1N9AA

Farnesyltransferase complex with tetrahydropyridine inhibitors
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
312
structure length
312
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aryl tetrahydropyridine inhibitors of farnesyltransferase: bioavailable analogues with improved cellular potency.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase alpha subunit
total genus 122
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n9aA00
3HXDA 1LTXA 1D8DA 1D8EA 1TNUA 2ZIRA 3EUVA 4GTQA 1LD8A 1DCEA 1JCSA 2R2LA 3Q73A 3E34A 1N95A 1X81A 2IEJA 1O1SA 1TNBA 1N4PA 4GTTA 1FT1A 4GTMA 3C72A 4GTOA 1KZOA 1TNYA 4YDOA 1TN8A 3PZ1A 3PZ4A 3Q75A 3SFXA 2ZISA 3PZ3A 4GTPA 2F0YA 3Q78A 1JCQA 1FT2A 3HXFA 1N94A 1N9AA 3DSWA 4GTVA 1SA5A 3Q7FA 4L9PA 1KZPA 1LD7A 2H6IA 3PZ2A 3HXCA 1O5MA 3KSLA 1TNZA 1SA4A 3DRAA 3DSXA 3HXEA 3HXBA 3SFYA 3E37A 2BEDA 1FPPA 3EU5A 1TN6A 1N4RA 3DSSA 4MBGA 2H6FA 4EHMA 1JCRA 3DSTA 1NI1A 1TNOA 1NL4A 1O1TA 4GTSA 4GTRA 2H6GA 3DPYA 3DSVA 3E33A 1O1RA 1MZCA 3E32A 1TN7A 3DSUA 4LNGA 3E30A 4LNBA 2H6HA 3Q7AA 3Q79A 3KSQA 1N4QA 1N4SA 1QBQA 1S63A 4YDEA 1S64A
chains in the Genus database with same CATH superfamily
4CGVA 5J08A 1E8WA 3EU9A 2WXHA 1DCEA 3IHYA 1JCSA 2LO6A 3Q73A 2B6CA 1WDYA 3ZHEB 3HIZA 4ANWA 3TWWA 3JCKC 1TNYA 2MOWA 3TL5A 2DWZA 2R02A 4U04A 3RAUA 1GW6A 2F0YA 4G1TA 1FVFA 3Q15A 3I4GA 1ELKA 4I2ZA 3CHSA 3VTXA 3CEQA 2AWIA 2P9NG 5T3RA 4F6RD 4GAAA 5EKQD 4XEIG 1OWMA 3HXEA 3QARA 4KBQA 2KXPC 4FADA 3V30A 4B94A 3ASDA 3UT7A 5JJ6A 2YINA 3GW4A 3KD7A 4UWKA 2IQCA 2P58C 2WVIA 2VJ8A 4JZYA 4AM9A 1XGWA 3SY2A 4CRWA 4BSZB 1NL4A 2CHXA 3ZFWA 3TJPA 1G3NB 4U95D 4I1MA 4L1BA 4AVXA 3FUJA 2KCVA 2WM9A 3QC1A 4LEUA 3BG0B 5CBNA 3PEVB 2BUGA 4XZ4A 3S7BA 4XI0A 1NZNA 2VYIA 2X3MA 2Y3AA 5AQ9A 4RLYA 3VTYA 1V55E 2VGYA 3LPZA 2IF4A 2OEWA 2V4HC 5EX0A 1IKND 4YDOA 4GCOA 3NOGD 4P29A 4E6HA 3PS6A 3Q78A 1HS6A 3UINC 1PY1A 3CHQA 2C0MA 5ENPD 4K5CA 4PDXA 2Y4TA 3ONLA 1AP7A 1MJ0A 3FTYA 4AV7A 1HXIA 3SD5A 3U4TA 4ILGA 4K5AB 2R59A 4J8SA 3VLDA 1E8ZA 3EU5A 4FJYA 3IXEA 2XPYA 1SVXA 1OXJA 3ULYA 3L13A 3T8KA 5KBAA 4AP2A 4NIKA 5H7PA 3T5VA 4G2VA 3QK0A 4JC8A 5FT9A 3SFZA 2KC7A 2AJAA 1JWGA 2YQ8A 4N39A 1BD8A 3FDHA 3CHRA 3ZIMA 3RO2A 1SZ9A 2MHKA 3PDNA 5ARGA 5AN8A 2CFZA 4YDWA 3MKRA 2I6HA 2WXNA 3V2XA 3FP3A 3RRMB 4CT4A 1PAQA 3B7UX 1TN8A 3J5QB 3KS2A 3T5XA 4I1AA 5LFAA 1IHGA 4HBDA 4WWNA 1JPLA 4UQYA 1N9AA 3C3QA 3DSWA 5D0OD 2X6KA 3SBSA 4XX5A 4FP7A 3HXCA 3EIQC 2XGMA 4TV3A 5LOZA 1WY6A 2AXZA 3FULA 2P9SG 4GZCA 1FPPA 5D66A 4HI9A 2WMOA 4MBGA 3MKQA 4XE0A 4XKCA 3UKUG 3ENEA 1YYHA 4GMJA 4QFVA 4I9EA 1IYGA 3G2WA 3IHVA 2HE0A 4C0MA 3E33A 3FWVA 1EYHA 4G26A 4TXPA 5ENRD 3ZU7B 3FTUA 5CRUA 2JABA 4HQDA 5JHBA 4MRUA 4YDEA 4U96D 3EHMA 3D9OA 3HXDA 2OEVA 3RO3A 3ZPJA 3Q4AB 3L22A 3B7SA 4EBAA 5FZQA 1W3BA 3EHQA 4CGWA 3URZA 3ZXPA 2AXVA 5BW8C 4ATZD 5LX8A 3E34A 2IEJA 1KT0A 5BV0A 2P9IG 4WNGA 5AENA 3FUNA 3FU5A 3FUDA 1Y6IA 5ANLA 3IEGA 1UN8A 4WNDA 1UG3A 2I1JA 1UJJA 4U63A 3LEWA 3C98A 4OYSA 3SBTB 1OCCE 1BI7B 4E85A 4HRLA 3R7RA 4GMRA 2V4LA 1SA4A 3ZXSA 3TWUA 3NB2A 2PQNA 2QY7A 4LNUD 1OCRE 3CVVA 3O48A 3ZYMA 4B89A 4EHMA 2WPVA 4N5CA 2ONDA 3ULEG 4WNFA 3AJIA 5C1DA 5LCWC 3ZYKA 4GA2A 4C48B 3QB2A 1O1TA 2QYJA 4JHKA 5C2YA 4LG6A 2NXPA 5G05J 3G2SA 5KJNA 4ZFHA 1N4SA 3G2VA 3RSEG 3PREA 1DNPA 5B1AE 4BSXA 1BI8B 1ELRA 4J8EA 3FH5A 2DVWA 1UJKA 5EYPF 1H6PA 3CK7A 3FFLA 5DIZA 1TNUA 2LUHA 4BWRA 2F8YA 3CLJA 1MQSA 2P2CP 2VSNA 1YCSB 5G2NA 2OVFA 1YA0A 4GMLA 4JEHA 4J8FA 3B13A 2IOLA 3BG1B 4AOFA 4ZHBA 1Q2ZA 4FULA 3HXFA 1SQMA 4L9PA 4GA0A 2XGOA 4CEMA 3KSLA 3PE3A 4ILIA 4J6IA 4APFA 5G04C 5KJKA 2WXFA 4HRMB 1N11A 4IULA 1UN9A 3LY8A 3PEUB 3ASOE 3AG2E 3V2OA 2Y69E 4G11A 4CT0A 2I1KA 3WG7E 3AS4A 4K0RA 3ZYLA 4JW1A 2WXPA 1OT8A 3DEPA 4CDNA 2PQRA 3D9HA 3OAWA 4I43A 2ZU6B 3C3OA 3Q9NC 1E7VA 2BKGA 3VLFA 2MRIA 1OWOA 4TUUA 3D9NA 3K9IA 2ZGGA 4OVVA 5ENTD 5A7DB 2KCKA 4Q69A 2LSUA 2JLBA 3I3NA 4HNAD 4FJZA 1OCOE 2R05A 3KAEA 5CCMA 1O1SA 3DWLG 4KYOB 5JJ7A 3PUKA 4F53A 4UWFA 1N4PA 4IYPA 1H6OA 3B7BA 4BTAA 3Q75A 3SFXA 3UI2A 1IHBA 5FZSA 3ZN3A 3GZSA 4PUCA 4GTVA 2WXLA 3UUXA 3PZDA 2C2LA 3OTNA 3UPVA 1VDYA 1TNZA 3DRAA 4O60A 2R17C 3HXBA 1SW6A 4J8DA 3RIBA 1N4RA 3DSSA 3HVEA 3ML9A 2ZXWE 1HZ4A 3KEAA 4ACLA 3L9TA 4BX8A 1JCRA 1TEZA 2ETBA 4MKTA 5AIJA 3E4BA 4WWOA 1QZ2A 2J08A 2KZTA 3FU3A 1HH8A 2OV8A 3MJWA 3UM1A 2F37A 4KXKB 4A3VA 2R03A 4DPRA 4G23A 1O1RA 3AG4E 4YVOA 3CVWA 4PH4B 3DSUA 4CDMA 3CSFA 3ASHA 2V5FA 4JHJA 3Q7AA 3QKYA 1AWCB 4U0ZA 3QAQA 3Q9UC 5KWDA 1LTXA 3FH7A 3FTVA 3UM3A 1D8EA 1ZBPA 5G55A 1V54E 4KMOA 4M3OA 2WQ6A 2C0LA 3FEYA 5ENOD 3IKOB 1P5QA 4JXTA 5EX3A 3D9MA 3U66A 1MX2A 4NQ0A 2HM8A 3D9PA 3APCA 4HS2A 3NOCD 1KZOA 4DRXE 3D9LA 5FIOA 3UX4A 5KCMA 3R9MA 5E75A 3DXMG 1JCQA 5EN5D 2V5QC 3PNLB 4JA7A 2RFMA 3C5RA 1NFIE 2IONA 1EPUA 2EIME 3FHEA 3U9WA 2XRYA 2WXGA 3UIOC 3E37A 3I4RB 1PC2A 5AJLA 1TN6A 3L08A 2V0PA 1QQEA 3ONKA 4C9BB 5D2MC 4GYYA 1NI1A 3SZ7A 4IRUA 2WXJA 4B0ZA 4OAVB 4OAUC 4A3TA 2DYSE 5BXUA 5J90A 2WB2A 5AQAA 5BNWA 1S63A 4UQXA 4JD2G 3SNXA 4TRQA 1WM5A 2FI7A 4L7TA 3UT4A 4GB9A 3ZRHA 2NC9A 2DZOA 4ACKA 5JHAA 2BTDA 3SHFA 1N95A 4HXIA 3S7JA 3QWWA 2L6BA 4HVBA 5CMYA 4A1SA 4DLOA 3PZ1A 4GZ5A 4FHJA 4XKBA 1HO8A 2RKKA 4DK5A 4Q96A 5FJYA 4N3AA 2LXMA 3G2TA 3T8MA 4HFGA 1IQRA 3FH8A 1FCHA 4I6GA 2CHWA 4NRHB 3HHMA 3TXMA 2JEKA 2BEDA 2WMNA 5CBOA 3HYMB 4I6EA 1A17A 5IY5E 4HORA 4BT8A 3QJZA 3ZEFA 2KM4A 3BQOA 3BEEA 3W9GA 2GRQB 4EZJA 4D10C 5FQ4A 4DX7D 3AU5A 3UMVA 5CERB 4OVUA 2KCLA 2E0IA 4I9CA 3GYZA 2A5UA 1HG2A 1INZA 1OWPA 3AU4A 3RU0A 4KZ0A 4LNGA 1E7UA 1H2VC 3E30A 4JHRA 4EPZA 1S64A 4HLLA 2XPZA 4G8LA 4ANVA 3NZSA 2M63A 2WXKA 4DX1A 3FTSA 4BTBA 3AG1E 1E8YA 3FUIA 2J4DA 3ASNE 3ASGA 4GTTA 3Q47B 3OXGA 4GTMA 3WXXA 5ENNA 5EILA 1YMPA 4Y6CA 5AYWD 5AAOA 4UI9J 3UM0A 2X6JA 1LD7A 3FU0A 2NYJA 3ZUVB 2L0TB 4W9RA 2J4BA 1Z3YA 3UT8A 3LXUX 2LSVA 3CHPA 3DEOA 3MCXA 1N52A 3L16A 3DPDA 1LF8A 5BUZA 4JA9A 2NSZA 4BERA 5DBKA 4ME2A 3T9KA 1MX6A 4O1OA 1TR4A 4BY6A 3IBEA 4GTRA 2PNNA 5KNGA 1K3ZD 4A55A 1DC2A 3ZNGA 3PH0C 4G8KA 3QOUA 2VSOE 3GZ1A 3UIPC 2Y1LE 2XCBA 4L23A 3V31A 5E76A 4B93B 3TWRA 4Y6WA 2WQHA 3CHOA 4G24A 4U8YD 4GU5A 3NBNB 4F1PA 4RQIA 4HI8A 4RVBA 4EECA 4JL0A 2AXUA 3APDA 2EIKE 3JXJA 3L17A 4GTOA 2VSYA 3PZ4A 5ANRA 2VGXB 2KZTB 4LCTA 2J9QA 2EINE 4AY5A 4WUYA 3MEKA 3RRUA 2X6HA 2IOSA 3FUEA 4EZLA 4AEZC 4V3IA 1K8KG 2H6IA 1H6KA 4CZ2D 2VGEA 1OWNA 3CGHA 2VGXA 1UW4B 1HFAA 3FU6A 5EDSA 4WAFA 3SFYA 2Y0BG 1H2UA 3HG0D 4N3BA 2IO2C 4HOSA 3DXKG 5G05C 5M72A 2XENA 3DBSA 2L9BA 5CHEE 1U3CA 2CG3A 4QQIA 1OUVA 5LCWJ 3QWVA 4HB5A 3MGBA 3OXLA 2EQXA 5EIDA 3CVQA 2P9PG 2PL2A 3NZUA 3HDXA 3CVLA 1N54A 2ETCA 3LKUA 3LJ3A 5EYLA 1S0PA 1TN7A 3MKQB 3R9AB 4LSZE 2GW1A 1E96B 3Q79A 3G2UA 3MV3B 3UQ3A 4APOA 2Y4UA 3TWSA 3CSTA 3UM2A 2RFAA 4MLPA 2BF0X 2IFUA 4U8VD 4AIFA 3JQ1A 2XEVA 4F3VA 3EHRA 3BU8A 3CIAA 4BT9A 2ZGDA 4HLEA 3OXFA 1U2VG 1H0AA 4UI9C 4K5BA 3ZHEA 1RZ4A 1HU3A 3ZVVA 2X6FA 3AAAC 2QYUA 4UUCA 4GTPA 2DZNA 3ABME 3SF4A 3FEXA 2P9UG 4LERA 4FU3A 2X6IA 1SA5A 3Q7FA 2I2OA 3SGHA 4AJWA 4KT6B 2FULA 3RK6A 4BETA 1OCZE 3C3RA 2LAHA 4GCNA 4TXRA 3FUFA 4YDYA 4L2LA 4ANXA 4BFRA 3JYSA 3JQ0A 2ILRA 4GYWA 4U0UA 4U8HA 4UWLA 3LY7A 3HRAA 5HRYA 4RSYA 4NACA 2DIWA 3QDNA 4GTSA 3S7DA 2KBXA 2QZAA 4TXQA 3DSVA 3R7QA 2IO3C 2J09A 2VQ2A 4A63B 5FWQA 2H6HA 3QNKA 5EIBE 2XZTG 5B1BE 3PRZA 4N2SA 4UQZA 1QYMA 2GRLA 1OWLA 4N5QA 4GTQA 1OY3D 2X38A 1Z6TA 1LD8A 2FO1E 1L5JA 3SQVA 2RD0A 1BPOA 1IXVA 1TNBA 2GRPB 2GRMA 1HF8A 3L82A 1EDUA 5FTPA 3CHMA 4O6FA 2IY0C 3B7RL 4DI3A 4HRNA 4WNEA 4A1GA 2UWJG 3PE4A 2DCPA 4ANUA 4J8YA 1N94A 1DVPA 5A6CA 4KVOA 1KT1A 2LXLA 5LP0A 1WG0A 1O5MA 5FQ8A 3DSXA 2QFCA 2RG8A 4GA1A 1B89A 2OOEA 4CCAA 4EBAG 2GROB 4EZKA 3GZ2A 5JJTA 1NA3A 1N0QA 1MYOA 5FINA 5CECB 2L6JA 3DSTA 3AS5A 5AJDA 4XI9A 4EQFA 2LNIA 2XEHA 1TJFA 3MA5A 4FC8A 4J7WA 4M7CA 5KJMA 3HVEB 1HX8A 3BUAA 2LAIA 2XZDG 1KLXA 2FBNA 3CKCA 4BESA 3CKBA 3JUEA 4YNDA 3FUMA 2GRRB 4G25A 3KSQA 5CRVA 5BXOA 3TG5A 5FZRA 4B8AA 3Q5MA 3MYVA 2XHEA 3APFA 2R5SA 1D8DA 4FLBA 4GZ6A 2L0IA 2VTBA 2ZIRA 3EUVA 4IN3B 5BPPA 5G04J 2FF4A 2AVPA 2XPIA 4H7YA 4CYMD 1ZB1A 2WXMA 3P2BA 3S7FA 1FT1A 1MHQA 3PUJA 2YHEA 3FUHA 2WXOA 1JWFA 1S70B 1N0RA 4DUIA 4U7EB 3TWTA 1KZPA 2XGSA 1KPSB 3CVUA 3VLEA 4RG9A 3NQPA 4ATGA 3TG4A 2A4ZA 3CV0A 2YHCA 5ARFA 3LCAA 5B3SE 1D9SA 5ENQD 3ZKJA 4B8CB 4WWPA 2PZIA 5FQ7A 2DYRE 1UOHA 3ESKA 4X8QA 1K1AA 1Y8MA 2BKKB 4FA6A 1IQUA 5JA4D 5CMWA 1TYQG 4LRZA 5KJLA 2KATA 3RJVA 4CDRA 3LVRE 2XS1A 4F7AA 2A5EA 3RKVA 1HG5A 4J0UA 4NURA 3KEZA 3ZGQA 4HOTA 1NP7A 4URKA 1TJCA 3NF1A 3UKRG 3FTXA 3ABLE 1X81A 4C0EA 4GYOA 2XS8A 1ZU2A 5CEAA 5HI7A 4PS3A 2XEEA 3D3MA 5ITZF 3C72A 3CQGB 3EIJA 4AXHA 5CCLA 3PZ3A 2P9LG 4JPSA 3JUIA 1QNFA 3CVYA 1E8XA 2IU1A 2IJGX 2PM7A 1A5EA 3PZ2A 4XIFA 3CR3A 3TAXA 1WAO1 2J49A 4DI4A 3NAWA 2VSXE 2XCCA 3JXIA 4JB8P 3FTWA 3MZLB 5AARA 3CK8A 2CHZA 2P9KG 1Z3XA 2DBAA 3V79K 3FUKA 4HOUA 5HS0A 1K1BA 3ABKE 2PM6A 4K03A 3LY9A 5ENSD 2GGFA 2WQ7A 4RG6A 1TNOA 3EJNA 3F6QA 3DPYA 4UI9K 1MZCA 4R7LA 2I9CA 2MYOA 4N3CA 1Z5SC 2V8SE 4I17A 3N71A 2F8XK 4L2YA 4UWHA 3ULQA 1QBQA 3B95A 2QC9A 4LUNU 3QWPA 4ILHB 1RW2A 3ML8A 3UTMA 4I1OB 2J07A 4PS7A 3LYAA 4KVMA 5AQ7A 1HE8A 1ELWA 2R2LA 2CFUA 3CVNA 4H7XA 5HQ8A 3CVPA 3SI5A 3D9JA 3P1UA 3ISMC 2UY1B 2UY1A 3LJNA 3X2QE 4DJAA 5D0QD 4ABNA 2HYZA 3TGOA 3O4ZA 2AW6A 3AG3E 5AQBA 3SO8A 4AY6A 3ASFA 5T4YA 3B7TA 4DX5D 2FEZA 2FO7A 3AS8A 3CVXA 4GZDA 3W9FA 3EDTB 3D9IA 2CG2A 5A23A 2XRZA 5JMND 3CK9A 5BT1A 3MV2B 1XNFA 4MS6A 4UWGA 1SZAA 3EHNA 5T8IA 4DX2A 1E90A 4JVSA 4O1PA 2VTBB 2H6GA 3L54A 3J5PA 3E32A 1DCQA 3TWXA 2WXRA 3ZYQA 2XQ0A 2OCCE 4LNBA 1N4QA 3S2AA 1EF1C 2HO1A 3IV0A 4GZ3A 4BEPA 1U3DA 2GRNB 3U64A 2B0OE 4DX6D 2EILE 5KNHD 4U0SA 4FHKA 1H19A 5CEDB 1NA0A 2OVBA 3MX3A 2WXIA 3ZW3A 3TWQA 2ZISA 2EIJE 3LS8A 1BLXB 3I5PA 4TUMA 4I2WA 1FT2A 2WXQA 4Z68A 3UXGA 4FLHA 1X5BA 4N2QA 1FVHA 2YNQA 3TXNA 5FQ6A 4YVQC 3ESLA 1MX4A 3CQCB 4GPMA 3LDZA 4F1SA 5BV1A 4JEUA 1H2TC 2E2EA 3TWVA 2ETAA 2Q7FA 2H6FA 3FY4A 3Q49B 1JUQA 5HKPA 4Q94A 3U3WA 3D9KA 3L6AA 4GPKA 4HOQA 3PNTB 4PS8A 3FTZA 3PVLA 1BU9A 2J8SD 4BX9A 3LVQE 4DLQA 4KZCA 4U07A 4I6JA 3RRNB 2HR2A
chains in the Genus database with same CATH topology
3HXDA 1LTXA 1D8DA 1D8EA 1TNUA 2ZIRA 3EUVA 4GTQA 1LD8A 1DCEA 1JCSA 2R2LA 3Q73A 3E34A 1N95A 1X81A 2IEJA 1O1SA 1TNBA 1N4PA 4GTTA 1FT1A 4GTMA 3C72A 4GTOA 1KZOA 1TNYA 4YDOA 1TN8A 3PZ1A 3PZ4A 3Q75A 3SFXA 2ZISA 3PZ3A 4GTPA 2F0YA 3Q78A 1JCQA 1FT2A 3HXFA 1N94A 1N9AA 3DSWA 4GTVA 1SA5A 3Q7FA 4L9PA 1KZPA 1LD7A 2H6IA 3PZ2A 3HXCA 1O5MA 3KSLA 1TNZA 1SA4A 3DRAA 3DSXA 3HXEA 3HXBA 3SFYA 3E37A 2BEDA 1FPPA 3EU5A 1TN6A 1N4RA 3DSSA 4MBGA 2H6FA 4EHMA 1JCRA 3DSTA 1NI1A 1TNOA 1NL4A 1O1TA 4GTSA 4GTRA 2H6GA 3DPYA 3DSVA 3E33A 1O1RA 1MZCA 3E32A 1TN7A 3DSUA 4LNGA 3E30A 4LNBA 2H6HA 3Q7AA 3Q79A 3KSQA 1N4QA 1N4SA 1QBQA 1S63A 4YDEA 1S64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXD A;  1LTX A;  1D8D A;  1D8E A;  1TNU A;  2ZIR A;  3EUV A;  4GTQ A;  1LD8 A;  1DCE A;  1JCS A;  2R2L A;  3Q73 A;  3E34 A;  1N95 A;  1X81 A;  2IEJ A;  1O1S A;  1TNB A;  1N4P A;  4GTT A;  1FT1 A;  4GTM A;  3C72 A;  4GTO A;  1KZO A;  1TNY A;  4YDO A;  1TN8 A;  3PZ1 A;  3PZ4 A;  3Q75 A;  3SFX A;  2ZIS A;  3PZ3 A;  4GTP A;  2F0Y A;  3Q78 A;  1JCQ A;  1FT2 A;  3HXF A;  1N94 A;  1N9A A;  3DSW A;  4GTV A;  1SA5 A;  3Q7F A;  4L9P A;  1KZP A;  1LD7 A;  2H6I A;  3PZ2 A;  3HXC A;  1O5M A;  3KSL A;  1TNZ A;  1SA4 A;  3DRA A;  3DSX A;  3HXE A;  3HXB A;  3SFY A;  3E37 A;  2BED A;  1FPP A;  3EU5 A;  1TN6 A;  1N4R A;  3DSS A;  4MBG A;  2H6F A;  4EHM A;  1JCR A;  3DST A;  1NI1 A;  1TNO A;  1NL4 A;  1O1T A;  4GTS A;  4GTR A;  2H6G A;  3DPY A;  3DSV A;  3E33 A;  1O1R A;  1MZC A;  3E32 A;  1TN7 A;  3DSU A;  4LNG A;  3E30 A;  4LNB A;  2H6H A;  3Q7A A;  3Q79 A;  3KSQ A;  1N4Q A;  1N4S A;  1QBQ A;  1S63 A;  4YDE A;  1S64 A; 
#chains in the Genus database with same CATH topology
 4CGV A;  5J08 A;  1E8W A;  3EU9 A;  2WXH A;  1DCE A;  3IHY A;  1JCS A;  2LO6 A;  3Q73 A;  2B6C A;  1WDY A;  3ZHE B;  3HIZ A;  4ANW A;  3TWW A;  3JCK C;  1TNY A;  2MOW A;  3TL5 A;  2DWZ A;  2R02 A;  4U04 A;  3RAU A;  1GW6 A;  2F0Y A;  4G1T A;  1FVF A;  3Q15 A;  3I4G A;  1ELK A;  4I2Z A;  3CHS A;  3VTX A;  3CEQ A;  2AWI A;  2P9N G;  5T3R A;  4F6R D;  4GAA A;  5EKQ D;  4XEI G;  1OWM A;  3HXE A;  3QAR A;  4KBQ A;  2KXP C;  4FAD A;  3V30 A;  4B94 A;  3ASD A;  3UT7 A;  5JJ6 A;  2YIN A;  3GW4 A;  3KD7 A;  4UWK A;  2IQC A;  2P58 C;  2WVI A;  2VJ8 A;  4JZY A;  4AM9 A;  1XGW A;  3SY2 A;  4CRW A;  4BSZ B;  1NL4 A;  2CHX A;  3ZFW A;  3TJP A;  1G3N B;  4U95 D;  4I1M A;  4L1B A;  4AVX A;  3FUJ A;  2KCV A;  2WM9 A;  3QC1 A;  4LEU A;  3BG0 B;  5CBN A;  3PEV B;  2BUG A;  4XZ4 A;  3S7B A;  4XI0 A;  1NZN A;  2VYI A;  2X3M A;  2Y3A A;  5AQ9 A;  4RLY A;  3VTY A;  1V55 E;  2VGY A;  3LPZ A;  2IF4 A;  2OEW A;  2V4H C;  5EX0 A;  1IKN D;  4YDO A;  4GCO A;  3NOG D;  4P29 A;  4E6H A;  3PS6 A;  3Q78 A;  1HS6 A;  3UIN C;  1PY1 A;  3CHQ A;  2C0M A;  5ENP D;  4K5C A;  4PDX A;  2Y4T A;  3ONL A;  1AP7 A;  1MJ0 A;  3FTY A;  4AV7 A;  1HXI A;  3SD5 A;  3U4T A;  4ILG A;  4K5A B;  2R59 A;  4J8S A;  3VLD A;  1E8Z A;  3EU5 A;  4FJY A;  3IXE A;  2XPY A;  1SVX A;  1OXJ A;  3ULY A;  3L13 A;  3T8K A;  5KBA A;  4AP2 A;  4NIK A;  5H7P A;  3T5V A;  4G2V A;  3QK0 A;  4JC8 A;  5FT9 A;  3SFZ A;  2KC7 A;  2AJA A;  1JWG A;  2YQ8 A;  4N39 A;  1BD8 A;  3FDH A;  3CHR A;  3ZIM A;  3RO2 A;  1SZ9 A;  2MHK A;  3PDN A;  5ARG A;  5AN8 A;  2CFZ A;  4YDW A;  3MKR A;  2I6H A;  2WXN A;  3V2X A;  3FP3 A;  3RRM B;  4CT4 A;  1PAQ A;  3B7U X;  1TN8 A;  3J5Q B;  3KS2 A;  3T5X A;  4I1A A;  5LFA A;  1IHG A;  4HBD A;  4WWN A;  1JPL A;  4UQY A;  1N9A A;  3C3Q A;  3DSW A;  5D0O D;  2X6K A;  3SBS A;  4XX5 A;  4FP7 A;  3HXC A;  3EIQ C;  2XGM A;  4TV3 A;  5LOZ A;  1WY6 A;  2AXZ A;  3FUL A;  2P9S G;  4GZC A;  1FPP A;  5D66 A;  4HI9 A;  2WMO A;  4MBG A;  3MKQ A;  4XE0 A;  4XKC A;  3UKU G;  3ENE A;  1YYH A;  4GMJ A;  4QFV A;  4I9E A;  1IYG A;  3G2W A;  3IHV A;  2HE0 A;  4C0M A;  3E33 A;  3FWV A;  1EYH A;  4G26 A;  4TXP A;  5ENR D;  3ZU7 B;  3FTU A;  5CRU A;  2JAB A;  4HQD A;  5JHB A;  4MRU A;  4YDE A;  4U96 D;  3EHM A;  3D9O A;  3HXD A;  2OEV A;  3RO3 A;  3ZPJ A;  3Q4A B;  3L22 A;  3B7S A;  4EBA A;  5FZQ A;  1W3B A;  3EHQ A;  4CGW A;  3URZ A;  3ZXP A;  2AXV A;  5BW8 C;  4ATZ D;  5LX8 A;  3E34 A;  2IEJ A;  1KT0 A;  5BV0 A;  2P9I G;  4WNG A;  5AEN A;  3FUN A;  3FU5 A;  3FUD A;  1Y6I A;  5ANL A;  3IEG A;  1UN8 A;  4WND A;  1UG3 A;  2I1J A;  1UJJ A;  4U63 A;  3LEW A;  3C98 A;  4OYS A;  3SBT B;  1OCC E;  1BI7 B;  4E85 A;  4HRL A;  3R7R A;  4GMR A;  2V4L A;  1SA4 A;  3ZXS A;  3TWU A;  3NB2 A;  2PQN A;  2QY7 A;  4LNU D;  1OCR E;  3CVV A;  3O48 A;  3ZYM A;  4B89 A;  4EHM A;  2WPV A;  4N5C A;  2OND A;  3ULE G;  4WNF A;  3AJI A;  5C1D A;  5LCW C;  3ZYK A;  4GA2 A;  4C48 B;  3QB2 A;  1O1T A;  2QYJ A;  4JHK A;  5C2Y A;  4LG6 A;  2NXP A;  5G05 J;  3G2S A;  5KJN A;  4ZFH A;  1N4S A;  3G2V A;  3RSE G;  3PRE A;  1DNP A;  5B1A E;  4BSX A;  1BI8 B;  1ELR A;  4J8E A;  3FH5 A;  2DVW A;  1UJK A;  5EYP F;  1H6P A;  3CK7 A;  3FFL A;  5DIZ A;  1TNU A;  2LUH A;  4BWR A;  2F8Y A;  3CLJ A;  1MQS A;  2P2C P;  2VSN A;  1YCS B;  5G2N A;  2OVF A;  1YA0 A;  4GML A;  4JEH A;  4J8F A;  3B13 A;  2IOL A;  3BG1 B;  4AOF A;  4ZHB A;  1Q2Z A;  4FUL A;  3HXF A;  1SQM A;  4L9P A;  4GA0 A;  2XGO A;  4CEM A;  3KSL A;  3PE3 A;  4ILI A;  4J6I A;  4APF A;  5G04 C;  5KJK A;  2WXF A;  4HRM B;  1N11 A;  4IUL A;  1UN9 A;  3LY8 A;  3PEU B;  3ASO E;  3AG2 E;  3V2O A;  2Y69 E;  4G11 A;  4CT0 A;  2I1K A;  3WG7 E;  3AS4 A;  4K0R A;  3ZYL A;  4JW1 A;  2WXP A;  1OT8 A;  3DEP A;  4CDN A;  2PQR A;  3D9H A;  3OAW A;  4I43 A;  2ZU6 B;  3C3O A;  3Q9N C;  1E7V A;  2BKG A;  3VLF A;  2MRI A;  1OWO A;  4TUU A;  3D9N A;  3K9I A;  2ZGG A;  4OVV A;  5ENT D;  5A7D B;  2KCK A;  4Q69 A;  2LSU A;  2JLB A;  3I3N A;  4HNA D;  4FJZ A;  1OCO E;  2R05 A;  3KAE A;  5CCM A;  1O1S A;  3DWL G;  4KYO B;  5JJ7 A;  3PUK A;  4F53 A;  4UWF A;  1N4P A;  4IYP A;  1H6O A;  3B7B A;  4BTA A;  3Q75 A;  3SFX A;  3UI2 A;  1IHB A;  5FZS A;  3ZN3 A;  3GZS A;  4PUC A;  4GTV A;  2WXL A;  3UUX A;  3PZD A;  2C2L A;  3OTN A;  3UPV A;  1VDY A;  1TNZ A;  3DRA A;  4O60 A;  2R17 C;  3HXB A;  1SW6 A;  4J8D A;  3RIB A;  1N4R A;  3DSS A;  3HVE A;  3ML9 A;  2ZXW E;  1HZ4 A;  3KEA A;  4ACL A;  3L9T A;  4BX8 A;  1JCR A;  1TEZ A;  2ETB A;  4MKT A;  5AIJ A;  3E4B A;  4WWO A;  1QZ2 A;  2J08 A;  2KZT A;  3FU3 A;  1HH8 A;  2OV8 A;  3MJW A;  3UM1 A;  2F37 A;  4KXK B;  4A3V A;  2R03 A;  4DPR A;  4G23 A;  1O1R A;  3AG4 E;  4YVO A;  3CVW A;  4PH4 B;  3DSU A;  4CDM A;  3CSF A;  3ASH A;  2V5F A;  4JHJ A;  3Q7A A;  3QKY A;  1AWC B;  4U0Z A;  3QAQ A;  3Q9U C;  5KWD A;  1LTX A;  3FH7 A;  3FTV A;  3UM3 A;  1D8E A;  1ZBP A;  5G55 A;  1V54 E;  4KMO A;  4M3O A;  2WQ6 A;  2C0L A;  3FEY A;  5ENO D;  3IKO B;  1P5Q A;  4JXT A;  5EX3 A;  3D9M A;  3U66 A;  1MX2 A;  4NQ0 A;  2HM8 A;  3D9P A;  3APC A;  4HS2 A;  3NOC D;  1KZO A;  4DRX E;  3D9L A;  5FIO A;  3UX4 A;  5KCM A;  3R9M A;  5E75 A;  3DXM G;  1JCQ A;  5EN5 D;  2V5Q C;  3PNL B;  4JA7 A;  2RFM A;  3C5R A;  1NFI E;  2ION A;  1EPU A;  2EIM E;  3FHE A;  3U9W A;  2XRY A;  2WXG A;  3UIO C;  3E37 A;  3I4R B;  1PC2 A;  5AJL A;  1TN6 A;  3L08 A;  2V0P A;  1QQE A;  3ONK A;  4C9B B;  5D2M C;  4GYY A;  1NI1 A;  3SZ7 A;  4IRU A;  2WXJ A;  4B0Z A;  4OAV B;  4OAU C;  4A3T A;  2DYS E;  5BXU A;  5J90 A;  2WB2 A;  5AQA A;  5BNW A;  1S63 A;  4UQX A;  4JD2 G;  3SNX A;  4TRQ A;  1WM5 A;  2FI7 A;  4L7T A;  3UT4 A;  4GB9 A;  3ZRH A;  2NC9 A;  2DZO A;  4ACK A;  5JHA A;  2BTD A;  3SHF A;  1N95 A;  4HXI A;  3S7J A;  3QWW A;  2L6B A;  4HVB A;  5CMY A;  4A1S A;  4DLO A;  3PZ1 A;  4GZ5 A;  4FHJ A;  4XKB A;  1HO8 A;  2RKK A;  4DK5 A;  4Q96 A;  5FJY A;  4N3A A;  2LXM A;  3G2T A;  3T8M A;  4HFG A;  1IQR A;  3FH8 A;  1FCH A;  4I6G A;  2CHW A;  4NRH B;  3HHM A;  3TXM A;  2JEK A;  2BED A;  2WMN A;  5CBO A;  3HYM B;  4I6E A;  1A17 A;  5IY5 E;  4HOR A;  4BT8 A;  3QJZ A;  3ZEF A;  2KM4 A;  3BQO A;  3BEE A;  3W9G A;  2GRQ B;  4EZJ A;  4D10 C;  5FQ4 A;  4DX7 D;  3AU5 A;  3UMV A;  5CER B;  4OVU A;  2KCL A;  2E0I A;  4I9C A;  3GYZ A;  2A5U A;  1HG2 A;  1INZ A;  1OWP A;  3AU4 A;  3RU0 A;  4KZ0 A;  4LNG A;  1E7U A;  1H2V C;  3E30 A;  4JHR A;  4EPZ A;  1S64 A;  4HLL A;  2XPZ A;  4G8L A;  4ANV A;  3NZS A;  2M63 A;  2WXK A;  4DX1 A;  3FTS A;  4BTB A;  3AG1 E;  1E8Y A;  3FUI A;  2J4D A;  3ASN E;  3ASG A;  4GTT A;  3Q47 B;  3OXG A;  4GTM A;  3WXX A;  5ENN A;  5EIL A;  1YMP A;  4Y6C A;  5AYW D;  5AAO A;  4UI9 J;  3UM0 A;  2X6J A;  1LD7 A;  3FU0 A;  2NYJ A;  3ZUV B;  2L0T B;  4W9R A;  2J4B A;  1Z3Y A;  3UT8 A;  3LXU X;  2LSV A;  3CHP A;  3DEO A;  3MCX A;  1N52 A;  3L16 A;  3DPD A;  1LF8 A;  5BUZ A;  4JA9 A;  2NSZ A;  4BER A;  5DBK A;  4ME2 A;  3T9K A;  1MX6 A;  4O1O A;  1TR4 A;  4BY6 A;  3IBE A;  4GTR A;  2PNN A;  5KNG A;  1K3Z D;  4A55 A;  1DC2 A;  3ZNG A;  3PH0 C;  4G8K A;  3QOU A;  2VSO E;  3GZ1 A;  3UIP C;  2Y1L E;  2XCB A;  4L23 A;  3V31 A;  5E76 A;  4B93 B;  3TWR A;  4Y6W A;  2WQH A;  3CHO A;  4G24 A;  4U8Y D;  4GU5 A;  3NBN B;  4F1P A;  4RQI A;  4HI8 A;  4RVB A;  4EEC A;  4JL0 A;  2AXU A;  3APD A;  2EIK E;  3JXJ A;  3L17 A;  4GTO A;  2VSY A;  3PZ4 A;  5ANR A;  2VGX B;  2KZT B;  4LCT A;  2J9Q A;  2EIN E;  4AY5 A;  4WUY A;  3MEK A;  3RRU A;  2X6H A;  2IOS A;  3FUE A;  4EZL A;  4AEZ C;  4V3I A;  1K8K G;  2H6I A;  1H6K A;  4CZ2 D;  2VGE A;  1OWN A;  3CGH A;  2VGX A;  1UW4 B;  1HFA A;  3FU6 A;  5EDS A;  4WAF A;  3SFY A;  2Y0B G;  1H2U A;  3HG0 D;  4N3B A;  2IO2 C;  4HOS A;  3DXK G;  5G05 C;  5M72 A;  2XEN A;  3DBS A;  2L9B A;  5CHE E;  1U3C A;  2CG3 A;  4QQI A;  1OUV A;  5LCW J;  3QWV A;  4HB5 A;  3MGB A;  3OXL A;  2EQX A;  5EID A;  3CVQ A;  2P9P G;  2PL2 A;  3NZU A;  3HDX A;  3CVL A;  1N54 A;  2ETC A;  3LKU A;  3LJ3 A;  5EYL A;  1S0P A;  1TN7 A;  3MKQ B;  3R9A B;  4LSZ E;  2GW1 A;  1E96 B;  3Q79 A;  3G2U A;  3MV3 B;  3UQ3 A;  4APO A;  2Y4U A;  3TWS A;  3CST A;  3UM2 A;  2RFA A;  4MLP A;  2BF0 X;  2IFU A;  4U8V D;  4AIF A;  3JQ1 A;  2XEV A;  4F3V A;  3EHR A;  3BU8 A;  3CIA A;  4BT9 A;  2ZGD A;  4HLE A;  3OXF A;  1U2V G;  1H0A A;  4UI9 C;  4K5B A;  3ZHE A;  1RZ4 A;  1HU3 A;  3ZVV A;  2X6F A;  3AAA C;  2QYU A;  4UUC A;  4GTP A;  2DZN A;  3ABM E;  3SF4 A;  3FEX A;  2P9U G;  4LER A;  4FU3 A;  2X6I A;  1SA5 A;  3Q7F A;  2I2O A;  3SGH A;  4AJW A;  4KT6 B;  2FUL A;  3RK6 A;  4BET A;  1OCZ E;  3C3R A;  2LAH A;  4GCN A;  4TXR A;  3FUF A;  4YDY A;  4L2L A;  4ANX A;  4BFR A;  3JYS A;  3JQ0 A;  2ILR A;  4GYW A;  4U0U A;  4U8H A;  4UWL A;  3LY7 A;  3HRA A;  5HRY A;  4RSY A;  4NAC A;  2DIW A;  3QDN A;  4GTS A;  3S7D A;  2KBX A;  2QZA A;  4TXQ A;  3DSV A;  3R7Q A;  2IO3 C;  2J09 A;  2VQ2 A;  4A63 B;  5FWQ A;  2H6H A;  3QNK A;  5EIB E;  2XZT G;  5B1B E;  3PRZ A;  4N2S A;  4UQZ A;  1QYM A;  2GRL A;  1OWL A;  4N5Q A;  4GTQ A;  1OY3 D;  2X38 A;  1Z6T A;  1LD8 A;  2FO1 E;  1L5J A;  3SQV A;  2RD0 A;  1BPO A;  1IXV A;  1TNB A;  2GRP B;  2GRM A;  1HF8 A;  3L82 A;  1EDU A;  5FTP A;  3CHM A;  4O6F A;  2IY0 C;  3B7R L;  4DI3 A;  4HRN A;  4WNE A;  4A1G A;  2UWJ G;  3PE4 A;  2DCP A;  4ANU A;  4J8Y A;  1N94 A;  1DVP A;  5A6C A;  4KVO A;  1KT1 A;  2LXL A;  5LP0 A;  1WG0 A;  1O5M A;  5FQ8 A;  3DSX A;  2QFC A;  2RG8 A;  4GA1 A;  1B89 A;  2OOE A;  4CCA A;  4EBA G;  2GRO B;  4EZK A;  3GZ2 A;  5JJT A;  1NA3 A;  1N0Q A;  1MYO A;  5FIN A;  5CEC B;  2L6J A;  3DST A;  3AS5 A;  5AJD A;  4XI9 A;  4EQF A;  2LNI A;  2XEH A;  1TJF A;  3MA5 A;  4FC8 A;  4J7W A;  4M7C A;  5KJM A;  3HVE B;  1HX8 A;  3BUA A;  2LAI A;  2XZD G;  1KLX A;  2FBN A;  3CKC A;  4BES A;  3CKB A;  3JUE A;  4YND A;  3FUM A;  2GRR B;  4G25 A;  3KSQ A;  5CRV A;  5BXO A;  3TG5 A;  5FZR A;  4B8A A;  3Q5M A;  3MYV A;  2XHE A;  3APF A;  2R5S A;  1D8D A;  4FLB A;  4GZ6 A;  2L0I A;  2VTB A;  2ZIR A;  3EUV A;  4IN3 B;  5BPP A;  5G04 J;  2FF4 A;  2AVP A;  2XPI A;  4H7Y A;  4CYM D;  1ZB1 A;  2WXM A;  3P2B A;  3S7F A;  1FT1 A;  1MHQ A;  3PUJ A;  2YHE A;  3FUH A;  2WXO A;  1JWF A;  1S70 B;  1N0R A;  4DUI A;  4U7E B;  3TWT A;  1KZP A;  2XGS A;  1KPS B;  3CVU A;  3VLE A;  4RG9 A;  3NQP A;  4ATG A;  3TG4 A;  2A4Z A;  3CV0 A;  2YHC A;  5ARF A;  3LCA A;  5B3S E;  1D9S A;  5ENQ D;  3ZKJ A;  4B8C B;  4WWP A;  2PZI A;  5FQ7 A;  2DYR E;  1UOH A;  3ESK A;  4X8Q A;  1K1A A;  1Y8M A;  2BKK B;  4FA6 A;  1IQU A;  5JA4 D;  5CMW A;  1TYQ G;  4LRZ A;  5KJL A;  2KAT A;  3RJV A;  4CDR A;  3LVR E;  2XS1 A;  4F7A A;  2A5E A;  3RKV A;  1HG5 A;  4J0U A;  4NUR A;  3KEZ A;  3ZGQ A;  4HOT A;  1NP7 A;  4URK A;  1TJC A;  3NF1 A;  3UKR G;  3FTX A;  3ABL E;  1X81 A;  4C0E A;  4GYO A;  2XS8 A;  1ZU2 A;  5CEA A;  5HI7 A;  4PS3 A;  2XEE A;  3D3M A;  5ITZ F;  3C72 A;  3CQG B;  3EIJ A;  4AXH A;  5CCL A;  3PZ3 A;  2P9L G;  4JPS A;  3JUI A;  1QNF A;  3CVY A;  1E8X A;  2IU1 A;  2IJG X;  2PM7 A;  1A5E A;  3PZ2 A;  4XIF A;  3CR3 A;  3TAX A;  1WAO 1;  2J49 A;  4DI4 A;  3NAW A;  2VSX E;  2XCC A;  3JXI A;  4JB8 P;  3FTW A;  3MZL B;  5AAR A;  3CK8 A;  2CHZ A;  2P9K G;  1Z3X A;  2DBA A;  3V79 K;  3FUK A;  4HOU A;  5HS0 A;  1K1B A;  3ABK E;  2PM6 A;  4K03 A;  3LY9 A;  5ENS D;  2GGF A;  2WQ7 A;  4RG6 A;  1TNO A;  3EJN A;  3F6Q A;  3DPY A;  4UI9 K;  1MZC A;  4R7L A;  2I9C A;  2MYO A;  4N3C A;  1Z5S C;  2V8S E;  4I17 A;  3N71 A;  2F8X K;  4L2Y A;  4UWH A;  3ULQ A;  1QBQ A;  3B95 A;  2QC9 A;  4LUN U;  3QWP A;  4ILH B;  1RW2 A;  3ML8 A;  3UTM A;  4I1O B;  2J07 A;  4PS7 A;  3LYA A;  4KVM A;  5AQ7 A;  1HE8 A;  1ELW A;  2R2L A;  2CFU A;  3CVN A;  4H7X A;  5HQ8 A;  3CVP A;  3SI5 A;  3D9J A;  3P1U A;  3ISM C;  2UY1 B;  2UY1 A;  3LJN A;  3X2Q E;  4DJA A;  5D0Q D;  4ABN A;  2HYZ A;  3TGO A;  3O4Z A;  2AW6 A;  3AG3 E;  5AQB A;  3SO8 A;  4AY6 A;  3ASF A;  5T4Y A;  3B7T A;  4DX5 D;  2FEZ A;  2FO7 A;  3AS8 A;  3CVX A;  4GZD A;  3W9F A;  3EDT B;  3D9I A;  2CG2 A;  5A23 A;  2XRZ A;  5JMN D;  3CK9 A;  5BT1 A;  3MV2 B;  1XNF A;  4MS6 A;  4UWG A;  1SZA A;  3EHN A;  5T8I A;  4DX2 A;  1E90 A;  4JVS A;  4O1P A;  2VTB B;  2H6G A;  3L54 A;  3J5P A;  3E32 A;  1DCQ A;  3TWX A;  2WXR A;  3ZYQ A;  2XQ0 A;  2OCC E;  4LNB A;  1N4Q A;  3S2A A;  1EF1 C;  2HO1 A;  3IV0 A;  4GZ3 A;  4BEP A;  1U3D A;  2GRN B;  3U64 A;  2B0O E;  4DX6 D;  2EIL E;  5KNH D;  4U0S A;  4FHK A;  1H19 A;  5CED B;  1NA0 A;  2OVB A;  3MX3 A;  2WXI A;  3ZW3 A;  3TWQ A;  2ZIS A;  2EIJ E;  3LS8 A;  1BLX B;  3I5P A;  4TUM A;  4I2W A;  1FT2 A;  2WXQ A;  4Z68 A;  3UXG A;  4FLH A;  1X5B A;  4N2Q A;  1FVH A;  2YNQ A;  3TXN A;  5FQ6 A;  4YVQ C;  3ESL A;  1MX4 A;  3CQC B;  4GPM A;  3LDZ A;  4F1S A;  5BV1 A;  4JEU A;  1H2T C;  2E2E A;  3TWV A;  2ETA A;  2Q7F A;  2H6F A;  3FY4 A;  3Q49 B;  1JUQ A;  5HKP A;  4Q94 A;  3U3W A;  3D9K A;  3L6A A;  4GPK A;  4HOQ A;  3PNT B;  4PS8 A;  3FTZ A;  3PVL A;  1BU9 A;  2J8S D;  4BX9 A;  3LVQ E;  4DLQ A;  4KZC A;  4U07 A;  4I6J A;  3RRN B;  2HR2 A; 
#chains in the Genus database with same CATH homology
 3HXD A;  1LTX A;  1D8D A;  1D8E A;  1TNU A;  2ZIR A;  3EUV A;  4GTQ A;  1LD8 A;  1DCE A;  1JCS A;  2R2L A;  3Q73 A;  3E34 A;  1N95 A;  1X81 A;  2IEJ A;  1O1S A;  1TNB A;  1N4P A;  4GTT A;  1FT1 A;  4GTM A;  3C72 A;  4GTO A;  1KZO A;  1TNY A;  4YDO A;  1TN8 A;  3PZ1 A;  3PZ4 A;  3Q75 A;  3SFX A;  2ZIS A;  3PZ3 A;  4GTP A;  2F0Y A;  3Q78 A;  1JCQ A;  1FT2 A;  3HXF A;  1N94 A;  1N9A A;  3DSW A;  4GTV A;  1SA5 A;  3Q7F A;  4L9P A;  1KZP A;  1LD7 A;  2H6I A;  3PZ2 A;  3HXC A;  1O5M A;  3KSL A;  1TNZ A;  1SA4 A;  3DRA A;  3DSX A;  3HXE A;  3HXB A;  3SFY A;  3E37 A;  2BED A;  1FPP A;  3EU5 A;  1TN6 A;  1N4R A;  3DSS A;  4MBG A;  2H6F A;  4EHM A;  1JCR A;  3DST A;  1NI1 A;  1TNO A;  1NL4 A;  1O1T A;  4GTS A;  4GTR A;  2H6G A;  3DPY A;  3DSV A;  3E33 A;  1O1R A;  1MZC A;  3E32 A;  1TN7 A;  3DSU A;  4LNG A;  3E30 A;  4LNB A;  2H6H A;  3Q7A A;  3Q79 A;  3KSQ A;  1N4Q A;  1N4S A;  1QBQ A;  1S63 A;  4YDE A;  1S64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...