3E37A

Protein farnesyltransferase complexed with bisubstrate ethylenediamine scaffold inhibitor 5
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Structural basis for binding and selectivity of antimalarial and anticancer ethylenediamine inhibitors to protein farnesyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 128
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3e37A00
1SA5A 4GTMA 3EU5A 1N94A 1KZOA 2ZIRA 3DSWA 3HXDA 1N95A 4GTPA 1S63A 1FPPA 3DSUA 4LNGA 1N9AA 3PZ1A 1O5MA 3SFYA 2IEJA 1O1TA 1FT1A 3KSLA 3HXFA 3HXBA 4GTSA 3PZ2A 3PZ3A 1D8DA 4MBGA 3E37A 1FT2A 4EHMA 1TNOA 1X81A 3E32A 2R2LA 3Q73A 2H6HA 1TN8A 1LD7A 3E33A 2BEDA 2H6GA 1NI1A 3DSXA 4GTOA 3Q7AA 1N4QA 1S64A 1NL4A 3E34A 1TNZA 3SFXA 3DSSA 4YDEA 1JCQA 2ZISA 1SA4A 3Q75A 1TNYA 3HXEA 1JCRA 1TNUA 1DCEA 1KZPA 1N4SA 1TNBA 1LD8A 1LTXA 3DPYA 3C72A 1O1SA 4GTTA 4GTVA 3DSTA 3Q7FA 3DSVA 1N4PA 2H6IA 1MZCA 1D8EA 1O1RA 1TN6A 3PZ4A 3Q79A 3EUVA 2H6FA 1N4RA 4GTRA 1QBQA 2F0YA 4LNBA 4L9PA 3DRAA 3HXCA 1TN7A 1JCSA 3Q78A 3KSQA 3E30A 4YDOA 4GTQA
chains in the Genus database with same CATH superfamily
3FULA 2YNQA 1PAQA 1N94A 3U9WA 3CHQA 2BKKB 3T8KA 4O6FA 2XCBA 3CHSA 1O1TA 2E0IA 3C3RA 4GTSA 5BXUA 5ANRA 3CVNA 1TYQG 2F8XK 4PS8A 2L6JA 1DNPA 1MJ0A 3LCAA 4ABNA 3FU0A 3FUKA 4J8SA 5LOZA 4HQDA 3CSFA 4ATZD 5BXOA 3CSTA 5EILA 4I1OB 4JPSA 2VSOE 3Q5MA 3RRMB 5B1AE 3DSSA 4AY5A 3LVQE 2CG3A 3Q75A 3ZIMA 1HG5A 4DX2A 4JL0A 2UWJG 3FUHA 4F3VA 5HS0A 1MX4A 4J8EA 3ENEA 2YHEA 4LUNU 2AW6A 4C9BB 3ASGA 3AG4E 3CVWA 4F1PA 4UWFA 3ZN3A 3Q79A 1SVXA 4J8FA 4AXHA 5HQ8A 1IHBA 4JA9A 3RKVA 3MV2B 2QYUA 1H2VC 4JHJA 3SNXA 3GW4A 2LO6A 1KT1A 3UI2A 2Y0BG 5FQ7A 1N11A 1EYHA 1HZ4A 2XGSA 1DC2A 3CVVA 2GRQB 3RO3A 1E96B 2FO1E 5M72A 1N52A 3E37A 4RLYA 2R2LA 3ZRHA 1OCZE 3KD7A 3ZYKA 4CDMA 4TXRA 1N0QA 5CHEE 3UPVA 3T8MA 1NFIE 1OWLA 4J6IA 5EN5D 4C0MA 1BU9A 4TUMA 3C3OA 4CDNA 2P9NG 4DJAA 1S0PA 2DVWA 4EQFA 4KBQA 3RIBA 2XZTG 1DCEA 1KZPA 4N3CA 4EPZA 1LF8A 2HYZA 3L6AA 1Z6TA 2OVFA 4TUUA 1A17A 3DPYA 3UQ3A 1IYGA 2Y69E 3PVLA 5JMND 4G25A 4JEHA 5FZRA 3V2XA 4UWHA 1OCRE 4ANVA 2KC7A 2XGMA 2WB2A 1H6KA 1EPUA 3S7BA 4BEPA 4N2QA 1DCQA 4ME2A 5T8IA 3I5PA 3SQVA 4GZDA 3UT7A 3LYAA 3AAAC 3EU5A 2GRNB 4FU3A 4ILHB 3R7QA 3ZW3A 3UIPC 4FLHA 3GZ1A 1N9AA 3ZU7B 1UOHA 4BSXA 4CT0A 3SFYA 4A3VA 5B1BE 3TL5A 5C1DA 1MX2A 4HXIA 2KZTB 1FCHA 2LUHA 4Y6WA 3NOCD 3E32A 2J09A 4RQIA 1H2TC 3PE3A 3IHVA 3QWVA 4IRUA 3SFZA 1S70B 4BTBA 5EIBE 1KPSB 2P9LG 5BW8C 2LSUA 4DI4A 1XGWA 3P1UA 4GPMA 4I1AA 3SFXA 3Q9NC 5A23A 4RG6A 4U8VD 3AS5A 3HVEB 4TXQA 3BG0B 1LTXA 3T5VA 3TXNA 3ZYQA 3LDZA 4U8YD 4ANWA 1Y6IA 2CG2A 4UQYA 4L2LA 4CGVA 2WXJA 1HG2A 4LEUA 4A3TA 2IF4A 3BUAA 4U04A 1E7UA 4ILIA 2A5UA 4EZKA 4G2VA 3URZA 3FDHA 3DEOA 3HXCA 4X8QA 4XIFA 4G1TA 4I9CA 4CDRA 2AVPA 4MKTA 2VQ2A 3PNTB 2I1KA 1WDYA 4M7CA 4GYWA 4HVBA 1FT1A 3ML8A 3SBTB 2QC9A 2WXOA 5G04C 3LEWA 5EYLA 3PZ2A 3CHPA 1D8DA 4I1MA 5AAOA 4C0EA 3WXXA 3JUEA 3ASDA 2XQ0A 3OXLA 1H19A 4FHJA 5AJDA 2V5FA 3SF4A 3MKQA 1KT0A 4HOUA 2DIWA 3LY7A 2CFUA 3LY9A 5KJNA 3CR3A 3AG3E 2UY1A 4GA1A 3OXGA 2WXHA 2LNIA 1H0AA 5HI7A 4AEZC 4QQIA 5EX3A 3UKUG 2WVIA 4J8DA 5ENTD 1YYHA 3FUEA 3UM0A 1O1SA 3MJWA 5AARA 3ABME 2J07A 4B93B 3AS4A 3ZGQA 2VTBA 1BI7B 4ZHBA 4P29A 2ZGGA 1QQEA 4FJZA 4ANUA 3PE4A 2GRLA 1OT8A 4BTAA 2KBXA 3CV0A 4XZ4A 4MS6A 4G26A 1K8KG 3NBNB 4EECA 1UJJA 4R7LA 3ABLE 3AG2E 3SI5A 3ZYLA 3C98A 5FQ8A 4U0UA 3GYZA 3PZ3A 5CERB 2WXNA 4ILGA 3NAWA 3NQPA 4EHMA 3AU4A 5FZSA 4HOSA 4XEIG 2JEKA 3TG4A 3UIOC 1PY1A 2J4DA 3PS6A 2XEVA 3TJPA 3LY8A 4LCTA 1Q2ZA 4I43A 2QZAA 4N5CA 2P9PG 4GYOA 3D3MA 3CK8A 2RKKA 5FIOA 1NL4A 1E90A 4HLLA 1AWCB 4HLEA 1JCRA 3PEVB 4NACA 2GRMA 2WMOA 2JABA 5KCMA 4WWOA 1ZU2A 4YVOA 1TEZA 3PDNA 3L54A 5KJLA 3J5PA 3UM1A 3G2UA 2ETBA 2XRYA 2RG8A 3HHMA 1JWGA 3CQGB 3PNLB 1HFAA 3LS8A 4HRMB 4AY6A 3FY4A 2L6BA 1BLXB 3FUIA 3D9OA 5LX8A 5IY5E 3E30A 4YVQC 1E8ZA 3PUKA 3X2QE 1SA5A 5AYWD 5H7PA 2FULA 4J7WA 3D9LA 4CEMA 4D10C 5ENSD 4JVSA 2WPVA 4GCNA 2RFMA 4GZ3A 4DX6D 1KLXA 3MA5A 2VGYA 2J4BA 3R7RA 2PM7A 4ACLA 3VTYA 1K1BA 3Q73A 2H6HA 3FUMA 1ELRA 4PH4B 4WWNA 4WAFA 5EDSA 2KATA 3JXJA 3EIJA 2X6JA 2WXRA 5ENQD 4MRUA 5AQAA 5JHBA 2NYJA 1SA4A 1JWFA 1TNYA 3FTSA 4U96D 2FO7A 5A6CA 4BX8A 5ENOD 4B8AA 3TGOA 4EZJA 1MHQA 3FEXA 2VSXE 2B0OE 4JD2G 3ASFA 1IQRA 5AQBA 3CVQA 3I4GA 1OCOE 4I2ZA 3V79K 1N4PA 3LXUX 2WQ6A 3QJZA 1D8EA 1WG0A 3OTNA 4JA7A 2LSVA 3SO8A 5EYPF 3S2AA 5FQ6A 2XS8A 2AXZA 2HE0A 2VGEA 3KSQA 2L9BA 4H7XA 4ATGA 3JUIA 1OUVA 2R03A 2FBNA 3EHRA 3S7JA 3JQ0A 3DSUA 3QDNA 3SY2A 1MQSA 1U3CA 2KCLA 1HO8A 1Z3YA 4FHKA 4HFGA 3PZ1A 4GYYA 2IEJA 3ULQA 4DPRA 1E8WA 3HYMB 3RU0A 1ZB1A 2V5QC 3D9NA 1TNOA 1X81A 4G8LA 4K5BA 4MLPA 4HRNA 3OAWA 4GMJA 4NIKA 2VJ8A 5E76A 3PZDA 1E8XA 1ZBPA 3FUNA 1N4QA 1A5EA 5CMYA 3D9IA 4YDEA 5D2MC 1WAO1 4IULA 3QC1A 2KM4A 3HDXA 5AQ7A 1LD8A 3FP3A 3ULEG 1JUQA 3FFLA 2WXPA 4FC8A 5JJ6A 3Q4AB 3RK6A 5CBNA 1TJCA 2XENA 1HF8A 4APOA 1GW6A 2X6HA 3JQ1A 2AXVA 1WY6A 1PC2A 2OEWA 3FTWA 3DEPA 4GU5A 3O4ZA 5G55A 3IV0A 5ENPD 1TN7A 3N71A 3ONLA 3ZHEA 4KVMA 4U63A 2X6KA 5FQ4A 4DUIA 1V54E 2EILE 3EHNA 5C2YA 3RRUA 4KZCA 3CIAA 5CMWA 4FLBA 3UINC 3FEYA 2AWIA 4XE0A 4JHRA 3U66A 4HI8A 2YHCA 3TWQA 3QWWA 4MBGA 3V30A 4Y6CA 3PRZA 4TXPA 2BTDA 2Y4UA 1K3ZD 4RG9A 3NF1A 3MZLB 5AJLA 2CHWA 2BEDA 3CHOA 3MCXA 3JCKC 2PM6A 4JZYA 3TG5A 5JJ7A 1MYOA 3ABKE 5CCMA 1HXIA 4C48B 5EKQD 3SHFA 3VTXA 1IHGA 2I2OA 3U3WA 3ESLA 2VSYA 3U4TA 4UQXA 4DLQA 1B89A 2Y1LE 3IEGA 2Y4TA 3ZXSA 5BNWA 3KEAA 2DWZA 5CEDB 3UM3A 4I17A 3L82A 3BU8A 4BERA 4ACKA 2ZU6B 3FHEA 2KCKA 3ZXPA 3DSTA 3Q47B 4GA2A 3TWVA 3KEZA 3CVYA 2H6IA 4U8HA 1O1RA 3PZ4A 5AENA 2XRZA 4GTRA 2ETAA 1QBQA 4ANXA 4LNBA 5BT1A 5LCWJ 4LG6A 5LFAA 1W3BA 2AXUA 1RZ4A 3C3QA 2C0LA 4I9EA 4UI9C 3HXDA 1N95A 4GTPA 2VGXA 3TWUA 2P9IG 4TRQA 3LKUA 5KJKA 4PUCA 4LERA 3UTMA 2V0PA 4DLOA 2DYSE 3MGBA 3LPZA 3T9KA 4A1SA 4B94A 2BKGA 4OAUC 2X3MA 3C5RA 2GRPB 1NI1A 2IY0C 5BPPA 4GZ6A 3UX4A 3AJIA 2WMNA 3B7UX 4Z68A 1ELKA 4HB5A 1QNFA 3VLDA 1N54A 1UG3A 5KWDA 4YDWA 4LSZE 3DBSA 2PL2A 2V4LA 4QFVA 3EDTB 3EHQA 2QY7A 4APFA 3LJNA 5D0QD 1U2VG 3Q9UC 4GAAA 2DCPA 2IFUA 1P5QA 3KAEA 2P9UG 4JEUA 5BV1A 4FULA 3FUJA 2R59A 3MKQB 1HU3A 2XCCA 4IYPA 4RVBA 4AV7A 4BX9A 3QOUA 3FUFA 3ZUVB 2UY1B 3DXMG 3B7TA 4I6EA 3HXFA 2HO1A 3EJNA 5B3SE 2J8SD 3QWPA 5KNHD 1TN8A 4L7TA 1UW4B 2M63A 4L1BA 2VTBB 4V3IA 3ZEFA 4O1PA 3GZSA 2X38A 2WXGA 1NZNA 2WXFA 2RFAA 3RAUA 1TNUA 3J5QB 3S7DA 1TNBA 3D9MA 3FH7A 2R02A 1IKND 3D9HA 5CECB 4G24A 3VLEA 3U64A 1OWNA 4ZFHA 3JYSA 4U0SA 3CHMA 4Q94A 3JXIA 4GTTA 5FTPA 1WM5A 2IQCA 3TAXA 3HG0D 4AIFA 3I4RB 2ZXWE 2LAHA 1NA3A 2E2EA 2EINE 4J8YA 3TWWA 5T3RA 5G04J 3G2WA 3G2SA 3Q15A 4FJYA 2XHEA 3AG1E 5DBKA 3L17A 4GTQA 1KZOA 4WUYA 4A63B 3CEQA 3NZSA 2J9QA 4B89A 5CRVA 2HR2A 4U07A 2EQXA 1O5MA 2ZGDA 2NXPA 3AS8A 5T4YA 3ZNGA 2WXQA 4U95D 4BETA 4DI3A 1FT2A 3B7RL 2PNNA 3BQOA 1X5BA 2XPIA 2C0MA 3LJ3A 5FINA 1OXJA 1YA0A 4BFRA 4XKCA 4B8CB 3QKYA 3SZ7A 2A5EA 4CRWA 2FEZA 4I6GA 5AIJA 4Q96A 2F37A 1H6OA 3R9MA 3FU5A 2LAIA 3R9AB 3CQCB 3CVLA 3VLFA 1V55E 4BWRA 5HKPA 3QNKA 2R5SA 4RSYA 4HNAD 2WXIA 3L13A 5EX0A 3IHYA 5FWQA 4LRZA 2I1JA 2P9KG 3Q7FA 4O1OA 2L0TB 5CEAA 4JC8A 2H6FA 3TWRA 3DWLG 5ENRD 3P2BA 1U3DA 2RD0A 4EBAG 4OVVA 4G23A 3EIQC 4KXKB 5J90A 4N2SA 2J08A 2XGOA 2F8YA 3V2OA 4K5AB 1FPPA 1SW6A 2IONA 4BSZB 2WQ7A 3EU9A 4XKBA 3PREA 4W9RA 3FH5A 3KSLA 5A7DB 3IKOB 5ENNA 1TR4A 3CGHA 3G2TA 2WXKA 2IU1A 3L08A 3DPDA 4DX5D 1ELWA 2ILRA 3FH8A 5LP0A 4F6RD 4U7EB 4I2WA 4NURA 2NC9A 4L2YA 3MX3A 2KXPC 4GTOA 3B7BA 3L22A 5CCLA 1H6PA 3E34A 1JCQA 2IOLA 3NZUA 4GCOA 4E6HA 3QARA 4CCAA 2HM8A 4LNUD 1G3NB 2BUGA 4CZ2D 2OEVA 3CHRA 2EIME 3D9KA 4FA6A 2XEEA 2MHKA 3B13A 3RSEG 4YNDA 5KJMA 3L9TA 4KMOA 4U0ZA 2V4HC 1RW2A 3QAQA 3APFA 3TXMA 4AOFA 4HRLA 3HIZA 4NRHB 2XPZA 4JXTA 2VYIA 4WNFA 2NSZA 5LCWC 1BPOA 1JCSA 3Q78A 4I6JA 5ANLA 2L0IA 4K03A 5G05J 2P9SG 4GTMA 4HI9A 4J0UA 3DSWA 4Q69A 5CBOA 2IO3C 5BUZA 3ML9A 4CT4A 3QK0A 3UXGA 3AU5A 2OOEA 3W9FA 4AVXA 1YMPA 2VSNA 3ZFWA 4UWLA 1NA0A 4AJWA 4BT9A 1EDUA 4HORA 4O60A 1FVFA 4E85A 2OV8A 3FU3A 4FADA 3ONKA 3E33A 3BEEA 2V8SE 1OWPA 2H6GA 5ITZF 3DSXA 3FUDA 5FT9A 1H2UA 1S64A 3FTUA 2WQHA 1TNZA 4XI9A 4WWPA 3V31A 2ZISA 4KZ0A 3HXEA 4G8KA 1DVPA 5G2NA 3ZHEB 3CLJA 2KZTA 1QYMA 3L16A 2BF0X 2PZIA 2GROB 3ULYA 4BESA 3NB2A 2P2CP 3C72A 1IXVA 4KT6B 4H7YA 2I9CA 3CKBA 5AQ9A 5KNGA 3UT8A 3RJVA 2C2LA 3PEUB 3ISMC 3CK7A 3O48A 3EUVA 4NQ0A 1K1AA 4WNEA 3FU6A 4UWGA 4UQZA 1HX8A 3SBSA 3ASHA 3I3NA 4CGWA 3MV3B 3PH0C 2XEHA 5JHAA 2FI7A 3HVEA 2ZIRA 4FP7A 3UM2A 4JW1A 2LXLA 1HH8A 3B95A 4IN3B 4F53A 3ASNE 3ZKJA 4KVOA 2PQNA 3G2VA 2IJGX 3D9JA 4UI9K 3HXBA 5J08A 2JLBA 4HBDA 5JJTA 2MRIA 1OWMA 1TJFA 1HE8A 5JA4D 4PDXA 2EIJE 1BI8B 5DIZA 5ARGA 3NOGD 2IOSA 4XI0A 1SZ9A 3Q7AA 4EBAA 4OVUA 4N3AA 2I6HA 3PUJA 4N5QA 3APDA 1N4SA 2DBAA 2MOWA 1UJKA 2GW1A 5FJYA 3FWVA 4GB9A 2VGXB 1FVHA 3FTZA 4F7AA 1Z5SC 5E75A 4GA0A 4HOTA 3FTVA 3Q49B 2XS1A 4URKA 2P58C 1MZCA 2OVBA 1INZA 2DZNA 4GPKA 4OYSA 3DXKG 4WNDA 4WNGA 3RRNB 3SD5A 2AJAA 1Y8MA 2WM9A 3EHMA 4L9PA 4B0ZA 3DRAA 4JB8P 1XNFA 4OAVB 4JHKA 3D9PA 1OWOA 1JPLA 2GRRB 4LNGA 5FZQA 4CYMD 3FTYA 2DYRE 1OCCE 2CHXA 2GGFA 3TWSA 3KS2A 1BD8A 5HRYA 3ZVVA 3UUXA 3BG1B 3APCA 2WXMA 3ZYMA 4K0RA 1LD7A 4N3BA 2PQRA 5ARFA 1L5JA 3UKRG 5BV0A 3E4BA 2XPYA 1SZAA 1SQMA 3ESKA 3CVUA 3F6QA 5EIDA 3CK9A 4GMRA 2EIKE 3MKRA 2CHZA 4DK5A 5KBAA 4K5CA 1E7VA 1UN8A 5AN8A 2X6IA 2WXLA 2MYOA 2KCVA 3MEKA 4UUCA 4A1GA 1VDYA 5D66A 4M3OA 2IO2C 3CVPA 1QZ2A 4UI9J 2DZOA 3W9GA 2Y3AA 2R05A 1N4RA 3SGHA 2F0YA 4BY6A 4AM9A 4BT8A 3IXEA 4DX7D 3UMVA 4YDOA 2A4ZA 1Z3XA 4DRXE 1S63A 4G11A 2R17C 1D9SA 2OCCE 3CVXA 4HOQA 3IBEA 1OY3D 2ONDA 1N0RA 3UT4A 4GMLA 4DX1A 4UWKA 1UN9A 4YDYA 3LVRE 3ZPJA 2XZDG 4GZ5A 4HS2A 5D0OD 3ASOE 3FTXA 1E8YA 2YINA 4KYOB 2QFCA 2LXMA 3B7SA 1HS6A 1AP7A 2YQ8A 5CRUA 2QYJA 4PS3A 4F1SA 3CKCA 4L23A 3T5XA 2ETCA 3TWXA 3HRAA 4N39A 4AP2A 2CFZA 1EF1C 3GZ2A 4XX5A 1MX6A 4TV3A 2Q7FA 4GTVA 3MYVA 1NP7A 3TWTA 3QB2A 3WG7E 3S7FA 2J49A 3K9IA 3DSVA 1TN6A 3RO2A 2X6FA 1IQUA 1YCSB 4GZCA 4PS7A 4A55A 2B6CA 2FF4A 4EZLA 3OXFA 5G05C
chains in the Genus database with same CATH topology
1SA5A 4GTMA 3EU5A 1N94A 1KZOA 2ZIRA 3DSWA 3HXDA 1N95A 4GTPA 1S63A 1FPPA 3DSUA 4LNGA 1N9AA 3PZ1A 1O5MA 3SFYA 2IEJA 1O1TA 1FT1A 3KSLA 3HXFA 3HXBA 4GTSA 3PZ2A 3PZ3A 1D8DA 4MBGA 3E37A 1FT2A 4EHMA 1TNOA 1X81A 3E32A 2R2LA 3Q73A 2H6HA 1TN8A 1LD7A 3E33A 2BEDA 2H6GA 1NI1A 3DSXA 4GTOA 3Q7AA 1N4QA 1S64A 1NL4A 3E34A 1TNZA 3SFXA 3DSSA 4YDEA 1JCQA 2ZISA 1SA4A 3Q75A 1TNYA 3HXEA 1JCRA 1TNUA 1DCEA 1KZPA 1N4SA 1TNBA 1LD8A 1LTXA 3DPYA 3C72A 1O1SA 4GTTA 4GTVA 3DSTA 3Q7FA 3DSVA 1N4PA 2H6IA 1MZCA 1D8EA 1O1RA 1TN6A 3PZ4A 3Q79A 3EUVA 2H6FA 1N4RA 4GTRA 1QBQA 2F0YA 4LNBA 4L9PA 3DRAA 3HXCA 1TN7A 1JCSA 3Q78A 3KSQA 3E30A 4YDOA 4GTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SA5 A;  4GTM A;  3EU5 A;  1N94 A;  1KZO A;  2ZIR A;  3DSW A;  3HXD A;  1N95 A;  4GTP A;  1S63 A;  1FPP A;  3DSU A;  4LNG A;  1N9A A;  3PZ1 A;  1O5M A;  3SFY A;  2IEJ A;  1O1T A;  1FT1 A;  3KSL A;  3HXF A;  3HXB A;  4GTS A;  3PZ2 A;  3PZ3 A;  1D8D A;  4MBG A;  3E37 A;  1FT2 A;  4EHM A;  1TNO A;  1X81 A;  3E32 A;  2R2L A;  3Q73 A;  2H6H A;  1TN8 A;  1LD7 A;  3E33 A;  2BED A;  2H6G A;  1NI1 A;  3DSX A;  4GTO A;  3Q7A A;  1N4Q A;  1S64 A;  1NL4 A;  3E34 A;  1TNZ A;  3SFX A;  3DSS A;  4YDE A;  1JCQ A;  2ZIS A;  1SA4 A;  3Q75 A;  1TNY A;  3HXE A;  1JCR A;  1TNU A;  1DCE A;  1KZP A;  1N4S A;  1TNB A;  1LD8 A;  1LTX A;  3DPY A;  3C72 A;  1O1S A;  4GTT A;  4GTV A;  3DST A;  3Q7F A;  3DSV A;  1N4P A;  2H6I A;  1MZC A;  1D8E A;  1O1R A;  1TN6 A;  3PZ4 A;  3Q79 A;  3EUV A;  2H6F A;  1N4R A;  4GTR A;  1QBQ A;  2F0Y A;  4LNB A;  4L9P A;  3DRA A;  3HXC A;  1TN7 A;  1JCS A;  3Q78 A;  3KSQ A;  3E30 A;  4YDO A;  4GTQ A; 
#chains in the Genus database with same CATH topology
 3FUL A;  2YNQ A;  1PAQ A;  1N94 A;  3U9W A;  3CHQ A;  2BKK B;  3T8K A;  4O6F A;  2XCB A;  3CHS A;  1O1T A;  2E0I A;  3C3R A;  4GTS A;  5BXU A;  5ANR A;  3CVN A;  1TYQ G;  2F8X K;  4PS8 A;  2L6J A;  1DNP A;  1MJ0 A;  3LCA A;  4ABN A;  3FU0 A;  3FUK A;  4J8S A;  5LOZ A;  4HQD A;  3CSF A;  4ATZ D;  5BXO A;  3CST A;  5EIL A;  4I1O B;  4JPS A;  2VSO E;  3Q5M A;  3RRM B;  5B1A E;  3DSS A;  4AY5 A;  3LVQ E;  2CG3 A;  3Q75 A;  3ZIM A;  1HG5 A;  4DX2 A;  4JL0 A;  2UWJ G;  3FUH A;  4F3V A;  5HS0 A;  1MX4 A;  4J8E A;  3ENE A;  2YHE A;  4LUN U;  2AW6 A;  4C9B B;  3ASG A;  3AG4 E;  3CVW A;  4F1P A;  4UWF A;  3ZN3 A;  3Q79 A;  1SVX A;  4J8F A;  4AXH A;  5HQ8 A;  1IHB A;  4JA9 A;  3RKV A;  3MV2 B;  2QYU A;  1H2V C;  4JHJ A;  3SNX A;  3GW4 A;  2LO6 A;  1KT1 A;  3UI2 A;  2Y0B G;  5FQ7 A;  1N11 A;  1EYH A;  1HZ4 A;  2XGS A;  1DC2 A;  3CVV A;  2GRQ B;  3RO3 A;  1E96 B;  2FO1 E;  5M72 A;  1N52 A;  3E37 A;  4RLY A;  2R2L A;  3ZRH A;  1OCZ E;  3KD7 A;  3ZYK A;  4CDM A;  4TXR A;  1N0Q A;  5CHE E;  3UPV A;  3T8M A;  1NFI E;  1OWL A;  4J6I A;  5EN5 D;  4C0M A;  1BU9 A;  4TUM A;  3C3O A;  4CDN A;  2P9N G;  4DJA A;  1S0P A;  2DVW A;  4EQF A;  4KBQ A;  3RIB A;  2XZT G;  1DCE A;  1KZP A;  4N3C A;  4EPZ A;  1LF8 A;  2HYZ A;  3L6A A;  1Z6T A;  2OVF A;  4TUU A;  1A17 A;  3DPY A;  3UQ3 A;  1IYG A;  2Y69 E;  3PVL A;  5JMN D;  4G25 A;  4JEH A;  5FZR A;  3V2X A;  4UWH A;  1OCR E;  4ANV A;  2KC7 A;  2XGM A;  2WB2 A;  1H6K A;  1EPU A;  3S7B A;  4BEP A;  4N2Q A;  1DCQ A;  4ME2 A;  5T8I A;  3I5P A;  3SQV A;  4GZD A;  3UT7 A;  3LYA A;  3AAA C;  3EU5 A;  2GRN B;  4FU3 A;  4ILH B;  3R7Q A;  3ZW3 A;  3UIP C;  4FLH A;  3GZ1 A;  1N9A A;  3ZU7 B;  1UOH A;  4BSX A;  4CT0 A;  3SFY A;  4A3V A;  5B1B E;  3TL5 A;  5C1D A;  1MX2 A;  4HXI A;  2KZT B;  1FCH A;  2LUH A;  4Y6W A;  3NOC D;  3E32 A;  2J09 A;  4RQI A;  1H2T C;  3PE3 A;  3IHV A;  3QWV A;  4IRU A;  3SFZ A;  1S70 B;  4BTB A;  5EIB E;  1KPS B;  2P9L G;  5BW8 C;  2LSU A;  4DI4 A;  1XGW A;  3P1U A;  4GPM A;  4I1A A;  3SFX A;  3Q9N C;  5A23 A;  4RG6 A;  4U8V D;  3AS5 A;  3HVE B;  4TXQ A;  3BG0 B;  1LTX A;  3T5V A;  3TXN A;  3ZYQ A;  3LDZ A;  4U8Y D;  4ANW A;  1Y6I A;  2CG2 A;  4UQY A;  4L2L A;  4CGV A;  2WXJ A;  1HG2 A;  4LEU A;  4A3T A;  2IF4 A;  3BUA A;  4U04 A;  1E7U A;  4ILI A;  2A5U A;  4EZK A;  4G2V A;  3URZ A;  3FDH A;  3DEO A;  3HXC A;  4X8Q A;  4XIF A;  4G1T A;  4I9C A;  4CDR A;  2AVP A;  4MKT A;  2VQ2 A;  3PNT B;  2I1K A;  1WDY A;  4M7C A;  4GYW A;  4HVB A;  1FT1 A;  3ML8 A;  3SBT B;  2QC9 A;  2WXO A;  5G04 C;  3LEW A;  5EYL A;  3PZ2 A;  3CHP A;  1D8D A;  4I1M A;  5AAO A;  4C0E A;  3WXX A;  3JUE A;  3ASD A;  2XQ0 A;  3OXL A;  1H19 A;  4FHJ A;  5AJD A;  2V5F A;  3SF4 A;  3MKQ A;  1KT0 A;  4HOU A;  2DIW A;  3LY7 A;  2CFU A;  3LY9 A;  5KJN A;  3CR3 A;  3AG3 E;  2UY1 A;  4GA1 A;  3OXG A;  2WXH A;  2LNI A;  1H0A A;  5HI7 A;  4AEZ C;  4QQI A;  5EX3 A;  3UKU G;  2WVI A;  4J8D A;  5ENT D;  1YYH A;  3FUE A;  3UM0 A;  1O1S A;  3MJW A;  5AAR A;  3ABM E;  2J07 A;  4B93 B;  3AS4 A;  3ZGQ A;  2VTB A;  1BI7 B;  4ZHB A;  4P29 A;  2ZGG A;  1QQE A;  4FJZ A;  4ANU A;  3PE4 A;  2GRL A;  1OT8 A;  4BTA A;  2KBX A;  3CV0 A;  4XZ4 A;  4MS6 A;  4G26 A;  1K8K G;  3NBN B;  4EEC A;  1UJJ A;  4R7L A;  3ABL E;  3AG2 E;  3SI5 A;  3ZYL A;  3C98 A;  5FQ8 A;  4U0U A;  3GYZ A;  3PZ3 A;  5CER B;  2WXN A;  4ILG A;  3NAW A;  3NQP A;  4EHM A;  3AU4 A;  5FZS A;  4HOS A;  4XEI G;  2JEK A;  3TG4 A;  3UIO C;  1PY1 A;  2J4D A;  3PS6 A;  2XEV A;  3TJP A;  3LY8 A;  4LCT A;  1Q2Z A;  4I43 A;  2QZA A;  4N5C A;  2P9P G;  4GYO A;  3D3M A;  3CK8 A;  2RKK A;  5FIO A;  1NL4 A;  1E90 A;  4HLL A;  1AWC B;  4HLE A;  1JCR A;  3PEV B;  4NAC A;  2GRM A;  2WMO A;  2JAB A;  5KCM A;  4WWO A;  1ZU2 A;  4YVO A;  1TEZ A;  3PDN A;  3L54 A;  5KJL A;  3J5P A;  3UM1 A;  3G2U A;  2ETB A;  2XRY A;  2RG8 A;  3HHM A;  1JWG A;  3CQG B;  3PNL B;  1HFA A;  3LS8 A;  4HRM B;  4AY6 A;  3FY4 A;  2L6B A;  1BLX B;  3FUI A;  3D9O A;  5LX8 A;  5IY5 E;  3E30 A;  4YVQ C;  1E8Z A;  3PUK A;  3X2Q E;  1SA5 A;  5AYW D;  5H7P A;  2FUL A;  4J7W A;  3D9L A;  4CEM A;  4D10 C;  5ENS D;  4JVS A;  2WPV A;  4GCN A;  2RFM A;  4GZ3 A;  4DX6 D;  1KLX A;  3MA5 A;  2VGY A;  2J4B A;  3R7R A;  2PM7 A;  4ACL A;  3VTY A;  1K1B A;  3Q73 A;  2H6H A;  3FUM A;  1ELR A;  4PH4 B;  4WWN A;  4WAF A;  5EDS A;  2KAT A;  3JXJ A;  3EIJ A;  2X6J A;  2WXR A;  5ENQ D;  4MRU A;  5AQA A;  5JHB A;  2NYJ A;  1SA4 A;  1JWF A;  1TNY A;  3FTS A;  4U96 D;  2FO7 A;  5A6C A;  4BX8 A;  5ENO D;  4B8A A;  3TGO A;  4EZJ A;  1MHQ A;  3FEX A;  2VSX E;  2B0O E;  4JD2 G;  3ASF A;  1IQR A;  5AQB A;  3CVQ A;  3I4G A;  1OCO E;  4I2Z A;  3V79 K;  1N4P A;  3LXU X;  2WQ6 A;  3QJZ A;  1D8E A;  1WG0 A;  3OTN A;  4JA7 A;  2LSV A;  3SO8 A;  5EYP F;  3S2A A;  5FQ6 A;  2XS8 A;  2AXZ A;  2HE0 A;  2VGE A;  3KSQ A;  2L9B A;  4H7X A;  4ATG A;  3JUI A;  1OUV A;  2R03 A;  2FBN A;  3EHR A;  3S7J A;  3JQ0 A;  3DSU A;  3QDN A;  3SY2 A;  1MQS A;  1U3C A;  2KCL A;  1HO8 A;  1Z3Y A;  4FHK A;  4HFG A;  3PZ1 A;  4GYY A;  2IEJ A;  3ULQ A;  4DPR A;  1E8W A;  3HYM B;  3RU0 A;  1ZB1 A;  2V5Q C;  3D9N A;  1TNO A;  1X81 A;  4G8L A;  4K5B A;  4MLP A;  4HRN A;  3OAW A;  4GMJ A;  4NIK A;  2VJ8 A;  5E76 A;  3PZD A;  1E8X A;  1ZBP A;  3FUN A;  1N4Q A;  1A5E A;  5CMY A;  3D9I A;  4YDE A;  5D2M C;  1WAO 1;  4IUL A;  3QC1 A;  2KM4 A;  3HDX A;  5AQ7 A;  1LD8 A;  3FP3 A;  3ULE G;  1JUQ A;  3FFL A;  2WXP A;  4FC8 A;  5JJ6 A;  3Q4A B;  3RK6 A;  5CBN A;  1TJC A;  2XEN A;  1HF8 A;  4APO A;  1GW6 A;  2X6H A;  3JQ1 A;  2AXV A;  1WY6 A;  1PC2 A;  2OEW A;  3FTW A;  3DEP A;  4GU5 A;  3O4Z A;  5G55 A;  3IV0 A;  5ENP D;  1TN7 A;  3N71 A;  3ONL A;  3ZHE A;  4KVM A;  4U63 A;  2X6K A;  5FQ4 A;  4DUI A;  1V54 E;  2EIL E;  3EHN A;  5C2Y A;  3RRU A;  4KZC A;  3CIA A;  5CMW A;  4FLB A;  3UIN C;  3FEY A;  2AWI A;  4XE0 A;  4JHR A;  3U66 A;  4HI8 A;  2YHC A;  3TWQ A;  3QWW A;  4MBG A;  3V30 A;  4Y6C A;  3PRZ A;  4TXP A;  2BTD A;  2Y4U A;  1K3Z D;  4RG9 A;  3NF1 A;  3MZL B;  5AJL A;  2CHW A;  2BED A;  3CHO A;  3MCX A;  3JCK C;  2PM6 A;  4JZY A;  3TG5 A;  5JJ7 A;  1MYO A;  3ABK E;  5CCM A;  1HXI A;  4C48 B;  5EKQ D;  3SHF A;  3VTX A;  1IHG A;  2I2O A;  3U3W A;  3ESL A;  2VSY A;  3U4T A;  4UQX A;  4DLQ A;  1B89 A;  2Y1L E;  3IEG A;  2Y4T A;  3ZXS A;  5BNW A;  3KEA A;  2DWZ A;  5CED B;  3UM3 A;  4I17 A;  3L82 A;  3BU8 A;  4BER A;  4ACK A;  2ZU6 B;  3FHE A;  2KCK A;  3ZXP A;  3DST A;  3Q47 B;  4GA2 A;  3TWV A;  3KEZ A;  3CVY A;  2H6I A;  4U8H A;  1O1R A;  3PZ4 A;  5AEN A;  2XRZ A;  4GTR A;  2ETA A;  1QBQ A;  4ANX A;  4LNB A;  5BT1 A;  5LCW J;  4LG6 A;  5LFA A;  1W3B A;  2AXU A;  1RZ4 A;  3C3Q A;  2C0L A;  4I9E A;  4UI9 C;  3HXD A;  1N95 A;  4GTP A;  2VGX A;  3TWU A;  2P9I G;  4TRQ A;  3LKU A;  5KJK A;  4PUC A;  4LER A;  3UTM A;  2V0P A;  4DLO A;  2DYS E;  3MGB A;  3LPZ A;  3T9K A;  4A1S A;  4B94 A;  2BKG A;  4OAU C;  2X3M A;  3C5R A;  2GRP B;  1NI1 A;  2IY0 C;  5BPP A;  4GZ6 A;  3UX4 A;  3AJI A;  2WMN A;  3B7U X;  4Z68 A;  1ELK A;  4HB5 A;  1QNF A;  3VLD A;  1N54 A;  1UG3 A;  5KWD A;  4YDW A;  4LSZ E;  3DBS A;  2PL2 A;  2V4L A;  4QFV A;  3EDT B;  3EHQ A;  2QY7 A;  4APF A;  3LJN A;  5D0Q D;  1U2V G;  3Q9U C;  4GAA A;  2DCP A;  2IFU A;  1P5Q A;  3KAE A;  2P9U G;  4JEU A;  5BV1 A;  4FUL A;  3FUJ A;  2R59 A;  3MKQ B;  1HU3 A;  2XCC A;  4IYP A;  4RVB A;  4AV7 A;  4BX9 A;  3QOU A;  3FUF A;  3ZUV B;  2UY1 B;  3DXM G;  3B7T A;  4I6E A;  3HXF A;  2HO1 A;  3EJN A;  5B3S E;  2J8S D;  3QWP A;  5KNH D;  1TN8 A;  4L7T A;  1UW4 B;  2M63 A;  4L1B A;  2VTB B;  4V3I A;  3ZEF A;  4O1P A;  3GZS A;  2X38 A;  2WXG A;  1NZN A;  2WXF A;  2RFA A;  3RAU A;  1TNU A;  3J5Q B;  3S7D A;  1TNB A;  3D9M A;  3FH7 A;  2R02 A;  1IKN D;  3D9H A;  5CEC B;  4G24 A;  3VLE A;  3U64 A;  1OWN A;  4ZFH A;  3JYS A;  4U0S A;  3CHM A;  4Q94 A;  3JXI A;  4GTT A;  5FTP A;  1WM5 A;  2IQC A;  3TAX A;  3HG0 D;  4AIF A;  3I4R B;  2ZXW E;  2LAH A;  1NA3 A;  2E2E A;  2EIN E;  4J8Y A;  3TWW A;  5T3R A;  5G04 J;  3G2W A;  3G2S A;  3Q15 A;  4FJY A;  2XHE A;  3AG1 E;  5DBK A;  3L17 A;  4GTQ A;  1KZO A;  4WUY A;  4A63 B;  3CEQ A;  3NZS A;  2J9Q A;  4B89 A;  5CRV A;  2HR2 A;  4U07 A;  2EQX A;  1O5M A;  2ZGD A;  2NXP A;  3AS8 A;  5T4Y A;  3ZNG A;  2WXQ A;  4U95 D;  4BET A;  4DI3 A;  1FT2 A;  3B7R L;  2PNN A;  3BQO A;  1X5B A;  2XPI A;  2C0M A;  3LJ3 A;  5FIN A;  1OXJ A;  1YA0 A;  4BFR A;  4XKC A;  4B8C B;  3QKY A;  3SZ7 A;  2A5E A;  4CRW A;  2FEZ A;  4I6G A;  5AIJ A;  4Q96 A;  2F37 A;  1H6O A;  3R9M A;  3FU5 A;  2LAI A;  3R9A B;  3CQC B;  3CVL A;  3VLF A;  1V55 E;  4BWR A;  5HKP A;  3QNK A;  2R5S A;  4RSY A;  4HNA D;  2WXI A;  3L13 A;  5EX0 A;  3IHY A;  5FWQ A;  4LRZ A;  2I1J A;  2P9K G;  3Q7F A;  4O1O A;  2L0T B;  5CEA A;  4JC8 A;  2H6F A;  3TWR A;  3DWL G;  5ENR D;  3P2B A;  1U3D A;  2RD0 A;  4EBA G;  4OVV A;  4G23 A;  3EIQ C;  4KXK B;  5J90 A;  4N2S A;  2J08 A;  2XGO A;  2F8Y A;  3V2O A;  4K5A B;  1FPP A;  1SW6 A;  2ION A;  4BSZ B;  2WQ7 A;  3EU9 A;  4XKB A;  3PRE A;  4W9R A;  3FH5 A;  3KSL A;  5A7D B;  3IKO B;  5ENN A;  1TR4 A;  3CGH A;  3G2T A;  2WXK A;  2IU1 A;  3L08 A;  3DPD A;  4DX5 D;  1ELW A;  2ILR A;  3FH8 A;  5LP0 A;  4F6R D;  4U7E B;  4I2W A;  4NUR A;  2NC9 A;  4L2Y A;  3MX3 A;  2KXP C;  4GTO A;  3B7B A;  3L22 A;  5CCL A;  1H6P A;  3E34 A;  1JCQ A;  2IOL A;  3NZU A;  4GCO A;  4E6H A;  3QAR A;  4CCA A;  2HM8 A;  4LNU D;  1G3N B;  2BUG A;  4CZ2 D;  2OEV A;  3CHR A;  2EIM E;  3D9K A;  4FA6 A;  2XEE A;  2MHK A;  3B13 A;  3RSE G;  4YND A;  5KJM A;  3L9T A;  4KMO A;  4U0Z A;  2V4H C;  1RW2 A;  3QAQ A;  3APF A;  3TXM A;  4AOF A;  4HRL A;  3HIZ A;  4NRH B;  2XPZ A;  4JXT A;  2VYI A;  4WNF A;  2NSZ A;  5LCW C;  1BPO A;  1JCS A;  3Q78 A;  4I6J A;  5ANL A;  2L0I A;  4K03 A;  5G05 J;  2P9S G;  4GTM A;  4HI9 A;  4J0U A;  3DSW A;  4Q69 A;  5CBO A;  2IO3 C;  5BUZ A;  3ML9 A;  4CT4 A;  3QK0 A;  3UXG A;  3AU5 A;  2OOE A;  3W9F A;  4AVX A;  1YMP A;  2VSN A;  3ZFW A;  4UWL A;  1NA0 A;  4AJW A;  4BT9 A;  1EDU A;  4HOR A;  4O60 A;  1FVF A;  4E85 A;  2OV8 A;  3FU3 A;  4FAD A;  3ONK A;  3E33 A;  3BEE A;  2V8S E;  1OWP A;  2H6G A;  5ITZ F;  3DSX A;  3FUD A;  5FT9 A;  1H2U A;  1S64 A;  3FTU A;  2WQH A;  1TNZ A;  4XI9 A;  4WWP A;  3V31 A;  2ZIS A;  4KZ0 A;  3HXE A;  4G8K A;  1DVP A;  5G2N A;  3ZHE B;  3CLJ A;  2KZT A;  1QYM A;  3L16 A;  2BF0 X;  2PZI A;  2GRO B;  3ULY A;  4BES A;  3NB2 A;  2P2C P;  3C72 A;  1IXV A;  4KT6 B;  4H7Y A;  2I9C A;  3CKB A;  5AQ9 A;  5KNG A;  3UT8 A;  3RJV A;  2C2L A;  3PEU B;  3ISM C;  3CK7 A;  3O48 A;  3EUV A;  4NQ0 A;  1K1A A;  4WNE A;  3FU6 A;  4UWG A;  4UQZ A;  1HX8 A;  3SBS A;  3ASH A;  3I3N A;  4CGW A;  3MV3 B;  3PH0 C;  2XEH A;  5JHA A;  2FI7 A;  3HVE A;  2ZIR A;  4FP7 A;  3UM2 A;  4JW1 A;  2LXL A;  1HH8 A;  3B95 A;  4IN3 B;  4F53 A;  3ASN E;  3ZKJ A;  4KVO A;  2PQN A;  3G2V A;  2IJG X;  3D9J A;  4UI9 K;  3HXB A;  5J08 A;  2JLB A;  4HBD A;  5JJT A;  2MRI A;  1OWM A;  1TJF A;  1HE8 A;  5JA4 D;  4PDX A;  2EIJ E;  1BI8 B;  5DIZ A;  5ARG A;  3NOG D;  2IOS A;  4XI0 A;  1SZ9 A;  3Q7A A;  4EBA A;  4OVU A;  4N3A A;  2I6H A;  3PUJ A;  4N5Q A;  3APD A;  1N4S A;  2DBA A;  2MOW A;  1UJK A;  2GW1 A;  5FJY A;  3FWV A;  4GB9 A;  2VGX B;  1FVH A;  3FTZ A;  4F7A A;  1Z5S C;  5E75 A;  4GA0 A;  4HOT A;  3FTV A;  3Q49 B;  2XS1 A;  4URK A;  2P58 C;  1MZC A;  2OVB A;  1INZ A;  2DZN A;  4GPK A;  4OYS A;  3DXK G;  4WND A;  4WNG A;  3RRN B;  3SD5 A;  2AJA A;  1Y8M A;  2WM9 A;  3EHM A;  4L9P A;  4B0Z A;  3DRA A;  4JB8 P;  1XNF A;  4OAV B;  4JHK A;  3D9P A;  1OWO A;  1JPL A;  2GRR B;  4LNG A;  5FZQ A;  4CYM D;  3FTY A;  2DYR E;  1OCC E;  2CHX A;  2GGF A;  3TWS A;  3KS2 A;  1BD8 A;  5HRY A;  3ZVV A;  3UUX A;  3BG1 B;  3APC A;  2WXM A;  3ZYM A;  4K0R A;  1LD7 A;  4N3B A;  2PQR A;  5ARF A;  1L5J A;  3UKR G;  5BV0 A;  3E4B A;  2XPY A;  1SZA A;  1SQM A;  3ESK A;  3CVU A;  3F6Q A;  5EID A;  3CK9 A;  4GMR A;  2EIK E;  3MKR A;  2CHZ A;  4DK5 A;  5KBA A;  4K5C A;  1E7V A;  1UN8 A;  5AN8 A;  2X6I A;  2WXL A;  2MYO A;  2KCV A;  3MEK A;  4UUC A;  4A1G A;  1VDY A;  5D66 A;  4M3O A;  2IO2 C;  3CVP A;  1QZ2 A;  4UI9 J;  2DZO A;  3W9G A;  2Y3A A;  2R05 A;  1N4R A;  3SGH A;  2F0Y A;  4BY6 A;  4AM9 A;  4BT8 A;  3IXE A;  4DX7 D;  3UMV A;  4YDO A;  2A4Z A;  1Z3X A;  4DRX E;  1S63 A;  4G11 A;  2R17 C;  1D9S A;  2OCC E;  3CVX A;  4HOQ A;  3IBE A;  1OY3 D;  2OND A;  1N0R A;  3UT4 A;  4GML A;  4DX1 A;  4UWK A;  1UN9 A;  4YDY A;  3LVR E;  3ZPJ A;  2XZD G;  4GZ5 A;  4HS2 A;  5D0O D;  3ASO E;  3FTX A;  1E8Y A;  2YIN A;  4KYO B;  2QFC A;  2LXM A;  3B7S A;  1HS6 A;  1AP7 A;  2YQ8 A;  5CRU A;  2QYJ A;  4PS3 A;  4F1S A;  3CKC A;  4L23 A;  3T5X A;  2ETC A;  3TWX A;  3HRA A;  4N39 A;  4AP2 A;  2CFZ A;  1EF1 C;  3GZ2 A;  4XX5 A;  1MX6 A;  4TV3 A;  2Q7F A;  4GTV A;  3MYV A;  1NP7 A;  3TWT A;  3QB2 A;  3WG7 E;  3S7F A;  2J49 A;  3K9I A;  3DSV A;  1TN6 A;  3RO2 A;  2X6F A;  1IQU A;  1YCS B;  4GZC A;  4PS7 A;  4A55 A;  2B6C A;  2FF4 A;  4EZL A;  3OXF A;  5G05 C; 
#chains in the Genus database with same CATH homology
 1SA5 A;  4GTM A;  3EU5 A;  1N94 A;  1KZO A;  2ZIR A;  3DSW A;  3HXD A;  1N95 A;  4GTP A;  1S63 A;  1FPP A;  3DSU A;  4LNG A;  1N9A A;  3PZ1 A;  1O5M A;  3SFY A;  2IEJ A;  1O1T A;  1FT1 A;  3KSL A;  3HXF A;  3HXB A;  4GTS A;  3PZ2 A;  3PZ3 A;  1D8D A;  4MBG A;  3E37 A;  1FT2 A;  4EHM A;  1TNO A;  1X81 A;  3E32 A;  2R2L A;  3Q73 A;  2H6H A;  1TN8 A;  1LD7 A;  3E33 A;  2BED A;  2H6G A;  1NI1 A;  3DSX A;  4GTO A;  3Q7A A;  1N4Q A;  1S64 A;  1NL4 A;  3E34 A;  1TNZ A;  3SFX A;  3DSS A;  4YDE A;  1JCQ A;  2ZIS A;  1SA4 A;  3Q75 A;  1TNY A;  3HXE A;  1JCR A;  1TNU A;  1DCE A;  1KZP A;  1N4S A;  1TNB A;  1LD8 A;  1LTX A;  3DPY A;  3C72 A;  1O1S A;  4GTT A;  4GTV A;  3DST A;  3Q7F A;  3DSV A;  1N4P A;  2H6I A;  1MZC A;  1D8E A;  1O1R A;  1TN6 A;  3PZ4 A;  3Q79 A;  3EUV A;  2H6F A;  1N4R A;  4GTR A;  1QBQ A;  2F0Y A;  4LNB A;  4L9P A;  3DRA A;  3HXC A;  1TN7 A;  1JCS A;  3Q78 A;  3KSQ A;  3E30 A;  4YDO A;  4GTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...