U3OA 4HRNA 1U3DA 2EQXA 1K73R 2EQIA 3MP1A 4JW1A 3DBSA 3E32A 1LOJA 1HD3A 2RHIA 2R59A 4XZ4A 2OEVA 3I5PA 4TXQA 2WVIA 2I9CA 3OBYA 4CC2A 4J9FA 3G2WA 4CGVA 1JCRA 3AS5A 2J06A 4M78D 3CC7Q 3LPZA 3CVPA 4HI8A 1FT2A 1ZA2B 3G71A 2LAIA 3CCJT 5GAN4 3QK0A 2EPDA 3BEEA 2NSZA 1OI1A 1VQNQ 3JB9F 2KBXA 2FZKB 4E7LA 4HOSA 1OU8A 1C6VX 2KVQG 4M77F 4C5EA 2SEMA 3B7BA 1GCQC 2XQ0A 4L59A 1G3YA 4G8KA 5CMYA 2ROTA 1S72T 3GW4A 2GRMA 4KBQA 1M1KR 1E8XA 3FU3A 1AD5A 4M7AC 5EX3A 4BTAA 2H3EB 2V1RA 4F3VA 1GCPA 4BB7A 4YNDA 1UN8A 4GTTA 4HOUA 2BUGA 1H2VC 5C1DA 3JCMg 3C5RA 1N52A 2V4HC 1VQKQ 4HRMB 3ONLA 4O6JA 3TL5A 3CCRQ 2KYBA 3ZHEA 3AS4A 3W9GA 1K0SA 1VQ6A 2H6FA 1BBZA 1FMKA 2XGMA 4W9RA 3HXCA 1OZ2A 1KT0A 2BUDA 4J83A 2M51A 4AFUC 3TJPA 3FUNA 1WXTA 4HXJA 2ZXWE 1ACMB 3ZFJA 1OXJA 4XU3A 2GNCA 1ELRA 3ASDA 5AT1B 5FLXE 4LCTA 2AZVA 1H3HA 3MP8A 2RB6A 2DXUA 4L9PA 3JCMJ 1UEBA 1W2BA 3JB9H 2QGFB 3AAAC 1PC0A 5AQ7A 1WHHA 1Q7YU 2KRNA 2AT1B 1QLYA 4E7HA 1WJQA 3CCMA 2KZTA 2LQKA 2YRDA 4YVQC 2O88A 3D7SB 5ENOD 3FUIA 1W6XA 3HXEA 2R17C 2LP5A 1AWWA 3MA5A 2JMCA 1KC8U 1QVFP 1ZU2A 1OPKA 3L1AA 3G6EA 1NFIE 1HZ4A 2ZZDA 2IO2C 1PM3A 3A8GB 2RFAA 4M7DF 4DI4A 4JD2G 4M75F 1QYMA 2VASA 2MOXA 1R0BG 4KVMA 4JRPA 4LDYA 1UG3A 4BE2A 4JPSA 4MRUA 1VQ4Q 1E8YA 1KD1C 4X1VA 5J26A 4FSXA 4E2FB 2XK0A 3CK8A 1JJ2S 1XGWA 4GZ5A 4IN3B 3MEUA 5GAOl 3PE3A 3FTWA 5CKFA 4H7YA 2KT8A 5FROA 3M58A 2DLPA 1H6KA 4U63A 5GAOn 3E37A 3GF5A 5GANf 3UT4A 1QNFA 2DM1A 1FMWA 3DRAA 3FUKA 4LERA 1YN8A 2EWNA 1CKBA 4OMOA 1A5EA 3ZL7C 3ESKA 3L6AA 4RTZA 1M9SA 3G4ST 1TNUA 1ZHIA 4JEUA 2R2LA 3JXJA 4FLBA 3KS2A 1NL4A 3JYSA 5A6CA 2H6HA 4N0AA 2DVWA 5JA4D 4JC8A 5ARGA 4XAXB 1B34B 3HHTB 2CUDA 3G2SA 4EBAG 3HFOA 4M4ZA 1JWFA 3M0UA 3CMEQ 1YWPA 3D9NA 2JM9A 3TSZA 5GANe 2AHJB 4XTZA 1VQPT 2EAYA 7AT1B 1Y96A 3CC4T 4JRQA 3CCEA 3ASNE 4DBHA 2QYUA 3FTSA 1QZ2A 4DEYA 4FW1A 4DOWA 1ZUKA 4FC8A 2F0YA 2J6KA 1RAGB 4FT2A 3CQCB 1SPKA 3FTZA 5AQBA 2R5AA 1OY3D 3HL8A 1TH7A 3T5XA 3EG0A 3EU5A 2LNIA 3PVQA 3M0TA 2E2EA 3ML9A 4NIKA 1SQMA 2WXHA 5BV1A 2ZPFB 3PFSA 2YUOA 1RI9A 2LZ6B 4DX1A 5LJ3d 2CP7A 1OT8A 2KXDA 2RG8A
chains in the Genus database with same CATH topology
2ETBA 3D9HA 5KNGA 3I5SA 4IIOA 3O5ZA 5CEDB 4D8KA 1JEGA 2DBKA 1UOHA 4R0KA 2ABLA 3JUEA 4YDWA 2C0OA 5BXOA 1QKXA 2QC9A 2IIMA 1TR4A 1X2QA 1X6BA 2JABA 1NEGA 1MV0B 4JB8P 2L6BA 3Q9NC 3JV3A 1T3LA 4BERA 5CBNA 5IHNA 1Y57A 2KRMA 3IXEA 2CT3A 1BI8B 1UE9A 1WXBA 2KRSA 2KGTA 2FPDA 3TWVA 5AAOA 4LG6A 5I11A 3QWXX 1A0NB 3TWXA 3V31A 2RQTA 4DX7D 3EHQA 2MIOA 4HI9A 3M0SA 4O1PA 1N11A 4RLYA 1M3CA 2D0NA 3UATA 2HCKA 2P4RA 3LH5A 2PZ1A 4EIKA 1DCQA 1SRLA 1W1FA 2OI3A 1X69A 5HS0A 5EIDA 2F2WA 4JZ3A 4RTVA 3EG2A 4CYMD 2EYYA 2LJ3A 1NYFA 3B95A 4FSSA 1QCFA 2RNAA 1IXVA 1BU1A 1UDLA 1ZSGA 4AFZC 2XZTG 3TWTA 1UHFA 1ZUYA 2NYJA 3J5QB 2F37A 1JXOA 2EGAA 3SHWA 3U23A 4HBDA 2EYWA 3LJNA 2V5QC 1BK2A 4JJDA 2XENA 5FWCA 4J8YA 3VRYA 5EC7A 3VS1A 3J5PA 1H8KA 2BZYA 4CZ2D 2RQRA 1TUCA 2YSQA 1T3SA 2LQNA 2FO1E 4J9CA 1Z9QA 1B07A 1G3NB 2FPFA 4HVUA 1U06A 1VYVA 2A28A 4G8LA 1NYGA 4J9EA 3VS4A 3RBBB 1UHCA 4RUGA 1M27C 1SSHA 5GJWB 2L3SA 4LUEA 2JT4A 5EIBE 4LNUD 5AQ9A 1Z9ZA 2CT4A 3RNJA 4RTYA 2O31A 3UTMA 3V2OA 1X2KA 5HKPA 2BKKB 2Y0BG 4J9GA 1U5SA 4DX5D 1IO6A 1WDXA 2H8HA 3EU9A 2P2CP 2PNIA 3TSWA 4J9IA 2OAWA 1KFZA 2HBWA 4DRXE 3SO8A 5IHKA 1MYOA 3KEAA 4GPMA 4GMRA 4U8YD 5HRYA 1SRMA 2RQVA 2L3QA 1E7OA 4DX6D 2ETAA 2VKNA 2F2VA 1K9AA 2I0NA 2O9SA 4O1OA 5CERB 4QT7A 1NM7A 3ZUVB 1KIKA 2MYOA 4HQDA 1WFWA 2J8SD 3NPFA 1BD8A 5FW9A 2OJ2A 3NHNA 2ECZA 1WA7A 2J6FA 2BKGA 2J6OA 1IKND 1SW6A 1CKAA 2LCSA 4O60A 2DL8A 2X3XD 1IHBA 1FYNA 5L23A 3THKA 3NGPA 4J9BA 1MX6A 2F8YA 1PRMC 4HNAD 1AZEA 1GFDA 1KSWA 4U96D 1ZX6A 1WI7A 1N0RA 4AFSC 2XEEA 3T8KA 2XMFA 4U95D 4CC4B 2CSQA 1YYHA 4A63B 1CSKA 1G2BA 5IHIA 1MX2A 2FEIA 1WXUA 2O2OA 2BTTA 2GTOA 2DBMA 4JJCA 2VWFA 3ZNGA 2KYMA 2KXPC 1ZBJA 1GL5A 2DWZA 4CC7A 3QWYA 1RLQC 1H92A 3UF4A 4AFQC 1GBRA 4DX2A 1UGVA 1UUEA 5IXFA 1AWOA 1K0XA 4UUCA 2JXBA 2FRYA 5FIOA 2D1XA 3CQTA 3ULRB 5ITZF 2LJ0A 1ARKA 1E6GA 3JXIA 1AWJA 2CDTA 2LX7A 2AKKA 4E6RA 3PE0A 3M0QA 2KBTA 2DNUA 1MX4A 1ZUUA 3TWWA 1M3BA 4OMLA 2K6DA 1B3QA 4LNPA 2EW3A 5HCKA 3I5RA 3VS2A 1AEYA 1BI7B 5I22A 2RQWA 2KXCA 2KEAA 2JTEA 1QWFA 3H41A 3F6QA 1X43A 1WX6A 5IH2A 4GBQA 4OAUC 2KR3A 2PNNA 1N0QA 2DL4A 3TWRA 2C0TA 1JU5C 1NLOC 3C0CA 1ABOA 2XEHA 5KBAA 2D8JA 2CUBA 3DEPA 3PVLA 2DRMA 4J7WA 1SHFA 4C48B 2LMJA 1UJ0A 1X27A 2PTKA 5FWBA 3TVTA 3HG0D 1T0HA 2ED1A 2DE0X 2DZOA 2KT1A 4LN2A 1GFCA 2CH4W 1NG2A 1QWEA 2K7AA 4OMNA 1AVZC 2DF6A 3REBB 4TUMA 2AJAA 4J9DA 3ZU7B 4HVWA 1AWCB 3H0HA 3Q9UC 5KNHD 2RMOA 2DRKA 1HJDA 1VYUA 4BETA 4ATZD 2W0ZA 4Z89A 1KJWA 1PNJA 2A08A 2RN8A 3H0IA 1OPLA 1SEMA 3AJIA 5EYLA 2A37A 2AK5A 2DJQA 5ECAA 2AKLA 2A5EA 2L0AA 5ENQD 1ZLMA 5CECB 2K3BA 2VVKA 1V1CA 1I0CA 2EGEA 2DL3A 2LNHB 5AQAA 5AARA 2G6FX 4JPBW 1SVXA 1QKWA 2BZXA 3VS6A 2YDLA 5FINA 2ETCA 2L3PA 5D66A 1YMPA 4AG2C 3NMZC 2DL5A 2ZGDA 5ENTD 3ZKJA 4RTTA 4DUIA 1PWTA 3KFVA 2FPEA 4KRTA 1TG0A 2RQUA 3EGUA 2XZDG 3UA6A 1PHTA 1RUWA 1NLPC 4OAVB 3SEMA 2K9GA 4CC3A 5ENRD 1K1ZA 4BEPA 3R6NA 4BESA 4Y92A 1WIEA 1PKSA 2RF0A 1I07A 1U3OA 4HRNA 2D8HA 3FJ5A 2EQIA 4HRLA 1HD3A 3IQLA 2FRWA 3VS3A 5ENPD 4ESRA 5EN5D 1OV3A 3T9KA 1AOJA 1YWOA 2LQWA 4Z88A 1K3ZD 4CC2A 4J9FA 1W70A 2J06A 4F16A 4OMMA 4HI8A 4K11A 1UG1A 2EGCA 2ENMA 1HSQA 5ENSD 2EPDA 1DC2A 2NWMA 4F17A 4LSZE 2SRCA 2KBXA 4RTWA 1K1AA 1MJ0A 2M0YA 4OMPA 2HSPA 4F1PA 2AZSA 4K5AB 1UTIA 2J05A 4YDYA 2SEMA 1AP7A 1BLXB 2DZNA 3B7BA 1GCQC 1UECA 4WCIA 2DILA 2ROLA 4G8KA 2ROTA 1YP5A 2HE0A 3HRAA 3VS7A 1K76A 1AD5A 1JO8A 1YNZA 1BU9A 2ESWA 2V1RA 1GCPA 5IXBA 1S70B 2EYXA 2ZGGA 4Z68A 1WDYA 3C5RA 2EVRA 1G83A 2JS2A 2V4HC 4K5CA 1BB9A 4HRMB 3UXGA 2KYBA 1YCSB 1M3AA 3W9GA 1K0SA 4B93B 3M0PA 4OMQA 1FMKA 1BBZA 2ED0A 3VRZA 2M51A 3REAB 2F2XA 4AFUC 1WXTA 4HXJA 2J7IA 2GNCA 3EG1A 4F14A 1VA7A 1H3HA 2B86A 2AZVA 3I9QA 4ZNXA 1PRLC 5CBOA 3AAAC 2DX1A 5AQ7A 1JXMA 2KRNA 1QLYA 2F8XK 3EG3A 2GGRA 2E5KA 4F6RD 2KROA 5GJVB 2O88A 2C0IA 5ENOD 4D8DA 1W6XA 4ZFHA 1AWWA 2JMAA 2LP5A 4N5QA 2JMCA 1OPKA 2DA9A 3M0RA 4HB5A 1N5ZA 3VS0A 1NFIE 2DYBA 4J9HA 2JS0A 2RFAA 4DEXA 1Y0MA 2K2MA 2EBPA 1QYMA 2O9VA 4U8VD 1OOTA 2MOXA 3TWUA 2YUQA 4JJBA 4RTUA 2L2PA 2V1QA 2QYJA 2FO0A 2KE9A 4X1VA 2B0OE 1T0JA 4GLMA 2DL7A 2BZ8A 1UJYA 3I35A 2W10A 4Z8AA 5AN8A 3EHRA 3TWSA 1X6GA 2KT8A 4ORZA 2DLPA 1NEBA 1GRIA 1E6HA 1MUZA 1UFFA 3TWQA 1M30A 1OEBA 3H0FA 3NOCD 2QDLA 3NOGD 4QFVA 5JMND 1MV3A 2DM1A 4RTXA 1J3TA 2Y1LE 1YN8A 1CKBA 2GQIA 4OMOA 1A5EA 3ZL7C 2MCNA 1PKTA 3UI2A 2CH4A 1D9SA 4HVVA 4BSZB 4RTZA 3V79K 2A36A 2GTJA 2YUNA 4AG1C 3W9FA 1K1BA 1LCKA 4ZHBA 4QQIA 3JXJA 2DMOA 5KWDA 4HCKA 3V2XA 2JM8A 1VYTA 2CSIA 5EILA 1WYXA 1GBQA 1WLPB 2FG0A 4IIMA 1JQQA 2DVWA 5JA4D 1GCQA 1M8MA 2HEQA 2VGEA 2EYZA 2HDAA 3VS5A 2CUDA 2K79A 1K4US 2KNBB 3NBNB 2GBQA 5BXUA 2EKHA 4M4ZA 4HLLA 3M0UA 5EYPF 2RPNA 1YWPA 1ABQA 2RFMA 2DVJA 2JM9A 3TSZA 2YT6A 2NUZA 1SHGA 4LUDA 4JZ4A 1WG0A 3UA7A 3V30A 1S1NA 3DEOA 4DEYA 1ZUKA 1AZGB 1I1JA 2J6KA 2JW4A 4LE9A 3GBQA 4K5BA 1SPKA 5AQBA 2LJ1A 1EFNA 2X3WD 3A98A 1OY3D 3EG0A 5CEAA 3PVQA 3M0TA 2YUPA 2CREA 4NIKA 1AWXA 1XOVA 1RI9A 2YUOA 2LZ6B 4DX1A 1RLPC 1OT8A 2KXDA 1TUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ETB A;  3D9H A;  5KNG A;  3I5S A;  4IIO A;  3O5Z A;  5CED B;  4D8K A;  1JEG A;  2DBK A;  1UOH A;  4R0K A;  2ABL A;  3JUE A;  4YDW A;  2C0O A;  5BXO A;  1QKX A;  2QC9 A;  2IIM A;  1TR4 A;  1X2Q A;  1X6B A;  2JAB A;  1NEG A;  1MV0 B;  4JB8 P;  2L6B A;  3Q9N C;  3JV3 A;  1T3L A;  4BER A;  5CBN A;  5IHN A;  1Y57 A;  2KRM A;  3IXE A;  2CT3 A;  1BI8 B;  1UE9 A;  1WXB A;  2KRS A;  2KGT A;  2FPD A;  3TWV A;  5AAO A;  4LG6 A;  5I11 A;  3QWX X;  1A0N B;  3TWX A;  3V31 A;  2RQT A;  4DX7 D;  3EHQ A;  2MIO A;  4HI9 A;  3M0S A;  4O1P A;  1N11 A;  4RLY A;  1M3C A;  2D0N A;  3UAT A;  2HCK A;  2P4R A;  3LH5 A;  2PZ1 A;  4EIK A;  1DCQ A;  1SRL A;  1W1F A;  2OI3 A;  1X69 A;  5HS0 A;  5EID A;  2F2W A;  4JZ3 A;  4RTV A;  3EG2 A;  4CYM D;  2EYY A;  2LJ3 A;  1NYF A;  3B95 A;  4FSS A;  1QCF A;  2RNA A;  1IXV A;  1BU1 A;  1UDL A;  1ZSG A;  4AFZ C;  2XZT G;  3TWT A;  1UHF A;  1ZUY A;  2NYJ A;  3J5Q B;  2F37 A;  1JXO A;  2EGA A;  3SHW A;  3U23 A;  4HBD A;  2EYW A;  3LJN A;  2V5Q C;  1BK2 A;  4JJD A;  2XEN A;  5FWC A;  4J8Y A;  3VRY A;  5EC7 A;  3VS1 A;  3J5P A;  1H8K A;  2BZY A;  4CZ2 D;  2RQR A;  1TUC A;  2YSQ A;  1T3S A;  2LQN A;  2FO1 E;  4J9C A;  1Z9Q A;  1B07 A;  1G3N B;  2FPF A;  4HVU A;  1U06 A;  1VYV A;  2A28 A;  4G8L A;  1NYG A;  4J9E A;  3VS4 A;  3RBB B;  1UHC A;  4RUG A;  1M27 C;  1SSH A;  5GJW B;  2L3S A;  4LUE A;  2JT4 A;  5EIB E;  4LNU D;  5AQ9 A;  1Z9Z A;  2CT4 A;  3RNJ A;  4RTY A;  2O31 A;  3UTM A;  3V2O A;  1X2K A;  5HKP A;  2BKK B;  2Y0B G;  4J9G A;  1U5S A;  4DX5 D;  1IO6 A;  1WDX A;  2H8H A;  3EU9 A;  2P2C P;  2PNI A;  3TSW A;  4J9I A;  2OAW A;  1KFZ A;  2HBW A;  4DRX E;  3SO8 A;  5IHK A;  1MYO A;  3KEA A;  4GPM A;  4GMR A;  4U8Y D;  5HRY A;  1SRM A;  2RQV A;  2L3Q A;  1E7O A;  4DX6 D;  2ETA A;  2VKN A;  2F2V A;  1K9A A;  2I0N A;  2O9S A;  4O1O A;  5CER B;  4QT7 A;  1NM7 A;  3ZUV B;  1KIK A;  2MYO A;  4HQD A;  1WFW A;  2J8S D;  3NPF A;  1BD8 A;  5FW9 A;  2OJ2 A;  3NHN A;  2ECZ A;  1WA7 A;  2J6F A;  2BKG A;  2J6O A;  1IKN D;  1SW6 A;  1CKA A;  2LCS A;  4O60 A;  2DL8 A;  2X3X D;  1IHB A;  1FYN A;  5L23 A;  3THK A;  3NGP A;  4J9B A;  1MX6 A;  2F8Y A;  1PRM C;  4HNA D;  1AZE A;  1GFD A;  1KSW A;  4U96 D;  1ZX6 A;  1WI7 A;  1N0R A;  4AFS C;  2XEE A;  3T8K A;  2XMF A;  4U95 D;  4CC4 B;  2CSQ A;  1YYH A;  4A63 B;  1CSK A;  1G2B A;  5IHI A;  1MX2 A;  2FEI A;  1WXU A;  2O2O A;  2BTT A;  2GTO A;  2DBM A;  4JJC A;  2VWF A;  3ZNG A;  2KYM A;  2KXP C;  1ZBJ A;  1GL5 A;  2DWZ A;  4CC7 A;  3QWY A;  1RLQ C;  1H92 A;  3UF4 A;  4AFQ C;  1GBR A;  4DX2 A;  1UGV A;  1UUE A;  5IXF A;  1AWO A;  1K0X A;  4UUC A;  2JXB A;  2FRY A;  5FIO A;  2D1X A;  3CQT A;  3ULR B;  5ITZ F;  2LJ0 A;  1ARK A;  1E6G A;  3JXI A;  1AWJ A;  2CDT A;  2LX7 A;  2AKK A;  4E6R A;  3PE0 A;  3M0Q A;  2KBT A;  2DNU A;  1MX4 A;  1ZUU A;  3TWW A;  1M3B A;  4OML A;  2K6D A;  1B3Q A;  4LNP A;  2EW3 A;  5HCK A;  3I5R A;  3VS2 A;  1AEY A;  1BI7 B;  5I22 A;  2RQW A;  2KXC A;  2KEA A;  2JTE A;  1QWF A;  3H41 A;  3F6Q A;  1X43 A;  1WX6 A;  5IH2 A;  4GBQ A;  4OAU C;  2KR3 A;  2PNN A;  1N0Q A;  2DL4 A;  3TWR A;  2C0T A;  1JU5 C;  1NLO C;  3C0C A;  1ABO A;  2XEH A;  5KBA A;  2D8J A;  2CUB A;  3DEP A;  3PVL A;  2DRM A;  4J7W A;  1SHF A;  4C48 B;  2LMJ A;  1UJ0 A;  1X27 A;  2PTK A;  5FWB A;  3TVT A;  3HG0 D;  1T0H A;  2ED1 A;  2DE0 X;  2DZO A;  2KT1 A;  4LN2 A;  1GFC A;  2CH4 W;  1NG2 A;  1QWE A;  2K7A A;  4OMN A;  1AVZ C;  2DF6 A;  3REB B;  4TUM A;  2AJA A;  4J9D A;  3ZU7 B;  4HVW A;  1AWC B;  3H0H A;  3Q9U C;  5KNH D;  2RMO A;  2DRK A;  1HJD A;  1VYU A;  4BET A;  4ATZ D;  2W0Z A;  4Z89 A;  1KJW A;  1PNJ A;  2A08 A;  2RN8 A;  3H0I A;  1OPL A;  1SEM A;  3AJI A;  5EYL A;  2A37 A;  2AK5 A;  2DJQ A;  5ECA A;  2AKL A;  2A5E A;  2L0A A;  5ENQ D;  1ZLM A;  5CEC B;  2K3B A;  2VVK A;  1V1C A;  1I0C A;  2EGE A;  2DL3 A;  2LNH B;  5AQA A;  5AAR A;  2G6F X;  4JPB W;  1SVX A;  1QKW A;  2BZX A;  3VS6 A;  2YDL A;  5FIN A;  2ETC A;  2L3P A;  5D66 A;  1YMP A;  4AG2 C;  3NMZ C;  2DL5 A;  2ZGD A;  5ENT D;  3ZKJ A;  4RTT A;  4DUI A;  1PWT A;  3KFV A;  2FPE A;  4KRT A;  1TG0 A;  2RQU A;  3EGU A;  2XZD G;  3UA6 A;  1PHT A;  1RUW A;  1NLP C;  4OAV B;  3SEM A;  2K9G A;  4CC3 A;  5ENR D;  1K1Z A;  4BEP A;  3R6N A;  4BES A;  4Y92 A;  1WIE A;  1PKS A;  2RF0 A;  1I07 A;  1U3O A;  4HRN A;  2D8H A;  3FJ5 A;  2EQI A;  4HRL A;  1HD3 A;  3IQL A;  2FRW A;  3VS3 A;  5ENP D;  4ESR A;  5EN5 D;  1OV3 A;  3T9K A;  1AOJ A;  1YWO A;  2LQW A;  4Z88 A;  1K3Z D;  4CC2 A;  4J9F A;  1W70 A;  2J06 A;  4F16 A;  4OMM A;  4HI8 A;  4K11 A;  1UG1 A;  2EGC A;  2ENM A;  1HSQ A;  5ENS D;  2EPD A;  1DC2 A;  2NWM A;  4F17 A;  4LSZ E;  2SRC A;  2KBX A;  4RTW A;  1K1A A;  1MJ0 A;  2M0Y A;  4OMP A;  2HSP A;  4F1P A;  2AZS A;  4K5A B;  1UTI A;  2J05 A;  4YDY A;  2SEM A;  1AP7 A;  1BLX B;  2DZN A;  3B7B A;  1GCQ C;  1UEC A;  4WCI A;  2DIL A;  2ROL A;  4G8K A;  2ROT A;  1YP5 A;  2HE0 A;  3HRA A;  3VS7 A;  1K76 A;  1AD5 A;  1JO8 A;  1YNZ A;  1BU9 A;  2ESW A;  2V1R A;  1GCP A;  5IXB A;  1S70 B;  2EYX A;  2ZGG A;  4Z68 A;  1WDY A;  3C5R A;  2EVR A;  1G83 A;  2JS2 A;  2V4H C;  4K5C A;  1BB9 A;  4HRM B;  3UXG A;  2KYB A;  1YCS B;  1M3A A;  3W9G A;  1K0S A;  4B93 B;  3M0P A;  4OMQ A;  1FMK A;  1BBZ A;  2ED0 A;  3VRZ A;  2M51 A;  3REA B;  2F2X A;  4AFU C;  1WXT A;  4HXJ A;  2J7I A;  2GNC A;  3EG1 A;  4F14 A;  1VA7 A;  1H3H A;  2B86 A;  2AZV A;  3I9Q A;  4ZNX A;  1PRL C;  5CBO A;  3AAA C;  2DX1 A;  5AQ7 A;  1JXM A;  2KRN A;  1QLY A;  2F8X K;  3EG3 A;  2GGR A;  2E5K A;  4F6R D;  2KRO A;  5GJV B;  2O88 A;  2C0I A;  5ENO D;  4D8D A;  1W6X A;  4ZFH A;  1AWW A;  2JMA A;  2LP5 A;  4N5Q A;  2JMC A;  1OPK A;  2DA9 A;  3M0R A;  4HB5 A;  1N5Z A;  3VS0 A;  1NFI E;  2DYB A;  4J9H A;  2JS0 A;  2RFA A;  4DEX A;  1Y0M A;  2K2M A;  2EBP A;  1QYM A;  2O9V A;  4U8V D;  1OOT A;  2MOX A;  3TWU A;  2YUQ A;  4JJB A;  4RTU A;  2L2P A;  2V1Q A;  2QYJ A;  2FO0 A;  2KE9 A;  4X1V A;  2B0O E;  1T0J A;  4GLM A;  2DL7 A;  2BZ8 A;  1UJY A;  3I35 A;  2W10 A;  4Z8A A;  5AN8 A;  3EHR A;  3TWS A;  1X6G A;  2KT8 A;  4ORZ A;  2DLP A;  1NEB A;  1GRI A;  1E6H A;  1MUZ A;  1UFF A;  3TWQ A;  1M30 A;  1OEB A;  3H0F A;  3NOC D;  2QDL A;  3NOG D;  4QFV A;  5JMN D;  1MV3 A;  2DM1 A;  4RTX A;  1J3T A;  2Y1L E;  1YN8 A;  1CKB A;  2GQI A;  4OMO A;  1A5E A;  3ZL7 C;  2MCN A;  1PKT A;  3UI2 A;  2CH4 A;  1D9S A;  4HVV A;  4BSZ B;  4RTZ A;  3V79 K;  2A36 A;  2GTJ A;  2YUN A;  4AG1 C;  3W9F A;  1K1B A;  1LCK A;  4ZHB A;  4QQI A;  3JXJ A;  2DMO A;  5KWD A;  4HCK A;  3V2X A;  2JM8 A;  1VYT A;  2CSI A;  5EIL A;  1WYX A;  1GBQ A;  1WLP B;  2FG0 A;  4IIM A;  1JQQ A;  2DVW A;  5JA4 D;  1GCQ A;  1M8M A;  2HEQ A;  2VGE A;  2EYZ A;  2HDA A;  3VS5 A;  2CUD A;  2K79 A;  1K4U S;  2KNB B;  3NBN B;  2GBQ A;  5BXU A;  2EKH A;  4M4Z A;  4HLL A;  3M0U A;  5EYP F;  2RPN A;  1YWP A;  1ABQ A;  2RFM A;  2DVJ A;  2JM9 A;  3TSZ A;  2YT6 A;  2NUZ A;  1SHG A;  4LUD A;  4JZ4 A;  1WG0 A;  3UA7 A;  3V30 A;  1S1N A;  3DEO A;  4DEY A;  1ZUK A;  1AZG B;  1I1J A;  2J6K A;  2JW4 A;  4LE9 A;  3GBQ A;  4K5B A;  1SPK A;  5AQB A;  2LJ1 A;  1EFN A;  2X3W D;  3A98 A;  1OY3 D;  3EG0 A;  5CEA A;  3PVQ A;  3M0T A;  2YUP A;  2CRE A;  4NIK A;  1AWX A;  1XOV A;  1RI9 A;  2YUO A;  2LZ6 B;  4DX1 A;  1RLP C;  1OT8 A;  2KXD A;  1TUD A; 
#chains in the Genus database with same CATH topology
 3ZRH A;  2ETB A;  3D9H A;  4MZM A;  4IIO A;  4BX9 A;  4IUR A;  4QQ6 A;  4CCA A;  2XPY A;  2OTJ T;  4GML A;  3OYB A;  1XJW B;  3FDH A;  2EJG A;  2EIF A;  4FJZ A;  1I8F A;  2I2L A;  2XRZ A;  2QC9 A;  1TR4 A;  2XHE A;  2CZ0 B;  1X6B A;  3EGD A;  2YIN A;  3P8D A;  4JS4 A;  4JB8 P;  1Q95 G;  2VGM A;  1YJW Q;  1T3L A;  3Q75 A;  2RJD A;  5KYX A;  4NUR A;  2OTL Q;  4M7A G;  5IHN A;  4A1S A;  1IGQ A;  2XGS A;  3CMA T;  3CD6 Q;  4KZ0 A;  1BI8 B;  1UE9 A;  2KRS A;  5D0O D;  2KGT A;  4M78 G;  3DXM G;  1HG2 A;  3JAM E;  1Q86 U;  5AAO A;  4LG6 A;  4J5Y A;  3LGF A;  3ASO E;  4OVV A;  2CZ6 B;  4M7A B;  3RKY A;  3DSX A;  3EHQ A;  2CZ7 B;  1Q7Y R;  3ZFW A;  4O1P A;  4M78 B;  2YHC A;  3IHV A;  3BDL A;  4L6V 5;  1VQ9 Q;  1WGS A;  3FTX A;  2MOW A;  2UY1 A;  3MKQ B;  4U0S A;  4EIK A;  1DCQ A;  1SRL A;  1W1F A;  3I55 A;  3CCU T;  3V8J A;  1OYX A;  2RM4 A;  3FP3 A;  2F2W A;  2RHY A;  3M9Q A;  4CT0 A;  2RJF A;  1PY1 A;  4JRK A;  2KMT A;  4RTV A;  2EYY A;  5T4Y A;  1NYF A;  3D3M A;  2FB7 A;  3C4S A;  1ZSG A;  3CCL T;  4AFZ C;  2QEX A;  2XZT G;  1YI2 T;  2HYZ A;  1UHF A;  2CHW A;  2NYJ A;  5LJ5 f;  3J5Q B;  2DYR E;  2ZIR A;  2C06 A;  1V54 E;  5IY5 E;  1OCC E;  4HBD A;  4I17 A;  4ABN A;  1LNX A;  2EYW A;  4JJD A;  4AEZ C;  1OZ3 A;  4WF2 A;  1QVF S;  3VRY A;  4GZD A;  4V3I A;  2EKO A;  3CXC P;  4E7I A;  4BUG A;  1HG5 A;  3CBP A;  5LCW C;  3FY4 A;  3VS1 A;  4F7U E;  4CDR A;  4HT8 A;  3OSV A;  1N94 A;  3LY9 A;  5CK9 A;  3SNX A;  2YSQ A;  3HRS A;  4LD9 K;  2LQN A;  3RK6 A;  4J9C A;  1Z9Q A;  5LL6 S;  1IZ6 A;  2XS1 A;  1VYV A;  2A28 A;  4BDY A;  2B6C A;  3ZXS A;  4JUV A;  4U8H A;  3CCQ T;  1KHC A;  2JOY A;  1HO8 A;  2V8I A;  2XI9 A;  4C92 A;  2CP5 A;  1Z9Z A;  3G71 Q;  1Y6I A;  1PCX A;  3VKI A;  2R58 A;  3LEW A;  1VUB A;  2JN0 A;  1E8Z A;  3ZYK A;  3ZBD A;  3CHM A;  3R7Q A;  1U5S A;  3R9A B;  4DX5 D;  1IO6 A;  3QHS A;  5CKH A;  1HFA A;  3LYI A;  1NE8 A;  3UPV A;  2P2C P;  4I1A A;  2CZ1 B;  2OAW A;  1KFZ A;  2V0P A;  4UWF A;  3CK9 A;  3PH0 C;  4E7K A;  2VGY A;  1Y71 A;  2KM4 A;  4OGE A;  1MYO A;  5IHK A;  1MNE A;  2RJC A;  2KCK A;  1EDU A;  2IEJ A;  4C8Q A;  4I9C A;  1QVG A;  2F2V A;  3MPU B;  4C92 D;  4O1O A;  4QT7 A;  2C0M A;  3PE4 A;  1TEZ A;  4RKU E;  4I6J A;  3LWH A;  1KIK A;  1MMA A;  5HK3 A;  3RO2 A;  3GPL A;  4HQD A;  1WFW A;  2J8S D;  4JHK A;  2YHT A;  2WXO A;  2J6O A;  1SW6 A;  2KCL A;  3OS5 A;  3EIQ C;  2DL8 A;  4AIF A;  2GCX A;  1FYN A;  2JTM A;  3J80 E;  4QKU A;  2X6J A;  4IUV A;  1VQM T;  1I4K 1;  1AZE A;  1YJ9 A;  2QA4 A;  1IHV A;  3OYE A;  1OWP A;  1ZX6 A;  1K8A U;  4GTQ A;  1VQ6 Q;  2XEE A;  1Z3X A;  1RAD B;  2CSQ A;  2Y90 A;  3OW2 P;  1VQL T;  5GAO p;  5G04 J;  3JCM f;  3U9W A;  2VWF A;  5G05 C;  3ZNG A;  2KXP C;  2DXB A;  1GL5 A;  1FX7 A;  1Q86 R;  1YIJ A;  3FUL A;  4CC7 A;  1Q82 C;  2XDB A;  3HIZ A;  1HX8 A;  1QMC A;  3GLX A;  1RLQ C;  2GRN B;  1YHQ T;  1H92 A;  2X6I A;  1FWZ A;  2BTD A;  1KK7 A;  3WVE B;  5GAO q;  3QDN A;  3DWL G;  2IU1 A;  3CCM Q;  4JXT A;  3NF1 A;  1ELK A;  3N5B B;  2DFU A;  1UUE A;  4AY5 A;  3OS2 A;  1K0X A;  5FIO A;  4BSX A;  4BY6 A;  3SWN A;  3CVX A;  2E10 A;  3CQT A;  2QQA A;  5DY9 A;  3ULR B;  5ITZ F;  2LJ0 A;  1VQ7 T;  3FLG A;  5CIU A;  1ARK A;  3ASH A;  1YJN A;  4V2S A;  3V8K A;  3KAE A;  4E6R A;  4CRW A;  1D09 B;  3JQ0 A;  4PFO A;  1M3B A;  2EFI A;  3ISM C;  1MZC A;  4C0F A;  4ZGE B;  4M77 E;  3AG3 E;  4JLI A;  1BI7 B;  3C72 A;  1SA4 A;  2DPP B;  5AYF A;  2IO3 C;  3T8M A;  3I4R B;  4L2Y A;  3ZIM A;  1WJS A;  1NJI U;  3KD7 A;  5T3R A;  3TRE A;  4XKC A;  2C0T A;  4XTV A;  4FT4 A;  5KBA A;  3M54 A;  1W2B P;  3SFY A;  3LXU X;  3H9N A;  3EGX A;  3RR6 A;  3CXC S;  4J7W A;  1M90 U;  4J0U A;  4C48 B;  3UIP C;  5KJN A;  1D1C A;  1EIF A;  3G1J A;  3GIB A;  3TVT A;  4PJO C;  1T0H A;  2VGX A;  2OND A;  2E6N A;  1Q81 U;  3A8H B;  5KYY B;  4GTV A;  3HRT A;  5J08 A;  3L9T A;  4PJN A;  1O5M A;  1YFN A;  2CH4 W;  1QWE A;  4OMN A;  2EIN E;  1AVZ C;  3OYM A;  2V5F A;  2DTI A;  3OMC A;  3PMT A;  5I2M A;  3DXK G;  5IN1 A;  1WHL A;  2BF0 X;  3RAU A;  1TTH B;  4BE1 A;  4BET A;  2DYS E;  5AJL A;  3SY2 A;  1TJC A;  1WHM A;  2F69 A;  2RN8 A;  2X38 A;  3INZ A;  1VQO T;  3CCE Q;  3BG1 B;  4FLH A;  2AK5 A;  5EYL A;  4AXH A;  4YVO A;  2E4H A;  2AKL A;  4BI3 A;  1D8D A;  4PS8 A;  5ENQ D;  1ZLM A;  2DVE A;  2K3B A;  4PNO A;  4C5G A;  2E1H A;  1V1C A;  4LNB A;  5AAR A;  3DB3 A;  1SVX A;  4KT6 B;  2BZX A;  2HQE A;  2YDL A;  1NA3 A;  3JB9 D;  5D66 A;  2DXT A;  4AG2 C;  3OYK A;  4ILH B;  3HTR A;  2VSN A;  2DEU A;  4XQ3 A;  4DUI A;  3KFV A;  4J8D A;  4GTP A;  5KCH A;  1NP7 A;  2BE9 B;  2XPI A;  1TG0 A;  1LD7 A;  5D6W A;  3S2A A;  4PDX A;  3C98 A;  1PHT A;  1R77 A;  1RUW A;  4FYV B;  5JJT A;  1SZA A;  3OXL A;  4K0R A;  1K8A R;  2K9G A;  2QAZ A;  4MMK A;  1WHJ A;  3AT1 B;  3DPD A;  3L2Q A;  5GAM h;  3LX7 A;  2CKK A;  1I07 A;  3H8Z A;  5KCM A;  1WPY A;  2X6H A;  3FIF A;  5FQ4 A;  3BUA A;  4HRL A;  3IQL A;  4LEU A;  3I56 A;  4ESR A;  3AG2 E;  3PZ2 A;  1OV3 A;  1Y07 A;  1YWO A;  4Z88 A;  4LDX A;  1K3Z D;  3FUM A;  2ATC B;  5LJ5 j;  2EQK A;  3TQ7 P;  3ME9 A;  4B89 A;  3L08 A;  2P9S G;  2RHZ A;  3OW2 S;  4L5G A;  2Y69 E;  3GZ1 A;  3ZVV A;  2EGC A;  2ENM A;  5T8I A;  3I55 Q;  4BTB A;  1NZ9 A;  2NWM A;  1OQK A;  1DCE A;  2SRC A;  3CPF A;  2E41 A;  4WWN A;  2NUP A;  2NC9 A;  3CVV A;  1WAO 1;  4OB3 B;  2KQW A;  2HSP A;  1JBM A;  4F1P A;  4M75 A;  2QEX Q;  4BT9 A;  4D10 C;  5CKD A;  2OVB A;  2LCL A;  4AMC A;  1BLX B;  3ABM E;  3UM3 A;  1HXD A;  1MGQ A;  5LJ3 g;  1QBQ A;  1QVP A;  2JEK A;  1YP5 A;  2HE0 A;  4J8S A;  2CYZ B;  2KK4 A;  4HKE A;  3VS7 A;  4RSY A;  3MKD A;  5CKE A;  1GW6 A;  1WQ7 A;  5C6S A;  3CC2 A;  3HHM A;  2ESW A;  3M53 A;  1WJR A;  3L42 A;  4C8Q F;  1NJI R;  1IHG A;  1BI1 A;  4M7D D;  1S70 B;  1WHG A;  4M75 D;  3QJY A;  1WDY A;  3PNL B;  1G83 A;  2FYK A;  2L9B A;  2HD0 A;  2PQR A;  3Q78 A;  1M1K U;  1X6O A;  2P0P A;  4G24 A;  4F7U G;  1M90 R;  2VTB B;  3VLF A;  1YCS B;  5L8R E;  1M3A A;  4B93 B;  4OMQ A;  4NOY A;  1M4Z A;  4MML A;  5KYW A;  1Q81 R;  3LW5 E;  2YQ8 A;  4FJY A;  4EDU A;  3VRZ A;  3MYV A;  2F2X A;  1VQ8 A;  4F7U B;  2CP2 A;  3EG1 A;  4F14 A;  1X01 A;  2B86 A;  3I9Q A;  4IUT A;  4ZNX A;  3VV0 A;  2X4W A;  4L2L A;  4GYW A;  4I6E A;  4M78 E;  2H6I A;  5CBO A;  3MJX A;  1ELW A;  1H19 A;  4N5C A;  3OTN A;  3FUE A;  1TU0 B;  3MGB A;  1JXM A;  2CP0 A;  3EG3 A;  1HK9 A;  2XD0 A;  2E5K A;  2CG2 A;  1VQ4 T;  1KHI A;  3WG7 E;  1N8R C;  2OV8 A;  3TGO A;  4JHR A;  4WAF A;  4A3T A;  4F53 A;  2JMA A;  2FVU A;  3CCJ A;  4CDN A;  2DA9 A;  2E3H A;  4XEI G;  4MDW A;  4EMK C;  4DEX A;  1KC8 C;  2CGH A;  4BD3 A;  3SFM A;  3OYC A;  1SA5 A;  2OOE A;  4U8V D;  5FZR A;  3TWU A;  3NZS A;  4A4E A;  1OUL A;  2L2P A;  2V1Q A;  1HH8 A;  6AT1 B;  1JCQ A;  8AT1 B;  2DKG A;  3B7U X;  3E9G A;  3FFL A;  3APF A;  5C2Y A;  1T0J A;  2CS7 A;  3S3M A;  2HL3 A;  2BZ8 A;  4A54 A;  1UJY A;  3I35 A;  1K9M C;  1YJ9 Q;  4GMJ A;  1S72 A;  2QA4 Q;  4NRH B;  3OYL A;  1GRI A;  1UFF A;  2QQ9 A;  3FU0 A;  3TWQ A;  2X4X A;  2GRP B;  1OEB A;  4KBM B;  3NOC D;  3UWN A;  3NOG D;  3ER0 A;  3APC A;  5JMN D;  4BI4 A;  5GAN 5;  1J3T A;  3CPW S;  2WB2 A;  4PK4 A;  2V4L A;  3BW1 A;  5GAN 6;  1PKT A;  2CH4 A;  2HBP A;  4B9X A;  1S63 A;  2YUN A;  1O1T A;  5G04 C;  3W9F A;  1LCK A;  1I5L A;  2RK1 A;  4G25 A;  3CME T;  1YIJ Q;  3SZ7 A;  2DMO A;  5KWD A;  4URK A;  1VYT A;  2CSI A;  2WQH A;  3IEG A;  3S7D A;  2GFA A;  1WLP B;  2XU8 A;  4EMG A;  2FG0 A;  4DK5 A;  5GAM j;  1M8M A;  1GCQ A;  3FTU A;  3PZ1 A;  3LS8 A;  4PUC A;  2LVM A;  2WPV A;  4P29 A;  2HDA A;  3CHQ A;  2O01 E;  3D9P A;  5M9O A;  3V7C A;  3UPU A;  1K4U S;  4HA8 A;  2D6F A;  2K3Y A;  2GBQ A;  4WNG A;  2A4Z A;  2X4Y A;  4HLL A;  4QVD A;  2CP6 A;  3QUI A;  3QAQ A;  2DVJ A;  3MZL B;  2YT6 A;  2NUZ A;  1LJO A;  1SHG A;  3CGH A;  4OP0 A;  3MKQ A;  4FA6 A;  3PZ4 A;  3DEO A;  1XTD A;  1AZG B;  3S7J A;  2JW4 A;  3CLJ A;  4WWO A;  3HXB A;  4AJW A;  2LJ1 A;  3A98 A;  2J08 A;  1PSF A;  1KG1 A;  3RDV A;  5HI7 A;  3CKB A;  4M77 G;  2OTL T;  4DBQ A;  5JJ6 A;  4A4G A;  1TUD A;  5GAN 3;  2IG0 A;  4JDS A;  4D8K A;  1JEG A;  2DBK A;  3PRZ A;  3DB4 A;  1UGQ B;  1UOH A;  2UWJ G;  1D3B A;  4M77 B;  1FMV A;  3ULE G;  4GYY A;  1TS9 A;  4M78 C;  2XGO A;  3B13 A;  3MHX A;  1M1G A;  2HZY A;  4NQ0 A;  1WXB A;  3JCM V;  4KGV B;  2MMP A;  2FPD A;  4Y28 E;  3A8M B;  3QWX X;  1RI0 A;  4J6Y A;  5HK0 A;  1MMN A;  1EX4 A;  1OUV A;  4J8E A;  2WSE E;  3G4S A;  4CI0 C;  3FB9 A;  1Q2Z A;  3IKO B;  3M0S A;  4PFP A;  2WMO A;  1TUG B;  2F5T X;  2HM8 A;  2M0O A;  1PSE A;  2IFU A;  3S6W A;  3HFN A;  4GTO A;  3FUF A;  4HS2 A;  4YDE A;  1ZSZ A;  3CBM A;  4CYM D;  1BIA A;  4ZGJ B;  2IOL A;  2LJ3 A;  3B95 A;  3P2B A;  2LXL A;  2P9I G;  2RKK A;  1TSF A;  1KQ1 A;  2RNA A;  4RG2 A;  5I21 A;  1ZUY A;  4JVS A;  3EFO B;  3E33 A;  1VQP A;  2QQR A;  2VJ8 A;  1JXO A;  3U23 A;  3CC4 A;  2ION A;  4UQZ A;  3VYH B;  5GMK i;  4B6M A;  2HQX A;  5FWC A;  5M72 A;  4J8Y A;  2XEV A;  4JL0 A;  2ZPH B;  4Z02 A;  3LY8 A;  1FPP A;  4WNF A;  1VIF A;  4XKB A;  2DO3 A;  3CVN A;  1H8K A;  1QW1 A;  2BZY A;  1Z3Y A;  2RQR A;  2WXR A;  4TUU A;  1TUC A;  1UGP B;  2DTH A;  4GB9 A;  3ABL E;  1T3S A;  2M1H A;  4FYW B;  1XNI A;  2FPF A;  4HVU A;  5GMK m;  4N2S A;  3HVE A;  1U06 A;  3FTY A;  4G8L A;  3JCM W;  4PL6 A;  4J6I A;  2OTJ A;  2O4X B;  2Z0W A;  4G11 A;  4ZTF A;  3EG9 B;  3C3Q A;  1BIB A;  3K9I A;  4EMK B;  2PM7 A;  1M27 C;  1SSH A;  5GJW B;  4DA4 A;  4J7I A;  2JT4 A;  2FHD A;  5AYW D;  2CT4 A;  4B0Z A;  2O31 A;  5DM7 R;  2IY0 C;  3UTM A;  3QZ9 B;  3ASK A;  2WXN A;  5FU7 C;  2BKK B;  1QQJ A;  4QQG A;  3CMA A;  2L0T B;  2IPO B;  3EH2 A;  3M55 A;  3X28 B;  4J9I A;  4U07 A;  4O6F A;  2HBW A;  2WQ7 A;  4DRX E;  2PVG B;  2ZGW A;  3KEA A;  3LCA A;  4GMR A;  5CHE E;  2RQV A;  5I2S A;  3SD4 A;  3CHP A;  4KUD K;  2ETA A;  2VKN A;  2I0N A;  4J8F A;  2O9S A;  3CCU A;  5HKC A;  1VQ6 T;  2I1J A;  1QCO A;  4WND A;  3TXN A;  3CC2 Q;  4FCY A;  3QXE B;  5FW9 A;  2OJ2 A;  2ECZ A;  3FEX A;  1IKN D;  2X4J A;  3CCL A;  5LJ3 f;  1IHB A;  3DSS A;  3E9F A;  5E75 A;  3MEW A;  4C5I A;  1YIT T;  1JCS A;  4LXC A;  3GNF B;  1MX6 A;  1KLX A;  2F8Y A;  1PRM C;  3CCV Q;  1GFD A;  2EQJ A;  3CR3 A;  4U96 D;  5J39 A;  4EPZ A;  1LF8 A;  2RK2 A;  4U95 D;  4GPK A;  2EJ9 A;  3ZN3 A;  1YYH A;  1G2B A;  5IHI A;  2G3R A;  2NLU A;  2HO1 A;  2FEI A;  2BTT A;  2NYS A;  4C0G A;  1UB4 A;  3GZ2 A;  2DWZ A;  4DOV A;  1HF8 A;  5KYY A;  2DXC A;  4E6H A;  4WTO B;  4FM4 B;  2KI7 A;  3A5Z B;  3UDC A;  3CCQ A;  3M57 A;  3FH5 A;  5LJ3 e;  1AWO A;  2JXB A;  3M56 A;  3JB9 I;  4GTS A;  2FRY A;  1RAH B;  5FRM A;  3BDU A;  2WQ6 A;  2XID A;  3E4B A;  3JB9 J;  4HCB A;  3CCJ Q;  5GAN h;  1E6G A;  3C95 A;  3PIO A;  2IOS A;  2VXF A;  1SKU B;  2RI2 A;  2MWP A;  3ABK E;  3PE0 A;  2OEW A;  3A8L B;  3Q5M A;  4A55 A;  4C92 E;  3I4G A;  1B3Q A;  3ZPJ A;  5FU6 C;  3GP8 A;  2YRC A;  3DLL A;  3Q15 A;  2PQW A;  3CCS T;  3QSU A;  3UX4 A;  4M7A F;  3VS2 A;  3QII A;  2KXC A;  3TAX A;  2KEA A;  3UM1 A;  2JTE A;  4UWL A;  1X5B A;  3CIA A;  3JSC A;  2MI6 A;  2MHK A;  3MEV A;  1S72 Q;  2GGF A;  2EJF A;  1F1B B;  5D2M C;  1O1R A;  1WX6 A;  4GBQ A;  5IH2 A;  4OAU C;  1JRI A;  4Y6W A;  4LUN U;  2FEZ A;  4UWK A;  5BNW A;  5BUZ A;  1N0Q A;  4C0E A;  1TN6 A;  5LP0 A;  4EQF A;  2HQH A;  3MO8 A;  3UIN C;  1M2O A;  4QVZ A;  4Y91 A;  4TXR A;  4ELY C;  4APF A;  1JU5 C;  1NLO C;  3NQP A;  1ABO A;  2XEH A;  3ZXP A;  3PVL A;  1M2V A;  2DRM A;  1SHF A;  3Q4A B;  5CVI A;  1VQM A;  2PTK A;  3RKV A;  5FWB A;  4C5H A;  1NPR A;  2ED1 A;  2VXE A;  2DE0 X;  2KT1 A;  2KC7 A;  2VSY A;  3BY7 A;  1W4S A;  3UT1 A;  4QVC A;  4FW2 A;  4A1G A;  1KQS P;  3QKY A;  2ZIS A;  4GZ6 A;  5FQ6 A;  3REB B;  2XDD A;  1VQL A;  4UI9 K;  3FU6 A;  3MV2 B;  4XX5 A;  1RAC B;  3S7F A;  5KNH D;  3LKU A;  4C0M A;  2M16 A;  2JTF A;  1OWO A;  2BE7 D;  4ATZ D;  3C94 A;  1KJW A;  1PNJ A;  3QAR A;  2A5U A;  4HLE A;  3HXF A;  1YHQ A;  4MZP A;  4Q69 A;  3MCA B;  1BI2 A;  3L2U A;  4ME7 A;  2A37 A;  1FVH A;  4FHJ A;  4JRI A;  2DTO A;  2QY7 A;  5CEC B;  2KY9 A;  2VVK A;  2EIM E;  1VQ7 A;  1TXQ A;  5A7D B;  2EGE A;  1JJ2 A;  3OB9 A;  1OCO E;  3LVR E;  3L2Z A;  2ETC A;  1N9R A;  2L3P A;  2RJE A;  3LLR A;  2DL5 A;  2ZGD A;  3ZKJ A;  3ZHE B;  2NXP A;  3EHM A;  1PWT A;  1JPL A;  5D6Y A;  3E34 A;  3EJN A;  3FHE A;  5KYU A;  4GA2 A;  2CHZ A;  2RQU A;  5FU7 B;  3UA6 A;  2AWI A;  2IQC A;  3URZ A;  4K03 A;  3DLM A;  4KZC A;  2HMA A;  2E65 A;  2P4T A;  2PVD B;  1WIE A;  3PNT B;  5FRN A;  4DBF A;  1PKS A;  2RF0 A;  1OU9 A;  2J4D A;  3M4Y A;  3FJ5 A;  5GAN 8;  2KZT B;  4HXI A;  4C8Q D;  3ZYQ A;  3VS3 A;  5ENP D;  5EN5 D;  3T9K A;  3LDZ A;  2LQW A;  3U64 A;  5LJ5 h;  3G4S Q;  3OQ5 A;  2LC4 A;  4OMM A;  5IT9 E;  2J07 A;  4OVU A;  1UG1 A;  4C92 C;  2E12 A;  3TCJ A;  1EZZ B;  1HSQ A;  4MZT A;  3E30 A;  2JLB A;  1BKB A;  3RES A;  4OB2 B;  2L6J A;  3MV3 B;  3PGG A;  4F17 A;  3HSB A;  1K73 C;  4EEC A;  1E90 A;  4RTW A;  1K1A A;  1MJ0 A;  2MF2 A;  1AT1 B;  3HRU A;  4OMP A;  2GRR B;  2VSO E;  2AZS A;  3OA6 A;  3PNW C;  4K5A B;  1B7T A;  1UTI A;  3ZEH A;  3PZ3 A;  2OX7 A;  1Y8M A;  2J05 A;  3MP6 A;  1VQP Q;  4YDY A;  3IV0 A;  3CC4 Q;  1AP7 A;  5HQ8 A;  3FRN A;  1UEC A;  3SBT B;  2K2V A;  3AU5 A;  2DIL A;  1N9S A;  4KXK B;  3G6E Q;  2Y4X A;  5GMK e;  3CVU A;  3HRA A;  5GAN j;  4PJO A;  3S7B A;  3B7T A;  4J8O A;  3GOX A;  3QWW A;  1D8E A;  1BU9 A;  2C0L A;  3H6Z A;  3PUK A;  1NI1 A;  1Z5S C;  3QYH B;  5ENN A;  3QG1 A;  2EYX A;  2ZGG A;  2IVW A;  3CBO A;  3UQ3 A;  2JS2 A;  2EVR A;  3SHF A;  4J6W A;  4K5C A;  1BB9 A;  8ATC B;  2OTJ Q;  4OYS A;  4BE0 A;  1M1K C;  1XNF A;  1U2V G;  3PEU B;  1INZ A;  4EMH A;  5FZQ A;  3D9J A;  4ILG A;  3FEY A;  3BG0 B;  4PJO D;  5AJD A;  1D1A A;  4AY6 A;  3MEA A;  3L16 A;  2J7I A;  1VA7 A;  1OWM A;  3QJZ A;  1Y96 B;  4AVX A;  5FU6 B;  4ATG A;  2C2L A;  3CMA Q;  2WXM A;  4AT1 B;  4OF1 A;  1PD0 A;  2F8X K;  4CRI A;  2AXZ A;  4ZGD B;  1KD1 R;  4F6R D;  2HNI A;  2KRO A;  3Q7F A;  2YLC A;  2OCC E;  2RHX A;  1KQS S;  2QAS A;  4D8D A;  1VQ5 T;  4ZFH A;  5GAM d;  4G26 A;  2R5S A;  4BAC A;  3OXG A;  4HB5 A;  1N6A A;  3VS0 A;  4BY6 C;  4J9H A;  3SWN C;  3CCU Q;  2JS0 A;  3T9N A;  4WUY A;  2I1K A;  2XIC A;  3PTA A;  3O4Z A;  2K2M A;  4F04 B;  3JCM h;  2O9V A;  4NS5 A;  1QVF A;  1OOT A;  2COW A;  3TG5 A;  3VTY A;  1EF1 C;  4JJB A;  3D9M A;  3RKX A;  2EQU A;  2FO0 A;  1IGU A;  3EGD B;  3CHO A;  4GLM A;  3AG4 E;  1KZO A;  5G55 A;  5KYX B;  3NAW A;  4PJM A;  1MQS A;  5CCA A;  4EPC A;  5AN8 A;  5FQ7 A;  4M7D E;  3TWS A;  4ORZ A;  1NEB A;  5FTP A;  3EH1 A;  3ONK A;  4M75 E;  1UN9 A;  4RMO A;  4RTX A;  4ZN1 A;  2Y1L E;  3D9L A;  4BWR A;  2GQI A;  5CR2 A;  1QCN A;  2VYI A;  4A4K A;  4OMF B;  3UI2 A;  4HVV A;  1D9S A;  2E0I A;  1JUQ A;  3FTV A;  3VTX A;  3T5V A;  5ARF A;  4ZHB A;  4QQI A;  2UY1 B;  4I1M A;  4HCK A;  3V2X A;  3CC7 T;  3MX3 A;  5EIL A;  2VV5 A;  1GBQ A;  2DCP A;  3RMS A;  4IIM A;  1JQQ A;  4E7Z A;  1BPO A;  2HEQ A;  2VGE A;  4Y6C A;  2HL5 C;  4IKF A;  2EYZ A;  5KYN A;  3VS5 A;  1VQN T;  2L8D A;  2K79 A;  1G5V A;  1BCM A;  3NTI A;  5FJY A;  2DAQ A;  2EKH A;  3OMG A;  3OY9 A;  1D0Z A;  5EYP F;  2RFM A;  1NBE B;  3LGL A;  4LUD A;  3QO3 A;  4J6X A;  3V30 A;  1HS6 A;  4F7A A;  2WM9 A;  4BDZ A;  2GFU A;  1I1J A;  1S64 A;  4M77 C;  1BI3 A;  3GBQ A;  4K5B A;  1EFN A;  2E64 A;  5CEA A;  4KT0 E;  1AHJ B;  4N3B A;  2WXL A;  3NB2 A;  4CGW A;  3QBY A;  5CMW A;  2YUP A;  4C92 G;  2HKQ B;  2ZAE A;  2HSE B;  1AWX A;  1XOV A;  3NTH A;  3SDZ A;  1N9A A;  5KE2 A;  2QYZ A;  1VQK T;  4G23 A;  5KNG A;  3I5S A;  1TYQ G;  4HOQ A;  2CG3 A;  3EDT B;  2V8J A;  3O5Z A;  4C92 B;  1Q82 U;  1EPU A;  3CCR T;  2GF7 A;  3EFS A;  3FUH A;  2WMN A;  1MMD A;  4TV3 A;  1VQM Q;  1RAF B;  2AVP A;  2ABL A;  2NUT B;  3JUE A;  4YDW A;  2C0O A;  2R02 A;  1QKX A;  3UKR G;  1I81 A;  2OVF A;  1X2Q A;  3Q1J A;  4C8Q G;  5CCM A;  1NEG A;  2R57 A;  1MV0 B;  2RD1 A;  5BPP A;  3Q9N C;  4E85 A;  1P5Q A;  5JHA A;  4MDX A;  4HOR A;  4X8Q A;  1Y57 A;  2V8K A;  3IXE A;  3LJ3 A;  5CAI A;  4WNE A;  4ANX A;  4C8Q B;  2WXG A;  2RA2 A;  5I11 A;  3S3O A;  3PS6 A;  9ATC B;  3TWX A;  3V7S A;  4JZY A;  4B8C B;  4DLQ A;  4DX7 D;  4ME2 A;  1I5O B;  5CO7 A;  2K57 A;  3J81 E;  4GTM A;  4GZC A;  2P9K G;  3PDN A;  4RLY A;  1M3C A;  2Y4Y A;  2WAC A;  1YHQ Q;  4DBR A;  1W2B S;  3UAT A;  2HCK A;  2P4R A;  3LH5 A;  2PZ1 A;  3CK7 A;  3ZW3 A;  3RIR A;  1X69 A;  3CVY A;  5HS0 A;  1D1B A;  1TNZ A;  2KSS A;  2IF4 A;  3OYJ A;  3L13 A;  1VQ7 Q;  2QZA A;  2X6K A;  1D0X A;  2P0Q A;  4MKT A;  1QCF A;  4M7D C;  1B34 A;  1BU1 A;  3TWT A;  1Q7Y C;  4M75 C;  3C3O A;  3FC3 A;  3DSW A;  2F37 A;  2EGA A;  3SHW A;  3CHS A;  3FH7 A;  1P92 A;  1V55 E;  5B1A E;  4KUI A;  2ZPG B;  3LJN A;  2XEN A;  2DEQ A;  1WNL A;  4BI8 B;  2RD0 A;  3PUJ A;  5EC7 A;  3BU8 A;  4I6G A;  4EBA A;  4VUB A;  1X81 A;  2WXJ A;  4GCO A;  4XU2 A;  3JCM Q;  1NZN A;  1E7U A;  3J5P A;  2CFU A;  2XHC A;  3CXC A;  3X2Q E;  4CZ2 D;  2XCB A;  2LSV A;  2LUH A;  3HP9 A;  3L54 A;  3C12 A;  1BI0 A;  2V26 A;  2OTL A;  5A0G A;  4PJO F;  1NYG A;  4RG8 A;  2DIQ A;  2FO7 A;  2VC8 A;  4BY6 B;  2XDP A;  4J9E A;  3SWN B;  3SFX A;  1TJF A;  2VQ2 A;  4RUG A;  1LD8 A;  3L2W A;  2L3S A;  3RNJ A;  4LNU D;  5AQ9 A;  4RTY A;  2JNG A;  4XK8 E;  3JCM X;  3SGH A;  4N3C A;  4GCN A;  5HKP A;  1E7V A;  1KT1 A;  2QFC A;  1UW4 B;  2Y0B G;  5LFA A;  4AV7 A;  1R0C B;  2LDM A;  1IHW A;  3TSW A;  3D9K A;  1SSF A;  3ENE A;  3DKM A;  1QVG P;  2X3M A;  5DLO A;  2GQV A;  5HRY A;  4U8Y D;  3FEO A;  4II1 A;  2L3Q A;  1OCZ E;  2HAX A;  2VYT A;  4DX6 D;  1H2U A;  3MJW A;  1NA0 A;  1TNY A;  1K9A A;  3E19 A;  3CCV T;  4M7A A;  4XIF A;  1YJN Q;  3LWI A;  2JUF A;  3L17 A;  3ZUV B;  4M78 A;  2A7Y A;  2MYO A;  3EGX B;  3NHN A;  1WA7 A;  2J6F A;  2BKG A;  4TVR A;  4G1T A;  2VGX B;  3UM0 A;  2X3X D;  5L23 A;  3OXF A;  3JB9 G;  3AS8 A;  1Q82 R;  3V7R A;  3NGP A;  4J9B A;  3EIJ A;  1DVP A;  5B3S E;  3LH0 A;  4XTY A;  3ML8 A;  4PFZ A;  4I43 A;  4FU3 A;  4N2Q A;  3OS0 A;  1N0R A;  1YJW T;  3T8K A;  1PD1 A;  4M7A D;  4ELZ C;  1UGR B;  4GZ3 A;  2Y4T A;  3CD6 T;  4GA1 A;  1MX2 A;  1WXU A;  4JJC A;  2KCV A;  3QB2 A;  3RUX A;  4APO A;  2KYM A;  1ZBJ A;  2FUL A;  1OX9 A;  4NL3 A;  1L5J A;  3OW2 A;  5FT9 A;  2MWO A;  3P8B B;  4UWH A;  3CEQ A;  3HYM B;  1VQ9 T;  4AFQ C;  4DX2 A;  3L2V A;  4IYP A;  5KCO A;  4U0U A;  1C1A A;  1O75 A;  3MET A;  5IXF A;  1U1T A;  5CKB A;  2X9H A;  3HKS A;  3Q73 A;  5A0L A;  4RCB A;  2CDT A;  1HYO A;  5H7P A;  2LX7 A;  3UT7 A;  2M63 A;  2AKK A;  2LNV A;  1Q86 C;  2FBN A;  2AW6 A;  1MX4 A;  1ZUU A;  2MAM A;  5GAN 2;  2L0I A;  3JCK C;  4OML A;  2K6D A;  2FZG B;  3PEV B;  4C0D C;  3R9M A;  4LNP A;  4NAC A;  4UQY A;  2LAH A;  3I5R A;  2L89 A;  4GU5 A;  5I22 A;  1HE8 A;  4EZJ A;  3OYF A;  4GAA A;  1QWF A;  4E47 A;  3F6Q A;  2JVV A;  2J49 A;  1X43 A;  2DYI A;  2LX9 A;  3Q47 B;  2KR3 A;  2PNN A;  3EAE A;  4FL6 A;  3UT8 A;  4FYY B;  3RKW A;  1QP3 A;  5GMK l;  2XRY A;  5G05 J;  3M5A A;  2DL4 A;  2OAU A;  2J4B A;  2D8J A;  4JHJ A;  4XTU A;  5JJ7 A;  2CUB A;  3DEP A;  4M7D G;  2P84 A;  3ZYM A;  2LMJ A;  1YIT A;  1WM5 A;  1X27 A;  4M75 G;  3X26 B;  3SBS A;  3HPW A;  4KVO A;  2DZO A;  1M8V A;  3ZEF A;  2CP3 A;  4LN2 A;  3G71 T;  1GFC A;  1N8R U;  2NUP B;  2DJZ A;  4M7D B;  2K7A A;  4M75 B;  2DF6 A;  4TUM A;  2AJA A;  3HDX A;  4QW2 A;  3RSE G;  5EKQ D;  3ZU7 B;  2YWW A;  4J9D A;  4E7J A;  4UQX A;  3I56 Q;  3Q49 B;  3Q9U C;  5GAM g;  2RMO A;  2ZPE B;  1HJD A;  2Y4U A;  2W0Z A;  4Z89 A;  4XI9 A;  5BV0 A;  2X51 A;  1N95 A;  1EYH A;  4NL2 A;  2GRL A;  3SFZ A;  1WQW A;  4A3V A;  4I9E A;  1K9M U;  1M1F A;  4Q96 A;  3AJI A;  4TXP A;  3D9I A;  5ECA A;  2DJQ A;  4C0Z A;  2J09 A;  4KYO B;  3M4G A;  2A5E A;  3SI5 A;  2DET A;  3JUI A;  1TN8 A;  4C9B B;  2XG8 D;  3QKJ A;  1SF9 A;  2MK5 A;  1I0C A;  2DL3 A;  2LNH B;  5AQA A;  1ZSZ C;  5FIN A;  1QVG S;  1YMP A;  5C0M A;  2JZ2 A;  1RW2 A;  4XTX A;  3G7Z A;  2D0Q B;  4RTT A;  1HU3 A;  4KGZ B;  2LQ8 A;  5KYW B;  4BT8 A;  2J9Q A;  3CKC A;  3L82 A;  2E70 A;  3CPW A;  3RU0 A;  3CCS A;  4R7L A;  1FCH A;  2FF4 A;  3EGU A;  4JA7 A;  2H3J A;  2VB6 A;  5GAN d;  4OAV B;  2K4Y A;  1N4S A;  4U7E B;  5DBK A;  2YNQ A;  3CST A;  5GAO m;  4OGC A;  3R6N A;  1YI2 A;  3NTK A;  1E96 B;  4MLP A;  3JCM b;  3OYG A;  4PKC C;  4A4F A;  2D8H A;  2QGG A;  4ATO A;  1MHN A;  2FRW A;  2WXF A;  2KAF A;  3IHY A;  1AOJ A;  3E2U A;  2DIG A;  3CCM T;  4LDU A;  5CQY A;  4L23 A;  5FZS A;  1W70 A;  3KUF A;  4F16 A;  2EQM A;  4E7S A;  1K8A C;  3FH8 A;  1H6O A;  4P5N A;  1VQ8 Q;  4UC4 A;  2R05 A;  1N4P A;  5KJM A;  4K11 A;  2WSC E;  5E76 A;  3X20 B;  2PZI A;  3G6E T;  4RQI A;  4ANV A;  1MHQ A;  5ENS D;  1DC2 A;  3NZU A;  4LSZ E;  2D9T A;  2BED A;  2M0Y A;  2P9L G;  2KDS A;  2R5M A;  2YRV A;  3R6O A;  3RIB A;  2K5F A;  5A2Q E;  4L1B A;  3X25 B;  4N0A C;  2DZN A;  3ESL A;  5CQX A;  4WCI A;  4XE0 A;  2L3R A;  2ROL A;  3SD5 A;  4DPR A;  4GTR A;  4GYO A;  4XU0 A;  3RO3 A;  4OB0 B;  5BW8 C;  2WXK A;  1K76 A;  3ZYL A;  1RAA B;  1JO8 A;  1YNZ A;  2XKO C;  4AP2 A;  1TNB A;  3DSU A;  5KJL A;  4LDW A;  5IXB A;  4XI0 A;  3EFR A;  2JJ9 A;  3KEZ A;  1DNP A;  2EIL E;  4Z68 A;  4O5V A;  3PZD A;  1FT1 A;  4DI3 A;  2X35 A;  4M78 F;  2QTX A;  4JS5 A;  2WXP A;  3UXG A;  1PG5 B;  5FQ8 A;  2RH2 A;  1ZBX A;  3M0P A;  3UUX A;  2ED0 A;  5J90 A;  2M9U A;  3REA B;  1N8R R;  4C8Q E;  1IQU A;  3KBG A;  1NJI C;  4EZK A;  3JQ1 A;  2QQB A;  4KH0 B;  2BIV A;  4C0D B;  1PRL C;  2VSX E;  3GNG A;  2H6G A;  1KC8 R;  3OYI A;  2AIR B;  3RRU A;  2DX1 A;  1M90 C;  4DJA A;  3CCE T;  3P8H A;  5LJ3 h;  4HT9 A;  4U0Z A;  2DER A;  3MEK A;  2RO0 A;  2GGR A;  1HXI A;  2ZPB B;  3PRE A;  1Q81 C;  3VUB A;  5GJV B;  4FAD A;  2C0I A;  3VLE A;  3MKR A;  3Q7A A;  4AM9 A;  4R55 A;  1K9M R;  3AHU A;  4N5Q A;  3CQG B;  3FDR A;  3U4T A;  2QK0 A;  3M0R A;  1N5Z A;  2PVO B;  2DYB A;  2HKN A;  2WSF E;  4PLI A;  3VYG A;  1Y0M A;  3CVW A;  3FU5 A;  2EBP A;  2DZC A;  3QOU A;  3F70 A;  1KD1 U;  2YUQ A;  5LJ5 d;  3CVL A;  1D0Y A;  1D3B B;  4RTU A;  2QI2 A;  4YTL A;  2QYJ A;  1Z6T A;  4UI9 J;  2KE9 A;  3TXM A;  3QJ6 A;  2B0O E;  4H7X A;  2P58 C;  2DL7 A;  1KQ2 A;  3FUD A;  4HCC A;  4HOT A;  2W10 A;  4Z8A A;  2P0K A;  4A53 A;  3EHR A;  1X6G A;  1U8R A;  2DBA A;  4ACL A;  4MS6 A;  1TWB A;  1DJ7 B;  1E6H A;  1MUZ A;  1M30 A;  3H0F A;  3I3N A;  2DZ9 A;  4QFV A;  2QDL A;  1W3B A;  2YLB A;  1MV3 A;  5LJ5 e;  3WXM B;  3A1P A;  2E5Q A;  2MCN A;  2NUT A;  1YCY A;  4BSZ B;  1V76 A;  3V79 K;  2A36 A;  2GTJ A;  5A0D A;  4AG1 C;  5EG2 A;  2XPZ A;  2YXY A;  4XU1 A;  1K1B A;  4PJO E;  2LCC A;  2JM8 A;  2RHU A;  2F1L A;  4OB1 B;  1WYX A;  1ZSZ B;  4ZN3 A;  3PIP A;  2X6F A;  3I55 T;  5CRV A;  2VTB A;  3FUJ A;  4N39 A;  4FU6 A;  3UIO C;  2KNB B;  1A17 A;  3FJP A;  5GAN 7;  5DIZ A;  3NBN B;  4PLL A;  5BXU A;  1XQH A;  4A4H A;  2RPN A;  2QEX T;  1YA0 A;  1ABQ A;  4F7U A;  1YBY A;  4DLO A;  2EYQ A;  3URG A;  4N4I A;  5KE3 A;  4JZ4 A;  1WG0 A;  4EZL A;  2Y3A A;  4KH1 B;  3OYA A;  4IUL A;  5CCL A;  3UA7 A;  1BYM A;  1QP2 A;  3QDF A;  2LTO A;  1S1N A;  2EIJ E;  3G2V A;  1OWN A;  4LE9 A;  5D6X A;  3CEY A;  1SG5 A;  2X3W D;  1VQ5 A;  2VGN A;  3QWV A;  4ILI A;  3AU4 A;  4G2V A;  1UGS B;  2CRE A;  2LRQ A;  3HVE B;  3U66 A;  4N3A A;  1H64 1;  1VQO A;  1RLP C;  3QNK A;  4C8Q C;  3RRN B;  3LVQ E;  4FHK A;  1IXD A;  3KXT A;  5CED B;  3QPH A;  3IBE A;  1MMG A;  2BKD N;  2F5K A;  5A23 A;  4R0K A;  1JWG A;  1YIT Q;  1FVF A;  5BXO A;  2IIM A;  1KZP A;  2JAB A;  3RRM B;  3JCM d;  2L6B A;  5DLQ E;  1G3T A;  3JV3 A;  3ZGQ A;  4BER A;  5CBN A;  2DD4 A;  2KRM A;  2CT3 A;  4KMO A;  4FUL A;  3TWV A;  2MYS A;  1A0N B;  3GYZ A;  5ANL A;  3V31 A;  2RQT A;  3VJP A;  2ZPI B;  5AIJ A;  2MIO A;  4HI9 A;  2COZ A;  1TN7 A;  3CC7 A;  1OWL A;  3D9O A;  1N11 A;  1IYG A;  3EHN A;  2D0N A;  4R56 A;  3OYN A;  4KGX B;  2AXV A;  2K5I A;  3JCM e;  3KSL A;  4PS7 A;  2R03 A;  2FI7 A;  2OI3 A;  1SZ9 A;  5GAM f;  5EID A;  2DK3 A;  1VQN A;  4JZ3 A;  2LO6 A;  4M7C A;  1BCO A;  3E1S A;  4PS3 A;  3EG2 A;  4J7F A;  4M3O A;  4OVA A;  1U1S A;  5LJ3 j;  4FSS A;  3KSQ A;  1IXV A;  1UDL A;  4FP7 A;  1G8X A;  4ZTJ A;  2A3L A;  4I2Z A;  1E8W A;  5GMK h;  4I1O B;  4B9W A;  2V8S E;  1ZBP A;  3UMV A;  1N54 A;  2V5Q C;  1BK2 A;  3WVD B;  2A0F B;  1YJ9 T;  2MRI A;  3ASF A;  1H2T C;  2QA4 T;  3L22 A;  1WHK A;  3CCS Q;  2CFZ A;  2GRO B;  1QQE A;  4Q94 A;  5EX0 A;  2RI5 A;  5D0Q D;  4HCZ A;  4B94 A;  1UJJ A;  3SB2 A;  3CCL Q;  1LPL A;  3AG1 E;  1V29 B;  2PM6 A;  3B7R L;  4X9D A;  2ZU6 B;  1YI2 Q;  2QG9 B;  1RZ4 A;  3WXX A;  2FO1 E;  3PT9 A;  3PMI A;  3APD A;  3BQO A;  1LVK A;  3BE3 A;  1B07 A;  5GAM e;  1G3N B;  1YIJ T;  3JCM c;  1VQK A;  4X34 A;  3BFM A;  5KJK A;  3CCR A;  3J7A F;  2XCC A;  3VS4 A;  4XTW A;  3RBB B;  1UHC A;  1PC2 A;  4X9C A;  3RMQ A;  1G3S A;  4LUE A;  5EIB E;  4M77 A;  4CEM A;  3GZS A;  3V2O A;  1X2K A;  1YJN T;  4J9G A;  1K8K G;  1WDX A;  3OS1 A;  3L2R A;  2PUO B;  2H8H A;  3EU9 A;  4JJN K;  3OYD A;  4ANJ A;  2PNI A;  3JRZ A;  5FWQ A;  3CCQ Q;  2XS8 A;  3S3N A;  3SO8 A;  4GPM A;  4LDV A;  1SRM A;  3RER A;  3CPW P;  3U3W A;  1E7O A;  3N71 A;  4IRU A;  2PU9 B;  3OSS C;  2P9U G;  3G2T A;  4LRZ A;  5CER B;  1NM7 A;  4BX8 A;  4GLK A;  3TG4 A;  1IRX A;  4M77 D;  5IAY A;  4N4H A;  4UWG A;  2E6Z A;  3NPF A;  1M2V B;  4RCC A;  1BD8 A;  3LYA A;  5B1B E;  5GAN g;  1CKA A;  3A8O B;  3R7R A;  3QWP A;  1IQR A;  2LCS A;  4O60 A;  1VQ4 A;  1ZA1 B;  2DIW A;  4MBG A;  1KPS B;  3CV0 A;  2QTV A;  3THK A;  3RJV A;  1LTX A;  2HR2 A;  4HNA D;  3EFO A;  1KSW A;  3O48 A;  2MPX C;  2ILR A;  4B8A A;  1WI7 A;  2K3X A;  4AFS C;  3FWV A;  2KAT A;  2XMF A;  1B89 A;  1O1S A;  4CC4 B;  3DPY A;  2LT1 A;  4RG9 A;  4A63 B;  3CVQ A;  1CSK A;  2LSU A;  4PJL A;  1WZO A;  3HXD A;  4DQ2 A;  2O2O A;  2GTO A;  2DBM A;  1X75 C;  3LY7 A;  1TOV A;  1K73 U;  2IJG X;  4ACK A;  4RG6 A;  2I6H A;  1UJK A;  3Q79 A;  1RAE B;  2M02 A;  3DSV A;  1RAB B;  3QWY A;  4CT4 A;  4QQD A;  3UM2 A;  3X24 B;  4IUU A;  3DST A;  4M7D A;  2PL2 A;  3UF4 A;  1GBR A;  4C92 F;  2LXM A;  1UGV A;  3OYH A;  4F1S A;  2P9P G;  4JLG A;  1RL2 A;  4UUC A;  3CSF A;  5CRU A;  5ANR A;  2O4X A;  1M5Q 1;  1VQL Q;  3EG9 A;  3NFC A;  2D1X A;  1NPP A;  4EMK A;  4TRQ A;  3VLD A;  3JXI A;  1AWJ A;  3CME A;  2FL7 A;  3M0Q A;  2COY A;  2DNU A;  2KBT A;  3TU4 K;  3TWW A;  5LOZ A;  5KYU B;  1O9S A;  1H3Z A;  3ASG A;  3QZ5 B;  4ANW A;  5KH6 A;  4GY5 A;  3B7S A;  2EW3 A;  5HCK A;  1RAI B;  3V8L A;  1AEY A;  1IRE B;  4JEH A;  4UI9 C;  1WY6 A;  2RQW A;  4RVB A;  1N4Q A;  1GXI E;  4I2W A;  4PH4 B;  4IUP A;  4F7U F;  3CCV A;  3H41 A;  5J3B A;  4HVB A;  4LNG A;  3UKU G;  4D6W A;  1H6P A;  3TEE A;  5G2N A;  3VU3 C;  1C0M A;  2GRQ B;  2B8A A;  3TWR A;  2VUB A;  5GMK j;  5LX8 A;  2AXU A;  3C0C A;  3QYG B;  3I56 T;  5BT1 A;  1MND A;  1JB0 E;  4M7A E;  4AOF A;  1UJ0 A;  4IUQ A;  3HG0 D;  2RI3 A;  4BFR A;  2CHX A;  3QDR B;  2QXF A;  1FXX A;  4EHM A;  2FZC B;  3C3R A;  4U04 A;  1YJW A;  1NG2 A;  1TNO A;  5GAO r;  1ZQ1 A;  1R8O B;  2E3I A;  3CD6 A;  3MCX A;  4PJO G;  4HFG A;  4HVW A;  1AWC B;  1Y7X A;  3H0H A;  2QQS A;  2K5L A;  1VDY A;  1KQS A;  2DRK A;  3SF4 A;  1VYU A;  4FYX B;  2A08 A;  4PJO B;  5D7U A;  3H0I A;  1N4R A;  2WXQ A;  1VQ9 A;  5EDS A;  1IB8 A;  5LJ5 g;  3OAW A;  3SQV A;  1OPL A;  1SEM A;  5AEN A;  1JJ2 P;  4GA0 A;  1U3C A;  2ZCF B;  2EIK E;  1VQ5 Q;  2L0A A;  3G2U A;  4L7T A;  4ANU A;  4FIB A;  4KUL A;  3VUZ A;  3CC2 T;  3ULY A;  1OX8 A;  2P9N G;  5JHB A;  4N4G A;  2G6F X;  4JPB W;  4JA9 A;  1QKW A;  3VS6 A;  2Q7F A;  3CHR A;  3OYY A;  3O8V A;  2DD5 A;  1G3W A;  3NMZ C;  1VQO Q;  5ENT D;  3ULQ A;  3EUV A;  2PUK B;  2L5Q A;  2GW1 A;  1OCR E;  1ZB1 A;  2YHE A;  3P1U A;  4PJJ A;  2I2O A;  2FPE A;  4KRT A;  3JCM P;  5LCW J;  1PAQ A;  1VOM A;  2XZD G;  5HY6 A;  4LD6 A;  3M59 A;  2LT4 A;  1NLP C;  2QDY B;  3SEM A;  4WWP A;  4Q5W A;  4CC3 A;  1H0A A;  1N27 A;  1VQ8 T;  5ENR D;  1K1Z A;  4BEP A;  4BES A;  4Y92 A;  1S0P A;  1VIE A;  3OBW A;  2WXI A;  2PQN A;  3QC1 A;  4YDO A;  4CDM A;  1U3O A;  4HRN A;  1U3D A;  2EQX A;  1K73 R;  2EQI A;  3MP1 A;  4JW1 A;  3DBS A;  3E32 A;  1LOJ A;  1HD3 A;  2RHI A;  2R59 A;  4XZ4 A;  2OEV A;  3I5P A;  4TXQ A;  2WVI A;  2I9C A;  3OBY A;  4CC2 A;  4J9F A;  3G2W A;  4CGV A;  1JCR A;  3AS5 A;  2J06 A;  4M78 D;  3CC7 Q;  3LPZ A;  3CVP A;  4HI8 A;  1FT2 A;  1ZA2 B;  3G71 A;  2LAI A;  3CCJ T;  5GAN 4;  3QK0 A;  2EPD A;  3BEE A;  2NSZ A;  1OI1 A;  1VQN Q;  3JB9 F;  2KBX A;  2FZK B;  4E7L A;  4HOS A;  1OU8 A;  1C6V X;  2KVQ G;  4M77 F;  4C5E A;  2SEM A;  3B7B A;  1GCQ C;  2XQ0 A;  4L59 A;  1G3Y A;  4G8K A;  5CMY A;  2ROT A;  1S72 T;  3GW4 A;  2GRM A;  4KBQ A;  1M1K R;  1E8X A;  3FU3 A;  1AD5 A;  4M7A C;  5EX3 A;  4BTA A;  2H3E B;  2V1R A;  4F3V A;  1GCP A;  4BB7 A;  4YND A;  1UN8 A;  4GTT A;  4HOU A;  2BUG A;  1H2V C;  5C1D A;  3JCM g;  3C5R A;  1N52 A;  2V4H C;  1VQK Q;  4HRM B;  3ONL A;  4O6J A;  3TL5 A;  3CCR Q;  2KYB A;  3ZHE A;  3AS4 A;  3W9G A;  1K0S A;  1VQ6 A;  2H6F A;  1BBZ A;  1FMK A;  2XGM A;  4W9R A;  3HXC A;  1OZ2 A;  1KT0 A;  2BUD A;  4J83 A;  2M51 A;  4AFU C;  3TJP A;  3FUN A;  1WXT A;  4HXJ A;  2ZXW E;  1ACM B;  3ZFJ A;  1OXJ A;  4XU3 A;  2GNC A;  1ELR A;  3ASD A;  5AT1 B;  5FLX E;  4LCT A;  2AZV A;  1H3H A;  3MP8 A;  2RB6 A;  2DXU A;  4L9P A;  3JCM J;  1UEB A;  1W2B A;  3JB9 H;  2QGF B;  3AAA C;  1PC0 A;  5AQ7 A;  1WHH A;  1Q7Y U;  2KRN A;  2AT1 B;  1QLY A;  4E7H A;  1WJQ A;  3CCM A;  2KZT A;  2LQK A;  2YRD A;  4YVQ C;  2O88 A;  3D7S B;  5ENO D;  3FUI A;  1W6X A;  3HXE A;  2R17 C;  2LP5 A;  1AWW A;  3MA5 A;  2JMC A;  1KC8 U;  1QVF P;  1ZU2 A;  1OPK A;  3L1A A;  3G6E A;  1NFI E;  1HZ4 A;  2ZZD A;  2IO2 C;  1PM3 A;  3A8G B;  2RFA A;  4M7D F;  4DI4 A;  4JD2 G;  4M75 F;  1QYM A;  2VAS A;  2MOX A;  1R0B G;  4KVM A;  4JRP A;  4LDY A;  1UG3 A;  4BE2 A;  4JPS A;  4MRU A;  1VQ4 Q;  1E8Y A;  1KD1 C;  4X1V A;  5J26 A;  4FSX A;  4E2F B;  2XK0 A;  3CK8 A;  1JJ2 S;  1XGW A;  4GZ5 A;  4IN3 B;  3MEU A;  5GAO l;  3PE3 A;  3FTW A;  5CKF A;  4H7Y A;  2KT8 A;  5FRO A;  3M58 A;  2DLP A;  1H6K A;  4U63 A;  5GAO n;  3E37 A;  3GF5 A;  5GAN f;  3UT4 A;  1QNF A;  2DM1 A;  1FMW A;  3DRA A;  3FUK A;  4LER A;  1YN8 A;  2EWN A;  1CKB A;  4OMO A;  1A5E A;  3ZL7 C;  3ESK A;  3L6A A;  4RTZ A;  1M9S A;  3G4S T;  1TNU A;  1ZHI A;  4JEU A;  2R2L A;  3JXJ A;  4FLB A;  3KS2 A;  1NL4 A;  3JYS A;  5A6C A;  2H6H A;  4N0A A;  2DVW A;  5JA4 D;  4JC8 A;  5ARG A;  4XAX B;  1B34 B;  3HHT B;  2CUD A;  3G2S A;  4EBA G;  3HFO A;  4M4Z A;  1JWF A;  3M0U A;  3CME Q;  1YWP A;  3D9N A;  2JM9 A;  3TSZ A;  5GAN e;  2AHJ B;  4XTZ A;  1VQP T;  2EAY A;  7AT1 B;  1Y96 A;  3CC4 T;  4JRQ A;  3CCE A;  3ASN E;  4DBH A;  2QYU A;  3FTS A;  1QZ2 A;  4DEY A;  4FW1 A;  4DOW A;  1ZUK A;  4FC8 A;  2F0Y A;  2J6K A;  1RAG B;  4FT2 A;  3CQC B;  1SPK A;  3FTZ A;  5AQB A;  2R5A A;  1OY3 D;  3HL8 A;  1TH7 A;  3T5X A;  3EG0 A;  3EU5 A;  2LNI A;  3PVQ A;  3M0T A;  2E2E A;  3ML9 A;  4NIK A;  1SQM A;  2WXH A;  5BV1 A;  2ZPF B;  3PFS A;  2YUO A;  1RI9 A;  2LZ6 B;  4DX1 A;  5LJ3 d;  2CP7 A;  1OT8 A;  2KXD A;  2RG8 A; 
#chains in the Genus database with same CATH homology
 2ETB A;  3D9H A;  5KNG A;  3I5S A;  4IIO A;  3O5Z A;  5CED B;  4D8K A;  1JEG A;  2DBK A;  1UOH A;  4R0K A;  2ABL A;  3JUE A;  4YDW A;  2C0O A;  5BXO A;  1QKX A;  2QC9 A;  2IIM A;  1TR4 A;  1X2Q A;  1X6B A;  2JAB A;  1NEG A;  1MV0 B;  4JB8 P;  2L6B A;  3Q9N C;  3JV3 A;  1T3L A;  4BER A;  5CBN A;  5IHN A;  1Y57 A;  2KRM A;  3IXE A;  2CT3 A;  1BI8 B;  1UE9 A;  1WXB A;  2KRS A;  2KGT A;  2FPD A;  3TWV A;  5AAO A;  4LG6 A;  5I11 A;  3QWX X;  1A0N B;  3TWX A;  3V31 A;  2RQT A;  4DX7 D;  3EHQ A;  2MIO A;  4HI9 A;  3M0S A;  4O1P A;  1N11 A;  4RLY A;  1M3C A;  2D0N A;  3UAT A;  2HCK A;  2P4R A;  3LH5 A;  2PZ1 A;  4EIK A;  1DCQ A;  1SRL A;  1W1F A;  2OI3 A;  1X69 A;  5HS0 A;  5EID A;  2F2W A;  4JZ3 A;  4RTV A;  3EG2 A;  4CYM D;  2EYY A;  2LJ3 A;  1NYF A;  3B95 A;  4FSS A;  1QCF A;  2RNA A;  1IXV A;  1BU1 A;  1UDL A;  1ZSG A;  4AFZ C;  2XZT G;  3TWT A;  1UHF A;  1ZUY A;  2NYJ A;  3J5Q B;  2F37 A;  1JXO A;  2EGA A;  3SHW A;  3U23 A;  4HBD A;  2EYW A;  3LJN A;  2V5Q C;  1BK2 A;  4JJD A;  2XEN A;  5FWC A;  4J8Y A;  3VRY A;  5EC7 A;  3VS1 A;  3J5P A;  1H8K A;  2BZY A;  4CZ2 D;  2RQR A;  1TUC A;  2YSQ A;  1T3S A;  2LQN A;  2FO1 E;  4J9C A;  1Z9Q A;  1B07 A;  1G3N B;  2FPF A;  4HVU A;  1U06 A;  1VYV A;  2A28 A;  4G8L A;  1NYG A;  4J9E A;  3VS4 A;  3RBB B;  1UHC A;  4RUG A;  1M27 C;  1SSH A;  5GJW B;  2L3S A;  4LUE A;  2JT4 A;  5EIB E;  4LNU D;  5AQ9 A;  1Z9Z A;  2CT4 A;  3RNJ A;  4RTY A;  2O31 A;  3UTM A;  3V2O A;  1X2K A;  5HKP A;  2BKK B;  2Y0B G;  4J9G A;  1U5S A;  4DX5 D;  1IO6 A;  1WDX A;  2H8H A;  3EU9 A;  2P2C P;  2PNI A;  3TSW A;  4J9I A;  2OAW A;  1KFZ A;  2HBW A;  4DRX E;  3SO8 A;  5IHK A;  1MYO A;  3KEA A;  4GPM A;  4GMR A;  4U8Y D;  5HRY A;  1SRM A;  2RQV A;  2L3Q A;  1E7O A;  4DX6 D;  2ETA A;  2VKN A;  2F2V A;  1K9A A;  2I0N A;  2O9S A;  4O1O A;  5CER B;  4QT7 A;  1NM7 A;  3ZUV B;  1KIK A;  2MYO A;  4HQD A;  1WFW A;  2J8S D;  3NPF A;  1BD8 A;  5FW9 A;  2OJ2 A;  3NHN A;  2ECZ A;  1WA7 A;  2J6F A;  2BKG A;  2J6O A;  1IKN D;  1SW6 A;  1CKA A;  2LCS A;  4O60 A;  2DL8 A;  2X3X D;  1IHB A;  1FYN A;  5L23 A;  3THK A;  3NGP A;  4J9B A;  1MX6 A;  2F8Y A;  1PRM C;  4HNA D;  1AZE A;  1GFD A;  1KSW A;  4U96 D;  1ZX6 A;  1WI7 A;  1N0R A;  4AFS C;  2XEE A;  3T8K A;  2XMF A;  4U95 D;  4CC4 B;  2CSQ A;  1YYH A;  4A63 B;  1CSK A;  1G2B A;  5IHI A;  1MX2 A;  2FEI A;  1WXU A;  2O2O A;  2BTT A;  2GTO A;  2DBM A;  4JJC A;  2VWF A;  3ZNG A;  2KYM A;  2KXP C;  1ZBJ A;  1GL5 A;  2DWZ A;  4CC7 A;  3QWY A;  1RLQ C;  1H92 A;  3UF4 A;  4AFQ C;  1GBR A;  4DX2 A;  1UGV A;  1UUE A;  5IXF A;  1AWO A;  1K0X A;  4UUC A;  2JXB A;  2FRY A;  5FIO A;  2D1X A;  3CQT A;  3ULR B;  5ITZ F;  2LJ0 A;  1ARK A;  1E6G A;  3JXI A;  1AWJ A;  2CDT A;  2LX7 A;  2AKK A;  4E6R A;  3PE0 A;  3M0Q A;  2KBT A;  2DNU A;  1MX4 A;  1ZUU A;  3TWW A;  1M3B A;  4OML A;  2K6D A;  1B3Q A;  4LNP A;  2EW3 A;  5HCK A;  3I5R A;  3VS2 A;  1AEY A;  1BI7 B;  5I22 A;  2RQW A;  2KXC A;  2KEA A;  2JTE A;  1QWF A;  3H41 A;  3F6Q A;  1X43 A;  1WX6 A;  5IH2 A;  4GBQ A;  4OAU C;  2KR3 A;  2PNN A;  1N0Q A;  2DL4 A;  3TWR A;  2C0T A;  1JU5 C;  1NLO C;  3C0C A;  1ABO A;  2XEH A;  5KBA A;  2D8J A;  2CUB A;  3DEP A;  3PVL A;  2DRM A;  4J7W A;  1SHF A;  4C48 B;  2LMJ A;  1UJ0 A;  1X27 A;  2PTK A;  5FWB A;  3TVT A;  3HG0 D;  1T0H A;  2ED1 A;  2DE0 X;  2DZO A;  2KT1 A;  4LN2 A;  1GFC A;  2CH4 W;  1NG2 A;  1QWE A;  2K7A A;  4OMN A;  1AVZ C;  2DF6 A;  3REB B;  4TUM A;  2AJA A;  4J9D A;  3ZU7 B;  4HVW A;  1AWC B;  3H0H A;  3Q9U C;  5KNH D;  2RMO A;  2DRK A;  1HJD A;  1VYU A;  4BET A;  4ATZ D;  2W0Z A;  4Z89 A;  1KJW A;  1PNJ A;  2A08 A;  2RN8 A;  3H0I A;  1OPL A;  1SEM A;  3AJI A;  5EYL A;  2A37 A;  2AK5 A;  2DJQ A;  5ECA A;  2AKL A;  2A5E A;  2L0A A;  5ENQ D;  1ZLM A;  5CEC B;  2K3B A;  2VVK A;  1V1C A;  1I0C A;  2EGE A;  2DL3 A;  2LNH B;  5AQA A;  5AAR A;  2G6F X;  4JPB W;  1SVX A;  1QKW A;  2BZX A;  3VS6 A;  2YDL A;  5FIN A;  2ETC A;  2L3P A;  5D66 A;  1YMP A;  4AG2 C;  3NMZ C;  2DL5 A;  2ZGD A;  5ENT D;  3ZKJ A;  4RTT A;  4DUI A;  1PWT A;  3KFV A;  2FPE A;  4KRT A;  1TG0 A;  2RQU A;  3EGU A;  2XZD G;  3UA6 A;  1PHT A;  1RUW A;  1NLP C;  4OAV B;  3SEM A;  2K9G A;  4CC3 A;  5ENR D;  1K1Z A;  4BEP A;  3R6N A;  4BES A;  4Y92 A;  1WIE A;  1PKS A;  2RF0 A;  1I07 A;  1U3O A;  4HRN A;  2D8H A;  3FJ5 A;  2EQI A;  4HRL A;  1HD3 A;  3IQL A;  2FRW A;  3VS3 A;  5ENP D;  4ESR A;  5EN5 D;  1OV3 A;  3T9K A;  1AOJ A;  1YWO A;  2LQW A;  4Z88 A;  1K3Z D;  4CC2 A;  4J9F A;  1W70 A;  2J06 A;  4F16 A;  4OMM A;  4HI8 A;  4K11 A;  1UG1 A;  2EGC A;  2ENM A;  1HSQ A;  5ENS D;  2EPD A;  1DC2 A;  2NWM A;  4F17 A;  4LSZ E;  2SRC A;  2KBX A;  4RTW A;  1K1A A;  1MJ0 A;  2M0Y A;  4OMP A;  2HSP A;  4F1P A;  2AZS A;  4K5A B;  1UTI A;  2J05 A;  4YDY A;  2SEM A;  1AP7 A;  1BLX B;  2DZN A;  3B7B A;  1GCQ C;  1UEC A;  4WCI A;  2DIL A;  2ROL A;  4G8K A;  2ROT A;  1YP5 A;  2HE0 A;  3HRA A;  3VS7 A;  1K76 A;  1AD5 A;  1JO8 A;  1YNZ A;  1BU9 A;  2ESW A;  2V1R A;  1GCP A;  5IXB A;  1S70 B;  2EYX A;  2ZGG A;  4Z68 A;  1WDY A;  3C5R A;  2EVR A;  1G83 A;  2JS2 A;  2V4H C;  4K5C A;  1BB9 A;  4HRM B;  3UXG A;  2KYB A;  1YCS B;  1M3A A;  3W9G A;  1K0S A;  4B93 B;  3M0P A;  4OMQ A;  1FMK A;  1BBZ A;  2ED0 A;  3VRZ A;  2M51 A;  3REA B;  2F2X A;  4AFU C;  1WXT A;  4HXJ A;  2J7I A;  2GNC A;  3EG1 A;  4F14 A;  1VA7 A;  1H3H A;  2B86 A;  2AZV A;  3I9Q A;  4ZNX A;  1PRL C;  5CBO A;  3AAA C;  2DX1 A;  5AQ7 A;  1JXM A;  2KRN A;  1QLY A;  2F8X K;  3EG3 A;  2GGR A;  2E5K A;  4F6R D;  2KRO A;  5GJV B;  2O88 A;  2C0I A;  5ENO D;  4D8D A;  1W6X A;  4ZFH A;  1AWW A;  2JMA A;  2LP5 A;  4N5Q A;  2JMC A;  1OPK A;  2DA9 A;  3M0R A;  4HB5 A;  1N5Z A;  3VS0 A;  1NFI E;  2DYB A;  4J9H A;  2JS0 A;  2RFA A;  4DEX A;  1Y0M A;  2K2M A;  2EBP A;  1QYM A;  2O9V A;  4U8V D;  1OOT A;  2MOX A;  3TWU A;  2YUQ A;  4JJB A;  4RTU A;  2L2P A;  2V1Q A;  2QYJ A;  2FO0 A;  2KE9 A;  4X1V A;  2B0O E;  1T0J A;  4GLM A;  2DL7 A;  2BZ8 A;  1UJY A;  3I35 A;  2W10 A;  4Z8A A;  5AN8 A;  3EHR A;  3TWS A;  1X6G A;  2KT8 A;  4ORZ A;  2DLP A;  1NEB A;  1GRI A;  1E6H A;  1MUZ A;  1UFF A;  3TWQ A;  1M30 A;  1OEB A;  3H0F A;  3NOC D;  2QDL A;  3NOG D;  4QFV A;  5JMN D;  1MV3 A;  2DM1 A;  4RTX A;  1J3T A;  2Y1L E;  1YN8 A;  1CKB A;  2GQI A;  4OMO A;  1A5E A;  3ZL7 C;  2MCN A;  1PKT A;  3UI2 A;  2CH4 A;  1D9S A;  4HVV A;  4BSZ B;  4RTZ A;  3V79 K;  2A36 A;  2GTJ A;  2YUN A;  4AG1 C;  3W9F A;  1K1B A;  1LCK A;  4ZHB A;  4QQI A;  3JXJ A;  2DMO A;  5KWD A;  4HCK A;  3V2X A;  2JM8 A;  1VYT A;  2CSI A;  5EIL A;  1WYX A;  1GBQ A;  1WLP B;  2FG0 A;  4IIM A;  1JQQ A;  2DVW A;  5JA4 D;  1GCQ A;  1M8M A;  2HEQ A;  2VGE A;  2EYZ A;  2HDA A;  3VS5 A;  2CUD A;  2K79 A;  1K4U S;  2KNB B;  3NBN B;  2GBQ A;  5BXU A;  2EKH A;  4M4Z A;  4HLL A;  3M0U A;  5EYP F;  2RPN A;  1YWP A;  1ABQ A;  2RFM A;  2DVJ A;  2JM9 A;  3TSZ A;  2YT6 A;  2NUZ A;  1SHG A;  4LUD A;  4JZ4 A;  1WG0 A;  3UA7 A;  3V30 A;  1S1N A;  3DEO A;  4DEY A;  1ZUK A;  1AZG B;  1I1J A;  2J6K A;  2JW4 A;  4LE9 A;  3GBQ A;  4K5B A;  1SPK A;  5AQB A;  2LJ1 A;  1EFN A;  2X3W D;  3A98 A;  1OY3 D;  3EG0 A;  5CEA A;  3PVQ A;  3M0T A;  2YUP A;  2CRE A;  4NIK A;  1AWX A;  1XOV A;  1RI9 A;  2YUO A;  2LZ6 B;  4DX1 A;  1RLP C;  1OT8 A;  2KXD A;  1TUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...