4A63B

Crystal structure of the p73-aspp2 complex at 2.6a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
202
Chain Sequence
MRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Aspp2 Recognition by the Tumor Suppressor P73.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords TUMOUR PROTEIN 73
total genus 59
structure length 202
sequence length 202
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
B PF00023 Ank Ankyrin repeat
B PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4a63B01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4a63B02
1U3OA 2MYOA 2XZTG 1BK2A 2CT4A 1JXOA 1WFWA 4ZHBA 2L6BA 3RBBB 1BU1A 5AARA 4JJBA 4DX1A 2DL5A 2ECZA 1WDXA 4O60A 5FWCA 4D8DA 4JJDA 4BEPA 1OOTA 1UFFA 4LUEA 4AFQC 2HBWA 1QYMA 2BZ8A 2BTTA 4BERA 3THKA 1M8MA 4O1OA 2YUNA 1CKAA 3F6QA 3EHQA 2QC9A 2FO0A 2GGRA 3UI2A 1OY3D 1YN8A 1WX6A 4E6RA 1NEGA 3REAB 4J9IA 4LUDA 4ZNXA 4OAUC 3CQTA 5JMND 1YWOA 1HJDA 2YSQA 2D0NA 4BESA 1AEYA 1J3TA 3TSWA 2EGAA 3VS2A 1ZLMA 1OEBA 3EG1A 1IHBA 2O2OA 2B86A 3VRZA 2XENA 3D9HA 1SPKA 2JABA 2HSPA 3V2OA 1X69A 1K0XA 2V5QC 1E7OA 4J9EA 4J9CA 2BKGA 2B0OE 1JO8A 3DEOA 4AG2C 4ZFHA 1RUWA 4QQIA 1GCQC 3V31A 2XEEA 4UUCA 4D8KA 1X2KA 3TVTA 2D1XA 4R0KA 5ECAA 4U8VD 1WXBA 1N5ZA 1BU9A 5ITZF 4U96D 2XZDG 1RLPC 2J6FA 2PNIA 3KFVA 4FSSA 4LN2A 3W9GA 4RTUA 2CH4W 1H92A 1I1JA 1OPKA 2ETBA 2KT1A 4J9DA 4B93B 2RFAA 4F1PA 3A98A 2EQIA 4K5AB 4K5BA 5BXUA 3VS6A 1KJWA 1UJ0A 4CC2A 2KROA 2M0YA 5CEAA 2K9GA 1AWOA 1WDYA 3PVQA 3Q9NC 2CH4A 4GBQA 1I0CA 1QWFA 4LNPA 1Z9QA 5FW9A 3VS1A 2IIMA 2F2WA 3H0IA 1UTIA 3JXIA 4DUIA 2OJ2A 1WYXA 5AQAA 2AZVA 2EBPA 4DX5D 4GPMA 1ZUKA 2DX1A 1ZX6A 3TWXA 1WA7A 2D8JA 2LQNA 5IHIA 2KE9A 1T0HA 1MJ0A 2DZNA 4HVUA 3UTMA 4NIKA 2O9VA 2RMOA 2O9SA 2JM8A 4F16A 2DM1A 1X27A 2J8SD 2L3SA 1MX2A 1UOHA 2F2XA 4G8KA 2CREA 1G83A 1E6HA 2DE0X 2KR3A 4AFZC 4HNAD 2JT4A 5KBAA 3TWSA 1T3SA 1WI7A 3TSZA 1ZUYA 1MV3A 1BBZA 2JS0A 2FPFA 4OAVB 2YDLA 3UA6A 2J06A 2J6KA 4RUGA 1BB9A 2GTJA 5FIOA 1M3BA 1PRLC 5EN5D 4AFSC 1NLOC 3ZUVB 1X6BA 2K7AA 5ENTD 4ATZD 5CEDB 2J05A 1PWTA 3NOGD 1ARKA 1YCSB 3NGPA 4HBDA 4Z68A 2A36A 3QWXX 3VS0A 2EW3A 3KEAA 2LCSA 2DRKA 2XEHA 1YWPA 4RTTA 2RQWA 3TWRA 1X2QA 2EYZA 1K4US 1MX4A 1AWJA 5ENQD 1GCPA 1W6XA 2K3BA 2KGTA 2AZSA 1KFZA 4A63B 5CERB 2V4HC 3HG0D 4YDWA 2KYBA 3B7BA 5AQ7A 1NEBA 2ED1A 2I0NA 1QKXA 1JEGA 3I9QA 5AQBA 2H8HA 3VS5A 1GFDA 4AFUC 1BD8A 1WIEA 2HDAA 2DWZA 2K79A 5I11A 3HRAA 2KRNA 4JJCA 4IIMA 4DX7D 2VVKA 1G3NB 4C48B 2VWFA 1MX6A 5EYLA 1KSWA 1QCFA 5IHNA 2A5EA 1VYVA 2FRWA 3LH5A 2FG0A 2RF0A 1CKBA 1AP7A 1U5SA 4HRMB 2HE0A 5HKPA 2DRMA 2NWMA 1U06A 2RNAA 4HVWA 5EC7A 2V1QA 2YUOA 5L23A 2A08A 2LJ3A 1SVXA 1AD5A 5FWBA 1AZGB 3TWVA 5AN8A 1X6GA 3M0TA 1DCQA 2ETCA 1M3CA 2D8HA 3J5PA 1GRIA 3FJ5A 1Y57A 2FPEA 1GCQA 4RTYA 2JS2A 1NYFA 4OMQA 2DZOA 1PKSA 1OT8A 3EHRA 4GMRA 2A28A 2KRMA 2QDLA 3VS7A 3ZNGA 5CBOA 1OV3A 4CC3A 2ROTA 2X3WD 1K9AA 4HI9A 3C0CA 2CT3A 1SW6A 2ROLA 4M4ZA 2FO1E 2Y1LE 2E5KA 4WCIA 2F8YA 1A0NB 1Z9ZA 4OMMA 1VA7A 4Y92A 1PNJA 2FPDA 3PE0A 2AKLA 2KXCA 3M0UA 2MOXA 2OAWA 1OPLA 2DJQA 1K0SA 3AJIA 1JXMA 4LG6A 1H8KA 2L2PA 4TUMA 1UGVA 1IKND 2LJ1A 3J5QB 2DBKA 2Y0BG 1UDLA 4BETA 2ETAA 5ENSD 1UHFA 2C0TA 1V1CA 4ORZA 3NPFA 4LSZE 3T9KA 5KNGA 5HS0A 3M0PA 2KXDA 4F6RD 5I22A 5ENPD 2DILA 3RNJA 2RFMA 2GQIA 1UE9A 4G8LA 2ESWA 2P4RA 1NM7A 4J9HA 4Z88A 2LJ0A 1WLPB 3GBQA 3TWUA 4HCKA 1AVZC 1SHGA 2ED0A 2K6DA 2CUBA 4JPBW 1LCKA 3ZL7C 2KBXA 3UATA 4LE9A 2MIOA 1WXUA 2DL8A 1G2BA 2ENMA 1UJYA 4U8YD 3R6NA 3W9FA 5HCKA 2PNNA 4J9GA 4QFVA 2A37A 3QWYA 1SSHA 1YNZA 3NMZC 2DL7A 1DC2A 4OMPA 3SHWA 1AZEA 4N5QA 5EIBE 2CSQA 5HRYA 2F2VA 5ENOD 5CECB 4RTZA 1S70B 4K5CA 3M0SA 5IXBA 2PTKA 2NYJA 2L0AA 2LNHB 3EG3A 1X43A 2LX7A 2EYWA 1S1NA 1SHFA 2DVJA 4DEXA 3VS4A 1MV0B 2EYXA 3H0HA 2EVRA 1MYOA 1K3ZD 2GBQA 1GFCA 2EYYA 3DEPA 2KBTA 3PVLA 1K1AA 3B95A 2RQRA 3REBB 3JXJA 1FMKA 1A5EA 1D9SA 4ESRA 2SRCA 2JMCA 3M0QA 1Y0MA 2ABLA 4OMOA 1ZUUA 5GJVB 1KIKA 2EGEA 2DL4A 2BKKB 1UUEA 1E6GA 3IQLA 3LJNA 1PKTA 2JW4A 3V2XA 2DVWA 3H41A 1I07A 1QLYA 1TUCA 2HEQA 3Q9UC 4BSZB 5CBNA 2L3QA 4HXJA 5GJWB 4KRTA 4Z89A 2JMAA 4JZ4A 2OI3A 2VKNA 3UF4A 4OMLA 1AOJA 2JXBA 1NFIE 1EFNA 1AWXA 1HD3A 2KNBB 1IXVA 3H0FA 1HSQA 1GBRA 3SO8A 2K2MA 4OMNA 2G6FX 2QYJA 1ABQA 1N0QA 1K76A 2BZXA 2DL3A 4O1PA 5IHKA 1RI9A 2KXPC 3T8KA 3UA7A 4DRXE 2KEAA 4DX6D 1K1BA 3NBNB 3JUEA 2EPDA 1B07A 4HQDA 1NG2A 3EG0A 1MUZA 5D66A 1UECA 2J6OA 4DEYA 5IXFA 1XOVA 1ZSGA 2DF6A 1BI7B 2DBMA 2JM9A 1AWCB 4HVVA 3ZKJA 2DLPA 2C0IA 2YT6A 3VS3A 4DX2A 3TWQA 2M51A 4HLLA 2ZGGA 2LZ6B 1M30A 1JU5C 4HRNA 1GL5A 5EIDA 3SEMA 1YP5A 4JZ3A 5ENRD 2AJAA 3TWTA 4RLYA 1GBQA 4K11A 2VGEA 5EYPF 2KRSA 1M3AA 2RQVA 2CDTA 2DYBA 2F8XK 2SEMA 2CSIA 1NYGA 1WXTA 1BI8B 2W0ZA 4JB8P 1IO6A 4CZ2D 5BXOA 2DNUA 2X3XD 4X1VA 3C5RA 1QKWA 4IIOA 3ULRB 3EG2A 1N0RA 5AQ9A 2KT8A 4LNUD 2LQWA 3V30A 3O5ZA 4GLMA 3I35A 2RN8A 3I5SA 4HI8A 1YMPA 2GNCA 4CC4B 1H3HA 2BZYA 4RTVA 1SRLA 3VRYA 4J7WA 5JA4D 1PRMC 5EILA 2P2CP 1WG0A 4CC7A 1TR4A 1TUDA 1ABOA 4AG1C 4F17A 4QT7A 4J9BA 2J7IA 1UG1A 2NUZA 2O88A 5KNHD 2XMFA 1M27C 1BLXB 2KYMA 1B3QA 4Z8AA 2ZGDA 1N11A 5KWDA 1RLQC 1W1FA 2L3PA 1ZBJA 2O31A 2PZ1A 4HRLA 4J8YA 1T0JA 2EKHA 2RPNA 3UXGA 5FINA 3IXEA 1W70A 1JQQA 1QWEA 3U23A 3NOCD 2DA9A 3I5RA 2LMJA 4CYMD 2HCKA 1T3LA 3NHNA 2FEIA 1NLPC 5IH2A 2AKKA 2LP5A 3EU9A 2YUQA 1SEMA 3AAAC 2RQTA 5AAOA 4YDYA 2GTOA 2MCNA 4J9FA 1CSKA 4EIKA 3M0RA 1SRMA 2JTEA 2AK5A 3ZU7B 3JV3A 4RTXA 1UHCA 3TWWA 1AWWA 3V79K 2CUDA 1VYUA 2EGCA 2F37A 1YYHA 1FYNA 2W10A 2YUPA 1PHTA 2V1RA 4HB5A 1K1ZA 4F14A 2FRYA 1TG0A 2C0OA 2DMOA 4RTWA 3EGUA 1VYTA 4U95D 2RQUA
chains in the Genus database with same CATH superfamily
4G1TA 1XTDA 3SBSA 4M75B 1BK2A 3M9QA 4OYSA 3MKQB 4U0UA 4AY5A 2DXTA 3L13A 4DPRA 1WPYA 3JRZA 2QASA 2E6NA 1TN7A 1TNUA 3B7SA 3IBEA 4D8DA 2KI7A 1OOTA 2DJZA 4I6EA 4UQXA 1VQ8A 2DO3A 3CD6A 4BERA 3FJPA 3THKA 1RZ4A 1M8MA 1RAHB 5GAOq 3QNKA 2YUNA 1XJWB 1CKAA 4YDEA 2QC9A 2FO0A 4OVAA 4EMKA 3RK6A 1YN8A 3MO8A 4E6RA 2CHXA 1K8KG 4LUDA 4J6YA 4OAUC 3CQTA 5JMND 2X4XA 4F7UG 1YWOA 3EJNA 2JUFA 3LWIA 4Q96A 2QA4A 2EGAA 3TXMA 1RI0A 2PQWA 1YJNT 2LSVA 2B86A 3VRZA 3RRMB 1KHCA 4MMKA 2QI2A 3PIPA 3VLFA 3ZFWA 3DBSA 3HYMB 4J9CA 2H6GA 3FP3A 2X6IA 3L1AA 2BKGA 3ZHEB 5G55A 1RUWA 5LJ5j 4QQIA 4C9BB 2HNIA 2M1HA 4C0DC 5KYYA 5J39A 1F1BB 1HXIA 3I55T 4PNOA 3G2VA 3PGGA 3A8LB 1U3DA 5AT1B 1FPPA 1N5ZA 2CFUA 1BU9A 4M77A 2PQNA 3B7RL 3W9GA 3IEGA 1U1TA 1RADB 2ETBA 4PS7A 2WM9A 3OS5A 3OYNA 4J9DA 3ZYKA 3C95A 3I4GA 4F3VA 1MGQA 3JCMh 3LGFA 5FQ6A 3PT9A 4CC2A 5GAN3 1VQ6T 3KS2A 3ZXSA 1EDUA 4FULA 3MEUA 1AWOA 5KH6A 2CH4A 2HM8A 4QKUA 1I0CA 3CD6T 3PUJA 1IHGA 4C0FA 2LT1A 4J8FA 3KAEA 2OJ2A 4L7TA 4DUIA 1TNOA 1MHNA 1JB0E 4CRWA 4DX5D 3CHQA 2IU1A 4WWPA 3TWXA 3APDA 5GAOl 2KE9A 1NBEB 1VQKA 3ESKA 4HVUA 2O9VA 4BUGA 3MV2B 4KVOA 4U8HA 2WACA 3CPFA 4NURA 3O4ZA 2FBNA 2L3SA 4GTQA 2DYSE 3UX4A 4JHJA 1I8FA 2FF4A 2KR3A 4URKA 3VYHB 4HNAD 2JT4A 1KQSS 1T3SA 3MCXA 4WWNA 3TSZA 3R6OA 4JHRA 4NL2A 3HXFA 4FJZA 2YINA 4B9WA 4A4GA 1KLXA 4OAVB 3CCMA 2YDLA 1VQ8T 1LVKA 4ZN3A 2J6KA 1YJ9A 4RUGA 1BB9A 2GTJA 3MP1A 1PRLC 3MKRA 1UW4B 2ZPFB 4XZ4A 1X6BA 3CCVT 3OYMA 4U04A 3UPUA 3NQPA 1KK7A 4IRUA 2V8KA 1K9MU 2RHZA 1YIJA 2A36A 2A4ZA 4B8AA 1D8EA 3UMVA 4PL6A 4C8QC 4EZJA 2RM4A 4HLEA 2HYZA 3CKBA 4B8CB 1K4US 1VQ6A 3RKVA 1GCPA 1W6XA 4IUTA 4BI4A 2KGTA 4KYOB 3JUIA 5ANRA 3JB9G 1KG1A 5LJ3d 1N6AA 5CERB 3JB9J 3EGXB 2KYBA 3EGDA 3AS5A 2ED1A 3FU3A 3G2SA 1N8RU 5DM7R 4J6WA 3I9QA 2HKNA 1GFDA 5DLQE 2K4YA 4G2VA 4AFUC 2OCCE 4CDNA 4ILIA 2K79A 2KSSA 5I11A 1KZPA 3A8GB 2DK3A 4J6IA 4IIMA 3TU4K 3JCMW 3G1JA 1BI0A 4I9CA 5KE2A 3M4GA 2IONA 3PIOA 1JJ2A 3NZSA 3NFCA 3LH5A 5FZSA 1CKBA 1WJQA 1U5SA 3CCLQ 2HE0A 1U06A 4HFGA 3CMAT 4PS3A 5L23A 4WWOA 4PJLA 5FJYA 3HRTA 5FWBA 3CCRT 3E1SA 1KPSB 3TWVA 2DFUA 1X6GA 3AG1E 3VV0A 5GAN7 2ETCA 1M3CA 3JCMd 1GRIA 3WVDB 2COZA 4GA0A 2R5SA 2EJGA 4XTYA 3FHEA 4CDRA 5CHEE 1G8XA 3EHMA 3C4SA 3ABME 4OMQA 4Y28E 3KD7A 1O1RA 3QOUA 4N0AC 4GMRA 2EIJE 3WXXA 2OAUA 3RU0A 5CBOA 2LAHA 5B1BE 4FP7A 5LJ3f 1ELWA 2FB7A 2ZPEB 1KHIA 1X01A 3HXBA 3C0CA 3L2ZA 4H7XA 1M4ZA 1WHJA 2DIQA 2FO1E 4JRKA 1VQ5Q 3BY7A 2ILRA 2Y1LE 3APCA 3ZEFA 2CZ7B 4WCIA 2F8YA 2BIVA 1RABB 1Z9ZA 2X4JA 4Y92A 2M63A 4LDUA 3L2UA 2E2EA 1PNJA 4C5EA 4M7DB 4L5GA 3FUIA 3ML8A 1YI2Q 3BQOA 3PTAA 1K0SA 1YITA 1H8KA 4TUMA 3I4RB 1SQMA 5AJDA 2MOWA 1HF8A 1U1SA 5GMKl 4LCTA 2LJ1A 4C8QE 2NUTB 1NL4A 4JD2G 1UDLA 2ETAA 5D6XA 1UJKA 3JB9I 1V1CA 2GROB 2P9KG 3OAWA 4AT1B 3NPFA 1YIJT 4LSZE 1QCOA 1NA3A 1NPPA 5BW8C 3HTRA 3M0PA 4FU6A 5I22A 4ZTFA 5ENPD 3RNJA 2VSNA 3TQ7P 2X3MA 3ZEHA 4G8LA 2ESWA 4J9HA 5HY6A 4ILHB 2IY0C 4IYPA 3GF5A 4PLLA 1VQMQ 1YFNA 5CCLA 1KD1R 1LCKA 2KBXA 2QYZA 2MIOA 1DNPA 2HO1A 4JEUA 4WAFA 1G2BA 3G6EA 2ENMA 4U8YD 3R6NA 1HG2A 3N71A 4M78G 5HCKA 1BIAA 4EMKB 2KATA 4JDSA 3QWYA 1AZEA 1YNZA 3NMZC 4OMPA 4M75F 1NI1A 4BE2A 5EIBE 3EGXA 1Z6TA 5ENOD 2QXFA 5CECB 2C0LA 2J07A 2DTIA 2LNHB 4MDXA 1N54A 1W2BA 4CGVA 4OF1A 2NYSA 2EYXA 2BE7D 2VB6A 1Q81U 5G2NA 5LL6S 3MHXA 1MYOA 3CGHA 4Q69A 2GBQA 3QUIA 2XQ0A 1GXIE 4KT6B 4AJWA 3QHSA 4C92B 2IEJA 3WVEB 4LDXA 3B95A 1FMKA 4M75A 4RMOA 4ESRA 5GMKj 1NZ9A 4HKEA 1N95A 2AVPA 4I6JA 5GJVB 5J3BA 1QVFS 4GPKA 4M7DF 2LVMA 2JW4A 4IULA 1JCRA 4EBAA 4CDMA 2VYTA 3H41A 4WF2A 5LCWC 1QLYA 2PZIA 2L3QA 4BE0A 4JZ4A 2VKNA 3SWNC 1DCEA 1IHWA 4ANUA 2ZU6B 3OMCA 3L6AA 1WQ7A 3DSVA 3PDNA 2P0PA 1IXVA 3H0FA 1HS6A 3OB9A 3Q73A 4EZKA 4J8EA 2NUPA 4OMNA 4NACA 1K76A 4O1PA 3FTVA 2RI3A 3MCAB 4XAXB 4JS5A 4DRXE 4F7AA 2YXYA 3G71Q 3QWPA 1K1BA 2A0FB 3K9IA 3MX3A 2EQMA 3EH1A 7AT1B 3JCMJ 4ACKA 3EG0A 2X4WA 1RW2A 3DB3A 2YHCA 2WQ7A 3CCJT 4AM9A 2DBMA 3EG9A 4YVQC 2XDPA 4FSXA 1I5LA 1AWCB 1N4PA 1O75A 1UEBA 4MZTA 1YJWA 3R9MA 2JVVA 3CVNA 5T8IA 3AG4E 2X6KA 3CHRA 2QZAA 1B7TA 4C0GA 3TWQA 3Q7FA 3OYLA 3EUVA 2XG8D 3CCSQ 1M30A 1JU5C 1M1KC 3M53A 1E90A 3LXUX 1YP5A 4BY6B 1M1KR 4JZ3A 4XTVA 3JB9D 2CHWA 3QK0A 3GW4A 1PM3A 2DEUA 4GA2A 3FUKA 4PK4A 4C92F 1OQKA 4K11A 2VGEA 5EYPF 2KRSA 1S72A 2GFUA 3OYHA 5BV1A 1O5MA 5GAOn 2CDTA 4PS8A 2F8XK 5KYUB 2FULA 3O48A 5FRMA 1BI8B 1B34A 2MPXC 2DNUA 4M77G 4M7DC 2QY7A 1OULA 5LX8A 3ULRB 5AQ9A 5GMKh 4LNUD 4M7AC 1IYGA 2RN8A 5LJ3g 3LY7A 3L54A 5H7PA 1INZA 4N4IA 2QQ9A 1MHQA 3NF1A 1JCSA 2BZYA 3ZYLA 2QQSA 4JZYA 4HOTA 2E1HA 2M02A 4YVOA 3QZ9B 3ZGQA 1LD8A 4QVZA 2P58C 1VQNT 4QT7A 3MZLB 4A4FA 3Q15A 4GAAA 1BIBA 2PU9B 4JUVA 2O88A 4M7AE 5KNHD 1V55E 2IO3C 4PJNA 1B3QA 2HSEB 4XU2A 1N11A 1W1FA 2QDYB 4GLKA 3QKYA 1ZBJA 2FYKA 2O31A 3JCMX 3BEEA 4HA8A 5GAMd 5JHAA 2DVEA 1TNBA 2RA2A 1WM5A 3QWVA 2RPNA 3UXGA 5FINA 1XNIA 3U23A 4RQIA 3NOCD 3ZFJA 3ZPJA 3L16A 3I5RA 5CMYA 5FQ8A 4NL3A 3NHNA 3AG3E 5AJLA 5CKDA 1VQPT 2LP5A 3BW1A 1BKBA 3AAAC 1ZBXA 2BKDN 1UB4A 2GTOA 2MCNA 4J9FA 1CSKA 5GAOr 3PFSA 4TXQA 5LJ5e 3V8LA 1KT0A 4R55A 2MWPA 5D6WA 3FUHA 4VUBA 3LGLA 1N9RA 1Q95G 1N4RA 1VYUA 3CCUT 2F37A 1YYHA 3QYGB 4UWGA 2W10A 1Q86U 1PHTA 2H3EB 2UY1A 1TSFA 2LXMA 1G3SA 1TG0A 4RTWA 3QZ5B 1Q82U 3L42A 3M4YA 3OYGA 1QP2A 1X75C 1VQ4A 2KCLA 2DZCA 1U3OA 3UT8A 2CT4A 3WXMB 4LD6A 5CK9A 3DSUA 1BU1A 5AARA 3OSVA 2QQAA 1H2UA 2R05A 2ECZA 1WDXA 2RHIA 3AT1B 2ONDA 3JQ0A 3D9MA 4JJDA 4BEPA 1KT1A 2ZPBB 1PY1A 2HBWA 1QYMA 4DK5A 3RIBA 2HAXA 5D0OD 3G4SQ 4M77B 3Q75A 5CKFA 3EHQA 1NJIR 4BX9A 3VLEA 3ASFA 2WQ6A 4PJOG 2KQWA 3UI2A 1OY3D 2CFZA 5L8RE 3S3NA 3UT4A 1FT2A 3RERA 3DSWA 2LQ8A 4N3CA 3M5AA 5B1AE 4GTTA 2M9UA 3DB4A 4M77F 4BD3A 4BESA 1SSFA 1J3TA 1E8YA 3SFMA 3RO3A 3VS2A 1VQLQ 1ZLMA 1OEBA 1QW1A 3E33A 2GRPB 3EG1A 3ZXPA 2OVBA 2J9QA 3QJZA 4N5CA 1M5Q1 3BG0B 1Z5SC 2WXIA 2JABA 2HSPA 3UINC 1NPRA 3CC2T 3B7TA 3VU3C 1KC8R 4J9EA 3MEKA 3MA5A 4B0ZA 2D9TA 2IOSA 2WXQA 3VJPA 2B0OE 3DEOA 4AG2C 4IUQA 2V5FA 4WNDA 3CC4Q 4FYXB 4C92G 3CSTA 3KSQA 1VQOT 5A0GA 3V31A 1RACB 4UUCA 3JQ1A 4D8KA 1X2KA 3PS6A 4R0KA 5KYWB 4U8VD 5I2MA 1WXBA 2NUTA 2PNIA 4GCOA 2AXVA 3RKYA 4FSSA 4EECA 1E7UA 2KAFA 2RHXA 2Y90A 1PAQA 1BCMA 1PSEA 5KCOA 1YHQQ 2E6ZA 3KEZA 1JJ2P 4LD9K 1UN9A 1VIEA 3A98A 2EQIA 4K5AB 2DYRE 4K5BA 3VS6A 1UJ0A 5ARFA 4FHJA 3RAUA 1WDYA 4M78A 3I56A 3Q9NC 1N4QA 4KH0B 5CKEA 1RAEB 4RKUE 4KBMB 4D10C 3G2TA 4C8QD 3QO3A 4LNPA 3RO2A 2IIMA 4BSXA 3FEXA 3JXIA 1OCOE 1VQ9T 2CP5A 1FT1A 4TVRA 1TTHB 2EBPA 4JEHA 2Q7FA 2DX1A 4UWKA 3S7JA 3HRSA 2D8JA 2LQNA 1PD0A 1OCCE 2WPVA 4EBAG 4JLGA 1E8XA 2DZNA 8ATCB 3UTMA 3LDZA 1Y96B 1Z3YA 2JM8A 2P9NG 4F16A 2J8SD 1UOHA 1KZOA 1D8DA 1N94A 3QAQA 2CREA 2KZTB 1E6HA 1G83A 2L0IA 4B6MA 3CCLT 1QVGS 3SF4A 5BV0A 4XU3A 1EZZB 1D3BA 2ZPGB 1WI7A 3CCJA 3CCRQ 4BFRA 1MV3A 5T3RA 5LFAA 2FPFA 2R03A 2V0PA 3DXKG 3UA6A 4KT0E 3G4ST 4GZCA 5FIOA 1UGSB 2J4DA 1HZ4A 1OU9A 3SI5A 4AMCA 2OTJQ 3FULA 3ZUVB 3OBWA 4V2SA 2K7AA 5CEDB 1WNLA 1PWTA 4HXIA 2HQHA 4V3IA 1YCSB 3MKQA 4HBDA 3URZA 2H6HA 3NGPA 5GAN8 2IQCA 4XU1A 4RCCA 3ABKE 2EIME 2XEHA 1QP3A 1YWPA 4QW2A 3DPYA 3ONLA 3FTZA 5KYNA 3PNWC 2OVFA 5B3SE 5ENQD 1AWJA 1WAO1 1VQNA 3PREA 3GLXA 3QDNA 5EKQD 3EFOA 2X6JA 2I2OA 3HG0D 1IZ6A 4OGEA 1IQUA 1NEBA 5GAN5 2OEVA 1LPLA 2B8AA 1LD7A 2LSUA 3RRUA 4C0ZA 3FUEA 4CT4A 1WHLA 2F5TX 1BD8A 1WIEA 2DWZA 1E8ZA 2XEVA 5DIZA 3A1PA 4JJCA 4EDUA 4OP0A 3E9GA 4DX7D 2VVKA 2E4HA 1YIJQ 1G3YA 3PZ4A 4HT9A 4C48B 1MX6A 4LNGA 1QCFA 2RD1A 1EF1C 2A5EA 2KCVA 4OGCA 2FG0A 1YHQT 1UN8A 4HRMB 2PM7A 2QK0A 2RNAA 3OW2P 5G05J 4FM4B 1IB8A 5FTPA 1AD5A 4RG8A 1AZGB 4GZ6A 2LXLA 3M0TA 5GAOp 2D8HA 2P4TA 3J5PA 1G5VA 3SQVA 4WTOB 4YTLA 5A2QE 1TS9A 3SFYA 3JCMV 3OXLA 2DERA 1GCQA 3FWVA 2K5FA 3HXEA 2JS2A 4I1MA 4PJOF 5KCMA 4PH4B 1OT8A 4K0RA 1OX9A 2QDLA 2KY9A 2QQRA 2QEXA 5JJTA 2EQUA 3CCUA 4BX8A 4ABNA 4ZGEB 4I2WA 4E7JA 4JA9A 1V76A 1R0BG 2LUHA 2J08A 1SW6A 5CMWA 4ELYC 2CS7A 2E5KA 1Y71A 1A0NB 2K3XA 2ZZDA 3UKUG 2XPZA 4J8DA 4LDYA 2AKLA 3TXNA 2XS8A 4CEMA 3EFSA 3LVRE 3CMET 4PKCC 4M7AB 5LJ3h 4FLHA 1S72Q 4BT9A 4E7ZA 3FTXA 4DI3A 2GW1A 2L6JA 4A4HA 4ATGA 4JC8A 2DTHA 5GANg 2OTJT 1IHVA 3J5QB 1OWMA 2QTVA 3A5ZB 2Y0BG 4APFA 4BETA 1L5JA 2B6CA 4ORZA 4C92A 2X6HA 5EX0A 2DKGA 3QDRB 4PJMA 1H6KA 2O01E 5HS0A 1I5OB 4F6RD 3LLRA 1VQKQ 3UIOC 5CO7A 2GQIA 2P4RA 2XCCA 2HQXA 3LY9A 3GBQA 2JEKA 1I4K1 1SHGA 2ED0A 5CAIA 2EFIA 4JPBW 2WXNA 1M1FA 1LTXA 3ZL7C 1NJIC 5J26A 3ZW3A 1FXXA 5GANe 1TNYA 4F1SA 2DL8A 3OA6A 1HK9A 1YITQ 3S3OA 2E3IA 3GZ2A 4FHKA 2PNNA 1SSHA 1NP7A 2DL7A 3MKDA 2QEXT 3UM3A 4TRQA 4M77D 1YCYA 2I1KA 4C5GA 4PJOB 4RTZA 1S70B 4K5CA 4BTBA 4JL0A 2PTKA 2HKQB 2L0AA 2EYWA 1HH8A 3VUBA 5ANLA 2EVRA 1DJ7B 4J7FA 5FZQA 1YBYA 3C12A 3EAEA 2QA4Q 3SNXA 3CKCA 2KBTA 3PVLA 3HSBA 1A5EA 3SY2A 3ULYA 3BFMA 5LCWJ 2DCPA 2COWA 2WXGA 4ILGA 1KIKA 1M1GA 2QG9B 2BKKB 1UUEA 3LJNA 3TGOA 2M0OA 2R57A 2QGGA 1Q7YR 3OW2S 3UT7A 3OTNA 4BSZB 4M77E 4Z89A 3RIRA 3LYAA 1ZSZB 2BE9B 3UF4A 5FROA 1VQ9A 3D9IA 5CVIA 2JXBA 3QWWA 1EFNA 1WHGA 4QVDA 2K2VA 4F7UB 5KYYB 3L2RA 5HI7A 1HSQA 4EZLA 1H3ZA 1VQ4Q 3SO8A 2K2MA 5CCMA 2G6FX 1ABQA 2VQ2A 1N0QA 3CPWA 1LNXA 1RI9A 2HZYA 3Q79A 1WJSA 4DX6D 4A53A 3UM0A 1MQSA 3NBNB 2BUDA 2EPDA 5KYUA 2IO2C 4EQFA 4HQDA 3MV3B 1NG2A 3CMEQ 3RUXA 1UECA 4CI0C 1JCQA 3VYGA 2J6OA 5FT9A 4LDVA 4DEYA 4E7IA 1M90R 2DF6A 4ZGDB 2I2LA 3META 1OWPA 2JM9A 3MJXA 1EPUA 1UGQB 3CCQA 3ZKJA 4C5IA 3A8MB 1K8AC 3HPWA 2RKKA 3QBYA 1M8VA 3CEYA 4DX2A 2VXEA 3I5PA 2CGHA 1MMDA 4DBQA 4U0SA 4LXCA 5GAN4 2LZ6B 4E7SA 2Y4TA 5C1DA 3BG1B 2DIGA 2X6FA 3AS4A 1U8RA 1VQLA 3CSFA 2OX7A 3GIBA 5ENRD 1SKUB 2AJAA 2GRMA 1LOJA 3S6WA 2VSOE 2WSFE 2BTDA 5BNWA 2QTXA 1H2VC 2DYBA 3LY8A 5LJ5h 2RHUA 4CGWA 3OYIA 3GZ1A 4UWHA 1WXTA 2L89A 4UI9K 2W0ZA 4JB8P 3UWNA 5BXOA 2X3XD 3C5RA 1QKWA 5E75A 1M2VB 1N0RA 5EG2A 2KT8A 4GLMA 3V30A 1KQSA 2FL7A 2MWOA 1ZB1A 2CZ6B 2WVIA 2WXOA 5HKCA 4CC4B 3CCLA 2RO0A 3CLJA 2KMTA 4R7LA 4J7WA 4F7UF 1PRMC 2P2CP 3ASNE 4RVBA 1TR4A 6AT1B 1BPOA 2XU8A 3SWNB 2E10A 2MI6A 3CMAQ 4J9BA 2J7IA 2MRIA 2E5QA 2MF2A 4JRQA 4ANJA 1M27C 1BLXB 3Q5MA 4PDXA 5AIJA 1UGRB 1WHHA 2KYMA 4Z8AA 2KC7A 3KSLA 4LEUA 3PUKA 2PZ1A 4I1OB 4FJYA 1WHMA 2LO6A 2QYUA 4KZCA 4HRLA 3QKJA 4J8YA 1T0JA 1U2VG 3S2AA 3OYBA 2PQRA 2EIFA 4JRPA 2VV5A 3EIQC 1QWEA 2EQKA 5A0DA 2VGXB 2CP7A 2DA9A 3P8HA 2WXKA 2XDDA 4I6GA 2LMJA 1ZU2A 2G3RA 4M78F 4E47A 3CR3A 3CQCB 1QVGA 2AKKA 3EU9A 4K03A 2YUQA 1VQ5T 4DOVA 3CPWP 1OXJA 1KQ2A 1P92A 5KE3A 3FU6A 4A55A 3CCEQ 5J90A 4F53A 5GMKi 2VGYA 2YNQA 3M0RA 4MS6A 1ZA2B 3CVWA 1YI2T 4J0UA 2K3YA 2MAMA 3C98A 1UHCA 3TWWA 4C92C 1TJCA 3RMQA 4EPZA 1TWBA 4MKTA 4I9EA 3CCQT 1FYNA 4IUUA 2EINE 3OYJA 1VQOQ 2ZPIB 1K8AU 4UI9C 1ACMB 1K1ZA 2EJFA 3NAWA 4A1GA 2DIWA 5DLOA 2C0OA 2DMOA 4BB7A 2F5KA 4NOYA 2LNVA 5GANj 2RQUA 4GYWA 3NTHA 4BI3A 2ZXWE 4A3TA 4MZPA 2MYOA 2CKKA 2XK0A 2RI5A 2XZTG 5GAN6 5CQXA 1W2BP 2RJCA 1BCOA 1WFWA 4ZHBA 1VQMT 3PEUB 4EHMA 4J5YA 3Q78A 1RAIB 3CHSA 4L1BA 2J09A 4O60A 3VTYA 5FWCA 3JYSA 5GMKm 1UFFA 3I56T 1M90C 2BZ8A 3DLLA 5LJ5f 3AHUA 2O4XB 2CG2A 2VASA 4E7LA 1NZNA 3SGHA 3JCMc 2JTMA 5EDSA 1OCRE 2P9PG 2GGRA 1S0PA 1MNEA 4MBGA 3HXDA 4JS4A 3FUFA 1QBQA 4JA7A 1WX6A 4KH1B 1IREB 3REAB 4J9IA 4HCBA 3FH5A 3OYKA 3HVEB 4DJAA 1HJDA 2D0NA 4M78B 3V8JA 3JB9H 2JZ2A 4A1SA 3SD5A 1IHBA 2O2OA 3ASOE 3A8OB 1IQRA 5I21A 3UT1A 3HHMA 3LS8A 4ANVA 3D9HA 1SPKA 3E19A 3CVQA 2IF4A 1D1CA 1X69A 4E85A 4N3BA 2V5QC 2VTBA 2LCCA 4FCYA 3APFA 2X38A 3OBYA 3SWNA 3RDVA 2KDSA 3WG7E 1ZA1B 3CD6Q 1TN6A 4AY6A 2WQHA 1PC0A 1JO8A 3G6EQ 4BE1A 5LP0A 2XPIA 2WMOA 3CCVA 3RR6A 3Q4AB 1MNDA 2XEEA 1UJJA 4XIFA 4GY5A 1H0AA 1HU3A 1PD1A 2D1XA 1KD1C 4PJOD 2JN0A 5ECAA 2RJEA 2P0KA 1RLPC 3KFVA 2XZDG 4LN2A 1K73U 2EQXA 1H92A 5C2YA 4M75E 3B13A 4OMFB 4XI9A 2KT1A 3D9PA 2DTOA 2JNGA 4GTSA 3E4BA 3QDFA 1IGQA 1WZOA 2EYQA 3QB2A 5FU7C 3CXCP 5BXUA 3CC7A 4M7DG 2KROA 2OTLQ 2XGMA 5CEAA 2K9GA 5GAMj 4AXHA 2VGNA 3PEVB 4U0ZA 4C0DB 4GBQA 5CKBA 1N9AA 1QWFA 3VS1A 1Z9QA 4EMGA 2VYIA 2F2WA 3H0IA 1UTIA 4BACA 5HK0A 1ZSZA 3TL5A 1QVPA 2AZVA 5AQAA 3FUMA 2BF0X 1TUGB 3UM1A 2VUBA 3P1UA 4GPMA 1M9SA 1ZUKA 3S7DA 3RKXA 3G2WA 5IY5E 2V4LA 2WXPA 1WA7A 2MK5A 3I55Q 4I2ZA 1T0HA 2Y69E 1MJ0A 4NIKA 2ZPHB 3P2BA 2FZKB 4IURA 3CCST 3RJVA 2DM1A 1X27A 2A5UA 2F2XA 5GAN2 1C6VX 3KUFA 1VQ6Q 2P9UG 3CVVA 3EFOB 1WQWA 4XTWA 3TWSA 5CCAA 2XGOA 2PVGB 3RRNB 2JS0A 2LTOA 5T4YA 4TV3A 1R8OB 5GAMf 1JWGA 2J06A 4DBFA 2WB2A 2XHEA 4KGVB 3M55A 4TXPA 3QG1A 2RD0A 5EN5D 4AFSC 1NLOC 3G2UA 3ZN3A 1HYOA 4FL6A 1WGSA 5ENTD 4I43A 2J05A 2FZGB 3NOGD 3CBOA 1ARKA 4NQ0A 1VUBA 3VS0A 2R17C 2EW3A 3C94A 2DXBA 1OX8A 2D0QB 4G11A 2RQWA 3QIIA 2BUGA 3DSSA 2EYZA 1MX4A 3D9JA 1U3CA 2Z0WA 2AZSA 4CRIA 4A54A 4YDWA 3B7BA 5AQ7A 1VQ8Q 4X8QA 3E30A 1QCNA 4GTOA 3UPVA 1QKXA 2WXMA 3PE3A 3FLGA 4XE0A 4OB3B 5I2SA 2YRCA 3LH0A 1BYMA 3ASGA 5GAMe 1ZHIA 1PC2A 2GRNB 5JHBA 4HVBA 3HRAA 3QJ6A 2RK2A 1BI2A 1QQEA 3G4SA 3TJPA 1OWLA 5D0QD 4DLQA 4A4EA 1KD1U 4PFPA 1G3NB 2IOLA 2AXZA 3MP6A 5FU7B 5CR2A 4HCCA 3GYZA 1KSWA 5IHNA 1VYVA 4O5VA 2FRWA 5IN1A 1XQHA 3BDUA 3TCJA 4ZTJA 3DPDA 3HHTB 4GYYA 4LERA 3Q7AA 2C0MA 2DRMA 2NWMA 4HVWA 5EC7A 3CC7T 1OZ3A 4XQ3A 2A08A 2LJ3A 1SVXA 2FO7A 4G23A 1H2TC 2OTLT 3ENEA 3LW5E 4BDZA 1YI2A 3FH7A 1Q81R 3H9NA 3JCMe 1NYFA 3VKIA 2YWWA 3PZ2A 2DZOA 2JOYA 4J83A 3EHRA 2A28A 2EAYA 2XPYA 3ZNGA 1OV3A 3KBGA 4ME2A 2X3WD 1D0ZA 3IHVA 4FIBA 3JB9F 3DXMG 4M75D 3TREA 3SFXA 3C3QA 2CT3A 4M4ZA 4LUNU 2ROLA 2C06A 1C0MA 2R02A 1DVPA 4OMMA 1VA7A 2QQBA 2QA4T 5KCHA 3HL8A 1RL2A 4QQGA 3OY9A 4MRUA 2VC8A 1K9MR 5CRUA 3HKSA 2LC4A 2MOXA 1YJ9T 3FH8A 1VQ7A 1LF8A 1OPLA 4R56A 1Q7YC 2NLUA 1C1AA 5CIUA 1UGVA 3CBMA 2Y3AA 1Q2ZA 3X20B 2AWIA 4XX5A 1Y96A 4TXRA 4AOFA 1G3TA 4BTAA 5ENSD 1UHFA 2MYSA 3URGA 3L08A 3ONKA 1N8RR 2NXPA 5LJ3j 3BE3A 3SZ7A 4U7EB 4AIFA 1D3BB 3LX7A 4J6XA 4KUIA 2RFMA 2E64A 1NM7A 1FX7A 1E96B 4MLPA 2LJ0A 4AV7A 1WLPB 4HCKA 1AVZC 5DY9A 2CUBA 4BI8B 2R59A 3S7BA 4LE9A 1FWZA 3ASDA 3CC2Q 3OMGA 4ACLA 3VTXA 1UJYA 3D9NA 3CXCA 2ZGWA 3BUAA 1YJWT 4QFVA 2A37A 4I1AA 1DC2A 2IVWA 4N5QA 4ME7A 3Q49B 3ZRHA 4PJOE 3OSSC 1TYQG 5IXBA 2NYJA 5KJLA 1O1TA 1YHQA 1X43A 4IN3B 5BT1A 2LX7A 1SHFA 4DEXA 4U07A 1H6PA 2PM6A 1MV0B 3O8VA 3H0HA 4OVUA 1X5BA 1HO8A 1K3ZD 1N8RC 2EYYA 3DEPA 2DYIA 3EHNA 4M78D 2P9IG 4UI9J 2VTBB 1TXQA 3HFOA 2E65A 2XICA 1FMVA 2RQRA 3CCEA 2X35A 3JXJA 3REBB 4ZGJB 4M7DE 4IKFA 2SRCA 2ABLA 1WHKA 2DL4A 4JXTA 1K73C 2GQVA 5GANf 5A23A 5HQ8A 3CXCS 1I81A 1D09B 4JPSA 2V8IA 1I07A 1SF9A 4WNGA 2HEQA 3Q9UC 5CBNA 3TEEA 2JTFA 4HOUA 2GCXA 2V26A 2EJ9A 2WSCE 1MMGA 4KRTA 2OI3A 3LWHA 4RCBA 4OMLA 1AOJA 4GZDA 1FCHA 2WXLA 3MEWA 5FQ7A 5LOZA 1HD3A 2KNBB 3H8ZA 1IRXA 4KGZB 2CZ1B 1WJRA 3LPZA 2YHTA 4JLIA 3JCKC 2LQKA 3SB2A 3BU8A 1W3BA 4M7CA 4DLOA 2QYJA 2DL3A 2RHYA 4BY6A 1V29B 3ULQA 5IHKA 2KXPC 3ZBDA 3T8KA 4N2SA 4M77C 3FEYA 3PMTA 2ZAEA 4M7AG 3G7ZA 3JUEA 1B07A 4XTUA 1YJ9Q 1MZCA 2NC9A 1MUZA 4U63A 5IXFA 1XOVA 1BI7B 2P84A 4FYYB 4OVVA 1M2VA 4C8QB 5C0MA 3FTSA 2Y4UA 1B34B 3HFNA 3N5BB 2Y4YA 1S64A 2ZISA 1VQ5A 2HBPA 3TAXA 4AEZC 4PFOA 2E12A 5D6YA 4A4KA 1H6OA 2Y4XA 1GL5A 1TJFA 1Y8MA 3FUDA 3FRNA 3UM2A 4GMJA 2K5LA 4C92E 4ELZC 5IAYA 4FLBA 2WXHA 4IUPA 3D9OA 4RLYA 2RG8A 4L2YA 3TWTA 1GBQA 1OU8A 2KZTA 4MDWA 2SEMA 4M75G 5GAOm 4XKBA 2CSIA 3CCJQ 3CCRA 2XRYA 2LDMA 2FEZA 1OUVA 5FWQA 2E0IA 1YJWQ 1IO6A 2JLBA 1ZQ1A 3CCQQ 3UIPC 1N27A 4IIOA 4PJJA 3EG2A 3O5ZA 4XKCA 2LQWA 1VQPQ 3CC4A 2AW6A 3I35A 3CCVQ 3I5SA 3JCMg 3HRUA 2YLBA 2P9SG 2GNCA 4RG6A 3CK8A 1KQ1A 4GTVA 1MMNA 3VRYA 1H641 1N52A 5JA4D 1WG0A 4CC7A 2AT1B 1JWFA 2ZCFB 1VQMA 5LJ3e 2HR2A 4F17A 3PNTB 3ABLE 1OZ2A 4GZ3A 3PH0C 1NJIU 3QARA 1B89A 4N0AA 2WXJA 3J81E 1TU0B 2ZGDA 5KWDA 3I56Q 4PJOA 3CC2A 1SA5A 2EKHA 2EWNA 1P5QA 1KC8C 2OV8A 3CCUQ 1JQQA 3OS0A 3V7CA 2A7YA 4L9PA 3S3MA 2L8DA 2QFCA 3GPLA 1HE8A 4Y6WA 2HCKA 1T3LA 5CKHA 1NLPC 3ASKA 1SA4A 4J8SA 4UWLA 1KC8U 5KYXA 2WMNA 4OB2B 2XI9A 1SEMA 2CP3A 4WUYA 2P9LG 3JAME 4EIKA 3V7SA 3CCMQ 3FU0A 2JTEA 3LEWA 2A3LA 3I3NA 2PL2A 1Y07A 4G26A 4L6V5 3JV3A 2XD0A 1ELRA 2RJFA 3INZA 1JPLA 4FA6A 1TOVA 3V79K 5KJKA 1VIFA 4JJNK 1M1KU 4G25A 2EGCA 2LCLA 3G6ET 3ASHA 4HORA 1VQ7T 3OYEA 1LJOA 2YUPA 2V1RA 2OTJA 3U3WA 3QJYA 3CHPA 3CIAA 2KK4A 3HDXA 1OWOA 3CVUA 1VYTA 4C8QA 3L2WA 2UWJG 2VGMA 3QPHA 1VQKT 2CZ0B 3CK7A 2PVDB 4Z02A 2ZIRA 1AT1B 1EIFA 4XI0A 3QXEB 1IXDA 2H6IA 4GCNA 1JXOA 2L6BA 3RBBB 1JRIA 4JJBA 2RH2A 4DX1A 2DL5A 5FU6B 3FU5A 4E7HA 1YITT 4AFQC 4LUEA 2LX9A 4HOQA 5GANh 4B94A 5JJ6A 5KJNA 2BTTA 2VSXE 4O1OA 4KMOA 3ZYMA 3F6QA 3C72A 4GTMA 1VDYA 4KULA 3EH2A 4E2FB 1NEGA 2E70A 4UC4A 4CT0A 3L2VA 4ZNXA 4KGXB 5FQ4A 4CCAA 2XCBA 3D9KA 3SD4A 2YSQA 2CG3A 5KYWA 2FI7A 1AEYA 1EYHA 3TSWA 4C92D 2GF7A 1RAFB 2LRQA 3A8HB 4HS2A 2VSYA 1N4SA 4MMLA 1OI1A 2XS1A 2HL5C 2XENA 2EILE 4DBRA 3V2OA 1K0XA 1E7OA 4QVCA 3QSUA 5GAMh 1O9SA 3HP9A 4GMLA 4ANWA 2I1JA 2DZ9A 3X26B 4QQDA 4DBHA 3OXFA 4FW1A 1VQ9Q 4ZFHA 3SFZA 1GCQC 1QVFA 2BEDA 2HL3A 3CVLA 1X6OA 3UQ3A 3F70A 3TVTA 3PZ3A 2WXFA 2J6FA 4ATOA 5ITZF 4U96D 4RTUA 4G24A 2EIKE 2CH4W 1I1JA 2VXFA 4M7AF 1OPKA 4Y91A 3FY4A 1Q86R 4C8QG 3ZYQA 4B93B 2RJDA 2RFAA 4F1PA 3FDRA 4DA4A 3NTKA 3AS8A 1KJWA 2XRZA 2LAIA 1M2OA 2M0YA 5A7DB 5KYXB 2MHKA 3PVQA 3OW2A 1Q82R 3QC1A 3CMAA 4RSYA 3CVYA 3ME9A 3U64A 5FW9A 3JSCA 2IJGX 1XGWA 3EU5A 1WYXA 4XU0A 4FW2A 2AHJB 1OCZE 4Q5WA 3SDZA 2R58A 5ENNA 1ZX6A 3H6ZA 5IHIA 3PZ1A 3KXTA 2LT4A 2WXRA 3CQGB 2RMOA 2O9SA 3ML9A 2EKOA 4FADA 1G3WA 3EDTB 2PVOB 1KQSP 3GOXA 1MX2A 5FU6C 1YJNQ 4G8KA 2YRVA 2DE0X 4F7UA 5G04J 4AFZC 1XNFA 5KBAA 3CC7Q 3BDLA 1FVFA 2RI2A 4ZN1A 2H3JA 1ZUYA 1YA0A 3PZDA 2LNIA 1BBZA 1JUQA 3EIJA 3DSTA 3E9FA 4KUDK 2QGFB 1Y7XA 2I9CA 4FYVB 3CMEA 3CVPA 2IPOB 3V8KA 3FB9A 1PCXA 3OYDA 1M3BA 2DXUA 3J80E 4GTRA 3L9TA 3LKUA 5GANd 1TN8A 2L9BA 2F69A 3L2QA 4HCZA 3M54A 3C3OA 4ATZD 3QWXX 4Z68A 5BPPA 3QYHB 2L3RA 1NE8A 3KEAA 3SBTB 2DRKA 2LCSA 3X24B 2KVQG 4RTTA 2RK1A 2IFUA 3VUZA 3TWRA 1X2QA 2R2LA 5EX3A 1QZ2A 3GZSA 2K3BA 4C8QF 3VLDA 3FUJA 3PE4A 1KFZA 2O4XA 4UQYA 4A63B 4L23A 2V4HC 1X81A 4LNBA 2L5QA 4JRIA 2I0NA 4PFZA 3RSEG 2OOEA 1GW6A 2D6FA 1JEGA 2XHCA 1NA0A 5AQBA 2H8HA 3VS5A 3LCAA 9ATCB 2HDAA 2KRNA 2CP6A 2P0QA 4EMKC 3J7AF 4XK8E 3M57A 2VWFA 5EYLA 5ARGA 3JCMQ 4O6FA 4APOA 2PUKB 3IKOB 2RF0A 4EMHA 1AP7A 2KCKA 3GP8A 3D7SB 5HKPA 1RAAB 1RAGB 1JJ2S 1VQNQ 3FEOA 1QMCA 2V1QA 2YUOA 2VJ8A 3T8MA 3L82A 5KJMA 2DPPB 5AN8A 5HK3A 1DCQA 4GZ5A 4DI4A 3CVXA 3PMIA 5LJ5d 3FJ5A 3Q1JA 1Y57A 3OXGA 2UY1B 1FVHA 3TG5A 2FPEA 4GYOA 4WNFA 3CV0A 4RTYA 3CHMA 2XIDA 2EQJA 1PKSA 4A3VA 2KRMA 5D7UA 5FLXE 2DEQA 3EGDB 5A6CA 1WY6A 3VS7A 1H19A 3CPWS 3CCSA 4CC3A 2ROTA 3AG2E 4N4HA 2FHDA 1Q86C 1V54E 4LRZA 1FMWA 1K9AA 4HI9A 1TH7A 4L59A 2DAQA 5DBKA 4D6WA 1Q7YU 1SZAA 1EX4A 2FPDA 3OYAA 3PE0A 1ELKA 4DOWA 2J4BA 3MJWA 4L2LA 2KXCA 3M0UA 4DQ2A 2OAWA 3PNLB 2F1LA 4I17A 1MMAA 2DJQA 4N4GA 3AJIA 4RG9A 1JXMA 2YRDA 4LG6A 5G05C 2M16A 4JVSA 3SHFA 2L2PA 2R5MA 1QVGP 1TNZA 4C0EA 1IKND 3LYIA 3AU4A 2J49A 2QEXQ 1K9MC 4Q94A 2DBKA 4BWRA 3JCMf 1Q82C 2C0TA 4KVMA 4BT8A 5GMKe 2JJ9A 5AYWD 3T9KA 5KNGA 4F7UE 3ULEG 2KXDA 2F0YA 5BUZA 1D1BA 2DILA 2CHZA 3DWLG 1UE9A 1OWNA 2GRRB 4Z88A 4P29A 3NTIA 4O6JA 1UGPB 3TWUA 2K6DA 2E3HA 3MYVA 3B7UX 3LVQE 4JW1A 5J08A 3FIFA 2QAZA 2CP2A 4LDWA 3UATA 1YJNA 3FFLA 3CBPA 5FZRA 2V8JA 1S72T 1WXUA 3RMSA 4C0MA 2FZCB 4M7DA 2COYA 3UUXA 3W9FA 3D9LA 1Q81C 3IHYA 3M59A 4J9GA 3ESLA 2XKOC 1HG5A 3SHWA 5FRNA 3E37A 2I6HA 2GGFA 3RESA 3NB2A 2CSQA 5HRYA 2F2VA 3M0SA 1SZ9A 3E32A 3R7RA 4XTZA 3EG3A 3X25B 4N39A 1S1NA 2DVJA 3NZUA 5JJ7A 3VS4A 3OYYA 3D3MA 4GU5A 1HX8A 3TG4A 5M9OA 1VQLT 2E41A 3U66A 3HIZA 1IGUA 2WSEE 1GFCA 4OB1B 1Z3XA 3HVEA 2K57A 4FT4A 3E2UA 1TEZA 1K1AA 3DSXA 2K5IA 1D9SA 4PJOC 5CRVA 3G71A 2HMAA 1BI3A 2JMCA 3M0QA 1Y0MA 3MEAA 1PSFA 1ZUUA 4OMOA 3UDCA 2EGEA 5LJ5g 4B89A 4E7KA 3IQLA 1E6GA 4HT8A 1PKTA 3GNFB 3P8BB 3DKMA 3V2XA 3FC3A 2CP0A 2DVWA 4ANXA 1TUCA 3CC4T 5GJWB 5G04C 3V7RA 4HXJA 3OS1A 2JMAA 1NFIE 3P8DA 5A0LA 4YDOA 1AWXA 4WNEA 1QQJA 4UQZA 4FU3A 1GBRA 4YNDA 3JCMb 3E34A 4KZ0A 1PG5B 4X9DA 1VQPA 4F04B 4GTPA 2BZXA 4X9CA 3UA7A 4XTXA 2KEAA 3JCMP 4QQ6A 5M72A 4H7YA 2GFAA 3MPUB 4P5NA 5D66A 3L17A 4II1A 5IT9E 2ATCB 2X51A 1ZSGA 2AIRB 1S63A 4PLIA 2MMPA 4MZMA 4AVXA 3CK9A 2DD4A 5AENA 3M56A 3DRAA 4HVVA 4M78C 2DLPA 4UWFA 2KM4A 1E7VA 3T5VA 1QNFA 4Y6CA 2C0IA 4GB9A 2YT6A 3Q47B 2GRQB 3VS3A 3ER0A 3R9AB 1UG3A 1R77A 4HOSA 2M51A 4HLLA 2ZGGA 1VQ4T 4AP2A 4HRNA 5EIDA 2X9HA 3SEMA 1W2BS 3FTYA 2X4YA 4JHKA 2NUPB 4FYWB 2AXUA 1JBMA 2H6FA 3FTUA 3MGBA 3CCMT 3X28B 3OYCA 3MP8A 1K8AR 3RKWA 2XGSA 3S7FA 3U4TA 5AYFA 2YLCA 4XEIG 2CYZB 2YQ8A 1M3AA 2RQVA 4PUCA 3AU5A 2OEWA 4FC8A 5E76A 1NYGA 8AT1B 3U9WA 1E8WA 2C2LA 4CZ2D 1VQ7Q 4BY6C 4X1VA 4X34A 2FVUA 3EG9B 2YHEA 2IG0A 2R5AA 1Y6IA 3LJ3A 4RG2A 3FTWA 4HI8A 3MEVA 1YMPA 4N2QA 3HXCA 1H3HA 1BI1A 2RB6A 4RTVA 4E6HA 1SRLA 5EILA 1AHJB 4FT2A 4N3AA 1HFAA 3UKRG 1TUDA 1ABOA 4AG1C 3CCET 2PUOB 3ZHEA 1UG1A 3ISMC 2NUZA 2DETA 1R0CB 4W9RA 2XMFA 4KXKB 1ZBPA 3G71T 2GRLA 3OYFA 5CQYA 3OQ5A 1W4SA 2OTLA 1RLQC 2XDBA 2L3PA 1ZSZC 5GAMg 4GA1A 1D0XA 3PRZA 3IV0A 2NSZA 3EFRA 3L22A 4M3OA 3IXEA 1W70A 2DD5A 3CEQA 3CHOA 4KBQA 3ZVVA 1VQOA 1OYXA 4CYMD 4B9XA 4IUVA 3I55A 5IH2A 3ZIMA 2FEIA 1QVFP 1VOMA 4J8OA 1M90U 1O1SA 3X2QE 1SG5A 3GNGA 4M78E 4NS5A 3FDHA 2RQTA 5AAOA 4YDYA 3T9NA 4M7AA 1A17A 3R7QA 4M7DD 1SRMA 4M7AD 4BDYA 3T5XA 5D2MC 3OS2A 4OB0B 4M75C 5C6SA 2AK5A 4EPCA 2DXCA 3ZU7B 4J7IA 4RTXA 2DBAA 1N9SA 3DLMA 1K73R 1AWWA 2CUDA 3M58A 2VGXA 3FUNA 2HQEA 3C3RA 2L0TB 1HXDA 4HB5A 4F14A 2HD0A 2FRYA 2V8SE 4NRHB 4TUUA 1D0YA 3EGUA 1D1AA 4C5HA 4U95D
chains in the Genus database with same CATH topology
1U3OA 2MYOA 2XZTG 1BK2A 2CT4A 1JXOA 1WFWA 4ZHBA 2L6BA 3RBBB 1BU1A 5AARA 4JJBA 4DX1A 2DL5A 2ECZA 1WDXA 4O60A 5FWCA 4D8DA 4JJDA 4BEPA 1OOTA 1UFFA 4LUEA 4AFQC 2HBWA 1QYMA 2BZ8A 2BTTA 4BERA 3THKA 1M8MA 4O1OA 2YUNA 1CKAA 3F6QA 3EHQA 2QC9A 2FO0A 2GGRA 3UI2A 1OY3D 1YN8A 1WX6A 4E6RA 1NEGA 3REAB 4J9IA 4LUDA 4ZNXA 4OAUC 3CQTA 5JMND 1YWOA 1HJDA 2YSQA 2D0NA 4BESA 1AEYA 1J3TA 3TSWA 2EGAA 3VS2A 1ZLMA 1OEBA 3EG1A 1IHBA 2O2OA 2B86A 3VRZA 2XENA 3D9HA 1SPKA 2JABA 2HSPA 3V2OA 1X69A 1K0XA 2V5QC 1E7OA 4J9EA 4J9CA 2BKGA 2B0OE 1JO8A 3DEOA 4AG2C 4ZFHA 1RUWA 4QQIA 1GCQC 3V31A 2XEEA 4UUCA 4D8KA 1X2KA 3TVTA 2D1XA 4R0KA 5ECAA 4U8VD 1WXBA 1N5ZA 1BU9A 5ITZF 4U96D 2XZDG 1RLPC 2J6FA 2PNIA 3KFVA 4FSSA 4LN2A 3W9GA 4RTUA 2CH4W 1H92A 1I1JA 1OPKA 2ETBA 2KT1A 4J9DA 4B93B 2RFAA 4F1PA 3A98A 2EQIA 4K5AB 4K5BA 5BXUA 3VS6A 1KJWA 1UJ0A 4CC2A 2KROA 2M0YA 5CEAA 2K9GA 1AWOA 1WDYA 3PVQA 3Q9NC 2CH4A 4GBQA 1I0CA 1QWFA 4LNPA 1Z9QA 5FW9A 3VS1A 2IIMA 2F2WA 3H0IA 1UTIA 3JXIA 4DUIA 2OJ2A 1WYXA 5AQAA 2AZVA 2EBPA 4DX5D 4GPMA 1ZUKA 2DX1A 1ZX6A 3TWXA 1WA7A 2D8JA 2LQNA 5IHIA 2KE9A 1T0HA 1MJ0A 2DZNA 4HVUA 3UTMA 4NIKA 2O9VA 2RMOA 2O9SA 2JM8A 4F16A 2DM1A 1X27A 2J8SD 2L3SA 1MX2A 1UOHA 2F2XA 4G8KA 2CREA 1G83A 1E6HA 2DE0X 2KR3A 4AFZC 4HNAD 2JT4A 5KBAA 3TWSA 1T3SA 1WI7A 3TSZA 1ZUYA 1MV3A 1BBZA 2JS0A 2FPFA 4OAVB 2YDLA 3UA6A 2J06A 2J6KA 4RUGA 1BB9A 2GTJA 5FIOA 1M3BA 1PRLC 5EN5D 4AFSC 1NLOC 3ZUVB 1X6BA 2K7AA 5ENTD 4ATZD 5CEDB 2J05A 1PWTA 3NOGD 1ARKA 1YCSB 3NGPA 4HBDA 4Z68A 2A36A 3QWXX 3VS0A 2EW3A 3KEAA 2LCSA 2DRKA 2XEHA 1YWPA 4RTTA 2RQWA 3TWRA 1X2QA 2EYZA 1K4US 1MX4A 1AWJA 5ENQD 1GCPA 1W6XA 2K3BA 2KGTA 2AZSA 1KFZA 4A63B 5CERB 2V4HC 3HG0D 4YDWA 2KYBA 3B7BA 5AQ7A 1NEBA 2ED1A 2I0NA 1QKXA 1JEGA 3I9QA 5AQBA 2H8HA 3VS5A 1GFDA 4AFUC 1BD8A 1WIEA 2HDAA 2DWZA 2K79A 5I11A 3HRAA 2KRNA 4JJCA 4IIMA 4DX7D 2VVKA 1G3NB 4C48B 2VWFA 1MX6A 5EYLA 1KSWA 1QCFA 5IHNA 2A5EA 1VYVA 2FRWA 3LH5A 2FG0A 2RF0A 1CKBA 1AP7A 1U5SA 4HRMB 2HE0A 5HKPA 2DRMA 2NWMA 1U06A 2RNAA 4HVWA 5EC7A 2V1QA 2YUOA 5L23A 2A08A 2LJ3A 1SVXA 1AD5A 5FWBA 1AZGB 3TWVA 5AN8A 1X6GA 3M0TA 1DCQA 2ETCA 1M3CA 2D8HA 3J5PA 1GRIA 3FJ5A 1Y57A 2FPEA 1GCQA 4RTYA 2JS2A 1NYFA 4OMQA 2DZOA 1PKSA 1OT8A 3EHRA 4GMRA 2A28A 2KRMA 2QDLA 3VS7A 3ZNGA 5CBOA 1OV3A 4CC3A 2ROTA 2X3WD 1K9AA 4HI9A 3C0CA 2CT3A 1SW6A 2ROLA 4M4ZA 2FO1E 2Y1LE 2E5KA 4WCIA 2F8YA 1A0NB 1Z9ZA 4OMMA 1VA7A 4Y92A 1PNJA 2FPDA 3PE0A 2AKLA 2KXCA 3M0UA 2MOXA 2OAWA 1OPLA 2DJQA 1K0SA 3AJIA 1JXMA 4LG6A 1H8KA 2L2PA 4TUMA 1UGVA 1IKND 2LJ1A 3J5QB 2DBKA 2Y0BG 1UDLA 4BETA 2ETAA 5ENSD 1UHFA 2C0TA 1V1CA 4ORZA 3NPFA 4LSZE 3T9KA 5KNGA 5HS0A 3M0PA 2KXDA 4F6RD 5I22A 5ENPD 2DILA 3RNJA 2RFMA 2GQIA 1UE9A 4G8LA 2ESWA 2P4RA 1NM7A 4J9HA 4Z88A 2LJ0A 1WLPB 3GBQA 3TWUA 4HCKA 1AVZC 1SHGA 2ED0A 2K6DA 2CUBA 4JPBW 1LCKA 3ZL7C 2KBXA 3UATA 4LE9A 2MIOA 1WXUA 2DL8A 1G2BA 2ENMA 1UJYA 4U8YD 3R6NA 3W9FA 5HCKA 2PNNA 4J9GA 4QFVA 2A37A 3QWYA 1SSHA 1YNZA 3NMZC 2DL7A 1DC2A 4OMPA 3SHWA 1AZEA 4N5QA 5EIBE 2CSQA 5HRYA 2F2VA 5ENOD 5CECB 4RTZA 1S70B 4K5CA 3M0SA 5IXBA 2PTKA 2NYJA 2L0AA 2LNHB 3EG3A 1X43A 2LX7A 2EYWA 1S1NA 1SHFA 2DVJA 4DEXA 3VS4A 1MV0B 2EYXA 3H0HA 2EVRA 1MYOA 1K3ZD 2GBQA 1GFCA 2EYYA 3DEPA 2KBTA 3PVLA 1K1AA 3B95A 2RQRA 3REBB 3JXJA 1FMKA 1A5EA 1D9SA 4ESRA 2SRCA 2JMCA 3M0QA 1Y0MA 2ABLA 4OMOA 1ZUUA 5GJVB 1KIKA 2EGEA 2DL4A 2BKKB 1UUEA 1E6GA 3IQLA 3LJNA 1PKTA 2JW4A 3V2XA 2DVWA 3H41A 1I07A 1QLYA 1TUCA 2HEQA 3Q9UC 4BSZB 5CBNA 2L3QA 4HXJA 5GJWB 4KRTA 4Z89A 2JMAA 4JZ4A 2OI3A 2VKNA 3UF4A 4OMLA 1AOJA 2JXBA 1NFIE 1EFNA 1AWXA 1HD3A 2KNBB 1IXVA 3H0FA 1HSQA 1GBRA 3SO8A 2K2MA 4OMNA 2G6FX 2QYJA 1ABQA 1N0QA 1K76A 2BZXA 2DL3A 4O1PA 5IHKA 1RI9A 2KXPC 3T8KA 3UA7A 4DRXE 2KEAA 4DX6D 1K1BA 3NBNB 3JUEA 2EPDA 1B07A 4HQDA 1NG2A 3EG0A 1MUZA 5D66A 1UECA 2J6OA 4DEYA 5IXFA 1XOVA 1ZSGA 2DF6A 1BI7B 2DBMA 2JM9A 1AWCB 4HVVA 3ZKJA 2DLPA 2C0IA 2YT6A 3VS3A 4DX2A 3TWQA 2M51A 4HLLA 2ZGGA 2LZ6B 1M30A 1JU5C 4HRNA 1GL5A 5EIDA 3SEMA 1YP5A 4JZ3A 5ENRD 2AJAA 3TWTA 4RLYA 1GBQA 4K11A 2VGEA 5EYPF 2KRSA 1M3AA 2RQVA 2CDTA 2DYBA 2F8XK 2SEMA 2CSIA 1NYGA 1WXTA 1BI8B 2W0ZA 4JB8P 1IO6A 4CZ2D 5BXOA 2DNUA 2X3XD 4X1VA 3C5RA 1QKWA 4IIOA 3ULRB 3EG2A 1N0RA 5AQ9A 2KT8A 4LNUD 2LQWA 3V30A 3O5ZA 4GLMA 3I35A 2RN8A 3I5SA 4HI8A 1YMPA 2GNCA 4CC4B 1H3HA 2BZYA 4RTVA 1SRLA 3VRYA 4J7WA 5JA4D 1PRMC 5EILA 2P2CP 1WG0A 4CC7A 1TR4A 1TUDA 1ABOA 4AG1C 4F17A 4QT7A 4J9BA 2J7IA 1UG1A 2NUZA 2O88A 5KNHD 2XMFA 1M27C 1BLXB 2KYMA 1B3QA 4Z8AA 2ZGDA 1N11A 5KWDA 1RLQC 1W1FA 2L3PA 1ZBJA 2O31A 2PZ1A 4HRLA 4J8YA 1T0JA 2EKHA 2RPNA 3UXGA 5FINA 3IXEA 1W70A 1JQQA 1QWEA 3U23A 3NOCD 2DA9A 3I5RA 2LMJA 4CYMD 2HCKA 1T3LA 3NHNA 2FEIA 1NLPC 5IH2A 2AKKA 2LP5A 3EU9A 2YUQA 1SEMA 3AAAC 2RQTA 5AAOA 4YDYA 2GTOA 2MCNA 4J9FA 1CSKA 4EIKA 3M0RA 1SRMA 2JTEA 2AK5A 3ZU7B 3JV3A 4RTXA 1UHCA 3TWWA 1AWWA 3V79K 2CUDA 1VYUA 2EGCA 2F37A 1YYHA 1FYNA 2W10A 2YUPA 1PHTA 2V1RA 4HB5A 1K1ZA 4F14A 2FRYA 1TG0A 2C0OA 2DMOA 4RTWA 3EGUA 1VYTA 4U95D 2RQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3O A;  2MYO A;  2XZT G;  1BK2 A;  2CT4 A;  1JXO A;  1WFW A;  4ZHB A;  2L6B A;  3RBB B;  1BU1 A;  5AAR A;  4JJB A;  4DX1 A;  2DL5 A;  2ECZ A;  1WDX A;  4O60 A;  5FWC A;  4D8D A;  4JJD A;  4BEP A;  1OOT A;  1UFF A;  4LUE A;  4AFQ C;  2HBW A;  1QYM A;  2BZ8 A;  2BTT A;  4BER A;  3THK A;  1M8M A;  4O1O A;  2YUN A;  1CKA A;  3F6Q A;  3EHQ A;  2QC9 A;  2FO0 A;  2GGR A;  3UI2 A;  1OY3 D;  1YN8 A;  1WX6 A;  4E6R A;  1NEG A;  3REA B;  4J9I A;  4LUD A;  4ZNX A;  4OAU C;  3CQT A;  5JMN D;  1YWO A;  1HJD A;  2YSQ A;  2D0N A;  4BES A;  1AEY A;  1J3T A;  3TSW A;  2EGA A;  3VS2 A;  1ZLM A;  1OEB A;  3EG1 A;  1IHB A;  2O2O A;  2B86 A;  3VRZ A;  2XEN A;  3D9H A;  1SPK A;  2JAB A;  2HSP A;  3V2O A;  1X69 A;  1K0X A;  2V5Q C;  1E7O A;  4J9E A;  4J9C A;  2BKG A;  2B0O E;  1JO8 A;  3DEO A;  4AG2 C;  4ZFH A;  1RUW A;  4QQI A;  1GCQ C;  3V31 A;  2XEE A;  4UUC A;  4D8K A;  1X2K A;  3TVT A;  2D1X A;  4R0K A;  5ECA A;  4U8V D;  1WXB A;  1N5Z A;  1BU9 A;  5ITZ F;  4U96 D;  2XZD G;  1RLP C;  2J6F A;  2PNI A;  3KFV A;  4FSS A;  4LN2 A;  3W9G A;  4RTU A;  2CH4 W;  1H92 A;  1I1J A;  1OPK A;  2ETB A;  2KT1 A;  4J9D A;  4B93 B;  2RFA A;  4F1P A;  3A98 A;  2EQI A;  4K5A B;  4K5B A;  5BXU A;  3VS6 A;  1KJW A;  1UJ0 A;  4CC2 A;  2KRO A;  2M0Y A;  5CEA A;  2K9G A;  1AWO A;  1WDY A;  3PVQ A;  3Q9N C;  2CH4 A;  4GBQ A;  1I0C A;  1QWF A;  4LNP A;  1Z9Q A;  5FW9 A;  3VS1 A;  2IIM A;  2F2W A;  3H0I A;  1UTI A;  3JXI A;  4DUI A;  2OJ2 A;  1WYX A;  5AQA A;  2AZV A;  2EBP A;  4DX5 D;  4GPM A;  1ZUK A;  2DX1 A;  1ZX6 A;  3TWX A;  1WA7 A;  2D8J A;  2LQN A;  5IHI A;  2KE9 A;  1T0H A;  1MJ0 A;  2DZN A;  4HVU A;  3UTM A;  4NIK A;  2O9V A;  2RMO A;  2O9S A;  2JM8 A;  4F16 A;  2DM1 A;  1X27 A;  2J8S D;  2L3S A;  1MX2 A;  1UOH A;  2F2X A;  4G8K A;  2CRE A;  1G83 A;  1E6H A;  2DE0 X;  2KR3 A;  4AFZ C;  4HNA D;  2JT4 A;  5KBA A;  3TWS A;  1T3S A;  1WI7 A;  3TSZ A;  1ZUY A;  1MV3 A;  1BBZ A;  2JS0 A;  2FPF A;  4OAV B;  2YDL A;  3UA6 A;  2J06 A;  2J6K A;  4RUG A;  1BB9 A;  2GTJ A;  5FIO A;  1M3B A;  1PRL C;  5EN5 D;  4AFS C;  1NLO C;  3ZUV B;  1X6B A;  2K7A A;  5ENT D;  4ATZ D;  5CED B;  2J05 A;  1PWT A;  3NOG D;  1ARK A;  1YCS B;  3NGP A;  4HBD A;  4Z68 A;  2A36 A;  3QWX X;  3VS0 A;  2EW3 A;  3KEA A;  2LCS A;  2DRK A;  2XEH A;  1YWP A;  4RTT A;  2RQW A;  3TWR A;  1X2Q A;  2EYZ A;  1K4U S;  1MX4 A;  1AWJ A;  5ENQ D;  1GCP A;  1W6X A;  2K3B A;  2KGT A;  2AZS A;  1KFZ A;  4A63 B;  5CER B;  2V4H C;  3HG0 D;  4YDW A;  2KYB A;  3B7B A;  5AQ7 A;  1NEB A;  2ED1 A;  2I0N A;  1QKX A;  1JEG A;  3I9Q A;  5AQB A;  2H8H A;  3VS5 A;  1GFD A;  4AFU C;  1BD8 A;  1WIE A;  2HDA A;  2DWZ A;  2K79 A;  5I11 A;  3HRA A;  2KRN A;  4JJC A;  4IIM A;  4DX7 D;  2VVK A;  1G3N B;  4C48 B;  2VWF A;  1MX6 A;  5EYL A;  1KSW A;  1QCF A;  5IHN A;  2A5E A;  1VYV A;  2FRW A;  3LH5 A;  2FG0 A;  2RF0 A;  1CKB A;  1AP7 A;  1U5S A;  4HRM B;  2HE0 A;  5HKP A;  2DRM A;  2NWM A;  1U06 A;  2RNA A;  4HVW A;  5EC7 A;  2V1Q A;  2YUO A;  5L23 A;  2A08 A;  2LJ3 A;  1SVX A;  1AD5 A;  5FWB A;  1AZG B;  3TWV A;  5AN8 A;  1X6G A;  3M0T A;  1DCQ A;  2ETC A;  1M3C A;  2D8H A;  3J5P A;  1GRI A;  3FJ5 A;  1Y57 A;  2FPE A;  1GCQ A;  4RTY A;  2JS2 A;  1NYF A;  4OMQ A;  2DZO A;  1PKS A;  1OT8 A;  3EHR A;  4GMR A;  2A28 A;  2KRM A;  2QDL A;  3VS7 A;  3ZNG A;  5CBO A;  1OV3 A;  4CC3 A;  2ROT A;  2X3W D;  1K9A A;  4HI9 A;  3C0C A;  2CT3 A;  1SW6 A;  2ROL A;  4M4Z A;  2FO1 E;  2Y1L E;  2E5K A;  4WCI A;  2F8Y A;  1A0N B;  1Z9Z A;  4OMM A;  1VA7 A;  4Y92 A;  1PNJ A;  2FPD A;  3PE0 A;  2AKL A;  2KXC A;  3M0U A;  2MOX A;  2OAW A;  1OPL A;  2DJQ A;  1K0S A;  3AJI A;  1JXM A;  4LG6 A;  1H8K A;  2L2P A;  4TUM A;  1UGV A;  1IKN D;  2LJ1 A;  3J5Q B;  2DBK A;  2Y0B G;  1UDL A;  4BET A;  2ETA A;  5ENS D;  1UHF A;  2C0T A;  1V1C A;  4ORZ A;  3NPF A;  4LSZ E;  3T9K A;  5KNG A;  5HS0 A;  3M0P A;  2KXD A;  4F6R D;  5I22 A;  5ENP D;  2DIL A;  3RNJ A;  2RFM A;  2GQI A;  1UE9 A;  4G8L A;  2ESW A;  2P4R A;  1NM7 A;  4J9H A;  4Z88 A;  2LJ0 A;  1WLP B;  3GBQ A;  3TWU A;  4HCK A;  1AVZ C;  1SHG A;  2ED0 A;  2K6D A;  2CUB A;  4JPB W;  1LCK A;  3ZL7 C;  2KBX A;  3UAT A;  4LE9 A;  2MIO A;  1WXU A;  2DL8 A;  1G2B A;  2ENM A;  1UJY A;  4U8Y D;  3R6N A;  3W9F A;  5HCK A;  2PNN A;  4J9G A;  4QFV A;  2A37 A;  3QWY A;  1SSH A;  1YNZ A;  3NMZ C;  2DL7 A;  1DC2 A;  4OMP A;  3SHW A;  1AZE A;  4N5Q A;  5EIB E;  2CSQ A;  5HRY A;  2F2V A;  5ENO D;  5CEC B;  4RTZ A;  1S70 B;  4K5C A;  3M0S A;  5IXB A;  2PTK A;  2NYJ A;  2L0A A;  2LNH B;  3EG3 A;  1X43 A;  2LX7 A;  2EYW A;  1S1N A;  1SHF A;  2DVJ A;  4DEX A;  3VS4 A;  1MV0 B;  2EYX A;  3H0H A;  2EVR A;  1MYO A;  1K3Z D;  2GBQ A;  1GFC A;  2EYY A;  3DEP A;  2KBT A;  3PVL A;  1K1A A;  3B95 A;  2RQR A;  3REB B;  3JXJ A;  1FMK A;  1A5E A;  1D9S A;  4ESR A;  2SRC A;  2JMC A;  3M0Q A;  1Y0M A;  2ABL A;  4OMO A;  1ZUU A;  5GJV B;  1KIK A;  2EGE A;  2DL4 A;  2BKK B;  1UUE A;  1E6G A;  3IQL A;  3LJN A;  1PKT A;  2JW4 A;  3V2X A;  2DVW A;  3H41 A;  1I07 A;  1QLY A;  1TUC A;  2HEQ A;  3Q9U C;  4BSZ B;  5CBN A;  2L3Q A;  4HXJ A;  5GJW B;  4KRT A;  4Z89 A;  2JMA A;  4JZ4 A;  2OI3 A;  2VKN A;  3UF4 A;  4OML A;  1AOJ A;  2JXB A;  1NFI E;  1EFN A;  1AWX A;  1HD3 A;  2KNB B;  1IXV A;  3H0F A;  1HSQ A;  1GBR A;  3SO8 A;  2K2M A;  4OMN A;  2G6F X;  2QYJ A;  1ABQ A;  1N0Q A;  1K76 A;  2BZX A;  2DL3 A;  4O1P A;  5IHK A;  1RI9 A;  2KXP C;  3T8K A;  3UA7 A;  4DRX E;  2KEA A;  4DX6 D;  1K1B A;  3NBN B;  3JUE A;  2EPD A;  1B07 A;  4HQD A;  1NG2 A;  3EG0 A;  1MUZ A;  5D66 A;  1UEC A;  2J6O A;  4DEY A;  5IXF A;  1XOV A;  1ZSG A;  2DF6 A;  1BI7 B;  2DBM A;  2JM9 A;  1AWC B;  4HVV A;  3ZKJ A;  2DLP A;  2C0I A;  2YT6 A;  3VS3 A;  4DX2 A;  3TWQ A;  2M51 A;  4HLL A;  2ZGG A;  2LZ6 B;  1M30 A;  1JU5 C;  4HRN A;  1GL5 A;  5EID A;  3SEM A;  1YP5 A;  4JZ3 A;  5ENR D;  2AJA A;  3TWT A;  4RLY A;  1GBQ A;  4K11 A;  2VGE A;  5EYP F;  2KRS A;  1M3A A;  2RQV A;  2CDT A;  2DYB A;  2F8X K;  2SEM A;  2CSI A;  1NYG A;  1WXT A;  1BI8 B;  2W0Z A;  4JB8 P;  1IO6 A;  4CZ2 D;  5BXO A;  2DNU A;  2X3X D;  4X1V A;  3C5R A;  1QKW A;  4IIO A;  3ULR B;  3EG2 A;  1N0R A;  5AQ9 A;  2KT8 A;  4LNU D;  2LQW A;  3V30 A;  3O5Z A;  4GLM A;  3I35 A;  2RN8 A;  3I5S A;  4HI8 A;  1YMP A;  2GNC A;  4CC4 B;  1H3H A;  2BZY A;  4RTV A;  1SRL A;  3VRY A;  4J7W A;  5JA4 D;  1PRM C;  5EIL A;  2P2C P;  1WG0 A;  4CC7 A;  1TR4 A;  1TUD A;  1ABO A;  4AG1 C;  4F17 A;  4QT7 A;  4J9B A;  2J7I A;  1UG1 A;  2NUZ A;  2O88 A;  5KNH D;  2XMF A;  1M27 C;  1BLX B;  2KYM A;  1B3Q A;  4Z8A A;  2ZGD A;  1N11 A;  5KWD A;  1RLQ C;  1W1F A;  2L3P A;  1ZBJ A;  2O31 A;  2PZ1 A;  4HRL A;  4J8Y A;  1T0J A;  2EKH A;  2RPN A;  3UXG A;  5FIN A;  3IXE A;  1W70 A;  1JQQ A;  1QWE A;  3U23 A;  3NOC D;  2DA9 A;  3I5R A;  2LMJ A;  4CYM D;  2HCK A;  1T3L A;  3NHN A;  2FEI A;  1NLP C;  5IH2 A;  2AKK A;  2LP5 A;  3EU9 A;  2YUQ A;  1SEM A;  3AAA C;  2RQT A;  5AAO A;  4YDY A;  2GTO A;  2MCN A;  4J9F A;  1CSK A;  4EIK A;  3M0R A;  1SRM A;  2JTE A;  2AK5 A;  3ZU7 B;  3JV3 A;  4RTX A;  1UHC A;  3TWW A;  1AWW A;  3V79 K;  2CUD A;  1VYU A;  2EGC A;  2F37 A;  1YYH A;  1FYN A;  2W10 A;  2YUP A;  1PHT A;  2V1R A;  4HB5 A;  1K1Z A;  4F14 A;  2FRY A;  1TG0 A;  2C0O A;  2DMO A;  4RTW A;  3EGU A;  1VYT A;  4U95 D;  2RQU A; 
#chains in the Genus database with same CATH topology
 4G1T A;  1XTD A;  3SBS A;  4M75 B;  1BK2 A;  3M9Q A;  4OYS A;  3MKQ B;  4U0U A;  4AY5 A;  2DXT A;  3L13 A;  4DPR A;  1WPY A;  3JRZ A;  2QAS A;  2E6N A;  1TN7 A;  1TNU A;  3B7S A;  3IBE A;  4D8D A;  2KI7 A;  1OOT A;  2DJZ A;  4I6E A;  4UQX A;  1VQ8 A;  2DO3 A;  3CD6 A;  4BER A;  3FJP A;  3THK A;  1RZ4 A;  1M8M A;  1RAH B;  5GAO q;  3QNK A;  2YUN A;  1XJW B;  1CKA A;  4YDE A;  2QC9 A;  2FO0 A;  4OVA A;  4EMK A;  3RK6 A;  1YN8 A;  3MO8 A;  4E6R A;  2CHX A;  1K8K G;  4LUD A;  4J6Y A;  4OAU C;  3CQT A;  5JMN D;  2X4X A;  4F7U G;  1YWO A;  3EJN A;  2JUF A;  3LWI A;  4Q96 A;  2QA4 A;  2EGA A;  3TXM A;  1RI0 A;  2PQW A;  1YJN T;  2LSV A;  2B86 A;  3VRZ A;  3RRM B;  1KHC A;  4MMK A;  2QI2 A;  3PIP A;  3VLF A;  3ZFW A;  3DBS A;  3HYM B;  4J9C A;  2H6G A;  3FP3 A;  2X6I A;  3L1A A;  2BKG A;  3ZHE B;  5G55 A;  1RUW A;  5LJ5 j;  4QQI A;  4C9B B;  2HNI A;  2M1H A;  4C0D C;  5KYY A;  5J39 A;  1F1B B;  1HXI A;  3I55 T;  4PNO A;  3G2V A;  3PGG A;  3A8L B;  1U3D A;  5AT1 B;  1FPP A;  1N5Z A;  2CFU A;  1BU9 A;  4M77 A;  2PQN A;  3B7R L;  3W9G A;  3IEG A;  1U1T A;  1RAD B;  2ETB A;  4PS7 A;  2WM9 A;  3OS5 A;  3OYN A;  4J9D A;  3ZYK A;  3C95 A;  3I4G A;  4F3V A;  1MGQ A;  3JCM h;  3LGF A;  5FQ6 A;  3PT9 A;  4CC2 A;  5GAN 3;  1VQ6 T;  3KS2 A;  3ZXS A;  1EDU A;  4FUL A;  3MEU A;  1AWO A;  5KH6 A;  2CH4 A;  2HM8 A;  4QKU A;  1I0C A;  3CD6 T;  3PUJ A;  1IHG A;  4C0F A;  2LT1 A;  4J8F A;  3KAE A;  2OJ2 A;  4L7T A;  4DUI A;  1TNO A;  1MHN A;  1JB0 E;  4CRW A;  4DX5 D;  3CHQ A;  2IU1 A;  4WWP A;  3TWX A;  3APD A;  5GAO l;  2KE9 A;  1NBE B;  1VQK A;  3ESK A;  4HVU A;  2O9V A;  4BUG A;  3MV2 B;  4KVO A;  4U8H A;  2WAC A;  3CPF A;  4NUR A;  3O4Z A;  2FBN A;  2L3S A;  4GTQ A;  2DYS E;  3UX4 A;  4JHJ A;  1I8F A;  2FF4 A;  2KR3 A;  4URK A;  3VYH B;  4HNA D;  2JT4 A;  1KQS S;  1T3S A;  3MCX A;  4WWN A;  3TSZ A;  3R6O A;  4JHR A;  4NL2 A;  3HXF A;  4FJZ A;  2YIN A;  4B9W A;  4A4G A;  1KLX A;  4OAV B;  3CCM A;  2YDL A;  1VQ8 T;  1LVK A;  4ZN3 A;  2J6K A;  1YJ9 A;  4RUG A;  1BB9 A;  2GTJ A;  3MP1 A;  1PRL C;  3MKR A;  1UW4 B;  2ZPF B;  4XZ4 A;  1X6B A;  3CCV T;  3OYM A;  4U04 A;  3UPU A;  3NQP A;  1KK7 A;  4IRU A;  2V8K A;  1K9M U;  2RHZ A;  1YIJ A;  2A36 A;  2A4Z A;  4B8A A;  1D8E A;  3UMV A;  4PL6 A;  4C8Q C;  4EZJ A;  2RM4 A;  4HLE A;  2HYZ A;  3CKB A;  4B8C B;  1K4U S;  1VQ6 A;  3RKV A;  1GCP A;  1W6X A;  4IUT A;  4BI4 A;  2KGT A;  4KYO B;  3JUI A;  5ANR A;  3JB9 G;  1KG1 A;  5LJ3 d;  1N6A A;  5CER B;  3JB9 J;  3EGX B;  2KYB A;  3EGD A;  3AS5 A;  2ED1 A;  3FU3 A;  3G2S A;  1N8R U;  5DM7 R;  4J6W A;  3I9Q A;  2HKN A;  1GFD A;  5DLQ E;  2K4Y A;  4G2V A;  4AFU C;  2OCC E;  4CDN A;  4ILI A;  2K79 A;  2KSS A;  5I11 A;  1KZP A;  3A8G B;  2DK3 A;  4J6I A;  4IIM A;  3TU4 K;  3JCM W;  3G1J A;  1BI0 A;  4I9C A;  5KE2 A;  3M4G A;  2ION A;  3PIO A;  1JJ2 A;  3NZS A;  3NFC A;  3LH5 A;  5FZS A;  1CKB A;  1WJQ A;  1U5S A;  3CCL Q;  2HE0 A;  1U06 A;  4HFG A;  3CMA T;  4PS3 A;  5L23 A;  4WWO A;  4PJL A;  5FJY A;  3HRT A;  5FWB A;  3CCR T;  3E1S A;  1KPS B;  3TWV A;  2DFU A;  1X6G A;  3AG1 E;  3VV0 A;  5GAN 7;  2ETC A;  1M3C A;  3JCM d;  1GRI A;  3WVD B;  2COZ A;  4GA0 A;  2R5S A;  2EJG A;  4XTY A;  3FHE A;  4CDR A;  5CHE E;  1G8X A;  3EHM A;  3C4S A;  3ABM E;  4OMQ A;  4Y28 E;  3KD7 A;  1O1R A;  3QOU A;  4N0A C;  4GMR A;  2EIJ E;  3WXX A;  2OAU A;  3RU0 A;  5CBO A;  2LAH A;  5B1B E;  4FP7 A;  5LJ3 f;  1ELW A;  2FB7 A;  2ZPE B;  1KHI A;  1X01 A;  3HXB A;  3C0C A;  3L2Z A;  4H7X A;  1M4Z A;  1WHJ A;  2DIQ A;  2FO1 E;  4JRK A;  1VQ5 Q;  3BY7 A;  2ILR A;  2Y1L E;  3APC A;  3ZEF A;  2CZ7 B;  4WCI A;  2F8Y A;  2BIV A;  1RAB B;  1Z9Z A;  2X4J A;  4Y92 A;  2M63 A;  4LDU A;  3L2U A;  2E2E A;  1PNJ A;  4C5E A;  4M7D B;  4L5G A;  3FUI A;  3ML8 A;  1YI2 Q;  3BQO A;  3PTA A;  1K0S A;  1YIT A;  1H8K A;  4TUM A;  3I4R B;  1SQM A;  5AJD A;  2MOW A;  1HF8 A;  1U1S A;  5GMK l;  4LCT A;  2LJ1 A;  4C8Q E;  2NUT B;  1NL4 A;  4JD2 G;  1UDL A;  2ETA A;  5D6X A;  1UJK A;  3JB9 I;  1V1C A;  2GRO B;  2P9K G;  3OAW A;  4AT1 B;  3NPF A;  1YIJ T;  4LSZ E;  1QCO A;  1NA3 A;  1NPP A;  5BW8 C;  3HTR A;  3M0P A;  4FU6 A;  5I22 A;  4ZTF A;  5ENP D;  3RNJ A;  2VSN A;  3TQ7 P;  2X3M A;  3ZEH A;  4G8L A;  2ESW A;  4J9H A;  5HY6 A;  4ILH B;  2IY0 C;  4IYP A;  3GF5 A;  4PLL A;  1VQM Q;  1YFN A;  5CCL A;  1KD1 R;  1LCK A;  2KBX A;  2QYZ A;  2MIO A;  1DNP A;  2HO1 A;  4JEU A;  4WAF A;  1G2B A;  3G6E A;  2ENM A;  4U8Y D;  3R6N A;  1HG2 A;  3N71 A;  4M78 G;  5HCK A;  1BIA A;  4EMK B;  2KAT A;  4JDS A;  3QWY A;  1AZE A;  1YNZ A;  3NMZ C;  4OMP A;  4M75 F;  1NI1 A;  4BE2 A;  5EIB E;  3EGX A;  1Z6T A;  5ENO D;  2QXF A;  5CEC B;  2C0L A;  2J07 A;  2DTI A;  2LNH B;  4MDX A;  1N54 A;  1W2B A;  4CGV A;  4OF1 A;  2NYS A;  2EYX A;  2BE7 D;  2VB6 A;  1Q81 U;  5G2N A;  5LL6 S;  3MHX A;  1MYO A;  3CGH A;  4Q69 A;  2GBQ A;  3QUI A;  2XQ0 A;  1GXI E;  4KT6 B;  4AJW A;  3QHS A;  4C92 B;  2IEJ A;  3WVE B;  4LDX A;  3B95 A;  1FMK A;  4M75 A;  4RMO A;  4ESR A;  5GMK j;  1NZ9 A;  4HKE A;  1N95 A;  2AVP A;  4I6J A;  5GJV B;  5J3B A;  1QVF S;  4GPK A;  4M7D F;  2LVM A;  2JW4 A;  4IUL A;  1JCR A;  4EBA A;  4CDM A;  2VYT A;  3H41 A;  4WF2 A;  5LCW C;  1QLY A;  2PZI A;  2L3Q A;  4BE0 A;  4JZ4 A;  2VKN A;  3SWN C;  1DCE A;  1IHW A;  4ANU A;  2ZU6 B;  3OMC A;  3L6A A;  1WQ7 A;  3DSV A;  3PDN A;  2P0P A;  1IXV A;  3H0F A;  1HS6 A;  3OB9 A;  3Q73 A;  4EZK A;  4J8E A;  2NUP A;  4OMN A;  4NAC A;  1K76 A;  4O1P A;  3FTV A;  2RI3 A;  3MCA B;  4XAX B;  4JS5 A;  4DRX E;  4F7A A;  2YXY A;  3G71 Q;  3QWP A;  1K1B A;  2A0F B;  3K9I A;  3MX3 A;  2EQM A;  3EH1 A;  7AT1 B;  3JCM J;  4ACK A;  3EG0 A;  2X4W A;  1RW2 A;  3DB3 A;  2YHC A;  2WQ7 A;  3CCJ T;  4AM9 A;  2DBM A;  3EG9 A;  4YVQ C;  2XDP A;  4FSX A;  1I5L A;  1AWC B;  1N4P A;  1O75 A;  1UEB A;  4MZT A;  1YJW A;  3R9M A;  2JVV A;  3CVN A;  5T8I A;  3AG4 E;  2X6K A;  3CHR A;  2QZA A;  1B7T A;  4C0G A;  3TWQ A;  3Q7F A;  3OYL A;  3EUV A;  2XG8 D;  3CCS Q;  1M30 A;  1JU5 C;  1M1K C;  3M53 A;  1E90 A;  3LXU X;  1YP5 A;  4BY6 B;  1M1K R;  4JZ3 A;  4XTV A;  3JB9 D;  2CHW A;  3QK0 A;  3GW4 A;  1PM3 A;  2DEU A;  4GA2 A;  3FUK A;  4PK4 A;  4C92 F;  1OQK A;  4K11 A;  2VGE A;  5EYP F;  2KRS A;  1S72 A;  2GFU A;  3OYH A;  5BV1 A;  1O5M A;  5GAO n;  2CDT A;  4PS8 A;  2F8X K;  5KYU B;  2FUL A;  3O48 A;  5FRM A;  1BI8 B;  1B34 A;  2MPX C;  2DNU A;  4M77 G;  4M7D C;  2QY7 A;  1OUL A;  5LX8 A;  3ULR B;  5AQ9 A;  5GMK h;  4LNU D;  4M7A C;  1IYG A;  2RN8 A;  5LJ3 g;  3LY7 A;  3L54 A;  5H7P A;  1INZ A;  4N4I A;  2QQ9 A;  1MHQ A;  3NF1 A;  1JCS A;  2BZY A;  3ZYL A;  2QQS A;  4JZY A;  4HOT A;  2E1H A;  2M02 A;  4YVO A;  3QZ9 B;  3ZGQ A;  1LD8 A;  4QVZ A;  2P58 C;  1VQN T;  4QT7 A;  3MZL B;  4A4F A;  3Q15 A;  4GAA A;  1BIB A;  2PU9 B;  4JUV A;  2O88 A;  4M7A E;  5KNH D;  1V55 E;  2IO3 C;  4PJN A;  1B3Q A;  2HSE B;  4XU2 A;  1N11 A;  1W1F A;  2QDY B;  4GLK A;  3QKY A;  1ZBJ A;  2FYK A;  2O31 A;  3JCM X;  3BEE A;  4HA8 A;  5GAM d;  5JHA A;  2DVE A;  1TNB A;  2RA2 A;  1WM5 A;  3QWV A;  2RPN A;  3UXG A;  5FIN A;  1XNI A;  3U23 A;  4RQI A;  3NOC D;  3ZFJ A;  3ZPJ A;  3L16 A;  3I5R A;  5CMY A;  5FQ8 A;  4NL3 A;  3NHN A;  3AG3 E;  5AJL A;  5CKD A;  1VQP T;  2LP5 A;  3BW1 A;  1BKB A;  3AAA C;  1ZBX A;  2BKD N;  1UB4 A;  2GTO A;  2MCN A;  4J9F A;  1CSK A;  5GAO r;  3PFS A;  4TXQ A;  5LJ5 e;  3V8L A;  1KT0 A;  4R55 A;  2MWP A;  5D6W A;  3FUH A;  4VUB A;  3LGL A;  1N9R A;  1Q95 G;  1N4R A;  1VYU A;  3CCU T;  2F37 A;  1YYH A;  3QYG B;  4UWG A;  2W10 A;  1Q86 U;  1PHT A;  2H3E B;  2UY1 A;  1TSF A;  2LXM A;  1G3S A;  1TG0 A;  4RTW A;  3QZ5 B;  1Q82 U;  3L42 A;  3M4Y A;  3OYG A;  1QP2 A;  1X75 C;  1VQ4 A;  2KCL A;  2DZC A;  1U3O A;  3UT8 A;  2CT4 A;  3WXM B;  4LD6 A;  5CK9 A;  3DSU A;  1BU1 A;  5AAR A;  3OSV A;  2QQA A;  1H2U A;  2R05 A;  2ECZ A;  1WDX A;  2RHI A;  3AT1 B;  2OND A;  3JQ0 A;  3D9M A;  4JJD A;  4BEP A;  1KT1 A;  2ZPB B;  1PY1 A;  2HBW A;  1QYM A;  4DK5 A;  3RIB A;  2HAX A;  5D0O D;  3G4S Q;  4M77 B;  3Q75 A;  5CKF A;  3EHQ A;  1NJI R;  4BX9 A;  3VLE A;  3ASF A;  2WQ6 A;  4PJO G;  2KQW A;  3UI2 A;  1OY3 D;  2CFZ A;  5L8R E;  3S3N A;  3UT4 A;  1FT2 A;  3RER A;  3DSW A;  2LQ8 A;  4N3C A;  3M5A A;  5B1A E;  4GTT A;  2M9U A;  3DB4 A;  4M77 F;  4BD3 A;  4BES A;  1SSF A;  1J3T A;  1E8Y A;  3SFM A;  3RO3 A;  3VS2 A;  1VQL Q;  1ZLM A;  1OEB A;  1QW1 A;  3E33 A;  2GRP B;  3EG1 A;  3ZXP A;  2OVB A;  2J9Q A;  3QJZ A;  4N5C A;  1M5Q 1;  3BG0 B;  1Z5S C;  2WXI A;  2JAB A;  2HSP A;  3UIN C;  1NPR A;  3CC2 T;  3B7T A;  3VU3 C;  1KC8 R;  4J9E A;  3MEK A;  3MA5 A;  4B0Z A;  2D9T A;  2IOS A;  2WXQ A;  3VJP A;  2B0O E;  3DEO A;  4AG2 C;  4IUQ A;  2V5F A;  4WND A;  3CC4 Q;  4FYX B;  4C92 G;  3CST A;  3KSQ A;  1VQO T;  5A0G A;  3V31 A;  1RAC B;  4UUC A;  3JQ1 A;  4D8K A;  1X2K A;  3PS6 A;  4R0K A;  5KYW B;  4U8V D;  5I2M A;  1WXB A;  2NUT A;  2PNI A;  4GCO A;  2AXV A;  3RKY A;  4FSS A;  4EEC A;  1E7U A;  2KAF A;  2RHX A;  2Y90 A;  1PAQ A;  1BCM A;  1PSE A;  5KCO A;  1YHQ Q;  2E6Z A;  3KEZ A;  1JJ2 P;  4LD9 K;  1UN9 A;  1VIE A;  3A98 A;  2EQI A;  4K5A B;  2DYR E;  4K5B A;  3VS6 A;  1UJ0 A;  5ARF A;  4FHJ A;  3RAU A;  1WDY A;  4M78 A;  3I56 A;  3Q9N C;  1N4Q A;  4KH0 B;  5CKE A;  1RAE B;  4RKU E;  4KBM B;  4D10 C;  3G2T A;  4C8Q D;  3QO3 A;  4LNP A;  3RO2 A;  2IIM A;  4BSX A;  3FEX A;  3JXI A;  1OCO E;  1VQ9 T;  2CP5 A;  1FT1 A;  4TVR A;  1TTH B;  2EBP A;  4JEH A;  2Q7F A;  2DX1 A;  4UWK A;  3S7J A;  3HRS A;  2D8J A;  2LQN A;  1PD0 A;  1OCC E;  2WPV A;  4EBA G;  4JLG A;  1E8X A;  2DZN A;  8ATC B;  3UTM A;  3LDZ A;  1Y96 B;  1Z3Y A;  2JM8 A;  2P9N G;  4F16 A;  2J8S D;  1UOH A;  1KZO A;  1D8D A;  1N94 A;  3QAQ A;  2CRE A;  2KZT B;  1E6H A;  1G83 A;  2L0I A;  4B6M A;  3CCL T;  1QVG S;  3SF4 A;  5BV0 A;  4XU3 A;  1EZZ B;  1D3B A;  2ZPG B;  1WI7 A;  3CCJ A;  3CCR Q;  4BFR A;  1MV3 A;  5T3R A;  5LFA A;  2FPF A;  2R03 A;  2V0P A;  3DXK G;  3UA6 A;  4KT0 E;  3G4S T;  4GZC A;  5FIO A;  1UGS B;  2J4D A;  1HZ4 A;  1OU9 A;  3SI5 A;  4AMC A;  2OTJ Q;  3FUL A;  3ZUV B;  3OBW A;  4V2S A;  2K7A A;  5CED B;  1WNL A;  1PWT A;  4HXI A;  2HQH A;  4V3I A;  1YCS B;  3MKQ A;  4HBD A;  3URZ A;  2H6H A;  3NGP A;  5GAN 8;  2IQC A;  4XU1 A;  4RCC A;  3ABK E;  2EIM E;  2XEH A;  1QP3 A;  1YWP A;  4QW2 A;  3DPY A;  3ONL A;  3FTZ A;  5KYN A;  3PNW C;  2OVF A;  5B3S E;  5ENQ D;  1AWJ A;  1WAO 1;  1VQN A;  3PRE A;  3GLX A;  3QDN A;  5EKQ D;  3EFO A;  2X6J A;  2I2O A;  3HG0 D;  1IZ6 A;  4OGE A;  1IQU A;  1NEB A;  5GAN 5;  2OEV A;  1LPL A;  2B8A A;  1LD7 A;  2LSU A;  3RRU A;  4C0Z A;  3FUE A;  4CT4 A;  1WHL A;  2F5T X;  1BD8 A;  1WIE A;  2DWZ A;  1E8Z A;  2XEV A;  5DIZ A;  3A1P A;  4JJC A;  4EDU A;  4OP0 A;  3E9G A;  4DX7 D;  2VVK A;  2E4H A;  1YIJ Q;  1G3Y A;  3PZ4 A;  4HT9 A;  4C48 B;  1MX6 A;  4LNG A;  1QCF A;  2RD1 A;  1EF1 C;  2A5E A;  2KCV A;  4OGC A;  2FG0 A;  1YHQ T;  1UN8 A;  4HRM B;  2PM7 A;  2QK0 A;  2RNA A;  3OW2 P;  5G05 J;  4FM4 B;  1IB8 A;  5FTP A;  1AD5 A;  4RG8 A;  1AZG B;  4GZ6 A;  2LXL A;  3M0T A;  5GAO p;  2D8H A;  2P4T A;  3J5P A;  1G5V A;  3SQV A;  4WTO B;  4YTL A;  5A2Q E;  1TS9 A;  3SFY A;  3JCM V;  3OXL A;  2DER A;  1GCQ A;  3FWV A;  2K5F A;  3HXE A;  2JS2 A;  4I1M A;  4PJO F;  5KCM A;  4PH4 B;  1OT8 A;  4K0R A;  1OX9 A;  2QDL A;  2KY9 A;  2QQR A;  2QEX A;  5JJT A;  2EQU A;  3CCU A;  4BX8 A;  4ABN A;  4ZGE B;  4I2W A;  4E7J A;  4JA9 A;  1V76 A;  1R0B G;  2LUH A;  2J08 A;  1SW6 A;  5CMW A;  4ELY C;  2CS7 A;  2E5K A;  1Y71 A;  1A0N B;  2K3X A;  2ZZD A;  3UKU G;  2XPZ A;  4J8D A;  4LDY A;  2AKL A;  3TXN A;  2XS8 A;  4CEM A;  3EFS A;  3LVR E;  3CME T;  4PKC C;  4M7A B;  5LJ3 h;  4FLH A;  1S72 Q;  4BT9 A;  4E7Z A;  3FTX A;  4DI3 A;  2GW1 A;  2L6J A;  4A4H A;  4ATG A;  4JC8 A;  2DTH A;  5GAN g;  2OTJ T;  1IHV A;  3J5Q B;  1OWM A;  2QTV A;  3A5Z B;  2Y0B G;  4APF A;  4BET A;  1L5J A;  2B6C A;  4ORZ A;  4C92 A;  2X6H A;  5EX0 A;  2DKG A;  3QDR B;  4PJM A;  1H6K A;  2O01 E;  5HS0 A;  1I5O B;  4F6R D;  3LLR A;  1VQK Q;  3UIO C;  5CO7 A;  2GQI A;  2P4R A;  2XCC A;  2HQX A;  3LY9 A;  3GBQ A;  2JEK A;  1I4K 1;  1SHG A;  2ED0 A;  5CAI A;  2EFI A;  4JPB W;  2WXN A;  1M1F A;  1LTX A;  3ZL7 C;  1NJI C;  5J26 A;  3ZW3 A;  1FXX A;  5GAN e;  1TNY A;  4F1S A;  2DL8 A;  3OA6 A;  1HK9 A;  1YIT Q;  3S3O A;  2E3I A;  3GZ2 A;  4FHK A;  2PNN A;  1SSH A;  1NP7 A;  2DL7 A;  3MKD A;  2QEX T;  3UM3 A;  4TRQ A;  4M77 D;  1YCY A;  2I1K A;  4C5G A;  4PJO B;  4RTZ A;  1S70 B;  4K5C A;  4BTB A;  4JL0 A;  2PTK A;  2HKQ B;  2L0A A;  2EYW A;  1HH8 A;  3VUB A;  5ANL A;  2EVR A;  1DJ7 B;  4J7F A;  5FZQ A;  1YBY A;  3C12 A;  3EAE A;  2QA4 Q;  3SNX A;  3CKC A;  2KBT A;  3PVL A;  3HSB A;  1A5E A;  3SY2 A;  3ULY A;  3BFM A;  5LCW J;  2DCP A;  2COW A;  2WXG A;  4ILG A;  1KIK A;  1M1G A;  2QG9 B;  2BKK B;  1UUE A;  3LJN A;  3TGO A;  2M0O A;  2R57 A;  2QGG A;  1Q7Y R;  3OW2 S;  3UT7 A;  3OTN A;  4BSZ B;  4M77 E;  4Z89 A;  3RIR A;  3LYA A;  1ZSZ B;  2BE9 B;  3UF4 A;  5FRO A;  1VQ9 A;  3D9I A;  5CVI A;  2JXB A;  3QWW A;  1EFN A;  1WHG A;  4QVD A;  2K2V A;  4F7U B;  5KYY B;  3L2R A;  5HI7 A;  1HSQ A;  4EZL A;  1H3Z A;  1VQ4 Q;  3SO8 A;  2K2M A;  5CCM A;  2G6F X;  1ABQ A;  2VQ2 A;  1N0Q A;  3CPW A;  1LNX A;  1RI9 A;  2HZY A;  3Q79 A;  1WJS A;  4DX6 D;  4A53 A;  3UM0 A;  1MQS A;  3NBN B;  2BUD A;  2EPD A;  5KYU A;  2IO2 C;  4EQF A;  4HQD A;  3MV3 B;  1NG2 A;  3CME Q;  3RUX A;  1UEC A;  4CI0 C;  1JCQ A;  3VYG A;  2J6O A;  5FT9 A;  4LDV A;  4DEY A;  4E7I A;  1M90 R;  2DF6 A;  4ZGD B;  2I2L A;  3MET A;  1OWP A;  2JM9 A;  3MJX A;  1EPU A;  1UGQ B;  3CCQ A;  3ZKJ A;  4C5I A;  3A8M B;  1K8A C;  3HPW A;  2RKK A;  3QBY A;  1M8V A;  3CEY A;  4DX2 A;  2VXE A;  3I5P A;  2CGH A;  1MMD A;  4DBQ A;  4U0S A;  4LXC A;  5GAN 4;  2LZ6 B;  4E7S A;  2Y4T A;  5C1D A;  3BG1 B;  2DIG A;  2X6F A;  3AS4 A;  1U8R A;  1VQL A;  3CSF A;  2OX7 A;  3GIB A;  5ENR D;  1SKU B;  2AJA A;  2GRM A;  1LOJ A;  3S6W A;  2VSO E;  2WSF E;  2BTD A;  5BNW A;  2QTX A;  1H2V C;  2DYB A;  3LY8 A;  5LJ5 h;  2RHU A;  4CGW A;  3OYI A;  3GZ1 A;  4UWH A;  1WXT A;  2L89 A;  4UI9 K;  2W0Z A;  4JB8 P;  3UWN A;  5BXO A;  2X3X D;  3C5R A;  1QKW A;  5E75 A;  1M2V B;  1N0R A;  5EG2 A;  2KT8 A;  4GLM A;  3V30 A;  1KQS A;  2FL7 A;  2MWO A;  1ZB1 A;  2CZ6 B;  2WVI A;  2WXO A;  5HKC A;  4CC4 B;  3CCL A;  2RO0 A;  3CLJ A;  2KMT A;  4R7L A;  4J7W A;  4F7U F;  1PRM C;  2P2C P;  3ASN E;  4RVB A;  1TR4 A;  6AT1 B;  1BPO A;  2XU8 A;  3SWN B;  2E10 A;  2MI6 A;  3CMA Q;  4J9B A;  2J7I A;  2MRI A;  2E5Q A;  2MF2 A;  4JRQ A;  4ANJ A;  1M27 C;  1BLX B;  3Q5M A;  4PDX A;  5AIJ A;  1UGR B;  1WHH A;  2KYM A;  4Z8A A;  2KC7 A;  3KSL A;  4LEU A;  3PUK A;  2PZ1 A;  4I1O B;  4FJY A;  1WHM A;  2LO6 A;  2QYU A;  4KZC A;  4HRL A;  3QKJ A;  4J8Y A;  1T0J A;  1U2V G;  3S2A A;  3OYB A;  2PQR A;  2EIF A;  4JRP A;  2VV5 A;  3EIQ C;  1QWE A;  2EQK A;  5A0D A;  2VGX B;  2CP7 A;  2DA9 A;  3P8H A;  2WXK A;  2XDD A;  4I6G A;  2LMJ A;  1ZU2 A;  2G3R A;  4M78 F;  4E47 A;  3CR3 A;  3CQC B;  1QVG A;  2AKK A;  3EU9 A;  4K03 A;  2YUQ A;  1VQ5 T;  4DOV A;  3CPW P;  1OXJ A;  1KQ2 A;  1P92 A;  5KE3 A;  3FU6 A;  4A55 A;  3CCE Q;  5J90 A;  4F53 A;  5GMK i;  2VGY A;  2YNQ A;  3M0R A;  4MS6 A;  1ZA2 B;  3CVW A;  1YI2 T;  4J0U A;  2K3Y A;  2MAM A;  3C98 A;  1UHC A;  3TWW A;  4C92 C;  1TJC A;  3RMQ A;  4EPZ A;  1TWB A;  4MKT A;  4I9E A;  3CCQ T;  1FYN A;  4IUU A;  2EIN E;  3OYJ A;  1VQO Q;  2ZPI B;  1K8A U;  4UI9 C;  1ACM B;  1K1Z A;  2EJF A;  3NAW A;  4A1G A;  2DIW A;  5DLO A;  2C0O A;  2DMO A;  4BB7 A;  2F5K A;  4NOY A;  2LNV A;  5GAN j;  2RQU A;  4GYW A;  3NTH A;  4BI3 A;  2ZXW E;  4A3T A;  4MZP A;  2MYO A;  2CKK A;  2XK0 A;  2RI5 A;  2XZT G;  5GAN 6;  5CQX A;  1W2B P;  2RJC A;  1BCO A;  1WFW A;  4ZHB A;  1VQM T;  3PEU B;  4EHM A;  4J5Y A;  3Q78 A;  1RAI B;  3CHS A;  4L1B A;  2J09 A;  4O60 A;  3VTY A;  5FWC A;  3JYS A;  5GMK m;  1UFF A;  3I56 T;  1M90 C;  2BZ8 A;  3DLL A;  5LJ5 f;  3AHU A;  2O4X B;  2CG2 A;  2VAS A;  4E7L A;  1NZN A;  3SGH A;  3JCM c;  2JTM A;  5EDS A;  1OCR E;  2P9P G;  2GGR A;  1S0P A;  1MNE A;  4MBG A;  3HXD A;  4JS4 A;  3FUF A;  1QBQ A;  4JA7 A;  1WX6 A;  4KH1 B;  1IRE B;  3REA B;  4J9I A;  4HCB A;  3FH5 A;  3OYK A;  3HVE B;  4DJA A;  1HJD A;  2D0N A;  4M78 B;  3V8J A;  3JB9 H;  2JZ2 A;  4A1S A;  3SD5 A;  1IHB A;  2O2O A;  3ASO E;  3A8O B;  1IQR A;  5I21 A;  3UT1 A;  3HHM A;  3LS8 A;  4ANV A;  3D9H A;  1SPK A;  3E19 A;  3CVQ A;  2IF4 A;  1D1C A;  1X69 A;  4E85 A;  4N3B A;  2V5Q C;  2VTB A;  2LCC A;  4FCY A;  3APF A;  2X38 A;  3OBY A;  3SWN A;  3RDV A;  2KDS A;  3WG7 E;  1ZA1 B;  3CD6 Q;  1TN6 A;  4AY6 A;  2WQH A;  1PC0 A;  1JO8 A;  3G6E Q;  4BE1 A;  5LP0 A;  2XPI A;  2WMO A;  3CCV A;  3RR6 A;  3Q4A B;  1MND A;  2XEE A;  1UJJ A;  4XIF A;  4GY5 A;  1H0A A;  1HU3 A;  1PD1 A;  2D1X A;  1KD1 C;  4PJO D;  2JN0 A;  5ECA A;  2RJE A;  2P0K A;  1RLP C;  3KFV A;  2XZD G;  4LN2 A;  1K73 U;  2EQX A;  1H92 A;  5C2Y A;  4M75 E;  3B13 A;  4OMF B;  4XI9 A;  2KT1 A;  3D9P A;  2DTO A;  2JNG A;  4GTS A;  3E4B A;  3QDF A;  1IGQ A;  1WZO A;  2EYQ A;  3QB2 A;  5FU7 C;  3CXC P;  5BXU A;  3CC7 A;  4M7D G;  2KRO A;  2OTL Q;  2XGM A;  5CEA A;  2K9G A;  5GAM j;  4AXH A;  2VGN A;  3PEV B;  4U0Z A;  4C0D B;  4GBQ A;  5CKB A;  1N9A A;  1QWF A;  3VS1 A;  1Z9Q A;  4EMG A;  2VYI A;  2F2W A;  3H0I A;  1UTI A;  4BAC A;  5HK0 A;  1ZSZ A;  3TL5 A;  1QVP A;  2AZV A;  5AQA A;  3FUM A;  2BF0 X;  1TUG B;  3UM1 A;  2VUB A;  3P1U A;  4GPM A;  1M9S A;  1ZUK A;  3S7D A;  3RKX A;  3G2W A;  5IY5 E;  2V4L A;  2WXP A;  1WA7 A;  2MK5 A;  3I55 Q;  4I2Z A;  1T0H A;  2Y69 E;  1MJ0 A;  4NIK A;  2ZPH B;  3P2B A;  2FZK B;  4IUR A;  3CCS T;  3RJV A;  2DM1 A;  1X27 A;  2A5U A;  2F2X A;  5GAN 2;  1C6V X;  3KUF A;  1VQ6 Q;  2P9U G;  3CVV A;  3EFO B;  1WQW A;  4XTW A;  3TWS A;  5CCA A;  2XGO A;  2PVG B;  3RRN B;  2JS0 A;  2LTO A;  5T4Y A;  4TV3 A;  1R8O B;  5GAM f;  1JWG A;  2J06 A;  4DBF A;  2WB2 A;  2XHE A;  4KGV B;  3M55 A;  4TXP A;  3QG1 A;  2RD0 A;  5EN5 D;  4AFS C;  1NLO C;  3G2U A;  3ZN3 A;  1HYO A;  4FL6 A;  1WGS A;  5ENT D;  4I43 A;  2J05 A;  2FZG B;  3NOG D;  3CBO A;  1ARK A;  4NQ0 A;  1VUB A;  3VS0 A;  2R17 C;  2EW3 A;  3C94 A;  2DXB A;  1OX8 A;  2D0Q B;  4G11 A;  2RQW A;  3QII A;  2BUG A;  3DSS A;  2EYZ A;  1MX4 A;  3D9J A;  1U3C A;  2Z0W A;  2AZS A;  4CRI A;  4A54 A;  4YDW A;  3B7B A;  5AQ7 A;  1VQ8 Q;  4X8Q A;  3E30 A;  1QCN A;  4GTO A;  3UPV A;  1QKX A;  2WXM A;  3PE3 A;  3FLG A;  4XE0 A;  4OB3 B;  5I2S A;  2YRC A;  3LH0 A;  1BYM A;  3ASG A;  5GAM e;  1ZHI A;  1PC2 A;  2GRN B;  5JHB A;  4HVB A;  3HRA A;  3QJ6 A;  2RK2 A;  1BI2 A;  1QQE A;  3G4S A;  3TJP A;  1OWL A;  5D0Q D;  4DLQ A;  4A4E A;  1KD1 U;  4PFP A;  1G3N B;  2IOL A;  2AXZ A;  3MP6 A;  5FU7 B;  5CR2 A;  4HCC A;  3GYZ A;  1KSW A;  5IHN A;  1VYV A;  4O5V A;  2FRW A;  5IN1 A;  1XQH A;  3BDU A;  3TCJ A;  4ZTJ A;  3DPD A;  3HHT B;  4GYY A;  4LER A;  3Q7A A;  2C0M A;  2DRM A;  2NWM A;  4HVW A;  5EC7 A;  3CC7 T;  1OZ3 A;  4XQ3 A;  2A08 A;  2LJ3 A;  1SVX A;  2FO7 A;  4G23 A;  1H2T C;  2OTL T;  3ENE A;  3LW5 E;  4BDZ A;  1YI2 A;  3FH7 A;  1Q81 R;  3H9N A;  3JCM e;  1NYF A;  3VKI A;  2YWW A;  3PZ2 A;  2DZO A;  2JOY A;  4J83 A;  3EHR A;  2A28 A;  2EAY A;  2XPY A;  3ZNG A;  1OV3 A;  3KBG A;  4ME2 A;  2X3W D;  1D0Z A;  3IHV A;  4FIB A;  3JB9 F;  3DXM G;  4M75 D;  3TRE A;  3SFX A;  3C3Q A;  2CT3 A;  4M4Z A;  4LUN U;  2ROL A;  2C06 A;  1C0M A;  2R02 A;  1DVP A;  4OMM A;  1VA7 A;  2QQB A;  2QA4 T;  5KCH A;  3HL8 A;  1RL2 A;  4QQG A;  3OY9 A;  4MRU A;  2VC8 A;  1K9M R;  5CRU A;  3HKS A;  2LC4 A;  2MOX A;  1YJ9 T;  3FH8 A;  1VQ7 A;  1LF8 A;  1OPL A;  4R56 A;  1Q7Y C;  2NLU A;  1C1A A;  5CIU A;  1UGV A;  3CBM A;  2Y3A A;  1Q2Z A;  3X20 B;  2AWI A;  4XX5 A;  1Y96 A;  4TXR A;  4AOF A;  1G3T A;  4BTA A;  5ENS D;  1UHF A;  2MYS A;  3URG A;  3L08 A;  3ONK A;  1N8R R;  2NXP A;  5LJ3 j;  3BE3 A;  3SZ7 A;  4U7E B;  4AIF A;  1D3B B;  3LX7 A;  4J6X A;  4KUI A;  2RFM A;  2E64 A;  1NM7 A;  1FX7 A;  1E96 B;  4MLP A;  2LJ0 A;  4AV7 A;  1WLP B;  4HCK A;  1AVZ C;  5DY9 A;  2CUB A;  4BI8 B;  2R59 A;  3S7B A;  4LE9 A;  1FWZ A;  3ASD A;  3CC2 Q;  3OMG A;  4ACL A;  3VTX A;  1UJY A;  3D9N A;  3CXC A;  2ZGW A;  3BUA A;  1YJW T;  4QFV A;  2A37 A;  4I1A A;  1DC2 A;  2IVW A;  4N5Q A;  4ME7 A;  3Q49 B;  3ZRH A;  4PJO E;  3OSS C;  1TYQ G;  5IXB A;  2NYJ A;  5KJL A;  1O1T A;  1YHQ A;  1X43 A;  4IN3 B;  5BT1 A;  2LX7 A;  1SHF A;  4DEX A;  4U07 A;  1H6P A;  2PM6 A;  1MV0 B;  3O8V A;  3H0H A;  4OVU A;  1X5B A;  1HO8 A;  1K3Z D;  1N8R C;  2EYY A;  3DEP A;  2DYI A;  3EHN A;  4M78 D;  2P9I G;  4UI9 J;  2VTB B;  1TXQ A;  3HFO A;  2E65 A;  2XIC A;  1FMV A;  2RQR A;  3CCE A;  2X35 A;  3JXJ A;  3REB B;  4ZGJ B;  4M7D E;  4IKF A;  2SRC A;  2ABL A;  1WHK A;  2DL4 A;  4JXT A;  1K73 C;  2GQV A;  5GAN f;  5A23 A;  5HQ8 A;  3CXC S;  1I81 A;  1D09 B;  4JPS A;  2V8I A;  1I07 A;  1SF9 A;  4WNG A;  2HEQ A;  3Q9U C;  5CBN A;  3TEE A;  2JTF A;  4HOU A;  2GCX A;  2V26 A;  2EJ9 A;  2WSC E;  1MMG A;  4KRT A;  2OI3 A;  3LWH A;  4RCB A;  4OML A;  1AOJ A;  4GZD A;  1FCH A;  2WXL A;  3MEW A;  5FQ7 A;  5LOZ A;  1HD3 A;  2KNB B;  3H8Z A;  1IRX A;  4KGZ B;  2CZ1 B;  1WJR A;  3LPZ A;  2YHT A;  4JLI A;  3JCK C;  2LQK A;  3SB2 A;  3BU8 A;  1W3B A;  4M7C A;  4DLO A;  2QYJ A;  2DL3 A;  2RHY A;  4BY6 A;  1V29 B;  3ULQ A;  5IHK A;  2KXP C;  3ZBD A;  3T8K A;  4N2S A;  4M77 C;  3FEY A;  3PMT A;  2ZAE A;  4M7A G;  3G7Z A;  3JUE A;  1B07 A;  4XTU A;  1YJ9 Q;  1MZC A;  2NC9 A;  1MUZ A;  4U63 A;  5IXF A;  1XOV A;  1BI7 B;  2P84 A;  4FYY B;  4OVV A;  1M2V A;  4C8Q B;  5C0M A;  3FTS A;  2Y4U A;  1B34 B;  3HFN A;  3N5B B;  2Y4Y A;  1S64 A;  2ZIS A;  1VQ5 A;  2HBP A;  3TAX A;  4AEZ C;  4PFO A;  2E12 A;  5D6Y A;  4A4K A;  1H6O A;  2Y4X A;  1GL5 A;  1TJF A;  1Y8M A;  3FUD A;  3FRN A;  3UM2 A;  4GMJ A;  2K5L A;  4C92 E;  4ELZ C;  5IAY A;  4FLB A;  2WXH A;  4IUP A;  3D9O A;  4RLY A;  2RG8 A;  4L2Y A;  3TWT A;  1GBQ A;  1OU8 A;  2KZT A;  4MDW A;  2SEM A;  4M75 G;  5GAO m;  4XKB A;  2CSI A;  3CCJ Q;  3CCR A;  2XRY A;  2LDM A;  2FEZ A;  1OUV A;  5FWQ A;  2E0I A;  1YJW Q;  1IO6 A;  2JLB A;  1ZQ1 A;  3CCQ Q;  3UIP C;  1N27 A;  4IIO A;  4PJJ A;  3EG2 A;  3O5Z A;  4XKC A;  2LQW A;  1VQP Q;  3CC4 A;  2AW6 A;  3I35 A;  3CCV Q;  3I5S A;  3JCM g;  3HRU A;  2YLB A;  2P9S G;  2GNC A;  4RG6 A;  3CK8 A;  1KQ1 A;  4GTV A;  1MMN A;  3VRY A;  1H64 1;  1N52 A;  5JA4 D;  1WG0 A;  4CC7 A;  2AT1 B;  1JWF A;  2ZCF B;  1VQM A;  5LJ3 e;  2HR2 A;  4F17 A;  3PNT B;  3ABL E;  1OZ2 A;  4GZ3 A;  3PH0 C;  1NJI U;  3QAR A;  1B89 A;  4N0A A;  2WXJ A;  3J81 E;  1TU0 B;  2ZGD A;  5KWD A;  3I56 Q;  4PJO A;  3CC2 A;  1SA5 A;  2EKH A;  2EWN A;  1P5Q A;  1KC8 C;  2OV8 A;  3CCU Q;  1JQQ A;  3OS0 A;  3V7C A;  2A7Y A;  4L9P A;  3S3M A;  2L8D A;  2QFC A;  3GPL A;  1HE8 A;  4Y6W A;  2HCK A;  1T3L A;  5CKH A;  1NLP C;  3ASK A;  1SA4 A;  4J8S A;  4UWL A;  1KC8 U;  5KYX A;  2WMN A;  4OB2 B;  2XI9 A;  1SEM A;  2CP3 A;  4WUY A;  2P9L G;  3JAM E;  4EIK A;  3V7S A;  3CCM Q;  3FU0 A;  2JTE A;  3LEW A;  2A3L A;  3I3N A;  2PL2 A;  1Y07 A;  4G26 A;  4L6V 5;  3JV3 A;  2XD0 A;  1ELR A;  2RJF A;  3INZ A;  1JPL A;  4FA6 A;  1TOV A;  3V79 K;  5KJK A;  1VIF A;  4JJN K;  1M1K U;  4G25 A;  2EGC A;  2LCL A;  3G6E T;  3ASH A;  4HOR A;  1VQ7 T;  3OYE A;  1LJO A;  2YUP A;  2V1R A;  2OTJ A;  3U3W A;  3QJY A;  3CHP A;  3CIA A;  2KK4 A;  3HDX A;  1OWO A;  3CVU A;  1VYT A;  4C8Q A;  3L2W A;  2UWJ G;  2VGM A;  3QPH A;  1VQK T;  2CZ0 B;  3CK7 A;  2PVD B;  4Z02 A;  2ZIR A;  1AT1 B;  1EIF A;  4XI0 A;  3QXE B;  1IXD A;  2H6I A;  4GCN A;  1JXO A;  2L6B A;  3RBB B;  1JRI A;  4JJB A;  2RH2 A;  4DX1 A;  2DL5 A;  5FU6 B;  3FU5 A;  4E7H A;  1YIT T;  4AFQ C;  4LUE A;  2LX9 A;  4HOQ A;  5GAN h;  4B94 A;  5JJ6 A;  5KJN A;  2BTT A;  2VSX E;  4O1O A;  4KMO A;  3ZYM A;  3F6Q A;  3C72 A;  4GTM A;  1VDY A;  4KUL A;  3EH2 A;  4E2F B;  1NEG A;  2E70 A;  4UC4 A;  4CT0 A;  3L2V A;  4ZNX A;  4KGX B;  5FQ4 A;  4CCA A;  2XCB A;  3D9K A;  3SD4 A;  2YSQ A;  2CG3 A;  5KYW A;  2FI7 A;  1AEY A;  1EYH A;  3TSW A;  4C92 D;  2GF7 A;  1RAF B;  2LRQ A;  3A8H B;  4HS2 A;  2VSY A;  1N4S A;  4MML A;  1OI1 A;  2XS1 A;  2HL5 C;  2XEN A;  2EIL E;  4DBR A;  3V2O A;  1K0X A;  1E7O A;  4QVC A;  3QSU A;  5GAM h;  1O9S A;  3HP9 A;  4GML A;  4ANW A;  2I1J A;  2DZ9 A;  3X26 B;  4QQD A;  4DBH A;  3OXF A;  4FW1 A;  1VQ9 Q;  4ZFH A;  3SFZ A;  1GCQ C;  1QVF A;  2BED A;  2HL3 A;  3CVL A;  1X6O A;  3UQ3 A;  3F70 A;  3TVT A;  3PZ3 A;  2WXF A;  2J6F A;  4ATO A;  5ITZ F;  4U96 D;  4RTU A;  4G24 A;  2EIK E;  2CH4 W;  1I1J A;  2VXF A;  4M7A F;  1OPK A;  4Y91 A;  3FY4 A;  1Q86 R;  4C8Q G;  3ZYQ A;  4B93 B;  2RJD A;  2RFA A;  4F1P A;  3FDR A;  4DA4 A;  3NTK A;  3AS8 A;  1KJW A;  2XRZ A;  2LAI A;  1M2O A;  2M0Y A;  5A7D B;  5KYX B;  2MHK A;  3PVQ A;  3OW2 A;  1Q82 R;  3QC1 A;  3CMA A;  4RSY A;  3CVY A;  3ME9 A;  3U64 A;  5FW9 A;  3JSC A;  2IJG X;  1XGW A;  3EU5 A;  1WYX A;  4XU0 A;  4FW2 A;  2AHJ B;  1OCZ E;  4Q5W A;  3SDZ A;  2R58 A;  5ENN A;  1ZX6 A;  3H6Z A;  5IHI A;  3PZ1 A;  3KXT A;  2LT4 A;  2WXR A;  3CQG B;  2RMO A;  2O9S A;  3ML9 A;  2EKO A;  4FAD A;  1G3W A;  3EDT B;  2PVO B;  1KQS P;  3GOX A;  1MX2 A;  5FU6 C;  1YJN Q;  4G8K A;  2YRV A;  2DE0 X;  4F7U A;  5G04 J;  4AFZ C;  1XNF A;  5KBA A;  3CC7 Q;  3BDL A;  1FVF A;  2RI2 A;  4ZN1 A;  2H3J A;  1ZUY A;  1YA0 A;  3PZD A;  2LNI A;  1BBZ A;  1JUQ A;  3EIJ A;  3DST A;  3E9F A;  4KUD K;  2QGF B;  1Y7X A;  2I9C A;  4FYV B;  3CME A;  3CVP A;  2IPO B;  3V8K A;  3FB9 A;  1PCX A;  3OYD A;  1M3B A;  2DXU A;  3J80 E;  4GTR A;  3L9T A;  3LKU A;  5GAN d;  1TN8 A;  2L9B A;  2F69 A;  3L2Q A;  4HCZ A;  3M54 A;  3C3O A;  4ATZ D;  3QWX X;  4Z68 A;  5BPP A;  3QYH B;  2L3R A;  1NE8 A;  3KEA A;  3SBT B;  2DRK A;  2LCS A;  3X24 B;  2KVQ G;  4RTT A;  2RK1 A;  2IFU A;  3VUZ A;  3TWR A;  1X2Q A;  2R2L A;  5EX3 A;  1QZ2 A;  3GZS A;  2K3B A;  4C8Q F;  3VLD A;  3FUJ A;  3PE4 A;  1KFZ A;  2O4X A;  4UQY A;  4A63 B;  4L23 A;  2V4H C;  1X81 A;  4LNB A;  2L5Q A;  4JRI A;  2I0N A;  4PFZ A;  3RSE G;  2OOE A;  1GW6 A;  2D6F A;  1JEG A;  2XHC A;  1NA0 A;  5AQB A;  2H8H A;  3VS5 A;  3LCA A;  9ATC B;  2HDA A;  2KRN A;  2CP6 A;  2P0Q A;  4EMK C;  3J7A F;  4XK8 E;  3M57 A;  2VWF A;  5EYL A;  5ARG A;  3JCM Q;  4O6F A;  4APO A;  2PUK B;  3IKO B;  2RF0 A;  4EMH A;  1AP7 A;  2KCK A;  3GP8 A;  3D7S B;  5HKP A;  1RAA B;  1RAG B;  1JJ2 S;  1VQN Q;  3FEO A;  1QMC A;  2V1Q A;  2YUO A;  2VJ8 A;  3T8M A;  3L82 A;  5KJM A;  2DPP B;  5AN8 A;  5HK3 A;  1DCQ A;  4GZ5 A;  4DI4 A;  3CVX A;  3PMI A;  5LJ5 d;  3FJ5 A;  3Q1J A;  1Y57 A;  3OXG A;  2UY1 B;  1FVH A;  3TG5 A;  2FPE A;  4GYO A;  4WNF A;  3CV0 A;  4RTY A;  3CHM A;  2XID A;  2EQJ A;  1PKS A;  4A3V A;  2KRM A;  5D7U A;  5FLX E;  2DEQ A;  3EGD B;  5A6C A;  1WY6 A;  3VS7 A;  1H19 A;  3CPW S;  3CCS A;  4CC3 A;  2ROT A;  3AG2 E;  4N4H A;  2FHD A;  1Q86 C;  1V54 E;  4LRZ A;  1FMW A;  1K9A A;  4HI9 A;  1TH7 A;  4L59 A;  2DAQ A;  5DBK A;  4D6W A;  1Q7Y U;  1SZA A;  1EX4 A;  2FPD A;  3OYA A;  3PE0 A;  1ELK A;  4DOW A;  2J4B A;  3MJW A;  4L2L A;  2KXC A;  3M0U A;  4DQ2 A;  2OAW A;  3PNL B;  2F1L A;  4I17 A;  1MMA A;  2DJQ A;  4N4G A;  3AJI A;  4RG9 A;  1JXM A;  2YRD A;  4LG6 A;  5G05 C;  2M16 A;  4JVS A;  3SHF A;  2L2P A;  2R5M A;  1QVG P;  1TNZ A;  4C0E A;  1IKN D;  3LYI A;  3AU4 A;  2J49 A;  2QEX Q;  1K9M C;  4Q94 A;  2DBK A;  4BWR A;  3JCM f;  1Q82 C;  2C0T A;  4KVM A;  4BT8 A;  5GMK e;  2JJ9 A;  5AYW D;  3T9K A;  5KNG A;  4F7U E;  3ULE G;  2KXD A;  2F0Y A;  5BUZ A;  1D1B A;  2DIL A;  2CHZ A;  3DWL G;  1UE9 A;  1OWN A;  2GRR B;  4Z88 A;  4P29 A;  3NTI A;  4O6J A;  1UGP B;  3TWU A;  2K6D A;  2E3H A;  3MYV A;  3B7U X;  3LVQ E;  4JW1 A;  5J08 A;  3FIF A;  2QAZ A;  2CP2 A;  4LDW A;  3UAT A;  1YJN A;  3FFL A;  3CBP A;  5FZR A;  2V8J A;  1S72 T;  1WXU A;  3RMS A;  4C0M A;  2FZC B;  4M7D A;  2COY A;  3UUX A;  3W9F A;  3D9L A;  1Q81 C;  3IHY A;  3M59 A;  4J9G A;  3ESL A;  2XKO C;  1HG5 A;  3SHW A;  5FRN A;  3E37 A;  2I6H A;  2GGF A;  3RES A;  3NB2 A;  2CSQ A;  5HRY A;  2F2V A;  3M0S A;  1SZ9 A;  3E32 A;  3R7R A;  4XTZ A;  3EG3 A;  3X25 B;  4N39 A;  1S1N A;  2DVJ A;  3NZU A;  5JJ7 A;  3VS4 A;  3OYY A;  3D3M A;  4GU5 A;  1HX8 A;  3TG4 A;  5M9O A;  1VQL T;  2E41 A;  3U66 A;  3HIZ A;  1IGU A;  2WSE E;  1GFC A;  4OB1 B;  1Z3X A;  3HVE A;  2K57 A;  4FT4 A;  3E2U A;  1TEZ A;  1K1A A;  3DSX A;  2K5I A;  1D9S A;  4PJO C;  5CRV A;  3G71 A;  2HMA A;  1BI3 A;  2JMC A;  3M0Q A;  1Y0M A;  3MEA A;  1PSF A;  1ZUU A;  4OMO A;  3UDC A;  2EGE A;  5LJ5 g;  4B89 A;  4E7K A;  3IQL A;  1E6G A;  4HT8 A;  1PKT A;  3GNF B;  3P8B B;  3DKM A;  3V2X A;  3FC3 A;  2CP0 A;  2DVW A;  4ANX A;  1TUC A;  3CC4 T;  5GJW B;  5G04 C;  3V7R A;  4HXJ A;  3OS1 A;  2JMA A;  1NFI E;  3P8D A;  5A0L A;  4YDO A;  1AWX A;  4WNE A;  1QQJ A;  4UQZ A;  4FU3 A;  1GBR A;  4YND A;  3JCM b;  3E34 A;  4KZ0 A;  1PG5 B;  4X9D A;  1VQP A;  4F04 B;  4GTP A;  2BZX A;  4X9C A;  3UA7 A;  4XTX A;  2KEA A;  3JCM P;  4QQ6 A;  5M72 A;  4H7Y A;  2GFA A;  3MPU B;  4P5N A;  5D66 A;  3L17 A;  4II1 A;  5IT9 E;  2ATC B;  2X51 A;  1ZSG A;  2AIR B;  1S63 A;  4PLI A;  2MMP A;  4MZM A;  4AVX A;  3CK9 A;  2DD4 A;  5AEN A;  3M56 A;  3DRA A;  4HVV A;  4M78 C;  2DLP A;  4UWF A;  2KM4 A;  1E7V A;  3T5V A;  1QNF A;  4Y6C A;  2C0I A;  4GB9 A;  2YT6 A;  3Q47 B;  2GRQ B;  3VS3 A;  3ER0 A;  3R9A B;  1UG3 A;  1R77 A;  4HOS A;  2M51 A;  4HLL A;  2ZGG A;  1VQ4 T;  4AP2 A;  4HRN A;  5EID A;  2X9H A;  3SEM A;  1W2B S;  3FTY A;  2X4Y A;  4JHK A;  2NUP B;  4FYW B;  2AXU A;  1JBM A;  2H6F A;  3FTU A;  3MGB A;  3CCM T;  3X28 B;  3OYC A;  3MP8 A;  1K8A R;  3RKW A;  2XGS A;  3S7F A;  3U4T A;  5AYF A;  2YLC A;  4XEI G;  2CYZ B;  2YQ8 A;  1M3A A;  2RQV A;  4PUC A;  3AU5 A;  2OEW A;  4FC8 A;  5E76 A;  1NYG A;  8AT1 B;  3U9W A;  1E8W A;  2C2L A;  4CZ2 D;  1VQ7 Q;  4BY6 C;  4X1V A;  4X34 A;  2FVU A;  3EG9 B;  2YHE A;  2IG0 A;  2R5A A;  1Y6I A;  3LJ3 A;  4RG2 A;  3FTW A;  4HI8 A;  3MEV A;  1YMP A;  4N2Q A;  3HXC A;  1H3H A;  1BI1 A;  2RB6 A;  4RTV A;  4E6H A;  1SRL A;  5EIL A;  1AHJ B;  4FT2 A;  4N3A A;  1HFA A;  3UKR G;  1TUD A;  1ABO A;  4AG1 C;  3CCE T;  2PUO B;  3ZHE A;  1UG1 A;  3ISM C;  2NUZ A;  2DET A;  1R0C B;  4W9R A;  2XMF A;  4KXK B;  1ZBP A;  3G71 T;  2GRL A;  3OYF A;  5CQY A;  3OQ5 A;  1W4S A;  2OTL A;  1RLQ C;  2XDB A;  2L3P A;  1ZSZ C;  5GAM g;  4GA1 A;  1D0X A;  3PRZ A;  3IV0 A;  2NSZ A;  3EFR A;  3L22 A;  4M3O A;  3IXE A;  1W70 A;  2DD5 A;  3CEQ A;  3CHO A;  4KBQ A;  3ZVV A;  1VQO A;  1OYX A;  4CYM D;  4B9X A;  4IUV A;  3I55 A;  5IH2 A;  3ZIM A;  2FEI A;  1QVF P;  1VOM A;  4J8O A;  1M90 U;  1O1S A;  3X2Q E;  1SG5 A;  3GNG A;  4M78 E;  4NS5 A;  3FDH A;  2RQT A;  5AAO A;  4YDY A;  3T9N A;  4M7A A;  1A17 A;  3R7Q A;  4M7D D;  1SRM A;  4M7A D;  4BDY A;  3T5X A;  5D2M C;  3OS2 A;  4OB0 B;  4M75 C;  5C6S A;  2AK5 A;  4EPC A;  2DXC A;  3ZU7 B;  4J7I A;  4RTX A;  2DBA A;  1N9S A;  3DLM A;  1K73 R;  1AWW A;  2CUD A;  3M58 A;  2VGX A;  3FUN A;  2HQE A;  3C3R A;  2L0T B;  1HXD A;  4HB5 A;  4F14 A;  2HD0 A;  2FRY A;  2V8S E;  4NRH B;  4TUU A;  1D0Y A;  3EGU A;  1D1A A;  4C5H A;  4U95 D; 
#chains in the Genus database with same CATH homology
 1U3O A;  2MYO A;  2XZT G;  1BK2 A;  2CT4 A;  1JXO A;  1WFW A;  4ZHB A;  2L6B A;  3RBB B;  1BU1 A;  5AAR A;  4JJB A;  4DX1 A;  2DL5 A;  2ECZ A;  1WDX A;  4O60 A;  5FWC A;  4D8D A;  4JJD A;  4BEP A;  1OOT A;  1UFF A;  4LUE A;  4AFQ C;  2HBW A;  1QYM A;  2BZ8 A;  2BTT A;  4BER A;  3THK A;  1M8M A;  4O1O A;  2YUN A;  1CKA A;  3F6Q A;  3EHQ A;  2QC9 A;  2FO0 A;  2GGR A;  3UI2 A;  1OY3 D;  1YN8 A;  1WX6 A;  4E6R A;  1NEG A;  3REA B;  4J9I A;  4LUD A;  4ZNX A;  4OAU C;  3CQT A;  5JMN D;  1YWO A;  1HJD A;  2YSQ A;  2D0N A;  4BES A;  1AEY A;  1J3T A;  3TSW A;  2EGA A;  3VS2 A;  1ZLM A;  1OEB A;  3EG1 A;  1IHB A;  2O2O A;  2B86 A;  3VRZ A;  2XEN A;  3D9H A;  1SPK A;  2JAB A;  2HSP A;  3V2O A;  1X69 A;  1K0X A;  2V5Q C;  1E7O A;  4J9E A;  4J9C A;  2BKG A;  2B0O E;  1JO8 A;  3DEO A;  4AG2 C;  4ZFH A;  1RUW A;  4QQI A;  1GCQ C;  3V31 A;  2XEE A;  4UUC A;  4D8K A;  1X2K A;  3TVT A;  2D1X A;  4R0K A;  5ECA A;  4U8V D;  1WXB A;  1N5Z A;  1BU9 A;  5ITZ F;  4U96 D;  2XZD G;  1RLP C;  2J6F A;  2PNI A;  3KFV A;  4FSS A;  4LN2 A;  3W9G A;  4RTU A;  2CH4 W;  1H92 A;  1I1J A;  1OPK A;  2ETB A;  2KT1 A;  4J9D A;  4B93 B;  2RFA A;  4F1P A;  3A98 A;  2EQI A;  4K5A B;  4K5B A;  5BXU A;  3VS6 A;  1KJW A;  1UJ0 A;  4CC2 A;  2KRO A;  2M0Y A;  5CEA A;  2K9G A;  1AWO A;  1WDY A;  3PVQ A;  3Q9N C;  2CH4 A;  4GBQ A;  1I0C A;  1QWF A;  4LNP A;  1Z9Q A;  5FW9 A;  3VS1 A;  2IIM A;  2F2W A;  3H0I A;  1UTI A;  3JXI A;  4DUI A;  2OJ2 A;  1WYX A;  5AQA A;  2AZV A;  2EBP A;  4DX5 D;  4GPM A;  1ZUK A;  2DX1 A;  1ZX6 A;  3TWX A;  1WA7 A;  2D8J A;  2LQN A;  5IHI A;  2KE9 A;  1T0H A;  1MJ0 A;  2DZN A;  4HVU A;  3UTM A;  4NIK A;  2O9V A;  2RMO A;  2O9S A;  2JM8 A;  4F16 A;  2DM1 A;  1X27 A;  2J8S D;  2L3S A;  1MX2 A;  1UOH A;  2F2X A;  4G8K A;  2CRE A;  1G83 A;  1E6H A;  2DE0 X;  2KR3 A;  4AFZ C;  4HNA D;  2JT4 A;  5KBA A;  3TWS A;  1T3S A;  1WI7 A;  3TSZ A;  1ZUY A;  1MV3 A;  1BBZ A;  2JS0 A;  2FPF A;  4OAV B;  2YDL A;  3UA6 A;  2J06 A;  2J6K A;  4RUG A;  1BB9 A;  2GTJ A;  5FIO A;  1M3B A;  1PRL C;  5EN5 D;  4AFS C;  1NLO C;  3ZUV B;  1X6B A;  2K7A A;  5ENT D;  4ATZ D;  5CED B;  2J05 A;  1PWT A;  3NOG D;  1ARK A;  1YCS B;  3NGP A;  4HBD A;  4Z68 A;  2A36 A;  3QWX X;  3VS0 A;  2EW3 A;  3KEA A;  2LCS A;  2DRK A;  2XEH A;  1YWP A;  4RTT A;  2RQW A;  3TWR A;  1X2Q A;  2EYZ A;  1K4U S;  1MX4 A;  1AWJ A;  5ENQ D;  1GCP A;  1W6X A;  2K3B A;  2KGT A;  2AZS A;  1KFZ A;  4A63 B;  5CER B;  2V4H C;  3HG0 D;  4YDW A;  2KYB A;  3B7B A;  5AQ7 A;  1NEB A;  2ED1 A;  2I0N A;  1QKX A;  1JEG A;  3I9Q A;  5AQB A;  2H8H A;  3VS5 A;  1GFD A;  4AFU C;  1BD8 A;  1WIE A;  2HDA A;  2DWZ A;  2K79 A;  5I11 A;  3HRA A;  2KRN A;  4JJC A;  4IIM A;  4DX7 D;  2VVK A;  1G3N B;  4C48 B;  2VWF A;  1MX6 A;  5EYL A;  1KSW A;  1QCF A;  5IHN A;  2A5E A;  1VYV A;  2FRW A;  3LH5 A;  2FG0 A;  2RF0 A;  1CKB A;  1AP7 A;  1U5S A;  4HRM B;  2HE0 A;  5HKP A;  2DRM A;  2NWM A;  1U06 A;  2RNA A;  4HVW A;  5EC7 A;  2V1Q A;  2YUO A;  5L23 A;  2A08 A;  2LJ3 A;  1SVX A;  1AD5 A;  5FWB A;  1AZG B;  3TWV A;  5AN8 A;  1X6G A;  3M0T A;  1DCQ A;  2ETC A;  1M3C A;  2D8H A;  3J5P A;  1GRI A;  3FJ5 A;  1Y57 A;  2FPE A;  1GCQ A;  4RTY A;  2JS2 A;  1NYF A;  4OMQ A;  2DZO A;  1PKS A;  1OT8 A;  3EHR A;  4GMR A;  2A28 A;  2KRM A;  2QDL A;  3VS7 A;  3ZNG A;  5CBO A;  1OV3 A;  4CC3 A;  2ROT A;  2X3W D;  1K9A A;  4HI9 A;  3C0C A;  2CT3 A;  1SW6 A;  2ROL A;  4M4Z A;  2FO1 E;  2Y1L E;  2E5K A;  4WCI A;  2F8Y A;  1A0N B;  1Z9Z A;  4OMM A;  1VA7 A;  4Y92 A;  1PNJ A;  2FPD A;  3PE0 A;  2AKL A;  2KXC A;  3M0U A;  2MOX A;  2OAW A;  1OPL A;  2DJQ A;  1K0S A;  3AJI A;  1JXM A;  4LG6 A;  1H8K A;  2L2P A;  4TUM A;  1UGV A;  1IKN D;  2LJ1 A;  3J5Q B;  2DBK A;  2Y0B G;  1UDL A;  4BET A;  2ETA A;  5ENS D;  1UHF A;  2C0T A;  1V1C A;  4ORZ A;  3NPF A;  4LSZ E;  3T9K A;  5KNG A;  5HS0 A;  3M0P A;  2KXD A;  4F6R D;  5I22 A;  5ENP D;  2DIL A;  3RNJ A;  2RFM A;  2GQI A;  1UE9 A;  4G8L A;  2ESW A;  2P4R A;  1NM7 A;  4J9H A;  4Z88 A;  2LJ0 A;  1WLP B;  3GBQ A;  3TWU A;  4HCK A;  1AVZ C;  1SHG A;  2ED0 A;  2K6D A;  2CUB A;  4JPB W;  1LCK A;  3ZL7 C;  2KBX A;  3UAT A;  4LE9 A;  2MIO A;  1WXU A;  2DL8 A;  1G2B A;  2ENM A;  1UJY A;  4U8Y D;  3R6N A;  3W9F A;  5HCK A;  2PNN A;  4J9G A;  4QFV A;  2A37 A;  3QWY A;  1SSH A;  1YNZ A;  3NMZ C;  2DL7 A;  1DC2 A;  4OMP A;  3SHW A;  1AZE A;  4N5Q A;  5EIB E;  2CSQ A;  5HRY A;  2F2V A;  5ENO D;  5CEC B;  4RTZ A;  1S70 B;  4K5C A;  3M0S A;  5IXB A;  2PTK A;  2NYJ A;  2L0A A;  2LNH B;  3EG3 A;  1X43 A;  2LX7 A;  2EYW A;  1S1N A;  1SHF A;  2DVJ A;  4DEX A;  3VS4 A;  1MV0 B;  2EYX A;  3H0H A;  2EVR A;  1MYO A;  1K3Z D;  2GBQ A;  1GFC A;  2EYY A;  3DEP A;  2KBT A;  3PVL A;  1K1A A;  3B95 A;  2RQR A;  3REB B;  3JXJ A;  1FMK A;  1A5E A;  1D9S A;  4ESR A;  2SRC A;  2JMC A;  3M0Q A;  1Y0M A;  2ABL A;  4OMO A;  1ZUU A;  5GJV B;  1KIK A;  2EGE A;  2DL4 A;  2BKK B;  1UUE A;  1E6G A;  3IQL A;  3LJN A;  1PKT A;  2JW4 A;  3V2X A;  2DVW A;  3H41 A;  1I07 A;  1QLY A;  1TUC A;  2HEQ A;  3Q9U C;  4BSZ B;  5CBN A;  2L3Q A;  4HXJ A;  5GJW B;  4KRT A;  4Z89 A;  2JMA A;  4JZ4 A;  2OI3 A;  2VKN A;  3UF4 A;  4OML A;  1AOJ A;  2JXB A;  1NFI E;  1EFN A;  1AWX A;  1HD3 A;  2KNB B;  1IXV A;  3H0F A;  1HSQ A;  1GBR A;  3SO8 A;  2K2M A;  4OMN A;  2G6F X;  2QYJ A;  1ABQ A;  1N0Q A;  1K76 A;  2BZX A;  2DL3 A;  4O1P A;  5IHK A;  1RI9 A;  2KXP C;  3T8K A;  3UA7 A;  4DRX E;  2KEA A;  4DX6 D;  1K1B A;  3NBN B;  3JUE A;  2EPD A;  1B07 A;  4HQD A;  1NG2 A;  3EG0 A;  1MUZ A;  5D66 A;  1UEC A;  2J6O A;  4DEY A;  5IXF A;  1XOV A;  1ZSG A;  2DF6 A;  1BI7 B;  2DBM A;  2JM9 A;  1AWC B;  4HVV A;  3ZKJ A;  2DLP A;  2C0I A;  2YT6 A;  3VS3 A;  4DX2 A;  3TWQ A;  2M51 A;  4HLL A;  2ZGG A;  2LZ6 B;  1M30 A;  1JU5 C;  4HRN A;  1GL5 A;  5EID A;  3SEM A;  1YP5 A;  4JZ3 A;  5ENR D;  2AJA A;  3TWT A;  4RLY A;  1GBQ A;  4K11 A;  2VGE A;  5EYP F;  2KRS A;  1M3A A;  2RQV A;  2CDT A;  2DYB A;  2F8X K;  2SEM A;  2CSI A;  1NYG A;  1WXT A;  1BI8 B;  2W0Z A;  4JB8 P;  1IO6 A;  4CZ2 D;  5BXO A;  2DNU A;  2X3X D;  4X1V A;  3C5R A;  1QKW A;  4IIO A;  3ULR B;  3EG2 A;  1N0R A;  5AQ9 A;  2KT8 A;  4LNU D;  2LQW A;  3V30 A;  3O5Z A;  4GLM A;  3I35 A;  2RN8 A;  3I5S A;  4HI8 A;  1YMP A;  2GNC A;  4CC4 B;  1H3H A;  2BZY A;  4RTV A;  1SRL A;  3VRY A;  4J7W A;  5JA4 D;  1PRM C;  5EIL A;  2P2C P;  1WG0 A;  4CC7 A;  1TR4 A;  1TUD A;  1ABO A;  4AG1 C;  4F17 A;  4QT7 A;  4J9B A;  2J7I A;  1UG1 A;  2NUZ A;  2O88 A;  5KNH D;  2XMF A;  1M27 C;  1BLX B;  2KYM A;  1B3Q A;  4Z8A A;  2ZGD A;  1N11 A;  5KWD A;  1RLQ C;  1W1F A;  2L3P A;  1ZBJ A;  2O31 A;  2PZ1 A;  4HRL A;  4J8Y A;  1T0J A;  2EKH A;  2RPN A;  3UXG A;  5FIN A;  3IXE A;  1W70 A;  1JQQ A;  1QWE A;  3U23 A;  3NOC D;  2DA9 A;  3I5R A;  2LMJ A;  4CYM D;  2HCK A;  1T3L A;  3NHN A;  2FEI A;  1NLP C;  5IH2 A;  2AKK A;  2LP5 A;  3EU9 A;  2YUQ A;  1SEM A;  3AAA C;  2RQT A;  5AAO A;  4YDY A;  2GTO A;  2MCN A;  4J9F A;  1CSK A;  4EIK A;  3M0R A;  1SRM A;  2JTE A;  2AK5 A;  3ZU7 B;  3JV3 A;  4RTX A;  1UHC A;  3TWW A;  1AWW A;  3V79 K;  2CUD A;  1VYU A;  2EGC A;  2F37 A;  1YYH A;  1FYN A;  2W10 A;  2YUP A;  1PHT A;  2V1R A;  4HB5 A;  1K1Z A;  4F14 A;  2FRY A;  1TG0 A;  2C0O A;  2DMO A;  4RTW A;  3EGU A;  1VYT A;  4U95 D;  2RQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...