3E37A

Protein farnesyltransferase complexed with bisubstrate ethylenediamine scaffold inhibitor 5
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Structural basis for binding and selectivity of antimalarial and anticancer ethylenediamine inhibitors to protein farnesyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 128
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3e37A00
3DSXA 2H6HA 4LNBA 3SFYA 4YDOA 1O5MA 3C72A 4GTRA 1D8DA 1N4QA 1N4PA 1LTXA 1SA4A 1NL4A 2H6IA 3Q79A 3HXFA 1TNOA 3DSSA 1D8EA 4GTOA 1O1TA 1MZCA 1O1SA 1FT2A 1NI1A 3Q78A 3EU5A 3KSQA 4MBGA 1N4RA 3PZ3A 1JCRA 3Q73A 4GTMA 1TNZA 3E30A 3PZ2A 2R2LA 1S64A 2IEJA 2BEDA 3Q7FA 4L9PA 3KSLA 1LD8A 2H6FA 1FT1A 3E37A 4GTTA 1JCSA 1KZPA 1S63A 3PZ4A 3HXCA 4GTPA 1KZOA 2ZISA 2ZIRA 1TNBA 1DCEA 1TN8A 4GTQA 1SA5A 1N95A 1TN6A 1LD7A 1TNYA 3HXBA 4GTVA 3DSWA 3HXDA 1QBQA 4LNGA 3DRAA 3HXEA 3SFXA 3DSUA 4YDEA 1N94A 3DSVA 4EHMA 3Q75A 3E34A 3Q7AA 1JCQA 1N4SA 3E33A 3E32A 1N9AA 1TN7A 2H6GA 3DSTA 1FPPA 3PZ1A 1X81A 3DPYA 2F0YA 1TNUA 1O1RA 4GTSA 3EUVA
chains in the Genus database with same CATH superfamily
1S0PA 1JUQA 2XRZA 3FUKA 1LF8A 3C3OA 4BFRA 2AXZA 3CVVA 4UI9J 4UWKA 5AYWD 3VTXA 1YCSB 2OEVA 2IO2C 1NZNA 5BUZA 1LTXA 3PS6A 2PZIA 2DIWA 3VLDA 3LY7A 1OUVA 4QQIA 4PUCA 4R7LA 1SVXA 1NP7A 3UM0A 3ZYKA 1N0QA 1NA3A 3FY4A 3CVWA 2QC9A 4A3TA 2VGXA 1HE8A 3MZLB 1K3ZD 4DLQA 3QARA 2CG2A 3FUDA 4KZ0A 5KNHD 1D9SA 2Y4UA 3HRAA 5T4YA 3E37A 2CHZA 3TWWA 4OAUC 4WNGA 3PZ4A 5IY5E 3Q9NC 1BLXB 2EIJE 1OCZE 3ULYA 3CSTA 2ZIRA 2EQXA 1H19A 4CDRA 2IOSA 4GA1A 2F37A 4P29A 1DCQA 2CFZA 3LEWA 3RJVA 5ENQD 2Y3AA 3CHRA 3B7TA 3FFLA 2VYIA 3U4TA 4UWFA 1OWOA 3UM1A 4CCAA 2OVFA 3T5XA 2HYZA 2MOWA 3LY9A 5D66A 2AXVA 4HFGA 5EN5D 5A7DB 4CDMA 2LAHA 1TN7A 3S7BA 1Z5SC 5LOZA 2I9CA 4BTAA 1EPUA 1Z6TA 5BXUA 4LG6A 1ELKA 2VGEA 4Q94A 1MYOA 5FQ6A 1DVPA 2WQ7A 1MJ0A 3PE4A 3QC1A 4GZDA 3UMVA 3QWVA 3LVRE 3AG1E 4DX1A 3FUJA 5CBOA 4FA6A 3CEQA 4B8CB 1P5QA 3RAUA 3QKYA 4ZFHA 1KT0A 4DX6D 3RIBA 1Q2ZA 2R2LA 3ML9A 2WM9A 4L2YA 4I1OB 5ITZF 4WUYA 4TV3A 3W9FA 4EECA 1JCSA 4HBDA 3AG2E 4HI8A 4GCNA 3TXMA 3T5VA 1SZAA 1UJJA 3ASDA 3ISMC 4M7CA 4AEZC 3DSWA 3TJPA 4YVQC 3DRAA 4GYOA 3FUNA 4A55A 3BUAA 4UQZA 2R05A 3MCXA 3I4RB 1FVFA 3AS4A 2V5QC 3ZPJA 5LP0A 4ILIA 3FTWA 4A63B 2J8SD 2KXPC 5KJKA 4W9RA 3VTYA 3NBNB 1TR4A 2J9QA 2NXPA 3BEEA 4HRLA 3SFYA 1XGWA 3EJNA 2X6HA 2X3MA 3GZ1A 4E6HA 4U8HA 1PC2A 2IJGX 1RZ4A 3PH0C 4ZHBA 2BUGA 3D9JA 3JUIA 1WAO1 4AV7A 1SW6A 5G04J 3WG7E 4U0UA 4MBGA 2ETCA 4G8LA 2DCPA 1S70B 3L13A 4KYOB 4CT0A 3JQ1A 1IQRA 5AN8A 2ILRA 2WXPA 3QNKA 3KSLA 2YINA 2BKGA 3FULA 4CYMD 3O4ZA 2FO7A 3MV2B 1TJCA 2XPIA 4IYPA 5AQ9A 2WXNA 5BXOA 3ASOE 2XCCA 5AENA 4FHJA 2L6JA 4PS8A 3HDXA 2XS1A 4AJWA 4CDNA 3KEAA 5KJLA 5KJNA 3QWWA 1AWCB 3ZKJA 4G24A 1QQEA 3DSVA 1U2VG 4M3OA 1H2TC 2E0IA 3Q7AA 3Q4AB 4FADA 3LVQE 2XGSA 3CVLA 2P58C 3ASNE 3Q15A 4GTSA 4PS3A 2DVWA 2V8SE 3AU5A 2OEWA 3JUEA 4K0RA 3DXMG 2F8YA 2LSUA 3ZEFA 4GYYA 4K5AB 2GRPB 3CK9A 3FTVA 1H2UA 3LXUX 3Q79A 3SF4A 5J08A 2ZXWE 3SHFA 4XKBA 1HXIA 5FWQA 5D2MC 2XQ0A 3LPZA 3EHMA 1MX2A 4WWNA 4GPKA 1HF8A 5FQ8A 2PL2A 1E8YA 5EIDA 3JYSA 1E90A 3J5PA 4DX7D 3HHMA 2WXHA 4WNFA 5JHAA 3DBSA 2A5EA 3Q7FA 3EDTB 2HO1A 1IXVA 5FQ7A 2LO6A 2JABA 2V0PA 4ANXA 3G2VA 4J8EA 3Q49B 2ZISA 4PDXA 5EILA 4MS6A 1TN6A 3GW4A 4NACA 4ACLA 4I9EA 3QK0A 3HG0D 4G8KA 4GZ3A 2PNNA 4HOQA 5KCMA 3KD7A 3HYMB 3RO2A 5ENOD 3UIOC 3R9MA 4RG9A 2OCCE 2NC9A 3UT7A 4UQYA 1OCOE 3DSXA 5JJ7A 3J5QB 4L2LA 1QYMA 2IOLA 3CK7A 1K1AA 3KAEA 5HKPA 3QDNA 3ESKA 4JEHA 5FJYA 2LAIA 5JMND 4WWPA 3ONKA 2FBNA 3JQ0A 1OT8A 2NYJA 1O1TA 1NI1A 2VJ8A 3S7JA 4RSYA 1MX4A 4QFVA 2P9UG 1PAQA 5A23A 4BT9A 4F6RD 1IQUA 3E30A 2WMNA 3APDA 3CK8A 3UXGA 2IFUA 3FWVA 3PDNA 4JPSA 4N3CA 4UWHA 1TN8A 1KLXA 5EYPF 3VLFA 3SFZA 4N5QA 1HFAA 3HXEA 4MKTA 3D9PA 5KWDA 2LUHA 4BETA 5HI7A 1EDUA 2VQ2A 1N4SA 3L16A 4Q69A 3D9KA 3IHVA 1ZB1A 4ME2A 2ZGGA 4UUCA 2PQRA 2HE0A 2XHEA 4B94A 5G05C 3L6AA 5BV0A 4GMLA 2CHXA 2KC7A 2J08A 3FUMA 3PUKA 4JHJA 4C0EA 4GYWA 3Q9UC 4HLLA 1E8ZA 4ILHB 4AP2A 3TWRA 3RU0A 1FT2A 2XPYA 2VTBA 2E2EA 5KBAA 4J8DA 4CGVA 3APCA 2EINE 2X6IA 2XZDG 2FO1E 3PEVB 1AP7A 1YYHA 3EHRA 2DWZA 1A17A 4L9PA 4LEUA 1OCCE 4KVOA 4RVBA 1HU3A 4GTTA 1E7VA 3EHNA 3D3MA 3HXCA 2A5UA 3FEYA 3CQCB 5ARFA 4AVXA 3OXFA 1SA5A 3QWPA 5H7PA 5JJTA 4U95D 3NAWA 3T8MA 2WXMA 2NSZA 3R7QA 4KBQA 3F6QA 2I1JA 4GMJA 4XKCA 4E85A 5FQ4A 4YDYA 4EHMA 3E34A 5BV1A 2XGMA 1JCQA 4YNDA 4DK5A 4AM9A 4ACKA 1ZBPA 1B89A 1TNUA 4URKA 4K5BA 3TWTA 2RG8A 2VGYA 3ZYMA 1NFIE 2ETAA 3ZYLA 2C0MA 2QZAA 5E75A 3D9HA 4HLEA 4V3IA 3MA5A 4KMOA 5LX8A 3FTZA 3PVLA 4BTBA 2I1KA 4NURA 3HXFA 3QAQA 3ASGA 4XEIG 2UY1B 1Y8MA 4KZCA 4YDWA 3NZUA 3CHMA 3U9WA 3Q47B 2QFCA 2P2CP 4G25A 3AG4E 3P1UA 3FU6A 4BX8A 1HG5A 3D9OA 4LSZE 2IEJA 3QOUA 3ABLE 1EF1C 1INZA 5FZQA 3UUXA 2WPVA 4O6FA 5CCLA 3FUHA 2MRIA 1MX6A 3FU5A 2BF0X 1DCEA 1HX8A 3IKOB 2CG3A 3SBSA 4GAAA 3O48A 4EPZA 1TNYA 2DZNA 2KCVA 5LCWC 2XZTG 1QZ2A 4OVUA 2GRLA 3CLJA 3G2SA 3MV3B 4FJYA 3FTYA 4HI9A 2GRNB 3TAXA 4BSZB 2DYRE 4BY6A 2V4HC 4FJZA 3CVYA 1V55E 4CT4A 2J4DA 3SGHA 5J90A 4ATZD 5G2NA 1WG0A 3URZA 2CHWA 5CMWA 3ABME 4I2WA 2R03A 4YDOA 4HXIA 3SO8A 2QYJA 3AS5A 5AQAA 2XEVA 4N2SA 3CR3A 1SA4A 4WWOA 3BG1B 1D8EA 2WXLA 5A6CA 2L6BA 2X6JA 3EU5A 2B6CA 1GW6A 1UN9A 1U3DA 1BI7B 3CKCA 1N4RA 2MYOA 2Y1LE 2OVBA 2IO3C 4BSXA 1JPLA 3GZ2A 4NQ0A 3UM3A 1BI8B 3FH7A 2KATA 3MEKA 4U7EB 1E8WA 1N11A 3RRUA 3U66A 3NQPA 1S63A 3FU0A 3TWQA 2B0OE 3T8KA 4B8AA 4IULA 3RRNB 2X6KA 4JC8A 4JVSA 2IONA 3B7UX 3HXBA 3LS8A 4HQDA 3SFXA 3DSUA 5B1BE 3CHOA 5AAOA 2FF4A 4ANWA 5FIOA 3CVXA 2XPZA 1KPSB 3AS8A 2V5FA 4BWRA 1N9AA 4CZ2D 1K8KG 4B0ZA 2XRYA 4A1SA 4G23A 4FU3A 5CEDB 3CSFA 5ENNA 4LNBA 2R59A 3C98A 1BU9A 4OAVB 5FZRA 3NOCD 4GTRA 4DX5D 1UG3A 1IKND 4I1MA 1NL4A 5JHBA 2DYSE 1TNOA 2WXFA 5EKQD 5BW8C 5JA4D 4HB5A 1MZCA 3CIAA 3PUJA 4O60A 2J07A 4LERA 4HRNA 3TWUA 3APFA 3U3WA 3DXKG 4BT8A 3HVEA 3PZ2A 4XI0A 3GZSA 4G26A 2J49A 3RSEG 1FT1A 4J6IA 1G3NB 4EBAA 3V2OA 3TWVA 4BX9A 5ARGA 2YNQA 1QNFA 3ZNGA 4GTVA 5B3SE 3LJ3A 4HOTA 5KJMA 4DPRA 1VDYA 4I6EA 3ZU7B 1WM5A 2ZGDA 4C48B 3CHQA 3Q75A 4JL0A 3ONLA 4NRHB 3ZVVA 1X81A 3ASFA 2F0YA 2F8XK 1O1RA 4DJAA 4KXKB 3G2TA 4AY5A 3C5RA 4ANUA 1Z3YA 1IHGA 4JD2G 5ENTD 4FHKA 5ENSD 3IHYA 4HOUA 5HQ8A 4DI3A 2P9LG 1YMPA 4H7YA 2XENA 4FLHA 3UT4A 3ZN3A 4EBAG 2VSNA 2VSYA 1OWPA 4G11A 3UKRG 4UQXA 4XX5A 1HZ4A 3L08A 2ONDA 3CV0A 4DX2A 3WXXA 3FTSA 4F7AA 2JEKA 3PNLB 1ZU2A 2KZTA 4JEUA 1DNPA 4L23A 1OWMA 2WXGA 2VSXE 5CBNA 3QB2A 4XZ4A 3ZW3A 2WXKA 5FZSA 3T9KA 1FCHA 4HORA 1NA0A 2IY0C 1RW2A 5T8IA 2GGFA 3SD5A 2P9PG 2M63A 2GRMA 1TJFA 1OXJA 3AAAC 3ZHEA 2I6HA 1BD8A 4O1PA 1V54E 2RFMA 3MJWA 1E8XA 1OCRE 2WMOA 4TRQA 3ZRHA 1Z3XA 4APFA 4Y6WA 4C9BB 4TXQA 4EZLA 4EZJA 3DSTA 2WQHA 1H6PA 4U0ZA 4OVVA 5BPPA 2EIKE 4JW1A 3FU3A 1UN8A 4U8YD 1U3CA 4APOA 4HOSA 3V30A 3IV0A 3OXLA 4EQFA 3C72A 1H2VC 2EILE 5CCMA 4XI9A 2FULA 3L17A 2VGXB 2LSVA 4JHKA 3DSSA 2AW6A 1SQMA 4FC8A 4GZCA 4JHRA 3KSQA 3IXEA 3FTUA 3G2UA 3RRMB 5ANLA 4CGWA 3PZ3A 3ULQA 5JJ6A 1FVHA 4BEPA 2OOEA 1XNFA 4N3BA 3CVUA 4N3AA 3S2AA 5BT1A 4GU5A 5G05J 3AJIA 3ZXPA 2BKKB 5CHEE 3L82A 2ETBA 4GTPA 4UI9C 3UI2A 4LCTA 5DIZA 3QJZA 1IYGA 3CQGB 1N95A 2AVPA 1LD7A 2C2LA 3E4BA 4J0UA 2YHEA 4Z68A 3BG0B 2GRQB 3UPVA 4A1GA 2AXUA 3SY2A 4LUNU 1N94A 2FI7A 5BNWA 3SZ7A 5EDSA 3MYVA 4MRUA 2OV8A 2MHKA 3V79K 4CEMA 2J09A 3D9NA 1JWGA 4FP7A 3EIQC 3ZIMA 3V2XA 3LCAA 4PS7A 3FH8A 4TUMA 5FT9A 1HS6A 4F1SA 3Q78A 4ILGA 4GB9A 3RKVA 2WB2A 2HM8A 4K03A 3MKQA 2C0LA 3JXJA 3S7FA 3CHSA 3AU4A 2R02A 4GTMA 4D10C 2J4BA 3R7RA 4CRWA 5AIJA 3DPDA 2XGOA 4ANVA 3D9LA 4FULA 2R5SA 3FHEA 2GRRB 2LXMA 4GZ5A 4XIFA 3MGBA 2PM7A 3ZGQA 1ELWA 5CEAA 3FDHA 3BU8A 4WNDA 2BTDA 5CERB 4TXRA 4UWLA 3UQ3A 3L22A 5AQ7A 3TXNA 3HXDA 3S7DA 5AJLA 3NOGD 4AOFA 4UWGA 3RO3A 2WXRA 3UIPC 1N0RA 4I43A 3TG5A 3E32A 3JCKC 4JXTA 2H6GA 4KT6B 5KNGA 2GW1A 1H6OA 3DPYA 3CGHA 1TYQG 3ASHA 2AJAA 4HNAD 3RK6A 1BPOA 1K1BA 1O5MA 3Q5MA 4N39A 5C2YA 3L9TA 2KM4A 3SI5A 2UWJG 4GA0A 2H6IA 4IN3B 5CECB 2KCKA 4U0SA 5LCWJ 2P9NG 2X38A 2DZOA 2L0TB 3R9AB 4GTOA 4C0MA 5FTPA 2LXLA 4DI4A 1JCRA 5CMYA 5M72A 3SBTB 2P9SG 4KVMA 4F3VA 2UY1A 4JA9A 3OAWA 1S64A 3B7BA 2PM6A 4U63A 4J8SA 1LD8A 3NB2A 3BQOA 2IU1A 4EZKA 4HVBA 2AWIA 5ENRD 3LYAA 2HR2A 1TNBA 4OYSA 4GMRA 4LRZA 3MX3A 1MQSA 3ABKE 2CFUA 1H0AA 4U96D 4LNUD 3LY8A 3NF1A 5G04C 4L7TA 2WQ6A 5EIBE 4WNEA 1UW4B 5HRYA 3UM2A 2I2OA 4NIKA 3PZ1A 5CRUA 3KS2A 3FH5A 2VSOE 2WXIA 2H6HA 2ZU6B 4BERA 1HG2A 3HVEB 3ULEG 4B93B 2WXOA 4WAFA 1EYHA 3FP3A 5T3RA 1D8DA 1N4QA 3UX4A 1PY1A 2RFAA 2XEEA 2P9KG 4U07A 4DUIA 3B7RL 5HS0A 5G55A 3L54A 4F1PA 2GROB 1OY3D 4YVOA 2PQNA 3ML8A 2RKKA 1ELRA 5LFAA 1DC2A 4JZYA 4ATGA 3PREA 3B95A 4JB8P 3EHQA 3TWXA 1X5BA 1UJKA 2YHCA 3DEOA 4Y6CA 5ANRA 1N54A 4IRUA 4AIFA 1KZPA 2IQCA 3LKUA 1KZOA 1WDYA 3OTNA 4N5CA 1HO8A 1OWLA 4G1TA 3IBEA 4I6GA 3HIZA 3ENEA 3B13A 5D0QD 1E7UA 1JWFA 1QBQA 5B1AE 2KBXA 4JA7A 3CHPA 4UI9K 1A5EA 3LDZA 1N52A 3LJNA 2WXQA 4GCOA 1SZ9A 2KZTB 2Y4TA 3FEXA 4HS2A 3OXGA 3X2QE 2R17C 3N71A 3DEPA 4TXPA 1YA0A 3FUEA 3PE3A 1N4PA 4GZ6A 4DLOA 1Y6IA 3C3RA 3SQVA 3U64A 3ZHEB 3FTXA 5CRVA 4O1OA 3ZYQA 1KT1A 5AJDA 2L9BA 4Q96A 4U04A 1E96B 1MHQA 3UT8A 2JLBA 3ZUVB 3UTMA 2EIME 3PEUB 3TGOA 3MKRA 3TWSA 4U8VD 4B89A 3D9MA 4FLBA 3CVQA 4I1AA 3C3QA 2YQ8A 4GA2A 4LNGA 3ZFWA 4ABNA 2Y0BG 3KEZA 2A4ZA 3ZXSA 3CKBA 1H6KA 2QY7A 3GYZA 2LNIA 3B7SA 5EX3A 2DBAA 1L5JA 3E33A 4RLYA 4K5CA 4BESA 4J7WA 4I9CA 2RD0A 4L1BA 3EUVA 4J8FA 3FUIA 4G2VA 3CVNA 2WVIA 4AXHA 5DBKA 4H7XA 1TEZA 2FEZA 3D9IA 2Q7FA 3SNXA 1WY6A 5AQBA 2VTBB 3NZSA 2V4LA 3UKUG 4I6JA 4MLPA 2L0IA 3K9IA 3EIJA 4F53A 4RG6A 1O1SA 3IEGA 3G2WA 4TUUA 1HH8A 2QYUA 4J8YA 3ESLA 4GPMA 4AY6A 3Q73A 2KCLA 2WXJA 1TNZA 1IHBA 2Y69E 4RQIA 3I3NA 5EX0A 4XE0A 2IF4A 3UINC 3W9GA 1UOHA 4I2ZA 2BEDA 3DWLG 4A3VA 2H6FA 3PRZA 4DRXE 4I17A 5E76A 5EYLA 4HRMB 4GTQA 2XCBA 3TG4A 3AG3E 2P9IG 3I4GA 4N2QA 5D0OD 5AARA 5ENPD 3VLEA 3PZDA 3P2BA 2XEHA 3CVPA 1W3BA 3JXIA 3I5PA 4YDEA 3TL5A 3PNTB 5C1DA 2X6FA 4X8QA 3MKQB 4PH4B 1FPPA 5FINA 3FUFA 3EU9A 3V31A 2XS8A 1OWNA
chains in the Genus database with same CATH topology
3DSXA 2H6HA 4LNBA 3SFYA 4YDOA 1O5MA 3C72A 4GTRA 1D8DA 1N4QA 1N4PA 1LTXA 1SA4A 1NL4A 2H6IA 3Q79A 3HXFA 1TNOA 3DSSA 1D8EA 4GTOA 1O1TA 1MZCA 1O1SA 1FT2A 1NI1A 3Q78A 3EU5A 3KSQA 4MBGA 1N4RA 3PZ3A 1JCRA 3Q73A 4GTMA 1TNZA 3E30A 3PZ2A 2R2LA 1S64A 2IEJA 2BEDA 3Q7FA 4L9PA 3KSLA 1LD8A 2H6FA 1FT1A 3E37A 4GTTA 1JCSA 1KZPA 1S63A 3PZ4A 3HXCA 4GTPA 1KZOA 2ZISA 2ZIRA 1TNBA 1DCEA 1TN8A 4GTQA 1SA5A 1N95A 1TN6A 1LD7A 1TNYA 3HXBA 4GTVA 3DSWA 3HXDA 1QBQA 4LNGA 3DRAA 3HXEA 3SFXA 3DSUA 4YDEA 1N94A 3DSVA 4EHMA 3Q75A 3E34A 3Q7AA 1JCQA 1N4SA 3E33A 3E32A 1N9AA 1TN7A 2H6GA 3DSTA 1FPPA 3PZ1A 1X81A 3DPYA 2F0YA 1TNUA 1O1RA 4GTSA 3EUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSX A;  2H6H A;  4LNB A;  3SFY A;  4YDO A;  1O5M A;  3C72 A;  4GTR A;  1D8D A;  1N4Q A;  1N4P A;  1LTX A;  1SA4 A;  1NL4 A;  2H6I A;  3Q79 A;  3HXF A;  1TNO A;  3DSS A;  1D8E A;  4GTO A;  1O1T A;  1MZC A;  1O1S A;  1FT2 A;  1NI1 A;  3Q78 A;  3EU5 A;  3KSQ A;  4MBG A;  1N4R A;  3PZ3 A;  1JCR A;  3Q73 A;  4GTM A;  1TNZ A;  3E30 A;  3PZ2 A;  2R2L A;  1S64 A;  2IEJ A;  2BED A;  3Q7F A;  4L9P A;  3KSL A;  1LD8 A;  2H6F A;  1FT1 A;  3E37 A;  4GTT A;  1JCS A;  1KZP A;  1S63 A;  3PZ4 A;  3HXC A;  4GTP A;  1KZO A;  2ZIS A;  2ZIR A;  1TNB A;  1DCE A;  1TN8 A;  4GTQ A;  1SA5 A;  1N95 A;  1TN6 A;  1LD7 A;  1TNY A;  3HXB A;  4GTV A;  3DSW A;  3HXD A;  1QBQ A;  4LNG A;  3DRA A;  3HXE A;  3SFX A;  3DSU A;  4YDE A;  1N94 A;  3DSV A;  4EHM A;  3Q75 A;  3E34 A;  3Q7A A;  1JCQ A;  1N4S A;  3E33 A;  3E32 A;  1N9A A;  1TN7 A;  2H6G A;  3DST A;  1FPP A;  3PZ1 A;  1X81 A;  3DPY A;  2F0Y A;  1TNU A;  1O1R A;  4GTS A;  3EUV A; 
#chains in the Genus database with same CATH topology
 1S0P A;  1JUQ A;  2XRZ A;  3FUK A;  1LF8 A;  3C3O A;  4BFR A;  2AXZ A;  3CVV A;  4UI9 J;  4UWK A;  5AYW D;  3VTX A;  1YCS B;  2OEV A;  2IO2 C;  1NZN A;  5BUZ A;  1LTX A;  3PS6 A;  2PZI A;  2DIW A;  3VLD A;  3LY7 A;  1OUV A;  4QQI A;  4PUC A;  4R7L A;  1SVX A;  1NP7 A;  3UM0 A;  3ZYK A;  1N0Q A;  1NA3 A;  3FY4 A;  3CVW A;  2QC9 A;  4A3T A;  2VGX A;  1HE8 A;  3MZL B;  1K3Z D;  4DLQ A;  3QAR A;  2CG2 A;  3FUD A;  4KZ0 A;  5KNH D;  1D9S A;  2Y4U A;  3HRA A;  5T4Y A;  3E37 A;  2CHZ A;  3TWW A;  4OAU C;  4WNG A;  3PZ4 A;  5IY5 E;  3Q9N C;  1BLX B;  2EIJ E;  1OCZ E;  3ULY A;  3CST A;  2ZIR A;  2EQX A;  1H19 A;  4CDR A;  2IOS A;  4GA1 A;  2F37 A;  4P29 A;  1DCQ A;  2CFZ A;  3LEW A;  3RJV A;  5ENQ D;  2Y3A A;  3CHR A;  3B7T A;  3FFL A;  2VYI A;  3U4T A;  4UWF A;  1OWO A;  3UM1 A;  4CCA A;  2OVF A;  3T5X A;  2HYZ A;  2MOW A;  3LY9 A;  5D66 A;  2AXV A;  4HFG A;  5EN5 D;  5A7D B;  4CDM A;  2LAH A;  1TN7 A;  3S7B A;  1Z5S C;  5LOZ A;  2I9C A;  4BTA A;  1EPU A;  1Z6T A;  5BXU A;  4LG6 A;  1ELK A;  2VGE A;  4Q94 A;  1MYO A;  5FQ6 A;  1DVP A;  2WQ7 A;  1MJ0 A;  3PE4 A;  3QC1 A;  4GZD A;  3UMV A;  3QWV A;  3LVR E;  3AG1 E;  4DX1 A;  3FUJ A;  5CBO A;  4FA6 A;  3CEQ A;  4B8C B;  1P5Q A;  3RAU A;  3QKY A;  4ZFH A;  1KT0 A;  4DX6 D;  3RIB A;  1Q2Z A;  2R2L A;  3ML9 A;  2WM9 A;  4L2Y A;  4I1O B;  5ITZ F;  4WUY A;  4TV3 A;  3W9F A;  4EEC A;  1JCS A;  4HBD A;  3AG2 E;  4HI8 A;  4GCN A;  3TXM A;  3T5V A;  1SZA A;  1UJJ A;  3ASD A;  3ISM C;  4M7C A;  4AEZ C;  3DSW A;  3TJP A;  4YVQ C;  3DRA A;  4GYO A;  3FUN A;  4A55 A;  3BUA A;  4UQZ A;  2R05 A;  3MCX A;  3I4R B;  1FVF A;  3AS4 A;  2V5Q C;  3ZPJ A;  5LP0 A;  4ILI A;  3FTW A;  4A63 B;  2J8S D;  2KXP C;  5KJK A;  4W9R A;  3VTY A;  3NBN B;  1TR4 A;  2J9Q A;  2NXP A;  3BEE A;  4HRL A;  3SFY A;  1XGW A;  3EJN A;  2X6H A;  2X3M A;  3GZ1 A;  4E6H A;  4U8H A;  1PC2 A;  2IJG X;  1RZ4 A;  3PH0 C;  4ZHB A;  2BUG A;  3D9J A;  3JUI A;  1WAO 1;  4AV7 A;  1SW6 A;  5G04 J;  3WG7 E;  4U0U A;  4MBG A;  2ETC A;  4G8L A;  2DCP A;  1S70 B;  3L13 A;  4KYO B;  4CT0 A;  3JQ1 A;  1IQR A;  5AN8 A;  2ILR A;  2WXP A;  3QNK A;  3KSL A;  2YIN A;  2BKG A;  3FUL A;  4CYM D;  3O4Z A;  2FO7 A;  3MV2 B;  1TJC A;  2XPI A;  4IYP A;  5AQ9 A;  2WXN A;  5BXO A;  3ASO E;  2XCC A;  5AEN A;  4FHJ A;  2L6J A;  4PS8 A;  3HDX A;  2XS1 A;  4AJW A;  4CDN A;  3KEA A;  5KJL A;  5KJN A;  3QWW A;  1AWC B;  3ZKJ A;  4G24 A;  1QQE A;  3DSV A;  1U2V G;  4M3O A;  1H2T C;  2E0I A;  3Q7A A;  3Q4A B;  4FAD A;  3LVQ E;  2XGS A;  3CVL A;  2P58 C;  3ASN E;  3Q15 A;  4GTS A;  4PS3 A;  2DVW A;  2V8S E;  3AU5 A;  2OEW A;  3JUE A;  4K0R A;  3DXM G;  2F8Y A;  2LSU A;  3ZEF A;  4GYY A;  4K5A B;  2GRP B;  3CK9 A;  3FTV A;  1H2U A;  3LXU X;  3Q79 A;  3SF4 A;  5J08 A;  2ZXW E;  3SHF A;  4XKB A;  1HXI A;  5FWQ A;  5D2M C;  2XQ0 A;  3LPZ A;  3EHM A;  1MX2 A;  4WWN A;  4GPK A;  1HF8 A;  5FQ8 A;  2PL2 A;  1E8Y A;  5EID A;  3JYS A;  1E90 A;  3J5P A;  4DX7 D;  3HHM A;  2WXH A;  4WNF A;  5JHA A;  3DBS A;  2A5E A;  3Q7F A;  3EDT B;  2HO1 A;  1IXV A;  5FQ7 A;  2LO6 A;  2JAB A;  2V0P A;  4ANX A;  3G2V A;  4J8E A;  3Q49 B;  2ZIS A;  4PDX A;  5EIL A;  4MS6 A;  1TN6 A;  3GW4 A;  4NAC A;  4ACL A;  4I9E A;  3QK0 A;  3HG0 D;  4G8K A;  4GZ3 A;  2PNN A;  4HOQ A;  5KCM A;  3KD7 A;  3HYM B;  3RO2 A;  5ENO D;  3UIO C;  3R9M A;  4RG9 A;  2OCC E;  2NC9 A;  3UT7 A;  4UQY A;  1OCO E;  3DSX A;  5JJ7 A;  3J5Q B;  4L2L A;  1QYM A;  2IOL A;  3CK7 A;  1K1A A;  3KAE A;  5HKP A;  3QDN A;  3ESK A;  4JEH A;  5FJY A;  2LAI A;  5JMN D;  4WWP A;  3ONK A;  2FBN A;  3JQ0 A;  1OT8 A;  2NYJ A;  1O1T A;  1NI1 A;  2VJ8 A;  3S7J A;  4RSY A;  1MX4 A;  4QFV A;  2P9U G;  1PAQ A;  5A23 A;  4BT9 A;  4F6R D;  1IQU A;  3E30 A;  2WMN A;  3APD A;  3CK8 A;  3UXG A;  2IFU A;  3FWV A;  3PDN A;  4JPS A;  4N3C A;  4UWH A;  1TN8 A;  1KLX A;  5EYP F;  3VLF A;  3SFZ A;  4N5Q A;  1HFA A;  3HXE A;  4MKT A;  3D9P A;  5KWD A;  2LUH A;  4BET A;  5HI7 A;  1EDU A;  2VQ2 A;  1N4S A;  3L16 A;  4Q69 A;  3D9K A;  3IHV A;  1ZB1 A;  4ME2 A;  2ZGG A;  4UUC A;  2PQR A;  2HE0 A;  2XHE A;  4B94 A;  5G05 C;  3L6A A;  5BV0 A;  4GML A;  2CHX A;  2KC7 A;  2J08 A;  3FUM A;  3PUK A;  4JHJ A;  4C0E A;  4GYW A;  3Q9U C;  4HLL A;  1E8Z A;  4ILH B;  4AP2 A;  3TWR A;  3RU0 A;  1FT2 A;  2XPY A;  2VTB A;  2E2E A;  5KBA A;  4J8D A;  4CGV A;  3APC A;  2EIN E;  2X6I A;  2XZD G;  2FO1 E;  3PEV B;  1AP7 A;  1YYH A;  3EHR A;  2DWZ A;  1A17 A;  4L9P A;  4LEU A;  1OCC E;  4KVO A;  4RVB A;  1HU3 A;  4GTT A;  1E7V A;  3EHN A;  3D3M A;  3HXC A;  2A5U A;  3FEY A;  3CQC B;  5ARF A;  4AVX A;  3OXF A;  1SA5 A;  3QWP A;  5H7P A;  5JJT A;  4U95 D;  3NAW A;  3T8M A;  2WXM A;  2NSZ A;  3R7Q A;  4KBQ A;  3F6Q A;  2I1J A;  4GMJ A;  4XKC A;  4E85 A;  5FQ4 A;  4YDY A;  4EHM A;  3E34 A;  5BV1 A;  2XGM A;  1JCQ A;  4YND A;  4DK5 A;  4AM9 A;  4ACK A;  1ZBP A;  1B89 A;  1TNU A;  4URK A;  4K5B A;  3TWT A;  2RG8 A;  2VGY A;  3ZYM A;  1NFI E;  2ETA A;  3ZYL A;  2C0M A;  2QZA A;  5E75 A;  3D9H A;  4HLE A;  4V3I A;  3MA5 A;  4KMO A;  5LX8 A;  3FTZ A;  3PVL A;  4BTB A;  2I1K A;  4NUR A;  3HXF A;  3QAQ A;  3ASG A;  4XEI G;  2UY1 B;  1Y8M A;  4KZC A;  4YDW A;  3NZU A;  3CHM A;  3U9W A;  3Q47 B;  2QFC A;  2P2C P;  4G25 A;  3AG4 E;  3P1U A;  3FU6 A;  4BX8 A;  1HG5 A;  3D9O A;  4LSZ E;  2IEJ A;  3QOU A;  3ABL E;  1EF1 C;  1INZ A;  5FZQ A;  3UUX A;  2WPV A;  4O6F A;  5CCL A;  3FUH A;  2MRI A;  1MX6 A;  3FU5 A;  2BF0 X;  1DCE A;  1HX8 A;  3IKO B;  2CG3 A;  3SBS A;  4GAA A;  3O48 A;  4EPZ A;  1TNY A;  2DZN A;  2KCV A;  5LCW C;  2XZT G;  1QZ2 A;  4OVU A;  2GRL A;  3CLJ A;  3G2S A;  3MV3 B;  4FJY A;  3FTY A;  4HI9 A;  2GRN B;  3TAX A;  4BSZ B;  2DYR E;  4BY6 A;  2V4H C;  4FJZ A;  3CVY A;  1V55 E;  4CT4 A;  2J4D A;  3SGH A;  5J90 A;  4ATZ D;  5G2N A;  1WG0 A;  3URZ A;  2CHW A;  5CMW A;  3ABM E;  4I2W A;  2R03 A;  4YDO A;  4HXI A;  3SO8 A;  2QYJ A;  3AS5 A;  5AQA A;  2XEV A;  4N2S A;  3CR3 A;  1SA4 A;  4WWO A;  3BG1 B;  1D8E A;  2WXL A;  5A6C A;  2L6B A;  2X6J A;  3EU5 A;  2B6C A;  1GW6 A;  1UN9 A;  1U3D A;  1BI7 B;  3CKC A;  1N4R A;  2MYO A;  2Y1L E;  2OVB A;  2IO3 C;  4BSX A;  1JPL A;  3GZ2 A;  4NQ0 A;  3UM3 A;  1BI8 B;  3FH7 A;  2KAT A;  3MEK A;  4U7E B;  1E8W A;  1N11 A;  3RRU A;  3U66 A;  3NQP A;  1S63 A;  3FU0 A;  3TWQ A;  2B0O E;  3T8K A;  4B8A A;  4IUL A;  3RRN B;  2X6K A;  4JC8 A;  4JVS A;  2ION A;  3B7U X;  3HXB A;  3LS8 A;  4HQD A;  3SFX A;  3DSU A;  5B1B E;  3CHO A;  5AAO A;  2FF4 A;  4ANW A;  5FIO A;  3CVX A;  2XPZ A;  1KPS B;  3AS8 A;  2V5F A;  4BWR A;  1N9A A;  4CZ2 D;  1K8K G;  4B0Z A;  2XRY A;  4A1S A;  4G23 A;  4FU3 A;  5CED B;  3CSF A;  5ENN A;  4LNB A;  2R59 A;  3C98 A;  1BU9 A;  4OAV B;  5FZR A;  3NOC D;  4GTR A;  4DX5 D;  1UG3 A;  1IKN D;  4I1M A;  1NL4 A;  5JHB A;  2DYS E;  1TNO A;  2WXF A;  5EKQ D;  5BW8 C;  5JA4 D;  4HB5 A;  1MZC A;  3CIA A;  3PUJ A;  4O60 A;  2J07 A;  4LER A;  4HRN A;  3TWU A;  3APF A;  3U3W A;  3DXK G;  4BT8 A;  3HVE A;  3PZ2 A;  4XI0 A;  3GZS A;  4G26 A;  2J49 A;  3RSE G;  1FT1 A;  4J6I A;  1G3N B;  4EBA A;  3V2O A;  3TWV A;  4BX9 A;  5ARG A;  2YNQ A;  1QNF A;  3ZNG A;  4GTV A;  5B3S E;  3LJ3 A;  4HOT A;  5KJM A;  4DPR A;  1VDY A;  4I6E A;  3ZU7 B;  1WM5 A;  2ZGD A;  4C48 B;  3CHQ A;  3Q75 A;  4JL0 A;  3ONL A;  4NRH B;  3ZVV A;  1X81 A;  3ASF A;  2F0Y A;  2F8X K;  1O1R A;  4DJA A;  4KXK B;  3G2T A;  4AY5 A;  3C5R A;  4ANU A;  1Z3Y A;  1IHG A;  4JD2 G;  5ENT D;  4FHK A;  5ENS D;  3IHY A;  4HOU A;  5HQ8 A;  4DI3 A;  2P9L G;  1YMP A;  4H7Y A;  2XEN A;  4FLH A;  3UT4 A;  3ZN3 A;  4EBA G;  2VSN A;  2VSY A;  1OWP A;  4G11 A;  3UKR G;  4UQX A;  4XX5 A;  1HZ4 A;  3L08 A;  2OND A;  3CV0 A;  4DX2 A;  3WXX A;  3FTS A;  4F7A A;  2JEK A;  3PNL B;  1ZU2 A;  2KZT A;  4JEU A;  1DNP A;  4L23 A;  1OWM A;  2WXG A;  2VSX E;  5CBN A;  3QB2 A;  4XZ4 A;  3ZW3 A;  2WXK A;  5FZS A;  3T9K A;  1FCH A;  4HOR A;  1NA0 A;  2IY0 C;  1RW2 A;  5T8I A;  2GGF A;  3SD5 A;  2P9P G;  2M63 A;  2GRM A;  1TJF A;  1OXJ A;  3AAA C;  3ZHE A;  2I6H A;  1BD8 A;  4O1P A;  1V54 E;  2RFM A;  3MJW A;  1E8X A;  1OCR E;  2WMO A;  4TRQ A;  3ZRH A;  1Z3X A;  4APF A;  4Y6W A;  4C9B B;  4TXQ A;  4EZL A;  4EZJ A;  3DST A;  2WQH A;  1H6P A;  4U0Z A;  4OVV A;  5BPP A;  2EIK E;  4JW1 A;  3FU3 A;  1UN8 A;  4U8Y D;  1U3C A;  4APO A;  4HOS A;  3V30 A;  3IV0 A;  3OXL A;  4EQF A;  3C72 A;  1H2V C;  2EIL E;  5CCM A;  4XI9 A;  2FUL A;  3L17 A;  2VGX B;  2LSV A;  4JHK A;  3DSS A;  2AW6 A;  1SQM A;  4FC8 A;  4GZC A;  4JHR A;  3KSQ A;  3IXE A;  3FTU A;  3G2U A;  3RRM B;  5ANL A;  4CGW A;  3PZ3 A;  3ULQ A;  5JJ6 A;  1FVH A;  4BEP A;  2OOE A;  1XNF A;  4N3B A;  3CVU A;  4N3A A;  3S2A A;  5BT1 A;  4GU5 A;  5G05 J;  3AJI A;  3ZXP A;  2BKK B;  5CHE E;  3L82 A;  2ETB A;  4GTP A;  4UI9 C;  3UI2 A;  4LCT A;  5DIZ A;  3QJZ A;  1IYG A;  3CQG B;  1N95 A;  2AVP A;  1LD7 A;  2C2L A;  3E4B A;  4J0U A;  2YHE A;  4Z68 A;  3BG0 B;  2GRQ B;  3UPV A;  4A1G A;  2AXU A;  3SY2 A;  4LUN U;  1N94 A;  2FI7 A;  5BNW A;  3SZ7 A;  5EDS A;  3MYV A;  4MRU A;  2OV8 A;  2MHK A;  3V79 K;  4CEM A;  2J09 A;  3D9N A;  1JWG A;  4FP7 A;  3EIQ C;  3ZIM A;  3V2X A;  3LCA A;  4PS7 A;  3FH8 A;  4TUM A;  5FT9 A;  1HS6 A;  4F1S A;  3Q78 A;  4ILG A;  4GB9 A;  3RKV A;  2WB2 A;  2HM8 A;  4K03 A;  3MKQ A;  2C0L A;  3JXJ A;  3S7F A;  3CHS A;  3AU4 A;  2R02 A;  4GTM A;  4D10 C;  2J4B A;  3R7R A;  4CRW A;  5AIJ A;  3DPD A;  2XGO A;  4ANV A;  3D9L A;  4FUL A;  2R5S A;  3FHE A;  2GRR B;  2LXM A;  4GZ5 A;  4XIF A;  3MGB A;  2PM7 A;  3ZGQ A;  1ELW A;  5CEA A;  3FDH A;  3BU8 A;  4WND A;  2BTD A;  5CER B;  4TXR A;  4UWL A;  3UQ3 A;  3L22 A;  5AQ7 A;  3TXN A;  3HXD A;  3S7D A;  5AJL A;  3NOG D;  4AOF A;  4UWG A;  3RO3 A;  2WXR A;  3UIP C;  1N0R A;  4I43 A;  3TG5 A;  3E32 A;  3JCK C;  4JXT A;  2H6G A;  4KT6 B;  5KNG A;  2GW1 A;  1H6O A;  3DPY A;  3CGH A;  1TYQ G;  3ASH A;  2AJA A;  4HNA D;  3RK6 A;  1BPO A;  1K1B A;  1O5M A;  3Q5M A;  4N39 A;  5C2Y A;  3L9T A;  2KM4 A;  3SI5 A;  2UWJ G;  4GA0 A;  2H6I A;  4IN3 B;  5CEC B;  2KCK A;  4U0S A;  5LCW J;  2P9N G;  2X38 A;  2DZO A;  2L0T B;  3R9A B;  4GTO A;  4C0M A;  5FTP A;  2LXL A;  4DI4 A;  1JCR A;  5CMY A;  5M72 A;  3SBT B;  2P9S G;  4KVM A;  4F3V A;  2UY1 A;  4JA9 A;  3OAW A;  1S64 A;  3B7B A;  2PM6 A;  4U63 A;  4J8S A;  1LD8 A;  3NB2 A;  3BQO A;  2IU1 A;  4EZK A;  4HVB A;  2AWI A;  5ENR D;  3LYA A;  2HR2 A;  1TNB A;  4OYS A;  4GMR A;  4LRZ A;  3MX3 A;  1MQS A;  3ABK E;  2CFU A;  1H0A A;  4U96 D;  4LNU D;  3LY8 A;  3NF1 A;  5G04 C;  4L7T A;  2WQ6 A;  5EIB E;  4WNE A;  1UW4 B;  5HRY A;  3UM2 A;  2I2O A;  4NIK A;  3PZ1 A;  5CRU A;  3KS2 A;  3FH5 A;  2VSO E;  2WXI A;  2H6H A;  2ZU6 B;  4BER A;  1HG2 A;  3HVE B;  3ULE G;  4B93 B;  2WXO A;  4WAF A;  1EYH A;  3FP3 A;  5T3R A;  1D8D A;  1N4Q A;  3UX4 A;  1PY1 A;  2RFA A;  2XEE A;  2P9K G;  4U07 A;  4DUI A;  3B7R L;  5HS0 A;  5G55 A;  3L54 A;  4F1P A;  2GRO B;  1OY3 D;  4YVO A;  2PQN A;  3ML8 A;  2RKK A;  1ELR A;  5LFA A;  1DC2 A;  4JZY A;  4ATG A;  3PRE A;  3B95 A;  4JB8 P;  3EHQ A;  3TWX A;  1X5B A;  1UJK A;  2YHC A;  3DEO A;  4Y6C A;  5ANR A;  1N54 A;  4IRU A;  4AIF A;  1KZP A;  2IQC A;  3LKU A;  1KZO A;  1WDY A;  3OTN A;  4N5C A;  1HO8 A;  1OWL A;  4G1T A;  3IBE A;  4I6G A;  3HIZ A;  3ENE A;  3B13 A;  5D0Q D;  1E7U A;  1JWF A;  1QBQ A;  5B1A E;  2KBX A;  4JA7 A;  3CHP A;  4UI9 K;  1A5E A;  3LDZ A;  1N52 A;  3LJN A;  2WXQ A;  4GCO A;  1SZ9 A;  2KZT B;  2Y4T A;  3FEX A;  4HS2 A;  3OXG A;  3X2Q E;  2R17 C;  3N71 A;  3DEP A;  4TXP A;  1YA0 A;  3FUE A;  3PE3 A;  1N4P A;  4GZ6 A;  4DLO A;  1Y6I A;  3C3R A;  3SQV A;  3U64 A;  3ZHE B;  3FTX A;  5CRV A;  4O1O A;  3ZYQ A;  1KT1 A;  5AJD A;  2L9B A;  4Q96 A;  4U04 A;  1E96 B;  1MHQ A;  3UT8 A;  2JLB A;  3ZUV B;  3UTM A;  2EIM E;  3PEU B;  3TGO A;  3MKR A;  3TWS A;  4U8V D;  4B89 A;  3D9M A;  4FLB A;  3CVQ A;  4I1A A;  3C3Q A;  2YQ8 A;  4GA2 A;  4LNG A;  3ZFW A;  4ABN A;  2Y0B G;  3KEZ A;  2A4Z A;  3ZXS A;  3CKB A;  1H6K A;  2QY7 A;  3GYZ A;  2LNI A;  3B7S A;  5EX3 A;  2DBA A;  1L5J A;  3E33 A;  4RLY A;  4K5C A;  4BES A;  4J7W A;  4I9C A;  2RD0 A;  4L1B A;  3EUV A;  4J8F A;  3FUI A;  4G2V A;  3CVN A;  2WVI A;  4AXH A;  5DBK A;  4H7X A;  1TEZ A;  2FEZ A;  3D9I A;  2Q7F A;  3SNX A;  1WY6 A;  5AQB A;  2VTB B;  3NZS A;  2V4L A;  3UKU G;  4I6J A;  4MLP A;  2L0I A;  3K9I A;  3EIJ A;  4F53 A;  4RG6 A;  1O1S A;  3IEG A;  3G2W A;  4TUU A;  1HH8 A;  2QYU A;  4J8Y A;  3ESL A;  4GPM A;  4AY6 A;  3Q73 A;  2KCL A;  2WXJ A;  1TNZ A;  1IHB A;  2Y69 E;  4RQI A;  3I3N A;  5EX0 A;  4XE0 A;  2IF4 A;  3UIN C;  3W9G A;  1UOH A;  4I2Z A;  2BED A;  3DWL G;  4A3V A;  2H6F A;  3PRZ A;  4DRX E;  4I17 A;  5E76 A;  5EYL A;  4HRM B;  4GTQ A;  2XCB A;  3TG4 A;  3AG3 E;  2P9I G;  3I4G A;  4N2Q A;  5D0O D;  5AAR A;  5ENP D;  3VLE A;  3PZD A;  3P2B A;  2XEH A;  3CVP A;  1W3B A;  3JXI A;  3I5P A;  4YDE A;  3TL5 A;  3PNT B;  5C1D A;  2X6F A;  4X8Q A;  3MKQ B;  4PH4 B;  1FPP A;  5FIN A;  3FUF A;  3EU9 A;  3V31 A;  2XS8 A;  1OWN A; 
#chains in the Genus database with same CATH homology
 3DSX A;  2H6H A;  4LNB A;  3SFY A;  4YDO A;  1O5M A;  3C72 A;  4GTR A;  1D8D A;  1N4Q A;  1N4P A;  1LTX A;  1SA4 A;  1NL4 A;  2H6I A;  3Q79 A;  3HXF A;  1TNO A;  3DSS A;  1D8E A;  4GTO A;  1O1T A;  1MZC A;  1O1S A;  1FT2 A;  1NI1 A;  3Q78 A;  3EU5 A;  3KSQ A;  4MBG A;  1N4R A;  3PZ3 A;  1JCR A;  3Q73 A;  4GTM A;  1TNZ A;  3E30 A;  3PZ2 A;  2R2L A;  1S64 A;  2IEJ A;  2BED A;  3Q7F A;  4L9P A;  3KSL A;  1LD8 A;  2H6F A;  1FT1 A;  3E37 A;  4GTT A;  1JCS A;  1KZP A;  1S63 A;  3PZ4 A;  3HXC A;  4GTP A;  1KZO A;  2ZIS A;  2ZIR A;  1TNB A;  1DCE A;  1TN8 A;  4GTQ A;  1SA5 A;  1N95 A;  1TN6 A;  1LD7 A;  1TNY A;  3HXB A;  4GTV A;  3DSW A;  3HXD A;  1QBQ A;  4LNG A;  3DRA A;  3HXE A;  3SFX A;  3DSU A;  4YDE A;  1N94 A;  3DSV A;  4EHM A;  3Q75 A;  3E34 A;  3Q7A A;  1JCQ A;  1N4S A;  3E33 A;  3E32 A;  1N9A A;  1TN7 A;  2H6G A;  3DST A;  1FPP A;  3PZ1 A;  1X81 A;  3DPY A;  2F0Y A;  1TNU A;  1O1R A;  4GTS A;  3EUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...