4A63B

Crystal structure of the p73-aspp2 complex at 2.6a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
202
Chain Sequence
b'MRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUMOUR PROTEIN 73
publication title Structural Basis for Aspp2 Recognition by the Tumor Suppressor P73.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 59
structure length 202
sequence length 202
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
B PF00023 Ank Ankyrin repeat
B PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4a63B01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4a63B02
2DILA 2EPDA 1S70B 1X27A 2PZ1A 1M3BA 3A98A 1J3TA 1NYGA 4OMQA 4J9HA 2OJ2A 1GCQA 1NG2A 1PHTA 3C5RA 1ABOA 5ENRD 3T8KA 1VYVA 4HCKA 3HG0D 3NMZC 2YT6A 1JXMA 2EBPA 4QQIA 5EN5D 2YUNA 4JZ4A 5EIDA 1WLPB 4GPMA 1OPKA 1YP5A 2A28A 2J05A 2OAWA 2JMCA 2KBTA 2BTTA 1GL5A 4LNUD 2KXDA 1AWXA 2MOXA 3NOCD 2FRWA 2LNHB 1A0NB 2VVKA 1WA7A 4QT7A 2X3XD 2L3QA 5CEDB 5IH2A 2CDTA 1KFZA 2M0YA 2SRCA 2RNAA 5FWBA 4U8VD 5CECB 2RQRA 3V30A 2KE9A 2RPNA 1YN8A 5I22A 3TWWA 1TUCA 2L0AA 4HB5A 3H0HA 5HCKA 5GJVB 4OAUC 1TUDA 2LJ3A 4B93B 1D9SA 3M0RA 5I11A 2B86A 1N0RA 2EKHA 3H41A 4HVWA 2XEHA 3JXIA 1WI7A 4F1PA 2ABLA 2JABA 2CSIA 4RUGA 1U5SA 1T0HA 1OT8A 1PRLC 1IHBA 1BI8B 2KT1A 2XMFA 1QWFA 2KRSA 1WG0A 4J9FA 1QYMA 5FIOA 4HRLA 1E7OA 1WDXA 4AFUC 1AZEA 1UE9A 1K76A 1PWTA 2C0OA 1G83A 2EGCA 3CQTA 1NLOC 4AFZC 2DRMA 3VS3A 5EIBE 1W70A 2XENA 4G8KA 2F8YA 2XZTG 2BZYA 2O88A 1JO8A 2O9VA 4Z8AA 2ETBA 2F37A 1X6BA 4YDYA 1N11A 1EFNA 2A37A 4EIKA 3TWXA 1H8KA 1WIEA 5HS0A 2HE0A 2B0OE 3VS4A 1I07A 4RTYA 1QWEA 1T3LA 1I1JA 1KIKA 3V31A 1Y57A 2LQNA 3EG1A 4AFSC 1X2KA 4F17A 1AWOA 4LG6A 2DWZA 1UOHA 2L6BA 2FEIA 1PRMC 2CH4A 2PNIA 4D8KA 2ED0A 1GCQC 2HEQA 1BK2A 4YDWA 1K1AA 5CBOA 5JA4D 5IHIA 3GBQA 1QCFA 2RQVA 3VS1A 1VYUA 2EW3A 3H0FA 5AQAA 1BU1A 1AWCB 2AK5A 4DX7D 2VGEA 3UTMA 2HDAA 3SO8A 2DMOA 1X2QA 2ENMA 3EHRA 1JXOA 2W0ZA 5EYPF 2XZDG 1X6GA 5KNHD 2PTKA 1SRLA 4JJDA 1RLPC 1SEMA 2LJ0A 5CEAA 1IXVA 4J9CA 2RF0A 2ZGGA 5EYLA 1OEBA 2I0NA 4ZNXA 1UHFA 1JEGA 2FO1E 1CSKA 2JXBA 4O1PA 2SEMA 3TSWA 4AG1C 2ROTA 4K5BA 2DLPA 4RTZA 3W9GA 4HI9A 2MCNA 3U23A 4BEPA 2K6DA 1UG1A 4CC7A 5IHNA 3T9KA 2L3SA 3TWUA 4F16A 4UUCA 4C48B 1G3NB 4J8YA 1UDLA 3J5PA 2JM8A 1GCPA 2DA9A 1N0QA 3I5SA 2JS0A 4X1VA 2GBQA 2A36A 5BXUA 2F8XK 1ZUYA 2K7AA 2YSQA 3I9QA 1LCKA 4OMPA 3UA6A 2P4RA 4DRXE 4LUEA 2KXCA 3VS2A 4IIMA 2RFMA 1UHCA 2P2CP 2VKNA 3EG2A 4F14A 3M0QA 4DX2A 1W6XA 2OI3A 2ROLA 1UFFA 2NYJA 2JS2A 4RTVA 4ATZD 2J6FA 1ZUKA 1ZBJA 1YMPA 1CKAA 2F2XA 2LP5A 5FW9A 1V1CA 1E6GA 4OMMA 2JT4A 2X3WD 1BLXB 1UJYA 1OPLA 2A5EA 4U95D 2KGTA 1M3AA 2CT3A 2DM1A 3ZUVB 2V1RA 2EVRA 1NEBA 4ESRA 5CBNA 1K0XA 1X43A 2O9SA 3KEAA 4J7WA 1RI9A 4J9GA 3AAAC 3TWRA 3VRYA 1NEGA 2BZXA 1IO6A 2DL4A 5ENPD 1UUEA 2V1QA 1SPKA 2AZSA 5FWCA 4O60A 2ESWA 5KBAA 3RBBB 1T0JA 4CC3A 3EG0A 4A63B 4JJBA 2RQTA 4ZFHA 3M0TA 1QLYA 4HBDA 1SHGA 1KSWA 1WYXA 1GRIA 3ZU7B 3V2OA 1B07A 1N5ZA 2EYXA 1QKWA 4LE9A 4QFVA 2BKGA 2GQIA 2KNBB 2KR3A 2AKLA 1SSHA 5IHKA 4AFQC 1ARKA 3M0UA 2MYOA 1UJ0A 5JMND 2DJQA 2FPDA 1MX6A 2KROA 1WXUA 1UECA 2RFAA 1SHFA 2CREA 1M8MA 3EGUA 4Z68A 1RLQC 2EYWA 1AEYA 1B3QA 3ZL7C 3DEOA 2YUPA 2MIOA 1WDYA 2L3PA 3SEMA 1JU5C 4TUMA 4OMOA 1UTIA 2KXPC 5EC7A 5AQBA 4BESA 1KJWA 2VWFA 2NWMA 1SVXA 1GBRA 3UF4A 3QWYA 3VS7A 4E6RA 3JV3A 3REAB 1QKXA 3IQLA 3AJIA 4U96D 3D9HA 1Z9ZA 2V5QC 2DE0X 3SHWA 2KBXA 2KRMA 1XOVA 4DX1A 2FRYA 2YDLA 3I35A 2JTEA 3J5QB 1NM7A 2C0TA 2JW4A 2ZGDA 4DX5D 1DC2A 1PKSA 1S1NA 2LJ1A 1YNZA 2CT4A 3PE0A 1GFDA 2GTJA 1K9AA 4LSZE 2DL5A 1H3HA 2DL8A 1SW6A 4K5CA 2F2WA 4CC2A 1YYHA 5ITZF 4RTXA 2HBWA 1AZGB 2ED1A 4WCIA 4HXJA 1X69A 2QYJA 3H0IA 5CERB 3VRZA 2CH4W 2DL7A 2DVJA 5AN8A 4ZHBA 2EQIA 2FPEA 2XEEA 2K79A 1OY3D 2DBKA 1NLPC 4IIOA 3HRAA 3Q9NC 5AARA 1PNJA 4ORZA 1NYFA 3TVTA 1AP7A 1M3CA 1MX4A 4HI8A 3EU9A 4NIKA 5D66A 3B95A 1U3OA 1U06A 2H8HA 1JQQA 4CC4B 4AG2C 2BZ8A 3ZKJA 2AZVA 2LZ6B 2D0NA 3EG3A 1W1FA 4Z89A 3M0PA 2CUBA 3RNJA 3NOGD 2K3BA 4DEYA 1YCSB 1M27C 2GTOA 2RMOA 1DCQA 4K11A 4HVVA 4J9IA 2DL3A 5KNGA 2DNUA 4JJCA 2CUDA 1CKBA 4J9BA 4JPBW 5ENOD 1VA7A 4RTTA 2DBMA 5ECAA 2J6OA 4OAVB 1IKND 5ENSD 4G8LA 1ZX6A 5ENQD 2D8JA 4BSZB 2EGEA 4HQDA 5FINA 1SRMA 5BXOA 2J7IA 3NBNB 3VS5A 2J6KA 1ZSGA 4D8DA 4J9EA 2KEAA 2PNNA 2ECZA 3O5ZA 1AOJA 2KYMA 4KRTA 3EHQA 3REBB 2DVWA 1MV3A 1MV0B 1NFIE 5HKPA 1BD8A 4HNAD 4JB8P 4HVUA 3TSZA 1K4US 1MUZA 3NGPA 3V2XA 2GNCA 2F2VA 2M51A 2DRKA 2YUOA 3I5RA 5KWDA 3W9FA 1YWPA 4DX6D 1K1ZA 4HRMB 4F6RD 2DF6A 3NPFA 1K3ZD 2ETAA 1Y0MA 5ENTD 1WXBA 2K9GA 1M30A 4RTUA 4HRNA 2HSPA 3V79K 2DYBA 3F6QA 3LJNA 5AQ7A 1AVZC 4J9DA 1ZLMA 2L2PA 3C0CA 1FYNA 2KRNA 4BETA 2O2OA 2J06A 1HSQA 3UATA 1ABQA 4M4ZA 2RN8A 1HD3A 4GLMA 2QDLA 5IXBA 3ZNGA 1GFCA 1MJ0A 4LN2A 3B7BA 3THKA 4N5QA 1OOTA 2D8HA 2J8SD 2G6FX 2Y1LE 2JM9A 2KYBA 2V4HC 4Y92A 3VS0A 2IIMA 4Z88A 1MX2A 3M0SA 4LUDA 1K0SA 2Y0BG 4GBQA 1I0CA 2O31A 3JXJA 1GBQA 2JMAA 1AD5A 1H92A 1K1BA 1HJDA 3TWTA 2W10A 2AKKA 2LX7A 4JZ3A 1AWWA 1YWOA 3IXEA 4CZ2D 3TWVA 2E5KA 2YUQA 2BKKB 1T3SA 3UI2A 2GGRA 2EYYA 3NHNA 3PVLA 4K5AB 2AJAA 5AAOA 1G2BA 2D1XA 2DX1A 3TWQA 5L23A 1A5EA 3DEPA 4R0KA 1UGVA 2RQWA 4DEXA 4FSSA 4OMLA 1WX6A 2EYZA 1FMKA 4CYMD 2RQUA 2DZNA 3TWSA 3Q9UC 2CSQA 5GJWB 2HCKA 2A08A 2FPFA 2EGAA 2NUZA 3FJ5A 1VYTA 1ZUUA 4O1OA 3LH5A 1BI7B 1OV3A 4U8YD 3JUEA 1TG0A 1WXTA 1RUWA 4OMNA 1TR4A 5IXFA 1WFWA 4RTWA 1MYOA 1BU9A 3KFVA 2QC9A 4GMRA 5AQ9A 1E6HA 2C0IA 3R6NA 2K2MA 3UXGA 1BBZA 1AWJA 2DZOA 4RLYA 1BB9A 4DUIA 2FG0A 3VS6A 3QWXX 2LCSA 2ETCA 4HLLA 2LQWA 1PKTA 5HRYA 2FO0A 3ULRB 4BERA 1Z9QA 3PVQA 2LMJA 3UA7A 2KT8A 4LNPA 5EILA
chains in the Genus database with same CATH superfamily
2DILA 4XTXA 2OOEA 4IYPA 2O4XB 5FROA 1X27A 2QQAA 4CGWA 3D9IA 1J3TA 1VQ8Q 4OMQA 4XIFA 2GW1A 1NG2A 1WHKA 1PHTA 4J8SA 3QUIA 1ABOA 5KJLA 4HCKA 4MRUA 3CCRQ 5GMKe 1MNEA 1QVFA 1IHGA 2HL3A 5EIDA 1YP5A 1OPKA 2J05A 2MOWA 3GZ2A 1HYOA 2WSEE 4C92C 3DPDA 2JMCA 2KBTA 1GL5A 2EIME 1PC0A 2Y90A 4M7DD 2VSYA 4L6V5 4QT7A 1KFZA 3CCMA 4ZTFA 3CHMA 2RNAA 5DBKA 4FSXA 5FWBA 3MPUB 3CIAA 4U8VD 4F7UF 3LYAA 5I22A 1YN8A 1N4SA 1V29B 1TUCA 2PVOB 3H0HA 4HB5A 5GJVB 2EQKA 3VUBA 3L17A 4BY6B 5I11A 3RMSA 1MMDA 4AY5A 4GAAA 4BWRA 1WNLA 2EKHA 3H41A 3QKJA 4DBRA 1KQSA 1B34B 2L6JA 3JXIA 1WI7A 4XZ4A 3V7RA 3CCQQ 4PJMA 2AIRB 2JABA 5EDSA 4F7AA 1BI3A 4DK5A 1W2BP 3KEZA 1OWPA 5G2NA 2KRSA 3L2UA 2IQCA 3SI5A 2K2VA 3I3NA 5FIOA 4HRLA 2WQ6A 1AZEA 3PREA 1PWTA 2NLUA 4AFZC 1NLOC 3S7JA 2DRMA 3J7AF 3VS3A 3UUXA 4FT4A 4URKA 2EWNA 2XENA 1NP7A 2F8YA 4Z8AA 2D6FA 4WUYA 1H3ZA 2F37A 4ABNA 5ARGA 3UQ3A 1EFNA 5GAMe 1YJNT 2WXFA 2A4ZA 2XK0A 2HE0A 2B0OE 4IUTA 2QTXA 1I07A 5JHAA 4ILGA 2RJFA 3SWNA 1PC2A 1KIKA 1K8AC 2LQNA 5C1DA 2JZ2A 1RAFB 1BIBA 5G55A 1UOHA 4QQDA 1WAO1 2ILRA 4Q96A 2CH4A 4UQXA 3QZ5B 2HL5C 2YWWA 3CVXA 4LDYA 1BK2A 5LJ3g 1YJNA 2KI7A 2R57A 2Y4UA 4M78F 5A0DA 1TS9A 1VYUA 2P9LG 3H0FA 2OTJA 2QFCA 2ZPEB 3CPWA 1XTDA 2HDAA 3OBWA 2DYIA 5GANh 3GF5A 3MP1A 4UWFA 3PZ4A 1Y96A 3RDVA 1JWGA 1E8ZA 4O5VA 3CMAQ 3EG9A 2LJ0A 1IXVA 4M77A 3OYFA 4J9CA 2RF0A 2J4DA 1G3TA 4AXHA 5LX8A 2KCKA 1OEBA 3O48A 1CSKA 4XQ3A 4AG1C 1RADB 4FU6A 5T4YA 3TEEA 2EJGA 4K5BA 5AIJA 5G05C 4J83A 2MCNA 4ATGA 4BEPA 2K6DA 3EHNA 4G23A 4R55A 4CEMA 4LEUA 2RK2A 4C8QD 1XGWA 3ASGA 3SFZA 2L3SA 3MEKA 2EQMA 5AYWD 3LY8A 1G3NB 3UT8A 4C48B 3JCMW 1YA0A 3G6ET 3D9LA 2QK0A 2EKOA 4FYVB 4IUQA 3G4ST 5BXUA 2F8XK 1LD7A 3I9QA 3L82A 3ZRHA 1MMGA 2P4RA 2C06A 4LUEA 2KXCA 5KYUA 4GCOA 3HL8A 3VS2A 3BY7A 2LNVA 2K3YA 3EG2A 4RVBA 2OI3A 2JS2A 3AS4A 2YRDA 1ZUKA 3PIPA 4HOUA 4JRIA 4CT0A 3U3WA 4XTZA 9ATCB 2XG8D 1E6GA 3DXKG 3SWNC 3G6EA 2X3WD 4O6JA 1UJYA 3G4SA 1E7VA 2YHCA 3SNXA 3NFCA 4N2QA 1SZAA 4AY6A 2H6IA 3PMIA 4IURA 5G04C 2Z0WA 5CBNA 1QW1A 1X43A 3U4TA 2VSXE 3KEAA 2X4YA 3MEAA 1KLXA 1TNBA 5J90A 1N8RU 4J9GA 3AAAC 4GTOA 4DLQA 4AT1B 5CQYA 2BZXA 1WJRA 5CRUA 4JEUA 3HXCA 3PE3A 4FC8A 4HLEA 4RKUE 3CCSA 5ENPD 3AT1B 4JJNK 1Q86R 5AENA 2AZSA 3HVEB 5FWCA 5FTPA 2OCCE 4RCBA 1Q7YU 1T0JA 4CC3A 3EG0A 5FZRA 4JJBA 4C0GA 3U64A 2KC7A 2FB7A 2CYZB 3ZU7B 2COWA 2EYXA 3UIOC 2F1LA 3ABME 4LE9A 1X75C 2RHYA 2F0YA 4E47A 3FH5A 3ZBDA 2AKLA 1C1AA 3B13A 3RKXA 1SSHA 3SFMA 2WXHA 3M0UA 3QJZA 5A23A 5BNWA 5CR2A 2ZXWE 3OYJA 1IZ6A 1RAEB 2ZPHB 1DJ7B 1FVHA 2LT4A 3G2WA 2ZPIB 2ZPFB 1WPYA 1UEBA 4FYWB 2XEVA 4APFA 4A4FA 2QTVA 3CXCS 4PJJA 5FLXE 1AEYA 5CRVA 4Q5WA 3TG4A 2KZTB 1B3QA 2BKDN 5KE3A 3DLLA 3DEOA 2LT1A 2YUPA 3CPFA 3UM3A 3SEMA 3S3OA 2C0MA 4OMOA 4XTYA 5EC7A 2DKGA 1SVXA 2CP5A 4I2WA 3ML8A 3WVDB 4UWKA 1YI2T 3AJIA 3LW5E 4QW2A 1B34A 3SHFA 3U66A 3I55T 5CMYA 2IJGX 2J09A 3JSCA 2E0IA 4FL6A 2DE0X 4G26A 4UWLA 1BYMA 2KBXA 2KRMA 1OWOA 2YRCA 4ILIA 4EMKA 3ULYA 4DX1A 2YDLA 2R2LA 4EPCA 3TU4K 4YDEA 5LJ3f 2C0TA 2JW4A 1FVFA 3L2VA 4DX5D 1TN8A 1PM3A 4M78A 2CT4A 3H6ZA 4Q69A 2GTJA 2R5SA 4LSZE 3ME9A 1H3HA 1YI2A 3I55A 2R02A 1YYHA 4II1A 4DI4A 1AZGB 3UMVA 1LD8A 4KYOB 5FU7B 5JHBA 3HXFA 3ESKA 3NZUA 1X69A 3VRZA 2E10A 3L2QA 1UN9A 3X2QE 3INZA 4J6IA 2EQIA 2L89A 2RM4A 1OY3D 3HRAA 3FTVA 3L1AA 5FU6C 4ORZA 1YHQT 1VQ7T 1HFAA 2WXQA 1IXDA 2DYRE 3LJ3A 1M2VB 1BCOA 1NYFA 3LY7A 1M3CA 3VLDA 3JUIA 1MX4A 4HI8A 5GAN6 1G5VA 3EU9A 4F7UE 4M7DG 2H8HA 2Q7FA 4NACA 3L2RA 2HAXA 2M1HA 3ZKJA 2AZVA 4R56A 2LZ6B 4PJOD 4GYYA 1O1SA 3M0PA 2CUBA 1OWMA 2I9CA 4JA9A 3RNJA 2K3BA 4K11A 4ZGJB 2VB6A 5CCMA 4J9IA 4J9BA 4NOYA 3JQ0A 1VA7A 1YHQA 3M58A 1VQ7A 1HG5A 5ENSD 4CDMA 3FU3A 3G71T 2GRRB 2HR2A 4C0ZA 4G8LA 4L23A 5A0GA 1XNFA 4PS3A 1D1AA 3TREA 4WNFA 3EGDA 3FHEA 3FB9A 4HCCA 3RESA 3FUDA 5BXOA 2J7IA 3VS5A 2QYUA 4KBQA 2VTBA 4I43A 3O5ZA 2WXLA 4C9BB 3CK7A 4GY5A 3V7CA 3CCRT 1VQPQ 1HG2A 3REBB 3X20B 3MX3A 4EMKC 2DVWA 2LUHA 1NFIE 5HKPA 1MV0B 4HVUA 3TSZA 4GA0A 4PL6A 2IVWA 4MMLA 2DRKA 3I5RA 5BW8C 5KWDA 2NUTB 3W9FA 3CQCB 4M78C 5HKCA 1VQ8A 1K1ZA 4F6RD 2PVDB 4KVMA 5KYYB 3GZ1A 5J39A 3MEUA 5LL6S 4GTMA 1PSFA 4AMCA 1OCCE 2MWOA 3V79K 2WXOA 3JCMf 3F6QA 1LNXA 3MP8A 4U63A 3OW2S 2OTJQ 1FYNA 1KT1A 1HXDA 3ZHEA 2JTMA 2O2OA 4BDZA 3FH7A 4JA7A 3ENEA 4GA2A 3M5AA 3CCQT 3ASDA 2QDLA 3G2TA 1GFCA 4MLPA 3N71A 1MJ0A 2XRYA 3B7BA 4LN2A 3THKA 3FUMA 3ONKA 1IQRA 1E8WA 2D8HA 3FTZA 2AVPA 4Y92A 2CKKA 1H2UA 5BT1A 1PSEA 1EPUA 4OYSA 2Y4YA 4Z88A 3VTYA 4N4IA 3DLMA 4LUDA 4AV7A 3FC3A 4VUBA 2IO2C 2XHEA 3HVEA 3NZSA 2O31A 3JXJA 3HKSA 1IHVA 3WXMB 1VQ4Q 5E75A 2JVVA 1OCRE 3CV0A 1K1BA 2EJ9A 2P0PA 3P8BB 4DQ2A 1N27A 3DRAA 2BE7D 1Z3XA 2NUPA 2YLBA 3S3MA 3QNKA 4EHMA 1ACMB 3IKOB 2LVMA 3RMQA 4JZ3A 5KYNA 2I2OA 3ESLA 3ASKA 4C8QG 1YWOA 5GAOl 3QYHB 1JCQA 3QJ6A 4C0EA 5HK3A 3JB9J 4HCZA 1TEZA 1WHGA 2VSNA 3PVLA 3H9NA 1I8FA 4Y28E 4JW1A 3SGHA 4B0ZA 2XCCA 3FTUA 4XTVA 3DEPA 3X28B 3FTSA 1UGVA 4A4HA 3GPLA 1KPSB 2E12A 2EQJA 4LDUA 3JCMb 4OMLA 2GRLA 2VGXB 3M56A 4CYMD 3Q9UC 1D0YA 2KZTA 3HIZA 4LD6A 3FJ5A 2NUZA 4BX9A 4N2SA 1OX9A 1RI0A 3CMAT 4FA6A 4M7AD 2QI2A 4WAFA 1TSFA 1WFWA 3OW2P 3EU5A 1QCOA 4R7LA 3EAEA 5GMKi 1NZNA 1PAQA 2GGFA 4M7DF 2K2MA 2QEXQ 3CCSQ 4A55A 3UXGA 8ATCB 4LCTA 2E3IA 2VUBA 3QDRB 3HXBA 2WSFE 4IN3B 3OXGA 3VS6A 4HLLA 2Y3AA 3DSUA 3CMAA 1ZBPA 2OEVA 1Q86U 2PUOB 3LGFA 3LCAA 3UA7A 2OVFA 2VSOE 4LRZA 4ANXA 4N4HA 4LNPA 3OYIA 3NTKA 2RJCA 4GMJA 2RD0A 5IN1A 2IOSA 3TXMA 2PZ1A 1Q82U 1M3BA 3MKQB 2DPPB 5GAMf 2E64A 5LJ3e 4PLLA 3IEGA 3CMEQ 1EIFA 4AEZC 2LDMA 5ENRD 3T8KA 5LP0A 3HHTB 3HG0D 4N5CA 2FL7A 2YT6A 2FYKA 2DAQA 2P9NG 4QQIA 5EN5D 3G1JA 2A28A 1WHHA 2MPXC 4J8OA 3BEEA 4BTBA 3PNWC 4ILHB 4PS8A 2MOXA 3SQVA 3VU3C 2LNHB 3FEXA 1O9SA 2VYTA 4LXCA 3ER0A 4I9CA 5CKFA 3RKWA 1RL2A 4GZ6A 2ZZDA 4X8QA 5CECB 1LPLA 3C98A 4FM4B 2RQRA 2GRQB 1OULA 1TUDA 5EG2A 3FU6A 2B86A 4Q94A 3PTAA 2DEUA 5JJ7A 3ZXSA 5GAOq 3S7FA 2OVBA 1PRLC 2KT1A 3U9WA 2XICA 1QWFA 4MZMA 5G05J 2L3RA 1TOVA 3LLRA 4AFUC 1K76A 2C0OA 1G83A 1RAHB 3CR3A 2QQSA 1IB8A 3DBSA 4E7IA 3ZGQA 1JO8A 4OVVA 2ETBA 1X6BA 3BDUA 4YDYA 1N11A 4KGVB 1K9MR 3QZ9B 3TGOA 3OB9A 3UKUG 3QB2A 3CQGB 1KZOA 1NL4A 2LSVA 2WPVA 1I1JA 4BUGA 3V31A 3EG1A 1M4ZA 2L0IA 3T8MA 4AFSC 4TRQA 4FJZA 1AWOA 4LG6A 4U8HA 5FQ7A 4C8QF 4ZGEB 2I1KA 2E70A 2EJFA 1ZHIA 2FEIA 1Y07A 5A6CA 3JRZA 1JJ2S 1TJFA 4M77F 3PZ2A 1M5Q1 2ED0A 3T5XA 2HEQA 5JA4D 1QP3A 1WGSA 1ZQ1A 2XS1A 4M75E 1H6KA 2KQWA 4A54A 4Z02A 1QQEA 4YDOA 4DX7D 1N4PA 2OTLA 4ELYC 1X2QA 2IFUA 3SD5A 5CKEA 1GW6A 2CZ7B 5A0LA 3HTRA 2DD4A 2W0ZA 4QVCA 1G8XA 5EYPF 2XZDG 2PTKA 2VYIA 4PJOG 3QARA 1VOMA 2CFUA 4JJDA 3QDNA 3OYNA 3RO3A 1Q86C 2BE9B 2DCPA 2HZYA 4Y91A 2ZGGA 4ZNXA 1KHCA 1SKUB 1VQ9Q 2FZGB 1JEGA 2FO1E 3L2ZA 5GANe 3EFSA 3JB9D 4O1PA 2GROB 2AHJB 3M54A 3GIBA 3JQ1A 2DLPA 4J8FA 4ELZC 1Q82C 1QNFA 1H641 3BE3A 4YVOA 4XAXB 4YTLA 3BFMA 3D7SB 5ENNA 1UG1A 4QVDA 4CC7A 4F1SA 4AM9A 3FWVA 3GNFB 3TWUA 3DSSA 4F16A 2C0LA 3EIQC 3OXLA 1UDLA 4J8YA 2JM8A 4DI3A 3ZIMA 2DA9A 2M0OA 5GMKj 1N0QA 5AJDA 5KJMA 3OS2A 1KZPA 3L54A 2GBQA 1SZ9A 4NURA 2DXCA 2YLCA 3HPWA 1LCKA 4EZLA 3RRNB 3MV2B 2DJZA 4IIMA 4NL2A 2K5IA 5CHEE 2P2CP 4F14A 3ZYMA 4M7DA 1WQWA 4DX2A 1M8VA 3SFXA 3CCMT 2ROLA 1UFFA 3C3OA 4RTVA 4G24A 2ZGWA 3QWVA 2J07A 4I9EA 1G3SA 1AT1B 2KDSA 4ATZD 3TL5A 5B3SE 2F2XA 2LP5A 5FW9A 3CSFA 3CCVA 4FYYB 2ATCB 1OPLA 4U95D 4L59A 2MWPA 4PFZA 1U8RA 1JJ2P 2RK1A 4FLBA 4KZ0A 3X26B 1M3AA 3L42A 2EVRA 4F7UB 2XRZA 1NEBA 3CXCA 3UDCA 3EGXA 3RUXA 4C92E 4J7WA 2P9PG 3CGHA 1YCYA 3VRYA 4XU3A 3FUKA 3TXNA 2E1HA 4F3VA 2EQUA 2KCVA 2BEDA 3Q7FA 3FUJA 3ZFJA 3M9QA 1UUEA 2V1QA 2GRMA 3META 5FRMA 1U3CA 2ESWA 2AXVA 3FTYA 4FCYA 1QVGP 1VQPT 2MI6A 3CHQA 3OSSC 3M53A 1V55E 3M57A 1HS6A 5GAMj 4JRQA 4TXPA 3AS8A 3OMCA 1SHGA 2BIVA 4G11A 3ABLE 2ZPBB 1B07A 1N5ZA 4BI4A 1QKWA 4FYXB 1VIFA 2NSZA 3Q49B 4CRWA 2BKGA 4NQ0A 5EKQD 4X34A 2GQIA 4B89A 3KD7A 4AFQC 4U7EB 2MYOA 3MKQA 5T8IA 5JMND 1UJ0A 2DJQA 3BW1A 4FULA 3UX4A 2J08A 5KYXB 1TNYA 5IY5E 1RACB 1WXUA 1UECA 2RFAA 5GAOm 1VQPA 4IUPA 1HF8A 1LVKA 3EGUA 4Z68A 2EYWA 2OTJT 2F5TX 1JCRA 3EUVA 1K8KG 3M55A 4XU2A 3ZL7C 2LQKA 4PJOB 4TXQA 3A8MB 2AWIA 4L7TA 4ACKA 3EDTB 3O8VA 4N0AA 1UTIA 4ANWA 4M7DC 2XQ0A 4BESA 4EZJA 1KJWA 2VWFA 2NWMA 2R03A 3MJXA 1H6PA 2UWJG 3CC7A 1X6OA 4M7AG 3JV3A 3ONLA 2LQ8A 5LJ5h 3B7SA 3JCKC 5D6WA 2KMTA 2RB6A 1QKXA 4FP7A 3BU8A 2X6IA 3Q73A 3CHPA 2Y4XA 1R0BG 1VQ4T 1OUVA 3D9HA 4U96D 2XPIA 1RAAB 4UWGA 4BE0A 1ZB1A 3SHWA 1TJCA 1PD1A 2IG0A 4C8QA 4HA8A 2BTDA 3OBYA 1H19A 3L22A 1NM7A 1XQHA 2ZGDA 2LJ1A 4BDYA 1SA5A 4GTRA 1IGQA 4NL3A 3DSTA 1VQ4A 4CC2A 4RTXA 1JB0E 3NTHA 4JLGA 4RG8A 1VQMA 3FEYA 4XU1A 3L16A 2QYJA 4BFRA 2FZCB 1ZU2A 1BI2A 2CH4W 5KCMA 1EF1C 2X6JA 2DTOA 3CC2T 5AN8A 1BI1A 4XTUA 1W3BA 1PD0A 4A4GA 2WXRA 2XEEA 2DBKA 1MNDA 1NLPC 1FMVA 3Q9NC 2RHZA 2IONA 4N3CA 2DIWA 3HFOA 4EMGA 3DXMG 4FHKA 1PNJA 2KSSA 3LXUX 2IF4A 2XDBA 1U3OA 2BZ8A 2LXMA 3D9KA 2D0NA 4E7LA 3EG3A 3E1SA 3E9FA 4DEYA 1YCSB 1M27C 4C5EA 1H2VC 2GTOA 1KQ1A 4C0DC 2QEXT 1DCQA 3CCST 3LVQE 2DNUA 2CUDA 3MGBA 3HRSA 4JRPA 2DBMA 4OAVB 3DSWA 1IKND 2MMPA 2PZIA 4J5YA 4N0AC 2J4BA 2A5UA 2H3JA 4J6WA 2P9IG 5FINA 2PQWA 4OGCA 3SB2A 2J6KA 3PZ1A 3FUEA 1X01A 4C5GA 2QEXA 1DCEA 3EHMA 2M63A 3OMGA 3AU4A 4WNEA 1AOJA 1OCZE 3ULEG 3APCA 3EHQA 4HCBA 4EDUA 3QXEB 4QQGA 1K4US 4C8QC 4HNAD 1BD8A 4LDWA 1K9MU 5D6XA 5I21A 3KAEA 2M51A 1Q82R 1UGSB 2GCXA 4M77C 3RRUA 2EFIA 5ANRA 5B1BE 3QSUA 5LJ5g 2P58C 4TUUA 3HHMA 4DX6D 3NPFA 4HRMB 2DF6A 1K3ZD 2O4XA 2ETAA 3B7TA 5ENTD 1WXBA 4M77E 5GANg 2K9GA 2C2LA 3CMEA 3D9OA 4M7AB 5GMKl 4RTUA 5FWQA 5AYFA 1NJIR 4AVXA 4U0ZA 4P5NA 3G2VA 3IBEA 4J9DA 4UI9C 2L2PA 4I6JA 4BETA 1HSQA 5IAYA 1KT0A 2OTLQ 4MDWA 1ZSZB 4A53A 2M16A 2FVUA 3LWIA 3L6AA 1FWZA 3ISMC 1UW4B 2DXUA 4FT2A 1OOTA 2PL2A 2J8SD 5GAOr 5IT9E 2IY0C 3FDRA 3KSQA 3OYEA 2E3HA 3ML9A 2JNGA 1YBYA 3VYHB 4BACA 2FO7A 3G2SA 4U07A 1UGPB 3RKVA 3S2AA 2VC8A 1OXJA 5B1AE 3SBTB 2L5QA 3F70A 4WWPA 8AT1B 4H7YA 4BY6A 2JMAA 1HX8A 3JB9G 1NPRA 1QP2A 2Y4TA 3BG1B 4A3VA 3TWTA 3VKIA 2W10A 2AKKA 4I2ZA 4GZDA 5D6YA 3CEQA 2E2EA 3UKRG 4GB9A 3ASNE 4N3BA 1AWWA 3GYZA 3IXEA 2CFZA 1Y6IA 2GRNB 4JEHA 4K0RA 2J9QA 3UI2A 2GGRA 4UC4A 3FUNA 1I4K1 2IOLA 5AAOA 2D1XA 2MHKA 2LXLA 4RG9A 4N39A 1D8DA 1A5EA 2RQWA 4DEXA 2UY1B 5GAN5 4ANJA 3AG3E 3B7RL 4FSSA 2EYZA 1FMKA 1M1FA 3MKDA 5LJ3d 5KE2A 3TWSA 3CCVQ 4KUDK 2V8KA 4PJOA 2FPFA 2EGAA 5CKBA 4O6FA 3LH5A 1ZA1B 1BI7B 5CO7A 1E7UA 4MS6A 1W4SA 5DLOA 1OV3A 4U8YD 4PK4A 1I5OB 2RKKA 2KY9A 4OB1B 4M75B 4HOQA 5IXFA 3FUIA 3CBPA 4XX5A 1VQ9T 3MZLB 2QC9A 1M9SA 3KFVA 2LO6A 2QQRA 3TAXA 1E6HA 3FY4A 3VLFA 2IU1A 3VTXA 2C0IA 2E5QA 4KT0E 4B9WA 2D9TA 3E30A 3ZVVA 3A8LB 5GAOn 4GZ3A 3ZYLA 1BBZA 4RLYA 5GAN8 2DFUA 2RH2A 2CGHA 5CKHA 2LQWA 1EYHA 1N9RA 3WG7E 1E8YA 1QVFP 3CK8A 2BUGA 1Z9QA 3OYYA 3PVQA 1VQ5A 4XI0A 2KT8A 1K9MC 1R77A 4PH4B 1VQ9A 5FZQA 3LVRE 3FEOA 3EH1A 1S70B 2ZCFB 3A98A 1NYGA 3ZEHA 4JHKA 1OWLA 3DSXA 1GCQA 2PUKB 2VQ2A 1VQ8T 3A8OB 4GTPA 1UGRB 4BY6C 4OMFB 4J8EA 2H6GA 3RU0A 2QA4Q 3NMZC 3B7UX 2DTHA 2EBPA 2YUNA 1WLPB 2OAWA 1MMAA 2V8SE 5LCWJ 3UINC 1KQSP 2BTTA 3MKRA 2KXDA 3OS5A 3NOCD 1LF8A 2FRWA 1MMNA 1A0NB 2VVKA 1WA7A 4BT8A 2L3QA 3MYVA 2X3XD 2CDTA 4F53A 5C2YA 4A4KA 4BI3A 2SRCA 4BB7A 4FADA 3CHOA 1GXIE 3GP8A 3V30A 2RPNA 3TWWA 5HCKA 2F69A 2RG8A 2LJ3A 3LKUA 1G3WA 4JDSA 1VQ6Q 4B93B 1D9SA 4M78E 3CC7Q 3S7DA 1N0RA 4HXIA 4HVWA 2XEHA 1YFNA 4F1PA 2L9BA 2CSIA 4PS7A 1OT8A 4G2VA 3APFA 4C92B 2XMFA 5LJ5f 2BF0X 4LNGA 5FQ6A 1WG0A 1WQ7A 2XDDA 3FULA 3PZDA 3UT1A 5GANf 4KT6B 2EGCA 1HU3A 3JCMd 2WXNA 4PJNA 2DZ9A 2FULA 1OZ3A 1W70A 3DSVA 2O88A 4G8KA 3URZA 2XZTG 1MHNA 3G7ZA 2O9VA 2LCCA 4ZTJA 1QMCA 1RAIB 3JCMP 3D9JA 2A37A 4EIKA 4GLKA 3TWXA 1NZ9A 1OU9A 1YJ9Q 2R58A 4ACLA 1H8KA 1W2BA 2YHEA 3VV0A 4DA4A 3PEUB 1QVPA 4ANUA 4PNOA 3CPWP 3JB9F 3A5ZB 1N6AA 3H8ZA 1VQMQ 1T3LA 1Y57A 3JYSA 1M90U 1BKBA 2R17C 1X2KA 4F17A 1O1RA 2R5MA 2YHTA 2L6BA 3O4ZA 1Y71A 4X9CA 4XU0A 3OYMA 4NRHB 3EFOB 4D8KA 1GCQC 4YDWA 5CBOA 3UT7A 1VQNQ 1E8XA 3APDA 4M7AA 1RW2A 2RQVA 4CCAA 2XD0A 4I1OB 1OI1A 1SF9A 3CC4Q 4CDNA 5E76A 2V26A 4MDXA 2VGEA 3UTMA 4OVAA 1JUQA 2V8IA 5AJLA 3FTWA 2ENMA 3EHRA 1EX4A 1FT1A 1JXOA 3R9AB 5BPPA 1X6GA 5KNHD 4HKEA 1H0AA 3JCMc 4E7HA 3Q4AB 1TXQA 1D1BA 4GYOA 1MGQA 3CCJQ 2OX7A 3Q78A 2I0NA 5EYLA 1UHFA 3SY2A 1SA4A 2ROTA 4J6YA 4RTZA 3P8HA 2Y69E 1KK7A 1YIJQ 2HQXA 4PJLA 1N95A 1O1TA 5LJ3j 4LNBA 1KHIA 1Q81U 3T9KA 2XI9A 2V0PA 4L2YA 2RI3A 3N5BB 1GCPA 2QGGA 2ZPGB 2JS0A 2K7AA 2YSQA 3UA6A 1ZUYA 3OYDA 3HXEA 4JLIA 1JRIA 2RFMA 1UHCA 3D9PA 4LDVA 3MP6A 4GZ5A 1SG5A 3M0QA 1WM5A 2HO1A 1OX8A 3LYIA 1FT2A 3WVEB 2CZ1B 4UI9K 1C6VX 3RRMB 3CCLA 2IPOB 1ZBJA 1YMPA 2PQRA 3UM1A 1CKAA 1V1CA 1F1BB 2YQ8A 1IYGA 1P92A 5DY9A 1HH8A 4C5HA 4B8AA 4KBMB 2A5EA 2R5AA 2KGTA 1NJIU 4C5IA 2JTFA 2CT3A 4BD3A 2PM6A 5GAMd 3ZUVB 5GMKm 3BG0B 5CCLA 3JB9I 1MQSA 1XJWB 3PNTB 4ESRA 5FJYA 1Q95G 4G25A 2YINA 3VJPA 3PE4A 3FFLA 1M2VA 3D3MA 1NEGA 2P9KG 4RG2A 2GQVA 2P0QA 3LX7A 2CP7A 1IO6A 3PNLB 2DL4A 5LFAA 5I2SA 3Q79A 5GAN2 3CVLA 4N3AA 1D09B 4EPZA 1SPKA 4O60A 3NF1A 3QPHA 4DBHA 5KBAA 2LC4A 3RBBB 2NC9A 4A63B 1IREB 2RQTA 3SWNB 4M75D 1KC8U 2ZU6B 4HBDA 1S72Q 1VQOQ 1WYXA 3ZW3A 3M59A 2RO0A 4L5GA 2EIFA 1M90C 2CS7A 4F7UG 2KNBB 2L8DA 4CRIA 2VGNA 1TNUA 5IHKA 4FW2A 1DVPA 4B6MA 2FPDA 4DBQA 3CVNA 3BDLA 4L2LA 1MX6A 2KROA 3CD6Q 1SHFA 5EX0A 2FHDA 4D6WA 4C0FA 5C0MA 1RLQC 1KD1R 3OQ5A 5BV1A 5JJ6A 2OTLT 1OYXA 1QZ2A 2RD1A 1JWFA 3AG4E 3ABKE 3EG9B 2FZKB 2DYSE 1JU5C 2GF7A 4G1TA 2K5LA 3CVWA 2KK4A 2LTOA 2NUTA 4EBAG 3ASFA 1RABB 5KCOA 3PGGA 3CSTA 5AQBA 1N4QA 5KYYA 4KH0B 1GBRA 3QK0A 3UF4A 3OY9A 3QWYA 3RIRA 2VXEA 2ZIRA 3VS7A 3HRUA 5G04J 5BUZA 3SD4A 5EX3A 5GAN3 5FU7C 1TYQG 4CDRA 2PVGB 3GLXA 3IQLA 3OYKA 3R7QA 1LOJA 1D8EA 2QAZA 1Z9ZA 3JCMJ 1Q81C 2V5QC 4E7SA 3I4GA 3SDZA 3FP3A 4M7CA 2FRYA 2MK5A 4K03A 5KYUB 5LJ5e 1QVGS 1H2TC 1VQ5Q 4E85A 2DK3A 1EDUA 1N4RA 4J0UA 1DC2A 3EIJA 1S1NA 3PE0A 3JCMX 2DVEA 1K9AA 1YJWQ 3GOXA 1SW6A 4K5CA 5ITZF 2HBWA 3FUFA 4C92D 2E65A 4OVUA 4GTVA 3QG1A 4HXJA 2COYA 3H0IA 2WMNA 2YRVA 2DL7A 3P8DA 2AW6A 4XKCA 3CCVT 2AT1B 2DTIA 2K79A 4J8DA 4QKUA 1NJIC 3CHSA 5AARA 2X38A 4FHJA 1K73R 4YVQC 2WVIA 2X9HA 1HXIA 3TVTA 1AP7A 5J08A 3NB2A 5D66A 3CBOA 3B95A 3Q47B 1U06A 1JQQA 4CC4B 2V8JA 3SF4A 3G2UA 2X4JA 2FEZA 4Z89A 2CP6A 2P84A 3NOGD 4UQYA 3NTIA 3JAME 4B94A 2VGXA 2RMOA 3E19A 2XPYA 5KNGA 1INZA 4JJCA 4OB3B 2LNIA 5ENOD 3L08A 1KC8C 2J6OA 3I4RB 3I5PA 4E7KA 1ZX6A 2VJ8A 5FU6B 2J49A 2LAIA 2RHUA 4BSZB 2V5FA 3URGA 4HQDA 1SRMA 3ULQA 2DO3A 2MF2A 2HQEA 1YITA 4J9EA 3PIOA 2E41A 2KEAA 2PNNA 4DJAA 3RIBA 2OV8A 2KYMA 2QA4T 3TG5A 3HXDA 4KRTA 3SFYA 3QHSA 3ASOE 2HKNA 3SBSA 4XE0A 1D1CA 2K4YA 1MV3A 2XGOA 4JB8P 1Y8MA 5FZSA 2HNIA 3IHVA 4P29A 3NGPA 3V2XA 2F2VA 2X4WA 2YUOA 4EZKA 4A1SA 1SQMA 3FIFA 4M3OA 2E6NA 3Q5MA 4JXTA 1PY1A 4WF2A 1Y0MA 1DNPA 1N52A 1ZA2B 2QQBA 2QA4A 5DIZA 3ZXPA 4HRNA 2HSPA 4XKBA 5CAIA 4JVSA 2DYBA 2MRIA 2LCLA 1VQ6T 3LJNA 3L13A 3CC7T 1ZLMA 2VGMA 3UATA 1NI1A 4OF1A 2I1JA 3TCJA 3HSBA 1X81A 2RN8A 1HD3A 4AP2A 4GLMA 2PQNA 3ZNGA 4BTAA 5IXBA 4EMKB 2CG3A 2CHXA 3PUJA 1P5QA 4N5QA 4BT9A 2JLBA 3NQPA 2Y1LE 3VS0A 2V4HC 3T5VA 2RHIA 3UM2A 3AS5A 4RG6A 4M78B 3A8HB 4I17A 1R8OB 2RI5A 2G3RA 3M0SA 1U3DA 4JUVA 4KUIA 1K0SA 1VQ6A 3CC2A 5CCAA 5FRNA 4JC8A 3EH2A 1I0CA 4I1AA 2CZ0B 2YNQA 4M7DE 3OYGA 1HK9A 1YJ9T 5A2QE 3HP9A 1Z3YA 3PZ3A 2A3LA 3FDHA 4PFPA 3GW4A 4OB0B 3TJPA 1VQMT 5T3RA 3C72A 4E6HA 3KUFA 5ARFA 4CZ2D 4PJOF 2E5KA 1WJSA 2YUQA 3JCMh 1SSFA 2EYYA 2O01E 2HKQB 2RHXA 3Q75A 1G2BA 2JEKA 2DX1A 3TWQA 2FBNA 1VQNT 5KH6A 5L23A 2OEWA 4N4GA 4R0KA 1YJ9A 2DXBA 3CKCA 2DIQA 3CC4T 1M90R 1TWBA 1WX6A 4TVRA 2RQUA 2DBAA 3M4GA 3OTNA 3ASHA 3CCLQ 2CSQA 5GJWB 2A08A 1ZUUA 4PUCA 1NA0A 3CBMA 2DETA 5J26A 4DBFA 2CHZA 4ME2A 4TXRA 1TG0A 1WXTA 4OMNA 1TR4A 4XI9A 3CCJT 4RTWA 3EGDB 4QVZA 3T9NA 1VQNA 3R9MA 5KJKA 1MYOA 1BU9A 2HD0A 3RERA 2VASA 4EECA 1QQJA 4GMRA 2P9UG 3CCEQ 5AQ9A 1Z5SC 3CC4A 3PFSA 2VTBB 1A17A 1YIJT 1VIEA 3MCAB 3OYHA 1AWJA 4UQZA 4M77D 2FG0A 3QWXX 3CCUQ 1N94A 2GRPB 1PKTA 3PH0C 5HRYA 2FO0A 5CQXA 3QDFA 3ULRB 4BERA 3M4YA 2LMJA 4MKTA 3CCJA 2NXPA 5GMKh 3E32A 3MA5A 2JJ9A 3OW2A 3RK6A 4OB2B 4M75G 6AT1B 4LERA 2EPDA 2RJDA 5LOZA 4GPKA 1O75A 4J7IA 1Q81R 4J9HA 2OJ2A 4HOSA 1YIJA 4UWHA 1E90A 3UWNA 3C5RA 1VYVA 3LDZA 2WXKA 3AHUA 2XIDA 3CMET 1JXMA 4ATOA 4JZ4A 3ZHEB 2DD5A 5CMWA 4GPMA 1OZ2A 2EINE 2QYZA 2HYZA 1UJKA 3PT9A 4LNUD 1NA3A 1AWXA 1BIAA 4GTSA 3CHRA 5IH2A 1KD1U 5CEDB 4BI8B 2QASA 2R05A 4WNDA 2M0YA 5A7DB 3QKYA 4CT4A 4C8QE 3D9NA 3MEWA 1JCSA 1Q2ZA 2KE9A 3OAWA 2L0AA 4OAUC 1QCNA 2WQHA 4E2FB 2XU8A 3KS2A 3M0RA 3AG1E 5D7UA 4PFOA 1NBEB 2HSEB 3OA6A 1I5LA 3L9TA 2NUPB 2XKOC 3JCMg 2ABLA 2JN0A 3RJVA 4RUGA 3VYGA 1U5SA 1T0HA 1TNOA 1IHBA 1BI8B 2GFUA 5GAMh 1VQOT 1HZ4A 1S64A 1S72T 4WTOB 4J9FA 1PCXA 4HT8A 1QYMA 2MYSA 2QDYB 1D0ZA 3PMTA 4F7UA 4U0UA 1E7OA 1WDXA 1UE9A 3BQOA 1M1KU 3CQTA 4MBGA 3FU5A 4AIFA 4B8CB 1ELWA 2KM4A 5EIBE 5AT1B 4GMLA 1M1GA 1TUGB 1QVFS 2BZYA 4KVOA 3KSLA 3HYMB 4CI0C 2FF4A 2X51A 1KC8R 1D0XA 1WZOA 4LD9K 4Y6CA 3CD6T 1WIEA 3FUHA 4M7AF 5HS0A 4A1GA 3MO8A 3QBYA 1UG3A 3VS4A 1S72A 1MZCA 2F5KA 3Q1JA 3I56Q 1VQOA 2DIGA 4ZN1A 4RTYA 1QWEA 2HBPA 5KCHA 3CVVA 4WWNA 4C92G 2WXGA 3A8GB 3MEVA 2WQ7A 4EBAA 2DWZA 1LTXA 4GZCA 2P0KA 1PRMC 4KZCA 4PLIA 4JD2G 2PNIA 1B7TA 5GAN4 4HOTA 3QO3A 1K1AA 2KATA 5IHIA 1N54A 1KQSS 3GBQA 1QCFA 4J6XA 3VS1A 3CD6A 1K73U 2OAUA 5KYXA 4IULA 2EW3A 1VQLQ 5AQAA 1BU1A 2QY7A 1AWCB 2AK5A 2LSUA 2AXZA 3SO8A 3ZFWA 2DMOA 2QQ9A 3VUZA 4AJWA 2NYSA 3DB4A 5I2MA 4RMOA 4EMHA 4L1BA 2EYQA 3E37A 1SRLA 5J3BA 3V7SA 1RLPC 1SEMA 2WXIA 5CEAA 4ME7A 1TN7A 3ZN3A 3S3NA 1BI0A 1VQKQ 1VQ5T 1ELKA 2JXBA 1UN8A 2H6HA 2X3MA 2SEMA 3LEWA 2COZA 3TSWA 3E34A 1N9SA 1TH7A 3W9GA 3K9IA 4HI9A 5CKDA 4IUVA 4BX8A 3R6OA 3LWHA 4E7JA 3U23A 1YJWT 3TQ7P 2EILE 1YITQ 4QQ6A 5IHNA 2XPZA 1FCHA 1M2OA 4UUCA 3ZYQA 3J5PA 2B6CA 5GAN7 1WHMA 3I5SA 4M78D 4BE2A 3R7RA 4J7FA 4X1VA 1V54E 1U1TA 2A36A 4OMPA 2WACA 3OYBA 4DRXE 3NAWA 1KD1C 3CXCP 2VKNA 3CPWS 3CCMQ 4KH1B 3CKBA 1YJWA 1N8RC 4M75F 3UM0A 1W6XA 1OCOE 3ZYKA 2NYJA 2EAYA 3LS8A 3QAQA 5D0OD 1D3BB 1K8AR 5M9OA 4IUUA 1WY6A 2J6FA 5CK9A 5GAMg 3VLEA 4JHJA 5CVIA 3C3QA 4OMMA 1Q7YC 2HMAA 2JT4A 1BLXB 3L2WA 2EIKE 4WNGA 4NS5A 2DM1A 1FXXA 2V1RA 2QGFB 3P1UA 3CVPA 4HFGA 2WXMA 4HS2A 4BE1A 2E4HA 4EQFA 2O9SA 1K0XA 4FJYA 1KQ2A 1R0CB 3OYAA 1RI9A 4KGZB 1M1KC 3TWRA 2X35A 2BUDA 1NE8A 5HQ8A 2ZISA 4I6EA 3MCXA 4MZTA 3CC2Q 3MHXA 2I2LA 3C94A 1JJ2A 4XEIG 1QBQA 3CLJA 5M72A 4ZFHA 3KBGA 3M0TA 1QLYA 4PJOC 3G71A 2R59A 2X6HA 3QYGB 1KSWA 3UT4A 1GRIA 3RO2A 3V2OA 3RSEG 3MJWA 5KJNA 4QFVA 4HORA 3E33A 1Z6TA 4PJOE 2KR3A 3QIIA 3FTXA 7AT1B 4OGEA 4PDXA 1ARKA 3QOUA 4KGXB 5FT9A 2YXYA 5DM7R 3CCRA 4CGVA 2V4LA 3JCMQ 3PRZA 1QVGA 5LJ5d 1YJNQ 1K73C 2CREA 2CP2A 2QXFA 5HY6A 3Q7AA 5GANd 1M8MA 4DOVA 2WXJA 2HQHA 3DKMA 3QWWA 4Y6WA 2MIOA 1WDYA 4AOFA 1JBMA 3P2BA 2L3PA 3OYLA 1IRXA 4TUMA 4C92F 3LY9A 1TNZA 2PU9B 4HVBA 2KXPC 3OYCA 4FU3A 1LJOA 4APOA 2P9SG 2B8AA 5JJTA 2XDPA 3CK9A 2DERA 3CVQA 1E96B 4E6RA 4LUNU 3REAB 3CCQA 2WMOA 2XGSA 3CVUA 4JZYA 1FMWA 2DZCA 2M02A 2WXPA 3A1PA 4I6GA 1S0PA 4GA1A 2LAHA 4HT9A 3HDXA 1ZSZA 4XTWA 1XOVA 1BPOA 3HRTA 3I35A 3UPUA 5KYWB 2JTEA 4M77G 3OSVA 3J5QB 2RI2A 1UGQB 2IO3C 2ZAEA 1OQKA 1PKSA 5ANLA 1WHJA 4M7DB 1YNZA 3QJYA 4V2SA 1GFDA 4D10C 2DL5A 2DL8A 2F2WA 2HM8A 4H7XA 2ED1A 4WCIA 4JRKA 4L9PA 5CERB 1C0MA 2DVJA 3CCLT 3G6EQ 4ZHBA 1N9AA 3BUAA 4MMKA 2WSCE 3G4SQ 2FPEA 5GAOp 3OS1A 4OP0A 5H7PA 4IIOA 1VDYA 3ZEFA 1EZZB 2LX9A 4RCCA 3GZSA 3EGXB 4MZPA 3UIPC 3E2UA 3OS0A 1IQUA 2IEJA 4F04B 4JHRA 1HO8A 3EFRA 4NIKA 3PS6A 3MV3B 4AG2C 3Q15A 4DOWA 4ZGDB 3CCET 1S63A 4BSXA 4FIBA 2UY1A 3PDNA 1U2VG 1W1FA 3FU0A 2L0TB 2CP0A 2H6FA 2EQXA 2KAFA 3PEVB 4HVVA 2DL3A 4GYWA 1RZ4A 4W9RA 3CCUT 1CKBA 4GTTA 4JPBW 1X5BA 4JS4A 4RTTA 2XHCA 5ECAA 2X4XA 1PG5B 4X9DA 3IV0A 3LH0A 3QWPA 4WWOA 3AU5A 5ENQD 4M75A 3IHYA 2D8JA 2JOYA 2VV5A 2I6HA 2EGEA 1IHWA 3JCMV 3CCEA 3CEYA 2CZ6B 4U0SA 2JUFA 1B89A 4RQIA 5HI7A 4DLOA 3NBNB 2XCBA 4M7AC 2K5FA 1ZSGA 4D8DA 1TTHB 2E6ZA 3FH8A 2ECZA 1WJQA 1JPLA 2KVQG 4XK8E 4M7AE 3CCUA 1KG1A 1ZBXA 2K3XA 3C12A 4C0DB 3KXTA 1ZSZC 1MHQA 4GCNA 2RA2A 2CP3A 3E4BA 1MUZA 2GNCA 3FJPA 3J81E 3D9MA 1YWPA 3V8JA 4GU5A 2H3EB 3C3RA 4KXKB 4ZN3A 4KULA 3C95A 2CG2A 2GFAA 1D3BA 1H6OA 2X6KA 3AG2E 3QC1A 1M30A 1G3YA 4RSYA 3UPVA 4JS5A 3HFNA 3DWLG 5AQ7A 1AVZC 1WHLA 3C0CA 3RR6A 2A7YA 2KRNA 2J06A 4A3TA 1ABQA 3SZ7A 5D2MC 1Y96B 1FX7A 4M4ZA 1N8RR 4C8QB 3LPZA 4YNDA 1V76A 3ZPJA 4IRUA 2A0FB 2RJEA 2G6FX 4C0MA 2JM9A 2KYBA 4M77B 4PKCC 2IIMA 1MX2A 1Q7YR 3J80E 2XS8A 3FLGA 1AHJB 1TU0B 5LJ5j 3JB9H 2DEQA 2EIJE 5C6SA 1NPPA 2Y0BG 4GBQA 4LDXA 4KMOA 2FI7A 1Y7XA 1OWNA 3RKYA 1OU8A 1YI2Q 5GANj 1GBQA 3I55Q 4IKFA 1AD5A 2VGYA 1H92A 3PUKA 1IGUA 2PM7A 2XGMA 1HJDA 1XNIA 1VQKA 4JL0A 3I56T 1M1KR 5FQ4A 1ELRA 1U1SA 4C92A 1RAGB 2LX7A 4FW1A 2AXUA 4M75C 3DPYA 3TWVA 3X24B 2BKKB 1T3SA 4GTQA 4TV3A 2ONDA 3NHNA 3GNGA 2D0QB 5LCWC 4K5AB 4M78G 2AJAA 5BV0A 1VUBA 3EJNA 4I1MA 4FLHA 3RAUA 1VQLT 2WB2A 1BCMA 1UJJA 3I56A 5HK0A 3S7BA 2DZNA 2K57A 3FRNA 5L8RE 3JCMe 3S6WA 3WXXA 1K8AU 2HCKA 1TN6A 3CVYA 1VYTA 2QZAA 4O1OA 5CIUA 4U04A 5DLQE 1UB4A 2WM9A 4JPSA 1YHQQ 1VQ7Q 3JUEA 3V8LA 2X6FA 1RUWA 2DXTA 2LRQA 3E9GA 1W2BS 4UI9J 1VQKT 3DB3A 2CHWA 1O5MA 2QG9B 3EFOA 4A4EA 2MAMA 1VQLA 4E7ZA 4ANVA 3R6NA 3X25B 2M9UA 3LGLA 1HE8A 1I81A 1YITT 2DZOA 4V3IA 1BB9A 4DUIA 5LJ3h 2LCSA 3V8KA 2ETCA 1FPPA 4B9XA 1L5JA 2VXFA 3OXFA 2P4TA 5D0QD 3C4SA 3G71Q 5FQ8A 5KYWA 2KCLA 4DPRA 5EILA
chains in the Genus database with same CATH topology
2DILA 2EPDA 1S70B 1X27A 2PZ1A 1M3BA 3A98A 1J3TA 1NYGA 4OMQA 4J9HA 2OJ2A 1GCQA 1NG2A 1PHTA 3C5RA 1ABOA 5ENRD 3T8KA 1VYVA 4HCKA 3HG0D 3NMZC 2YT6A 1JXMA 2EBPA 4QQIA 5EN5D 2YUNA 4JZ4A 5EIDA 1WLPB 4GPMA 1OPKA 1YP5A 2A28A 2J05A 2OAWA 2JMCA 2KBTA 2BTTA 1GL5A 4LNUD 2KXDA 1AWXA 2MOXA 3NOCD 2FRWA 2LNHB 1A0NB 2VVKA 1WA7A 4QT7A 2X3XD 2L3QA 5CEDB 5IH2A 2CDTA 1KFZA 2M0YA 2SRCA 2RNAA 5FWBA 4U8VD 5CECB 2RQRA 3V30A 2KE9A 2RPNA 1YN8A 5I22A 3TWWA 1TUCA 2L0AA 4HB5A 3H0HA 5HCKA 5GJVB 4OAUC 1TUDA 2LJ3A 4B93B 1D9SA 3M0RA 5I11A 2B86A 1N0RA 2EKHA 3H41A 4HVWA 2XEHA 3JXIA 1WI7A 4F1PA 2ABLA 2JABA 2CSIA 4RUGA 1U5SA 1T0HA 1OT8A 1PRLC 1IHBA 1BI8B 2KT1A 2XMFA 1QWFA 2KRSA 1WG0A 4J9FA 1QYMA 5FIOA 4HRLA 1E7OA 1WDXA 4AFUC 1AZEA 1UE9A 1K76A 1PWTA 2C0OA 1G83A 2EGCA 3CQTA 1NLOC 4AFZC 2DRMA 3VS3A 5EIBE 1W70A 2XENA 4G8KA 2F8YA 2XZTG 2BZYA 2O88A 1JO8A 2O9VA 4Z8AA 2ETBA 2F37A 1X6BA 4YDYA 1N11A 1EFNA 2A37A 4EIKA 3TWXA 1H8KA 1WIEA 5HS0A 2HE0A 2B0OE 3VS4A 1I07A 4RTYA 1QWEA 1T3LA 1I1JA 1KIKA 3V31A 1Y57A 2LQNA 3EG1A 4AFSC 1X2KA 4F17A 1AWOA 4LG6A 2DWZA 1UOHA 2L6BA 2FEIA 1PRMC 2CH4A 2PNIA 4D8KA 2ED0A 1GCQC 2HEQA 1BK2A 4YDWA 1K1AA 5CBOA 5JA4D 5IHIA 3GBQA 1QCFA 2RQVA 3VS1A 1VYUA 2EW3A 3H0FA 5AQAA 1BU1A 1AWCB 2AK5A 4DX7D 2VGEA 3UTMA 2HDAA 3SO8A 2DMOA 1X2QA 2ENMA 3EHRA 1JXOA 2W0ZA 5EYPF 2XZDG 1X6GA 5KNHD 2PTKA 1SRLA 4JJDA 1RLPC 1SEMA 2LJ0A 5CEAA 1IXVA 4J9CA 2RF0A 2ZGGA 5EYLA 1OEBA 2I0NA 4ZNXA 1UHFA 1JEGA 2FO1E 1CSKA 2JXBA 4O1PA 2SEMA 3TSWA 4AG1C 2ROTA 4K5BA 2DLPA 4RTZA 3W9GA 4HI9A 2MCNA 3U23A 4BEPA 2K6DA 1UG1A 4CC7A 5IHNA 3T9KA 2L3SA 3TWUA 4F16A 4UUCA 4C48B 1G3NB 4J8YA 1UDLA 3J5PA 2JM8A 1GCPA 2DA9A 1N0QA 3I5SA 2JS0A 4X1VA 2GBQA 2A36A 5BXUA 2F8XK 1ZUYA 2K7AA 2YSQA 3I9QA 1LCKA 4OMPA 3UA6A 2P4RA 4DRXE 4LUEA 2KXCA 3VS2A 4IIMA 2RFMA 1UHCA 2P2CP 2VKNA 3EG2A 4F14A 3M0QA 4DX2A 1W6XA 2OI3A 2ROLA 1UFFA 2NYJA 2JS2A 4RTVA 4ATZD 2J6FA 1ZUKA 1ZBJA 1YMPA 1CKAA 2F2XA 2LP5A 5FW9A 1V1CA 1E6GA 4OMMA 2JT4A 2X3WD 1BLXB 1UJYA 1OPLA 2A5EA 4U95D 2KGTA 1M3AA 2CT3A 2DM1A 3ZUVB 2V1RA 2EVRA 1NEBA 4ESRA 5CBNA 1K0XA 1X43A 2O9SA 3KEAA 4J7WA 1RI9A 4J9GA 3AAAC 3TWRA 3VRYA 1NEGA 2BZXA 1IO6A 2DL4A 5ENPD 1UUEA 2V1QA 1SPKA 2AZSA 5FWCA 4O60A 2ESWA 5KBAA 3RBBB 1T0JA 4CC3A 3EG0A 4A63B 4JJBA 2RQTA 4ZFHA 3M0TA 1QLYA 4HBDA 1SHGA 1KSWA 1WYXA 1GRIA 3ZU7B 3V2OA 1B07A 1N5ZA 2EYXA 1QKWA 4LE9A 4QFVA 2BKGA 2GQIA 2KNBB 2KR3A 2AKLA 1SSHA 5IHKA 4AFQC 1ARKA 3M0UA 2MYOA 1UJ0A 5JMND 2DJQA 2FPDA 1MX6A 2KROA 1WXUA 1UECA 2RFAA 1SHFA 2CREA 1M8MA 3EGUA 4Z68A 1RLQC 2EYWA 1AEYA 1B3QA 3ZL7C 3DEOA 2YUPA 2MIOA 1WDYA 2L3PA 3SEMA 1JU5C 4TUMA 4OMOA 1UTIA 2KXPC 5EC7A 5AQBA 4BESA 1KJWA 2VWFA 2NWMA 1SVXA 1GBRA 3UF4A 3QWYA 3VS7A 4E6RA 3JV3A 3REAB 1QKXA 3IQLA 3AJIA 4U96D 3D9HA 1Z9ZA 2V5QC 2DE0X 3SHWA 2KBXA 2KRMA 1XOVA 4DX1A 2FRYA 2YDLA 3I35A 2JTEA 3J5QB 1NM7A 2C0TA 2JW4A 2ZGDA 4DX5D 1DC2A 1PKSA 1S1NA 2LJ1A 1YNZA 2CT4A 3PE0A 1GFDA 2GTJA 1K9AA 4LSZE 2DL5A 1H3HA 2DL8A 1SW6A 4K5CA 2F2WA 4CC2A 1YYHA 5ITZF 4RTXA 2HBWA 1AZGB 2ED1A 4WCIA 4HXJA 1X69A 2QYJA 3H0IA 5CERB 3VRZA 2CH4W 2DL7A 2DVJA 5AN8A 4ZHBA 2EQIA 2FPEA 2XEEA 2K79A 1OY3D 2DBKA 1NLPC 4IIOA 3HRAA 3Q9NC 5AARA 1PNJA 4ORZA 1NYFA 3TVTA 1AP7A 1M3CA 1MX4A 4HI8A 3EU9A 4NIKA 5D66A 3B95A 1U3OA 1U06A 2H8HA 1JQQA 4CC4B 4AG2C 2BZ8A 3ZKJA 2AZVA 2LZ6B 2D0NA 3EG3A 1W1FA 4Z89A 3M0PA 2CUBA 3RNJA 3NOGD 2K3BA 4DEYA 1YCSB 1M27C 2GTOA 2RMOA 1DCQA 4K11A 4HVVA 4J9IA 2DL3A 5KNGA 2DNUA 4JJCA 2CUDA 1CKBA 4J9BA 4JPBW 5ENOD 1VA7A 4RTTA 2DBMA 5ECAA 2J6OA 4OAVB 1IKND 5ENSD 4G8LA 1ZX6A 5ENQD 2D8JA 4BSZB 2EGEA 4HQDA 5FINA 1SRMA 5BXOA 2J7IA 3NBNB 3VS5A 2J6KA 1ZSGA 4D8DA 4J9EA 2KEAA 2PNNA 2ECZA 3O5ZA 1AOJA 2KYMA 4KRTA 3EHQA 3REBB 2DVWA 1MV3A 1MV0B 1NFIE 5HKPA 1BD8A 4HNAD 4JB8P 4HVUA 3TSZA 1K4US 1MUZA 3NGPA 3V2XA 2GNCA 2F2VA 2M51A 2DRKA 2YUOA 3I5RA 5KWDA 3W9FA 1YWPA 4DX6D 1K1ZA 4HRMB 4F6RD 2DF6A 3NPFA 1K3ZD 2ETAA 1Y0MA 5ENTD 1WXBA 2K9GA 1M30A 4RTUA 4HRNA 2HSPA 3V79K 2DYBA 3F6QA 3LJNA 5AQ7A 1AVZC 4J9DA 1ZLMA 2L2PA 3C0CA 1FYNA 2KRNA 4BETA 2O2OA 2J06A 1HSQA 3UATA 1ABQA 4M4ZA 2RN8A 1HD3A 4GLMA 2QDLA 5IXBA 3ZNGA 1GFCA 1MJ0A 4LN2A 3B7BA 3THKA 4N5QA 1OOTA 2D8HA 2J8SD 2G6FX 2Y1LE 2JM9A 2KYBA 2V4HC 4Y92A 3VS0A 2IIMA 4Z88A 1MX2A 3M0SA 4LUDA 1K0SA 2Y0BG 4GBQA 1I0CA 2O31A 3JXJA 1GBQA 2JMAA 1AD5A 1H92A 1K1BA 1HJDA 3TWTA 2W10A 2AKKA 2LX7A 4JZ3A 1AWWA 1YWOA 3IXEA 4CZ2D 3TWVA 2E5KA 2YUQA 2BKKB 1T3SA 3UI2A 2GGRA 2EYYA 3NHNA 3PVLA 4K5AB 2AJAA 5AAOA 1G2BA 2D1XA 2DX1A 3TWQA 5L23A 1A5EA 3DEPA 4R0KA 1UGVA 2RQWA 4DEXA 4FSSA 4OMLA 1WX6A 2EYZA 1FMKA 4CYMD 2RQUA 2DZNA 3TWSA 3Q9UC 2CSQA 5GJWB 2HCKA 2A08A 2FPFA 2EGAA 2NUZA 3FJ5A 1VYTA 1ZUUA 4O1OA 3LH5A 1BI7B 1OV3A 4U8YD 3JUEA 1TG0A 1WXTA 1RUWA 4OMNA 1TR4A 5IXFA 1WFWA 4RTWA 1MYOA 1BU9A 3KFVA 2QC9A 4GMRA 5AQ9A 1E6HA 2C0IA 3R6NA 2K2MA 3UXGA 1BBZA 1AWJA 2DZOA 4RLYA 1BB9A 4DUIA 2FG0A 3VS6A 3QWXX 2LCSA 2ETCA 4HLLA 2LQWA 1PKTA 5HRYA 2FO0A 3ULRB 4BERA 1Z9QA 3PVQA 2LMJA 3UA7A 2KT8A 4LNPA 5EILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIL A;  2EPD A;  1S70 B;  1X27 A;  2PZ1 A;  1M3B A;  3A98 A;  1J3T A;  1NYG A;  4OMQ A;  4J9H A;  2OJ2 A;  1GCQ A;  1NG2 A;  1PHT A;  3C5R A;  1ABO A;  5ENR D;  3T8K A;  1VYV A;  4HCK A;  3HG0 D;  3NMZ C;  2YT6 A;  1JXM A;  2EBP A;  4QQI A;  5EN5 D;  2YUN A;  4JZ4 A;  5EID A;  1WLP B;  4GPM A;  1OPK A;  1YP5 A;  2A28 A;  2J05 A;  2OAW A;  2JMC A;  2KBT A;  2BTT A;  1GL5 A;  4LNU D;  2KXD A;  1AWX A;  2MOX A;  3NOC D;  2FRW A;  2LNH B;  1A0N B;  2VVK A;  1WA7 A;  4QT7 A;  2X3X D;  2L3Q A;  5CED B;  5IH2 A;  2CDT A;  1KFZ A;  2M0Y A;  2SRC A;  2RNA A;  5FWB A;  4U8V D;  5CEC B;  2RQR A;  3V30 A;  2KE9 A;  2RPN A;  1YN8 A;  5I22 A;  3TWW A;  1TUC A;  2L0A A;  4HB5 A;  3H0H A;  5HCK A;  5GJV B;  4OAU C;  1TUD A;  2LJ3 A;  4B93 B;  1D9S A;  3M0R A;  5I11 A;  2B86 A;  1N0R A;  2EKH A;  3H41 A;  4HVW A;  2XEH A;  3JXI A;  1WI7 A;  4F1P A;  2ABL A;  2JAB A;  2CSI A;  4RUG A;  1U5S A;  1T0H A;  1OT8 A;  1PRL C;  1IHB A;  1BI8 B;  2KT1 A;  2XMF A;  1QWF A;  2KRS A;  1WG0 A;  4J9F A;  1QYM A;  5FIO A;  4HRL A;  1E7O A;  1WDX A;  4AFU C;  1AZE A;  1UE9 A;  1K76 A;  1PWT A;  2C0O A;  1G83 A;  2EGC A;  3CQT A;  1NLO C;  4AFZ C;  2DRM A;  3VS3 A;  5EIB E;  1W70 A;  2XEN A;  4G8K A;  2F8Y A;  2XZT G;  2BZY A;  2O88 A;  1JO8 A;  2O9V A;  4Z8A A;  2ETB A;  2F37 A;  1X6B A;  4YDY A;  1N11 A;  1EFN A;  2A37 A;  4EIK A;  3TWX A;  1H8K A;  1WIE A;  5HS0 A;  2HE0 A;  2B0O E;  3VS4 A;  1I07 A;  4RTY A;  1QWE A;  1T3L A;  1I1J A;  1KIK A;  3V31 A;  1Y57 A;  2LQN A;  3EG1 A;  4AFS C;  1X2K A;  4F17 A;  1AWO A;  4LG6 A;  2DWZ A;  1UOH A;  2L6B A;  2FEI A;  1PRM C;  2CH4 A;  2PNI A;  4D8K A;  2ED0 A;  1GCQ C;  2HEQ A;  1BK2 A;  4YDW A;  1K1A A;  5CBO A;  5JA4 D;  5IHI A;  3GBQ A;  1QCF A;  2RQV A;  3VS1 A;  1VYU A;  2EW3 A;  3H0F A;  5AQA A;  1BU1 A;  1AWC B;  2AK5 A;  4DX7 D;  2VGE A;  3UTM A;  2HDA A;  3SO8 A;  2DMO A;  1X2Q A;  2ENM A;  3EHR A;  1JXO A;  2W0Z A;  5EYP F;  2XZD G;  1X6G A;  5KNH D;  2PTK A;  1SRL A;  4JJD A;  1RLP C;  1SEM A;  2LJ0 A;  5CEA A;  1IXV A;  4J9C A;  2RF0 A;  2ZGG A;  5EYL A;  1OEB A;  2I0N A;  4ZNX A;  1UHF A;  1JEG A;  2FO1 E;  1CSK A;  2JXB A;  4O1P A;  2SEM A;  3TSW A;  4AG1 C;  2ROT A;  4K5B A;  2DLP A;  4RTZ A;  3W9G A;  4HI9 A;  2MCN A;  3U23 A;  4BEP A;  2K6D A;  1UG1 A;  4CC7 A;  5IHN A;  3T9K A;  2L3S A;  3TWU A;  4F16 A;  4UUC A;  4C48 B;  1G3N B;  4J8Y A;  1UDL A;  3J5P A;  2JM8 A;  1GCP A;  2DA9 A;  1N0Q A;  3I5S A;  2JS0 A;  4X1V A;  2GBQ A;  2A36 A;  5BXU A;  2F8X K;  1ZUY A;  2K7A A;  2YSQ A;  3I9Q A;  1LCK A;  4OMP A;  3UA6 A;  2P4R A;  4DRX E;  4LUE A;  2KXC A;  3VS2 A;  4IIM A;  2RFM A;  1UHC A;  2P2C P;  2VKN A;  3EG2 A;  4F14 A;  3M0Q A;  4DX2 A;  1W6X A;  2OI3 A;  2ROL A;  1UFF A;  2NYJ A;  2JS2 A;  4RTV A;  4ATZ D;  2J6F A;  1ZUK A;  1ZBJ A;  1YMP A;  1CKA A;  2F2X A;  2LP5 A;  5FW9 A;  1V1C A;  1E6G A;  4OMM A;  2JT4 A;  2X3W D;  1BLX B;  1UJY A;  1OPL A;  2A5E A;  4U95 D;  2KGT A;  1M3A A;  2CT3 A;  2DM1 A;  3ZUV B;  2V1R A;  2EVR A;  1NEB A;  4ESR A;  5CBN A;  1K0X A;  1X43 A;  2O9S A;  3KEA A;  4J7W A;  1RI9 A;  4J9G A;  3AAA C;  3TWR A;  3VRY A;  1NEG A;  2BZX A;  1IO6 A;  2DL4 A;  5ENP D;  1UUE A;  2V1Q A;  1SPK A;  2AZS A;  5FWC A;  4O60 A;  2ESW A;  5KBA A;  3RBB B;  1T0J A;  4CC3 A;  3EG0 A;  4A63 B;  4JJB A;  2RQT A;  4ZFH A;  3M0T A;  1QLY A;  4HBD A;  1SHG A;  1KSW A;  1WYX A;  1GRI A;  3ZU7 B;  3V2O A;  1B07 A;  1N5Z A;  2EYX A;  1QKW A;  4LE9 A;  4QFV A;  2BKG A;  2GQI A;  2KNB B;  2KR3 A;  2AKL A;  1SSH A;  5IHK A;  4AFQ C;  1ARK A;  3M0U A;  2MYO A;  1UJ0 A;  5JMN D;  2DJQ A;  2FPD A;  1MX6 A;  2KRO A;  1WXU A;  1UEC A;  2RFA A;  1SHF A;  2CRE A;  1M8M A;  3EGU A;  4Z68 A;  1RLQ C;  2EYW A;  1AEY A;  1B3Q A;  3ZL7 C;  3DEO A;  2YUP A;  2MIO A;  1WDY A;  2L3P A;  3SEM A;  1JU5 C;  4TUM A;  4OMO A;  1UTI A;  2KXP C;  5EC7 A;  5AQB A;  4BES A;  1KJW A;  2VWF A;  2NWM A;  1SVX A;  1GBR A;  3UF4 A;  3QWY A;  3VS7 A;  4E6R A;  3JV3 A;  3REA B;  1QKX A;  3IQL A;  3AJI A;  4U96 D;  3D9H A;  1Z9Z A;  2V5Q C;  2DE0 X;  3SHW A;  2KBX A;  2KRM A;  1XOV A;  4DX1 A;  2FRY A;  2YDL A;  3I35 A;  2JTE A;  3J5Q B;  1NM7 A;  2C0T A;  2JW4 A;  2ZGD A;  4DX5 D;  1DC2 A;  1PKS A;  1S1N A;  2LJ1 A;  1YNZ A;  2CT4 A;  3PE0 A;  1GFD A;  2GTJ A;  1K9A A;  4LSZ E;  2DL5 A;  1H3H A;  2DL8 A;  1SW6 A;  4K5C A;  2F2W A;  4CC2 A;  1YYH A;  5ITZ F;  4RTX A;  2HBW A;  1AZG B;  2ED1 A;  4WCI A;  4HXJ A;  1X69 A;  2QYJ A;  3H0I A;  5CER B;  3VRZ A;  2CH4 W;  2DL7 A;  2DVJ A;  5AN8 A;  4ZHB A;  2EQI A;  2FPE A;  2XEE A;  2K79 A;  1OY3 D;  2DBK A;  1NLP C;  4IIO A;  3HRA A;  3Q9N C;  5AAR A;  1PNJ A;  4ORZ A;  1NYF A;  3TVT A;  1AP7 A;  1M3C A;  1MX4 A;  4HI8 A;  3EU9 A;  4NIK A;  5D66 A;  3B95 A;  1U3O A;  1U06 A;  2H8H A;  1JQQ A;  4CC4 B;  4AG2 C;  2BZ8 A;  3ZKJ A;  2AZV A;  2LZ6 B;  2D0N A;  3EG3 A;  1W1F A;  4Z89 A;  3M0P A;  2CUB A;  3RNJ A;  3NOG D;  2K3B A;  4DEY A;  1YCS B;  1M27 C;  2GTO A;  2RMO A;  1DCQ A;  4K11 A;  4HVV A;  4J9I A;  2DL3 A;  5KNG A;  2DNU A;  4JJC A;  2CUD A;  1CKB A;  4J9B A;  4JPB W;  5ENO D;  1VA7 A;  4RTT A;  2DBM A;  5ECA A;  2J6O A;  4OAV B;  1IKN D;  5ENS D;  4G8L A;  1ZX6 A;  5ENQ D;  2D8J A;  4BSZ B;  2EGE A;  4HQD A;  5FIN A;  1SRM A;  5BXO A;  2J7I A;  3NBN B;  3VS5 A;  2J6K A;  1ZSG A;  4D8D A;  4J9E A;  2KEA A;  2PNN A;  2ECZ A;  3O5Z A;  1AOJ A;  2KYM A;  4KRT A;  3EHQ A;  3REB B;  2DVW A;  1MV3 A;  1MV0 B;  1NFI E;  5HKP A;  1BD8 A;  4HNA D;  4JB8 P;  4HVU A;  3TSZ A;  1K4U S;  1MUZ A;  3NGP A;  3V2X A;  2GNC A;  2F2V A;  2M51 A;  2DRK A;  2YUO A;  3I5R A;  5KWD A;  3W9F A;  1YWP A;  4DX6 D;  1K1Z A;  4HRM B;  4F6R D;  2DF6 A;  3NPF A;  1K3Z D;  2ETA A;  1Y0M A;  5ENT D;  1WXB A;  2K9G A;  1M30 A;  4RTU A;  4HRN A;  2HSP A;  3V79 K;  2DYB A;  3F6Q A;  3LJN A;  5AQ7 A;  1AVZ C;  4J9D A;  1ZLM A;  2L2P A;  3C0C A;  1FYN A;  2KRN A;  4BET A;  2O2O A;  2J06 A;  1HSQ A;  3UAT A;  1ABQ A;  4M4Z A;  2RN8 A;  1HD3 A;  4GLM A;  2QDL A;  5IXB A;  3ZNG A;  1GFC A;  1MJ0 A;  4LN2 A;  3B7B A;  3THK A;  4N5Q A;  1OOT A;  2D8H A;  2J8S D;  2G6F X;  2Y1L E;  2JM9 A;  2KYB A;  2V4H C;  4Y92 A;  3VS0 A;  2IIM A;  4Z88 A;  1MX2 A;  3M0S A;  4LUD A;  1K0S A;  2Y0B G;  4GBQ A;  1I0C A;  2O31 A;  3JXJ A;  1GBQ A;  2JMA A;  1AD5 A;  1H92 A;  1K1B A;  1HJD A;  3TWT A;  2W10 A;  2AKK A;  2LX7 A;  4JZ3 A;  1AWW A;  1YWO A;  3IXE A;  4CZ2 D;  3TWV A;  2E5K A;  2YUQ A;  2BKK B;  1T3S A;  3UI2 A;  2GGR A;  2EYY A;  3NHN A;  3PVL A;  4K5A B;  2AJA A;  5AAO A;  1G2B A;  2D1X A;  2DX1 A;  3TWQ A;  5L23 A;  1A5E A;  3DEP A;  4R0K A;  1UGV A;  2RQW A;  4DEX A;  4FSS A;  4OML A;  1WX6 A;  2EYZ A;  1FMK A;  4CYM D;  2RQU A;  2DZN A;  3TWS A;  3Q9U C;  2CSQ A;  5GJW B;  2HCK A;  2A08 A;  2FPF A;  2EGA A;  2NUZ A;  3FJ5 A;  1VYT A;  1ZUU A;  4O1O A;  3LH5 A;  1BI7 B;  1OV3 A;  4U8Y D;  3JUE A;  1TG0 A;  1WXT A;  1RUW A;  4OMN A;  1TR4 A;  5IXF A;  1WFW A;  4RTW A;  1MYO A;  1BU9 A;  3KFV A;  2QC9 A;  4GMR A;  5AQ9 A;  1E6H A;  2C0I A;  3R6N A;  2K2M A;  3UXG A;  1BBZ A;  1AWJ A;  2DZO A;  4RLY A;  1BB9 A;  4DUI A;  2FG0 A;  3VS6 A;  3QWX X;  2LCS A;  2ETC A;  4HLL A;  2LQW A;  1PKT A;  5HRY A;  2FO0 A;  3ULR B;  4BER A;  1Z9Q A;  3PVQ A;  2LMJ A;  3UA7 A;  2KT8 A;  4LNP A;  5EIL A; 
#chains in the Genus database with same CATH topology
 2DIL A;  4XTX A;  2OOE A;  4IYP A;  2O4X B;  5FRO A;  1X27 A;  2QQA A;  4CGW A;  3D9I A;  1J3T A;  1VQ8 Q;  4OMQ A;  4XIF A;  2GW1 A;  1NG2 A;  1WHK A;  1PHT A;  4J8S A;  3QUI A;  1ABO A;  5KJL A;  4HCK A;  4MRU A;  3CCR Q;  5GMK e;  1MNE A;  1QVF A;  1IHG A;  2HL3 A;  5EID A;  1YP5 A;  1OPK A;  2J05 A;  2MOW A;  3GZ2 A;  1HYO A;  2WSE E;  4C92 C;  3DPD A;  2JMC A;  2KBT A;  1GL5 A;  2EIM E;  1PC0 A;  2Y90 A;  4M7D D;  2VSY A;  4L6V 5;  4QT7 A;  1KFZ A;  3CCM A;  4ZTF A;  3CHM A;  2RNA A;  5DBK A;  4FSX A;  5FWB A;  3MPU B;  3CIA A;  4U8V D;  4F7U F;  3LYA A;  5I22 A;  1YN8 A;  1N4S A;  1V29 B;  1TUC A;  2PVO B;  3H0H A;  4HB5 A;  5GJV B;  2EQK A;  3VUB A;  3L17 A;  4BY6 B;  5I11 A;  3RMS A;  1MMD A;  4AY5 A;  4GAA A;  4BWR A;  1WNL A;  2EKH A;  3H41 A;  3QKJ A;  4DBR A;  1KQS A;  1B34 B;  2L6J A;  3JXI A;  1WI7 A;  4XZ4 A;  3V7R A;  3CCQ Q;  4PJM A;  2AIR B;  2JAB A;  5EDS A;  4F7A A;  1BI3 A;  4DK5 A;  1W2B P;  3KEZ A;  1OWP A;  5G2N A;  2KRS A;  3L2U A;  2IQC A;  3SI5 A;  2K2V A;  3I3N A;  5FIO A;  4HRL A;  2WQ6 A;  1AZE A;  3PRE A;  1PWT A;  2NLU A;  4AFZ C;  1NLO C;  3S7J A;  2DRM A;  3J7A F;  3VS3 A;  3UUX A;  4FT4 A;  4URK A;  2EWN A;  2XEN A;  1NP7 A;  2F8Y A;  4Z8A A;  2D6F A;  4WUY A;  1H3Z A;  2F37 A;  4ABN A;  5ARG A;  3UQ3 A;  1EFN A;  5GAM e;  1YJN T;  2WXF A;  2A4Z A;  2XK0 A;  2HE0 A;  2B0O E;  4IUT A;  2QTX A;  1I07 A;  5JHA A;  4ILG A;  2RJF A;  3SWN A;  1PC2 A;  1KIK A;  1K8A C;  2LQN A;  5C1D A;  2JZ2 A;  1RAF B;  1BIB A;  5G55 A;  1UOH A;  4QQD A;  1WAO 1;  2ILR A;  4Q96 A;  2CH4 A;  4UQX A;  3QZ5 B;  2HL5 C;  2YWW A;  3CVX A;  4LDY A;  1BK2 A;  5LJ3 g;  1YJN A;  2KI7 A;  2R57 A;  2Y4U A;  4M78 F;  5A0D A;  1TS9 A;  1VYU A;  2P9L G;  3H0F A;  2OTJ A;  2QFC A;  2ZPE B;  3CPW A;  1XTD A;  2HDA A;  3OBW A;  2DYI A;  5GAN h;  3GF5 A;  3MP1 A;  4UWF A;  3PZ4 A;  1Y96 A;  3RDV A;  1JWG A;  1E8Z A;  4O5V A;  3CMA Q;  3EG9 A;  2LJ0 A;  1IXV A;  4M77 A;  3OYF A;  4J9C A;  2RF0 A;  2J4D A;  1G3T A;  4AXH A;  5LX8 A;  2KCK A;  1OEB A;  3O48 A;  1CSK A;  4XQ3 A;  4AG1 C;  1RAD B;  4FU6 A;  5T4Y A;  3TEE A;  2EJG A;  4K5B A;  5AIJ A;  5G05 C;  4J83 A;  2MCN A;  4ATG A;  4BEP A;  2K6D A;  3EHN A;  4G23 A;  4R55 A;  4CEM A;  4LEU A;  2RK2 A;  4C8Q D;  1XGW A;  3ASG A;  3SFZ A;  2L3S A;  3MEK A;  2EQM A;  5AYW D;  3LY8 A;  1G3N B;  3UT8 A;  4C48 B;  3JCM W;  1YA0 A;  3G6E T;  3D9L A;  2QK0 A;  2EKO A;  4FYV B;  4IUQ A;  3G4S T;  5BXU A;  2F8X K;  1LD7 A;  3I9Q A;  3L82 A;  3ZRH A;  1MMG A;  2P4R A;  2C06 A;  4LUE A;  2KXC A;  5KYU A;  4GCO A;  3HL8 A;  3VS2 A;  3BY7 A;  2LNV A;  2K3Y A;  3EG2 A;  4RVB A;  2OI3 A;  2JS2 A;  3AS4 A;  2YRD A;  1ZUK A;  3PIP A;  4HOU A;  4JRI A;  4CT0 A;  3U3W A;  4XTZ A;  9ATC B;  2XG8 D;  1E6G A;  3DXK G;  3SWN C;  3G6E A;  2X3W D;  4O6J A;  1UJY A;  3G4S A;  1E7V A;  2YHC A;  3SNX A;  3NFC A;  4N2Q A;  1SZA A;  4AY6 A;  2H6I A;  3PMI A;  4IUR A;  5G04 C;  2Z0W A;  5CBN A;  1QW1 A;  1X43 A;  3U4T A;  2VSX E;  3KEA A;  2X4Y A;  3MEA A;  1KLX A;  1TNB A;  5J90 A;  1N8R U;  4J9G A;  3AAA C;  4GTO A;  4DLQ A;  4AT1 B;  5CQY A;  2BZX A;  1WJR A;  5CRU A;  4JEU A;  3HXC A;  3PE3 A;  4FC8 A;  4HLE A;  4RKU E;  3CCS A;  5ENP D;  3AT1 B;  4JJN K;  1Q86 R;  5AEN A;  2AZS A;  3HVE B;  5FWC A;  5FTP A;  2OCC E;  4RCB A;  1Q7Y U;  1T0J A;  4CC3 A;  3EG0 A;  5FZR A;  4JJB A;  4C0G A;  3U64 A;  2KC7 A;  2FB7 A;  2CYZ B;  3ZU7 B;  2COW A;  2EYX A;  3UIO C;  2F1L A;  3ABM E;  4LE9 A;  1X75 C;  2RHY A;  2F0Y A;  4E47 A;  3FH5 A;  3ZBD A;  2AKL A;  1C1A A;  3B13 A;  3RKX A;  1SSH A;  3SFM A;  2WXH A;  3M0U A;  3QJZ A;  5A23 A;  5BNW A;  5CR2 A;  2ZXW E;  3OYJ A;  1IZ6 A;  1RAE B;  2ZPH B;  1DJ7 B;  1FVH A;  2LT4 A;  3G2W A;  2ZPI B;  2ZPF B;  1WPY A;  1UEB A;  4FYW B;  2XEV A;  4APF A;  4A4F A;  2QTV A;  3CXC S;  4PJJ A;  5FLX E;  1AEY A;  5CRV A;  4Q5W A;  3TG4 A;  2KZT B;  1B3Q A;  2BKD N;  5KE3 A;  3DLL A;  3DEO A;  2LT1 A;  2YUP A;  3CPF A;  3UM3 A;  3SEM A;  3S3O A;  2C0M A;  4OMO A;  4XTY A;  5EC7 A;  2DKG A;  1SVX A;  2CP5 A;  4I2W A;  3ML8 A;  3WVD B;  4UWK A;  1YI2 T;  3AJI A;  3LW5 E;  4QW2 A;  1B34 A;  3SHF A;  3U66 A;  3I55 T;  5CMY A;  2IJG X;  2J09 A;  3JSC A;  2E0I A;  4FL6 A;  2DE0 X;  4G26 A;  4UWL A;  1BYM A;  2KBX A;  2KRM A;  1OWO A;  2YRC A;  4ILI A;  4EMK A;  3ULY A;  4DX1 A;  2YDL A;  2R2L A;  4EPC A;  3TU4 K;  4YDE A;  5LJ3 f;  2C0T A;  2JW4 A;  1FVF A;  3L2V A;  4DX5 D;  1TN8 A;  1PM3 A;  4M78 A;  2CT4 A;  3H6Z A;  4Q69 A;  2GTJ A;  2R5S A;  4LSZ E;  3ME9 A;  1H3H A;  1YI2 A;  3I55 A;  2R02 A;  1YYH A;  4II1 A;  4DI4 A;  1AZG B;  3UMV A;  1LD8 A;  4KYO B;  5FU7 B;  5JHB A;  3HXF A;  3ESK A;  3NZU A;  1X69 A;  3VRZ A;  2E10 A;  3L2Q A;  1UN9 A;  3X2Q E;  3INZ A;  4J6I A;  2EQI A;  2L89 A;  2RM4 A;  1OY3 D;  3HRA A;  3FTV A;  3L1A A;  5FU6 C;  4ORZ A;  1YHQ T;  1VQ7 T;  1HFA A;  2WXQ A;  1IXD A;  2DYR E;  3LJ3 A;  1M2V B;  1BCO A;  1NYF A;  3LY7 A;  1M3C A;  3VLD A;  3JUI A;  1MX4 A;  4HI8 A;  5GAN 6;  1G5V A;  3EU9 A;  4F7U E;  4M7D G;  2H8H A;  2Q7F A;  4NAC A;  3L2R A;  2HAX A;  2M1H A;  3ZKJ A;  2AZV A;  4R56 A;  2LZ6 B;  4PJO D;  4GYY A;  1O1S A;  3M0P A;  2CUB A;  1OWM A;  2I9C A;  4JA9 A;  3RNJ A;  2K3B A;  4K11 A;  4ZGJ B;  2VB6 A;  5CCM A;  4J9I A;  4J9B A;  4NOY A;  3JQ0 A;  1VA7 A;  1YHQ A;  3M58 A;  1VQ7 A;  1HG5 A;  5ENS D;  4CDM A;  3FU3 A;  3G71 T;  2GRR B;  2HR2 A;  4C0Z A;  4G8L A;  4L23 A;  5A0G A;  1XNF A;  4PS3 A;  1D1A A;  3TRE A;  4WNF A;  3EGD A;  3FHE A;  3FB9 A;  4HCC A;  3RES A;  3FUD A;  5BXO A;  2J7I A;  3VS5 A;  2QYU A;  4KBQ A;  2VTB A;  4I43 A;  3O5Z A;  2WXL A;  4C9B B;  3CK7 A;  4GY5 A;  3V7C A;  3CCR T;  1VQP Q;  1HG2 A;  3REB B;  3X20 B;  3MX3 A;  4EMK C;  2DVW A;  2LUH A;  1NFI E;  5HKP A;  1MV0 B;  4HVU A;  3TSZ A;  4GA0 A;  4PL6 A;  2IVW A;  4MML A;  2DRK A;  3I5R A;  5BW8 C;  5KWD A;  2NUT B;  3W9F A;  3CQC B;  4M78 C;  5HKC A;  1VQ8 A;  1K1Z A;  4F6R D;  2PVD B;  4KVM A;  5KYY B;  3GZ1 A;  5J39 A;  3MEU A;  5LL6 S;  4GTM A;  1PSF A;  4AMC A;  1OCC E;  2MWO A;  3V79 K;  2WXO A;  3JCM f;  3F6Q A;  1LNX A;  3MP8 A;  4U63 A;  3OW2 S;  2OTJ Q;  1FYN A;  1KT1 A;  1HXD A;  3ZHE A;  2JTM A;  2O2O A;  4BDZ A;  3FH7 A;  4JA7 A;  3ENE A;  4GA2 A;  3M5A A;  3CCQ T;  3ASD A;  2QDL A;  3G2T A;  1GFC A;  4MLP A;  3N71 A;  1MJ0 A;  2XRY A;  3B7B A;  4LN2 A;  3THK A;  3FUM A;  3ONK A;  1IQR A;  1E8W A;  2D8H A;  3FTZ A;  2AVP A;  4Y92 A;  2CKK A;  1H2U A;  5BT1 A;  1PSE A;  1EPU A;  4OYS A;  2Y4Y A;  4Z88 A;  3VTY A;  4N4I A;  3DLM A;  4LUD A;  4AV7 A;  3FC3 A;  4VUB A;  2IO2 C;  2XHE A;  3HVE A;  3NZS A;  2O31 A;  3JXJ A;  3HKS A;  1IHV A;  3WXM B;  1VQ4 Q;  5E75 A;  2JVV A;  1OCR E;  3CV0 A;  1K1B A;  2EJ9 A;  2P0P A;  3P8B B;  4DQ2 A;  1N27 A;  3DRA A;  2BE7 D;  1Z3X A;  2NUP A;  2YLB A;  3S3M A;  3QNK A;  4EHM A;  1ACM B;  3IKO B;  2LVM A;  3RMQ A;  4JZ3 A;  5KYN A;  2I2O A;  3ESL A;  3ASK A;  4C8Q G;  1YWO A;  5GAO l;  3QYH B;  1JCQ A;  3QJ6 A;  4C0E A;  5HK3 A;  3JB9 J;  4HCZ A;  1TEZ A;  1WHG A;  2VSN A;  3PVL A;  3H9N A;  1I8F A;  4Y28 E;  4JW1 A;  3SGH A;  4B0Z A;  2XCC A;  3FTU A;  4XTV A;  3DEP A;  3X28 B;  3FTS A;  1UGV A;  4A4H A;  3GPL A;  1KPS B;  2E12 A;  2EQJ A;  4LDU A;  3JCM b;  4OML A;  2GRL A;  2VGX B;  3M56 A;  4CYM D;  3Q9U C;  1D0Y A;  2KZT A;  3HIZ A;  4LD6 A;  3FJ5 A;  2NUZ A;  4BX9 A;  4N2S A;  1OX9 A;  1RI0 A;  3CMA T;  4FA6 A;  4M7A D;  2QI2 A;  4WAF A;  1TSF A;  1WFW A;  3OW2 P;  3EU5 A;  1QCO A;  4R7L A;  3EAE A;  5GMK i;  1NZN A;  1PAQ A;  2GGF A;  4M7D F;  2K2M A;  2QEX Q;  3CCS Q;  4A55 A;  3UXG A;  8ATC B;  4LCT A;  2E3I A;  2VUB A;  3QDR B;  3HXB A;  2WSF E;  4IN3 B;  3OXG A;  3VS6 A;  4HLL A;  2Y3A A;  3DSU A;  3CMA A;  1ZBP A;  2OEV A;  1Q86 U;  2PUO B;  3LGF A;  3LCA A;  3UA7 A;  2OVF A;  2VSO E;  4LRZ A;  4ANX A;  4N4H A;  4LNP A;  3OYI A;  3NTK A;  2RJC A;  4GMJ A;  2RD0 A;  5IN1 A;  2IOS A;  3TXM A;  2PZ1 A;  1Q82 U;  1M3B A;  3MKQ B;  2DPP B;  5GAM f;  2E64 A;  5LJ3 e;  4PLL A;  3IEG A;  3CME Q;  1EIF A;  4AEZ C;  2LDM A;  5ENR D;  3T8K A;  5LP0 A;  3HHT B;  3HG0 D;  4N5C A;  2FL7 A;  2YT6 A;  2FYK A;  2DAQ A;  2P9N G;  4QQI A;  5EN5 D;  3G1J A;  2A28 A;  1WHH A;  2MPX C;  4J8O A;  3BEE A;  4BTB A;  3PNW C;  4ILH B;  4PS8 A;  2MOX A;  3SQV A;  3VU3 C;  2LNH B;  3FEX A;  1O9S A;  2VYT A;  4LXC A;  3ER0 A;  4I9C A;  5CKF A;  3RKW A;  1RL2 A;  4GZ6 A;  2ZZD A;  4X8Q A;  5CEC B;  1LPL A;  3C98 A;  4FM4 B;  2RQR A;  2GRQ B;  1OUL A;  1TUD A;  5EG2 A;  3FU6 A;  2B86 A;  4Q94 A;  3PTA A;  2DEU A;  5JJ7 A;  3ZXS A;  5GAO q;  3S7F A;  2OVB A;  1PRL C;  2KT1 A;  3U9W A;  2XIC A;  1QWF A;  4MZM A;  5G05 J;  2L3R A;  1TOV A;  3LLR A;  4AFU C;  1K76 A;  2C0O A;  1G83 A;  1RAH B;  3CR3 A;  2QQS A;  1IB8 A;  3DBS A;  4E7I A;  3ZGQ A;  1JO8 A;  4OVV A;  2ETB A;  1X6B A;  3BDU A;  4YDY A;  1N11 A;  4KGV B;  1K9M R;  3QZ9 B;  3TGO A;  3OB9 A;  3UKU G;  3QB2 A;  3CQG B;  1KZO A;  1NL4 A;  2LSV A;  2WPV A;  1I1J A;  4BUG A;  3V31 A;  3EG1 A;  1M4Z A;  2L0I A;  3T8M A;  4AFS C;  4TRQ A;  4FJZ A;  1AWO A;  4LG6 A;  4U8H A;  5FQ7 A;  4C8Q F;  4ZGE B;  2I1K A;  2E70 A;  2EJF A;  1ZHI A;  2FEI A;  1Y07 A;  5A6C A;  3JRZ A;  1JJ2 S;  1TJF A;  4M77 F;  3PZ2 A;  1M5Q 1;  2ED0 A;  3T5X A;  2HEQ A;  5JA4 D;  1QP3 A;  1WGS A;  1ZQ1 A;  2XS1 A;  4M75 E;  1H6K A;  2KQW A;  4A54 A;  4Z02 A;  1QQE A;  4YDO A;  4DX7 D;  1N4P A;  2OTL A;  4ELY C;  1X2Q A;  2IFU A;  3SD5 A;  5CKE A;  1GW6 A;  2CZ7 B;  5A0L A;  3HTR A;  2DD4 A;  2W0Z A;  4QVC A;  1G8X A;  5EYP F;  2XZD G;  2PTK A;  2VYI A;  4PJO G;  3QAR A;  1VOM A;  2CFU A;  4JJD A;  3QDN A;  3OYN A;  3RO3 A;  1Q86 C;  2BE9 B;  2DCP A;  2HZY A;  4Y91 A;  2ZGG A;  4ZNX A;  1KHC A;  1SKU B;  1VQ9 Q;  2FZG B;  1JEG A;  2FO1 E;  3L2Z A;  5GAN e;  3EFS A;  3JB9 D;  4O1P A;  2GRO B;  2AHJ B;  3M54 A;  3GIB A;  3JQ1 A;  2DLP A;  4J8F A;  4ELZ C;  1Q82 C;  1QNF A;  1H64 1;  3BE3 A;  4YVO A;  4XAX B;  4YTL A;  3BFM A;  3D7S B;  5ENN A;  1UG1 A;  4QVD A;  4CC7 A;  4F1S A;  4AM9 A;  3FWV A;  3GNF B;  3TWU A;  3DSS A;  4F16 A;  2C0L A;  3EIQ C;  3OXL A;  1UDL A;  4J8Y A;  2JM8 A;  4DI3 A;  3ZIM A;  2DA9 A;  2M0O A;  5GMK j;  1N0Q A;  5AJD A;  5KJM A;  3OS2 A;  1KZP A;  3L54 A;  2GBQ A;  1SZ9 A;  4NUR A;  2DXC A;  2YLC A;  3HPW A;  1LCK A;  4EZL A;  3RRN B;  3MV2 B;  2DJZ A;  4IIM A;  4NL2 A;  2K5I A;  5CHE E;  2P2C P;  4F14 A;  3ZYM A;  4M7D A;  1WQW A;  4DX2 A;  1M8V A;  3SFX A;  3CCM T;  2ROL A;  1UFF A;  3C3O A;  4RTV A;  4G24 A;  2ZGW A;  3QWV A;  2J07 A;  4I9E A;  1G3S A;  1AT1 B;  2KDS A;  4ATZ D;  3TL5 A;  5B3S E;  2F2X A;  2LP5 A;  5FW9 A;  3CSF A;  3CCV A;  4FYY B;  2ATC B;  1OPL A;  4U95 D;  4L59 A;  2MWP A;  4PFZ A;  1U8R A;  1JJ2 P;  2RK1 A;  4FLB A;  4KZ0 A;  3X26 B;  1M3A A;  3L42 A;  2EVR A;  4F7U B;  2XRZ A;  1NEB A;  3CXC A;  3UDC A;  3EGX A;  3RUX A;  4C92 E;  4J7W A;  2P9P G;  3CGH A;  1YCY A;  3VRY A;  4XU3 A;  3FUK A;  3TXN A;  2E1H A;  4F3V A;  2EQU A;  2KCV A;  2BED A;  3Q7F A;  3FUJ A;  3ZFJ A;  3M9Q A;  1UUE A;  2V1Q A;  2GRM A;  3MET A;  5FRM A;  1U3C A;  2ESW A;  2AXV A;  3FTY A;  4FCY A;  1QVG P;  1VQP T;  2MI6 A;  3CHQ A;  3OSS C;  3M53 A;  1V55 E;  3M57 A;  1HS6 A;  5GAM j;  4JRQ A;  4TXP A;  3AS8 A;  3OMC A;  1SHG A;  2BIV A;  4G11 A;  3ABL E;  2ZPB B;  1B07 A;  1N5Z A;  4BI4 A;  1QKW A;  4FYX B;  1VIF A;  2NSZ A;  3Q49 B;  4CRW A;  2BKG A;  4NQ0 A;  5EKQ D;  4X34 A;  2GQI A;  4B89 A;  3KD7 A;  4AFQ C;  4U7E B;  2MYO A;  3MKQ A;  5T8I A;  5JMN D;  1UJ0 A;  2DJQ A;  3BW1 A;  4FUL A;  3UX4 A;  2J08 A;  5KYX B;  1TNY A;  5IY5 E;  1RAC B;  1WXU A;  1UEC A;  2RFA A;  5GAO m;  1VQP A;  4IUP A;  1HF8 A;  1LVK A;  3EGU A;  4Z68 A;  2EYW A;  2OTJ T;  2F5T X;  1JCR A;  3EUV A;  1K8K G;  3M55 A;  4XU2 A;  3ZL7 C;  2LQK A;  4PJO B;  4TXQ A;  3A8M B;  2AWI A;  4L7T A;  4ACK A;  3EDT B;  3O8V A;  4N0A A;  1UTI A;  4ANW A;  4M7D C;  2XQ0 A;  4BES A;  4EZJ A;  1KJW A;  2VWF A;  2NWM A;  2R03 A;  3MJX A;  1H6P A;  2UWJ G;  3CC7 A;  1X6O A;  4M7A G;  3JV3 A;  3ONL A;  2LQ8 A;  5LJ5 h;  3B7S A;  3JCK C;  5D6W A;  2KMT A;  2RB6 A;  1QKX A;  4FP7 A;  3BU8 A;  2X6I A;  3Q73 A;  3CHP A;  2Y4X A;  1R0B G;  1VQ4 T;  1OUV A;  3D9H A;  4U96 D;  2XPI A;  1RAA B;  4UWG A;  4BE0 A;  1ZB1 A;  3SHW A;  1TJC A;  1PD1 A;  2IG0 A;  4C8Q A;  4HA8 A;  2BTD A;  3OBY A;  1H19 A;  3L22 A;  1NM7 A;  1XQH A;  2ZGD A;  2LJ1 A;  4BDY A;  1SA5 A;  4GTR A;  1IGQ A;  4NL3 A;  3DST A;  1VQ4 A;  4CC2 A;  4RTX A;  1JB0 E;  3NTH A;  4JLG A;  4RG8 A;  1VQM A;  3FEY A;  4XU1 A;  3L16 A;  2QYJ A;  4BFR A;  2FZC B;  1ZU2 A;  1BI2 A;  2CH4 W;  5KCM A;  1EF1 C;  2X6J A;  2DTO A;  3CC2 T;  5AN8 A;  1BI1 A;  4XTU A;  1W3B A;  1PD0 A;  4A4G A;  2WXR A;  2XEE A;  2DBK A;  1MND A;  1NLP C;  1FMV A;  3Q9N C;  2RHZ A;  2ION A;  4N3C A;  2DIW A;  3HFO A;  4EMG A;  3DXM G;  4FHK A;  1PNJ A;  2KSS A;  3LXU X;  2IF4 A;  2XDB A;  1U3O A;  2BZ8 A;  2LXM A;  3D9K A;  2D0N A;  4E7L A;  3EG3 A;  3E1S A;  3E9F A;  4DEY A;  1YCS B;  1M27 C;  4C5E A;  1H2V C;  2GTO A;  1KQ1 A;  4C0D C;  2QEX T;  1DCQ A;  3CCS T;  3LVQ E;  2DNU A;  2CUD A;  3MGB A;  3HRS A;  4JRP A;  2DBM A;  4OAV B;  3DSW A;  1IKN D;  2MMP A;  2PZI A;  4J5Y A;  4N0A C;  2J4B A;  2A5U A;  2H3J A;  4J6W A;  2P9I G;  5FIN A;  2PQW A;  4OGC A;  3SB2 A;  2J6K A;  3PZ1 A;  3FUE A;  1X01 A;  4C5G A;  2QEX A;  1DCE A;  3EHM A;  2M63 A;  3OMG A;  3AU4 A;  4WNE A;  1AOJ A;  1OCZ E;  3ULE G;  3APC A;  3EHQ A;  4HCB A;  4EDU A;  3QXE B;  4QQG A;  1K4U S;  4C8Q C;  4HNA D;  1BD8 A;  4LDW A;  1K9M U;  5D6X A;  5I21 A;  3KAE A;  2M51 A;  1Q82 R;  1UGS B;  2GCX A;  4M77 C;  3RRU A;  2EFI A;  5ANR A;  5B1B E;  3QSU A;  5LJ5 g;  2P58 C;  4TUU A;  3HHM A;  4DX6 D;  3NPF A;  4HRM B;  2DF6 A;  1K3Z D;  2O4X A;  2ETA A;  3B7T A;  5ENT D;  1WXB A;  4M77 E;  5GAN g;  2K9G A;  2C2L A;  3CME A;  3D9O A;  4M7A B;  5GMK l;  4RTU A;  5FWQ A;  5AYF A;  1NJI R;  4AVX A;  4U0Z A;  4P5N A;  3G2V A;  3IBE A;  4J9D A;  4UI9 C;  2L2P A;  4I6J A;  4BET A;  1HSQ A;  5IAY A;  1KT0 A;  2OTL Q;  4MDW A;  1ZSZ B;  4A53 A;  2M16 A;  2FVU A;  3LWI A;  3L6A A;  1FWZ A;  3ISM C;  1UW4 B;  2DXU A;  4FT2 A;  1OOT A;  2PL2 A;  2J8S D;  5GAO r;  5IT9 E;  2IY0 C;  3FDR A;  3KSQ A;  3OYE A;  2E3H A;  3ML9 A;  2JNG A;  1YBY A;  3VYH B;  4BAC A;  2FO7 A;  3G2S A;  4U07 A;  1UGP B;  3RKV A;  3S2A A;  2VC8 A;  1OXJ A;  5B1A E;  3SBT B;  2L5Q A;  3F70 A;  4WWP A;  8AT1 B;  4H7Y A;  4BY6 A;  2JMA A;  1HX8 A;  3JB9 G;  1NPR A;  1QP2 A;  2Y4T A;  3BG1 B;  4A3V A;  3TWT A;  3VKI A;  2W10 A;  2AKK A;  4I2Z A;  4GZD A;  5D6Y A;  3CEQ A;  2E2E A;  3UKR G;  4GB9 A;  3ASN E;  4N3B A;  1AWW A;  3GYZ A;  3IXE A;  2CFZ A;  1Y6I A;  2GRN B;  4JEH A;  4K0R A;  2J9Q A;  3UI2 A;  2GGR A;  4UC4 A;  3FUN A;  1I4K 1;  2IOL A;  5AAO A;  2D1X A;  2MHK A;  2LXL A;  4RG9 A;  4N39 A;  1D8D A;  1A5E A;  2RQW A;  4DEX A;  2UY1 B;  5GAN 5;  4ANJ A;  3AG3 E;  3B7R L;  4FSS A;  2EYZ A;  1FMK A;  1M1F A;  3MKD A;  5LJ3 d;  5KE2 A;  3TWS A;  3CCV Q;  4KUD K;  2V8K A;  4PJO A;  2FPF A;  2EGA A;  5CKB A;  4O6F A;  3LH5 A;  1ZA1 B;  1BI7 B;  5CO7 A;  1E7U A;  4MS6 A;  1W4S A;  5DLO A;  1OV3 A;  4U8Y D;  4PK4 A;  1I5O B;  2RKK A;  2KY9 A;  4OB1 B;  4M75 B;  4HOQ A;  5IXF A;  3FUI A;  3CBP A;  4XX5 A;  1VQ9 T;  3MZL B;  2QC9 A;  1M9S A;  3KFV A;  2LO6 A;  2QQR A;  3TAX A;  1E6H A;  3FY4 A;  3VLF A;  2IU1 A;  3VTX A;  2C0I A;  2E5Q A;  4KT0 E;  4B9W A;  2D9T A;  3E30 A;  3ZVV A;  3A8L B;  5GAO n;  4GZ3 A;  3ZYL A;  1BBZ A;  4RLY A;  5GAN 8;  2DFU A;  2RH2 A;  2CGH A;  5CKH A;  2LQW A;  1EYH A;  1N9R A;  3WG7 E;  1E8Y A;  1QVF P;  3CK8 A;  2BUG A;  1Z9Q A;  3OYY A;  3PVQ A;  1VQ5 A;  4XI0 A;  2KT8 A;  1K9M C;  1R77 A;  4PH4 B;  1VQ9 A;  5FZQ A;  3LVR E;  3FEO A;  3EH1 A;  1S70 B;  2ZCF B;  3A98 A;  1NYG A;  3ZEH A;  4JHK A;  1OWL A;  3DSX A;  1GCQ A;  2PUK B;  2VQ2 A;  1VQ8 T;  3A8O B;  4GTP A;  1UGR B;  4BY6 C;  4OMF B;  4J8E A;  2H6G A;  3RU0 A;  2QA4 Q;  3NMZ C;  3B7U X;  2DTH A;  2EBP A;  2YUN A;  1WLP B;  2OAW A;  1MMA A;  2V8S E;  5LCW J;  3UIN C;  1KQS P;  2BTT A;  3MKR A;  2KXD A;  3OS5 A;  3NOC D;  1LF8 A;  2FRW A;  1MMN A;  1A0N B;  2VVK A;  1WA7 A;  4BT8 A;  2L3Q A;  3MYV A;  2X3X D;  2CDT A;  4F53 A;  5C2Y A;  4A4K A;  4BI3 A;  2SRC A;  4BB7 A;  4FAD A;  3CHO A;  1GXI E;  3GP8 A;  3V30 A;  2RPN A;  3TWW A;  5HCK A;  2F69 A;  2RG8 A;  2LJ3 A;  3LKU A;  1G3W A;  4JDS A;  1VQ6 Q;  4B93 B;  1D9S A;  4M78 E;  3CC7 Q;  3S7D A;  1N0R A;  4HXI A;  4HVW A;  2XEH A;  1YFN A;  4F1P A;  2L9B A;  2CSI A;  4PS7 A;  1OT8 A;  4G2V A;  3APF A;  4C92 B;  2XMF A;  5LJ5 f;  2BF0 X;  4LNG A;  5FQ6 A;  1WG0 A;  1WQ7 A;  2XDD A;  3FUL A;  3PZD A;  3UT1 A;  5GAN f;  4KT6 B;  2EGC A;  1HU3 A;  3JCM d;  2WXN A;  4PJN A;  2DZ9 A;  2FUL A;  1OZ3 A;  1W70 A;  3DSV A;  2O88 A;  4G8K A;  3URZ A;  2XZT G;  1MHN A;  3G7Z A;  2O9V A;  2LCC A;  4ZTJ A;  1QMC A;  1RAI B;  3JCM P;  3D9J A;  2A37 A;  4EIK A;  4GLK A;  3TWX A;  1NZ9 A;  1OU9 A;  1YJ9 Q;  2R58 A;  4ACL A;  1H8K A;  1W2B A;  2YHE A;  3VV0 A;  4DA4 A;  3PEU B;  1QVP A;  4ANU A;  4PNO A;  3CPW P;  3JB9 F;  3A5Z B;  1N6A A;  3H8Z A;  1VQM Q;  1T3L A;  1Y57 A;  3JYS A;  1M90 U;  1BKB A;  2R17 C;  1X2K A;  4F17 A;  1O1R A;  2R5M A;  2YHT A;  2L6B A;  3O4Z A;  1Y71 A;  4X9C A;  4XU0 A;  3OYM A;  4NRH B;  3EFO B;  4D8K A;  1GCQ C;  4YDW A;  5CBO A;  3UT7 A;  1VQN Q;  1E8X A;  3APD A;  4M7A A;  1RW2 A;  2RQV A;  4CCA A;  2XD0 A;  4I1O B;  1OI1 A;  1SF9 A;  3CC4 Q;  4CDN A;  5E76 A;  2V26 A;  4MDX A;  2VGE A;  3UTM A;  4OVA A;  1JUQ A;  2V8I A;  5AJL A;  3FTW A;  2ENM A;  3EHR A;  1EX4 A;  1FT1 A;  1JXO A;  3R9A B;  5BPP A;  1X6G A;  5KNH D;  4HKE A;  1H0A A;  3JCM c;  4E7H A;  3Q4A B;  1TXQ A;  1D1B A;  4GYO A;  1MGQ A;  3CCJ Q;  2OX7 A;  3Q78 A;  2I0N A;  5EYL A;  1UHF A;  3SY2 A;  1SA4 A;  2ROT A;  4J6Y A;  4RTZ A;  3P8H A;  2Y69 E;  1KK7 A;  1YIJ Q;  2HQX A;  4PJL A;  1N95 A;  1O1T A;  5LJ3 j;  4LNB A;  1KHI A;  1Q81 U;  3T9K A;  2XI9 A;  2V0P A;  4L2Y A;  2RI3 A;  3N5B B;  1GCP A;  2QGG A;  2ZPG B;  2JS0 A;  2K7A A;  2YSQ A;  3UA6 A;  1ZUY A;  3OYD A;  3HXE A;  4JLI A;  1JRI A;  2RFM A;  1UHC A;  3D9P A;  4LDV A;  3MP6 A;  4GZ5 A;  1SG5 A;  3M0Q A;  1WM5 A;  2HO1 A;  1OX8 A;  3LYI A;  1FT2 A;  3WVE B;  2CZ1 B;  4UI9 K;  1C6V X;  3RRM B;  3CCL A;  2IPO B;  1ZBJ A;  1YMP A;  2PQR A;  3UM1 A;  1CKA A;  1V1C A;  1F1B B;  2YQ8 A;  1IYG A;  1P92 A;  5DY9 A;  1HH8 A;  4C5H A;  4B8A A;  4KBM B;  2A5E A;  2R5A A;  2KGT A;  1NJI U;  4C5I A;  2JTF A;  2CT3 A;  4BD3 A;  2PM6 A;  5GAM d;  3ZUV B;  5GMK m;  3BG0 B;  5CCL A;  3JB9 I;  1MQS A;  1XJW B;  3PNT B;  4ESR A;  5FJY A;  1Q95 G;  4G25 A;  2YIN A;  3VJP A;  3PE4 A;  3FFL A;  1M2V A;  3D3M A;  1NEG A;  2P9K G;  4RG2 A;  2GQV A;  2P0Q A;  3LX7 A;  2CP7 A;  1IO6 A;  3PNL B;  2DL4 A;  5LFA A;  5I2S A;  3Q79 A;  5GAN 2;  3CVL A;  4N3A A;  1D09 B;  4EPZ A;  1SPK A;  4O60 A;  3NF1 A;  3QPH A;  4DBH A;  5KBA A;  2LC4 A;  3RBB B;  2NC9 A;  4A63 B;  1IRE B;  2RQT A;  3SWN B;  4M75 D;  1KC8 U;  2ZU6 B;  4HBD A;  1S72 Q;  1VQO Q;  1WYX A;  3ZW3 A;  3M59 A;  2RO0 A;  4L5G A;  2EIF A;  1M90 C;  2CS7 A;  4F7U G;  2KNB B;  2L8D A;  4CRI A;  2VGN A;  1TNU A;  5IHK A;  4FW2 A;  1DVP A;  4B6M A;  2FPD A;  4DBQ A;  3CVN A;  3BDL A;  4L2L A;  1MX6 A;  2KRO A;  3CD6 Q;  1SHF A;  5EX0 A;  2FHD A;  4D6W A;  4C0F A;  5C0M A;  1RLQ C;  1KD1 R;  3OQ5 A;  5BV1 A;  5JJ6 A;  2OTL T;  1OYX A;  1QZ2 A;  2RD1 A;  1JWF A;  3AG4 E;  3ABK E;  3EG9 B;  2FZK B;  2DYS E;  1JU5 C;  2GF7 A;  4G1T A;  2K5L A;  3CVW A;  2KK4 A;  2LTO A;  2NUT A;  4EBA G;  3ASF A;  1RAB B;  5KCO A;  3PGG A;  3CST A;  5AQB A;  1N4Q A;  5KYY A;  4KH0 B;  1GBR A;  3QK0 A;  3UF4 A;  3OY9 A;  3QWY A;  3RIR A;  2VXE A;  2ZIR A;  3VS7 A;  3HRU A;  5G04 J;  5BUZ A;  3SD4 A;  5EX3 A;  5GAN 3;  5FU7 C;  1TYQ G;  4CDR A;  2PVG B;  3GLX A;  3IQL A;  3OYK A;  3R7Q A;  1LOJ A;  1D8E A;  2QAZ A;  1Z9Z A;  3JCM J;  1Q81 C;  2V5Q C;  4E7S A;  3I4G A;  3SDZ A;  3FP3 A;  4M7C A;  2FRY A;  2MK5 A;  4K03 A;  5KYU B;  5LJ5 e;  1QVG S;  1H2T C;  1VQ5 Q;  4E85 A;  2DK3 A;  1EDU A;  1N4R A;  4J0U A;  1DC2 A;  3EIJ A;  1S1N A;  3PE0 A;  3JCM X;  2DVE A;  1K9A A;  1YJW Q;  3GOX A;  1SW6 A;  4K5C A;  5ITZ F;  2HBW A;  3FUF A;  4C92 D;  2E65 A;  4OVU A;  4GTV A;  3QG1 A;  4HXJ A;  2COY A;  3H0I A;  2WMN A;  2YRV A;  2DL7 A;  3P8D A;  2AW6 A;  4XKC A;  3CCV T;  2AT1 B;  2DTI A;  2K79 A;  4J8D A;  4QKU A;  1NJI C;  3CHS A;  5AAR A;  2X38 A;  4FHJ A;  1K73 R;  4YVQ C;  2WVI A;  2X9H A;  1HXI A;  3TVT A;  1AP7 A;  5J08 A;  3NB2 A;  5D66 A;  3CBO A;  3B95 A;  3Q47 B;  1U06 A;  1JQQ A;  4CC4 B;  2V8J A;  3SF4 A;  3G2U A;  2X4J A;  2FEZ A;  4Z89 A;  2CP6 A;  2P84 A;  3NOG D;  4UQY A;  3NTI A;  3JAM E;  4B94 A;  2VGX A;  2RMO A;  3E19 A;  2XPY A;  5KNG A;  1INZ A;  4JJC A;  4OB3 B;  2LNI A;  5ENO D;  3L08 A;  1KC8 C;  2J6O A;  3I4R B;  3I5P A;  4E7K A;  1ZX6 A;  2VJ8 A;  5FU6 B;  2J49 A;  2LAI A;  2RHU A;  4BSZ B;  2V5F A;  3URG A;  4HQD A;  1SRM A;  3ULQ A;  2DO3 A;  2MF2 A;  2HQE A;  1YIT A;  4J9E A;  3PIO A;  2E41 A;  2KEA A;  2PNN A;  4DJA A;  3RIB A;  2OV8 A;  2KYM A;  2QA4 T;  3TG5 A;  3HXD A;  4KRT A;  3SFY A;  3QHS A;  3ASO E;  2HKN A;  3SBS A;  4XE0 A;  1D1C A;  2K4Y A;  1MV3 A;  2XGO A;  4JB8 P;  1Y8M A;  5FZS A;  2HNI A;  3IHV A;  4P29 A;  3NGP A;  3V2X A;  2F2V A;  2X4W A;  2YUO A;  4EZK A;  4A1S A;  1SQM A;  3FIF A;  4M3O A;  2E6N A;  3Q5M A;  4JXT A;  1PY1 A;  4WF2 A;  1Y0M A;  1DNP A;  1N52 A;  1ZA2 B;  2QQB A;  2QA4 A;  5DIZ A;  3ZXP A;  4HRN A;  2HSP A;  4XKB A;  5CAI A;  4JVS A;  2DYB A;  2MRI A;  2LCL A;  1VQ6 T;  3LJN A;  3L13 A;  3CC7 T;  1ZLM A;  2VGM A;  3UAT A;  1NI1 A;  4OF1 A;  2I1J A;  3TCJ A;  3HSB A;  1X81 A;  2RN8 A;  1HD3 A;  4AP2 A;  4GLM A;  2PQN A;  3ZNG A;  4BTA A;  5IXB A;  4EMK B;  2CG3 A;  2CHX A;  3PUJ A;  1P5Q A;  4N5Q A;  4BT9 A;  2JLB A;  3NQP A;  2Y1L E;  3VS0 A;  2V4H C;  3T5V A;  2RHI A;  3UM2 A;  3AS5 A;  4RG6 A;  4M78 B;  3A8H B;  4I17 A;  1R8O B;  2RI5 A;  2G3R A;  3M0S A;  1U3D A;  4JUV A;  4KUI A;  1K0S A;  1VQ6 A;  3CC2 A;  5CCA A;  5FRN A;  4JC8 A;  3EH2 A;  1I0C A;  4I1A A;  2CZ0 B;  2YNQ A;  4M7D E;  3OYG A;  1HK9 A;  1YJ9 T;  5A2Q E;  3HP9 A;  1Z3Y A;  3PZ3 A;  2A3L A;  3FDH A;  4PFP A;  3GW4 A;  4OB0 B;  3TJP A;  1VQM T;  5T3R A;  3C72 A;  4E6H A;  3KUF A;  5ARF A;  4CZ2 D;  4PJO F;  2E5K A;  1WJS A;  2YUQ A;  3JCM h;  1SSF A;  2EYY A;  2O01 E;  2HKQ B;  2RHX A;  3Q75 A;  1G2B A;  2JEK A;  2DX1 A;  3TWQ A;  2FBN A;  1VQN T;  5KH6 A;  5L23 A;  2OEW A;  4N4G A;  4R0K A;  1YJ9 A;  2DXB A;  3CKC A;  2DIQ A;  3CC4 T;  1M90 R;  1TWB A;  1WX6 A;  4TVR A;  2RQU A;  2DBA A;  3M4G A;  3OTN A;  3ASH A;  3CCL Q;  2CSQ A;  5GJW B;  2A08 A;  1ZUU A;  4PUC A;  1NA0 A;  3CBM A;  2DET A;  5J26 A;  4DBF A;  2CHZ A;  4ME2 A;  4TXR A;  1TG0 A;  1WXT A;  4OMN A;  1TR4 A;  4XI9 A;  3CCJ T;  4RTW A;  3EGD B;  4QVZ A;  3T9N A;  1VQN A;  3R9M A;  5KJK A;  1MYO A;  1BU9 A;  2HD0 A;  3RER A;  2VAS A;  4EEC A;  1QQJ A;  4GMR A;  2P9U G;  3CCE Q;  5AQ9 A;  1Z5S C;  3CC4 A;  3PFS A;  2VTB B;  1A17 A;  1YIJ T;  1VIE A;  3MCA B;  3OYH A;  1AWJ A;  4UQZ A;  4M77 D;  2FG0 A;  3QWX X;  3CCU Q;  1N94 A;  2GRP B;  1PKT A;  3PH0 C;  5HRY A;  2FO0 A;  5CQX A;  3QDF A;  3ULR B;  4BER A;  3M4Y A;  2LMJ A;  4MKT A;  3CCJ A;  2NXP A;  5GMK h;  3E32 A;  3MA5 A;  2JJ9 A;  3OW2 A;  3RK6 A;  4OB2 B;  4M75 G;  6AT1 B;  4LER A;  2EPD A;  2RJD A;  5LOZ A;  4GPK A;  1O75 A;  4J7I A;  1Q81 R;  4J9H A;  2OJ2 A;  4HOS A;  1YIJ A;  4UWH A;  1E90 A;  3UWN A;  3C5R A;  1VYV A;  3LDZ A;  2WXK A;  3AHU A;  2XID A;  3CME T;  1JXM A;  4ATO A;  4JZ4 A;  3ZHE B;  2DD5 A;  5CMW A;  4GPM A;  1OZ2 A;  2EIN E;  2QYZ A;  2HYZ A;  1UJK A;  3PT9 A;  4LNU D;  1NA3 A;  1AWX A;  1BIA A;  4GTS A;  3CHR A;  5IH2 A;  1KD1 U;  5CED B;  4BI8 B;  2QAS A;  2R05 A;  4WND A;  2M0Y A;  5A7D B;  3QKY A;  4CT4 A;  4C8Q E;  3D9N A;  3MEW A;  1JCS A;  1Q2Z A;  2KE9 A;  3OAW A;  2L0A A;  4OAU C;  1QCN A;  2WQH A;  4E2F B;  2XU8 A;  3KS2 A;  3M0R A;  3AG1 E;  5D7U A;  4PFO A;  1NBE B;  2HSE B;  3OA6 A;  1I5L A;  3L9T A;  2NUP B;  2XKO C;  3JCM g;  2ABL A;  2JN0 A;  3RJV A;  4RUG A;  3VYG A;  1U5S A;  1T0H A;  1TNO A;  1IHB A;  1BI8 B;  2GFU A;  5GAM h;  1VQO T;  1HZ4 A;  1S64 A;  1S72 T;  4WTO B;  4J9F A;  1PCX A;  4HT8 A;  1QYM A;  2MYS A;  2QDY B;  1D0Z A;  3PMT A;  4F7U A;  4U0U A;  1E7O A;  1WDX A;  1UE9 A;  3BQO A;  1M1K U;  3CQT A;  4MBG A;  3FU5 A;  4AIF A;  4B8C B;  1ELW A;  2KM4 A;  5EIB E;  5AT1 B;  4GML A;  1M1G A;  1TUG B;  1QVF S;  2BZY A;  4KVO A;  3KSL A;  3HYM B;  4CI0 C;  2FF4 A;  2X51 A;  1KC8 R;  1D0X A;  1WZO A;  4LD9 K;  4Y6C A;  3CD6 T;  1WIE A;  3FUH A;  4M7A F;  5HS0 A;  4A1G A;  3MO8 A;  3QBY A;  1UG3 A;  3VS4 A;  1S72 A;  1MZC A;  2F5K A;  3Q1J A;  3I56 Q;  1VQO A;  2DIG A;  4ZN1 A;  4RTY A;  1QWE A;  2HBP A;  5KCH A;  3CVV A;  4WWN A;  4C92 G;  2WXG A;  3A8G B;  3MEV A;  2WQ7 A;  4EBA A;  2DWZ A;  1LTX A;  4GZC A;  2P0K A;  1PRM C;  4KZC A;  4PLI A;  4JD2 G;  2PNI A;  1B7T A;  5GAN 4;  4HOT A;  3QO3 A;  1K1A A;  2KAT A;  5IHI A;  1N54 A;  1KQS S;  3GBQ A;  1QCF A;  4J6X A;  3VS1 A;  3CD6 A;  1K73 U;  2OAU A;  5KYX A;  4IUL A;  2EW3 A;  1VQL Q;  5AQA A;  1BU1 A;  2QY7 A;  1AWC B;  2AK5 A;  2LSU A;  2AXZ A;  3SO8 A;  3ZFW A;  2DMO A;  2QQ9 A;  3VUZ A;  4AJW A;  2NYS A;  3DB4 A;  5I2M A;  4RMO A;  4EMH A;  4L1B A;  2EYQ A;  3E37 A;  1SRL A;  5J3B A;  3V7S A;  1RLP C;  1SEM A;  2WXI A;  5CEA A;  4ME7 A;  1TN7 A;  3ZN3 A;  3S3N A;  1BI0 A;  1VQK Q;  1VQ5 T;  1ELK A;  2JXB A;  1UN8 A;  2H6H A;  2X3M A;  2SEM A;  3LEW A;  2COZ A;  3TSW A;  3E34 A;  1N9S A;  1TH7 A;  3W9G A;  3K9I A;  4HI9 A;  5CKD A;  4IUV A;  4BX8 A;  3R6O A;  3LWH A;  4E7J A;  3U23 A;  1YJW T;  3TQ7 P;  2EIL E;  1YIT Q;  4QQ6 A;  5IHN A;  2XPZ A;  1FCH A;  1M2O A;  4UUC A;  3ZYQ A;  3J5P A;  2B6C A;  5GAN 7;  1WHM A;  3I5S A;  4M78 D;  4BE2 A;  3R7R A;  4J7F A;  4X1V A;  1V54 E;  1U1T A;  2A36 A;  4OMP A;  2WAC A;  3OYB A;  4DRX E;  3NAW A;  1KD1 C;  3CXC P;  2VKN A;  3CPW S;  3CCM Q;  4KH1 B;  3CKB A;  1YJW A;  1N8R C;  4M75 F;  3UM0 A;  1W6X A;  1OCO E;  3ZYK A;  2NYJ A;  2EAY A;  3LS8 A;  3QAQ A;  5D0O D;  1D3B B;  1K8A R;  5M9O A;  4IUU A;  1WY6 A;  2J6F A;  5CK9 A;  5GAM g;  3VLE A;  4JHJ A;  5CVI A;  3C3Q A;  4OMM A;  1Q7Y C;  2HMA A;  2JT4 A;  1BLX B;  3L2W A;  2EIK E;  4WNG A;  4NS5 A;  2DM1 A;  1FXX A;  2V1R A;  2QGF B;  3P1U A;  3CVP A;  4HFG A;  2WXM A;  4HS2 A;  4BE1 A;  2E4H A;  4EQF A;  2O9S A;  1K0X A;  4FJY A;  1KQ2 A;  1R0C B;  3OYA A;  1RI9 A;  4KGZ B;  1M1K C;  3TWR A;  2X35 A;  2BUD A;  1NE8 A;  5HQ8 A;  2ZIS A;  4I6E A;  3MCX A;  4MZT A;  3CC2 Q;  3MHX A;  2I2L A;  3C94 A;  1JJ2 A;  4XEI G;  1QBQ A;  3CLJ A;  5M72 A;  4ZFH A;  3KBG A;  3M0T A;  1QLY A;  4PJO C;  3G71 A;  2R59 A;  2X6H A;  3QYG B;  1KSW A;  3UT4 A;  1GRI A;  3RO2 A;  3V2O A;  3RSE G;  3MJW A;  5KJN A;  4QFV A;  4HOR A;  3E33 A;  1Z6T A;  4PJO E;  2KR3 A;  3QII A;  3FTX A;  7AT1 B;  4OGE A;  4PDX A;  1ARK A;  3QOU A;  4KGX B;  5FT9 A;  2YXY A;  5DM7 R;  3CCR A;  4CGV A;  2V4L A;  3JCM Q;  3PRZ A;  1QVG A;  5LJ5 d;  1YJN Q;  1K73 C;  2CRE A;  2CP2 A;  2QXF A;  5HY6 A;  3Q7A A;  5GAN d;  1M8M A;  4DOV A;  2WXJ A;  2HQH A;  3DKM A;  3QWW A;  4Y6W A;  2MIO A;  1WDY A;  4AOF A;  1JBM A;  3P2B A;  2L3P A;  3OYL A;  1IRX A;  4TUM A;  4C92 F;  3LY9 A;  1TNZ A;  2PU9 B;  4HVB A;  2KXP C;  3OYC A;  4FU3 A;  1LJO A;  4APO A;  2P9S G;  2B8A A;  5JJT A;  2XDP A;  3CK9 A;  2DER A;  3CVQ A;  1E96 B;  4E6R A;  4LUN U;  3REA B;  3CCQ A;  2WMO A;  2XGS A;  3CVU A;  4JZY A;  1FMW A;  2DZC A;  2M02 A;  2WXP A;  3A1P A;  4I6G A;  1S0P A;  4GA1 A;  2LAH A;  4HT9 A;  3HDX A;  1ZSZ A;  4XTW A;  1XOV A;  1BPO A;  3HRT A;  3I35 A;  3UPU A;  5KYW B;  2JTE A;  4M77 G;  3OSV A;  3J5Q B;  2RI2 A;  1UGQ B;  2IO3 C;  2ZAE A;  1OQK A;  1PKS A;  5ANL A;  1WHJ A;  4M7D B;  1YNZ A;  3QJY A;  4V2S A;  1GFD A;  4D10 C;  2DL5 A;  2DL8 A;  2F2W A;  2HM8 A;  4H7X A;  2ED1 A;  4WCI A;  4JRK A;  4L9P A;  5CER B;  1C0M A;  2DVJ A;  3CCL T;  3G6E Q;  4ZHB A;  1N9A A;  3BUA A;  4MMK A;  2WSC E;  3G4S Q;  2FPE A;  5GAO p;  3OS1 A;  4OP0 A;  5H7P A;  4IIO A;  1VDY A;  3ZEF A;  1EZZ B;  2LX9 A;  4RCC A;  3GZS A;  3EGX B;  4MZP A;  3UIP C;  3E2U A;  3OS0 A;  1IQU A;  2IEJ A;  4F04 B;  4JHR A;  1HO8 A;  3EFR A;  4NIK A;  3PS6 A;  3MV3 B;  4AG2 C;  3Q15 A;  4DOW A;  4ZGD B;  3CCE T;  1S63 A;  4BSX A;  4FIB A;  2UY1 A;  3PDN A;  1U2V G;  1W1F A;  3FU0 A;  2L0T B;  2CP0 A;  2H6F A;  2EQX A;  2KAF A;  3PEV B;  4HVV A;  2DL3 A;  4GYW A;  1RZ4 A;  4W9R A;  3CCU T;  1CKB A;  4GTT A;  4JPB W;  1X5B A;  4JS4 A;  4RTT A;  2XHC A;  5ECA A;  2X4X A;  1PG5 B;  4X9D A;  3IV0 A;  3LH0 A;  3QWP A;  4WWO A;  3AU5 A;  5ENQ D;  4M75 A;  3IHY A;  2D8J A;  2JOY A;  2VV5 A;  2I6H A;  2EGE A;  1IHW A;  3JCM V;  3CCE A;  3CEY A;  2CZ6 B;  4U0S A;  2JUF A;  1B89 A;  4RQI A;  5HI7 A;  4DLO A;  3NBN B;  2XCB A;  4M7A C;  2K5F A;  1ZSG A;  4D8D A;  1TTH B;  2E6Z A;  3FH8 A;  2ECZ A;  1WJQ A;  1JPL A;  2KVQ G;  4XK8 E;  4M7A E;  3CCU A;  1KG1 A;  1ZBX A;  2K3X A;  3C12 A;  4C0D B;  3KXT A;  1ZSZ C;  1MHQ A;  4GCN A;  2RA2 A;  2CP3 A;  3E4B A;  1MUZ A;  2GNC A;  3FJP A;  3J81 E;  3D9M A;  1YWP A;  3V8J A;  4GU5 A;  2H3E B;  3C3R A;  4KXK B;  4ZN3 A;  4KUL A;  3C95 A;  2CG2 A;  2GFA A;  1D3B A;  1H6O A;  2X6K A;  3AG2 E;  3QC1 A;  1M30 A;  1G3Y A;  4RSY A;  3UPV A;  4JS5 A;  3HFN A;  3DWL G;  5AQ7 A;  1AVZ C;  1WHL A;  3C0C A;  3RR6 A;  2A7Y A;  2KRN A;  2J06 A;  4A3T A;  1ABQ A;  3SZ7 A;  5D2M C;  1Y96 B;  1FX7 A;  4M4Z A;  1N8R R;  4C8Q B;  3LPZ A;  4YND A;  1V76 A;  3ZPJ A;  4IRU A;  2A0F B;  2RJE A;  2G6F X;  4C0M A;  2JM9 A;  2KYB A;  4M77 B;  4PKC C;  2IIM A;  1MX2 A;  1Q7Y R;  3J80 E;  2XS8 A;  3FLG A;  1AHJ B;  1TU0 B;  5LJ5 j;  3JB9 H;  2DEQ A;  2EIJ E;  5C6S A;  1NPP A;  2Y0B G;  4GBQ A;  4LDX A;  4KMO A;  2FI7 A;  1Y7X A;  1OWN A;  3RKY A;  1OU8 A;  1YI2 Q;  5GAN j;  1GBQ A;  3I55 Q;  4IKF A;  1AD5 A;  2VGY A;  1H92 A;  3PUK A;  1IGU A;  2PM7 A;  2XGM A;  1HJD A;  1XNI A;  1VQK A;  4JL0 A;  3I56 T;  1M1K R;  5FQ4 A;  1ELR A;  1U1S A;  4C92 A;  1RAG B;  2LX7 A;  4FW1 A;  2AXU A;  4M75 C;  3DPY A;  3TWV A;  3X24 B;  2BKK B;  1T3S A;  4GTQ A;  4TV3 A;  2OND A;  3NHN A;  3GNG A;  2D0Q B;  5LCW C;  4K5A B;  4M78 G;  2AJA A;  5BV0 A;  1VUB A;  3EJN A;  4I1M A;  4FLH A;  3RAU A;  1VQL T;  2WB2 A;  1BCM A;  1UJJ A;  3I56 A;  5HK0 A;  3S7B A;  2DZN A;  2K57 A;  3FRN A;  5L8R E;  3JCM e;  3S6W A;  3WXX A;  1K8A U;  2HCK A;  1TN6 A;  3CVY A;  1VYT A;  2QZA A;  4O1O A;  5CIU A;  4U04 A;  5DLQ E;  1UB4 A;  2WM9 A;  4JPS A;  1YHQ Q;  1VQ7 Q;  3JUE A;  3V8L A;  2X6F A;  1RUW A;  2DXT A;  2LRQ A;  3E9G A;  1W2B S;  4UI9 J;  1VQK T;  3DB3 A;  2CHW A;  1O5M A;  2QG9 B;  3EFO A;  4A4E A;  2MAM A;  1VQL A;  4E7Z A;  4ANV A;  3R6N A;  3X25 B;  2M9U A;  3LGL A;  1HE8 A;  1I81 A;  1YIT T;  2DZO A;  4V3I A;  1BB9 A;  4DUI A;  5LJ3 h;  2LCS A;  3V8K A;  2ETC A;  1FPP A;  4B9X A;  1L5J A;  2VXF A;  3OXF A;  2P4T A;  5D0Q D;  3C4S A;  3G71 Q;  5FQ8 A;  5KYW A;  2KCL A;  4DPR A;  5EIL A; 
#chains in the Genus database with same CATH homology
 2DIL A;  2EPD A;  1S70 B;  1X27 A;  2PZ1 A;  1M3B A;  3A98 A;  1J3T A;  1NYG A;  4OMQ A;  4J9H A;  2OJ2 A;  1GCQ A;  1NG2 A;  1PHT A;  3C5R A;  1ABO A;  5ENR D;  3T8K A;  1VYV A;  4HCK A;  3HG0 D;  3NMZ C;  2YT6 A;  1JXM A;  2EBP A;  4QQI A;  5EN5 D;  2YUN A;  4JZ4 A;  5EID A;  1WLP B;  4GPM A;  1OPK A;  1YP5 A;  2A28 A;  2J05 A;  2OAW A;  2JMC A;  2KBT A;  2BTT A;  1GL5 A;  4LNU D;  2KXD A;  1AWX A;  2MOX A;  3NOC D;  2FRW A;  2LNH B;  1A0N B;  2VVK A;  1WA7 A;  4QT7 A;  2X3X D;  2L3Q A;  5CED B;  5IH2 A;  2CDT A;  1KFZ A;  2M0Y A;  2SRC A;  2RNA A;  5FWB A;  4U8V D;  5CEC B;  2RQR A;  3V30 A;  2KE9 A;  2RPN A;  1YN8 A;  5I22 A;  3TWW A;  1TUC A;  2L0A A;  4HB5 A;  3H0H A;  5HCK A;  5GJV B;  4OAU C;  1TUD A;  2LJ3 A;  4B93 B;  1D9S A;  3M0R A;  5I11 A;  2B86 A;  1N0R A;  2EKH A;  3H41 A;  4HVW A;  2XEH A;  3JXI A;  1WI7 A;  4F1P A;  2ABL A;  2JAB A;  2CSI A;  4RUG A;  1U5S A;  1T0H A;  1OT8 A;  1PRL C;  1IHB A;  1BI8 B;  2KT1 A;  2XMF A;  1QWF A;  2KRS A;  1WG0 A;  4J9F A;  1QYM A;  5FIO A;  4HRL A;  1E7O A;  1WDX A;  4AFU C;  1AZE A;  1UE9 A;  1K76 A;  1PWT A;  2C0O A;  1G83 A;  2EGC A;  3CQT A;  1NLO C;  4AFZ C;  2DRM A;  3VS3 A;  5EIB E;  1W70 A;  2XEN A;  4G8K A;  2F8Y A;  2XZT G;  2BZY A;  2O88 A;  1JO8 A;  2O9V A;  4Z8A A;  2ETB A;  2F37 A;  1X6B A;  4YDY A;  1N11 A;  1EFN A;  2A37 A;  4EIK A;  3TWX A;  1H8K A;  1WIE A;  5HS0 A;  2HE0 A;  2B0O E;  3VS4 A;  1I07 A;  4RTY A;  1QWE A;  1T3L A;  1I1J A;  1KIK A;  3V31 A;  1Y57 A;  2LQN A;  3EG1 A;  4AFS C;  1X2K A;  4F17 A;  1AWO A;  4LG6 A;  2DWZ A;  1UOH A;  2L6B A;  2FEI A;  1PRM C;  2CH4 A;  2PNI A;  4D8K A;  2ED0 A;  1GCQ C;  2HEQ A;  1BK2 A;  4YDW A;  1K1A A;  5CBO A;  5JA4 D;  5IHI A;  3GBQ A;  1QCF A;  2RQV A;  3VS1 A;  1VYU A;  2EW3 A;  3H0F A;  5AQA A;  1BU1 A;  1AWC B;  2AK5 A;  4DX7 D;  2VGE A;  3UTM A;  2HDA A;  3SO8 A;  2DMO A;  1X2Q A;  2ENM A;  3EHR A;  1JXO A;  2W0Z A;  5EYP F;  2XZD G;  1X6G A;  5KNH D;  2PTK A;  1SRL A;  4JJD A;  1RLP C;  1SEM A;  2LJ0 A;  5CEA A;  1IXV A;  4J9C A;  2RF0 A;  2ZGG A;  5EYL A;  1OEB A;  2I0N A;  4ZNX A;  1UHF A;  1JEG A;  2FO1 E;  1CSK A;  2JXB A;  4O1P A;  2SEM A;  3TSW A;  4AG1 C;  2ROT A;  4K5B A;  2DLP A;  4RTZ A;  3W9G A;  4HI9 A;  2MCN A;  3U23 A;  4BEP A;  2K6D A;  1UG1 A;  4CC7 A;  5IHN A;  3T9K A;  2L3S A;  3TWU A;  4F16 A;  4UUC A;  4C48 B;  1G3N B;  4J8Y A;  1UDL A;  3J5P A;  2JM8 A;  1GCP A;  2DA9 A;  1N0Q A;  3I5S A;  2JS0 A;  4X1V A;  2GBQ A;  2A36 A;  5BXU A;  2F8X K;  1ZUY A;  2K7A A;  2YSQ A;  3I9Q A;  1LCK A;  4OMP A;  3UA6 A;  2P4R A;  4DRX E;  4LUE A;  2KXC A;  3VS2 A;  4IIM A;  2RFM A;  1UHC A;  2P2C P;  2VKN A;  3EG2 A;  4F14 A;  3M0Q A;  4DX2 A;  1W6X A;  2OI3 A;  2ROL A;  1UFF A;  2NYJ A;  2JS2 A;  4RTV A;  4ATZ D;  2J6F A;  1ZUK A;  1ZBJ A;  1YMP A;  1CKA A;  2F2X A;  2LP5 A;  5FW9 A;  1V1C A;  1E6G A;  4OMM A;  2JT4 A;  2X3W D;  1BLX B;  1UJY A;  1OPL A;  2A5E A;  4U95 D;  2KGT A;  1M3A A;  2CT3 A;  2DM1 A;  3ZUV B;  2V1R A;  2EVR A;  1NEB A;  4ESR A;  5CBN A;  1K0X A;  1X43 A;  2O9S A;  3KEA A;  4J7W A;  1RI9 A;  4J9G A;  3AAA C;  3TWR A;  3VRY A;  1NEG A;  2BZX A;  1IO6 A;  2DL4 A;  5ENP D;  1UUE A;  2V1Q A;  1SPK A;  2AZS A;  5FWC A;  4O60 A;  2ESW A;  5KBA A;  3RBB B;  1T0J A;  4CC3 A;  3EG0 A;  4A63 B;  4JJB A;  2RQT A;  4ZFH A;  3M0T A;  1QLY A;  4HBD A;  1SHG A;  1KSW A;  1WYX A;  1GRI A;  3ZU7 B;  3V2O A;  1B07 A;  1N5Z A;  2EYX A;  1QKW A;  4LE9 A;  4QFV A;  2BKG A;  2GQI A;  2KNB B;  2KR3 A;  2AKL A;  1SSH A;  5IHK A;  4AFQ C;  1ARK A;  3M0U A;  2MYO A;  1UJ0 A;  5JMN D;  2DJQ A;  2FPD A;  1MX6 A;  2KRO A;  1WXU A;  1UEC A;  2RFA A;  1SHF A;  2CRE A;  1M8M A;  3EGU A;  4Z68 A;  1RLQ C;  2EYW A;  1AEY A;  1B3Q A;  3ZL7 C;  3DEO A;  2YUP A;  2MIO A;  1WDY A;  2L3P A;  3SEM A;  1JU5 C;  4TUM A;  4OMO A;  1UTI A;  2KXP C;  5EC7 A;  5AQB A;  4BES A;  1KJW A;  2VWF A;  2NWM A;  1SVX A;  1GBR A;  3UF4 A;  3QWY A;  3VS7 A;  4E6R A;  3JV3 A;  3REA B;  1QKX A;  3IQL A;  3AJI A;  4U96 D;  3D9H A;  1Z9Z A;  2V5Q C;  2DE0 X;  3SHW A;  2KBX A;  2KRM A;  1XOV A;  4DX1 A;  2FRY A;  2YDL A;  3I35 A;  2JTE A;  3J5Q B;  1NM7 A;  2C0T A;  2JW4 A;  2ZGD A;  4DX5 D;  1DC2 A;  1PKS A;  1S1N A;  2LJ1 A;  1YNZ A;  2CT4 A;  3PE0 A;  1GFD A;  2GTJ A;  1K9A A;  4LSZ E;  2DL5 A;  1H3H A;  2DL8 A;  1SW6 A;  4K5C A;  2F2W A;  4CC2 A;  1YYH A;  5ITZ F;  4RTX A;  2HBW A;  1AZG B;  2ED1 A;  4WCI A;  4HXJ A;  1X69 A;  2QYJ A;  3H0I A;  5CER B;  3VRZ A;  2CH4 W;  2DL7 A;  2DVJ A;  5AN8 A;  4ZHB A;  2EQI A;  2FPE A;  2XEE A;  2K79 A;  1OY3 D;  2DBK A;  1NLP C;  4IIO A;  3HRA A;  3Q9N C;  5AAR A;  1PNJ A;  4ORZ A;  1NYF A;  3TVT A;  1AP7 A;  1M3C A;  1MX4 A;  4HI8 A;  3EU9 A;  4NIK A;  5D66 A;  3B95 A;  1U3O A;  1U06 A;  2H8H A;  1JQQ A;  4CC4 B;  4AG2 C;  2BZ8 A;  3ZKJ A;  2AZV A;  2LZ6 B;  2D0N A;  3EG3 A;  1W1F A;  4Z89 A;  3M0P A;  2CUB A;  3RNJ A;  3NOG D;  2K3B A;  4DEY A;  1YCS B;  1M27 C;  2GTO A;  2RMO A;  1DCQ A;  4K11 A;  4HVV A;  4J9I A;  2DL3 A;  5KNG A;  2DNU A;  4JJC A;  2CUD A;  1CKB A;  4J9B A;  4JPB W;  5ENO D;  1VA7 A;  4RTT A;  2DBM A;  5ECA A;  2J6O A;  4OAV B;  1IKN D;  5ENS D;  4G8L A;  1ZX6 A;  5ENQ D;  2D8J A;  4BSZ B;  2EGE A;  4HQD A;  5FIN A;  1SRM A;  5BXO A;  2J7I A;  3NBN B;  3VS5 A;  2J6K A;  1ZSG A;  4D8D A;  4J9E A;  2KEA A;  2PNN A;  2ECZ A;  3O5Z A;  1AOJ A;  2KYM A;  4KRT A;  3EHQ A;  3REB B;  2DVW A;  1MV3 A;  1MV0 B;  1NFI E;  5HKP A;  1BD8 A;  4HNA D;  4JB8 P;  4HVU A;  3TSZ A;  1K4U S;  1MUZ A;  3NGP A;  3V2X A;  2GNC A;  2F2V A;  2M51 A;  2DRK A;  2YUO A;  3I5R A;  5KWD A;  3W9F A;  1YWP A;  4DX6 D;  1K1Z A;  4HRM B;  4F6R D;  2DF6 A;  3NPF A;  1K3Z D;  2ETA A;  1Y0M A;  5ENT D;  1WXB A;  2K9G A;  1M30 A;  4RTU A;  4HRN A;  2HSP A;  3V79 K;  2DYB A;  3F6Q A;  3LJN A;  5AQ7 A;  1AVZ C;  4J9D A;  1ZLM A;  2L2P A;  3C0C A;  1FYN A;  2KRN A;  4BET A;  2O2O A;  2J06 A;  1HSQ A;  3UAT A;  1ABQ A;  4M4Z A;  2RN8 A;  1HD3 A;  4GLM A;  2QDL A;  5IXB A;  3ZNG A;  1GFC A;  1MJ0 A;  4LN2 A;  3B7B A;  3THK A;  4N5Q A;  1OOT A;  2D8H A;  2J8S D;  2G6F X;  2Y1L E;  2JM9 A;  2KYB A;  2V4H C;  4Y92 A;  3VS0 A;  2IIM A;  4Z88 A;  1MX2 A;  3M0S A;  4LUD A;  1K0S A;  2Y0B G;  4GBQ A;  1I0C A;  2O31 A;  3JXJ A;  1GBQ A;  2JMA A;  1AD5 A;  1H92 A;  1K1B A;  1HJD A;  3TWT A;  2W10 A;  2AKK A;  2LX7 A;  4JZ3 A;  1AWW A;  1YWO A;  3IXE A;  4CZ2 D;  3TWV A;  2E5K A;  2YUQ A;  2BKK B;  1T3S A;  3UI2 A;  2GGR A;  2EYY A;  3NHN A;  3PVL A;  4K5A B;  2AJA A;  5AAO A;  1G2B A;  2D1X A;  2DX1 A;  3TWQ A;  5L23 A;  1A5E A;  3DEP A;  4R0K A;  1UGV A;  2RQW A;  4DEX A;  4FSS A;  4OML A;  1WX6 A;  2EYZ A;  1FMK A;  4CYM D;  2RQU A;  2DZN A;  3TWS A;  3Q9U C;  2CSQ A;  5GJW B;  2HCK A;  2A08 A;  2FPF A;  2EGA A;  2NUZ A;  3FJ5 A;  1VYT A;  1ZUU A;  4O1O A;  3LH5 A;  1BI7 B;  1OV3 A;  4U8Y D;  3JUE A;  1TG0 A;  1WXT A;  1RUW A;  4OMN A;  1TR4 A;  5IXF A;  1WFW A;  4RTW A;  1MYO A;  1BU9 A;  3KFV A;  2QC9 A;  4GMR A;  5AQ9 A;  1E6H A;  2C0I A;  3R6N A;  2K2M A;  3UXG A;  1BBZ A;  1AWJ A;  2DZO A;  4RLY A;  1BB9 A;  4DUI A;  2FG0 A;  3VS6 A;  3QWX X;  2LCS A;  2ETC A;  4HLL A;  2LQW A;  1PKT A;  5HRY A;  2FO0 A;  3ULR B;  4BER A;  1Z9Q A;  3PVQ A;  2LMJ A;  3UA7 A;  2KT8 A;  4LNP A;  5EIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...