3MKRA

Crystal structure of yeast alpha/epsilon-cop subcomplex of the copi vesicular coat
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
DELFDVKNAFYIGSYQQCINEAQRVKPSSPERDVERDVFLYRAYLAQRKYGVVLDEIKPSSAPELQAVRMFAEYLASHSRRDAIVAELDREMSRSVDVTNTTFLLMAASIYFYDQNPDAALRTLHQGDSLECMAMTVQILLKLDRLDLARKELKKMQDQDEDATLTQLATAWVSLAAGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGVLQEALDKDSGHPETLINLVVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYRAKENDFDRLVLQYAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coatomer subunit epsilon
publication title Structure of coatomer cage proteins and the relationship among COPI, COPII, and clathrin vesicle coats.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transport protein
total genus 112
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2010-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3mkrA00
4AY6A 1WAO1 3CVLA 5KJMA 4H7YA 3LY8A 3U3WA 4BT8A 4BTAA 2Y4TA 2FI7A 1HXIA 1Y8MA 3OXLA 3RIBA 1ZU2A 5D0QD 3ZN3A 5A6CA 2LNIA 3UPVA 3KS2A 4CGVA 2FO7A 1IYGA 4GA1A 4UI9J 4NRHB 3CKBA 1IHGA 4U0UA 1FCHA 3WXXA 4LEUA 2IF4A 4Y6CA 4I1AA 5FZRA 1PC2A 5LCWJ 3NF1A 1W3BA 4AIFA 5EX3A 4KYOB 5BNWA 3OXGA 2FEZA 4GCNA 4U0ZA 5CHEE 3E4BA 2XGSA 4HOSA 5G04C 4G1TA 2VSYA 3LYAA 3ZFWA 4I2WA 3PE4A 2VSNA 1QQEA 4WNGA 1HZ4A 5D0OD 3MKRA 5C1DA 4GCOA 2PQNA 4GA2A 2JLBA 4N3BA 3AS8A 3GZ2A 2C2LA 3LY9A 3ZPJA 4N2SA 2PQRA 5BT1A 3KD7A 2VQ2A 4UQZA 2VGXA 3FFLA 2QFCA 3VTYA 1KT1A 3FWVA 4I17A 2XCCA 5G05C 2LSVA 3HYMB 3Q47B 4XIFA 2P58C 3GYZA 3QDNA 3UUXA 3EDTB 3U4TA 4HORA 4G2VA 4N5CA 1NZNA 2HYZA 2YQ8A 3N71A 3MEKA 3PE3A 2LSUA 3RO2A 4J8EA 1ZBPA 4G25A 1B89A 3S7JA 2R5SA 1HH8A 4Y6WA 5DIZA 2UWJG 5EX0A 4AY5A 2OOEA 3ASFA 3ZGQA 4GYOA 3GZ1A 2WPVA 4JA7A 2XGMA 1YA0A 5HI7A 3CVQA 2V5FA 4U07A 4RG6A 2KCKA 4KBQA 4JA9A 5BW8C 3RU0A 2GW1A 3TG4A 2HR2A 4KXKB 3S7FA 3QOUA 2XGOA 3OXFA 2I6HA 5EKQD 2C0LA 1QZ2A 3PDNA 3TAXA 4GYWA 5FT9A 2Q7FA 3CVNA 5M72A 1KT0A 5DBKA 4I2ZA 2VYIA 5FZSA 2MHKA 2WQHA 3LKUA 2YHCA 4B94A 4NQ0A 4W9RA 3QKYA 3ZHEA 3O48A 4GZ5A 4EQFA 4G26A 4IN3B 5JJTA 2ONDA 5KJNA 4YVQC 4JL0A 2XCBA 5A7DB 3K9IA 1P5QA 3Q49B 3TG5A 4N2QA 4BWRA 4YNDA 2KC7A 4N3AA 4UI9K 3QWPA 5ARGA 3VTXA 4WNDA 3ASHA 4HOQA 2UY1B 4YVOA 1KLXA 5KJKA 3FP3A 2NC9A 2KCLA 5G04J 2FF4A 5FTPA 2VGXB 4UI9C 3GW4A 3CK9A 5CCLA 4UQYA 5ARFA 3UQ3A 4HOTA 4BTBA 4O6FA 5CCMA 3SZ7A 4WNEA 5FZQA 5LCWC 3AS5A 2C0MA 4I9CA 4G24A 4WUYA 2KATA 4GA0A 5JJ7A 1TJCA 5AYWD 4GPKA 4ABNA 4GZ3A 4U04A 3ASDA 4F3VA 3CVPA 5G05J 3RJVA 4RG9A 3CV0A 4APOA 3IEGA 4XI0A 2XPIA 4XI9A 3RKVA 2BUGA 1NA0A 3Q5MA 2Y4UA 3ASGA 1OUVA 3AS4A 4BT9A 1A17A 4H7XA 3URZA 3Q15A 4N3CA 2PZIA 4JHRA 1XNFA 2J9QA 1ELRA 3SF4A 3RO3A 3LCAA 4N39A 4J8DA 4ME2A 4WNFA 1ELWA 3TGOA 3BEEA 2PL2A 3Q4AB 3S7BA 2KCVA 3JYSA 1WM5A 4U0SA 3CK7A 2L6JA 3ESKA 1E96B 3MV2B 3CKCA 5HQ8A 2XEVA 5KJLA 4J8FA 3ZHEB 2E2EA 2VGYA 4G23A 4I9EA 5JJ6A 3ULQA 4CGWA 3MV3B 3LPZA 3QWVA 4UQXA 4CDRA 2UY1A 4GZ6A 2FBNA 3CK8A 3LY7A 3MA5A 3CEQA 2AVPA 4A1SA 4AM9A 4GYYA 3S7DA 3R9AB 1NA3A 4HOUA 2HO1A 3QWWA 5FJYA 3KAEA 4J0UA 2DBAA 2IFUA
chains in the Genus database with same CATH superfamily
3UMVA 3FTYA 2J4DA 1O1SA 3SD5A 3CVLA 2JEKA 4L23A 4FU3A 3LY8A 3U3WA 1MZCA 3DSXA 2XHEA 4TUUA 3FTSA 3ESLA 5CBNA 4C0EA 5ENSD 5BXUA 3HHMA 3L22A 2LNIA 3FH8A 4YDEA 2XQ0A 5ENTD 5AQAA 3L16A 4UI9J 4NRHB 4P29A 2RKKA 3ULYA 5AQ9A 4TXPA 3ASNE 4Q94A 4U0UA 2CHXA 2WXGA 3WXXA 1RZ4A 5FZRA 4HVBA 1W3BA 4J7WA 1K1AA 1H6KA 2RFAA 1BU9A 2IONA 4V3IA 3R9MA 3L13A 1TNOA 3PE4A 5KCMA 5HKPA 1LF8A 4UWLA 1DC2A 5D0OD 2ZGDA 3J5QB 3NBNB 3PNTB 4TXRA 5AJLA 3AS8A 3FDHA 4B8AA 3LY9A 5CMWA 1U3CA 4ANWA 5ITZF 4UQZA 2LO6A 3JQ0A 5FWQA 3VTYA 3V2XA 3FWVA 3B7RL 3C72A 4L1BA 3TWTA 3MGBA 5G05C 2LSVA 3Q7FA 3Q47B 4R7LA 3AG2E 3D9OA 2MRIA 3QDNA 4HLLA 3U4TA 3TXMA 2HYZA 2YQ8A 2OVBA 2Y0BG 4K0RA 3HXBA 4D10C 4B89A 1U3DA 2L6BA 2LSUA 4EZLA 4DX1A 3APDA 4G25A 4AVXA 4BX8A 2P9KG 2R5SA 2H6IA 1HH8A 3T5XA 2CG3A 3LVQE 1H2UA 4AEZC 4UUCA 5BV1A 5J90A 4I6JA 3ZGQA 4GTSA 3TWQA 2PM6A 3GZ1A 4J6IA 4LUNU 3CQGB 1S64A 3I5PA 4IYPA 5CRUA 2J8SD 5HI7A 4BX9A 2V5FA 3ULEG 4U07A 4UWGA 4ACLA 3EU9A 3ZNGA 3RRMB 3HVEA 1TN8A 3BG0B 4KXKB 3UXGA 4GTOA 1MHQA 4PDXA 4ZFHA 2R02A 1NP7A 5KBAA 2Y3AA 5LOZA 5FQ7A 3CVNA 4K5BA 2WB2A 3FU6A 4DK5A 3B7UX 4U96D 2DWZA 5FZSA 2MHKA 1NL4A 2GROB 2H6GA 2WQHA 3B13A 4GB9A 2VTBB 4CCAA 5CEDB 5HRYA 2YHCA 1X5BA 3TXNA 2WXRA 4NQ0A 1LTXA 3FHEA 3QKYA 3LXUX 1YCSB 4ILGA 3AU4A 4G26A 2XRZA 1N9AA 5JJTA 3G2SA 3CSTA 2ONDA 4JZYA 4FLBA 3X2QE 3D9NA 4K5AB 2J49A 5LFAA 3OAWA 2A4ZA 1E8YA 3L82A 1P5QA 1FT2A 2B0OE 2KC7A 3PZ4A 1OCZE 3TWWA 5AENA 4UI9K 1OWNA 4GAAA 4WNDA 3FU5A 3ASHA 1BLXB 1KLXA 4KT6B 4JEUA 3JUEA 4CDNA 4MRUA 1MX6A 5G04J 2VGXB 4UI9C 3GW4A 3KEZA 3LEWA 4UQYA 1FVFA 3DRAA 5ARFA 3RSEG 1K1BA 5D66A 2WMOA 4HOTA 2QC9A 3CIAA 1MX4A 2ETCA 1KZPA 2V8SE 2XZTG 3MKQB 3IHVA 3Q79A 4I9CA 1E7UA 2IQCA 2GRPB 2KATA 4GA0A 5FQ4A 4B0ZA 4DUIA 2V4HC 4FHJA 4GZ3A 3VLFA 4F53A 1O1RA 2QZAA 5EIBE 1E8WA 4APOA 3IEGA 4WWOA 2BUGA 4ZHBA 1UG3A 4YDWA 1TYQG 1JCRA 5BV0A 4ATZD 2RD0A 1Z3XA 3UI2A 1A17A 4HI8A 3PZ1A 1TNZA 4CT0A 2ZISA 2AXZA 4XZ4A 3SF4A 2P9NG 4XKBA 3IV0A 1ELWA 3TGOA 3BEEA 2PL2A 2QYUA 2KZTA 4UWFA 2KCVA 3JYSA 5G2NA 2P2CP 1H2TC 2GRQB 2X6JA 4G8LA 4HRMB 4RSYA 4LNGA 2E0IA 5KWDA 3PEUB 4G23A 4GTTA 3ULQA 3TWSA 3QWVA 1MQSA 2UY1A 4AOFA 3TJPA 1UOHA 4HFGA 4DRXE 3ASOE 4G11A 2WQ6A 3S7DA 3LS8A 4HOUA 4A63B 4EZKA 1QBQA 2XRYA 2PM7A 3QNKA 2IOSA 3KAEA 4J0UA 2DBAA 3ABLE 2F37A 4B8CB 3HXEA 3DBSA 2FI7A 3FTVA 3SFXA 3MCXA 1Y8MA 2QY7A 5EIDA 4QFVA 4AJWA 5D0QD 3ZN3A 3Q73A 3UPVA 3KS2A 2B6CA 4WAFA 1IYGA 2VSOE 4GA1A 1PY1A 4X8QA 3CKBA 1LD8A 3D9HA 1OWMA 4DPRA 2VTBA 3ZUVB 2WXOA 3HVEB 3FUNA 4LEUA 2OEVA 3TWXA 4Y6CA 4I1AA 4EECA 1PC2A 3CSFA 1JWFA 1SZAA 2H6FA 3B7BA 3OXGA 4XE0A 5CHEE 3FY4A 1H2VC 1SVXA 4EBAG 1N4PA 4Q69A 3BG1B 5G04C 1Q2ZA 2Y1LE 1H6PA 4NURA 5KNHD 3EJNA 2VSNA 1TN7A 3EHMA 2PQNA 2X6HA 4BEPA 5AAOA 2JLBA 4N3BA 2C2LA 3ENEA 3ZPJA 2A5UA 4N2SA 1S0PA 2VGXA 5J08A 3PS6A 3LJNA 2AW6A 3P2BA 4N5CA 3ZXSA 4DX5D 1NZNA 4I1MA 4I6GA 2P9PG 1LD7A 1TJFA 3MEKA 2EQXA 3PE3A 3RO2A 1ZBPA 5E75A 4A3VA 3RRUA 4FADA 3VLDA 4CDMA 5D2MC 2ZIRA 5DIZA 3D9IA 2UWJG 3QARA 2J07A 3ASFA 3CVUA 5ANRA 4OYSA 4GPMA 5IY5E 2WXLA 3PH0C 2XGMA 1YA0A 3RRNB 3NB2A 1DVPA 4KBQA 3CGHA 1OCRE 5EYPF 2X6IA 3ZEFA 3ZVVA 3TG4A 3EHQA 3UIPC 2IJGX 4YDOA 4K5CA 1D9SA 3S7FA 2XGOA 2C0LA 3PDNA 3UKRG 3TAXA 3MZLB 4FJZA 5FT9A 5M72A 2IEJA 1OWOA 5DBKA 1MYOA 3U9WA 4O60A 4CRWA 4PUCA 2WXQA 3SFYA 3UT8A 3QK0A 3AG4E 3O48A 5ANLA 4JD2G 4GU5A 4K03A 3L54A 1OY3D 2P9UG 2X6KA 3TL5A 2VSXE 2QYJA 3ABME 5ENNA 2KZTB 2XCBA 2YINA 1Z5SC 1K8KG 3FTZA 3JXIA 3Q49B 3TG5A 4N2QA 4FP7A 4U7EB 2J4BA 4NACA 4N3AA 3AU5A 3PREA 5BUZA 1E8ZA 3U64A 1V54E 2UY1B 2WXPA 3OTNA 2KCLA 2FF4A 2CFUA 5CCLA 3HIZA 2WVIA 3UQ3A 5C2YA 4HNAD 4FHKA 4O6FA 4F7AA 3SZ7A 3GZSA 4WNEA 5FZQA 1IHBA 3UT4A 3PUJA 4BSZB 1UJJA 5JJ7A 1TJCA 1TN6A 4BESA 3G2WA 4HRLA 1Z3YA 4DI3A 2AWIA 4PS3A 4KMOA 4RG9A 5T8IA 3TWRA 3L6AA 3SBSA 1UN9A 1D8EA 4XI0A 3RKVA 4RQIA 4XEIG 4JW1A 3Q5MA 2Y4UA 4C0MA 3JUIA 3EU5A 4A55A 1OUVA 4HLEA 4F6RD 3ML9A 3BUAA 4H7XA 3CHMA 3URZA 3ZYKA 5JHAA 2YHEA 1BD8A 2PZIA 5ENOD 3FTWA 3FUKA 3WG7E 2J9QA 1ELRA 5H7PA 4N39A 1UW4B 4O1OA 4ME2A 5G55A 4IULA 3CHSA 1UJKA 3SGHA 1TNBA 2NSZA 3CK7A 4F1PA 3CLJA 3ESKA 1E96B 1X81A 5AN8A 4J8FA 5EDSA 4MBGA 1EDUA 4BY6A 5T4YA 2VGYA 4I9EA 5JJ6A 2EILE 4Z68A 4URKA 4CGWA 3MV3B 3LPZA 3C98A 3E30A 2DYRE 4CDRA 4FA6A 4GZ6A 4I43A 1FPPA 4HXIA 4RVBA 2HE0A 4JPSA 3CEQA 1A5EA 2AVPA 3T8MA 2KM4A 3CHOA 1N94A 2KBXA 3CVWA 5AQ7A 2ILRA 1WY6A 3I4RB 5FJYA 1XGWA 2L0TB 4MS6A 2IFUA 2IO2C 1OCCE 1WAO1 1AWCB 3ISMC 4KVMA 1OWLA 4KVOA 5FQ6A 4BSXA 3O4ZA 3FU3A 2Y4TA 1BI7B 2J08A 3IXEA 4DI4A 1HXIA 2BKGA 3CHQA 3F6QA 2LXLA 4F1SA 3OXLA 5JMND 3G2UA 5AJDA 2MOWA 1ZU2A 3V31A 5A6CA 1HG2A 2V0PA 3ZYMA 3HXCA 4FULA 2WMNA 4HQDA 4M7CA 1FCHA 2ZXWE 1JWGA 3FTXA 4GMRA 2IF4A 3L08A 5LCWJ 3NF1A 2J09A 4AIFA 4HBDA 4KYOB 3C3QA 3FUIA 2X38A 3I4GA 4BERA 4DX6D 3EIQC 4GCNA 4U0ZA 3LDZA 4CZ2D 2I2OA 3FULA 2VSYA 3NOGD 3ZFWA 1QQEA 3CVYA 3V79K 4WNGA 3IHYA 2EIJE 4M3OA 3ONLA 5ENRD 3SI5A 5C1DA 1O1TA 4GA2A 4XKCA 3KSLA 1KPSB 2LXMA 3CQCB 5AQBA 2VQ2A 2V5QC 4JEHA 4JXTA 1E8XA 1KT1A 4I17A 2XCCA 3DEOA 4XIFA 4KZCA 2GRLA 3SHFA 3S2AA 3JQ1A 3EHRA 4G2VA 3UKUG 2XZDG 3DSUA 5FINA 2R03A 2I1KA 3SO8A 3FUEA 1OT8A 1SQMA 1U2VG 1B89A 1MJ0A 4JC8A 3T8KA 2EIKE 2IOLA 4Y6WA 1BI8B 3PRZA 4FC8A 5EX0A 4E6HA 4BFRA 3ZRHA 2OOEA 1N95A 2Y69E 4KZ0A 4GYOA 2A5EA 1DCEA 2CHWA 3RAUA 4JA7A 4A3TA 3CVQA 4RG6A 4JA9A 4I6EA 5BW8C 1N54A 3D9KA 5JA4D 2AJAA 2GRMA 3W9FA 3FUMA 3SY2A 3QOUA 1BPOA 1VDYA 3OXFA 1NI1A 3EIJA 2XEEA 4GYWA 2GRNB 3IBEA 1KT0A 3UIOC 4I2ZA 3FTUA 3UM1A 2VYIA 4DLQA 2HM8A 4HB5A 3APFA 3MX3A 3LKUA 2XPYA 4B94A 3V30A 3UM3A 3DPDA 5CECB 4W9RA 2OVFA 2IU1A 4GZ5A 1SA4A 3TWUA 1N0QA 4L2YA 5KJNA 4GTMA 3DSVA 4YVQC 4DX7D 4BETA 5AIJA 5A7DB 3K9IA 4ILIA 1ELKA 3CVXA 3W9GA 3ONKA 1SZ9A 2OV8A 4BWRA 4YNDA 2WQ7A 5A23A 1WG0A 1PAQA 3B7SA 2PNNA 3QWPA 2WXMA 4E85A 4EHMA 1WDYA 2IY0C 4YVOA 3P1UA 1NFIE 3HG0D 4OVVA 3FP3A 2LAIA 4J8YA 2M63A 2ETBA 5FTPA 2WXHA 3G2VA 3FUHA 3C3RA 1AP7A 3I3NA 2VJ8A 1EPUA 2DCPA 4GZDA 2IO3C 5CCMA 2P9IG 2F0YA 4WWNA 5LCWC 3CHPA 3KEAA 3FEYA 3LVRE 4MLPA 4WUYA 3ZW3A 4PS7A 5AYWD 4GMLA 2MYOA 4ABNA 4LG6A 3SQVA 4U04A 4F3VA 3CVPA 1KZOA 3RJVA 4OAVB 3QAQA 4HRNA 4LNBA 5EN5D 2GRRB 5B3SE 1N4SA 1H19A 2DYSE 2BTDA 3NZUA 3AS4A 4BT9A 3BQOA 4MKTA 1N11A 2P9LG 3ZKJA 2RG8A 3Q15A 3QC1A 1SW6A 4JHRA 4EPZA 1XNFA 1QNFA 4XX5A 3RO3A 2R59A 4L7TA 5LP0A 3LCAA 3T9KA 5KNGA 4J8DA 4WNFA 2WXJA 3S7BA 4U8YD 3D9LA 1TEZA 1S63A 3HXFA 1WM5A 4U0SA 2VGEA 5CEAA 2L6JA 3CKCA 5HQ8A 2XEVA 5KJLA 3AG3E 3PVLA 4JB8P 3ZHEB 4PS8A 2E2EA 2XENA 2H6HA 4DJAA 3DSWA 3FU0A 2NYJA 1Z6TA 4UQXA 5E76A 3D9JA 2FBNA 3LY7A 3B7TA 4LRZA 3SFZA 4IRUA 4AM9A 4J8SA 3DPYA 1NA3A 3T5VA 2HO1A 5FQ8A 4CYMD 1JPLA 3QWWA 4C9BB 4ILHB 2BF0X 3B95A 4ANVA 3UINC 2CFZA 4ANUA 4TRQA 3NOCD 4AY6A 1INZA 1IQRA 5KJMA 4HS2A 4H7YA 3EHNA 1D8DA 4BT8A 4BTAA 1GW6A 3NZSA 1HF8A 4ANXA 1HE8A 1G3NB 2EIME 3DSTA 3RIBA 4DX2A 1FVHA 4FLHA 3MJWA 3C5RA 3G2TA 4UWKA 3AG1E 4UWHA 4CGVA 2OEWA 1JCQA 2FO7A 1H6OA 1EYHA 3HDXA 2DIWA 2AXVA 3PUKA 5BPPA 1H0AA 1IHGA 2R17C 4U95D 2DZNA 3SBTB 1IXVA 3APCA 3VLEA 2NXPA 5EX3A 2P9SG 5BNWA 2FEZA 3FH7A 3UX4A 2DZOA 2X3MA 3E4BA 3Q78A 3ML8A 2XGSA 1HO8A 4HOSA 4EZJA 4G1TA 2XS1A 4JHJA 3LYAA 3QJZA 1O5MA 4I2WA 4L9PA 2ZU6B 2WM9A 4GTQA 5B1BE 1IKND 3NAWA 1HZ4A 3AJIA 3MKRA 1ZB1A 5CBOA 4GCOA 3PNLB 3U66A 3GZ2A 3E34A 3ZU7B 2PQRA 5BT1A 2WXNA 3KD7A 3QB2A 3FFLA 2QFCA 4LSZE 1HFAA 3HYMB 1RW2A 1Y6IA 2P58C 2XPZA 3V2OA 3GYZA 4TV3A 1EF1C 3UUXA 3EDTB 4HORA 2RFMA 3KSQA 2AXUA 2XS8A 2KXPC 3N71A 5LX8A 1V55E 4CEMA 2JABA 4J8EA 3S7JA 4DLOA 5FIOA 1OWPA 2LAHA 4TUMA 3FH5A 5AARA 1DCQA 4AY5A 4APFA 3FUJA 2F8XK 3UT7A 4Q96A 2WPVA 4U8HA 4GTPA 2KCKA 3E37A 2WXKA 1N0RA 3E33A 3UTMA 3RU0A 2GW1A 2HR2A 1YYHA 2GGFA 3NQPA 2I6HA 5EKQD 2X6FA 1QZ2A 4AXHA 1N4RA 5ENPD 5B1AE 2Q7FA 3EUVA 3ZYQA 3ZYLA 3PZ3A 4U8VD 1FT1A 4GTRA 3J5PA 1IQUA 3JCKC 4N5QA 3R7QA 3CHRA 3ZHEA 4ACKA 3ZIMA 4EQFA 3D9MA 5CRVA 4IN3B 4B93B 2I9CA 4JL0A 5JHBA 3FUFA 3DEPA 3DXKG 3D9PA 3D3MA 1HX8A 2ETAA 3LJ3A 3HRAA 4L2LA 2R2LA 5ARGA 1HU3A 2F8YA 3UM0A 3VTXA 4O1PA 4HOQA 4OVUA 4HI9A 5KJKA 3DXMG 2NC9A 4U63A 4CT4A 3L17A 1MX2A 3AAAC 2CG2A 4G8KA 3CK9A 5HS0A 3E32A 1N4QA 2BKKB 4AV7A 4GMJA 4FJYA 4BTBA 3FUDA 3TWVA 2YNQA 5CERB 1S70B 1DNPA 2R05A 3AS5A 3IKOB 1E90A 3DWLG 2C0MA 4G24A 3L9TA 5EILA 4GPKA 1K3ZD 1QYMA 2ZGGA 2BEDA 3ASDA 1TNUA 5G05J 3PZDA 3CR3A 3CV0A 2XPIA 2XEHA 4XI9A 3RK6A 5ENQD 1TR4A 1NA0A 4C48B 1N52A 4RLYA 3ZXPA 5CMYA 1UN8A 3ASGA 1SA5A 4JVSA 3PZ2A 4PH4B 4TXQA 4A1GA 1E7VA 2I1JA 4N3CA 1L5JA 5T3RA 2L0IA 5BXOA 4WWPA 1JCSA 2DVWA 3FEXA 3HXDA 4LERA 4EBAA 3ABKE 3CVVA 3UM2A 1YMPA 3Q4AB 3BU8A 4GZCA 1HG5A 2OCCE 2WXIA 2FULA 1OXJA 3MV2B 1OCOE 2CHZA 4ATGA 4OAUC 3R7RA 3JXJA 4LNUD 4I1OB 4LCTA 5EYLA 1JUQA 3Q9NC 3MYVA 4YDYA 4QQIA 2V4LA 2LUHA 3DSSA 3C3OA 3CK8A 4AP2A 3PEVB 3Q7AA 3MA5A 3Q75A 2L9BA 4A1SA 4GYYA 4JHKA 3R9AB 2WXFA 2EINE 4NIKA 3SNXA 2FO1E 1TNYA 3MKQA 4GTVA 3Q9UC 1HS6A
chains in the Genus database with same CATH topology
3UMVA 4AY6A 1INZA 3FTYA 1IQRA 2J4DA 1WAO1 3SD5A 4B8CB 3CVLA 5KJMA 2JEKA 4HS2A 4H7YA 4KVMA 3EHNA 4FU3A 4L23A 1OWLA 3DBSA 3LY8A 4KVOA 5FQ6A 4BSXA 3U3WA 4BT8A 3O4ZA 4BTAA 3FU3A 1GW6A 2Y4TA 3NZSA 2FI7A 1HF8A 4ANXA 2J08A 4DI4A 1HXIA 3FTVA 1HE8A 3MCXA 1Y8MA 3CHQA 2XHEA 4TUUA 3FTSA 2QY7A 4F1SA 3OXLA 3RIBA 4QFVA 1FVHA 4FLHA 3MJWA 3G2UA 5AJDA 2MOWA 1ZU2A 4AJWA 3G2TA 3ESLA 5D0QD 3ZN3A 4C0EA 5A6CA 3HHMA 4UWKA 3L22A 1HG2A 2LNIA 4UWHA 3FH8A 3UPVA 3KS2A 4CGVA 2XQ0A 2FO7A 4WAFA 1EYHA 1IYGA 2VSOE 3L16A 4GA1A 1PY1A 3HDXA 2DIWA 4UI9J 2V0PA 4NRHB 3ZYMA 2AXVA 4P29A 3PUKA 3CKBA 5BPPA 4FULA 1H0AA 1OWMA 2WMNA 4DPRA 1IHGA 2R17C 3SBTB 4Q94A 4U0UA 2VTBA 1FCHA 2CHXA 1JWGA 2WXOA 2WXGA 3APCA 3HVEB 3FUNA 3FTXA 3WXXA 4LEUA 2IF4A 4Y6CA 3L08A 4I1AA 5FZRA 1PC2A 4EECA 5LCWJ 3NF1A 2J09A 3VLEA 2NXPA 1W3BA 4HVBA 4AIFA 5EX3A 3CSFA 4KYOB 3FUIA 1H6KA 1JWFA 2X38A 3I4GA 1SZAA 5BNWA 3OXGA 2FEZA 3FH7A 3EIQC 4XE0A 3UX4A 4GCNA 4U0ZA 5CHEE 2IONA 3FY4A 1H2VC 2X3MA 3E4BA 4V3IA 3ML8A 3LDZA 2XGSA 3L13A 1HO8A 4EBAG 4HOSA 2I2OA 4Q69A 4EZJA 3FULA 3BG1B 4G1TA 4JHJA 5G04C 2VSYA 3LYAA 3QJZA 3ZFWA 4I2WA 2ZU6B 4NURA 3PE4A 5KCMA 2WM9A 3EJNA 2VSNA 1QQEA 3CVYA 1LF8A 4WNGA 4UWLA 3IHYA 1HZ4A 3EHMA 4TRQA 5D0OD 4M3OA 3MKRA 3ONLA 3SI5A 5C1DA 3PNTB 4GCOA 5AJLA 2PQNA 2X6HA 3PNLB 4GA2A 4XKCA 3U66A 2JLBA 4N3BA 3AS8A 3CQCB 3FDHA 3GZ2A 2C2LA 3ENEA 4B8AA 3LY9A 3ZPJA 2A5UA 4N2SA 5CMWA 2PQRA 5BT1A 2WXNA 3KD7A 1U3CA 2VQ2A 4ANWA 4UQZA 2LO6A 1S0PA 2VGXA 3FFLA 2QFCA 3JQ0A 3QB2A 4JEHA 4JXTA 5FWQA 3VTYA 1E8XA 1HFAA 4J0UA 1KT1A 5J08A 3FWVA 4I17A 3B7RL 4L1BA 3MGBA 2XCCA 5G05C 2LSVA 3HYMB 3Q47B 4R7LA 3PS6A 4XIFA 4KZCA 1Y6IA 2GRLA 2P58C 2XPZA 2AW6A 3D9OA 3GYZA 3P2BA 4TV3A 1EF1C 3S2AA 3SHFA 2MRIA 3QDNA 3UUXA 3JQ1A 3EDTB 3U4TA 4HORA 4G2VA 4N5CA 3ZXSA 3TXMA 1NZNA 4I1MA 2AXUA 2HYZA 2YQ8A 2OVBA 3N71A 4I6GA 4K0RA 1TJFA 2I1KA 3MEKA 4D10C 2EQXA 3FUEA 4CEMA 5LX8A 4B89A 3PE3A 1U3DA 1SQMA 2LSUA 3RO2A 4EZLA 4J8EA 1ZBPA 3APDA 1B89A 4G25A 3S7JA 4JC8A 4AVXA 5E75A 4A3VA 3RRUA 4BX8A 4DLOA 4FADA 2R5SA 1OWPA 2LAHA 1HH8A 2IOLA 3T5XA 3VLDA 4Y6WA 4CDMA 2CG3A 3LVQE 3PRZA 3FH5A 5DIZA 4FC8A 2UWJG 1H2UA 5EX0A 4AEZC 4AY5A 4BFRA 4E6HA 5BV1A 3QARA 3ZRHA 2J07A 4APFA 2OOEA 3ASFA 4I6JA 5J90A 3FUJA 3ZGQA 4KZ0A 4GYOA 2PM6A 3GZ1A 2CHWA 4J6IA 4LUNU 3CVUA 3CQGB 5ANRA 3UT7A 4OYSA 4Q96A 2WPVA 3I5PA 4U8HA 2WXLA 4IYPA 3PH0C 2XGMA 4JA7A 1YA0A 5HI7A 4A3TA 4BX9A 3CVQA 2V5FA 4U07A 4UWGA 4RG6A 3RRNB 2KCKA 4ACLA 1DVPA 2WXKA 3CGHA 4KBQA 4JA9A 4I6EA 2X6IA 3RRMB 5BW8C 3ZEFA 3RU0A 1N54A 2GW1A 3D9KA 3HVEA 3ZVVA 2GRMA 3TG4A 2HR2A 3BG0B 4KXKB 2IJGX 3FUMA 2GGFA 3S7FA 3QOUA 1BPOA 1MHQA 2XGOA 1VDYA 4PDXA 3OXFA 3NQPA 2I6HA 1NP7A 2X6FA 5EKQD 2C0LA 1QZ2A 3EIJA 2Y3AA 3PDNA 4AXHA 3TAXA 3MZLB 5LOZA 5FQ7A 4FJZA 4GYWA 5FT9A 2Q7FA 3CVNA 3IBEA 5M72A 2WB2A 3FU6A 4DK5A 1KT0A 1OWOA 5DBKA 3B7UX 3ZYQA 4I2ZA 3FTUA 4DLQA 2VYIA 2HM8A 3U9WA 3ZYLA 5FZSA 2MHKA 3APFA 4CRWA 3MX3A 3B13A 2WQHA 3LKUA 2WXQA 4GB9A 4PUCA 1IQUA 4CCAA 2VTBB 3JCKC 2XPYA 3UT8A 2YHCA 4B94A 3DPDA 1X5BA 3TXNA 2WXRA 4NQ0A 3QK0A 4W9RA 2OVFA 3R7QA 3CHRA 3FHEA 2IU1A 3QKYA 3LXUX 3O48A 5ANLA 3ZHEA 4ACKA 4GZ5A 4ILGA 4GU5A 3ZIMA 3AU4A 4EQFA 3D9MA 4K03A 4G26A 2XRZA 3L54A 4IN3B 5JJTA 3G2SA 3CSTA 2ONDA 4JZYA 4L2YA 2X6KA 4FLBA 2I9CA 5KJNA 3TL5A 2VSXE 4YVQC 3D9NA 4JL0A 3FUFA 5ENNA 5JHBA 2KZTB 2J49A 2XCBA 3D9PA 5AIJA 5A7DB 3D3MA 2YINA 3OAWA 5LFAA 3K9IA 4ILIA 1ELKA 3CVXA 2A4ZA 1HX8A 3ONKA 3LJ3A 1E8YA 1P5QA 3FTZA 1SZ9A 3Q49B 2OV8A 3TG5A 4N2QA 4L2LA 4BWRA 4YNDA 2KC7A 2WQ7A 5A23A 4FP7A 1PAQA 2J4BA 3B7SA 4NACA 3AU5A 1OWNA 3PREA 4N3AA 4UI9K 3QWPA 4GAAA 5BUZA 1E8ZA 2WXMA 3U64A 5ARGA 4E85A 1HU3A 3VTXA 4WNDA 3FU5A 3ASHA 4HOQA 2UY1B 4YVOA 1KLXA 4KT6B 4OVUA 4JEUA 3P1UA 5KJKA 4OVVA 3FP3A 4CDNA 2NC9A 4U63A 4CT4A 5AENA 2LAIA 3L17A 2M63A 2WXPA 3OTNA 4MRUA 2CG2A 2KCLA 2FF4A 5FTPA 5G04J 2VGXB 4UI9C 3GW4A 2CFUA 3CK9A 3KEZA 5CCLA 2WXHA 3LEWA 4UQYA 1FVFA 3G2VA 3FUHA 5ARFA 3HIZA 2WVIA 4AV7A 2WMOA 3I3NA 2VJ8A 4GMJA 1EPUA 4FJYA 5C2YA 3UQ3A 4HOTA 4BTBA 2DCPA 3CIAA 4FHKA 4GZDA 4O6FA 3FUDA 4F7AA 5CCMA 2YNQA 4WWNA 2V8SE 1DNPA 3GZSA 3CHPA 4WNEA 5FZQA 3SZ7A 5LCWC 3AS5A 3IKOB 3MKQB 1E90A 3IHVA 2C0MA 3FEYA 4I9CA 3LVRE 1E7UA 4G24A 3UT4A 3PUJA 4MLPA 2IQCA 4WUYA 3ZW3A 1UJJA 2KATA 4GA0A 4PS7A 5JJ7A 5FQ4A 1TJCA 5AYWD 4GPKA 4GMLA 4B0ZA 4ABNA 4FHJA 3G2WA 4GZ3A 4U04A 3VLFA 4F53A 3ASDA 4F3VA 3CVPA 1Z3YA 4DI3A 5G05J 3PZDA 3RJVA 2AWIA 1E8WA 4PS3A 4KMOA 3CR3A 4RG9A 3CV0A 5T8IA 3L6AA 3QAQA 3IEGA 3SBSA 4APOA 4WWOA 1UN9A 4XI0A 2XPIA 4XI9A 2BUGA 3RKVA 3RK6A 1UG3A 1NA0A 4JW1A 1N52A 3Q5MA 5CMYA 5BV0A 2Y4UA 4C0MA 3JUIA 2RD0A 1UN8A 4A55A 1Z3XA 1H19A 3ASGA 2BTDA 4JVSA 1OUVA 3NZUA 3AS4A 4BT9A 3ML9A 4MKTA 4HLEA 1A17A 4PH4B 4H7XA 3CHMA 3URZA 4A1GA 3ZYKA 2RG8A 3Q15A 5JHAA 1E7VA 2YHEA 2I1JA 3QC1A 4N3CA 1L5JA 2PZIA 4JHRA 5T3RA 4CT0A 4EPZA 2L0IA 3FTWA 3FUKA 4WWPA 1XNFA 2AXZA 1QNFA 2J9QA 1ELRA 4XZ4A 3FEXA 3SF4A 4LERA 4XX5A 3RO3A 4EBAA 2R59A 4L7TA 5LP0A 3LCAA 4N39A 1UW4B 4J8DA 4ME2A 4XKBA 3CVVA 4WNFA 2WXJA 3IV0A 1ELWA 5G55A 3TGOA 3BEEA 4IULA 2PL2A 3Q4AB 3S7BA 3CHSA 1UJKA 3D9LA 3SGHA 1TEZA 4GZCA 2NSZA 2KZTA 1HG5A 4UWFA 2KCVA 3JYSA 5G2NA 2WXIA 1WM5A 1H2TC 4U0SA 3CK7A 2L6JA 2FULA 3CLJA 3ESKA 2X6JA 1E96B 3MV2B 3CKCA 5HQ8A 2XEVA 4RSYA 2CHZA 5KJLA 2E0IA 4J8FA 4ATGA 5EDSA 3PVLA 3PEUB 1EDUA 3R7RA 3ZHEB 4BY6A 4PS8A 5T4YA 2E2EA 2VGYA 4G23A 4DJAA 4I9EA 4I1OB 3FU0A 5JJ6A 4LCTA 4URKA 3ULQA 4CGWA 3MV3B 3LPZA 1JUQA 1Z6TA 3C98A 3QWVA 4UQXA 1MQSA 4CDRA 4FA6A 5E76A 2UY1A 4AOFA 3D9JA 3MYVA 4GZ6A 4I43A 3TJPA 2FBNA 2V4LA 4HXIA 4RVBA 3CK8A 4HFGA 4AP2A 3PEVB 3LY7A 3MA5A 3B7TA 4LRZA 4JPSA 3CEQA 4G11A 2AVPA 3SFZA 2L9BA 4IRUA 3T8MA 4A1SA 2WQ6A 4AM9A 4GYYA 3S7DA 3LS8A 4JHKA 4J8SA 3R9AB 2WXFA 1NA3A 3T5VA 3SNXA 2KM4A 3CHOA 4HOUA 3CVWA 2HO1A 5FQ8A 4EZKA 2ILRA 1JPLA 1WY6A 3QWWA 4C9BB 4ILHB 3I4RB 2XRYA 2BF0X 3MKQA 2PM7A 5FJYA 1XGWA 2L0TB 4ANVA 4MS6A 3QNKA 2IOSA 3KAEA 3D9IA 2CFZA 4ANUA 2DBAA 1HS6A 2IFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AY6 A;  1WAO 1;  3CVL A;  5KJM A;  4H7Y A;  3LY8 A;  3U3W A;  4BT8 A;  4BTA A;  2Y4T A;  2FI7 A;  1HXI A;  1Y8M A;  3OXL A;  3RIB A;  1ZU2 A;  5D0Q D;  3ZN3 A;  5A6C A;  2LNI A;  3UPV A;  3KS2 A;  4CGV A;  2FO7 A;  1IYG A;  4GA1 A;  4UI9 J;  4NRH B;  3CKB A;  1IHG A;  4U0U A;  1FCH A;  3WXX A;  4LEU A;  2IF4 A;  4Y6C A;  4I1A A;  5FZR A;  1PC2 A;  5LCW J;  3NF1 A;  1W3B A;  4AIF A;  5EX3 A;  4KYO B;  5BNW A;  3OXG A;  2FEZ A;  4GCN A;  4U0Z A;  5CHE E;  3E4B A;  2XGS A;  4HOS A;  5G04 C;  4G1T A;  2VSY A;  3LYA A;  3ZFW A;  4I2W A;  3PE4 A;  2VSN A;  1QQE A;  4WNG A;  1HZ4 A;  5D0O D;  3MKR A;  5C1D A;  4GCO A;  2PQN A;  4GA2 A;  2JLB A;  4N3B A;  3AS8 A;  3GZ2 A;  2C2L A;  3LY9 A;  3ZPJ A;  4N2S A;  2PQR A;  5BT1 A;  3KD7 A;  2VQ2 A;  4UQZ A;  2VGX A;  3FFL A;  2QFC A;  3VTY A;  1KT1 A;  3FWV A;  4I17 A;  2XCC A;  5G05 C;  2LSV A;  3HYM B;  3Q47 B;  4XIF A;  2P58 C;  3GYZ A;  3QDN A;  3UUX A;  3EDT B;  3U4T A;  4HOR A;  4G2V A;  4N5C A;  1NZN A;  2HYZ A;  2YQ8 A;  3N71 A;  3MEK A;  3PE3 A;  2LSU A;  3RO2 A;  4J8E A;  1ZBP A;  4G25 A;  1B89 A;  3S7J A;  2R5S A;  1HH8 A;  4Y6W A;  5DIZ A;  2UWJ G;  5EX0 A;  4AY5 A;  2OOE A;  3ASF A;  3ZGQ A;  4GYO A;  3GZ1 A;  2WPV A;  4JA7 A;  2XGM A;  1YA0 A;  5HI7 A;  3CVQ A;  2V5F A;  4U07 A;  4RG6 A;  2KCK A;  4KBQ A;  4JA9 A;  5BW8 C;  3RU0 A;  2GW1 A;  3TG4 A;  2HR2 A;  4KXK B;  3S7F A;  3QOU A;  2XGO A;  3OXF A;  2I6H A;  5EKQ D;  2C0L A;  1QZ2 A;  3PDN A;  3TAX A;  4GYW A;  5FT9 A;  2Q7F A;  3CVN A;  5M72 A;  1KT0 A;  5DBK A;  4I2Z A;  2VYI A;  5FZS A;  2MHK A;  2WQH A;  3LKU A;  2YHC A;  4B94 A;  4NQ0 A;  4W9R A;  3QKY A;  3ZHE A;  3O48 A;  4GZ5 A;  4EQF A;  4G26 A;  4IN3 B;  5JJT A;  2OND A;  5KJN A;  4YVQ C;  4JL0 A;  2XCB A;  5A7D B;  3K9I A;  1P5Q A;  3Q49 B;  3TG5 A;  4N2Q A;  4BWR A;  4YND A;  2KC7 A;  4N3A A;  4UI9 K;  3QWP A;  5ARG A;  3VTX A;  4WND A;  3ASH A;  4HOQ A;  2UY1 B;  4YVO A;  1KLX A;  5KJK A;  3FP3 A;  2NC9 A;  2KCL A;  5G04 J;  2FF4 A;  5FTP A;  2VGX B;  4UI9 C;  3GW4 A;  3CK9 A;  5CCL A;  4UQY A;  5ARF A;  3UQ3 A;  4HOT A;  4BTB A;  4O6F A;  5CCM A;  3SZ7 A;  4WNE A;  5FZQ A;  5LCW C;  3AS5 A;  2C0M A;  4I9C A;  4G24 A;  4WUY A;  2KAT A;  4GA0 A;  5JJ7 A;  1TJC A;  5AYW D;  4GPK A;  4ABN A;  4GZ3 A;  4U04 A;  3ASD A;  4F3V A;  3CVP A;  5G05 J;  3RJV A;  4RG9 A;  3CV0 A;  4APO A;  3IEG A;  4XI0 A;  2XPI A;  4XI9 A;  3RKV A;  2BUG A;  1NA0 A;  3Q5M A;  2Y4U A;  3ASG A;  1OUV A;  3AS4 A;  4BT9 A;  1A17 A;  4H7X A;  3URZ A;  3Q15 A;  4N3C A;  2PZI A;  4JHR A;  1XNF A;  2J9Q A;  1ELR A;  3SF4 A;  3RO3 A;  3LCA A;  4N39 A;  4J8D A;  4ME2 A;  4WNF A;  1ELW A;  3TGO A;  3BEE A;  2PL2 A;  3Q4A B;  3S7B A;  2KCV A;  3JYS A;  1WM5 A;  4U0S A;  3CK7 A;  2L6J A;  3ESK A;  1E96 B;  3MV2 B;  3CKC A;  5HQ8 A;  2XEV A;  5KJL A;  4J8F A;  3ZHE B;  2E2E A;  2VGY A;  4G23 A;  4I9E A;  5JJ6 A;  3ULQ A;  4CGW A;  3MV3 B;  3LPZ A;  3QWV A;  4UQX A;  4CDR A;  2UY1 A;  4GZ6 A;  2FBN A;  3CK8 A;  3LY7 A;  3MA5 A;  3CEQ A;  2AVP A;  4A1S A;  4AM9 A;  4GYY A;  3S7D A;  3R9A B;  1NA3 A;  4HOU A;  2HO1 A;  3QWW A;  5FJY A;  3KAE A;  4J0U A;  2DBA A;  2IFU A; 
#chains in the Genus database with same CATH topology
 3UMV A;  3FTY A;  2J4D A;  1O1S A;  3SD5 A;  3CVL A;  2JEK A;  4L23 A;  4FU3 A;  3LY8 A;  3U3W A;  1MZC A;  3DSX A;  2XHE A;  4TUU A;  3FTS A;  3ESL A;  5CBN A;  4C0E A;  5ENS D;  5BXU A;  3HHM A;  3L22 A;  2LNI A;  3FH8 A;  4YDE A;  2XQ0 A;  5ENT D;  5AQA A;  3L16 A;  4UI9 J;  4NRH B;  4P29 A;  2RKK A;  3ULY A;  5AQ9 A;  4TXP A;  3ASN E;  4Q94 A;  4U0U A;  2CHX A;  2WXG A;  3WXX A;  1RZ4 A;  5FZR A;  4HVB A;  1W3B A;  4J7W A;  1K1A A;  1H6K A;  2RFA A;  1BU9 A;  2ION A;  4V3I A;  3R9M A;  3L13 A;  1TNO A;  3PE4 A;  5KCM A;  5HKP A;  1LF8 A;  4UWL A;  1DC2 A;  5D0O D;  2ZGD A;  3J5Q B;  3NBN B;  3PNT B;  4TXR A;  5AJL A;  3AS8 A;  3FDH A;  4B8A A;  3LY9 A;  5CMW A;  1U3C A;  4ANW A;  5ITZ F;  4UQZ A;  2LO6 A;  3JQ0 A;  5FWQ A;  3VTY A;  3V2X A;  3FWV A;  3B7R L;  3C72 A;  4L1B A;  3TWT A;  3MGB A;  5G05 C;  2LSV A;  3Q7F A;  3Q47 B;  4R7L A;  3AG2 E;  3D9O A;  2MRI A;  3QDN A;  4HLL A;  3U4T A;  3TXM A;  2HYZ A;  2YQ8 A;  2OVB A;  2Y0B G;  4K0R A;  3HXB A;  4D10 C;  4B89 A;  1U3D A;  2L6B A;  2LSU A;  4EZL A;  4DX1 A;  3APD A;  4G25 A;  4AVX A;  4BX8 A;  2P9K G;  2R5S A;  2H6I A;  1HH8 A;  3T5X A;  2CG3 A;  3LVQ E;  1H2U A;  4AEZ C;  4UUC A;  5BV1 A;  5J90 A;  4I6J A;  3ZGQ A;  4GTS A;  3TWQ A;  2PM6 A;  3GZ1 A;  4J6I A;  4LUN U;  3CQG B;  1S64 A;  3I5P A;  4IYP A;  5CRU A;  2J8S D;  5HI7 A;  4BX9 A;  2V5F A;  3ULE G;  4U07 A;  4UWG A;  4ACL A;  3EU9 A;  3ZNG A;  3RRM B;  3HVE A;  1TN8 A;  3BG0 B;  4KXK B;  3UXG A;  4GTO A;  1MHQ A;  4PDX A;  4ZFH A;  2R02 A;  1NP7 A;  5KBA A;  2Y3A A;  5LOZ A;  5FQ7 A;  3CVN A;  4K5B A;  2WB2 A;  3FU6 A;  4DK5 A;  3B7U X;  4U96 D;  2DWZ A;  5FZS A;  2MHK A;  1NL4 A;  2GRO B;  2H6G A;  2WQH A;  3B13 A;  4GB9 A;  2VTB B;  4CCA A;  5CED B;  5HRY A;  2YHC A;  1X5B A;  3TXN A;  2WXR A;  4NQ0 A;  1LTX A;  3FHE A;  3QKY A;  3LXU X;  1YCS B;  4ILG A;  3AU4 A;  4G26 A;  2XRZ A;  1N9A A;  5JJT A;  3G2S A;  3CST A;  2OND A;  4JZY A;  4FLB A;  3X2Q E;  3D9N A;  4K5A B;  2J49 A;  5LFA A;  3OAW A;  2A4Z A;  1E8Y A;  3L82 A;  1P5Q A;  1FT2 A;  2B0O E;  2KC7 A;  3PZ4 A;  1OCZ E;  3TWW A;  5AEN A;  4UI9 K;  1OWN A;  4GAA A;  4WND A;  3FU5 A;  3ASH A;  1BLX B;  1KLX A;  4KT6 B;  4JEU A;  3JUE A;  4CDN A;  4MRU A;  1MX6 A;  5G04 J;  2VGX B;  4UI9 C;  3GW4 A;  3KEZ A;  3LEW A;  4UQY A;  1FVF A;  3DRA A;  5ARF A;  3RSE G;  1K1B A;  5D66 A;  2WMO A;  4HOT A;  2QC9 A;  3CIA A;  1MX4 A;  2ETC A;  1KZP A;  2V8S E;  2XZT G;  3MKQ B;  3IHV A;  3Q79 A;  4I9C A;  1E7U A;  2IQC A;  2GRP B;  2KAT A;  4GA0 A;  5FQ4 A;  4B0Z A;  4DUI A;  2V4H C;  4FHJ A;  4GZ3 A;  3VLF A;  4F53 A;  1O1R A;  2QZA A;  5EIB E;  1E8W A;  4APO A;  3IEG A;  4WWO A;  2BUG A;  4ZHB A;  1UG3 A;  4YDW A;  1TYQ G;  1JCR A;  5BV0 A;  4ATZ D;  2RD0 A;  1Z3X A;  3UI2 A;  1A17 A;  4HI8 A;  3PZ1 A;  1TNZ A;  4CT0 A;  2ZIS A;  2AXZ A;  4XZ4 A;  3SF4 A;  2P9N G;  4XKB A;  3IV0 A;  1ELW A;  3TGO A;  3BEE A;  2PL2 A;  2QYU A;  2KZT A;  4UWF A;  2KCV A;  3JYS A;  5G2N A;  2P2C P;  1H2T C;  2GRQ B;  2X6J A;  4G8L A;  4HRM B;  4RSY A;  4LNG A;  2E0I A;  5KWD A;  3PEU B;  4G23 A;  4GTT A;  3ULQ A;  3TWS A;  3QWV A;  1MQS A;  2UY1 A;  4AOF A;  3TJP A;  1UOH A;  4HFG A;  4DRX E;  3ASO E;  4G11 A;  2WQ6 A;  3S7D A;  3LS8 A;  4HOU A;  4A63 B;  4EZK A;  1QBQ A;  2XRY A;  2PM7 A;  3QNK A;  2IOS A;  3KAE A;  4J0U A;  2DBA A;  3ABL E;  2F37 A;  4B8C B;  3HXE A;  3DBS A;  2FI7 A;  3FTV A;  3SFX A;  3MCX A;  1Y8M A;  2QY7 A;  5EID A;  4QFV A;  4AJW A;  5D0Q D;  3ZN3 A;  3Q73 A;  3UPV A;  3KS2 A;  2B6C A;  4WAF A;  1IYG A;  2VSO E;  4GA1 A;  1PY1 A;  4X8Q A;  3CKB A;  1LD8 A;  3D9H A;  1OWM A;  4DPR A;  2VTB A;  3ZUV B;  2WXO A;  3HVE B;  3FUN A;  4LEU A;  2OEV A;  3TWX A;  4Y6C A;  4I1A A;  4EEC A;  1PC2 A;  3CSF A;  1JWF A;  1SZA A;  2H6F A;  3B7B A;  3OXG A;  4XE0 A;  5CHE E;  3FY4 A;  1H2V C;  1SVX A;  4EBA G;  1N4P A;  4Q69 A;  3BG1 B;  5G04 C;  1Q2Z A;  2Y1L E;  1H6P A;  4NUR A;  5KNH D;  3EJN A;  2VSN A;  1TN7 A;  3EHM A;  2PQN A;  2X6H A;  4BEP A;  5AAO A;  2JLB A;  4N3B A;  2C2L A;  3ENE A;  3ZPJ A;  2A5U A;  4N2S A;  1S0P A;  2VGX A;  5J08 A;  3PS6 A;  3LJN A;  2AW6 A;  3P2B A;  4N5C A;  3ZXS A;  4DX5 D;  1NZN A;  4I1M A;  4I6G A;  2P9P G;  1LD7 A;  1TJF A;  3MEK A;  2EQX A;  3PE3 A;  3RO2 A;  1ZBP A;  5E75 A;  4A3V A;  3RRU A;  4FAD A;  3VLD A;  4CDM A;  5D2M C;  2ZIR A;  5DIZ A;  3D9I A;  2UWJ G;  3QAR A;  2J07 A;  3ASF A;  3CVU A;  5ANR A;  4OYS A;  4GPM A;  5IY5 E;  2WXL A;  3PH0 C;  2XGM A;  1YA0 A;  3RRN B;  3NB2 A;  1DVP A;  4KBQ A;  3CGH A;  1OCR E;  5EYP F;  2X6I A;  3ZEF A;  3ZVV A;  3TG4 A;  3EHQ A;  3UIP C;  2IJG X;  4YDO A;  4K5C A;  1D9S A;  3S7F A;  2XGO A;  2C0L A;  3PDN A;  3UKR G;  3TAX A;  3MZL B;  4FJZ A;  5FT9 A;  5M72 A;  2IEJ A;  1OWO A;  5DBK A;  1MYO A;  3U9W A;  4O60 A;  4CRW A;  4PUC A;  2WXQ A;  3SFY A;  3UT8 A;  3QK0 A;  3AG4 E;  3O48 A;  5ANL A;  4JD2 G;  4GU5 A;  4K03 A;  3L54 A;  1OY3 D;  2P9U G;  2X6K A;  3TL5 A;  2VSX E;  2QYJ A;  3ABM E;  5ENN A;  2KZT B;  2XCB A;  2YIN A;  1Z5S C;  1K8K G;  3FTZ A;  3JXI A;  3Q49 B;  3TG5 A;  4N2Q A;  4FP7 A;  4U7E B;  2J4B A;  4NAC A;  4N3A A;  3AU5 A;  3PRE A;  5BUZ A;  1E8Z A;  3U64 A;  1V54 E;  2UY1 B;  2WXP A;  3OTN A;  2KCL A;  2FF4 A;  2CFU A;  5CCL A;  3HIZ A;  2WVI A;  3UQ3 A;  5C2Y A;  4HNA D;  4FHK A;  4O6F A;  4F7A A;  3SZ7 A;  3GZS A;  4WNE A;  5FZQ A;  1IHB A;  3UT4 A;  3PUJ A;  4BSZ B;  1UJJ A;  5JJ7 A;  1TJC A;  1TN6 A;  4BES A;  3G2W A;  4HRL A;  1Z3Y A;  4DI3 A;  2AWI A;  4PS3 A;  4KMO A;  4RG9 A;  5T8I A;  3TWR A;  3L6A A;  3SBS A;  1UN9 A;  1D8E A;  4XI0 A;  3RKV A;  4RQI A;  4XEI G;  4JW1 A;  3Q5M A;  2Y4U A;  4C0M A;  3JUI A;  3EU5 A;  4A55 A;  1OUV A;  4HLE A;  4F6R D;  3ML9 A;  3BUA A;  4H7X A;  3CHM A;  3URZ A;  3ZYK A;  5JHA A;  2YHE A;  1BD8 A;  2PZI A;  5ENO D;  3FTW A;  3FUK A;  3WG7 E;  2J9Q A;  1ELR A;  5H7P A;  4N39 A;  1UW4 B;  4O1O A;  4ME2 A;  5G55 A;  4IUL A;  3CHS A;  1UJK A;  3SGH A;  1TNB A;  2NSZ A;  3CK7 A;  4F1P A;  3CLJ A;  3ESK A;  1E96 B;  1X81 A;  5AN8 A;  4J8F A;  5EDS A;  4MBG A;  1EDU A;  4BY6 A;  5T4Y A;  2VGY A;  4I9E A;  5JJ6 A;  2EIL E;  4Z68 A;  4URK A;  4CGW A;  3MV3 B;  3LPZ A;  3C98 A;  3E30 A;  2DYR E;  4CDR A;  4FA6 A;  4GZ6 A;  4I43 A;  1FPP A;  4HXI A;  4RVB A;  2HE0 A;  4JPS A;  3CEQ A;  1A5E A;  2AVP A;  3T8M A;  2KM4 A;  3CHO A;  1N94 A;  2KBX A;  3CVW A;  5AQ7 A;  2ILR A;  1WY6 A;  3I4R B;  5FJY A;  1XGW A;  2L0T B;  4MS6 A;  2IFU A;  2IO2 C;  1OCC E;  1WAO 1;  1AWC B;  3ISM C;  4KVM A;  1OWL A;  4KVO A;  5FQ6 A;  4BSX A;  3O4Z A;  3FU3 A;  2Y4T A;  1BI7 B;  2J08 A;  3IXE A;  4DI4 A;  1HXI A;  2BKG A;  3CHQ A;  3F6Q A;  2LXL A;  4F1S A;  3OXL A;  5JMN D;  3G2U A;  5AJD A;  2MOW A;  1ZU2 A;  3V31 A;  5A6C A;  1HG2 A;  2V0P A;  3ZYM A;  3HXC A;  4FUL A;  2WMN A;  4HQD A;  4M7C A;  1FCH A;  2ZXW E;  1JWG A;  3FTX A;  4GMR A;  2IF4 A;  3L08 A;  5LCW J;  3NF1 A;  2J09 A;  4AIF A;  4HBD A;  4KYO B;  3C3Q A;  3FUI A;  2X38 A;  3I4G A;  4BER A;  4DX6 D;  3EIQ C;  4GCN A;  4U0Z A;  3LDZ A;  4CZ2 D;  2I2O A;  3FUL A;  2VSY A;  3NOG D;  3ZFW A;  1QQE A;  3CVY A;  3V79 K;  4WNG A;  3IHY A;  2EIJ E;  4M3O A;  3ONL A;  5ENR D;  3SI5 A;  5C1D A;  1O1T A;  4GA2 A;  4XKC A;  3KSL A;  1KPS B;  2LXM A;  3CQC B;  5AQB A;  2VQ2 A;  2V5Q C;  4JEH A;  4JXT A;  1E8X A;  1KT1 A;  4I17 A;  2XCC A;  3DEO A;  4XIF A;  4KZC A;  2GRL A;  3SHF A;  3S2A A;  3JQ1 A;  3EHR A;  4G2V A;  3UKU G;  2XZD G;  3DSU A;  5FIN A;  2R03 A;  2I1K A;  3SO8 A;  3FUE A;  1OT8 A;  1SQM A;  1U2V G;  1B89 A;  1MJ0 A;  4JC8 A;  3T8K A;  2EIK E;  2IOL A;  4Y6W A;  1BI8 B;  3PRZ A;  4FC8 A;  5EX0 A;  4E6H A;  4BFR A;  3ZRH A;  2OOE A;  1N95 A;  2Y69 E;  4KZ0 A;  4GYO A;  2A5E A;  1DCE A;  2CHW A;  3RAU A;  4JA7 A;  4A3T A;  3CVQ A;  4RG6 A;  4JA9 A;  4I6E A;  5BW8 C;  1N54 A;  3D9K A;  5JA4 D;  2AJA A;  2GRM A;  3W9F A;  3FUM A;  3SY2 A;  3QOU A;  1BPO A;  1VDY A;  3OXF A;  1NI1 A;  3EIJ A;  2XEE A;  4GYW A;  2GRN B;  3IBE A;  1KT0 A;  3UIO C;  4I2Z A;  3FTU A;  3UM1 A;  2VYI A;  4DLQ A;  2HM8 A;  4HB5 A;  3APF A;  3MX3 A;  3LKU A;  2XPY A;  4B94 A;  3V30 A;  3UM3 A;  3DPD A;  5CEC B;  4W9R A;  2OVF A;  2IU1 A;  4GZ5 A;  1SA4 A;  3TWU A;  1N0Q A;  4L2Y A;  5KJN A;  4GTM A;  3DSV A;  4YVQ C;  4DX7 D;  4BET A;  5AIJ A;  5A7D B;  3K9I A;  4ILI A;  1ELK A;  3CVX A;  3W9G A;  3ONK A;  1SZ9 A;  2OV8 A;  4BWR A;  4YND A;  2WQ7 A;  5A23 A;  1WG0 A;  1PAQ A;  3B7S A;  2PNN A;  3QWP A;  2WXM A;  4E85 A;  4EHM A;  1WDY A;  2IY0 C;  4YVO A;  3P1U A;  1NFI E;  3HG0 D;  4OVV A;  3FP3 A;  2LAI A;  4J8Y A;  2M63 A;  2ETB A;  5FTP A;  2WXH A;  3G2V A;  3FUH A;  3C3R A;  1AP7 A;  3I3N A;  2VJ8 A;  1EPU A;  2DCP A;  4GZD A;  2IO3 C;  5CCM A;  2P9I G;  2F0Y A;  4WWN A;  5LCW C;  3CHP A;  3KEA A;  3FEY A;  3LVR E;  4MLP A;  4WUY A;  3ZW3 A;  4PS7 A;  5AYW D;  4GML A;  2MYO A;  4ABN A;  4LG6 A;  3SQV A;  4U04 A;  4F3V A;  3CVP A;  1KZO A;  3RJV A;  4OAV B;  3QAQ A;  4HRN A;  4LNB A;  5EN5 D;  2GRR B;  5B3S E;  1N4S A;  1H19 A;  2DYS E;  2BTD A;  3NZU A;  3AS4 A;  4BT9 A;  3BQO A;  4MKT A;  1N11 A;  2P9L G;  3ZKJ A;  2RG8 A;  3Q15 A;  3QC1 A;  1SW6 A;  4JHR A;  4EPZ A;  1XNF A;  1QNF A;  4XX5 A;  3RO3 A;  2R59 A;  4L7T A;  5LP0 A;  3LCA A;  3T9K A;  5KNG A;  4J8D A;  4WNF A;  2WXJ A;  3S7B A;  4U8Y D;  3D9L A;  1TEZ A;  1S63 A;  3HXF A;  1WM5 A;  4U0S A;  2VGE A;  5CEA A;  2L6J A;  3CKC A;  5HQ8 A;  2XEV A;  5KJL A;  3AG3 E;  3PVL A;  4JB8 P;  3ZHE B;  4PS8 A;  2E2E A;  2XEN A;  2H6H A;  4DJA A;  3DSW A;  3FU0 A;  2NYJ A;  1Z6T A;  4UQX A;  5E76 A;  3D9J A;  2FBN A;  3LY7 A;  3B7T A;  4LRZ A;  3SFZ A;  4IRU A;  4AM9 A;  4J8S A;  3DPY A;  1NA3 A;  3T5V A;  2HO1 A;  5FQ8 A;  4CYM D;  1JPL A;  3QWW A;  4C9B B;  4ILH B;  2BF0 X;  3B95 A;  4ANV A;  3UIN C;  2CFZ A;  4ANU A;  4TRQ A;  3NOC D;  4AY6 A;  1INZ A;  1IQR A;  5KJM A;  4HS2 A;  4H7Y A;  3EHN A;  1D8D A;  4BT8 A;  4BTA A;  1GW6 A;  3NZS A;  1HF8 A;  4ANX A;  1HE8 A;  1G3N B;  2EIM E;  3DST A;  3RIB A;  4DX2 A;  1FVH A;  4FLH A;  3MJW A;  3C5R A;  3G2T A;  4UWK A;  3AG1 E;  4UWH A;  4CGV A;  2OEW A;  1JCQ A;  2FO7 A;  1H6O A;  1EYH A;  3HDX A;  2DIW A;  2AXV A;  3PUK A;  5BPP A;  1H0A A;  1IHG A;  2R17 C;  4U95 D;  2DZN A;  3SBT B;  1IXV A;  3APC A;  3VLE A;  2NXP A;  5EX3 A;  2P9S G;  5BNW A;  2FEZ A;  3FH7 A;  3UX4 A;  2DZO A;  2X3M A;  3E4B A;  3Q78 A;  3ML8 A;  2XGS A;  1HO8 A;  4HOS A;  4EZJ A;  4G1T A;  2XS1 A;  4JHJ A;  3LYA A;  3QJZ A;  1O5M A;  4I2W A;  4L9P A;  2ZU6 B;  2WM9 A;  4GTQ A;  5B1B E;  1IKN D;  3NAW A;  1HZ4 A;  3AJI A;  3MKR A;  1ZB1 A;  5CBO A;  4GCO A;  3PNL B;  3U66 A;  3GZ2 A;  3E34 A;  3ZU7 B;  2PQR A;  5BT1 A;  2WXN A;  3KD7 A;  3QB2 A;  3FFL A;  2QFC A;  4LSZ E;  1HFA A;  3HYM B;  1RW2 A;  1Y6I A;  2P58 C;  2XPZ A;  3V2O A;  3GYZ A;  4TV3 A;  1EF1 C;  3UUX A;  3EDT B;  4HOR A;  2RFM A;  3KSQ A;  2AXU A;  2XS8 A;  2KXP C;  3N71 A;  5LX8 A;  1V55 E;  4CEM A;  2JAB A;  4J8E A;  3S7J A;  4DLO A;  5FIO A;  1OWP A;  2LAH A;  4TUM A;  3FH5 A;  5AAR A;  1DCQ A;  4AY5 A;  4APF A;  3FUJ A;  2F8X K;  3UT7 A;  4Q96 A;  2WPV A;  4U8H A;  4GTP A;  2KCK A;  3E37 A;  2WXK A;  1N0R A;  3E33 A;  3UTM A;  3RU0 A;  2GW1 A;  2HR2 A;  1YYH A;  2GGF A;  3NQP A;  2I6H A;  5EKQ D;  2X6F A;  1QZ2 A;  4AXH A;  1N4R A;  5ENP D;  5B1A E;  2Q7F A;  3EUV A;  3ZYQ A;  3ZYL A;  3PZ3 A;  4U8V D;  1FT1 A;  4GTR A;  3J5P A;  1IQU A;  3JCK C;  4N5Q A;  3R7Q A;  3CHR A;  3ZHE A;  4ACK A;  3ZIM A;  4EQF A;  3D9M A;  5CRV A;  4IN3 B;  4B93 B;  2I9C A;  4JL0 A;  5JHB A;  3FUF A;  3DEP A;  3DXK G;  3D9P A;  3D3M A;  1HX8 A;  2ETA A;  3LJ3 A;  3HRA A;  4L2L A;  2R2L A;  5ARG A;  1HU3 A;  2F8Y A;  3UM0 A;  3VTX A;  4O1P A;  4HOQ A;  4OVU A;  4HI9 A;  5KJK A;  3DXM G;  2NC9 A;  4U63 A;  4CT4 A;  3L17 A;  1MX2 A;  3AAA C;  2CG2 A;  4G8K A;  3CK9 A;  5HS0 A;  3E32 A;  1N4Q A;  2BKK B;  4AV7 A;  4GMJ A;  4FJY A;  4BTB A;  3FUD A;  3TWV A;  2YNQ A;  5CER B;  1S70 B;  1DNP A;  2R05 A;  3AS5 A;  3IKO B;  1E90 A;  3DWL G;  2C0M A;  4G24 A;  3L9T A;  5EIL A;  4GPK A;  1K3Z D;  1QYM A;  2ZGG A;  2BED A;  3ASD A;  1TNU A;  5G05 J;  3PZD A;  3CR3 A;  3CV0 A;  2XPI A;  2XEH A;  4XI9 A;  3RK6 A;  5ENQ D;  1TR4 A;  1NA0 A;  4C48 B;  1N52 A;  4RLY A;  3ZXP A;  5CMY A;  1UN8 A;  3ASG A;  1SA5 A;  4JVS A;  3PZ2 A;  4PH4 B;  4TXQ A;  4A1G A;  1E7V A;  2I1J A;  4N3C A;  1L5J A;  5T3R A;  2L0I A;  5BXO A;  4WWP A;  1JCS A;  2DVW A;  3FEX A;  3HXD A;  4LER A;  4EBA A;  3ABK E;  3CVV A;  3UM2 A;  1YMP A;  3Q4A B;  3BU8 A;  4GZC A;  1HG5 A;  2OCC E;  2WXI A;  2FUL A;  1OXJ A;  3MV2 B;  1OCO E;  2CHZ A;  4ATG A;  4OAU C;  3R7R A;  3JXJ A;  4LNU D;  4I1O B;  4LCT A;  5EYL A;  1JUQ A;  3Q9N C;  3MYV A;  4YDY A;  4QQI A;  2V4L A;  2LUH A;  3DSS A;  3C3O A;  3CK8 A;  4AP2 A;  3PEV B;  3Q7A A;  3MA5 A;  3Q75 A;  2L9B A;  4A1S A;  4GYY A;  4JHK A;  3R9A B;  2WXF A;  2EIN E;  4NIK A;  3SNX A;  2FO1 E;  1TNY A;  3MKQ A;  4GTV A;  3Q9U C;  1HS6 A; 
#chains in the Genus database with same CATH homology
 3UMV A;  4AY6 A;  1INZ A;  3FTY A;  1IQR A;  2J4D A;  1WAO 1;  3SD5 A;  4B8C B;  3CVL A;  5KJM A;  2JEK A;  4HS2 A;  4H7Y A;  4KVM A;  3EHN A;  4FU3 A;  4L23 A;  1OWL A;  3DBS A;  3LY8 A;  4KVO A;  5FQ6 A;  4BSX A;  3U3W A;  4BT8 A;  3O4Z A;  4BTA A;  3FU3 A;  1GW6 A;  2Y4T A;  3NZS A;  2FI7 A;  1HF8 A;  4ANX A;  2J08 A;  4DI4 A;  1HXI A;  3FTV A;  1HE8 A;  3MCX A;  1Y8M A;  3CHQ A;  2XHE A;  4TUU A;  3FTS A;  2QY7 A;  4F1S A;  3OXL A;  3RIB A;  4QFV A;  1FVH A;  4FLH A;  3MJW A;  3G2U A;  5AJD A;  2MOW A;  1ZU2 A;  4AJW A;  3G2T A;  3ESL A;  5D0Q D;  3ZN3 A;  4C0E A;  5A6C A;  3HHM A;  4UWK A;  3L22 A;  1HG2 A;  2LNI A;  4UWH A;  3FH8 A;  3UPV A;  3KS2 A;  4CGV A;  2XQ0 A;  2FO7 A;  4WAF A;  1EYH A;  1IYG A;  2VSO E;  3L16 A;  4GA1 A;  1PY1 A;  3HDX A;  2DIW A;  4UI9 J;  2V0P A;  4NRH B;  3ZYM A;  2AXV A;  4P29 A;  3PUK A;  3CKB A;  5BPP A;  4FUL A;  1H0A A;  1OWM A;  2WMN A;  4DPR A;  1IHG A;  2R17 C;  3SBT B;  4Q94 A;  4U0U A;  2VTB A;  1FCH A;  2CHX A;  1JWG A;  2WXO A;  2WXG A;  3APC A;  3HVE B;  3FUN A;  3FTX A;  3WXX A;  4LEU A;  2IF4 A;  4Y6C A;  3L08 A;  4I1A A;  5FZR A;  1PC2 A;  4EEC A;  5LCW J;  3NF1 A;  2J09 A;  3VLE A;  2NXP A;  1W3B A;  4HVB A;  4AIF A;  5EX3 A;  3CSF A;  4KYO B;  3FUI A;  1H6K A;  1JWF A;  2X38 A;  3I4G A;  1SZA A;  5BNW A;  3OXG A;  2FEZ A;  3FH7 A;  3EIQ C;  4XE0 A;  3UX4 A;  4GCN A;  4U0Z A;  5CHE E;  2ION A;  3FY4 A;  1H2V C;  2X3M A;  3E4B A;  4V3I A;  3ML8 A;  3LDZ A;  2XGS A;  3L13 A;  1HO8 A;  4EBA G;  4HOS A;  2I2O A;  4Q69 A;  4EZJ A;  3FUL A;  3BG1 B;  4G1T A;  4JHJ A;  5G04 C;  2VSY A;  3LYA A;  3QJZ A;  3ZFW A;  4I2W A;  2ZU6 B;  4NUR A;  3PE4 A;  5KCM A;  2WM9 A;  3EJN A;  2VSN A;  1QQE A;  3CVY A;  1LF8 A;  4WNG A;  4UWL A;  3IHY A;  1HZ4 A;  3EHM A;  4TRQ A;  5D0O D;  4M3O A;  3MKR A;  3ONL A;  3SI5 A;  5C1D A;  3PNT B;  4GCO A;  5AJL A;  2PQN A;  2X6H A;  3PNL B;  4GA2 A;  4XKC A;  3U66 A;  2JLB A;  4N3B A;  3AS8 A;  3CQC B;  3FDH A;  3GZ2 A;  2C2L A;  3ENE A;  4B8A A;  3LY9 A;  3ZPJ A;  2A5U A;  4N2S A;  5CMW A;  2PQR A;  5BT1 A;  2WXN A;  3KD7 A;  1U3C A;  2VQ2 A;  4ANW A;  4UQZ A;  2LO6 A;  1S0P A;  2VGX A;  3FFL A;  2QFC A;  3JQ0 A;  3QB2 A;  4JEH A;  4JXT A;  5FWQ A;  3VTY A;  1E8X A;  1HFA A;  4J0U A;  1KT1 A;  5J08 A;  3FWV A;  4I17 A;  3B7R L;  4L1B A;  3MGB A;  2XCC A;  5G05 C;  2LSV A;  3HYM B;  3Q47 B;  4R7L A;  3PS6 A;  4XIF A;  4KZC A;  1Y6I A;  2GRL A;  2P58 C;  2XPZ A;  2AW6 A;  3D9O A;  3GYZ A;  3P2B A;  4TV3 A;  1EF1 C;  3S2A A;  3SHF A;  2MRI A;  3QDN A;  3UUX A;  3JQ1 A;  3EDT B;  3U4T A;  4HOR A;  4G2V A;  4N5C A;  3ZXS A;  3TXM A;  1NZN A;  4I1M A;  2AXU A;  2HYZ A;  2YQ8 A;  2OVB A;  3N71 A;  4I6G A;  4K0R A;  1TJF A;  2I1K A;  3MEK A;  4D10 C;  2EQX A;  3FUE A;  4CEM A;  5LX8 A;  4B89 A;  3PE3 A;  1U3D A;  1SQM A;  2LSU A;  3RO2 A;  4EZL A;  4J8E A;  1ZBP A;  3APD A;  1B89 A;  4G25 A;  3S7J A;  4JC8 A;  4AVX A;  5E75 A;  4A3V A;  3RRU A;  4BX8 A;  4DLO A;  4FAD A;  2R5S A;  1OWP A;  2LAH A;  1HH8 A;  2IOL A;  3T5X A;  3VLD A;  4Y6W A;  4CDM A;  2CG3 A;  3LVQ E;  3PRZ A;  3FH5 A;  5DIZ A;  4FC8 A;  2UWJ G;  1H2U A;  5EX0 A;  4AEZ C;  4AY5 A;  4BFR A;  4E6H A;  5BV1 A;  3QAR A;  3ZRH A;  2J07 A;  4APF A;  2OOE A;  3ASF A;  4I6J A;  5J90 A;  3FUJ A;  3ZGQ A;  4KZ0 A;  4GYO A;  2PM6 A;  3GZ1 A;  2CHW A;  4J6I A;  4LUN U;  3CVU A;  3CQG B;  5ANR A;  3UT7 A;  4OYS A;  4Q96 A;  2WPV A;  3I5P A;  4U8H A;  2WXL A;  4IYP A;  3PH0 C;  2XGM A;  4JA7 A;  1YA0 A;  5HI7 A;  4A3T A;  4BX9 A;  3CVQ A;  2V5F A;  4U07 A;  4UWG A;  4RG6 A;  3RRN B;  2KCK A;  4ACL A;  1DVP A;  2WXK A;  3CGH A;  4KBQ A;  4JA9 A;  4I6E A;  2X6I A;  3RRM B;  5BW8 C;  3ZEF A;  3RU0 A;  1N54 A;  2GW1 A;  3D9K A;  3HVE A;  3ZVV A;  2GRM A;  3TG4 A;  2HR2 A;  3BG0 B;  4KXK B;  2IJG X;  3FUM A;  2GGF A;  3S7F A;  3QOU A;  1BPO A;  1MHQ A;  2XGO A;  1VDY A;  4PDX A;  3OXF A;  3NQP A;  2I6H A;  1NP7 A;  2X6F A;  5EKQ D;  2C0L A;  1QZ2 A;  3EIJ A;  2Y3A A;  3PDN A;  4AXH A;  3TAX A;  3MZL B;  5LOZ A;  5FQ7 A;  4FJZ A;  4GYW A;  5FT9 A;  2Q7F A;  3CVN A;  3IBE A;  5M72 A;  2WB2 A;  3FU6 A;  4DK5 A;  1KT0 A;  1OWO A;  5DBK A;  3B7U X;  3ZYQ A;  4I2Z A;  3FTU A;  4DLQ A;  2VYI A;  2HM8 A;  3U9W A;  3ZYL A;  5FZS A;  2MHK A;  3APF A;  4CRW A;  3MX3 A;  3B13 A;  2WQH A;  3LKU A;  2WXQ A;  4GB9 A;  4PUC A;  1IQU A;  4CCA A;  2VTB B;  3JCK C;  2XPY A;  3UT8 A;  2YHC A;  4B94 A;  3DPD A;  1X5B A;  3TXN A;  2WXR A;  4NQ0 A;  3QK0 A;  4W9R A;  2OVF A;  3R7Q A;  3CHR A;  3FHE A;  2IU1 A;  3QKY A;  3LXU X;  3O48 A;  5ANL A;  3ZHE A;  4ACK A;  4GZ5 A;  4ILG A;  4GU5 A;  3ZIM A;  3AU4 A;  4EQF A;  3D9M A;  4K03 A;  4G26 A;  2XRZ A;  3L54 A;  4IN3 B;  5JJT A;  3G2S A;  3CST A;  2OND A;  4JZY A;  4L2Y A;  2X6K A;  4FLB A;  2I9C A;  5KJN A;  3TL5 A;  2VSX E;  4YVQ C;  3D9N A;  4JL0 A;  3FUF A;  5ENN A;  5JHB A;  2KZT B;  2J49 A;  2XCB A;  3D9P A;  5AIJ A;  5A7D B;  3D3M A;  2YIN A;  3OAW A;  5LFA A;  3K9I A;  4ILI A;  1ELK A;  3CVX A;  2A4Z A;  1HX8 A;  3ONK A;  3LJ3 A;  1E8Y A;  1P5Q A;  3FTZ A;  1SZ9 A;  3Q49 B;  2OV8 A;  3TG5 A;  4N2Q A;  4L2L A;  4BWR A;  4YND A;  2KC7 A;  2WQ7 A;  5A23 A;  4FP7 A;  1PAQ A;  2J4B A;  3B7S A;  4NAC A;  3AU5 A;  1OWN A;  3PRE A;  4N3A A;  4UI9 K;  3QWP A;  4GAA A;  5BUZ A;  1E8Z A;  2WXM A;  3U64 A;  5ARG A;  4E85 A;  1HU3 A;  3VTX A;  4WND A;  3FU5 A;  3ASH A;  4HOQ A;  2UY1 B;  4YVO A;  1KLX A;  4KT6 B;  4OVU A;  4JEU A;  3P1U A;  5KJK A;  4OVV A;  3FP3 A;  4CDN A;  2NC9 A;  4U63 A;  4CT4 A;  5AEN A;  2LAI A;  3L17 A;  2M63 A;  2WXP A;  3OTN A;  4MRU A;  2CG2 A;  2KCL A;  2FF4 A;  5FTP A;  5G04 J;  2VGX B;  4UI9 C;  3GW4 A;  2CFU A;  3CK9 A;  3KEZ A;  5CCL A;  2WXH A;  3LEW A;  4UQY A;  1FVF A;  3G2V A;  3FUH A;  5ARF A;  3HIZ A;  2WVI A;  4AV7 A;  2WMO A;  3I3N A;  2VJ8 A;  4GMJ A;  1EPU A;  4FJY A;  5C2Y A;  3UQ3 A;  4HOT A;  4BTB A;  2DCP A;  3CIA A;  4FHK A;  4GZD A;  4O6F A;  3FUD A;  4F7A A;  5CCM A;  2YNQ A;  4WWN A;  2V8S E;  1DNP A;  3GZS A;  3CHP A;  4WNE A;  5FZQ A;  3SZ7 A;  5LCW C;  3AS5 A;  3IKO B;  3MKQ B;  1E90 A;  3IHV A;  2C0M A;  3FEY A;  4I9C A;  3LVR E;  1E7U A;  4G24 A;  3UT4 A;  3PUJ A;  4MLP A;  2IQC A;  4WUY A;  3ZW3 A;  1UJJ A;  2KAT A;  4GA0 A;  4PS7 A;  5JJ7 A;  5FQ4 A;  1TJC A;  5AYW D;  4GPK A;  4GML A;  4B0Z A;  4ABN A;  4FHJ A;  3G2W A;  4GZ3 A;  4U04 A;  3VLF A;  4F53 A;  3ASD A;  4F3V A;  3CVP A;  1Z3Y A;  4DI3 A;  5G05 J;  3PZD A;  3RJV A;  2AWI A;  1E8W A;  4PS3 A;  4KMO A;  3CR3 A;  4RG9 A;  3CV0 A;  5T8I A;  3L6A A;  3QAQ A;  3IEG A;  3SBS A;  4APO A;  4WWO A;  1UN9 A;  4XI0 A;  2XPI A;  4XI9 A;  2BUG A;  3RKV A;  3RK6 A;  1UG3 A;  1NA0 A;  4JW1 A;  1N52 A;  3Q5M A;  5CMY A;  5BV0 A;  2Y4U A;  4C0M A;  3JUI A;  2RD0 A;  1UN8 A;  4A55 A;  1Z3X A;  1H19 A;  3ASG A;  2BTD A;  4JVS A;  1OUV A;  3NZU A;  3AS4 A;  4BT9 A;  3ML9 A;  4MKT A;  4HLE A;  1A17 A;  4PH4 B;  4H7X A;  3CHM A;  3URZ A;  4A1G A;  3ZYK A;  2RG8 A;  3Q15 A;  5JHA A;  1E7V A;  2YHE A;  2I1J A;  3QC1 A;  4N3C A;  1L5J A;  2PZI A;  4JHR A;  5T3R A;  4CT0 A;  4EPZ A;  2L0I A;  3FTW A;  3FUK A;  4WWP A;  1XNF A;  2AXZ A;  1QNF A;  2J9Q A;  1ELR A;  4XZ4 A;  3FEX A;  3SF4 A;  4LER A;  4XX5 A;  3RO3 A;  4EBA A;  2R59 A;  4L7T A;  5LP0 A;  3LCA A;  4N39 A;  1UW4 B;  4J8D A;  4ME2 A;  4XKB A;  3CVV A;  4WNF A;  2WXJ A;  3IV0 A;  1ELW A;  5G55 A;  3TGO A;  3BEE A;  4IUL A;  2PL2 A;  3Q4A B;  3S7B A;  3CHS A;  1UJK A;  3D9L A;  3SGH A;  1TEZ A;  4GZC A;  2NSZ A;  2KZT A;  1HG5 A;  4UWF A;  2KCV A;  3JYS A;  5G2N A;  2WXI A;  1WM5 A;  1H2T C;  4U0S A;  3CK7 A;  2L6J A;  2FUL A;  3CLJ A;  3ESK A;  2X6J A;  1E96 B;  3MV2 B;  3CKC A;  5HQ8 A;  2XEV A;  4RSY A;  2CHZ A;  5KJL A;  2E0I A;  4J8F A;  4ATG A;  5EDS A;  3PVL A;  3PEU B;  1EDU A;  3R7R A;  3ZHE B;  4BY6 A;  4PS8 A;  5T4Y A;  2E2E A;  2VGY A;  4G23 A;  4DJA A;  4I9E A;  4I1O B;  3FU0 A;  5JJ6 A;  4LCT A;  4URK A;  3ULQ A;  4CGW A;  3MV3 B;  3LPZ A;  1JUQ A;  1Z6T A;  3C98 A;  3QWV A;  4UQX A;  1MQS A;  4CDR A;  4FA6 A;  5E76 A;  2UY1 A;  4AOF A;  3D9J A;  3MYV A;  4GZ6 A;  4I43 A;  3TJP A;  2FBN A;  2V4L A;  4HXI A;  4RVB A;  3CK8 A;  4HFG A;  4AP2 A;  3PEV B;  3LY7 A;  3MA5 A;  3B7T A;  4LRZ A;  4JPS A;  3CEQ A;  4G11 A;  2AVP A;  3SFZ A;  2L9B A;  4IRU A;  3T8M A;  4A1S A;  2WQ6 A;  4AM9 A;  4GYY A;  3S7D A;  3LS8 A;  4JHK A;  4J8S A;  3R9A B;  2WXF A;  1NA3 A;  3T5V A;  3SNX A;  2KM4 A;  3CHO A;  4HOU A;  3CVW A;  2HO1 A;  5FQ8 A;  4EZK A;  2ILR A;  1JPL A;  1WY6 A;  3QWW A;  4C9B B;  4ILH B;  3I4R B;  2XRY A;  2BF0 X;  3MKQ A;  2PM7 A;  5FJY A;  1XGW A;  2L0T B;  4ANV A;  4MS6 A;  3QNK A;  2IOS A;  3KAE A;  3D9I A;  2CFZ A;  4ANU A;  2DBA A;  1HS6 A;  2IFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...