1N9AA

Farnesyltransferase complex with tetrahydropyridine inhibitors
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
312
structure length
312
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase alpha subunit
publication title Aryl tetrahydropyridine inhibitors of farnesyltransferase: bioavailable analogues with improved cellular potency.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 122
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n9aA00
1N4QA 4LNBA 1JCQA 1D8EA 4YDOA 4GTVA 3Q79A 4LNGA 1N4SA 3E34A 1FPPA 3KSQA 3HXCA 3DSSA 1N95A 3E33A 3Q7FA 4L9PA 3DPYA 1N4PA 1TNBA 3Q75A 3E32A 1S64A 3DSWA 1KZPA 2BEDA 1O5MA 2H6FA 1LD8A 1O1RA 1X81A 3PZ4A 1N4RA 1TN6A 1QBQA 1JCSA 3SFXA 3PZ1A 3EUVA 1LD7A 2ZIRA 4GTRA 1D8DA 3DSUA 1KZOA 2H6HA 3C72A 3PZ3A 1JCRA 1O1SA 1TNUA 4GTQA 3Q7AA 1MZCA 1TN8A 3DSXA 2IEJA 4GTPA 4YDEA 3EU5A 1TNZA 1DCEA 1N9AA 3E37A 3KSLA 3SFYA 3PZ2A 4GTSA 3HXBA 3DSVA 2ZISA 1SA5A 4GTOA 1N94A 1O1TA 3HXDA 4EHMA 3HXEA 1TNOA 1S63A 1TN7A 1FT2A 4GTTA 4MBGA 1NI1A 1NL4A 2F0YA 3Q73A 3Q78A 3E30A 2H6IA 4GTMA 1FT1A 3DRAA 3HXFA 1TNYA 3DSTA 2R2LA 2H6GA 1LTXA 1SA4A
chains in the Genus database with same CATH superfamily
3N71A 1UN9A 2FBNA 4CRWA 3ZEFA 3ASDA 4HNAD 4LNGA 5EIDA 2OOEA 3HXCA 1QZ2A 1SZ9A 4XE0A 3TGOA 3UPVA 3LYAA 4TUUA 4RG6A 2X3MA 3DSWA 3PREA 3CKBA 1O5MA 1V55E 2B0OE 2HYZA 1TJFA 2RFAA 3CGHA 3I5PA 3JUIA 3WXXA 3ENEA 3IHVA 3PZ1A 1H6OA 3ASNE 1ELRA 4PS8A 3TWSA 2XGSA 3ULEG 3QKYA 3CHPA 1TJCA 4L2LA 1WY6A 3LKUA 5G05C 4IRUA 3RRMB 2NYJA 2YHCA 4AEZC 4YDWA 2XPIA 4LRZA 1HX8A 1JWGA 2XQ0A 3LVRE 2KCKA 3UTMA 4FLBA 4GTSA 1IHBA 3FTXA 5AIJA 3Q15A 2R05A 2AJAA 4ABNA 3G2WA 3HVEB 1IQUA 4HOUA 1HXIA 4UQXA 4EBAA 1FT1A 3QWPA 5ENRD 4K03A 2J08A 4CDMA 4AIFA 3CK7A 3Q9NC 4JD2G 5HRYA 1D8EA 4HQDA 1FPPA 3PNTB 1N95A 3FH5A 3DPYA 3URZA 4BERA 3B7SA 1G3NB 4DI3A 1HFAA 3PUKA 4NACA 1E8WA 2XZTG 3ZU7B 4B94A 5JHBA 4WNFA 1TEZA 3V2XA 1ZBPA 2C2LA 2I2OA 4GA2A 4CT0A 3SFXA 1OCOE 3VTXA 1N52A 3G2SA 1RZ4A 4KZ0A 1WAO1 1OCRE 3ZFWA 4GZ5A 4H7YA 2EIKE 3Q49B 5H7PA 5E75A 4DX6D 5KNHD 5AYWD 2IF4A 4J8FA 2NC9A 3L82A 1SZAA 3FH8A 3DWLG 1L5JA 2XRYA 5D0OD 3SFZA 3HXDA 4LNUD 3CVNA 5AQ9A 1TNOA 3B7TA 5G2NA 4NRHB 5HI7A 3DXKG 5AQ7A 4O1OA 4B89A 4B0ZA 1Y6IA 4HRMB 3S7BA 2H6IA 4GTMA 4BTBA 2OVBA 3JQ1A 2FO7A 2X38A 2P2CP 2DBAA 3TXNA 3BEEA 1OWNA 1A17A 4BWRA 3ZXSA 3TG5A 4GMRA 4HVBA 4N3BA 4ZFHA 4GPKA 2AXUA 3RRNB 3ZN3A 4MLPA 5AJDA 2QY7A 1TNBA 2CHXA 2EIJE 4DI4A 3GYZA 1E8ZA 3AS5A 4X8QA 5B3SE 4URKA 1AP7A 1BI7B 4UWGA 4RG9A 2WXFA 3RJVA 1O1RA 4YVQC 3EHNA 3QJZA 1YMPA 3CKCA 4FJYA 3RIBA 2HO1A 4UWFA 1PC2A 3I4GA 4PS3A 4IN3B 4ILGA 3DSUA 1OWMA 3QOUA 5LCWC 2VYIA 2RD0A 4YDYA 3ZXPA 4LEUA 3CVVA 4JHRA 1FCHA 3FTWA 5FZRA 1DCEA 4JHKA 3PE4A 4U95D 3FDHA 4KXKB 1K3ZD 3PRZA 4HS2A 3HG0D 5JJTA 4AJWA 4UQYA 3SZ7A 3R7QA 4TRQA 1H2VC 2J4BA 5CEDB 2P9IG 4WNDA 1TNYA 3PS6A 3DSTA 5CEAA 3GZSA 2R2LA 4U0SA 3ZRHA 4IULA 3CQCB 3L54A 3HVEA 3TWTA 1BLXB 4JEHA 4A63B 3CK9A 2R02A 3CLJA 4G1TA 3TWRA 4K5AB 2A5UA 3UM0A 3OAWA 3SD5A 3K9IA 1LD8A 3ZHEB 3T8KA 1BU9A 5C1DA 2XCCA 4EQFA 2WXGA 4I6JA 3D9OA 3GZ2A 3SBSA 3EUVA 3L17A 5ANRA 2RFMA 3OXGA 4U8YD 4GTQA 4G11A 3ESKA 3QC1A 4I9CA 1OT8A 1N0QA 2L9BA 3FEXA 3EHQA 5EYPF 3CHOA 5J08A 4EBAG 4DPRA 3CSFA 4J8YA 2DCPA 3TG4A 2ETBA 4TXQA 4AY5A 4GTTA 4MBGA 1IQRA 2LSVA 2FULA 1V54E 3AJIA 4KVMA 5DIZA 3CVLA 3Q78A 4E6HA 3B7UX 5DBKA 2XGMA 1PAQA 1HS6A 5B1BE 3U66A 4I1AA 1SA4A 1BPOA 1HF8A 4XI0A 3D9NA 5CMWA 2YINA 4FHKA 4GCOA 1S70B 2VGEA 3D9IA 4O1PA 3DSSA 3VLFA 2VJ8A 1UJJA 1N0RA 1OWLA 4U0ZA 3ZYMA 3SF4A 3BU8A 1MX6A 5CRUA 1U3DA 4GA0A 1Y8MA 3NZUA 1DC2A 5BNWA 5KJMA 2YHEA 3F6QA 3FTSA 1NA3A 2VGXB 5C2YA 1YYHA 4JEUA 2IO3C 2DYSE 2PNNA 3D3MA 3FTUA 3T5VA 2WXQA 2VGYA 5HS0A 3W9FA 5CECB 4ZHBA 4BT9A 5A23A 2P9KG 1U3CA 4F1PA 2GW1A 2PM6A 3LY8A 2B6CA 3DBSA 4J8SA 3KSLA 4A1SA 2OEWA 3MX3A 3KEZA 4JZYA 1QQEA 2GRMA 3FU6A 5T3RA 4I43A 1TN7A 5LOZA 3KEAA 2V8SE 2ZGDA 3RAUA 4E85A 3MA5A 2Y4TA 2LAHA 3PNLB 3WG7E 5HKPA 4ACLA 4BESA 2WXRA 2RKKA 3W9GA 3RRUA 5BXOA 1E8XA 2GGFA 3ONKA 4GB9A 4XX5A 1N4QA 1WM5A 4BETA 4JL0A 4C0EA 4DK5A 4FP7A 4Y6CA 3ZVVA 3ABME 3UT7A 3FP3A 1NP7A 1H19A 4ATGA 2WQHA 3J5QB 4FLHA 2FI7A 3FUMA 3AG1E 3PZDA 1HE8A 5JJ6A 2ETAA 1S0PA 3U64A 3PE3A 3NBNB 3FY4A 2CHWA 1OY3D 4UI9C 1AWCB 5FT9A 1YA0A 4U07A 1TN6A 2KCLA 3NOGD 4OVVA 5EDSA 3NOCD 3ZKJA 4HFGA 2BTDA 4WWPA 2V5FA 3BG1B 1LD7A 5FINA 5LFAA 2I1JA 4MKTA 5JHAA 3CSTA 3UUXA 3ZHEA 4V3IA 2XPYA 4AOFA 3FUIA 3FWVA 3C3QA 4J8DA 5CERB 3DSXA 3KD7A 3UT8A 4WAFA 4A3TA 1PY1A 1WDYA 3CVPA 3FU0A 5KCMA 3SFYA 5BUZA 1OWOA 1UN8A 3CQGB 2ZISA 2RG8A 1ELKA 4FJZA 1H2TC 2DVWA 1NL4A 3MZLB 4BEPA 2VSOE 3MKQB 2MRIA 3LDZA 4J6IA 2R03A 3HXFA 2Y0BG 3ABKE 2LAIA 4JA7A 1UOHA 4UWLA 3I4RB 1QNFA 4PDXA 2L0IA 3ZUVB 5LX8A 3KS2A 4WNGA 4XEIG 4CEMA 3CHMA 1JUQA 2LXLA 4YVOA 1OCCE 5AJLA 3CEQA 3MJWA 2WXLA 4RQIA 3ASHA 3QWWA 5ITZF 2UWJG 5HQ8A 3UXGA 4UI9K 4OVUA 3L16A 1QBQA 4F3VA 3FUHA 2XEHA 4RLYA 5ENPD 1IHGA 5KNGA 2OVFA 5G55A 2H6HA 3L22A 1Q2ZA 4LG6A 2XS1A 2DYRE 3MEKA 5B1AE 2PZIA 4F7AA 4BSXA 2IO2C 4J8EA 1NA0A 4GTPA 2QC9A 2IJGX 2XRZA 5BV0A 5T4YA 2WVIA 5D0QD 4JB8P 4W9RA 3CV0A 5FQ8A 1S63A 2LSUA 2QZAA 3CIAA 3SQVA 2EILE 5CMYA 2IOLA 3PH0C 4JVSA 3C3OA 3QDNA 3FH7A 2XHEA 3KAEA 2DZNA 4KVOA 2WXMA 3P2BA 4UWKA 3G2UA 1H6KA 5JA4D 4YDOA 3Q47B 3FUDA 3UT4A 3ASOE 3ESLA 4U8VD 4OYSA 4WWNA 1N4PA 1N11A 4J7WA 3UM3A 4R7LA 1S64A 3FUKA 4FULA 4I6GA 4K5CA 3LJ3A 3R9MA 3PZ4A 1Z6TA 2PM7A 2P9LG 4OAVB 3EU9A 4XI9A 4G23A 4DUIA 5FQ7A 3Q7AA 3APFA 5FQ6A 2R17C 4UQZA 4YDEA 3EU5A 3IV0A 4M3OA 1B89A 3Q4AB 4N39A 1E90A 2YQ8A 4C0MA 3S2AA 2M63A 3IBEA 5ANLA 4EZLA 4DX2A 4P29A 5KBAA 2OCCE 4DRXE 4KYOB 3FUFA 3NF1A 3EHRA 4GZCA 3V31A 4GCNA 3EHMA 2WPVA 3SGHA 5BW8C 1MHQA 4XKCA 1Z3XA 4K5BA 4GU5A 3TWWA 4GZ3A 2BKGA 1KLXA 2FEZA 3S7DA 1K1BA 1HH8A 3CR3A 4XZ4A 3MV2B 4RSYA 3LS8A 1N4SA 1JPLA 4BY6A 3FTZA 1QYMA 4MRUA 4L9PA 3Q7FA 3SBTB 3MKQA 3JXIA 3Q75A 4A1GA 4BT8A 2HM8A 3LCAA 2H6FA 3G2TA 2VSNA 1JWFA 1N4RA 4G2VA 2I1KA 3FU3A 5BV1A 4U7EB 4HOTA 3LVQE 1W3BA 3TAXA 3G2VA 2WXPA 2ZIRA 3JUEA 2QYJA 3C98A 1H2UA 2HR2A 2JEKA 4HI8A 2YNQA 1O1SA 2NSZA 4FADA 1IXVA 3V2OA 1X5BA 3HHMA 5KJLA 3RU0A 1N9AA 4DX5D 3ASGA 3PZ2A 4PH4B 3ABLE 2Y4UA 4LCTA 3HXBA 3EIQC 1DNPA 1N94A 3QK0A 5G04J 3HXEA 2WXKA 2VSYA 2PQNA 5FTPA 3NQPA 2J49A 1NI1A 2PL2A 3PDNA 4BSZB 2AWIA 2EQXA 3FUEA 1XNFA 3U9WA 2VTBB 2E2EA 3GZ1A 5BXUA 1HO8A 2CFUA 2OV8A 4CGWA 2P9PG 3CHSA 4DX1A 5IY5E 2J9QA 3X2QE 1FVFA 3TJPA 2E0IA 2JLBA 3RK6A 1H6PA 2Y69E 2KM4A 1K1AA 3UIOC 2C0MA 2MHKA 3ZYKA 4HI9A 2NXPA 5EX0A 5AQBA 2L6BA 2OEVA 3FEYA 4BX8A 5EX3A 1INZA 4L2YA 4DX7D 3BG0B 2R5SA 3PZ3A 4HBDA 1JCRA 4CCAA 2X6HA 3ML9A 1U2VG 1EYHA 2F8XK 4I1MA 1HZ4A 2IQCA 3CHQA 4WUYA 2CHZA 2J8SD 3EDTB 3TL5A 2P9SG 3FFLA 4CDRA 4ILIA 4Y6WA 4BFRA 1SA5A 2XS8A 3HRAA 4A55A 2AXZA 2IOSA 1A5EA 5AARA 3ZIMA 2V0PA 3DRAA 4ME2A 1UJKA 3ULQA 3AU5A 3ZYQA 3CVWA 2FO1E 4LERA 3APCA 3FHEA 5FZSA 4GTVA 4F53A 3VLDA 3TWUA 4ANXA 4HLEA 3VLEA 3L08A 3P1UA 3JCKC 3UX4A 4N5CA 1MJ0A 4U0UA 3EIJA 3AG4E 3UI2A 3O4ZA 3CVQA 1NZNA 1EDUA 4L1BA 3D9KA 3TWXA 3TWVA 2MYOA 2L6JA 2CG3A 1SW6A 4ILHB 3AAAC 3Q5MA 4I2ZA 1BI8B 4B93B 3IHYA 4KBQA 2KCVA 3GW4A 2X6FA 3E37A 2J07A 2GRPB 2C0LA 5KJNA 1TYQG 4GTOA 3RKVA 3FULA 4I6EA 4EHMA 3LJNA 1RW2A 3QB2A 4TUMA 4XKBA 2XCBA 1IYGA 3DEPA 4JHJA 2CFZA 4FHJA 2CG2A 4AV7A 1XGWA 3T5XA 4KZCA 3L6AA 4TXPA 4ACKA 5CCLA 5EIBE 4WWOA 3LY9A 4AP2A 4AVXA 1TR4A 3B7RL 2WQ7A 3SI5A 2GRQB 4WNEA 4G8KA 3SO8A 4GA1A 4ANVA 2VTBA 3UKRG 3B7BA 3E32A 5CBOA 4QQIA 3BUAA 5ENTD 3E4BA 3FUJA 2KC7A 5FJYA 2KZTB 3TWQA 5FQ4A 4B8AA 3QNKA 1E7UA 2ZU6B 1KT0A 3LEWA 4PS7A 1OUVA 4L23A 1TNUA 3TXMA 2LXMA 2Q7FA 3U4TA 2XGOA 4NQ0A 3ONLA 4O60A 3S7JA 3LXUX 4M7CA 4GMJA 4UI9J 3DSVA 2WXHA 5CCMA 3HDXA 2F37A 5JJ7A 5J90A 2DZOA 5EILA 4EZKA 2LO6A 2V4HC 3D9MA 4Q96A 2F0YA 4C48B 2VGXA 3OXLA 2LUHA 3B95A 2XEVA 4Q69A 2J4DA 4N2QA 3AS4A 3NZSA 2BKKB 4APFA 1NFIE 3NAWA 3UKUG 4I1OB 3JQ0A 3R7RA 3CK8A 4QFVA 3FTVA 3E33A 5EYLA 3CVUA 3JYSA 3RSEG 1D9SA 4A3VA 1KZPA 3D9HA 3QWVA 5EN5D 4NIKA 3C3RA 2XENA 5BPPA 1EF1C 2GRNB 2PQRA 3O48A 3T8MA 4HOSA 4D10C 5G05J 4F1SA 1GW6A 2ZGGA 1E96B 4GZDA 2AXVA 4N3AA 4APOA 4KT6B 4GPMA 3V30A 1D8DA 3SY2A 1KZOA 3C72A 4OAUC 3MCXA 2ILRA 3R9AB 2WXJA 5AAOA 4G25A 3V79K 4I17A 4BX9A 4I2WA 1DVPA 3LPZA 2GRRB 3CHRA 1UW4B 3CVXA 4Q94A 5A7DB 3ULYA 5FWQA 5BT1A 3L9TA 4CDNA 1VDYA 2A4ZA 1UG3A 3RO2A 2X6IA 3ZNGA 5CRVA 3E30A 1E8YA 2ONDA 2L0TB 2X6KA 4ANUA 4GZ6A 2H6GA 2EINE 5G04C 1DCQA 5AENA 4U63A 4LNBA 3Q9UC 3MYVA 4Z68A 4J0UA 3E34A 3ASFA 1Z3YA 3VTYA 1MYOA 2QYUA 3MGBA 4DLQA 5M72A 2LNIA 4ATZD 4DLOA 3PEVB 4AY6A 2VSXE 2BEDA 3UMVA 4FU3A 2IONA 2X6JA 3AG3E 2UY1B 3SHFA 1ZB1A 1JCSA 4G26A 3AS8A 1K8KG 4UUCA 4I9EA 2WXNA 4UWHA 5ARFA 2DIWA 2IU1A 4FA6A 1N54A 1Z5SC 5ENNA 4HORA 2KZTA 1P5QA 3ZPJA 2KATA 5D2MC 5ENQD 3C5RA 1E7VA 4GYOA 3PEUB 4IYPA 2MOWA 5T8IA 4EZJA 5KJKA 3MKRA 4B8CB 2KBXA 4N3CA 5E76A 5AN8A 3SNXA 2WB2A 1FT2A 3T9KA 2VQ2A 4HB5A 4GYWA 3Q73A 4C9BB 3HIZA 4N2SA 1MX4A 3D9JA 3UIPC 2J09A 1IKND 2QFCA 3QAQA 3S7FA 2XEEA 1JCQA 4PUCA 5A6CA 3PVLA 3LY7A 3D9LA 4JC8A 3ZGQA 2DWZA 1SVXA 2Y1LE 5D66A 3ZYLA 2A5EA 4BTAA 5CHEE 3U3WA 4HRNA 4CGVA 3CVYA 5AQAA 2BF0X 3FU5A 3OXFA 4K0RA 2AVPA 2AW6A 5LCWJ 2WQ6A 2HE0A 3ML8A 1MQSA 2WMNA 2KXPC 2ETCA 2P58C 4LUNU 1HU3A 4AM9A 4EPZA 3DPDA 3HYMB 3UM2A 4TV3A 4HRLA 4YNDA 4CT4A 5CBNA 2R59A 3BQOA 2Y3AA 1KT1A 3IEGA 1TN8A 2F8YA 2P9NG 3I3NA 2GROB 2BUGA 4G24A 1OXJA 4U96D 2ZXWE 2WXOA 2WMOA 2XPZA 3AU4A 1ELWA 4GAAA 1O1TA 4N5QA 1YCSB 3J5PA 1FVHA 3MV3B 3RO3A 2WXIA 1LF8A 4XIFA 4EECA 1KPSB 1OCZE 4JW1A 1H0AA 4DJAA 5ENSD 5LP0A 3UQ3A 2IY0C 1EPUA 3DEOA 4LSZE 2V4LA 3L13A 3Q79A 4U04A 3KSQA 1HG2A 4JA9A 2FF4A 5KWDA 1MX2A 3AG2E 3NB2A 3PUJA 4G8LA 2V5QC 1HG5A 4TXRA 1BD8A 4HOQA 4KMOA 1SQMA 4AXHA 4CZ2D 3UINC 5EKQD 1X81A 3QARA 4NURA 1ZU2A 3APDA 3UM1A 2JABA 4GMLA 4RVBA 4O6FA 1OWPA 3OTNA 4FC8A 1MZCA 5JMND 3FTYA 3IXEA 2P9UG 5FIOA 4HLLA 2WM9A 3FUNA 2GRLA 2IFUA 2UY1A 2IEJA 4H7XA 1TNZA 2EIME 3JXJA 2I9CA 5ENOD 3DXMG 5FZQA 3ISMC 4U8HA 4JXTA 4CYMD 4ANWA 3ZW3A 4HXIA 3EJNA 4GYYA 4MS6A 1WG0A 2XZDG 3IKOB 3B13A 4L7TA 4JPSA 4F6RD 5ARGA 3D9PA 2I6HA 1LTXA 4GTRA
chains in the Genus database with same CATH topology
1N4QA 4LNBA 1JCQA 1D8EA 4YDOA 4GTVA 3Q79A 4LNGA 1N4SA 3E34A 1FPPA 3KSQA 3HXCA 3DSSA 1N95A 3E33A 3Q7FA 4L9PA 3DPYA 1N4PA 1TNBA 3Q75A 3E32A 1S64A 3DSWA 1KZPA 2BEDA 1O5MA 2H6FA 1LD8A 1O1RA 1X81A 3PZ4A 1N4RA 1TN6A 1QBQA 1JCSA 3SFXA 3PZ1A 3EUVA 1LD7A 2ZIRA 4GTRA 1D8DA 3DSUA 1KZOA 2H6HA 3C72A 3PZ3A 1JCRA 1O1SA 1TNUA 4GTQA 3Q7AA 1MZCA 1TN8A 3DSXA 2IEJA 4GTPA 4YDEA 3EU5A 1TNZA 1DCEA 1N9AA 3E37A 3KSLA 3SFYA 3PZ2A 4GTSA 3HXBA 3DSVA 2ZISA 1SA5A 4GTOA 1N94A 1O1TA 3HXDA 4EHMA 3HXEA 1TNOA 1S63A 1TN7A 1FT2A 4GTTA 4MBGA 1NI1A 1NL4A 2F0YA 3Q73A 3Q78A 3E30A 2H6IA 4GTMA 1FT1A 3DRAA 3HXFA 1TNYA 3DSTA 2R2LA 2H6GA 1LTXA 1SA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4Q A;  4LNB A;  1JCQ A;  1D8E A;  4YDO A;  4GTV A;  3Q79 A;  4LNG A;  1N4S A;  3E34 A;  1FPP A;  3KSQ A;  3HXC A;  3DSS A;  1N95 A;  3E33 A;  3Q7F A;  4L9P A;  3DPY A;  1N4P A;  1TNB A;  3Q75 A;  3E32 A;  1S64 A;  3DSW A;  1KZP A;  2BED A;  1O5M A;  2H6F A;  1LD8 A;  1O1R A;  1X81 A;  3PZ4 A;  1N4R A;  1TN6 A;  1QBQ A;  1JCS A;  3SFX A;  3PZ1 A;  3EUV A;  1LD7 A;  2ZIR A;  4GTR A;  1D8D A;  3DSU A;  1KZO A;  2H6H A;  3C72 A;  3PZ3 A;  1JCR A;  1O1S A;  1TNU A;  4GTQ A;  3Q7A A;  1MZC A;  1TN8 A;  3DSX A;  2IEJ A;  4GTP A;  4YDE A;  3EU5 A;  1TNZ A;  1DCE A;  1N9A A;  3E37 A;  3KSL A;  3SFY A;  3PZ2 A;  4GTS A;  3HXB A;  3DSV A;  2ZIS A;  1SA5 A;  4GTO A;  1N94 A;  1O1T A;  3HXD A;  4EHM A;  3HXE A;  1TNO A;  1S63 A;  1TN7 A;  1FT2 A;  4GTT A;  4MBG A;  1NI1 A;  1NL4 A;  2F0Y A;  3Q73 A;  3Q78 A;  3E30 A;  2H6I A;  4GTM A;  1FT1 A;  3DRA A;  3HXF A;  1TNY A;  3DST A;  2R2L A;  2H6G A;  1LTX A;  1SA4 A; 
#chains in the Genus database with same CATH topology
 3N71 A;  1UN9 A;  2FBN A;  4CRW A;  3ZEF A;  3ASD A;  4HNA D;  4LNG A;  5EID A;  2OOE A;  3HXC A;  1QZ2 A;  1SZ9 A;  4XE0 A;  3TGO A;  3UPV A;  3LYA A;  4TUU A;  4RG6 A;  2X3M A;  3DSW A;  3PRE A;  3CKB A;  1O5M A;  1V55 E;  2B0O E;  2HYZ A;  1TJF A;  2RFA A;  3CGH A;  3I5P A;  3JUI A;  3WXX A;  3ENE A;  3IHV A;  3PZ1 A;  1H6O A;  3ASN E;  1ELR A;  4PS8 A;  3TWS A;  2XGS A;  3ULE G;  3QKY A;  3CHP A;  1TJC A;  4L2L A;  1WY6 A;  3LKU A;  5G05 C;  4IRU A;  3RRM B;  2NYJ A;  2YHC A;  4AEZ C;  4YDW A;  2XPI A;  4LRZ A;  1HX8 A;  1JWG A;  2XQ0 A;  3LVR E;  2KCK A;  3UTM A;  4FLB A;  4GTS A;  1IHB A;  3FTX A;  5AIJ A;  3Q15 A;  2R05 A;  2AJA A;  4ABN A;  3G2W A;  3HVE B;  1IQU A;  4HOU A;  1HXI A;  4UQX A;  4EBA A;  1FT1 A;  3QWP A;  5ENR D;  4K03 A;  2J08 A;  4CDM A;  4AIF A;  3CK7 A;  3Q9N C;  4JD2 G;  5HRY A;  1D8E A;  4HQD A;  1FPP A;  3PNT B;  1N95 A;  3FH5 A;  3DPY A;  3URZ A;  4BER A;  3B7S A;  1G3N B;  4DI3 A;  1HFA A;  3PUK A;  4NAC A;  1E8W A;  2XZT G;  3ZU7 B;  4B94 A;  5JHB A;  4WNF A;  1TEZ A;  3V2X A;  1ZBP A;  2C2L A;  2I2O A;  4GA2 A;  4CT0 A;  3SFX A;  1OCO E;  3VTX A;  1N52 A;  3G2S A;  1RZ4 A;  4KZ0 A;  1WAO 1;  1OCR E;  3ZFW A;  4GZ5 A;  4H7Y A;  2EIK E;  3Q49 B;  5H7P A;  5E75 A;  4DX6 D;  5KNH D;  5AYW D;  2IF4 A;  4J8F A;  2NC9 A;  3L82 A;  1SZA A;  3FH8 A;  3DWL G;  1L5J A;  2XRY A;  5D0O D;  3SFZ A;  3HXD A;  4LNU D;  3CVN A;  5AQ9 A;  1TNO A;  3B7T A;  5G2N A;  4NRH B;  5HI7 A;  3DXK G;  5AQ7 A;  4O1O A;  4B89 A;  4B0Z A;  1Y6I A;  4HRM B;  3S7B A;  2H6I A;  4GTM A;  4BTB A;  2OVB A;  3JQ1 A;  2FO7 A;  2X38 A;  2P2C P;  2DBA A;  3TXN A;  3BEE A;  1OWN A;  1A17 A;  4BWR A;  3ZXS A;  3TG5 A;  4GMR A;  4HVB A;  4N3B A;  4ZFH A;  4GPK A;  2AXU A;  3RRN B;  3ZN3 A;  4MLP A;  5AJD A;  2QY7 A;  1TNB A;  2CHX A;  2EIJ E;  4DI4 A;  3GYZ A;  1E8Z A;  3AS5 A;  4X8Q A;  5B3S E;  4URK A;  1AP7 A;  1BI7 B;  4UWG A;  4RG9 A;  2WXF A;  3RJV A;  1O1R A;  4YVQ C;  3EHN A;  3QJZ A;  1YMP A;  3CKC A;  4FJY A;  3RIB A;  2HO1 A;  4UWF A;  1PC2 A;  3I4G A;  4PS3 A;  4IN3 B;  4ILG A;  3DSU A;  1OWM A;  3QOU A;  5LCW C;  2VYI A;  2RD0 A;  4YDY A;  3ZXP A;  4LEU A;  3CVV A;  4JHR A;  1FCH A;  3FTW A;  5FZR A;  1DCE A;  4JHK A;  3PE4 A;  4U95 D;  3FDH A;  4KXK B;  1K3Z D;  3PRZ A;  4HS2 A;  3HG0 D;  5JJT A;  4AJW A;  4UQY A;  3SZ7 A;  3R7Q A;  4TRQ A;  1H2V C;  2J4B A;  5CED B;  2P9I G;  4WND A;  1TNY A;  3PS6 A;  3DST A;  5CEA A;  3GZS A;  2R2L A;  4U0S A;  3ZRH A;  4IUL A;  3CQC B;  3L54 A;  3HVE A;  3TWT A;  1BLX B;  4JEH A;  4A63 B;  3CK9 A;  2R02 A;  3CLJ A;  4G1T A;  3TWR A;  4K5A B;  2A5U A;  3UM0 A;  3OAW A;  3SD5 A;  3K9I A;  1LD8 A;  3ZHE B;  3T8K A;  1BU9 A;  5C1D A;  2XCC A;  4EQF A;  2WXG A;  4I6J A;  3D9O A;  3GZ2 A;  3SBS A;  3EUV A;  3L17 A;  5ANR A;  2RFM A;  3OXG A;  4U8Y D;  4GTQ A;  4G11 A;  3ESK A;  3QC1 A;  4I9C A;  1OT8 A;  1N0Q A;  2L9B A;  3FEX A;  3EHQ A;  5EYP F;  3CHO A;  5J08 A;  4EBA G;  4DPR A;  3CSF A;  4J8Y A;  2DCP A;  3TG4 A;  2ETB A;  4TXQ A;  4AY5 A;  4GTT A;  4MBG A;  1IQR A;  2LSV A;  2FUL A;  1V54 E;  3AJI A;  4KVM A;  5DIZ A;  3CVL A;  3Q78 A;  4E6H A;  3B7U X;  5DBK A;  2XGM A;  1PAQ A;  1HS6 A;  5B1B E;  3U66 A;  4I1A A;  1SA4 A;  1BPO A;  1HF8 A;  4XI0 A;  3D9N A;  5CMW A;  2YIN A;  4FHK A;  4GCO A;  1S70 B;  2VGE A;  3D9I A;  4O1P A;  3DSS A;  3VLF A;  2VJ8 A;  1UJJ A;  1N0R A;  1OWL A;  4U0Z A;  3ZYM A;  3SF4 A;  3BU8 A;  1MX6 A;  5CRU A;  1U3D A;  4GA0 A;  1Y8M A;  3NZU A;  1DC2 A;  5BNW A;  5KJM A;  2YHE A;  3F6Q A;  3FTS A;  1NA3 A;  2VGX B;  5C2Y A;  1YYH A;  4JEU A;  2IO3 C;  2DYS E;  2PNN A;  3D3M A;  3FTU A;  3T5V A;  2WXQ A;  2VGY A;  5HS0 A;  3W9F A;  5CEC B;  4ZHB A;  4BT9 A;  5A23 A;  2P9K G;  1U3C A;  4F1P A;  2GW1 A;  2PM6 A;  3LY8 A;  2B6C A;  3DBS A;  4J8S A;  3KSL A;  4A1S A;  2OEW A;  3MX3 A;  3KEZ A;  4JZY A;  1QQE A;  2GRM A;  3FU6 A;  5T3R A;  4I43 A;  1TN7 A;  5LOZ A;  3KEA A;  2V8S E;  2ZGD A;  3RAU A;  4E85 A;  3MA5 A;  2Y4T A;  2LAH A;  3PNL B;  3WG7 E;  5HKP A;  4ACL A;  4BES A;  2WXR A;  2RKK A;  3W9G A;  3RRU A;  5BXO A;  1E8X A;  2GGF A;  3ONK A;  4GB9 A;  4XX5 A;  1N4Q A;  1WM5 A;  4BET A;  4JL0 A;  4C0E A;  4DK5 A;  4FP7 A;  4Y6C A;  3ZVV A;  3ABM E;  3UT7 A;  3FP3 A;  1NP7 A;  1H19 A;  4ATG A;  2WQH A;  3J5Q B;  4FLH A;  2FI7 A;  3FUM A;  3AG1 E;  3PZD A;  1HE8 A;  5JJ6 A;  2ETA A;  1S0P A;  3U64 A;  3PE3 A;  3NBN B;  3FY4 A;  2CHW A;  1OY3 D;  4UI9 C;  1AWC B;  5FT9 A;  1YA0 A;  4U07 A;  1TN6 A;  2KCL A;  3NOG D;  4OVV A;  5EDS A;  3NOC D;  3ZKJ A;  4HFG A;  2BTD A;  4WWP A;  2V5F A;  3BG1 B;  1LD7 A;  5FIN A;  5LFA A;  2I1J A;  4MKT A;  5JHA A;  3CST A;  3UUX A;  3ZHE A;  4V3I A;  2XPY A;  4AOF A;  3FUI A;  3FWV A;  3C3Q A;  4J8D A;  5CER B;  3DSX A;  3KD7 A;  3UT8 A;  4WAF A;  4A3T A;  1PY1 A;  1WDY A;  3CVP A;  3FU0 A;  5KCM A;  3SFY A;  5BUZ A;  1OWO A;  1UN8 A;  3CQG B;  2ZIS A;  2RG8 A;  1ELK A;  4FJZ A;  1H2T C;  2DVW A;  1NL4 A;  3MZL B;  4BEP A;  2VSO E;  3MKQ B;  2MRI A;  3LDZ A;  4J6I A;  2R03 A;  3HXF A;  2Y0B G;  3ABK E;  2LAI A;  4JA7 A;  1UOH A;  4UWL A;  3I4R B;  1QNF A;  4PDX A;  2L0I A;  3ZUV B;  5LX8 A;  3KS2 A;  4WNG A;  4XEI G;  4CEM A;  3CHM A;  1JUQ A;  2LXL A;  4YVO A;  1OCC E;  5AJL A;  3CEQ A;  3MJW A;  2WXL A;  4RQI A;  3ASH A;  3QWW A;  5ITZ F;  2UWJ G;  5HQ8 A;  3UXG A;  4UI9 K;  4OVU A;  3L16 A;  1QBQ A;  4F3V A;  3FUH A;  2XEH A;  4RLY A;  5ENP D;  1IHG A;  5KNG A;  2OVF A;  5G55 A;  2H6H A;  3L22 A;  1Q2Z A;  4LG6 A;  2XS1 A;  2DYR E;  3MEK A;  5B1A E;  2PZI A;  4F7A A;  4BSX A;  2IO2 C;  4J8E A;  1NA0 A;  4GTP A;  2QC9 A;  2IJG X;  2XRZ A;  5BV0 A;  5T4Y A;  2WVI A;  5D0Q D;  4JB8 P;  4W9R A;  3CV0 A;  5FQ8 A;  1S63 A;  2LSU A;  2QZA A;  3CIA A;  3SQV A;  2EIL E;  5CMY A;  2IOL A;  3PH0 C;  4JVS A;  3C3O A;  3QDN A;  3FH7 A;  2XHE A;  3KAE A;  2DZN A;  4KVO A;  2WXM A;  3P2B A;  4UWK A;  3G2U A;  1H6K A;  5JA4 D;  4YDO A;  3Q47 B;  3FUD A;  3UT4 A;  3ASO E;  3ESL A;  4U8V D;  4OYS A;  4WWN A;  1N4P A;  1N11 A;  4J7W A;  3UM3 A;  4R7L A;  1S64 A;  3FUK A;  4FUL A;  4I6G A;  4K5C A;  3LJ3 A;  3R9M A;  3PZ4 A;  1Z6T A;  2PM7 A;  2P9L G;  4OAV B;  3EU9 A;  4XI9 A;  4G23 A;  4DUI A;  5FQ7 A;  3Q7A A;  3APF A;  5FQ6 A;  2R17 C;  4UQZ A;  4YDE A;  3EU5 A;  3IV0 A;  4M3O A;  1B89 A;  3Q4A B;  4N39 A;  1E90 A;  2YQ8 A;  4C0M A;  3S2A A;  2M63 A;  3IBE A;  5ANL A;  4EZL A;  4DX2 A;  4P29 A;  5KBA A;  2OCC E;  4DRX E;  4KYO B;  3FUF A;  3NF1 A;  3EHR A;  4GZC A;  3V31 A;  4GCN A;  3EHM A;  2WPV A;  3SGH A;  5BW8 C;  1MHQ A;  4XKC A;  1Z3X A;  4K5B A;  4GU5 A;  3TWW A;  4GZ3 A;  2BKG A;  1KLX A;  2FEZ A;  3S7D A;  1K1B A;  1HH8 A;  3CR3 A;  4XZ4 A;  3MV2 B;  4RSY A;  3LS8 A;  1N4S A;  1JPL A;  4BY6 A;  3FTZ A;  1QYM A;  4MRU A;  4L9P A;  3Q7F A;  3SBT B;  3MKQ A;  3JXI A;  3Q75 A;  4A1G A;  4BT8 A;  2HM8 A;  3LCA A;  2H6F A;  3G2T A;  2VSN A;  1JWF A;  1N4R A;  4G2V A;  2I1K A;  3FU3 A;  5BV1 A;  4U7E B;  4HOT A;  3LVQ E;  1W3B A;  3TAX A;  3G2V A;  2WXP A;  2ZIR A;  3JUE A;  2QYJ A;  3C98 A;  1H2U A;  2HR2 A;  2JEK A;  4HI8 A;  2YNQ A;  1O1S A;  2NSZ A;  4FAD A;  1IXV A;  3V2O A;  1X5B A;  3HHM A;  5KJL A;  3RU0 A;  1N9A A;  4DX5 D;  3ASG A;  3PZ2 A;  4PH4 B;  3ABL E;  2Y4U A;  4LCT A;  3HXB A;  3EIQ C;  1DNP A;  1N94 A;  3QK0 A;  5G04 J;  3HXE A;  2WXK A;  2VSY A;  2PQN A;  5FTP A;  3NQP A;  2J49 A;  1NI1 A;  2PL2 A;  3PDN A;  4BSZ B;  2AWI A;  2EQX A;  3FUE A;  1XNF A;  3U9W A;  2VTB B;  2E2E A;  3GZ1 A;  5BXU A;  1HO8 A;  2CFU A;  2OV8 A;  4CGW A;  2P9P G;  3CHS A;  4DX1 A;  5IY5 E;  2J9Q A;  3X2Q E;  1FVF A;  3TJP A;  2E0I A;  2JLB A;  3RK6 A;  1H6P A;  2Y69 E;  2KM4 A;  1K1A A;  3UIO C;  2C0M A;  2MHK A;  3ZYK A;  4HI9 A;  2NXP A;  5EX0 A;  5AQB A;  2L6B A;  2OEV A;  3FEY A;  4BX8 A;  5EX3 A;  1INZ A;  4L2Y A;  4DX7 D;  3BG0 B;  2R5S A;  3PZ3 A;  4HBD A;  1JCR A;  4CCA A;  2X6H A;  3ML9 A;  1U2V G;  1EYH A;  2F8X K;  4I1M A;  1HZ4 A;  2IQC A;  3CHQ A;  4WUY A;  2CHZ A;  2J8S D;  3EDT B;  3TL5 A;  2P9S G;  3FFL A;  4CDR A;  4ILI A;  4Y6W A;  4BFR A;  1SA5 A;  2XS8 A;  3HRA A;  4A55 A;  2AXZ A;  2IOS A;  1A5E A;  5AAR A;  3ZIM A;  2V0P A;  3DRA A;  4ME2 A;  1UJK A;  3ULQ A;  3AU5 A;  3ZYQ A;  3CVW A;  2FO1 E;  4LER A;  3APC A;  3FHE A;  5FZS A;  4GTV A;  4F53 A;  3VLD A;  3TWU A;  4ANX A;  4HLE A;  3VLE A;  3L08 A;  3P1U A;  3JCK C;  3UX4 A;  4N5C A;  1MJ0 A;  4U0U A;  3EIJ A;  3AG4 E;  3UI2 A;  3O4Z A;  3CVQ A;  1NZN A;  1EDU A;  4L1B A;  3D9K A;  3TWX A;  3TWV A;  2MYO A;  2L6J A;  2CG3 A;  1SW6 A;  4ILH B;  3AAA C;  3Q5M A;  4I2Z A;  1BI8 B;  4B93 B;  3IHY A;  4KBQ A;  2KCV A;  3GW4 A;  2X6F A;  3E37 A;  2J07 A;  2GRP B;  2C0L A;  5KJN A;  1TYQ G;  4GTO A;  3RKV A;  3FUL A;  4I6E A;  4EHM A;  3LJN A;  1RW2 A;  3QB2 A;  4TUM A;  4XKB A;  2XCB A;  1IYG A;  3DEP A;  4JHJ A;  2CFZ A;  4FHJ A;  2CG2 A;  4AV7 A;  1XGW A;  3T5X A;  4KZC A;  3L6A A;  4TXP A;  4ACK A;  5CCL A;  5EIB E;  4WWO A;  3LY9 A;  4AP2 A;  4AVX A;  1TR4 A;  3B7R L;  2WQ7 A;  3SI5 A;  2GRQ B;  4WNE A;  4G8K A;  3SO8 A;  4GA1 A;  4ANV A;  2VTB A;  3UKR G;  3B7B A;  3E32 A;  5CBO A;  4QQI A;  3BUA A;  5ENT D;  3E4B A;  3FUJ A;  2KC7 A;  5FJY A;  2KZT B;  3TWQ A;  5FQ4 A;  4B8A A;  3QNK A;  1E7U A;  2ZU6 B;  1KT0 A;  3LEW A;  4PS7 A;  1OUV A;  4L23 A;  1TNU A;  3TXM A;  2LXM A;  2Q7F A;  3U4T A;  2XGO A;  4NQ0 A;  3ONL A;  4O60 A;  3S7J A;  3LXU X;  4M7C A;  4GMJ A;  4UI9 J;  3DSV A;  2WXH A;  5CCM A;  3HDX A;  2F37 A;  5JJ7 A;  5J90 A;  2DZO A;  5EIL A;  4EZK A;  2LO6 A;  2V4H C;  3D9M A;  4Q96 A;  2F0Y A;  4C48 B;  2VGX A;  3OXL A;  2LUH A;  3B95 A;  2XEV A;  4Q69 A;  2J4D A;  4N2Q A;  3AS4 A;  3NZS A;  2BKK B;  4APF A;  1NFI E;  3NAW A;  3UKU G;  4I1O B;  3JQ0 A;  3R7R A;  3CK8 A;  4QFV A;  3FTV A;  3E33 A;  5EYL A;  3CVU A;  3JYS A;  3RSE G;  1D9S A;  4A3V A;  1KZP A;  3D9H A;  3QWV A;  5EN5 D;  4NIK A;  3C3R A;  2XEN A;  5BPP A;  1EF1 C;  2GRN B;  2PQR A;  3O48 A;  3T8M A;  4HOS A;  4D10 C;  5G05 J;  4F1S A;  1GW6 A;  2ZGG A;  1E96 B;  4GZD A;  2AXV A;  4N3A A;  4APO A;  4KT6 B;  4GPM A;  3V30 A;  1D8D A;  3SY2 A;  1KZO A;  3C72 A;  4OAU C;  3MCX A;  2ILR A;  3R9A B;  2WXJ A;  5AAO A;  4G25 A;  3V79 K;  4I17 A;  4BX9 A;  4I2W A;  1DVP A;  3LPZ A;  2GRR B;  3CHR A;  1UW4 B;  3CVX A;  4Q94 A;  5A7D B;  3ULY A;  5FWQ A;  5BT1 A;  3L9T A;  4CDN A;  1VDY A;  2A4Z A;  1UG3 A;  3RO2 A;  2X6I A;  3ZNG A;  5CRV A;  3E30 A;  1E8Y A;  2OND A;  2L0T B;  2X6K A;  4ANU A;  4GZ6 A;  2H6G A;  2EIN E;  5G04 C;  1DCQ A;  5AEN A;  4U63 A;  4LNB A;  3Q9U C;  3MYV A;  4Z68 A;  4J0U A;  3E34 A;  3ASF A;  1Z3Y A;  3VTY A;  1MYO A;  2QYU A;  3MGB A;  4DLQ A;  5M72 A;  2LNI A;  4ATZ D;  4DLO A;  3PEV B;  4AY6 A;  2VSX E;  2BED A;  3UMV A;  4FU3 A;  2ION A;  2X6J A;  3AG3 E;  2UY1 B;  3SHF A;  1ZB1 A;  1JCS A;  4G26 A;  3AS8 A;  1K8K G;  4UUC A;  4I9E A;  2WXN A;  4UWH A;  5ARF A;  2DIW A;  2IU1 A;  4FA6 A;  1N54 A;  1Z5S C;  5ENN A;  4HOR A;  2KZT A;  1P5Q A;  3ZPJ A;  2KAT A;  5D2M C;  5ENQ D;  3C5R A;  1E7V A;  4GYO A;  3PEU B;  4IYP A;  2MOW A;  5T8I A;  4EZJ A;  5KJK A;  3MKR A;  4B8C B;  2KBX A;  4N3C A;  5E76 A;  5AN8 A;  3SNX A;  2WB2 A;  1FT2 A;  3T9K A;  2VQ2 A;  4HB5 A;  4GYW A;  3Q73 A;  4C9B B;  3HIZ A;  4N2S A;  1MX4 A;  3D9J A;  3UIP C;  2J09 A;  1IKN D;  2QFC A;  3QAQ A;  3S7F A;  2XEE A;  1JCQ A;  4PUC A;  5A6C A;  3PVL A;  3LY7 A;  3D9L A;  4JC8 A;  3ZGQ A;  2DWZ A;  1SVX A;  2Y1L E;  5D66 A;  3ZYL A;  2A5E A;  4BTA A;  5CHE E;  3U3W A;  4HRN A;  4CGV A;  3CVY A;  5AQA A;  2BF0 X;  3FU5 A;  3OXF A;  4K0R A;  2AVP A;  2AW6 A;  5LCW J;  2WQ6 A;  2HE0 A;  3ML8 A;  1MQS A;  2WMN A;  2KXP C;  2ETC A;  2P58 C;  4LUN U;  1HU3 A;  4AM9 A;  4EPZ A;  3DPD A;  3HYM B;  3UM2 A;  4TV3 A;  4HRL A;  4YND A;  4CT4 A;  5CBN A;  2R59 A;  3BQO A;  2Y3A A;  1KT1 A;  3IEG A;  1TN8 A;  2F8Y A;  2P9N G;  3I3N A;  2GRO B;  2BUG A;  4G24 A;  1OXJ A;  4U96 D;  2ZXW E;  2WXO A;  2WMO A;  2XPZ A;  3AU4 A;  1ELW A;  4GAA A;  1O1T A;  4N5Q A;  1YCS B;  3J5P A;  1FVH A;  3MV3 B;  3RO3 A;  2WXI A;  1LF8 A;  4XIF A;  4EEC A;  1KPS B;  1OCZ E;  4JW1 A;  1H0A A;  4DJA A;  5ENS D;  5LP0 A;  3UQ3 A;  2IY0 C;  1EPU A;  3DEO A;  4LSZ E;  2V4L A;  3L13 A;  3Q79 A;  4U04 A;  3KSQ A;  1HG2 A;  4JA9 A;  2FF4 A;  5KWD A;  1MX2 A;  3AG2 E;  3NB2 A;  3PUJ A;  4G8L A;  2V5Q C;  1HG5 A;  4TXR A;  1BD8 A;  4HOQ A;  4KMO A;  1SQM A;  4AXH A;  4CZ2 D;  3UIN C;  5EKQ D;  1X81 A;  3QAR A;  4NUR A;  1ZU2 A;  3APD A;  3UM1 A;  2JAB A;  4GML A;  4RVB A;  4O6F A;  1OWP A;  3OTN A;  4FC8 A;  1MZC A;  5JMN D;  3FTY A;  3IXE A;  2P9U G;  5FIO A;  4HLL A;  2WM9 A;  3FUN A;  2GRL A;  2IFU A;  2UY1 A;  2IEJ A;  4H7X A;  1TNZ A;  2EIM E;  3JXJ A;  2I9C A;  5ENO D;  3DXM G;  5FZQ A;  3ISM C;  4U8H A;  4JXT A;  4CYM D;  4ANW A;  3ZW3 A;  4HXI A;  3EJN A;  4GYY A;  4MS6 A;  1WG0 A;  2XZD G;  3IKO B;  3B13 A;  4L7T A;  4JPS A;  4F6R D;  5ARG A;  3D9P A;  2I6H A;  1LTX A;  4GTR A; 
#chains in the Genus database with same CATH homology
 1N4Q A;  4LNB A;  1JCQ A;  1D8E A;  4YDO A;  4GTV A;  3Q79 A;  4LNG A;  1N4S A;  3E34 A;  1FPP A;  3KSQ A;  3HXC A;  3DSS A;  1N95 A;  3E33 A;  3Q7F A;  4L9P A;  3DPY A;  1N4P A;  1TNB A;  3Q75 A;  3E32 A;  1S64 A;  3DSW A;  1KZP A;  2BED A;  1O5M A;  2H6F A;  1LD8 A;  1O1R A;  1X81 A;  3PZ4 A;  1N4R A;  1TN6 A;  1QBQ A;  1JCS A;  3SFX A;  3PZ1 A;  3EUV A;  1LD7 A;  2ZIR A;  4GTR A;  1D8D A;  3DSU A;  1KZO A;  2H6H A;  3C72 A;  3PZ3 A;  1JCR A;  1O1S A;  1TNU A;  4GTQ A;  3Q7A A;  1MZC A;  1TN8 A;  3DSX A;  2IEJ A;  4GTP A;  4YDE A;  3EU5 A;  1TNZ A;  1DCE A;  1N9A A;  3E37 A;  3KSL A;  3SFY A;  3PZ2 A;  4GTS A;  3HXB A;  3DSV A;  2ZIS A;  1SA5 A;  4GTO A;  1N94 A;  1O1T A;  3HXD A;  4EHM A;  3HXE A;  1TNO A;  1S63 A;  1TN7 A;  1FT2 A;  4GTT A;  4MBG A;  1NI1 A;  1NL4 A;  2F0Y A;  3Q73 A;  3Q78 A;  3E30 A;  2H6I A;  4GTM A;  1FT1 A;  3DRA A;  3HXF A;  1TNY A;  3DST A;  2R2L A;  2H6G A;  1LTX A;  1SA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...