1N9AA

Farnesyltransferase complex with tetrahydropyridine inhibitors
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
312
structure length
312
Chain Sequence
b'FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Aryl tetrahydropyridine inhibitors of farnesyltransferase: bioavailable analogues with improved cellular potency.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 122
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n9aA00
1TNUA 3Q79A 3Q7FA 3Q75A 4GTVA 3Q7AA 1D8DA 2ZISA 3PZ4A 3SFYA 3E32A 1KZPA 3HXCA 1S63A 3SFXA 3Q78A 1N4QA 1LTXA 1NI1A 1NL4A 3DSWA 3EUVA 1TN8A 3HXDA 1TNBA 3DSSA 1SA5A 1O1RA 2H6GA 1N4SA 1TN6A 4LNGA 3DPYA 1N9AA 3PZ2A 4GTQA 4GTTA 1FT2A 4MBGA 3E30A 1O5MA 3HXFA 3C72A 3E34A 3Q73A 1DCEA 2H6HA 1MZCA 4GTRA 1N4PA 4LNBA 2IEJA 3HXEA 2ZIRA 1KZOA 1JCSA 2H6FA 3HXBA 1SA4A 1FPPA 4YDOA 1O1TA 4YDEA 3KSQA 1TNYA 1S64A 1N94A 1TNZA 1N4RA 3E33A 1D8EA 4EHMA 3DSUA 1JCQA 2F0YA 1JCRA 4L9PA 3EU5A 1O1SA 2BEDA 3PZ3A 1TN7A 4GTOA 1FT1A 1X81A 3E37A 2R2LA 4GTMA 1LD7A 3DSVA 4GTPA 2H6IA 1LD8A 3DSTA 3KSLA 4GTSA 1QBQA 1TNOA 3DSXA 3DRAA 3PZ1A 1N95A
chains in the Genus database with same CATH superfamily
5JMND 2CG3A 4M3OA 3PEVB 4BFRA 4I17A 3CGHA 4TUUA 3D9HA 1WG0A 4EBAA 4WWNA 2V4LA 2ILRA 1MJ0A 1N52A 4KT6B 3FUKA 3L17A 3LJ3A 5BNWA 1UN8A 3HXDA 1NP7A 2X38A 4C9BB 4XEIG 3L82A 4HXIA 1BI7B 3OAWA 3RU0A 2YHCA 4G2VA 4U04A 3ZN3A 2WMNA 3LYAA 2IO2C 1K8KG 2VGYA 1HZ4A 4UWKA 2CFZA 3LPZA 4HFGA 3HXBA 3VTYA 3RRMB 1GW6A 4AJWA 2R17C 2XENA 5KJKA 3QWPA 2F8XK 3ZXPA 1MX2A 4G8KA 4DRXE 2I1KA 3ASGA 2A4ZA 1BPOA 3L54A 2NC9A 4GTOA 3BG0B 4KZCA 4WNFA 2DCPA 5CBNA 3SHFA 3CVPA 4Q94A 3HRAA 4U63A 1VDYA 3DRAA 3EIJA 3PZDA 1MYOA 4FULA 1Z5SC 2Y1LE 3AG3E 2EIME 5LCWJ 4GTVA 3IV0A 3AG1E 3FFLA 3DXMG 1W3BA 2VTBB 3MKQA 4JC8A 3PREA 3NAWA 2WXOA 1D9SA 3SGHA 5EILA 3CVUA 3SO8A 4HVBA 2BF0X 2WVIA 2CHXA 3APFA 3EJNA 3DSSA 4G23A 3GZSA 5AQ7A 4JEHA 4E6HA 2XCCA 4XI9A 3UT8A 4F1PA 2Y0BG 1LF8A 2YNQA 4RLYA 3UKRG 3VTXA 3FU6A 3IBEA 3FUDA 4B8CB 2J9QA 3RRNB 1TEZA 5AIJA 4YDEA 5AQ9A 4GYYA 4CDNA 3OXFA 3CKBA 5D0OD 4OVVA 2XEHA 3S7FA 4GZ5A 3AAAC 3MX3A 4EBAG 2C0MA 4KYOB 2R05A 3OXLA 2WPVA 2DBAA 3CSFA 3ML8A 4LNUD 1DNPA 5FTPA 4GYWA 1AP7A 3UM3A 4NRHB 2V4HC 4FJYA 4N3BA 2J4BA 2IU1A 5JJ7A 1A5EA 1DC2A 3AG2E 2EILE 3Q79A 3UIOC 4AY5A 2GRQB 3PZ4A 4B89A 1JWGA 3FU5A 3GZ2A 1UOHA 4DLOA 3B7RL 2NXPA 2WXHA 3DSWA 4AV7A 2KM4A 5H7PA 3MCXA 5FZSA 1OCZE 2GRLA 4JD2G 3RKVA 2H6GA 3OXGA 4JEUA 4L1BA 3V79K 1FT2A 2YQ8A 3KS2A 4AP2A 3ZW3A 3ENEA 4B93B 4ILGA 4LNBA 3TAXA 4BERA 2QYJA 3ABLE 2ZU6B 1TJFA 3NZUA 2V8SE 4U95D 1BI8B 4A3VA 3PNLB 3EU5A 4GU5A 1INZA 3PZ3A 3B7BA 5D66A 2V5QC 2WQ7A 3R7QA 1L5JA 5JHBA 2H6IA 3ESLA 3S7BA 3ZNGA 3FUNA 1H6KA 3ASHA 4JL0A 2XZTG 4UI9J 5E76A 1E90A 5ANLA 4AVXA 5KJLA 5DIZA 2J08A 2BKKB 2CHZA 4JHKA 4HOQA 3JYSA 3LKUA 3D9IA 4A1SA 4TXPA 1WDYA 3ZHEA 1S63A 4FP7A 1U3DA 4ZFHA 4AY6A 3ZVVA 3ZU7B 2OVFA 3DEOA 3SFZA 4HOTA 2XEVA 4CZ2D 1N4SA 1U3CA 4HBDA 2J8SD 3CHSA 4KVOA 2LUHA 3TWQA 4A55A 1A17A 3U3WA 1BLXB 1KPSB 4LG6A 2DYSE 4FADA 1BU9A 2A5UA 3TXMA 1UJKA 3L6AA 1SA4A 3UKUG 4BETA 3L22A 4G26A 4MKTA 3CVLA 4JHRA 5BXOA 3V30A 1EF1C 4ATZD 5CMWA 4FJZA 4IYPA 2JLBA 5ENQD 4ANUA 1H2VC 4J8YA 1N11A 4LEUA 3DSVA 2GRNB 4YDWA 5ITZF 3RIBA 2OEVA 1YCSB 1OWLA 1IXVA 3O4ZA 3FEXA 1JUQA 1OY3D 2L0TB 4PS8A 5BT1A 4HNAD 4CCAA 1TJCA 4A63B 5BUZA 4ME2A 3LDZA 4HLEA 4B94A 2OOEA 2RD0A 3L9TA 3SBTB 2PZIA 3CVWA 4DPRA 2J07A 5FINA 3E32A 2R03A 2FEZA 3D9PA 3Q78A 2J49A 3I3NA 3DPDA 3UPVA 1OCRE 1TN8A 4L2LA 4PDXA 4N3AA 3CVYA 2IONA 2WXQA 1N9AA 1EYHA 3HG0D 4O1PA 4PS7A 1S70B 3KEAA 4XE0A 3BU8A 5CMYA 3V2OA 3HXFA 5JJTA 4B8AA 2P58C 3ULQA 3FUEA 1H6OA 3KD7A 2XS8A 2GROB 4YDOA 5A6CA 3KSQA 3UT4A 3FUIA 4PS3A 5HI7A 4FA6A 1E8YA 5KBAA 4I2ZA 4DJAA 4N2SA 2J4DA 4DX2A 4RVBA 4GTMA 2P9KG 4D10C 5JJ6A 1NZNA 5KJNA 3PNTB 1OCCE 4WNEA 1TR4A 2IOSA 4GYOA 2ONDA 3LVRE 3P2BA 1E8WA 5CHEE 4U07A 2HO1A 3B7TA 1KT1A 3G2VA 3B7SA 2EQXA 4PUCA 2CFUA 5HQ8A 4TXQA 3CK9A 4BESA 2I1JA 3LVQE 2PQRA 3G2UA 1TYQG 1WAO1 2HYZA 4LNGA 5FQ7A 2B0OE 3DPYA 4AOFA 4I6JA 3TWTA 2L6BA 4J0UA 2LNIA 2OCCE 1JWFA 3D9KA 5ARFA 4TRQA 4FHKA 3NQPA 4WUYA 2DVWA 4QFVA 2Y4TA 2WXGA 2YINA 1ELWA 1JCQA 3X2QE 3PEUB 1FVFA 3ABKE 4JPSA 3CKCA 2VTBA 2AXUA 3NZSA 3URZA 4G11A 3CHPA 3FULA 4C48B 3UM0A 5B3SE 3Q9NC 2KATA 1Z6TA 3CQGB 2AJAA 3BUAA 2L9BA 3PUJA 4APOA 5C1DA 4HI9A 4O1OA 4JVSA 3DEPA 1QBQA 3CV0A 2PM7A 4ZHBA 1NA0A 3ZFWA 5ENOD 5ENPD 4Q96A 4XKBA 3Q7AA 3CQCB 3FWVA 2EINE 3NBNB 3Q9UC 4J8SA 3AS8A 1LTXA 2FO7A 3ZUVB 1HH8A 1HF8A 4HORA 4KXKB 4QQIA 4O6FA 3DBSA 4DLQA 3QC1A 4K5BA 1DCQA 3FH5A 3NOCD 3KEZA 5EX3A 1YYHA 2FULA 3R7RA 3MGBA 3ONLA 5T8IA 4YVOA 3HXEA 3ASOE 1JCSA 2H6FA 4GA2A 4APFA 2L6JA 2V5FA 3J5QB 4I43A 1S64A 3R9AB 4I2WA 2GRRB 2GRPB 3RO2A 3QB2A 1S0PA 4J8FA 4U8YD 3S7DA 3CEQA 3IXEA 2ETCA 3PVLA 1K3ZD 1YMPA 2XZDG 1E96B 3FU3A 4URKA 3FTVA 4ACLA 2AWIA 4I1OB 1OWPA 3QK0A 4HQDA 3EHMA 2ZGGA 5BV0A 5ARGA 1N95A 4UI9K 4K5CA 1RW2A 3UT7A 5G04J 4NQ0A 1XGWA 3Q7FA 1QQEA 3SQVA 4RSYA 2AVPA 1Y6IA 3NB2A 2DZOA 4DI3A 2ZGDA 5CCMA 5A23A 4J7WA 2VJ8A 4HRNA 3SFXA 4XIFA 3CVXA 3PUKA 5G2NA 2QY7A 3NF1A 1NFIE 5LP0A 2XGSA 4J6IA 5CERB 4GMRA 1FVHA 3W9FA 3PZ2A 3TL5A 4NIKA 5CRVA 1UG3A 4HRMB 1H2UA 3Q5MA 2F37A 4OAUC 4TXRA 4N5QA 2P9IG 3ONKA 3MKRA 1N4PA 1SZ9A 3C3QA 3N71A 4CT4A 1WM5A 3TXNA 1YA0A 3FUMA 5FQ6A 1TNYA 5G05J 4CGVA 2XPYA 3UUXA 1IQUA 2LSVA 2WXNA 4BX9A 3MYVA 5ENSD 1HU3A 4HB5A 3AG4E 2XRYA 4FC8A 4IN3B 3FTWA 5BW8C 3TG4A 1U2VG 5T4YA 4BTAA 4NURA 1X81A 4FHJA 4ILHB 3FTXA 4U96D 4MS6A 3UM2A 3DSXA 4W9RA 3HVEB 1NA3A 5FZRA 3SNXA 3FHEA 3Q75A 3J5PA 2HE0A 1HS6A 4JZYA 2QC9A 4J8DA 4OVUA 5CEDB 1Y8MA 4LSZE 4GAAA 2Q7FA 3MEKA 5HS0A 1P5QA 1ZBPA 1K1BA 2P2CP 1H6PA 3APCA 3FUHA 3RK6A 4KBQA 5ENNA 4G25A 1SA5A 3D3MA 3TWUA 2VGXB 4LERA 4ILIA 2GW1A 5AARA 3DXKG 3EHRA 3E34A 3Q73A 2X6FA 1DVPA 1IHBA 4AIFA 5AAOA 1DCEA 5CRUA 4JXTA 1V55E 4L7TA 3RRUA 1KZOA 5EN5D 4YDYA 4Y6WA 2WXRA 4EQFA 4EZLA 2OV8A 3MA5A 5KJMA 2KCVA 3V31A 3E33A 3U66A 2I2OA 4L9PA 4ANWA 3ZEFA 4EPZA 3U4TA 5AENA 5HKPA 4BT8A 3WXXA 3Q49B 1MX6A 5CECB 4LUNU 3LY9A 3KSLA 3IEGA 3QKYA 4ANXA 5BXUA 3RAUA 3Q15A 5EX0A 3PZ1A 2P9SG 2IO3C 3U9WA 5FIOA 4DX7D 3CIAA 5LOZA 1BD8A 2WXLA 4C0EA 3IHVA 2JEKA 1HO8A 5EIBE 2PL2A 4I1AA 1PAQA 3EUVA 3BEEA 4MLPA 4U7EB 4GZ3A 3ZRHA 4I1MA 2BTDA 3L16A 2KCLA 3IKOB 3JXJA 2IOLA 4U0SA 3JQ1A 3EU9A 4G24A 3T8KA 4XI0A 5EDSA 5AN8A 2X3MA 3QNKA 2QYUA 3W9GA 1K1AA 4DUIA 3L13A 2KCKA 3FUJA 3PH0C 2IF4A 3T9KA 3I4RB 4EHMA 3S2AA 4FU3A 5LFAA 2P9PG 5AJDA 4GA0A 4CEMA 3SF4A 4UQZA 1UW4B 2UY1B 1IQRA 4X8QA 4XZ4A 3UMVA 3TWRA 4OYSA 1IKND 4WWOA 4K0RA 3UTMA 4HRLA 3LCAA 3MV3B 2VGEA 2RFMA 3QWWA 1ELRA 2FI7A 4ATGA 2ZXWE 4JHJA 3BQOA 1TNUA 4JA9A 3ZIMA 4DX5D 5B1BE 4NACA 4GMLA 3EHQA 4P29A 2WXFA 2WB2A 4UWGA 2VYIA 2DWZA 3FDHA 4ABNA 2R5SA 4I6EA 2OEWA 4UUCA 2HM8A 3FH7A 3ML9A 2LAHA 3G2SA 1OXJA 2XQ0A 2MYOA 2LSUA 2JABA 3D9MA 4E85A 1AWCB 4HLLA 2XCBA 3L08A 4I9CA 4UWHA 2XGOA 3AS5A 1H0AA 3QOUA 2XHEA 5FT9A 4TUMA 2CG2A 4KMOA 5DBKA 1SQMA 2ZIRA 3FU0A 2WXMA 3JUEA 1FCHA 1E7VA 4RQIA 4UWLA 3MJWA 1TNZA 3P1UA 4YNDA 5AQBA 2ETAA 5KNGA 3PDNA 4XX5A 3OTNA 3TWWA 3JCKC 3HYMB 3VLFA 1H2TC 2KZTB 2NYJA 2AXZA 3SBSA 4ANVA 4HS2A 4Q69A 4GA1A 2R02A 4HOSA 4HI8A 1WY6A 1TNOA 4HOUA 4PH4B 4DX6D 3FTUA 3ULEG 3SD5A 3UI2A 2Y3AA 3PE4A 1KT0A 2XGMA 2A5EA 2MOWA 1H19A 3BG1B 3RSEG 3HDXA 2PQNA 2NSZA 2C2LA 1OWNA 1OUVA 3QJZA 4UQXA 4L2YA 1MX4A 1N0RA 4CGWA 4GB9A 3UXGA 4F7AA 2WQ6A 1O1RA 4CRWA 2XPIA 4M7CA 2VSYA 1QNFA 3ASNE 3MZLB 5EYPF 3GW4A 4TV3A 5KCMA 4F53A 2QFCA 4MBGA 4BT9A 5KWDA 3UINC 5D0QD 2H6HA 1ZB1A 1MZCA 2XS1A 3D9NA 3SZ7A 1OWMA 4N2QA 3HHMA 3D9OA 3MV2B 5KNHD 4BX8A 1OT8A 3TWVA 3C98A 1MQSA 4EZJA 4GPKA 3UM1A 5AJLA 2BEDA 3B13A 5FZQA 3O48A 3VLDA 1RZ4A 1PC2A 4J8EA 2IQCA 4K03A 4GTPA 4DX1A 3I5PA 1LD8A 2P9NG 3DSTA 1Z3YA 4WNGA 4BWRA 4LRZA 5FWQA 5G55A 1Z3XA 2IJGX 4B0ZA 2L0IA 2EIKE 3NOGD 3ZKJA 3LY8A 4Z68A 2DYRE 3C3RA 1E8XA 3V2XA 5BPPA 2RG8A 4GMJA 5T3RA 3EIQC 3ZXSA 5JA4D 1N4QA 4BTBA 4A3TA 1NL4A 4U8VD 2I9CA 1V54E 1IHGA 2HR2A 3G2TA 4GTQA 4GTTA 3E30A 2J09A 1IYGA 5D2MC 5FJYA 2RKKA 3ZYQA 2ETBA 4GTRA 2Y69E 3VLEA 3TGOA 3MKQB 1E8ZA 3LEWA 2IEJA 3D9LA 3Q4AB 3D9JA 3G2WA 3HVEA 1MHQA 2PM6A 3DSUA 4F6RD 1HG2A 2F0YA 3FTZA 4GCOA 2MHKA 5ENTD 2LXMA 4V3IA 3FUFA 4N3CA 4KVMA 5LCWC 3QAQA 5ENRD 2RFAA 2YHEA 2VQ2A 2LAIA 3CR3A 4FLHA 1EDUA 2UWJG 1HX8A 2IFUA 3PS6A 2VGXA 4I9EA 3C3OA 5J08A 4JW1A 2OVBA 1KLXA 2GGFA 3PRZA 5EIDA 5FQ4A 3QDNA 3TG5A 3SFYA 1KZPA 1OWOA 3HXCA 4EZKA 5B1AE 1XNFA 4JB8P 4DK5A 3LJNA 2DIWA 3F6QA 5M72A 1TNBA 4O60A 5AQAA 5CEAA 1HXIA 3AS4A 3UIPC 3CVNA 4H7YA 5CBOA 3ABME 2LXLA 3B95A 3K9IA 3ZPJA 2GRMA 3PE3A 4AM9A 1G3NB 3CK8A 2P9LG 4Y6CA 3QWVA 4GZ6A 4L23A 2WXKA 3CLJA 3C5RA 5G04C 3R9MA 3GYZA 5A7DB 1UJJA 4GZCA 2VSNA 1E7UA 3E4BA 2I6HA 1O1TA 4F1SA 1PY1A 3FTSA 4U0ZA 1N4RA 3AU5A 3HIZA 4KZ0A 4UWFA 2E0IA 1JCRA 4CT0A 3JQ0A 1O1SA 4N39A 5ANRA 1TN7A 3T5XA 2BKGA 2F8YA 2MRIA 4WAFA 2FO1E 4EECA 1OCOE 2WXPA 3TWXA 2XPZA 4U0UA 2FF4A 2DZNA 2KC7A 3ULYA 4BSXA 2LO6A 4CDRA 5BV1A 4R7LA 2X6JA 4BSZB 4CDMA 1EPUA 2XEEA 2ZISA 4C0MA 2EIJE 1JPLA 4LCTA 1ZU2A 5G05C 3EDTB 1SVXA 2E2EA 3ZGQA 1SW6A 2WXJA 4WNDA 3SY2A 3FY4A 3LS8A 2X6KA 5FQ8A 2CHWA 1TN6A 4GCNA 1ELKA 3CHQA 3ZYMA 1SZAA 2UY1A 4YVQC 4RG9A 1O5MA 4U8HA 3C72A 2WQHA 5IY5E 2KXPC 3CSTA 4GZDA 4XKCA 2Y4UA 3ZHEB 3CK7A 4I6GA 3U64A 4DI4A 5C2YA 1QYMA 1X5BA 2R59A 1HE8A 4IRUA 1D8EA 3IHYA 3SI5A 2X6IA 2P9UG 4RG6A 4UI9C 3ASFA 5EYLA 3ISMC 3FEYA 4OAVB 5AYWD 1FT1A 3TWSA 2R2LA 3T5VA 2FBNA 4CYMD 3B7UX 2VSXE 3JXIA 4G8LA 2AW6A 3AJIA 3AU4A 3QARA 3EHNA 4F3VA 3CHMA 1Q2ZA 2PNNA 2WMOA 5EKQD 3ZYKA 1D8DA 3CVQA 3CVVA 2KBXA 3ASDA 3S7JA 1B89A 1UN9A 4N5CA 1QZ2A 2V0PA 1HFAA 3UX4A 4BEPA 1NI1A 2VSOE 3KAEA 4GPMA 3RO3A 2IY0C 3UQ3A 3DWLG 4JA7A 4MRUA 3CHOA 5E75A 3LY7A 3WG7E 4ACKA 2X6HA 4AXHA 4H7XA 2KZTA 3FH8A 5LX8A 2AXVA 3FP3A 5HRYA 2C0LA 1N0QA 2WM9A 4WWPA 2WXIA 4AEZC 4UQYA 2M63A 3I4GA 4A1GA 1FPPA 2B6CA 1N54A 4K5AB 4BY6A 1N94A 4IULA 5CCLA 3CHRA 3ESKA 3FTYA 3TJPA 3Q47B 3ZYLA 2BUGA 3E37A 5J90A 2QZAA 1HG5A 3GZ1A 4G1TA 1LD7A 4FLBA 3APDA 2XRZA 3T8MA 4GTSA 3JUIA 3RJVA 3LXUX 5JHAA
chains in the Genus database with same CATH topology
1TNUA 3Q79A 3Q7FA 3Q75A 4GTVA 3Q7AA 1D8DA 2ZISA 3PZ4A 3SFYA 3E32A 1KZPA 3HXCA 1S63A 3SFXA 3Q78A 1N4QA 1LTXA 1NI1A 1NL4A 3DSWA 3EUVA 1TN8A 3HXDA 1TNBA 3DSSA 1SA5A 1O1RA 2H6GA 1N4SA 1TN6A 4LNGA 3DPYA 1N9AA 3PZ2A 4GTQA 4GTTA 1FT2A 4MBGA 3E30A 1O5MA 3HXFA 3C72A 3E34A 3Q73A 1DCEA 2H6HA 1MZCA 4GTRA 1N4PA 4LNBA 2IEJA 3HXEA 2ZIRA 1KZOA 1JCSA 2H6FA 3HXBA 1SA4A 1FPPA 4YDOA 1O1TA 4YDEA 3KSQA 1TNYA 1S64A 1N94A 1TNZA 1N4RA 3E33A 1D8EA 4EHMA 3DSUA 1JCQA 2F0YA 1JCRA 4L9PA 3EU5A 1O1SA 2BEDA 3PZ3A 1TN7A 4GTOA 1FT1A 1X81A 3E37A 2R2LA 4GTMA 1LD7A 3DSVA 4GTPA 2H6IA 1LD8A 3DSTA 3KSLA 4GTSA 1QBQA 1TNOA 3DSXA 3DRAA 3PZ1A 1N95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNU A;  3Q79 A;  3Q7F A;  3Q75 A;  4GTV A;  3Q7A A;  1D8D A;  2ZIS A;  3PZ4 A;  3SFY A;  3E32 A;  1KZP A;  3HXC A;  1S63 A;  3SFX A;  3Q78 A;  1N4Q A;  1LTX A;  1NI1 A;  1NL4 A;  3DSW A;  3EUV A;  1TN8 A;  3HXD A;  1TNB A;  3DSS A;  1SA5 A;  1O1R A;  2H6G A;  1N4S A;  1TN6 A;  4LNG A;  3DPY A;  1N9A A;  3PZ2 A;  4GTQ A;  4GTT A;  1FT2 A;  4MBG A;  3E30 A;  1O5M A;  3HXF A;  3C72 A;  3E34 A;  3Q73 A;  1DCE A;  2H6H A;  1MZC A;  4GTR A;  1N4P A;  4LNB A;  2IEJ A;  3HXE A;  2ZIR A;  1KZO A;  1JCS A;  2H6F A;  3HXB A;  1SA4 A;  1FPP A;  4YDO A;  1O1T A;  4YDE A;  3KSQ A;  1TNY A;  1S64 A;  1N94 A;  1TNZ A;  1N4R A;  3E33 A;  1D8E A;  4EHM A;  3DSU A;  1JCQ A;  2F0Y A;  1JCR A;  4L9P A;  3EU5 A;  1O1S A;  2BED A;  3PZ3 A;  1TN7 A;  4GTO A;  1FT1 A;  1X81 A;  3E37 A;  2R2L A;  4GTM A;  1LD7 A;  3DSV A;  4GTP A;  2H6I A;  1LD8 A;  3DST A;  3KSL A;  4GTS A;  1QBQ A;  1TNO A;  3DSX A;  3DRA A;  3PZ1 A;  1N95 A; 
#chains in the Genus database with same CATH topology
 5JMN D;  2CG3 A;  4M3O A;  3PEV B;  4BFR A;  4I17 A;  3CGH A;  4TUU A;  3D9H A;  1WG0 A;  4EBA A;  4WWN A;  2V4L A;  2ILR A;  1MJ0 A;  1N52 A;  4KT6 B;  3FUK A;  3L17 A;  3LJ3 A;  5BNW A;  1UN8 A;  3HXD A;  1NP7 A;  2X38 A;  4C9B B;  4XEI G;  3L82 A;  4HXI A;  1BI7 B;  3OAW A;  3RU0 A;  2YHC A;  4G2V A;  4U04 A;  3ZN3 A;  2WMN A;  3LYA A;  2IO2 C;  1K8K G;  2VGY A;  1HZ4 A;  4UWK A;  2CFZ A;  3LPZ A;  4HFG A;  3HXB A;  3VTY A;  3RRM B;  1GW6 A;  4AJW A;  2R17 C;  2XEN A;  5KJK A;  3QWP A;  2F8X K;  3ZXP A;  1MX2 A;  4G8K A;  4DRX E;  2I1K A;  3ASG A;  2A4Z A;  1BPO A;  3L54 A;  2NC9 A;  4GTO A;  3BG0 B;  4KZC A;  4WNF A;  2DCP A;  5CBN A;  3SHF A;  3CVP A;  4Q94 A;  3HRA A;  4U63 A;  1VDY A;  3DRA A;  3EIJ A;  3PZD A;  1MYO A;  4FUL A;  1Z5S C;  2Y1L E;  3AG3 E;  2EIM E;  5LCW J;  4GTV A;  3IV0 A;  3AG1 E;  3FFL A;  3DXM G;  1W3B A;  2VTB B;  3MKQ A;  4JC8 A;  3PRE A;  3NAW A;  2WXO A;  1D9S A;  3SGH A;  5EIL A;  3CVU A;  3SO8 A;  4HVB A;  2BF0 X;  2WVI A;  2CHX A;  3APF A;  3EJN A;  3DSS A;  4G23 A;  3GZS A;  5AQ7 A;  4JEH A;  4E6H A;  2XCC A;  4XI9 A;  3UT8 A;  4F1P A;  2Y0B G;  1LF8 A;  2YNQ A;  4RLY A;  3UKR G;  3VTX A;  3FU6 A;  3IBE A;  3FUD A;  4B8C B;  2J9Q A;  3RRN B;  1TEZ A;  5AIJ A;  4YDE A;  5AQ9 A;  4GYY A;  4CDN A;  3OXF A;  3CKB A;  5D0O D;  4OVV A;  2XEH A;  3S7F A;  4GZ5 A;  3AAA C;  3MX3 A;  4EBA G;  2C0M A;  4KYO B;  2R05 A;  3OXL A;  2WPV A;  2DBA A;  3CSF A;  3ML8 A;  4LNU D;  1DNP A;  5FTP A;  4GYW A;  1AP7 A;  3UM3 A;  4NRH B;  2V4H C;  4FJY A;  4N3B A;  2J4B A;  2IU1 A;  5JJ7 A;  1A5E A;  1DC2 A;  3AG2 E;  2EIL E;  3Q79 A;  3UIO C;  4AY5 A;  2GRQ B;  3PZ4 A;  4B89 A;  1JWG A;  3FU5 A;  3GZ2 A;  1UOH A;  4DLO A;  3B7R L;  2NXP A;  2WXH A;  3DSW A;  4AV7 A;  2KM4 A;  5H7P A;  3MCX A;  5FZS A;  1OCZ E;  2GRL A;  4JD2 G;  3RKV A;  2H6G A;  3OXG A;  4JEU A;  4L1B A;  3V79 K;  1FT2 A;  2YQ8 A;  3KS2 A;  4AP2 A;  3ZW3 A;  3ENE A;  4B93 B;  4ILG A;  4LNB A;  3TAX A;  4BER A;  2QYJ A;  3ABL E;  2ZU6 B;  1TJF A;  3NZU A;  2V8S E;  4U95 D;  1BI8 B;  4A3V A;  3PNL B;  3EU5 A;  4GU5 A;  1INZ A;  3PZ3 A;  3B7B A;  5D66 A;  2V5Q C;  2WQ7 A;  3R7Q A;  1L5J A;  5JHB A;  2H6I A;  3ESL A;  3S7B A;  3ZNG A;  3FUN A;  1H6K A;  3ASH A;  4JL0 A;  2XZT G;  4UI9 J;  5E76 A;  1E90 A;  5ANL A;  4AVX A;  5KJL A;  5DIZ A;  2J08 A;  2BKK B;  2CHZ A;  4JHK A;  4HOQ A;  3JYS A;  3LKU A;  3D9I A;  4A1S A;  4TXP A;  1WDY A;  3ZHE A;  1S63 A;  4FP7 A;  1U3D A;  4ZFH A;  4AY6 A;  3ZVV A;  3ZU7 B;  2OVF A;  3DEO A;  3SFZ A;  4HOT A;  2XEV A;  4CZ2 D;  1N4S A;  1U3C A;  4HBD A;  2J8S D;  3CHS A;  4KVO A;  2LUH A;  3TWQ A;  4A55 A;  1A17 A;  3U3W A;  1BLX B;  1KPS B;  4LG6 A;  2DYS E;  4FAD A;  1BU9 A;  2A5U A;  3TXM A;  1UJK A;  3L6A A;  1SA4 A;  3UKU G;  4BET A;  3L22 A;  4G26 A;  4MKT A;  3CVL A;  4JHR A;  5BXO A;  3V30 A;  1EF1 C;  4ATZ D;  5CMW A;  4FJZ A;  4IYP A;  2JLB A;  5ENQ D;  4ANU A;  1H2V C;  4J8Y A;  1N11 A;  4LEU A;  3DSV A;  2GRN B;  4YDW A;  5ITZ F;  3RIB A;  2OEV A;  1YCS B;  1OWL A;  1IXV A;  3O4Z A;  3FEX A;  1JUQ A;  1OY3 D;  2L0T B;  4PS8 A;  5BT1 A;  4HNA D;  4CCA A;  1TJC A;  4A63 B;  5BUZ A;  4ME2 A;  3LDZ A;  4HLE A;  4B94 A;  2OOE A;  2RD0 A;  3L9T A;  3SBT B;  2PZI A;  3CVW A;  4DPR A;  2J07 A;  5FIN A;  3E32 A;  2R03 A;  2FEZ A;  3D9P A;  3Q78 A;  2J49 A;  3I3N A;  3DPD A;  3UPV A;  1OCR E;  1TN8 A;  4L2L A;  4PDX A;  4N3A A;  3CVY A;  2ION A;  2WXQ A;  1N9A A;  1EYH A;  3HG0 D;  4O1P A;  4PS7 A;  1S70 B;  3KEA A;  4XE0 A;  3BU8 A;  5CMY A;  3V2O A;  3HXF A;  5JJT A;  4B8A A;  2P58 C;  3ULQ A;  3FUE A;  1H6O A;  3KD7 A;  2XS8 A;  2GRO B;  4YDO A;  5A6C A;  3KSQ A;  3UT4 A;  3FUI A;  4PS3 A;  5HI7 A;  4FA6 A;  1E8Y A;  5KBA A;  4I2Z A;  4DJA A;  4N2S A;  2J4D A;  4DX2 A;  4RVB A;  4GTM A;  2P9K G;  4D10 C;  5JJ6 A;  1NZN A;  5KJN A;  3PNT B;  1OCC E;  4WNE A;  1TR4 A;  2IOS A;  4GYO A;  2OND A;  3LVR E;  3P2B A;  1E8W A;  5CHE E;  4U07 A;  2HO1 A;  3B7T A;  1KT1 A;  3G2V A;  3B7S A;  2EQX A;  4PUC A;  2CFU A;  5HQ8 A;  4TXQ A;  3CK9 A;  4BES A;  2I1J A;  3LVQ E;  2PQR A;  3G2U A;  1TYQ G;  1WAO 1;  2HYZ A;  4LNG A;  5FQ7 A;  2B0O E;  3DPY A;  4AOF A;  4I6J A;  3TWT A;  2L6B A;  4J0U A;  2LNI A;  2OCC E;  1JWF A;  3D9K A;  5ARF A;  4TRQ A;  4FHK A;  3NQP A;  4WUY A;  2DVW A;  4QFV A;  2Y4T A;  2WXG A;  2YIN A;  1ELW A;  1JCQ A;  3X2Q E;  3PEU B;  1FVF A;  3ABK E;  4JPS A;  3CKC A;  2VTB A;  2AXU A;  3NZS A;  3URZ A;  4G11 A;  3CHP A;  3FUL A;  4C48 B;  3UM0 A;  5B3S E;  3Q9N C;  2KAT A;  1Z6T A;  3CQG B;  2AJA A;  3BUA A;  2L9B A;  3PUJ A;  4APO A;  5C1D A;  4HI9 A;  4O1O A;  4JVS A;  3DEP A;  1QBQ A;  3CV0 A;  2PM7 A;  4ZHB A;  1NA0 A;  3ZFW A;  5ENO D;  5ENP D;  4Q96 A;  4XKB A;  3Q7A A;  3CQC B;  3FWV A;  2EIN E;  3NBN B;  3Q9U C;  4J8S A;  3AS8 A;  1LTX A;  2FO7 A;  3ZUV B;  1HH8 A;  1HF8 A;  4HOR A;  4KXK B;  4QQI A;  4O6F A;  3DBS A;  4DLQ A;  3QC1 A;  4K5B A;  1DCQ A;  3FH5 A;  3NOC D;  3KEZ A;  5EX3 A;  1YYH A;  2FUL A;  3R7R A;  3MGB A;  3ONL A;  5T8I A;  4YVO A;  3HXE A;  3ASO E;  1JCS A;  2H6F A;  4GA2 A;  4APF A;  2L6J A;  2V5F A;  3J5Q B;  4I43 A;  1S64 A;  3R9A B;  4I2W A;  2GRR B;  2GRP B;  3RO2 A;  3QB2 A;  1S0P A;  4J8F A;  4U8Y D;  3S7D A;  3CEQ A;  3IXE A;  2ETC A;  3PVL A;  1K3Z D;  1YMP A;  2XZD G;  1E96 B;  3FU3 A;  4URK A;  3FTV A;  4ACL A;  2AWI A;  4I1O B;  1OWP A;  3QK0 A;  4HQD A;  3EHM A;  2ZGG A;  5BV0 A;  5ARG A;  1N95 A;  4UI9 K;  4K5C A;  1RW2 A;  3UT7 A;  5G04 J;  4NQ0 A;  1XGW A;  3Q7F A;  1QQE A;  3SQV A;  4RSY A;  2AVP A;  1Y6I A;  3NB2 A;  2DZO A;  4DI3 A;  2ZGD A;  5CCM A;  5A23 A;  4J7W A;  2VJ8 A;  4HRN A;  3SFX A;  4XIF A;  3CVX A;  3PUK A;  5G2N A;  2QY7 A;  3NF1 A;  1NFI E;  5LP0 A;  2XGS A;  4J6I A;  5CER B;  4GMR A;  1FVH A;  3W9F A;  3PZ2 A;  3TL5 A;  4NIK A;  5CRV A;  1UG3 A;  4HRM B;  1H2U A;  3Q5M A;  2F37 A;  4OAU C;  4TXR A;  4N5Q A;  2P9I G;  3ONK A;  3MKR A;  1N4P A;  1SZ9 A;  3C3Q A;  3N71 A;  4CT4 A;  1WM5 A;  3TXN A;  1YA0 A;  3FUM A;  5FQ6 A;  1TNY A;  5G05 J;  4CGV A;  2XPY A;  3UUX A;  1IQU A;  2LSV A;  2WXN A;  4BX9 A;  3MYV A;  5ENS D;  1HU3 A;  4HB5 A;  3AG4 E;  2XRY A;  4FC8 A;  4IN3 B;  3FTW A;  5BW8 C;  3TG4 A;  1U2V G;  5T4Y A;  4BTA A;  4NUR A;  1X81 A;  4FHJ A;  4ILH B;  3FTX A;  4U96 D;  4MS6 A;  3UM2 A;  3DSX A;  4W9R A;  3HVE B;  1NA3 A;  5FZR A;  3SNX A;  3FHE A;  3Q75 A;  3J5P A;  2HE0 A;  1HS6 A;  4JZY A;  2QC9 A;  4J8D A;  4OVU A;  5CED B;  1Y8M A;  4LSZ E;  4GAA A;  2Q7F A;  3MEK A;  5HS0 A;  1P5Q A;  1ZBP A;  1K1B A;  2P2C P;  1H6P A;  3APC A;  3FUH A;  3RK6 A;  4KBQ A;  5ENN A;  4G25 A;  1SA5 A;  3D3M A;  3TWU A;  2VGX B;  4LER A;  4ILI A;  2GW1 A;  5AAR A;  3DXK G;  3EHR A;  3E34 A;  3Q73 A;  2X6F A;  1DVP A;  1IHB A;  4AIF A;  5AAO A;  1DCE A;  5CRU A;  4JXT A;  1V55 E;  4L7T A;  3RRU A;  1KZO A;  5EN5 D;  4YDY A;  4Y6W A;  2WXR A;  4EQF A;  4EZL A;  2OV8 A;  3MA5 A;  5KJM A;  2KCV A;  3V31 A;  3E33 A;  3U66 A;  2I2O A;  4L9P A;  4ANW A;  3ZEF A;  4EPZ A;  3U4T A;  5AEN A;  5HKP A;  4BT8 A;  3WXX A;  3Q49 B;  1MX6 A;  5CEC B;  4LUN U;  3LY9 A;  3KSL A;  3IEG A;  3QKY A;  4ANX A;  5BXU A;  3RAU A;  3Q15 A;  5EX0 A;  3PZ1 A;  2P9S G;  2IO3 C;  3U9W A;  5FIO A;  4DX7 D;  3CIA A;  5LOZ A;  1BD8 A;  2WXL A;  4C0E A;  3IHV A;  2JEK A;  1HO8 A;  5EIB E;  2PL2 A;  4I1A A;  1PAQ A;  3EUV A;  3BEE A;  4MLP A;  4U7E B;  4GZ3 A;  3ZRH A;  4I1M A;  2BTD A;  3L16 A;  2KCL A;  3IKO B;  3JXJ A;  2IOL A;  4U0S A;  3JQ1 A;  3EU9 A;  4G24 A;  3T8K A;  4XI0 A;  5EDS A;  5AN8 A;  2X3M A;  3QNK A;  2QYU A;  3W9G A;  1K1A A;  4DUI A;  3L13 A;  2KCK A;  3FUJ A;  3PH0 C;  2IF4 A;  3T9K A;  3I4R B;  4EHM A;  3S2A A;  4FU3 A;  5LFA A;  2P9P G;  5AJD A;  4GA0 A;  4CEM A;  3SF4 A;  4UQZ A;  1UW4 B;  2UY1 B;  1IQR A;  4X8Q A;  4XZ4 A;  3UMV A;  3TWR A;  4OYS A;  1IKN D;  4WWO A;  4K0R A;  3UTM A;  4HRL A;  3LCA A;  3MV3 B;  2VGE A;  2RFM A;  3QWW A;  1ELR A;  2FI7 A;  4ATG A;  2ZXW E;  4JHJ A;  3BQO A;  1TNU A;  4JA9 A;  3ZIM A;  4DX5 D;  5B1B E;  4NAC A;  4GML A;  3EHQ A;  4P29 A;  2WXF A;  2WB2 A;  4UWG A;  2VYI A;  2DWZ A;  3FDH A;  4ABN A;  2R5S A;  4I6E A;  2OEW A;  4UUC A;  2HM8 A;  3FH7 A;  3ML9 A;  2LAH A;  3G2S A;  1OXJ A;  2XQ0 A;  2MYO A;  2LSU A;  2JAB A;  3D9M A;  4E85 A;  1AWC B;  4HLL A;  2XCB A;  3L08 A;  4I9C A;  4UWH A;  2XGO A;  3AS5 A;  1H0A A;  3QOU A;  2XHE A;  5FT9 A;  4TUM A;  2CG2 A;  4KMO A;  5DBK A;  1SQM A;  2ZIR A;  3FU0 A;  2WXM A;  3JUE A;  1FCH A;  1E7V A;  4RQI A;  4UWL A;  3MJW A;  1TNZ A;  3P1U A;  4YND A;  5AQB A;  2ETA A;  5KNG A;  3PDN A;  4XX5 A;  3OTN A;  3TWW A;  3JCK C;  3HYM B;  3VLF A;  1H2T C;  2KZT B;  2NYJ A;  2AXZ A;  3SBS A;  4ANV A;  4HS2 A;  4Q69 A;  4GA1 A;  2R02 A;  4HOS A;  4HI8 A;  1WY6 A;  1TNO A;  4HOU A;  4PH4 B;  4DX6 D;  3FTU A;  3ULE G;  3SD5 A;  3UI2 A;  2Y3A A;  3PE4 A;  1KT0 A;  2XGM A;  2A5E A;  2MOW A;  1H19 A;  3BG1 B;  3RSE G;  3HDX A;  2PQN A;  2NSZ A;  2C2L A;  1OWN A;  1OUV A;  3QJZ A;  4UQX A;  4L2Y A;  1MX4 A;  1N0R A;  4CGW A;  4GB9 A;  3UXG A;  4F7A A;  2WQ6 A;  1O1R A;  4CRW A;  2XPI A;  4M7C A;  2VSY A;  1QNF A;  3ASN E;  3MZL B;  5EYP F;  3GW4 A;  4TV3 A;  5KCM A;  4F53 A;  2QFC A;  4MBG A;  4BT9 A;  5KWD A;  3UIN C;  5D0Q D;  2H6H A;  1ZB1 A;  1MZC A;  2XS1 A;  3D9N A;  3SZ7 A;  1OWM A;  4N2Q A;  3HHM A;  3D9O A;  3MV2 B;  5KNH D;  4BX8 A;  1OT8 A;  3TWV A;  3C98 A;  1MQS A;  4EZJ A;  4GPK A;  3UM1 A;  5AJL A;  2BED A;  3B13 A;  5FZQ A;  3O48 A;  3VLD A;  1RZ4 A;  1PC2 A;  4J8E A;  2IQC A;  4K03 A;  4GTP A;  4DX1 A;  3I5P A;  1LD8 A;  2P9N G;  3DST A;  1Z3Y A;  4WNG A;  4BWR A;  4LRZ A;  5FWQ A;  5G55 A;  1Z3X A;  2IJG X;  4B0Z A;  2L0I A;  2EIK E;  3NOG D;  3ZKJ A;  3LY8 A;  4Z68 A;  2DYR E;  3C3R A;  1E8X A;  3V2X A;  5BPP A;  2RG8 A;  4GMJ A;  5T3R A;  3EIQ C;  3ZXS A;  5JA4 D;  1N4Q A;  4BTB A;  4A3T A;  1NL4 A;  4U8V D;  2I9C A;  1V54 E;  1IHG A;  2HR2 A;  3G2T A;  4GTQ A;  4GTT A;  3E30 A;  2J09 A;  1IYG A;  5D2M C;  5FJY A;  2RKK A;  3ZYQ A;  2ETB A;  4GTR A;  2Y69 E;  3VLE A;  3TGO A;  3MKQ B;  1E8Z A;  3LEW A;  2IEJ A;  3D9L A;  3Q4A B;  3D9J A;  3G2W A;  3HVE A;  1MHQ A;  2PM6 A;  3DSU A;  4F6R D;  1HG2 A;  2F0Y A;  3FTZ A;  4GCO A;  2MHK A;  5ENT D;  2LXM A;  4V3I A;  3FUF A;  4N3C A;  4KVM A;  5LCW C;  3QAQ A;  5ENR D;  2RFA A;  2YHE A;  2VQ2 A;  2LAI A;  3CR3 A;  4FLH A;  1EDU A;  2UWJ G;  1HX8 A;  2IFU A;  3PS6 A;  2VGX A;  4I9E A;  3C3O A;  5J08 A;  4JW1 A;  2OVB A;  1KLX A;  2GGF A;  3PRZ A;  5EID A;  5FQ4 A;  3QDN A;  3TG5 A;  3SFY A;  1KZP A;  1OWO A;  3HXC A;  4EZK A;  5B1A E;  1XNF A;  4JB8 P;  4DK5 A;  3LJN A;  2DIW A;  3F6Q A;  5M72 A;  1TNB A;  4O60 A;  5AQA A;  5CEA A;  1HXI A;  3AS4 A;  3UIP C;  3CVN A;  4H7Y A;  5CBO A;  3ABM E;  2LXL A;  3B95 A;  3K9I A;  3ZPJ A;  2GRM A;  3PE3 A;  4AM9 A;  1G3N B;  3CK8 A;  2P9L G;  4Y6C A;  3QWV A;  4GZ6 A;  4L23 A;  2WXK A;  3CLJ A;  3C5R A;  5G04 C;  3R9M A;  3GYZ A;  5A7D B;  1UJJ A;  4GZC A;  2VSN A;  1E7U A;  3E4B A;  2I6H A;  1O1T A;  4F1S A;  1PY1 A;  3FTS A;  4U0Z A;  1N4R A;  3AU5 A;  3HIZ A;  4KZ0 A;  4UWF A;  2E0I A;  1JCR A;  4CT0 A;  3JQ0 A;  1O1S A;  4N39 A;  5ANR A;  1TN7 A;  3T5X A;  2BKG A;  2F8Y A;  2MRI A;  4WAF A;  2FO1 E;  4EEC A;  1OCO E;  2WXP A;  3TWX A;  2XPZ A;  4U0U A;  2FF4 A;  2DZN A;  2KC7 A;  3ULY A;  4BSX A;  2LO6 A;  4CDR A;  5BV1 A;  4R7L A;  2X6J A;  4BSZ B;  4CDM A;  1EPU A;  2XEE A;  2ZIS A;  4C0M A;  2EIJ E;  1JPL A;  4LCT A;  1ZU2 A;  5G05 C;  3EDT B;  1SVX A;  2E2E A;  3ZGQ A;  1SW6 A;  2WXJ A;  4WND A;  3SY2 A;  3FY4 A;  3LS8 A;  2X6K A;  5FQ8 A;  2CHW A;  1TN6 A;  4GCN A;  1ELK A;  3CHQ A;  3ZYM A;  1SZA A;  2UY1 A;  4YVQ C;  4RG9 A;  1O5M A;  4U8H A;  3C72 A;  2WQH A;  5IY5 E;  2KXP C;  3CST A;  4GZD A;  4XKC A;  2Y4U A;  3ZHE B;  3CK7 A;  4I6G A;  3U64 A;  4DI4 A;  5C2Y A;  1QYM A;  1X5B A;  2R59 A;  1HE8 A;  4IRU A;  1D8E A;  3IHY A;  3SI5 A;  2X6I A;  2P9U G;  4RG6 A;  4UI9 C;  3ASF A;  5EYL A;  3ISM C;  3FEY A;  4OAV B;  5AYW D;  1FT1 A;  3TWS A;  2R2L A;  3T5V A;  2FBN A;  4CYM D;  3B7U X;  2VSX E;  3JXI A;  4G8L A;  2AW6 A;  3AJI A;  3AU4 A;  3QAR A;  3EHN A;  4F3V A;  3CHM A;  1Q2Z A;  2PNN A;  2WMO A;  5EKQ D;  3ZYK A;  1D8D A;  3CVQ A;  3CVV A;  2KBX A;  3ASD A;  3S7J A;  1B89 A;  1UN9 A;  4N5C A;  1QZ2 A;  2V0P A;  1HFA A;  3UX4 A;  4BEP A;  1NI1 A;  2VSO E;  3KAE A;  4GPM A;  3RO3 A;  2IY0 C;  3UQ3 A;  3DWL G;  4JA7 A;  4MRU A;  3CHO A;  5E75 A;  3LY7 A;  3WG7 E;  4ACK A;  2X6H A;  4AXH A;  4H7X A;  2KZT A;  3FH8 A;  5LX8 A;  2AXV A;  3FP3 A;  5HRY A;  2C0L A;  1N0Q A;  2WM9 A;  4WWP A;  2WXI A;  4AEZ C;  4UQY A;  2M63 A;  3I4G A;  4A1G A;  1FPP A;  2B6C A;  1N54 A;  4K5A B;  4BY6 A;  1N94 A;  4IUL A;  5CCL A;  3CHR A;  3ESK A;  3FTY A;  3TJP A;  3Q47 B;  3ZYL A;  2BUG A;  3E37 A;  5J90 A;  2QZA A;  1HG5 A;  3GZ1 A;  4G1T A;  1LD7 A;  4FLB A;  3APD A;  2XRZ A;  3T8M A;  4GTS A;  3JUI A;  3RJV A;  3LXU X;  5JHA A; 
#chains in the Genus database with same CATH homology
 1TNU A;  3Q79 A;  3Q7F A;  3Q75 A;  4GTV A;  3Q7A A;  1D8D A;  2ZIS A;  3PZ4 A;  3SFY A;  3E32 A;  1KZP A;  3HXC A;  1S63 A;  3SFX A;  3Q78 A;  1N4Q A;  1LTX A;  1NI1 A;  1NL4 A;  3DSW A;  3EUV A;  1TN8 A;  3HXD A;  1TNB A;  3DSS A;  1SA5 A;  1O1R A;  2H6G A;  1N4S A;  1TN6 A;  4LNG A;  3DPY A;  1N9A A;  3PZ2 A;  4GTQ A;  4GTT A;  1FT2 A;  4MBG A;  3E30 A;  1O5M A;  3HXF A;  3C72 A;  3E34 A;  3Q73 A;  1DCE A;  2H6H A;  1MZC A;  4GTR A;  1N4P A;  4LNB A;  2IEJ A;  3HXE A;  2ZIR A;  1KZO A;  1JCS A;  2H6F A;  3HXB A;  1SA4 A;  1FPP A;  4YDO A;  1O1T A;  4YDE A;  3KSQ A;  1TNY A;  1S64 A;  1N94 A;  1TNZ A;  1N4R A;  3E33 A;  1D8E A;  4EHM A;  3DSU A;  1JCQ A;  2F0Y A;  1JCR A;  4L9P A;  3EU5 A;  1O1S A;  2BED A;  3PZ3 A;  1TN7 A;  4GTO A;  1FT1 A;  1X81 A;  3E37 A;  2R2L A;  4GTM A;  1LD7 A;  3DSV A;  4GTP A;  2H6I A;  1LD8 A;  3DST A;  3KSL A;  4GTS A;  1QBQ A;  1TNO A;  3DSX A;  3DRA A;  3PZ1 A;  1N95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...