1N9AA

Farnesyltransferase complex with tetrahydropyridine inhibitors
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
312
structure length
312
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Aryl tetrahydropyridine inhibitors of farnesyltransferase: bioavailable analogues with improved cellular potency.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 122
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n9aA00
1LTXA 3E37A 4YDEA 3PZ3A 1N4SA 3E33A 1TN6A 1D8EA 2IEJA 3HXDA 1TN7A 3SFYA 3E34A 1JCRA 4GTMA 1X81A 3DSTA 1SA5A 1MZCA 3Q79A 3HXEA 4GTTA 1SA4A 3Q73A 1JCQA 2R2LA 3DPYA 4EHMA 1N94A 2BEDA 1TNZA 4GTQA 1S64A 3DRAA 1TN8A 3EU5A 1KZPA 1O1SA 4GTRA 2ZIRA 1NI1A 3E30A 3HXBA 3Q78A 1D8DA 3KSQA 3PZ1A 1LD7A 3Q7FA 1FPPA 3EUVA 3KSLA 1O5MA 1LD8A 3DSSA 2F0YA 3Q75A 4GTOA 4GTVA 1N4QA 1NL4A 2H6IA 1KZOA 1FT1A 1JCSA 1N95A 2H6FA 3C72A 3HXCA 3DSWA 1N9AA 4GTPA 1QBQA 4YDOA 1TNUA 3SFXA 2H6HA 3DSUA 2H6GA 1S63A 3PZ4A 3PZ2A 1O1TA 4GTSA 4MBGA 3DSVA 2ZISA 1DCEA 1N4RA 3HXFA 4L9PA 1O1RA 1N4PA 3Q7AA 1TNOA 1TNBA 1TNYA 3E32A 3DSXA 4LNBA 1FT2A 4LNGA
chains in the Genus database with same CATH superfamily
3G2WA 5AENA 2CHXA 3FU0A 2RD0A 2P2CP 4KT6B 4DX5D 3SD5A 4HLEA 4DX2A 4DJAA 2PQRA 3RKVA 4UWGA 4ILIA 3EIJA 4UUCA 4KBQA 2J4BA 4JZYA 4YVOA 1S64A 3DRAA 1MJ0A 4RSYA 1H2TC 4AM9A 3PEUB 2I9CA 2ZIRA 4RG6A 4Q94A 1N0QA 1PAQA 3UI2A 3QB2A 1MX2A 4O6FA 3D9KA 4XE0A 4PS3A 2YQ8A 3CVVA 4B93B 4C9BB 3AU5A 1E90A 3ZHEB 4Y6CA 3VLFA 4BT9A 1OCRE 4C0EA 4I1MA 3SBTB 4JA9A 4GMJA 3SGHA 1IKND 3D9IA 2YHEA 4WWPA 3CHPA 5EX0A 4GTSA 1HXIA 4ACLA 5T3RA 1YMPA 4DLQA 1WAO1 4IYPA 4TXQA 1SVXA 3Q9NC 2CG2A 5LCWC 2UY1B 3UX4A 4JXTA 5DIZA 1YCSB 3SQVA 3DBSA 5B3SE 4GA1A 3DEOA 1EF1C 2DZNA 4TUUA 4UWFA 2AXZA 2JABA 2RKKA 4U0UA 5ENSD 1X81A 1ZB1A 4CDMA 5HKPA 2VTBB 1FVFA 3S2AA 3P2BA 3CVPA 1H6OA 3ZYMA 3SO8A 3RK6A 4Q96A 3AU4A 2P9NG 1NI1A 1VDYA 2FO7A 3P1UA 4HXIA 2WXRA 4BERA 2P9LG 4G1TA 1D9SA 1U3CA 1OY3D 3TL5A 2A4ZA 1NP7A 3BU8A 4HFGA 3D9MA 4JHRA 2H6FA 2WXHA 2Y0BG 4F3VA 3MV2B 4JHKA 3DSWA 2VGEA 1INZA 3J5QB 4GZCA 1UN8A 1E96B 2OEWA 2RG8A 4J8YA 2LAIA 2EQXA 4LEUA 2L6BA 3CV0A 4BSXA 4FJZA 3MV3B 3IBEA 4OVVA 2XGSA 3MEKA 4BETA 1UN9A 2YNQA 5ENNA 3D3MA 4I6JA 3ZIMA 2XGOA 3ASDA 4HOSA 1HS6A 3G2VA 2B6CA 2C0MA 2PNNA 5LFAA 2XENA 1ZU2A 3HXDA 2KM4A 5KWDA 3LCAA 1N54A 2ZGDA 2EINE 2BKGA 1HZ4A 1YA0A 3LKUA 4EBAA 4BT8A 1H6KA 4M7CA 2CHZA 4AXHA 1K8KG 2ILRA 4ANUA 2R5SA 1GW6A 4GTQA 4KMOA 4UI9K 3PH0C 3PS6A 3C3RA 3DWLG 4NRHB 1TEZA 3L6AA 3ZGQA 3FUEA 4LRZA 3NZSA 3R9AB 3EHQA 2GRNB 3FU6A 1N4QA 5FTPA 2LSUA 1OCCE 1FT1A 3GZ1A 4BESA 3AG2E 3B13A 5EILA 1N9AA 4XZ4A 2QY7A 3G2UA 5ENQD 1OWNA 1QBQA 2X3MA 2FO1E 3SFXA 2LO6A 3AG1E 1HG5A 3CHOA 5HQ8A 4N3AA 3SHFA 5ARGA 4YDWA 1HX8A 2R17C 3FU3A 4DPRA 2MOWA 4AVXA 2DWZA 2R03A 3QOUA 1DC2A 3PNLB 5J08A 2P9KG 2L9BA 3L22A 3CVXA 4BY6A 1MHQA 3AAAC 3PE3A 2EILE 3I3NA 1H2VC 4ANXA 3ML9A 4TV3A 2KBXA 1SA4A 3LPZA 4C48B 3TWUA 3Q73A 4JL0A 1JCQA 1QQEA 3LJ3A 2HYZA 5BW8C 1HFAA 1N94A 3OTNA 4EPZA 4F1SA 5G04C 3EU5A 2MYOA 3R7RA 1RZ4A 3LVRE 3BUAA 3KSLA 2VQ2A 2IQCA 3HG0D 5HS0A 3UKRG 3EU9A 3PE4A 3ASGA 2M63A 4GTPA 3JUEA 5AQ7A 5CBNA 3GYZA 1V55E 2WXLA 1SW6A 1TNUA 3ZU7B 2H6HA 3ABME 4A3TA 2V0PA 3CKBA 5KJKA 2KZTB 2BF0X 3ZFWA 3DSVA 4EQFA 3UINC 5ENPD 2R02A 3C5RA 3APCA 4UWLA 4TRQA 1H2UA 4PS8A 4HI8A 5CHEE 3X2QE 2XEHA 3FUJA 4OAUC 4APOA 1NFIE 3CK8A 3S7FA 1S0PA 4GZ6A 3Q49B 4XI0A 4GYOA 4GTMA 5KBAA 3DSTA 3ZW3A 3MZLB 5G04J 2VSYA 4J7WA 2X6KA 5ENRD 3TWSA 3QNKA 3CVQA 4EZLA 4XIFA 3HDXA 1OWMA 3CSTA 3FUMA 3HXBA 4K5CA 4O1PA 4G24A 5LOZA 3Q47B 1LD8A 3NZUA 4CDNA 4PDXA 3FWVA 3NB2A 3WG7E 2NXPA 1KZOA 1JCSA 3ZXSA 4CDRA 3HHMA 4HRNA 4W9RA 2UY1A 4FHJA 4L2LA 4WNGA 4BFRA 3FU5A 4HNAD 4Q69A 2RFMA 2XHEA 1QYMA 4N2QA 5KJLA 2X6IA 3VTYA 2C0LA 3HXFA 3ZXPA 1O1RA 1MQSA 3MKRA 3RRUA 3TGOA 2YINA 3TWQA 4E6HA 4ME2A 4G26A 4WWNA 5KJNA 1E8YA 2XRZA 1XNFA 1RW2A 5H7PA 1NA0A 3LJNA 4CT0A 4OYSA 4EZJA 2IO3C 4H7YA 1KT1A 5BNWA 3JUIA 4YDEA 3AS5A 1KPSB 2UWJG 1N11A 1G3NB 4BTAA 2P9UG 4MS6A 3U4TA 2V4LA 5C2YA 1XGWA 4N39A 1WM5A 4M3OA 5HRYA 3K9IA 5B1BE 3UT4A 4I2ZA 5KJMA 2P9PG 4X8QA 4QFVA 1L5JA 2V5QC 4HI9A 4RVBA 3OXGA 4KZCA 5AN8A 5ITZF 2ZXWE 3PZ1A 3AG4E 5CEAA 4GPMA 2PZIA 4GCOA 3RAUA 3URZA 4HB5A 1MX6A 3B7SA 2IOSA 4Y6WA 2FBNA 1SQMA 4L2YA 1N95A 3B7BA 3LDZA 3MCXA 3VLDA 3PVLA 2GROB 1A17A 2VSOE 1K3ZD 2FF4A 2BUGA 3PZ2A 5A7DB 4ILHB 4CZ2D 4ZHBA 3LY8A 4FLBA 4UQZA 4BTBA 3KEAA 5KCMA 4JEHA 3CQCB 3FP3A 3N71A 2B0OE 1LTXA 4E85A 2XZTG 3EIQC 4JB8P 3MKQA 4HOQA 3FUFA 3D9NA 2OEVA 2P9IG 2ONDA 4JA7A 3PZDA 4ANVA 4U7EB 4NIKA 2LAHA 2L0TB 4GA0A 5JJ6A 4LUNU 3B7TA 5BXOA 3V2OA 4DI3A 4AEZC 4A63B 4N5QA 4FP7A 5G55A 4KVOA 3ZYQA 2OV8A 1YYHA 2A5UA 1ELKA 1Z3XA 3ISMC 2FEZA 2DIWA 2DBAA 4J8SA 4KZ0A 2BKKB 3RO2A 4DI4A 3CGHA 3QJZA 4XEIG 3LYAA 4MLPA 5ENTD 3V2XA 4NURA 3FTYA 3UXGA 3DSUA 3AJIA 4ACKA 3CVUA 2VGXB 2WM9A 1K1AA 5CBOA 3LVQE 1X5BA 3F6QA 2V4HC 2ZU6B 5CERB 2IY0C 1Q2ZA 4DRXE 5BV1A 4WNDA 3SZ7A 4B94A 3ZNGA 3V79K 3FFLA 4APFA 3QWPA 4JHJA 3J5PA 1K1BA 1Z6TA 2YHCA 5J90A 3KEZA 4KYOB 2LNIA 3L17A 5CRUA 5FQ8A 2OCCE 4WNFA 5CMWA 5AJLA 5KNGA 4IRUA 5LX8A 1O1SA 5FT9A 4L7TA 1OUVA 4U8VD 4FC8A 2WMOA 1TJCA 3ZUVB 1O5MA 1H19A 2J8SD 4LERA 4I9EA 5M72A 2PM7A 3S7BA 5FQ4A 2KCLA 2E0IA 2KZTA 2V5FA 3CSFA 2DVWA 3ULEG 4R7LA 2X38A 2JEKA 4YDYA 3ASFA 3W9FA 1KLXA 1EDUA 1DCQA 5BT1A 4DX1A 2DYRE 3FUDA 4JC8A 3MA5A 3RRMB 2KC7A 5CCLA 2XPIA 3TJPA 2XEVA 5EIBE 1V54E 3U64A 1JUQA 2WVIA 5AAOA 4G2VA 1FVHA 3AS8A 4I17A 1N4PA 4NQ0A 2CG3A 4U0SA 5FINA 4HVBA 1HU3A 1TYQG 4HORA 2Q7FA 1DVPA 3B7RL 3KAEA 3EHRA 3QK0A 3DSXA 5E75A 2QYUA 4IULA 5DBKA 4U8YD 2AVPA 3ABKE 4AY5A 4HQDA 4I1AA 3PZ3A 1HO8A 2L0IA 2IEJA 3MYVA 1JWFA 2GRLA 3UIOC 3S7JA 1PY1A 1TR4A 2Y4UA 2AXVA 3Q79A 3VTXA 4K03A 4FULA 1S70B 4PUCA 5BUZA 3FTZA 3UPVA 3HRAA 3ZYKA 1NZNA 4TXRA 3JXIA 4GZ3A 2DCPA 2X6JA 2QFCA 1OWPA 5EN5D 3KSQA 1FPPA 5JA4D 3RJVA 4GYYA 3QKYA 3CHMA 4C0MA 2XEEA 3T9KA 3BQOA 3ULYA 3L9TA 3GZSA 4XI9A 3MX3A 1QNFA 1MX4A 2J08A 2GRPB 4B8CB 4WWOA 2Y4TA 3CQGB 2ETAA 3HVEA 4UQYA 3PZ4A 1U2VG 3JYSA 1ELRA 3L13A 3FTUA 4FHKA 2OOEA 2IOLA 3IXEA 2Y1LE 4L9PA 3ONLA 3UT7A 2WXOA 1A5EA 4OAVB 2EIJE 5EX3A 4CT4A 3ZVVA 4U07A 3B95A 1TNYA 5D66A 3E32A 4G8LA 3TWWA 2AW6A 1FT2A 5AQAA 4FLHA 2LSVA 3FEYA 2IF4A 3NF1A 1TN7A 2XCCA 3SFYA 5T4YA 5AYWD 3LXUX 3RO3A 2AJAA 3ZEFA 3HXEA 2J9QA 5D0OD 1OT8A 2I6HA 3FTVA 4J8FA 4CGWA 5A6CA 5BXUA 4MKTA 4V3IA 4HOUA 1KZPA 5ENOD 3ZKJA 4O60A 3VLEA 2L6JA 5AIJA 3NAWA 3PREA 1SZAA 4FA6A 5E76A 3PNTB 4P29A 4HRMB 4GCNA 4BWRA 5IY5E 4FJYA 2Y69E 3RU0A 3LY9A 2BTDA 5BV0A 4BEPA 5C1DA 3ZHEA 3I4RB 1BI8B 3FDHA 3AG3E 5FQ7A 3TXNA 4XX5A 3D9JA 5AQ9A 5G05C 4CCAA 4G11A 4G23A 3ZYLA 4A1GA 3UQ3A 3O4ZA 5CMYA 3ZRHA 2XPZA 2HO1A 2J49A 3UMVA 1OXJA 2JLBA 5FJYA 1TNOA 2CHWA 2PL2A 3T5XA 3RRNB 4GZDA 4U96D 3PEVB 1IYGA 3OXLA 4F1PA 1N4SA 3E33A 2CFZA 3UKUG 3DEPA 2WXKA 3C3QA 2VTBA 4K5BA 5ANLA 3CIAA 4F6RD 5EYLA 2F37A 3ASHA 3PUKA 2AXUA 3ASNE 4AP2A 2P58C 1BLXB 2E2EA 3CVLA 3Q78A 3O48A 3UUXA 3SY2A 3GZ2A 2IU1A 2Y3AA 4GAAA 3TWXA 4LNUD 3L16A 4DUIA 2F0YA 3ONKA 4ATGA 2LXMA 3U3WA 4WUYA 4ANWA 5G05J 5KNHD 3FUNA 3FTSA 4WAFA 2QYJA 3CKCA 3ESKA 2QC9A 3PUJA 4B89A 3HIZA 3UIPC 1E8XA 2ZISA 3FUKA 2WXJA 4BX9A 4K5AB 1H6PA 4U0ZA 3NOGD 4F7AA 3GW4A 3ULQA 3FH7A 3D9LA 1Z3YA 4HRLA 4HBDA 2MRIA 4LNGA 5EKQD 4RLYA 4B8AA 5FWQA 3E37A 4JPSA 3DPDA 1WG0A 3Q4AB 4YVQC 4CYMD 3ZPJA 3WXXA 1DNPA 3QARA 4LG6A 3APDA 2J09A 1BD8A 3AS4A 3W9GA 2A5EA 1BI7B 4YNDA 4GB9A 2WXGA 4I2WA 1EPUA 4HS2A 1UJJA 4I1OB 5D2MC 3RIBA 3Q7FA 2XCBA 3EUVA 2GRRB 2RFAA 3FTXA 2OVBA 3Q75A 4UQXA 4GTOA 3SI5A 1UJKA 5T8IA 3QDNA 3HYMB 3V31A 2GRQB 4G25A 4GU5A 4UI9C 2R05A 2IFUA 4WNEA 2J07A 1ZBPA 3MJWA 1S63A 4ATZD 3R9MA 2PQNA 3QAQA 2WQ6A 3U9WA 4I43A 3JQ0A 3TWVA 5ANRA 4A1SA 2CFUA 1E7VA 3ABLE 3CK7A 4CEMA 1E8ZA 3BEEA 2XQ0A 3UT8A 1NA3A 3S7DA 4GMLA 1U3DA 4CRWA 3G2TA 1E7UA 2GW1A 2GGFA 4UWHA 1IHGA 5JHAA 4LCTA 3CHRA 3CHSA 5AARA 3SBSA 4RQIA 3TG4A 5FQ6A 4A55A 3DPYA 3EHNA 4EHMA 3CR3A 4FADA 2IONA 2DYSE 2LXLA 2WPVA 1UOHA 5FZRA 3JCKC 4GTRA 4QQIA 3OAWA 2KXPC 4JEUA 4JD2G 2WXMA 4UI9J 2FULA 4ABNA 1P5QA 2FI7A 5LCWJ 3NOCD 1BU9A 4GTVA 3ZN3A 2H6IA 1WDYA 3LEWA 3TWTA 3RSEG 3HXCA 1W3BA 3FH5A 4YDOA 1JPLA 3LS8A 3OXFA 2H6GA 1OCOE 1TJFA 2XS1A 3C98A 4GPKA 1H0AA 1O1TA 1HH8A 1DCEA 4AY6A 4IN3B 2F8XK 4NACA 3Q7AA 1HE8A 5FZQA 4N5CA 4DX6D 4Z68A 1TNBA 3LY7A 1JWGA 2VSNA 2I1JA 3ML8A 4J6IA 4J8EA 3MKQB 3ENEA 3QC1A 1HG2A 1D8EA 3D9HA 2DZOA 4U63A 2IJGX 1IQRA 2QZAA 2XRYA 2I1KA 2KCKA 1JCRA 4BX8A 4J8DA 1E8WA 1SA5A 5CECB 4GTTA 5A23A 2WXQA 5BPPA 4L23A 3I5PA 3SF4A 1SZ9A 3L82A 2BEDA 1TNZA 2HE0A 4N3BA 3Q15A 3FHEA 2NYJA 3FUIA 5CEDB 3ASOE 4GZ5A 3U66A 1D8DA 4URKA 3IHVA 1LD7A 4N3CA 2MHKA 2IO2C 3DSSA 4G8KA 2XGMA 3IEGA 4XKCA 2NSZA 2NC9A 3QWVA 3DXMG 2EIME 3UM2A 1AP7A 4HLLA 4EZKA 3B7UX 2ETCA 3TG5A 2XS8A 2KCVA 1HF8A 3EHMA 3CVWA 3DXKG 4KVMA 4TUMA 3CEQA 3G2SA 3UM3A 3ESLA 1Y8MA 5JJ7A 4GYWA 1WY6A 5D0QD 5FIOA 1OCZE 4KXKB 2WXPA 4I6GA 3UM1A 5EIDA 1TN6A 4N2SA 2WXNA 3EDTB 4AV7A 3CK9A 4LSZE 5JHBA 3SNXA 4J0UA 1MZCA 2I2OA 3JQ1A 5G2NA 2J4DA 4BSZB 3L08A 3FEXA 3V30A 1N0RA 2WQHA 1UG3A 4ZFHA 4AJWA 4FU3A 3D9PA 1TN8A 4U04A 3PDNA 3CVNA 4GA2A 4MRUA 3FULA 3TWRA 4F53A 1MYOA 2ZGGA 3TAXA 3E4BA 3IV0A 5HI7A 3PRZA 1OWLA 5AQBA 2C2LA 4XKBA 5JMND 4DK5A 1KT0A 2X6FA 2WXIA 5B1AE 2OVFA 3KS2A 1PC2A 4DLOA 4JVSA 1FCHA 2LUHA 1EYHA 3IKOB 5CRVA 4PS7A 2VYIA 3NBNB 4MBGA 2HM8A 3R7QA 1QZ2A 4HOTA 1N4RA 3BG0B 2PM6A 2GRMA 4RG9A 4DX7D 3C3OA 4I9CA 2ETBA 4UWKA 4A3VA 3Q9UC 3CVYA 1OWOA 4JW1A 2XZDG 3FTWA 4LNBA 2EIKE 3NQPA 2V8SE 2HR2A 3SFZA 3T8KA 4H7XA 3FY4A 2VSXE 4AOFA 5EDSA 1LF8A 3IHYA 2R59A 3E34A 3UTMA 3UM0A 2VGYA 3EJNA 4EECA 2F8YA 3APFA 2WQ7A 2WB2A 5EYPF 3Q5MA 3KD7A 4EBAG 2X6HA 2R2LA 1ELWA 4D10C 2XPYA 3E30A 4L1BA 4U95D 5CCMA 1AWCB 3T8MA 5AJDA 2WMNA 4B0ZA 3T5VA 4O1OA 1Z5SC 1BPOA 5LP0A 2KATA 3CHQA 1NL4A 4U8HA 3TXMA 3BG1B 3MGBA 4ILGA 4I6EA 5JJTA 3C72A 1Y6IA 5ARFA 3CLJA 1IHBA 3HVEB 1B89A 2AWIA 2WXFA 4OVUA 4CGVA 3FH8A 1UW4B 5FZSA 3JXJA 2P9SG 2VGXA 4PH4B 1N52A 1IXVA 3L54A 3FUHA 3D9OA 4GMRA 4TXPA 1IQUA 3I4GA 2VJ8A 3QWWA 4AIFA 4K0RA
chains in the Genus database with same CATH topology
1LTXA 3E37A 4YDEA 3PZ3A 1N4SA 3E33A 1TN6A 1D8EA 2IEJA 3HXDA 1TN7A 3SFYA 3E34A 1JCRA 4GTMA 1X81A 3DSTA 1SA5A 1MZCA 3Q79A 3HXEA 4GTTA 1SA4A 3Q73A 1JCQA 2R2LA 3DPYA 4EHMA 1N94A 2BEDA 1TNZA 4GTQA 1S64A 3DRAA 1TN8A 3EU5A 1KZPA 1O1SA 4GTRA 2ZIRA 1NI1A 3E30A 3HXBA 3Q78A 1D8DA 3KSQA 3PZ1A 1LD7A 3Q7FA 1FPPA 3EUVA 3KSLA 1O5MA 1LD8A 3DSSA 2F0YA 3Q75A 4GTOA 4GTVA 1N4QA 1NL4A 2H6IA 1KZOA 1FT1A 1JCSA 1N95A 2H6FA 3C72A 3HXCA 3DSWA 1N9AA 4GTPA 1QBQA 4YDOA 1TNUA 3SFXA 2H6HA 3DSUA 2H6GA 1S63A 3PZ4A 3PZ2A 1O1TA 4GTSA 4MBGA 3DSVA 2ZISA 1DCEA 1N4RA 3HXFA 4L9PA 1O1RA 1N4PA 3Q7AA 1TNOA 1TNBA 1TNYA 3E32A 3DSXA 4LNBA 1FT2A 4LNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTX A;  3E37 A;  4YDE A;  3PZ3 A;  1N4S A;  3E33 A;  1TN6 A;  1D8E A;  2IEJ A;  3HXD A;  1TN7 A;  3SFY A;  3E34 A;  1JCR A;  4GTM A;  1X81 A;  3DST A;  1SA5 A;  1MZC A;  3Q79 A;  3HXE A;  4GTT A;  1SA4 A;  3Q73 A;  1JCQ A;  2R2L A;  3DPY A;  4EHM A;  1N94 A;  2BED A;  1TNZ A;  4GTQ A;  1S64 A;  3DRA A;  1TN8 A;  3EU5 A;  1KZP A;  1O1S A;  4GTR A;  2ZIR A;  1NI1 A;  3E30 A;  3HXB A;  3Q78 A;  1D8D A;  3KSQ A;  3PZ1 A;  1LD7 A;  3Q7F A;  1FPP A;  3EUV A;  3KSL A;  1O5M A;  1LD8 A;  3DSS A;  2F0Y A;  3Q75 A;  4GTO A;  4GTV A;  1N4Q A;  1NL4 A;  2H6I A;  1KZO A;  1FT1 A;  1JCS A;  1N95 A;  2H6F A;  3C72 A;  3HXC A;  3DSW A;  1N9A A;  4GTP A;  1QBQ A;  4YDO A;  1TNU A;  3SFX A;  2H6H A;  3DSU A;  2H6G A;  1S63 A;  3PZ4 A;  3PZ2 A;  1O1T A;  4GTS A;  4MBG A;  3DSV A;  2ZIS A;  1DCE A;  1N4R A;  3HXF A;  4L9P A;  1O1R A;  1N4P A;  3Q7A A;  1TNO A;  1TNB A;  1TNY A;  3E32 A;  3DSX A;  4LNB A;  1FT2 A;  4LNG A; 
#chains in the Genus database with same CATH topology
 3G2W A;  5AEN A;  2CHX A;  3FU0 A;  2RD0 A;  2P2C P;  4KT6 B;  4DX5 D;  3SD5 A;  4HLE A;  4DX2 A;  4DJA A;  2PQR A;  3RKV A;  4UWG A;  4ILI A;  3EIJ A;  4UUC A;  4KBQ A;  2J4B A;  4JZY A;  4YVO A;  1S64 A;  3DRA A;  1MJ0 A;  4RSY A;  1H2T C;  4AM9 A;  3PEU B;  2I9C A;  2ZIR A;  4RG6 A;  4Q94 A;  1N0Q A;  1PAQ A;  3UI2 A;  3QB2 A;  1MX2 A;  4O6F A;  3D9K A;  4XE0 A;  4PS3 A;  2YQ8 A;  3CVV A;  4B93 B;  4C9B B;  3AU5 A;  1E90 A;  3ZHE B;  4Y6C A;  3VLF A;  4BT9 A;  1OCR E;  4C0E A;  4I1M A;  3SBT B;  4JA9 A;  4GMJ A;  3SGH A;  1IKN D;  3D9I A;  2YHE A;  4WWP A;  3CHP A;  5EX0 A;  4GTS A;  1HXI A;  4ACL A;  5T3R A;  1YMP A;  4DLQ A;  1WAO 1;  4IYP A;  4TXQ A;  1SVX A;  3Q9N C;  2CG2 A;  5LCW C;  2UY1 B;  3UX4 A;  4JXT A;  5DIZ A;  1YCS B;  3SQV A;  3DBS A;  5B3S E;  4GA1 A;  3DEO A;  1EF1 C;  2DZN A;  4TUU A;  4UWF A;  2AXZ A;  2JAB A;  2RKK A;  4U0U A;  5ENS D;  1X81 A;  1ZB1 A;  4CDM A;  5HKP A;  2VTB B;  1FVF A;  3S2A A;  3P2B A;  3CVP A;  1H6O A;  3ZYM A;  3SO8 A;  3RK6 A;  4Q96 A;  3AU4 A;  2P9N G;  1NI1 A;  1VDY A;  2FO7 A;  3P1U A;  4HXI A;  2WXR A;  4BER A;  2P9L G;  4G1T A;  1D9S A;  1U3C A;  1OY3 D;  3TL5 A;  2A4Z A;  1NP7 A;  3BU8 A;  4HFG A;  3D9M A;  4JHR A;  2H6F A;  2WXH A;  2Y0B G;  4F3V A;  3MV2 B;  4JHK A;  3DSW A;  2VGE A;  1INZ A;  3J5Q B;  4GZC A;  1UN8 A;  1E96 B;  2OEW A;  2RG8 A;  4J8Y A;  2LAI A;  2EQX A;  4LEU A;  2L6B A;  3CV0 A;  4BSX A;  4FJZ A;  3MV3 B;  3IBE A;  4OVV A;  2XGS A;  3MEK A;  4BET A;  1UN9 A;  2YNQ A;  5ENN A;  3D3M A;  4I6J A;  3ZIM A;  2XGO A;  3ASD A;  4HOS A;  1HS6 A;  3G2V A;  2B6C A;  2C0M A;  2PNN A;  5LFA A;  2XEN A;  1ZU2 A;  3HXD A;  2KM4 A;  5KWD A;  3LCA A;  1N54 A;  2ZGD A;  2EIN E;  2BKG A;  1HZ4 A;  1YA0 A;  3LKU A;  4EBA A;  4BT8 A;  1H6K A;  4M7C A;  2CHZ A;  4AXH A;  1K8K G;  2ILR A;  4ANU A;  2R5S A;  1GW6 A;  4GTQ A;  4KMO A;  4UI9 K;  3PH0 C;  3PS6 A;  3C3R A;  3DWL G;  4NRH B;  1TEZ A;  3L6A A;  3ZGQ A;  3FUE A;  4LRZ A;  3NZS A;  3R9A B;  3EHQ A;  2GRN B;  3FU6 A;  1N4Q A;  5FTP A;  2LSU A;  1OCC E;  1FT1 A;  3GZ1 A;  4BES A;  3AG2 E;  3B13 A;  5EIL A;  1N9A A;  4XZ4 A;  2QY7 A;  3G2U A;  5ENQ D;  1OWN A;  1QBQ A;  2X3M A;  2FO1 E;  3SFX A;  2LO6 A;  3AG1 E;  1HG5 A;  3CHO A;  5HQ8 A;  4N3A A;  3SHF A;  5ARG A;  4YDW A;  1HX8 A;  2R17 C;  3FU3 A;  4DPR A;  2MOW A;  4AVX A;  2DWZ A;  2R03 A;  3QOU A;  1DC2 A;  3PNL B;  5J08 A;  2P9K G;  2L9B A;  3L22 A;  3CVX A;  4BY6 A;  1MHQ A;  3AAA C;  3PE3 A;  2EIL E;  3I3N A;  1H2V C;  4ANX A;  3ML9 A;  4TV3 A;  2KBX A;  1SA4 A;  3LPZ A;  4C48 B;  3TWU A;  3Q73 A;  4JL0 A;  1JCQ A;  1QQE A;  3LJ3 A;  2HYZ A;  5BW8 C;  1HFA A;  1N94 A;  3OTN A;  4EPZ A;  4F1S A;  5G04 C;  3EU5 A;  2MYO A;  3R7R A;  1RZ4 A;  3LVR E;  3BUA A;  3KSL A;  2VQ2 A;  2IQC A;  3HG0 D;  5HS0 A;  3UKR G;  3EU9 A;  3PE4 A;  3ASG A;  2M63 A;  4GTP A;  3JUE A;  5AQ7 A;  5CBN A;  3GYZ A;  1V55 E;  2WXL A;  1SW6 A;  1TNU A;  3ZU7 B;  2H6H A;  3ABM E;  4A3T A;  2V0P A;  3CKB A;  5KJK A;  2KZT B;  2BF0 X;  3ZFW A;  3DSV A;  4EQF A;  3UIN C;  5ENP D;  2R02 A;  3C5R A;  3APC A;  4UWL A;  4TRQ A;  1H2U A;  4PS8 A;  4HI8 A;  5CHE E;  3X2Q E;  2XEH A;  3FUJ A;  4OAU C;  4APO A;  1NFI E;  3CK8 A;  3S7F A;  1S0P A;  4GZ6 A;  3Q49 B;  4XI0 A;  4GYO A;  4GTM A;  5KBA A;  3DST A;  3ZW3 A;  3MZL B;  5G04 J;  2VSY A;  4J7W A;  2X6K A;  5ENR D;  3TWS A;  3QNK A;  3CVQ A;  4EZL A;  4XIF A;  3HDX A;  1OWM A;  3CST A;  3FUM A;  3HXB A;  4K5C A;  4O1P A;  4G24 A;  5LOZ A;  3Q47 B;  1LD8 A;  3NZU A;  4CDN A;  4PDX A;  3FWV A;  3NB2 A;  3WG7 E;  2NXP A;  1KZO A;  1JCS A;  3ZXS A;  4CDR A;  3HHM A;  4HRN A;  4W9R A;  2UY1 A;  4FHJ A;  4L2L A;  4WNG A;  4BFR A;  3FU5 A;  4HNA D;  4Q69 A;  2RFM A;  2XHE A;  1QYM A;  4N2Q A;  5KJL A;  2X6I A;  3VTY A;  2C0L A;  3HXF A;  3ZXP A;  1O1R A;  1MQS A;  3MKR A;  3RRU A;  3TGO A;  2YIN A;  3TWQ A;  4E6H A;  4ME2 A;  4G26 A;  4WWN A;  5KJN A;  1E8Y A;  2XRZ A;  1XNF A;  1RW2 A;  5H7P A;  1NA0 A;  3LJN A;  4CT0 A;  4OYS A;  4EZJ A;  2IO3 C;  4H7Y A;  1KT1 A;  5BNW A;  3JUI A;  4YDE A;  3AS5 A;  1KPS B;  2UWJ G;  1N11 A;  1G3N B;  4BTA A;  2P9U G;  4MS6 A;  3U4T A;  2V4L A;  5C2Y A;  1XGW A;  4N39 A;  1WM5 A;  4M3O A;  5HRY A;  3K9I A;  5B1B E;  3UT4 A;  4I2Z A;  5KJM A;  2P9P G;  4X8Q A;  4QFV A;  1L5J A;  2V5Q C;  4HI9 A;  4RVB A;  3OXG A;  4KZC A;  5AN8 A;  5ITZ F;  2ZXW E;  3PZ1 A;  3AG4 E;  5CEA A;  4GPM A;  2PZI A;  4GCO A;  3RAU A;  3URZ A;  4HB5 A;  1MX6 A;  3B7S A;  2IOS A;  4Y6W A;  2FBN A;  1SQM A;  4L2Y A;  1N95 A;  3B7B A;  3LDZ A;  3MCX A;  3VLD A;  3PVL A;  2GRO B;  1A17 A;  2VSO E;  1K3Z D;  2FF4 A;  2BUG A;  3PZ2 A;  5A7D B;  4ILH B;  4CZ2 D;  4ZHB A;  3LY8 A;  4FLB A;  4UQZ A;  4BTB A;  3KEA A;  5KCM A;  4JEH A;  3CQC B;  3FP3 A;  3N71 A;  2B0O E;  1LTX A;  4E85 A;  2XZT G;  3EIQ C;  4JB8 P;  3MKQ A;  4HOQ A;  3FUF A;  3D9N A;  2OEV A;  2P9I G;  2OND A;  4JA7 A;  3PZD A;  4ANV A;  4U7E B;  4NIK A;  2LAH A;  2L0T B;  4GA0 A;  5JJ6 A;  4LUN U;  3B7T A;  5BXO A;  3V2O A;  4DI3 A;  4AEZ C;  4A63 B;  4N5Q A;  4FP7 A;  5G55 A;  4KVO A;  3ZYQ A;  2OV8 A;  1YYH A;  2A5U A;  1ELK A;  1Z3X A;  3ISM C;  2FEZ A;  2DIW A;  2DBA A;  4J8S A;  4KZ0 A;  2BKK B;  3RO2 A;  4DI4 A;  3CGH A;  3QJZ A;  4XEI G;  3LYA A;  4MLP A;  5ENT D;  3V2X A;  4NUR A;  3FTY A;  3UXG A;  3DSU A;  3AJI A;  4ACK A;  3CVU A;  2VGX B;  2WM9 A;  1K1A A;  5CBO A;  3LVQ E;  1X5B A;  3F6Q A;  2V4H C;  2ZU6 B;  5CER B;  2IY0 C;  1Q2Z A;  4DRX E;  5BV1 A;  4WND A;  3SZ7 A;  4B94 A;  3ZNG A;  3V79 K;  3FFL A;  4APF A;  3QWP A;  4JHJ A;  3J5P A;  1K1B A;  1Z6T A;  2YHC A;  5J90 A;  3KEZ A;  4KYO B;  2LNI A;  3L17 A;  5CRU A;  5FQ8 A;  2OCC E;  4WNF A;  5CMW A;  5AJL A;  5KNG A;  4IRU A;  5LX8 A;  1O1S A;  5FT9 A;  4L7T A;  1OUV A;  4U8V D;  4FC8 A;  2WMO A;  1TJC A;  3ZUV B;  1O5M A;  1H19 A;  2J8S D;  4LER A;  4I9E A;  5M72 A;  2PM7 A;  3S7B A;  5FQ4 A;  2KCL A;  2E0I A;  2KZT A;  2V5F A;  3CSF A;  2DVW A;  3ULE G;  4R7L A;  2X38 A;  2JEK A;  4YDY A;  3ASF A;  3W9F A;  1KLX A;  1EDU A;  1DCQ A;  5BT1 A;  4DX1 A;  2DYR E;  3FUD A;  4JC8 A;  3MA5 A;  3RRM B;  2KC7 A;  5CCL A;  2XPI A;  3TJP A;  2XEV A;  5EIB E;  1V54 E;  3U64 A;  1JUQ A;  2WVI A;  5AAO A;  4G2V A;  1FVH A;  3AS8 A;  4I17 A;  1N4P A;  4NQ0 A;  2CG3 A;  4U0S A;  5FIN A;  4HVB A;  1HU3 A;  1TYQ G;  4HOR A;  2Q7F A;  1DVP A;  3B7R L;  3KAE A;  3EHR A;  3QK0 A;  3DSX A;  5E75 A;  2QYU A;  4IUL A;  5DBK A;  4U8Y D;  2AVP A;  3ABK E;  4AY5 A;  4HQD A;  4I1A A;  3PZ3 A;  1HO8 A;  2L0I A;  2IEJ A;  3MYV A;  1JWF A;  2GRL A;  3UIO C;  3S7J A;  1PY1 A;  1TR4 A;  2Y4U A;  2AXV A;  3Q79 A;  3VTX A;  4K03 A;  4FUL A;  1S70 B;  4PUC A;  5BUZ A;  3FTZ A;  3UPV A;  3HRA A;  3ZYK A;  1NZN A;  4TXR A;  3JXI A;  4GZ3 A;  2DCP A;  2X6J A;  2QFC A;  1OWP A;  5EN5 D;  3KSQ A;  1FPP A;  5JA4 D;  3RJV A;  4GYY A;  3QKY A;  3CHM A;  4C0M A;  2XEE A;  3T9K A;  3BQO A;  3ULY A;  3L9T A;  3GZS A;  4XI9 A;  3MX3 A;  1QNF A;  1MX4 A;  2J08 A;  2GRP B;  4B8C B;  4WWO A;  2Y4T A;  3CQG B;  2ETA A;  3HVE A;  4UQY A;  3PZ4 A;  1U2V G;  3JYS A;  1ELR A;  3L13 A;  3FTU A;  4FHK A;  2OOE A;  2IOL A;  3IXE A;  2Y1L E;  4L9P A;  3ONL A;  3UT7 A;  2WXO A;  1A5E A;  4OAV B;  2EIJ E;  5EX3 A;  4CT4 A;  3ZVV A;  4U07 A;  3B95 A;  1TNY A;  5D66 A;  3E32 A;  4G8L A;  3TWW A;  2AW6 A;  1FT2 A;  5AQA A;  4FLH A;  2LSV A;  3FEY A;  2IF4 A;  3NF1 A;  1TN7 A;  2XCC A;  3SFY A;  5T4Y A;  5AYW D;  3LXU X;  3RO3 A;  2AJA A;  3ZEF A;  3HXE A;  2J9Q A;  5D0O D;  1OT8 A;  2I6H A;  3FTV A;  4J8F A;  4CGW A;  5A6C A;  5BXU A;  4MKT A;  4V3I A;  4HOU A;  1KZP A;  5ENO D;  3ZKJ A;  4O60 A;  3VLE A;  2L6J A;  5AIJ A;  3NAW A;  3PRE A;  1SZA A;  4FA6 A;  5E76 A;  3PNT B;  4P29 A;  4HRM B;  4GCN A;  4BWR A;  5IY5 E;  4FJY A;  2Y69 E;  3RU0 A;  3LY9 A;  2BTD A;  5BV0 A;  4BEP A;  5C1D A;  3ZHE A;  3I4R B;  1BI8 B;  3FDH A;  3AG3 E;  5FQ7 A;  3TXN A;  4XX5 A;  3D9J A;  5AQ9 A;  5G05 C;  4CCA A;  4G11 A;  4G23 A;  3ZYL A;  4A1G A;  3UQ3 A;  3O4Z A;  5CMY A;  3ZRH A;  2XPZ A;  2HO1 A;  2J49 A;  3UMV A;  1OXJ A;  2JLB A;  5FJY A;  1TNO A;  2CHW A;  2PL2 A;  3T5X A;  3RRN B;  4GZD A;  4U96 D;  3PEV B;  1IYG A;  3OXL A;  4F1P A;  1N4S A;  3E33 A;  2CFZ A;  3UKU G;  3DEP A;  2WXK A;  3C3Q A;  2VTB A;  4K5B A;  5ANL A;  3CIA A;  4F6R D;  5EYL A;  2F37 A;  3ASH A;  3PUK A;  2AXU A;  3ASN E;  4AP2 A;  2P58 C;  1BLX B;  2E2E A;  3CVL A;  3Q78 A;  3O48 A;  3UUX A;  3SY2 A;  3GZ2 A;  2IU1 A;  2Y3A A;  4GAA A;  3TWX A;  4LNU D;  3L16 A;  4DUI A;  2F0Y A;  3ONK A;  4ATG A;  2LXM A;  3U3W A;  4WUY A;  4ANW A;  5G05 J;  5KNH D;  3FUN A;  3FTS A;  4WAF A;  2QYJ A;  3CKC A;  3ESK A;  2QC9 A;  3PUJ A;  4B89 A;  3HIZ A;  3UIP C;  1E8X A;  2ZIS A;  3FUK A;  2WXJ A;  4BX9 A;  4K5A B;  1H6P A;  4U0Z A;  3NOG D;  4F7A A;  3GW4 A;  3ULQ A;  3FH7 A;  3D9L A;  1Z3Y A;  4HRL A;  4HBD A;  2MRI A;  4LNG A;  5EKQ D;  4RLY A;  4B8A A;  5FWQ A;  3E37 A;  4JPS A;  3DPD A;  1WG0 A;  3Q4A B;  4YVQ C;  4CYM D;  3ZPJ A;  3WXX A;  1DNP A;  3QAR A;  4LG6 A;  3APD A;  2J09 A;  1BD8 A;  3AS4 A;  3W9G A;  2A5E A;  1BI7 B;  4YND A;  4GB9 A;  2WXG A;  4I2W A;  1EPU A;  4HS2 A;  1UJJ A;  4I1O B;  5D2M C;  3RIB A;  3Q7F A;  2XCB A;  3EUV A;  2GRR B;  2RFA A;  3FTX A;  2OVB A;  3Q75 A;  4UQX A;  4GTO A;  3SI5 A;  1UJK A;  5T8I A;  3QDN A;  3HYM B;  3V31 A;  2GRQ B;  4G25 A;  4GU5 A;  4UI9 C;  2R05 A;  2IFU A;  4WNE A;  2J07 A;  1ZBP A;  3MJW A;  1S63 A;  4ATZ D;  3R9M A;  2PQN A;  3QAQ A;  2WQ6 A;  3U9W A;  4I43 A;  3JQ0 A;  3TWV A;  5ANR A;  4A1S A;  2CFU A;  1E7V A;  3ABL E;  3CK7 A;  4CEM A;  1E8Z A;  3BEE A;  2XQ0 A;  3UT8 A;  1NA3 A;  3S7D A;  4GML A;  1U3D A;  4CRW A;  3G2T A;  1E7U A;  2GW1 A;  2GGF A;  4UWH A;  1IHG A;  5JHA A;  4LCT A;  3CHR A;  3CHS A;  5AAR A;  3SBS A;  4RQI A;  3TG4 A;  5FQ6 A;  4A55 A;  3DPY A;  3EHN A;  4EHM A;  3CR3 A;  4FAD A;  2ION A;  2DYS E;  2LXL A;  2WPV A;  1UOH A;  5FZR A;  3JCK C;  4GTR A;  4QQI A;  3OAW A;  2KXP C;  4JEU A;  4JD2 G;  2WXM A;  4UI9 J;  2FUL A;  4ABN A;  1P5Q A;  2FI7 A;  5LCW J;  3NOC D;  1BU9 A;  4GTV A;  3ZN3 A;  2H6I A;  1WDY A;  3LEW A;  3TWT A;  3RSE G;  3HXC A;  1W3B A;  3FH5 A;  4YDO A;  1JPL A;  3LS8 A;  3OXF A;  2H6G A;  1OCO E;  1TJF A;  2XS1 A;  3C98 A;  4GPK A;  1H0A A;  1O1T A;  1HH8 A;  1DCE A;  4AY6 A;  4IN3 B;  2F8X K;  4NAC A;  3Q7A A;  1HE8 A;  5FZQ A;  4N5C A;  4DX6 D;  4Z68 A;  1TNB A;  3LY7 A;  1JWG A;  2VSN A;  2I1J A;  3ML8 A;  4J6I A;  4J8E A;  3MKQ B;  3ENE A;  3QC1 A;  1HG2 A;  1D8E A;  3D9H A;  2DZO A;  4U63 A;  2IJG X;  1IQR A;  2QZA A;  2XRY A;  2I1K A;  2KCK A;  1JCR A;  4BX8 A;  4J8D A;  1E8W A;  1SA5 A;  5CEC B;  4GTT A;  5A23 A;  2WXQ A;  5BPP A;  4L23 A;  3I5P A;  3SF4 A;  1SZ9 A;  3L82 A;  2BED A;  1TNZ A;  2HE0 A;  4N3B A;  3Q15 A;  3FHE A;  2NYJ A;  3FUI A;  5CED B;  3ASO E;  4GZ5 A;  3U66 A;  1D8D A;  4URK A;  3IHV A;  1LD7 A;  4N3C A;  2MHK A;  2IO2 C;  3DSS A;  4G8K A;  2XGM A;  3IEG A;  4XKC A;  2NSZ A;  2NC9 A;  3QWV A;  3DXM G;  2EIM E;  3UM2 A;  1AP7 A;  4HLL A;  4EZK A;  3B7U X;  2ETC A;  3TG5 A;  2XS8 A;  2KCV A;  1HF8 A;  3EHM A;  3CVW A;  3DXK G;  4KVM A;  4TUM A;  3CEQ A;  3G2S A;  3UM3 A;  3ESL A;  1Y8M A;  5JJ7 A;  4GYW A;  1WY6 A;  5D0Q D;  5FIO A;  1OCZ E;  4KXK B;  2WXP A;  4I6G A;  3UM1 A;  5EID A;  1TN6 A;  4N2S A;  2WXN A;  3EDT B;  4AV7 A;  3CK9 A;  4LSZ E;  5JHB A;  3SNX A;  4J0U A;  1MZC A;  2I2O A;  3JQ1 A;  5G2N A;  2J4D A;  4BSZ B;  3L08 A;  3FEX A;  3V30 A;  1N0R A;  2WQH A;  1UG3 A;  4ZFH A;  4AJW A;  4FU3 A;  3D9P A;  1TN8 A;  4U04 A;  3PDN A;  3CVN A;  4GA2 A;  4MRU A;  3FUL A;  3TWR A;  4F53 A;  1MYO A;  2ZGG A;  3TAX A;  3E4B A;  3IV0 A;  5HI7 A;  3PRZ A;  1OWL A;  5AQB A;  2C2L A;  4XKB A;  5JMN D;  4DK5 A;  1KT0 A;  2X6F A;  2WXI A;  5B1A E;  2OVF A;  3KS2 A;  1PC2 A;  4DLO A;  4JVS A;  1FCH A;  2LUH A;  1EYH A;  3IKO B;  5CRV A;  4PS7 A;  2VYI A;  3NBN B;  4MBG A;  2HM8 A;  3R7Q A;  1QZ2 A;  4HOT A;  1N4R A;  3BG0 B;  2PM6 A;  2GRM A;  4RG9 A;  4DX7 D;  3C3O A;  4I9C A;  2ETB A;  4UWK A;  4A3V A;  3Q9U C;  3CVY A;  1OWO A;  4JW1 A;  2XZD G;  3FTW A;  4LNB A;  2EIK E;  3NQP A;  2V8S E;  2HR2 A;  3SFZ A;  3T8K A;  4H7X A;  3FY4 A;  2VSX E;  4AOF A;  5EDS A;  1LF8 A;  3IHY A;  2R59 A;  3E34 A;  3UTM A;  3UM0 A;  2VGY A;  3EJN A;  4EEC A;  2F8Y A;  3APF A;  2WQ7 A;  2WB2 A;  5EYP F;  3Q5M A;  3KD7 A;  4EBA G;  2X6H A;  2R2L A;  1ELW A;  4D10 C;  2XPY A;  3E30 A;  4L1B A;  4U95 D;  5CCM A;  1AWC B;  3T8M A;  5AJD A;  2WMN A;  4B0Z A;  3T5V A;  4O1O A;  1Z5S C;  1BPO A;  5LP0 A;  2KAT A;  3CHQ A;  1NL4 A;  4U8H A;  3TXM A;  3BG1 B;  3MGB A;  4ILG A;  4I6E A;  5JJT A;  3C72 A;  1Y6I A;  5ARF A;  3CLJ A;  1IHB A;  3HVE B;  1B89 A;  2AWI A;  2WXF A;  4OVU A;  4CGV A;  3FH8 A;  1UW4 B;  5FZS A;  3JXJ A;  2P9S G;  2VGX A;  4PH4 B;  1N52 A;  1IXV A;  3L54 A;  3FUH A;  3D9O A;  4GMR A;  4TXP A;  1IQU A;  3I4G A;  2VJ8 A;  3QWW A;  4AIF A;  4K0R A; 
#chains in the Genus database with same CATH homology
 1LTX A;  3E37 A;  4YDE A;  3PZ3 A;  1N4S A;  3E33 A;  1TN6 A;  1D8E A;  2IEJ A;  3HXD A;  1TN7 A;  3SFY A;  3E34 A;  1JCR A;  4GTM A;  1X81 A;  3DST A;  1SA5 A;  1MZC A;  3Q79 A;  3HXE A;  4GTT A;  1SA4 A;  3Q73 A;  1JCQ A;  2R2L A;  3DPY A;  4EHM A;  1N94 A;  2BED A;  1TNZ A;  4GTQ A;  1S64 A;  3DRA A;  1TN8 A;  3EU5 A;  1KZP A;  1O1S A;  4GTR A;  2ZIR A;  1NI1 A;  3E30 A;  3HXB A;  3Q78 A;  1D8D A;  3KSQ A;  3PZ1 A;  1LD7 A;  3Q7F A;  1FPP A;  3EUV A;  3KSL A;  1O5M A;  1LD8 A;  3DSS A;  2F0Y A;  3Q75 A;  4GTO A;  4GTV A;  1N4Q A;  1NL4 A;  2H6I A;  1KZO A;  1FT1 A;  1JCS A;  1N95 A;  2H6F A;  3C72 A;  3HXC A;  3DSW A;  1N9A A;  4GTP A;  1QBQ A;  4YDO A;  1TNU A;  3SFX A;  2H6H A;  3DSU A;  2H6G A;  1S63 A;  3PZ4 A;  3PZ2 A;  1O1T A;  4GTS A;  4MBG A;  3DSV A;  2ZIS A;  1DCE A;  1N4R A;  3HXF A;  4L9P A;  1O1R A;  1N4P A;  3Q7A A;  1TNO A;  1TNB A;  1TNY A;  3E32 A;  3DSX A;  4LNB A;  1FT2 A;  4LNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...