1N9AA

Farnesyltransferase complex with tetrahydropyridine inhibitors
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
312
structure length
312
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aryl tetrahydropyridine inhibitors of farnesyltransferase: bioavailable analogues with improved cellular potency.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase alpha subunit
total genus 122
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n9aA00
1NI1A 1TNYA 2H6GA 3Q73A 4L9PA 2H6FA 1LD7A 1FT1A 1X81A 3DSXA 3HXFA 1N4QA 3E33A 3Q79A 3HXEA 2F0YA 1O1TA 2BEDA 1N4SA 3DPYA 4GTSA 3EUVA 3HXBA 4GTTA 3HXDA 4GTMA 3PZ4A 1QBQA 1KZOA 1N94A 3PZ2A 3DSSA 2H6HA 3PZ3A 2R2LA 4LNBA 1N9AA 3DSTA 4GTRA 1S64A 1LTXA 1N4PA 4LNGA 4GTVA 1N95A 3SFYA 2ZISA 3Q75A 1S63A 1FPPA 1SA5A 1O1RA 3DRAA 3EU5A 1TN7A 1TN6A 1O5MA 1TNBA 1TN8A 3HXCA 3KSQA 3DSWA 3E37A 3Q7FA 3C72A 3DSUA 1JCSA 3DSVA 1LD8A 1KZPA 4EHMA 3Q78A 4MBGA 1O1SA 3E32A 1JCQA 1TNZA 2H6IA 1MZCA 3E30A 1D8EA 3PZ1A 1FT2A 4GTPA 4YDOA 2ZIRA 1DCEA 1JCRA 1NL4A 1D8DA 3KSLA 4GTQA 1TNUA 2IEJA 3SFXA 1SA4A 1TNOA 3Q7AA 1N4RA 4YDEA 4GTOA 3E34A
chains in the Genus database with same CATH superfamily
4U0ZA 5JHBA 4FHJA 4BESA 3EHRA 3SI5A 1H2TC 1FT1A 4ME2A 1E7UA 4XI0A 2KCLA 4J8YA 5JJ6A 1QQEA 1O1TA 3PVLA 2XEVA 4TXQA 4AEZC 2B0OE 2WXMA 3AG2E 3AS8A 3PH0C 4GTRA 3V31A 4HRLA 1MQSA 1UJKA 2ZISA 3Q75A 4RQIA 4P29A 4HFGA 3ULQA 4LUNU 3ZYLA 3DRAA 3HRAA 3KS2A 5AQBA 1XGWA 4UQXA 3ZHEB 1BI8B 3NF1A 1HG5A 3VLDA 3PS6A 3PREA 2UY1A 1N54A 1UG3A 4BX8A 3G2TA 2DYRE 3DXKG 3FUFA 2VGYA 1H19A 4QQIA 4F7AA 4LRZA 4KVMA 2A5EA 5FZSA 3C3QA 2LUHA 2QFCA 3VTYA 5ENNA 3CV0A 3JUEA 3UMVA 1UJJA 4IYPA 4DLOA 3QK0A 5JA4D 4UWLA 1DC2A 4FADA 3MKRA 2YNQA 3UTMA 4EZKA 3UM2A 3Q5MA 4G8KA 5AENA 1W3BA 3GZ1A 3UIPC 5H7PA 2OVFA 2ZXWE 3CHMA 3IV0A 3ZW3A 4GZ3A 2M63A 4JL0A 3U64A 5FQ7A 3PZ2A 3PZ3A 3APDA 5BV1A 3S7FA 1B89A 4J8SA 1N95A 4U0UA 4EPZA 4TUUA 4U95D 2V4HC 1TNBA 2XEEA 2J9QA 1KPSB 2WXOA 3FTXA 2WM9A 3RIBA 1A17A 4Q94A 2BTDA 2QYUA 3DXMG 4OAVB 1FVFA 3BU8A 4J8DA 3MYVA 3URZA 3T9KA 1FT2A 1HE8A 3QJZA 2XGSA 1A5EA 1YMPA 4CGVA 2DIWA 2P9UG 3SO8A 1HH8A 2KCKA 1N4RA 3OXFA 2E2EA 3LPZA 3FUHA 1WM5A 1LD7A 4Y6WA 4CDNA 4N2SA 3ZEFA 4MRUA 5ENQD 2L6JA 2OEVA 4WWPA 1MJ0A 1QYMA 2F0YA 3U9WA 4UI9K 4J6IA 4CDRA 3FUDA 5BNWA 4ANWA 2XENA 4L2LA 2FEZA 3QWWA 2C0MA 3IXEA 1SVXA 2OV8A 3L22A 1LTXA 5ITZF 4GA0A 2FI7A 3DPDA 2WQ6A 1DNPA 2WXHA 2XHEA 1SA5A 3Q15A 2RG8A 2EIKE 5E76A 4DX7D 4DUIA 2WQHA 3T8MA 3B7TA 3I5PA 3UINC 3CVWA 4EBAA 2YQ8A 2VGEA 4I2WA 3L13A 3MZLB 2RD0A 3GZ2A 3FTSA 4B93B 2KC7A 5FIOA 5KJLA 1E7VA 5EILA 4JC8A 2KZTB 3CK8A 3CHRA 3VLEA 3T8KA 4N3CA 4U04A 2IFUA 3TWVA 3LXUX 5FJYA 3ONKA 5FT9A 2Y1LE 1BPOA 5T4YA 1XNFA 4C0EA 3S2AA 5B1AE 3B13A 4WNGA 3Q79A 3FP3A 2RFAA 2HO1A 2WVIA 2FBNA 4AVXA 4AIFA 5J08A 5CEAA 2LAIA 3DSSA 3E4BA 4BERA 3LJ3A 3WXXA 2FULA 4TXPA 1N4PA 5CMYA 3QDNA 4ANUA 2ZU6B 4MS6A 1BU9A 3BEEA 2IONA 1Z6TA 4UWFA 2EIJE 3ULEG 1HO8A 1P5QA 2WXFA 3BQOA 3DSVA 1SZAA 3OXGA 2Q7FA 3NB2A 3LDZA 3RJVA 3ABKE 1HFAA 4XI9A 5ANRA 4B0ZA 4Q69A 5LCWC 2KBXA 5CRVA 4DPRA 4WNDA 4U07A 2F8XK 3TWTA 3ESKA 1Z5SC 2FO1E 5KNHD 2VSOE 1WY6A 1HXIA 4PUCA 5EX0A 3SY2A 4G24A 5G55A 1UOHA 2WPVA 1EF1C 2P9SG 5D66A 3HYMB 4CYMD 4I6EA 4XKBA 1TNOA 4JPSA 1OWNA 1TEZA 4M7CA 1MYOA 4GPMA 2XS1A 2DZOA 4FU3A 4I9CA 3IBEA 3CVXA 4JXTA 3C3RA 2GRMA 4WNEA 3MCXA 1V55E 3B95A 5CBOA 2P58C 4K0RA 3CLJA 3GW4A 4HORA 2LSUA 5FTPA 3CVQA 1HF8A 2J08A 2H6HA 2XCBA 4BX9A 3APFA 4I9EA 2HYZA 4XX5A 4PS8A 2AXUA 3FWVA 4CT4A 5C1DA 3L54A 4JA9A 3EDTB 1N52A 5CCMA 2XZDG 1INZA 4BTAA 3L17A 5G2NA 1H6KA 3W9FA 3I4GA 3LY7A 4NQ0A 1OWPA 4Q96A 4A1SA 4F3VA 1OWMA 3DEOA 2H6IA 4HBDA 4GMRA 1MX4A 4GB9A 4HQDA 4BSZB 5ANLA 2J49A 3PE4A 4GZCA 1NZNA 4F6RD 3CEQA 5KJNA 2X6HA 4U96D 2JLBA 1HZ4A 2OEWA 3B7UX 4ATZD 3E34A 3HIZA 1TNYA 3P2BA 4XIFA 1DCQA 2P9LG 4H7XA 1TR4A 2J4BA 4GZ6A 1S0PA 4GZ5A 3HXEA 5CCLA 3NOGD 4KYOB 1N4SA 3BUAA 2IQCA 3DPYA 2LAHA 4L2YA 3S7BA 1IXVA 3HXDA 1SZ9A 2MYOA 3ML8A 3QC1A 4ILHB 1IHBA 3CKCA 1BLXB 2R02A 2LO6A 3MKQB 3APCA 5HI7A 4UQYA 3RK6A 3ZYKA 1YYHA 2I6HA 2CFUA 1JWGA 3V30A 3Q7FA 2BKKB 3C72A 3UKRG 4RG9A 1KZPA 3D9HA 4K5AB 5LOZA 4A3TA 4HOTA 5AYWD 2XPIA 1H6PA 2PNNA 4N5CA 3NOCD 2GRQB 2MRIA 4G23A 2IO3C 2VTBB 3BG0B 3R9MA 3TGOA 1E96B 2NSZA 2WXJA 3ONLA 3RO3A 1Y8MA 3VTXA 2YHCA 3ABLE 4UWGA 4U63A 4K5BA 3FEXA 2VSNA 3Q9NC 4H7YA 3G2WA 1X81A 2V4LA 5AQ9A 5LX8A 3PRZA 2PZIA 4EZJA 1L5JA 1OWLA 4J8FA 4GTSA 4I6JA 3L82A 4TV3A 4N39A 3QAQA 4HVBA 4YVOA 3U66A 1NA0A 2RFMA 3ZNGA 2EINE 5AQ7A 4WWOA 5CHEE 3LYAA 4FULA 2V0PA 1H6OA 5EIDA 1E8YA 4I2ZA 2QC9A 4JVSA 2PL2A 3HXCA 2L6BA 4JW1A 3EU9A 4GYOA 5KWDA 5ENSD 4URKA 5HQ8A 2IF4A 2VJ8A 3FUNA 1OCCE 2WXPA 5FWQA 3QWPA 1Q2ZA 3SHFA 3TXMA 3E30A 4FA6A 2HM8A 4L23A 2A5UA 5JJTA 2V8SE 3ASNE 3FDHA 2WXGA 1ZB1A 3D9IA 4I43A 3O4ZA 4GMJA 3MV2B 2EIME 4YDEA 3LJNA 4NRHB 4UI9C 1YA0A 3PNTB 2NYJA 3DBSA 3TXNA 4L9PA 3SD5A 4N3BA 5ENPD 4JEUA 2XS8A 4N5QA 4Y6CA 4KBQA 3SBTB 4J8EA 4B8CB 4A55A 5CEDB 4KZCA 3PDNA 3MEKA 4F1SA 5HS0A 2AW6A 3LY8A 1N94A 3TG5A 4AY5A 4AM9A 3SQVA 3QNKA 3ZXSA 4K5CA 1PY1A 2DZNA 1IQUA 1ELWA 1TN6A 1D9SA 3CR3A 2IY0C 5BXUA 1FCHA 4DX2A 2CHWA 3KSQA 2C2LA 4LG6A 4HRMB 2MHKA 4DJAA 4CEMA 2YHEA 2JABA 3FUIA 5AJDA 3CQGB 3ASFA 2P9PG 2I1JA 3D9LA 1BI7B 4NACA 3EHQA 5KNGA 5C2YA 3AU5A 3UT7A 4DI4A 3ASHA 3ZGQA 1D8DA 3AG1E 3L16A 3PEVB 4APOA 1LF8A 3V2OA 2ZGDA 3FTUA 4BEPA 1VDYA 3UX4A 2IOSA 2R03A 2V5QC 2KM4A 3Q73A 3MKQA 4HLEA 3FFLA 3UPVA 3FU5A 3FUMA 4KXKB 2AVPA 3CQCB 3D9JA 3CSFA 3Q4AB 5JJ7A 2Y69E 2BEDA 4N2QA 3TWXA 4GPKA 3HXBA 2GRPB 3LCAA 2IJGX 3JQ0A 4GTTA 3KAEA 5AJLA 3ZKJA 4J0UA 4K03A 1NP7A 4U8YD 2FF4A 4HXIA 3CVLA 5G05C 3KD7A 2I2OA 3I3NA 4F53A 2QZAA 2R05A 3CGHA 5M72A 3HVEB 2C0LA 2CFZA 4L1BA 1ZU2A 3AG3E 4N3AA 4G11A 3K9IA 4BSXA 3TJPA 4JD2G 3ISMC 3C5RA 4FHKA 3CHPA 1LD8A 3P1UA 3CVYA 3OTNA 4B8AA 2IOLA 3UIOC 2VYIA 3ASGA 2NXPA 3D9KA 3PUJA 2LXLA 5EDSA 3BG1B 4M3OA 1EPUA 2GRLA 4LERA 4DX5D 4ILGA 2WMOA 2LSVA 3QARA 1H2VC 4A63B 1SW6A 1SA4A 4O60A 2MOWA 2ETCA 4GTOA 1V54E 3UM3A 4O6FA 1NI1A 1FVHA 1K1BA 3SFZA 4HI8A 3FEYA 5G05J 4R7LA 3DSXA 3IEGA 3MA5A 4I1MA 2WXIA 5BT1A 4J7WA 2OCCE 1ELKA 1K1AA 3RSEG 2WQ7A 5G04C 2GRNB 3LS8A 2DVWA 4LNBA 4UI9J 4C9BB 4OVVA 3AJIA 3AU4A 5BW8C 2XPYA 3NQPA 3PEUB 3JXIA 3IHYA 1K8KG 1S63A 5B1BE 3JYSA 3TG4A 5EIBE 2J07A 4WWNA 1UW4B 1K3ZD 4UWKA 1EDUA 1JCSA 4HNAD 4MLPA 4EHMA 3JXJA 3E32A 4LCTA 3R7QA 2AJAA 3ASOE 3IHVA 3RAUA 3LY9A 4BWRA 2J4DA 1S70B 4NURA 4PS7A 3LVRE 4HLLA 3IKOB 5ARFA 1RZ4A 4HS2A 2J09A 1TNUA 4GCOA 3TWUA 3UM1A 2B6CA 5FQ4A 3FH5A 4OVUA 4CRWA 5EYPF 3CHOA 2X38A 1ZBPA 4A3VA 3PZDA 4IN3B 4X8QA 2GW1A 4ANXA 2ETAA 4I17A 4CCAA 3MGBA 3AG4E 4HB5A 4JZYA 4FP7A 3EUVA 3RRUA 4FC8A 1OXJA 1N0RA 4JHKA 3PZ4A 3CHQA 1KZOA 2I1KA 4V3IA 3ZXPA 1Z3YA 4E6HA 1QZ2A 5D0OD 3SGHA 3SNXA 2UY1B 4YNDA 4ZFHA 3QKYA 4GCNA 1OT8A 1DVPA 2X6KA 3ZHEA 5BPPA 4JHJA 2BKGA 3RRMB 4EQFA 3QOUA 4ZHBA 3WG7E 4ABNA 5E75A 1Z3XA 1WAO1 2ETBA 1SQMA 3FUEA 4HI9A 2VTBA 3FUJA 1JCQA 2IU1A 4GU5A 4U0SA 4ACLA 1E8WA 4B89A 5D0QD 1DCEA 4ANVA 3OAWA 2DWZA 1Y6IA 2XZTG 2Y4TA 3HVEA 3D9NA 5DBKA 4APFA 1U3CA 2FO7A 3CVNA 1HS6A 1MX2A 2HE0A 4G8LA 2KXPC 2JEKA 4JB8P 2Y3AA 1BD8A 4LEUA 3U4TA 4FJZA 2XRZA 3ENEA 1UN9A 2P9KG 1N4QA 3G2UA 4U8VD 3R7RA 2KCVA 3CVPA 4DRXE 1X5BA 2PQNA 2LXMA 4U7EB 4ILIA 4TRQA 3R9AB 4AXHA 1HG2A 4HOQA 3UM0A 1N9AA 3C3OA 2WXRA 3QB2A 3FTYA 2P2CP 3SFYA 5AN8A 2HR2A 5FZQA 1OCZE 3ULYA 5D2MC 1ELRA 4XEIG 3Q47B 2J8SD 4HOSA 2E0IA 4CT0A 1TN8A 1IQRA 3DSUA 3ZFWA 3CIAA 5AAOA 5CBNA 3J5PA 3F6QA 4DLQA 1O1SA 1OCRE 3FH7A 1MX6A 2ZGGA 5LCWJ 3RRNB 1TNZA 3L6AA 1TYQG 3ESLA 4GTPA 3Q9UC 3Q49B 1KLXA 2GGFA 3T5VA 3SFXA 4C0MA 3SZ7A 3FTVA 3ZVVA 2CG3A 4L7TA 2WXKA 3GYZA 2XGMA 2H6FA 1KT0A 2DBAA 4U8HA 4KMOA 4G26A 5A23A 2WXNA 2XRYA 2P9IG 2AWIA 2XCCA 4DI3A 2P9NG 2F8YA 3EIQC 5JHAA 4GTMA 3C98A 5A6CA 4C48B 3T5XA 3B7BA 4GA1A 5AIJA 5BUZA 5CECB 4O1PA 3JQ1A 3FU6A 5EYLA 4GTVA 5ENRD 4GZDA 4W9RA 4MKTA 3MJWA 1AWCB 1PC2A 1OY3D 3EU5A 3LKUA 5EN5D 2Y4UA 3FHEA 4FLBA 4KVOA 3TWRA 3ZPJA 3DEPA 5FZRA 3ZRHA 4I1AA 3D3MA 3ZN3A 2KATA 1KT1A 3LVQE 5T8IA 5CERB 1RW2A 3UI2A 3AAAC 4BTBA 3GZSA 4YDOA 3J5QB 2LNIA 2I9CA 2UWJG 1AP7A 3KSLA 4KT6B 4GTQA 3CKBA 1H2UA 2R5SA 5FQ8A 3CK9A 2AXZA 5ENOD 3FU0A 4XKCA 2CHXA 1WG0A 1NA3A 3LEWA 4LNUD 1HU3A 4NIKA 4CDMA 4RG6A 2CG2A 3EJNA 2X6FA 3E33A 4XE0A 4UQZA 2QY7A 5T3RA 5CRUA 3FY4A 4AOFA 1WDYA 4LSZE 3RU0A 3TWSA 3DWLG 1QBQA 3FULA 4EZLA 4JHRA 5AQAA 4GYYA 4F1PA 5KCMA 3UUXA 4FLHA 5A7DB 4AY6A 1S64A 3JUIA 2OVBA 4LNGA 5EX3A 3ABME 3FUKA 4GMLA 4RSYA 4CGWA 5LP0A 1FPPA 3I4RB 4WUYA 4GA2A 3O48A 3X2QE 4DX1A 1JPLA 2VQ2A 3V2XA 1N11A 2QYJA 4I1OB 3HG0D 3Q78A 3ZYQA 4I6GA 5BXOA 3RO2A 4QFVA 3NAWA 2ONDA 3ZIMA 3NZUA 2EILE 2X3MA 2Y0BG 4AJWA 3CK7A 1D8EA 2ZIRA 1IYGA 3KEZA 1JCRA 2R59A 1NL4A 1PAQA 3FTWA 4FJYA 5LFAA 4HRNA 3PUKA 2YINA 1E8ZA 1MHQA 3CVUA 4B94A 2DCPA 3EHMA 1NFIE 4CZ2D 4ATGA 4G25A 4GYWA 4G1TA 5EKQD 4PH4B 4OAUC 2PM6A 2WXQA 2BF0X 1QNFA 5AARA 3ZU7B 3U3WA 3UQ3A 3ZYMA 3CHSA 3HXFA 3FU3A 2XQ0A 2DYSE 4IRUA 2IO2C 2XGOA 2CHZA 1H0AA 4RVBA 1UN8A 4GAAA 4JA7A 5JMND 3AS5A 3CVVA 3NBNB 2L0IA 2L0TB 5FINA 2R2LA 2EQXA 5HKPA 5KBAA 4BY6A 1E90A 4PS3A 4DX6D 5KJKA 1JWFA 3QWVA 4OYSA 4AV7A 1O1RA 1TN7A 4BT9A 3CSTA 4UUCA 1O5MA 4PDXA 5KJMA 2WB2A 3G2VA 3S7JA 1U3DA 3V79K 3UT4A 4G2VA 3MV3B 3D9MA 3N71A 1MZCA 4D10C 3TWQA 3PZ1A 5G04J 4TUMA 4EECA 2X6IA 1TJCA 2R17C 4DK5A 4ACKA 2IEJA 4A1GA 4BFRA 5HRYA 4XZ4A 3ML9A 4YDWA 3JCKC 3OXLA 4RLYA 1OUVA 2H6GA 1YCSB 3UT8A 2F37A 1N0QA 3PNLB 1JUQA 3KEAA 3SBSA 2RKKA 3EIJA 3UXGA 5BV0A 1OCOE 2BUGA 3MX3A 5J90A 2XEHA 4YDYA 2KZTA 2WXLA 3ASDA 5CMWA 2AXVA 4IULA 4UWHA 5FQ6A 3B7RL 1HX8A 2L9BA 3TL5A 2NC9A 1E8XA 2XPZA 3DSTA 4EBAG 4JEHA 3SF4A 1OWOA 2VGXA 2VSYA 2GROB 3HDXA 4BETA 4TXRA 3VLFA 3W9GA 2V5FA 2X6JA 2PQRA 1IHGA 1G3NB 5ARGA 1TJFA 1U2VG 3UKUG 3FTZA 4Z68A 3DSWA 5IY5E 3TAXA 3E37A 3S7DA 3PE3A 3FH8A 4KZ0A 1GW6A 3ZUVB 3L08A 4HOUA 4MBGA 2A4ZA 2VGXB 3L9TA 5DIZA 1IKND 4YVQC 3TWWA 3RKVA 2PM7A 2GRRB 1EYHA 3EHNA 4AP2A 5B3SE 3HHMA 3D9PA 2OOEA 4WAFA 4WNFA 4E85A 3AS4A 4BT8A 3G2SA 3Q7AA 4O1OA 2VSXE 3D9OA 3NZSA 3B7SA 5ENTD 2WMNA 2ILRA
chains in the Genus database with same CATH topology
1NI1A 1TNYA 2H6GA 3Q73A 4L9PA 2H6FA 1LD7A 1FT1A 1X81A 3DSXA 3HXFA 1N4QA 3E33A 3Q79A 3HXEA 2F0YA 1O1TA 2BEDA 1N4SA 3DPYA 4GTSA 3EUVA 3HXBA 4GTTA 3HXDA 4GTMA 3PZ4A 1QBQA 1KZOA 1N94A 3PZ2A 3DSSA 2H6HA 3PZ3A 2R2LA 4LNBA 1N9AA 3DSTA 4GTRA 1S64A 1LTXA 1N4PA 4LNGA 4GTVA 1N95A 3SFYA 2ZISA 3Q75A 1S63A 1FPPA 1SA5A 1O1RA 3DRAA 3EU5A 1TN7A 1TN6A 1O5MA 1TNBA 1TN8A 3HXCA 3KSQA 3DSWA 3E37A 3Q7FA 3C72A 3DSUA 1JCSA 3DSVA 1LD8A 1KZPA 4EHMA 3Q78A 4MBGA 1O1SA 3E32A 1JCQA 1TNZA 2H6IA 1MZCA 3E30A 1D8EA 3PZ1A 1FT2A 4GTPA 4YDOA 2ZIRA 1DCEA 1JCRA 1NL4A 1D8DA 3KSLA 4GTQA 1TNUA 2IEJA 3SFXA 1SA4A 1TNOA 3Q7AA 1N4RA 4YDEA 4GTOA 3E34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI1 A;  1TNY A;  2H6G A;  3Q73 A;  4L9P A;  2H6F A;  1LD7 A;  1FT1 A;  1X81 A;  3DSX A;  3HXF A;  1N4Q A;  3E33 A;  3Q79 A;  3HXE A;  2F0Y A;  1O1T A;  2BED A;  1N4S A;  3DPY A;  4GTS A;  3EUV A;  3HXB A;  4GTT A;  3HXD A;  4GTM A;  3PZ4 A;  1QBQ A;  1KZO A;  1N94 A;  3PZ2 A;  3DSS A;  2H6H A;  3PZ3 A;  2R2L A;  4LNB A;  1N9A A;  3DST A;  4GTR A;  1S64 A;  1LTX A;  1N4P A;  4LNG A;  4GTV A;  1N95 A;  3SFY A;  2ZIS A;  3Q75 A;  1S63 A;  1FPP A;  1SA5 A;  1O1R A;  3DRA A;  3EU5 A;  1TN7 A;  1TN6 A;  1O5M A;  1TNB A;  1TN8 A;  3HXC A;  3KSQ A;  3DSW A;  3E37 A;  3Q7F A;  3C72 A;  3DSU A;  1JCS A;  3DSV A;  1LD8 A;  1KZP A;  4EHM A;  3Q78 A;  4MBG A;  1O1S A;  3E32 A;  1JCQ A;  1TNZ A;  2H6I A;  1MZC A;  3E30 A;  1D8E A;  3PZ1 A;  1FT2 A;  4GTP A;  4YDO A;  2ZIR A;  1DCE A;  1JCR A;  1NL4 A;  1D8D A;  3KSL A;  4GTQ A;  1TNU A;  2IEJ A;  3SFX A;  1SA4 A;  1TNO A;  3Q7A A;  1N4R A;  4YDE A;  4GTO A;  3E34 A; 
#chains in the Genus database with same CATH topology
 4U0Z A;  5JHB A;  4FHJ A;  4BES A;  3EHR A;  3SI5 A;  1H2T C;  1FT1 A;  4ME2 A;  1E7U A;  4XI0 A;  2KCL A;  4J8Y A;  5JJ6 A;  1QQE A;  1O1T A;  3PVL A;  2XEV A;  4TXQ A;  4AEZ C;  2B0O E;  2WXM A;  3AG2 E;  3AS8 A;  3PH0 C;  4GTR A;  3V31 A;  4HRL A;  1MQS A;  1UJK A;  2ZIS A;  3Q75 A;  4RQI A;  4P29 A;  4HFG A;  3ULQ A;  4LUN U;  3ZYL A;  3DRA A;  3HRA A;  3KS2 A;  5AQB A;  1XGW A;  4UQX A;  3ZHE B;  1BI8 B;  3NF1 A;  1HG5 A;  3VLD A;  3PS6 A;  3PRE A;  2UY1 A;  1N54 A;  1UG3 A;  4BX8 A;  3G2T A;  2DYR E;  3DXK G;  3FUF A;  2VGY A;  1H19 A;  4QQI A;  4F7A A;  4LRZ A;  4KVM A;  2A5E A;  5FZS A;  3C3Q A;  2LUH A;  2QFC A;  3VTY A;  5ENN A;  3CV0 A;  3JUE A;  3UMV A;  1UJJ A;  4IYP A;  4DLO A;  3QK0 A;  5JA4 D;  4UWL A;  1DC2 A;  4FAD A;  3MKR A;  2YNQ A;  3UTM A;  4EZK A;  3UM2 A;  3Q5M A;  4G8K A;  5AEN A;  1W3B A;  3GZ1 A;  3UIP C;  5H7P A;  2OVF A;  2ZXW E;  3CHM A;  3IV0 A;  3ZW3 A;  4GZ3 A;  2M63 A;  4JL0 A;  3U64 A;  5FQ7 A;  3PZ2 A;  3PZ3 A;  3APD A;  5BV1 A;  3S7F A;  1B89 A;  4J8S A;  1N95 A;  4U0U A;  4EPZ A;  4TUU A;  4U95 D;  2V4H C;  1TNB A;  2XEE A;  2J9Q A;  1KPS B;  2WXO A;  3FTX A;  2WM9 A;  3RIB A;  1A17 A;  4Q94 A;  2BTD A;  2QYU A;  3DXM G;  4OAV B;  1FVF A;  3BU8 A;  4J8D A;  3MYV A;  3URZ A;  3T9K A;  1FT2 A;  1HE8 A;  3QJZ A;  2XGS A;  1A5E A;  1YMP A;  4CGV A;  2DIW A;  2P9U G;  3SO8 A;  1HH8 A;  2KCK A;  1N4R A;  3OXF A;  2E2E A;  3LPZ A;  3FUH A;  1WM5 A;  1LD7 A;  4Y6W A;  4CDN A;  4N2S A;  3ZEF A;  4MRU A;  5ENQ D;  2L6J A;  2OEV A;  4WWP A;  1MJ0 A;  1QYM A;  2F0Y A;  3U9W A;  4UI9 K;  4J6I A;  4CDR A;  3FUD A;  5BNW A;  4ANW A;  2XEN A;  4L2L A;  2FEZ A;  3QWW A;  2C0M A;  3IXE A;  1SVX A;  2OV8 A;  3L22 A;  1LTX A;  5ITZ F;  4GA0 A;  2FI7 A;  3DPD A;  2WQ6 A;  1DNP A;  2WXH A;  2XHE A;  1SA5 A;  3Q15 A;  2RG8 A;  2EIK E;  5E76 A;  4DX7 D;  4DUI A;  2WQH A;  3T8M A;  3B7T A;  3I5P A;  3UIN C;  3CVW A;  4EBA A;  2YQ8 A;  2VGE A;  4I2W A;  3L13 A;  3MZL B;  2RD0 A;  3GZ2 A;  3FTS A;  4B93 B;  2KC7 A;  5FIO A;  5KJL A;  1E7V A;  5EIL A;  4JC8 A;  2KZT B;  3CK8 A;  3CHR A;  3VLE A;  3T8K A;  4N3C A;  4U04 A;  2IFU A;  3TWV A;  3LXU X;  5FJY A;  3ONK A;  5FT9 A;  2Y1L E;  1BPO A;  5T4Y A;  1XNF A;  4C0E A;  3S2A A;  5B1A E;  3B13 A;  4WNG A;  3Q79 A;  3FP3 A;  2RFA A;  2HO1 A;  2WVI A;  2FBN A;  4AVX A;  4AIF A;  5J08 A;  5CEA A;  2LAI A;  3DSS A;  3E4B A;  4BER A;  3LJ3 A;  3WXX A;  2FUL A;  4TXP A;  1N4P A;  5CMY A;  3QDN A;  4ANU A;  2ZU6 B;  4MS6 A;  1BU9 A;  3BEE A;  2ION A;  1Z6T A;  4UWF A;  2EIJ E;  3ULE G;  1HO8 A;  1P5Q A;  2WXF A;  3BQO A;  3DSV A;  1SZA A;  3OXG A;  2Q7F A;  3NB2 A;  3LDZ A;  3RJV A;  3ABK E;  1HFA A;  4XI9 A;  5ANR A;  4B0Z A;  4Q69 A;  5LCW C;  2KBX A;  5CRV A;  4DPR A;  4WND A;  4U07 A;  2F8X K;  3TWT A;  3ESK A;  1Z5S C;  2FO1 E;  5KNH D;  2VSO E;  1WY6 A;  1HXI A;  4PUC A;  5EX0 A;  3SY2 A;  4G24 A;  5G55 A;  1UOH A;  2WPV A;  1EF1 C;  2P9S G;  5D66 A;  3HYM B;  4CYM D;  4I6E A;  4XKB A;  1TNO A;  4JPS A;  1OWN A;  1TEZ A;  4M7C A;  1MYO A;  4GPM A;  2XS1 A;  2DZO A;  4FU3 A;  4I9C A;  3IBE A;  3CVX A;  4JXT A;  3C3R A;  2GRM A;  4WNE A;  3MCX A;  1V55 E;  3B95 A;  5CBO A;  2P58 C;  4K0R A;  3CLJ A;  3GW4 A;  4HOR A;  2LSU A;  5FTP A;  3CVQ A;  1HF8 A;  2J08 A;  2H6H A;  2XCB A;  4BX9 A;  3APF A;  4I9E A;  2HYZ A;  4XX5 A;  4PS8 A;  2AXU A;  3FWV A;  4CT4 A;  5C1D A;  3L54 A;  4JA9 A;  3EDT B;  1N52 A;  5CCM A;  2XZD G;  1INZ A;  4BTA A;  3L17 A;  5G2N A;  1H6K A;  3W9F A;  3I4G A;  3LY7 A;  4NQ0 A;  1OWP A;  4Q96 A;  4A1S A;  4F3V A;  1OWM A;  3DEO A;  2H6I A;  4HBD A;  4GMR A;  1MX4 A;  4GB9 A;  4HQD A;  4BSZ B;  5ANL A;  2J49 A;  3PE4 A;  4GZC A;  1NZN A;  4F6R D;  3CEQ A;  5KJN A;  2X6H A;  4U96 D;  2JLB A;  1HZ4 A;  2OEW A;  3B7U X;  4ATZ D;  3E34 A;  3HIZ A;  1TNY A;  3P2B A;  4XIF A;  1DCQ A;  2P9L G;  4H7X A;  1TR4 A;  2J4B A;  4GZ6 A;  1S0P A;  4GZ5 A;  3HXE A;  5CCL A;  3NOG D;  4KYO B;  1N4S A;  3BUA A;  2IQC A;  3DPY A;  2LAH A;  4L2Y A;  3S7B A;  1IXV A;  3HXD A;  1SZ9 A;  2MYO A;  3ML8 A;  3QC1 A;  4ILH B;  1IHB A;  3CKC A;  1BLX B;  2R02 A;  2LO6 A;  3MKQ B;  3APC A;  5HI7 A;  4UQY A;  3RK6 A;  3ZYK A;  1YYH A;  2I6H A;  2CFU A;  1JWG A;  3V30 A;  3Q7F A;  2BKK B;  3C72 A;  3UKR G;  4RG9 A;  1KZP A;  3D9H A;  4K5A B;  5LOZ A;  4A3T A;  4HOT A;  5AYW D;  2XPI A;  1H6P A;  2PNN A;  4N5C A;  3NOC D;  2GRQ B;  2MRI A;  4G23 A;  2IO3 C;  2VTB B;  3BG0 B;  3R9M A;  3TGO A;  1E96 B;  2NSZ A;  2WXJ A;  3ONL A;  3RO3 A;  1Y8M A;  3VTX A;  2YHC A;  3ABL E;  4UWG A;  4U63 A;  4K5B A;  3FEX A;  2VSN A;  3Q9N C;  4H7Y A;  3G2W A;  1X81 A;  2V4L A;  5AQ9 A;  5LX8 A;  3PRZ A;  2PZI A;  4EZJ A;  1L5J A;  1OWL A;  4J8F A;  4GTS A;  4I6J A;  3L82 A;  4TV3 A;  4N39 A;  3QAQ A;  4HVB A;  4YVO A;  3U66 A;  1NA0 A;  2RFM A;  3ZNG A;  2EIN E;  5AQ7 A;  4WWO A;  5CHE E;  3LYA A;  4FUL A;  2V0P A;  1H6O A;  5EID A;  1E8Y A;  4I2Z A;  2QC9 A;  4JVS A;  2PL2 A;  3HXC A;  2L6B A;  4JW1 A;  3EU9 A;  4GYO A;  5KWD A;  5ENS D;  4URK A;  5HQ8 A;  2IF4 A;  2VJ8 A;  3FUN A;  1OCC E;  2WXP A;  5FWQ A;  3QWP A;  1Q2Z A;  3SHF A;  3TXM A;  3E30 A;  4FA6 A;  2HM8 A;  4L23 A;  2A5U A;  5JJT A;  2V8S E;  3ASN E;  3FDH A;  2WXG A;  1ZB1 A;  3D9I A;  4I43 A;  3O4Z A;  4GMJ A;  3MV2 B;  2EIM E;  4YDE A;  3LJN A;  4NRH B;  4UI9 C;  1YA0 A;  3PNT B;  2NYJ A;  3DBS A;  3TXN A;  4L9P A;  3SD5 A;  4N3B A;  5ENP D;  4JEU A;  2XS8 A;  4N5Q A;  4Y6C A;  4KBQ A;  3SBT B;  4J8E A;  4B8C B;  4A55 A;  5CED B;  4KZC A;  3PDN A;  3MEK A;  4F1S A;  5HS0 A;  2AW6 A;  3LY8 A;  1N94 A;  3TG5 A;  4AY5 A;  4AM9 A;  3SQV A;  3QNK A;  3ZXS A;  4K5C A;  1PY1 A;  2DZN A;  1IQU A;  1ELW A;  1TN6 A;  1D9S A;  3CR3 A;  2IY0 C;  5BXU A;  1FCH A;  4DX2 A;  2CHW A;  3KSQ A;  2C2L A;  4LG6 A;  4HRM B;  2MHK A;  4DJA A;  4CEM A;  2YHE A;  2JAB A;  3FUI A;  5AJD A;  3CQG B;  3ASF A;  2P9P G;  2I1J A;  3D9L A;  1BI7 B;  4NAC A;  3EHQ A;  5KNG A;  5C2Y A;  3AU5 A;  3UT7 A;  4DI4 A;  3ASH A;  3ZGQ A;  1D8D A;  3AG1 E;  3L16 A;  3PEV B;  4APO A;  1LF8 A;  3V2O A;  2ZGD A;  3FTU A;  4BEP A;  1VDY A;  3UX4 A;  2IOS A;  2R03 A;  2V5Q C;  2KM4 A;  3Q73 A;  3MKQ A;  4HLE A;  3FFL A;  3UPV A;  3FU5 A;  3FUM A;  4KXK B;  2AVP A;  3CQC B;  3D9J A;  3CSF A;  3Q4A B;  5JJ7 A;  2Y69 E;  2BED A;  4N2Q A;  3TWX A;  4GPK A;  3HXB A;  2GRP B;  3LCA A;  2IJG X;  3JQ0 A;  4GTT A;  3KAE A;  5AJL A;  3ZKJ A;  4J0U A;  4K03 A;  1NP7 A;  4U8Y D;  2FF4 A;  4HXI A;  3CVL A;  5G05 C;  3KD7 A;  2I2O A;  3I3N A;  4F53 A;  2QZA A;  2R05 A;  3CGH A;  5M72 A;  3HVE B;  2C0L A;  2CFZ A;  4L1B A;  1ZU2 A;  3AG3 E;  4N3A A;  4G11 A;  3K9I A;  4BSX A;  3TJP A;  4JD2 G;  3ISM C;  3C5R A;  4FHK A;  3CHP A;  1LD8 A;  3P1U A;  3CVY A;  3OTN A;  4B8A A;  2IOL A;  3UIO C;  2VYI A;  3ASG A;  2NXP A;  3D9K A;  3PUJ A;  2LXL A;  5EDS A;  3BG1 B;  4M3O A;  1EPU A;  2GRL A;  4LER A;  4DX5 D;  4ILG A;  2WMO A;  2LSV A;  3QAR A;  1H2V C;  4A63 B;  1SW6 A;  1SA4 A;  4O60 A;  2MOW A;  2ETC A;  4GTO A;  1V54 E;  3UM3 A;  4O6F A;  1NI1 A;  1FVH A;  1K1B A;  3SFZ A;  4HI8 A;  3FEY A;  5G05 J;  4R7L A;  3DSX A;  3IEG A;  3MA5 A;  4I1M A;  2WXI A;  5BT1 A;  4J7W A;  2OCC E;  1ELK A;  1K1A A;  3RSE G;  2WQ7 A;  5G04 C;  2GRN B;  3LS8 A;  2DVW A;  4LNB A;  4UI9 J;  4C9B B;  4OVV A;  3AJI A;  3AU4 A;  5BW8 C;  2XPY A;  3NQP A;  3PEU B;  3JXI A;  3IHY A;  1K8K G;  1S63 A;  5B1B E;  3JYS A;  3TG4 A;  5EIB E;  2J07 A;  4WWN A;  1UW4 B;  1K3Z D;  4UWK A;  1EDU A;  1JCS A;  4HNA D;  4MLP A;  4EHM A;  3JXJ A;  3E32 A;  4LCT A;  3R7Q A;  2AJA A;  3ASO E;  3IHV A;  3RAU A;  3LY9 A;  4BWR A;  2J4D A;  1S70 B;  4NUR A;  4PS7 A;  3LVR E;  4HLL A;  3IKO B;  5ARF A;  1RZ4 A;  4HS2 A;  2J09 A;  1TNU A;  4GCO A;  3TWU A;  3UM1 A;  2B6C A;  5FQ4 A;  3FH5 A;  4OVU A;  4CRW A;  5EYP F;  3CHO A;  2X38 A;  1ZBP A;  4A3V A;  3PZD A;  4IN3 B;  4X8Q A;  2GW1 A;  4ANX A;  2ETA A;  4I17 A;  4CCA A;  3MGB A;  3AG4 E;  4HB5 A;  4JZY A;  4FP7 A;  3EUV A;  3RRU A;  4FC8 A;  1OXJ A;  1N0R A;  4JHK A;  3PZ4 A;  3CHQ A;  1KZO A;  2I1K A;  4V3I A;  3ZXP A;  1Z3Y A;  4E6H A;  1QZ2 A;  5D0O D;  3SGH A;  3SNX A;  2UY1 B;  4YND A;  4ZFH A;  3QKY A;  4GCN A;  1OT8 A;  1DVP A;  2X6K A;  3ZHE A;  5BPP A;  4JHJ A;  2BKG A;  3RRM B;  4EQF A;  3QOU A;  4ZHB A;  3WG7 E;  4ABN A;  5E75 A;  1Z3X A;  1WAO 1;  2ETB A;  1SQM A;  3FUE A;  4HI9 A;  2VTB A;  3FUJ A;  1JCQ A;  2IU1 A;  4GU5 A;  4U0S A;  4ACL A;  1E8W A;  4B89 A;  5D0Q D;  1DCE A;  4ANV A;  3OAW A;  2DWZ A;  1Y6I A;  2XZT G;  2Y4T A;  3HVE A;  3D9N A;  5DBK A;  4APF A;  1U3C A;  2FO7 A;  3CVN A;  1HS6 A;  1MX2 A;  2HE0 A;  4G8L A;  2KXP C;  2JEK A;  4JB8 P;  2Y3A A;  1BD8 A;  4LEU A;  3U4T A;  4FJZ A;  2XRZ A;  3ENE A;  1UN9 A;  2P9K G;  1N4Q A;  3G2U A;  4U8V D;  3R7R A;  2KCV A;  3CVP A;  4DRX E;  1X5B A;  2PQN A;  2LXM A;  4U7E B;  4ILI A;  4TRQ A;  3R9A B;  4AXH A;  1HG2 A;  4HOQ A;  3UM0 A;  1N9A A;  3C3O A;  2WXR A;  3QB2 A;  3FTY A;  2P2C P;  3SFY A;  5AN8 A;  2HR2 A;  5FZQ A;  1OCZ E;  3ULY A;  5D2M C;  1ELR A;  4XEI G;  3Q47 B;  2J8S D;  4HOS A;  2E0I A;  4CT0 A;  1TN8 A;  1IQR A;  3DSU A;  3ZFW A;  3CIA A;  5AAO A;  5CBN A;  3J5P A;  3F6Q A;  4DLQ A;  1O1S A;  1OCR E;  3FH7 A;  1MX6 A;  2ZGG A;  5LCW J;  3RRN B;  1TNZ A;  3L6A A;  1TYQ G;  3ESL A;  4GTP A;  3Q9U C;  3Q49 B;  1KLX A;  2GGF A;  3T5V A;  3SFX A;  4C0M A;  3SZ7 A;  3FTV A;  3ZVV A;  2CG3 A;  4L7T A;  2WXK A;  3GYZ A;  2XGM A;  2H6F A;  1KT0 A;  2DBA A;  4U8H A;  4KMO A;  4G26 A;  5A23 A;  2WXN A;  2XRY A;  2P9I G;  2AWI A;  2XCC A;  4DI3 A;  2P9N G;  2F8Y A;  3EIQ C;  5JHA A;  4GTM A;  3C98 A;  5A6C A;  4C48 B;  3T5X A;  3B7B A;  4GA1 A;  5AIJ A;  5BUZ A;  5CEC B;  4O1P A;  3JQ1 A;  3FU6 A;  5EYL A;  4GTV A;  5ENR D;  4GZD A;  4W9R A;  4MKT A;  3MJW A;  1AWC B;  1PC2 A;  1OY3 D;  3EU5 A;  3LKU A;  5EN5 D;  2Y4U A;  3FHE A;  4FLB A;  4KVO A;  3TWR A;  3ZPJ A;  3DEP A;  5FZR A;  3ZRH A;  4I1A A;  3D3M A;  3ZN3 A;  2KAT A;  1KT1 A;  3LVQ E;  5T8I A;  5CER B;  1RW2 A;  3UI2 A;  3AAA C;  4BTB A;  3GZS A;  4YDO A;  3J5Q B;  2LNI A;  2I9C A;  2UWJ G;  1AP7 A;  3KSL A;  4KT6 B;  4GTQ A;  3CKB A;  1H2U A;  2R5S A;  5FQ8 A;  3CK9 A;  2AXZ A;  5ENO D;  3FU0 A;  4XKC A;  2CHX A;  1WG0 A;  1NA3 A;  3LEW A;  4LNU D;  1HU3 A;  4NIK A;  4CDM A;  4RG6 A;  2CG2 A;  3EJN A;  2X6F A;  3E33 A;  4XE0 A;  4UQZ A;  2QY7 A;  5T3R A;  5CRU A;  3FY4 A;  4AOF A;  1WDY A;  4LSZ E;  3RU0 A;  3TWS A;  3DWL G;  1QBQ A;  3FUL A;  4EZL A;  4JHR A;  5AQA A;  4GYY A;  4F1P A;  5KCM A;  3UUX A;  4FLH A;  5A7D B;  4AY6 A;  1S64 A;  3JUI A;  2OVB A;  4LNG A;  5EX3 A;  3ABM E;  3FUK A;  4GML A;  4RSY A;  4CGW A;  5LP0 A;  1FPP A;  3I4R B;  4WUY A;  4GA2 A;  3O48 A;  3X2Q E;  4DX1 A;  1JPL A;  2VQ2 A;  3V2X A;  1N11 A;  2QYJ A;  4I1O B;  3HG0 D;  3Q78 A;  3ZYQ A;  4I6G A;  5BXO A;  3RO2 A;  4QFV A;  3NAW A;  2OND A;  3ZIM A;  3NZU A;  2EIL E;  2X3M A;  2Y0B G;  4AJW A;  3CK7 A;  1D8E A;  2ZIR A;  1IYG A;  3KEZ A;  1JCR A;  2R59 A;  1NL4 A;  1PAQ A;  3FTW A;  4FJY A;  5LFA A;  4HRN A;  3PUK A;  2YIN A;  1E8Z A;  1MHQ A;  3CVU A;  4B94 A;  2DCP A;  3EHM A;  1NFI E;  4CZ2 D;  4ATG A;  4G25 A;  4GYW A;  4G1T A;  5EKQ D;  4PH4 B;  4OAU C;  2PM6 A;  2WXQ A;  2BF0 X;  1QNF A;  5AAR A;  3ZU7 B;  3U3W A;  3UQ3 A;  3ZYM A;  3CHS A;  3HXF A;  3FU3 A;  2XQ0 A;  2DYS E;  4IRU A;  2IO2 C;  2XGO A;  2CHZ A;  1H0A A;  4RVB A;  1UN8 A;  4GAA A;  4JA7 A;  5JMN D;  3AS5 A;  3CVV A;  3NBN B;  2L0I A;  2L0T B;  5FIN A;  2R2L A;  2EQX A;  5HKP A;  5KBA A;  4BY6 A;  1E90 A;  4PS3 A;  4DX6 D;  5KJK A;  1JWF A;  3QWV A;  4OYS A;  4AV7 A;  1O1R A;  1TN7 A;  4BT9 A;  3CST A;  4UUC A;  1O5M A;  4PDX A;  5KJM A;  2WB2 A;  3G2V A;  3S7J A;  1U3D A;  3V79 K;  3UT4 A;  4G2V A;  3MV3 B;  3D9M A;  3N71 A;  1MZC A;  4D10 C;  3TWQ A;  3PZ1 A;  5G04 J;  4TUM A;  4EEC A;  2X6I A;  1TJC A;  2R17 C;  4DK5 A;  4ACK A;  2IEJ A;  4A1G A;  4BFR A;  5HRY A;  4XZ4 A;  3ML9 A;  4YDW A;  3JCK C;  3OXL A;  4RLY A;  1OUV A;  2H6G A;  1YCS B;  3UT8 A;  2F37 A;  1N0Q A;  3PNL B;  1JUQ A;  3KEA A;  3SBS A;  2RKK A;  3EIJ A;  3UXG A;  5BV0 A;  1OCO E;  2BUG A;  3MX3 A;  5J90 A;  2XEH A;  4YDY A;  2KZT A;  2WXL A;  3ASD A;  5CMW A;  2AXV A;  4IUL A;  4UWH A;  5FQ6 A;  3B7R L;  1HX8 A;  2L9B A;  3TL5 A;  2NC9 A;  1E8X A;  2XPZ A;  3DST A;  4EBA G;  4JEH A;  3SF4 A;  1OWO A;  2VGX A;  2VSY A;  2GRO B;  3HDX A;  4BET A;  4TXR A;  3VLF A;  3W9G A;  2V5F A;  2X6J A;  2PQR A;  1IHG A;  1G3N B;  5ARG A;  1TJF A;  1U2V G;  3UKU G;  3FTZ A;  4Z68 A;  3DSW A;  5IY5 E;  3TAX A;  3E37 A;  3S7D A;  3PE3 A;  3FH8 A;  4KZ0 A;  1GW6 A;  3ZUV B;  3L08 A;  4HOU A;  4MBG A;  2A4Z A;  2VGX B;  3L9T A;  5DIZ A;  1IKN D;  4YVQ C;  3TWW A;  3RKV A;  2PM7 A;  2GRR B;  1EYH A;  3EHN A;  4AP2 A;  5B3S E;  3HHM A;  3D9P A;  2OOE A;  4WAF A;  4WNF A;  4E85 A;  3AS4 A;  4BT8 A;  3G2S A;  3Q7A A;  4O1O A;  2VSX E;  3D9O A;  3NZS A;  3B7S A;  5ENT D;  2WMN A;  2ILR A; 
#chains in the Genus database with same CATH homology
 1NI1 A;  1TNY A;  2H6G A;  3Q73 A;  4L9P A;  2H6F A;  1LD7 A;  1FT1 A;  1X81 A;  3DSX A;  3HXF A;  1N4Q A;  3E33 A;  3Q79 A;  3HXE A;  2F0Y A;  1O1T A;  2BED A;  1N4S A;  3DPY A;  4GTS A;  3EUV A;  3HXB A;  4GTT A;  3HXD A;  4GTM A;  3PZ4 A;  1QBQ A;  1KZO A;  1N94 A;  3PZ2 A;  3DSS A;  2H6H A;  3PZ3 A;  2R2L A;  4LNB A;  1N9A A;  3DST A;  4GTR A;  1S64 A;  1LTX A;  1N4P A;  4LNG A;  4GTV A;  1N95 A;  3SFY A;  2ZIS A;  3Q75 A;  1S63 A;  1FPP A;  1SA5 A;  1O1R A;  3DRA A;  3EU5 A;  1TN7 A;  1TN6 A;  1O5M A;  1TNB A;  1TN8 A;  3HXC A;  3KSQ A;  3DSW A;  3E37 A;  3Q7F A;  3C72 A;  3DSU A;  1JCS A;  3DSV A;  1LD8 A;  1KZP A;  4EHM A;  3Q78 A;  4MBG A;  1O1S A;  3E32 A;  1JCQ A;  1TNZ A;  2H6I A;  1MZC A;  3E30 A;  1D8E A;  3PZ1 A;  1FT2 A;  4GTP A;  4YDO A;  2ZIR A;  1DCE A;  1JCR A;  1NL4 A;  1D8D A;  3KSL A;  4GTQ A;  1TNU A;  2IEJ A;  3SFX A;  1SA4 A;  1TNO A;  3Q7A A;  1N4R A;  4YDE A;  4GTO A;  3E34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...