3E37A

Protein farnesyltransferase complexed with bisubstrate ethylenediamine scaffold inhibitor 5
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
315
structure length
315
Chain Sequence
b'FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Structural basis for binding and selectivity of antimalarial and anticancer ethylenediamine inhibitors to protein farnesyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 128
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3e37A00
3DSSA 3DSXA 1O1TA 1SA4A 3Q7FA 2H6GA 3E37A 1TNYA 3PZ3A 2BEDA 3DSUA 4GTOA 1D8EA 1TNOA 1N4SA 3DSVA 3KSLA 2H6FA 4GTVA 1QBQA 3DSTA 1TN6A 3Q75A 4GTQA 2F0YA 3SFYA 4YDOA 3E34A 2ZIRA 3PZ1A 1JCRA 3E33A 3HXEA 4GTSA 3HXBA 4YDEA 2ZISA 3HXFA 1N4QA 4LNGA 1TNBA 1FT1A 1TNUA 3Q79A 1JCQA 3Q78A 1N9AA 4GTRA 1MZCA 1FPPA 1LD7A 1O1RA 3EUVA 1N95A 4GTPA 3KSQA 1S64A 2IEJA 2H6HA 3E30A 1S63A 1JCSA 1LTXA 1X81A 1KZOA 3SFXA 4EHMA 1NL4A 3DSWA 1D8DA 3E32A 3Q73A 3PZ4A 2H6IA 4GTTA 4GTMA 1O1SA 3HXCA 3EU5A 3PZ2A 1TN7A 3HXDA 1N4PA 3DPYA 1N4RA 1TN8A 4LNBA 2R2LA 3DRAA 4MBGA 1DCEA 3Q7AA 1SA5A 3C72A 1FT2A 1N94A 4L9PA 1TNZA 1LD8A 1O5MA 1KZPA 1NI1A
chains in the Genus database with same CATH superfamily
3C98A 4LSZE 4ABNA 4HBDA 4J8FA 1O1TA 3AU5A 3AG3E 2GGFA 3L54A 3SBTB 3PEUB 3AS5A 3ZW3A 3U9WA 2F8YA 1N0RA 4Y6WA 3T5VA 1IHGA 2GW1A 1MQSA 2OOEA 3LVRE 4N3BA 5CEDB 2A5EA 5BV1A 2QFCA 4ILGA 3FTYA 1EDUA 3TWTA 3KEAA 2KCVA 3DXKG 2V4HC 4A55A 2WMNA 2VGYA 3NZSA 5D66A 4CGWA 3D9PA 1E8WA 3ZGQA 3RIBA 2XHEA 1UOHA 2KM4A 4BETA 2KATA 4B89A 2OVBA 1N95A 5BUZA 5FT9A 4WNDA 4BX9A 1V55E 4AXHA 3LJ3A 5AJLA 2J8SD 3T8KA 4G8LA 4UI9C 1O1SA 3ASGA 4J8EA 1FVFA 3S7FA 4TRQA 3HXCA 5JMND 5ENRD 3TWRA 1N4RA 4PS7A 2C2LA 4LNBA 5J90A 1Z5SC 2R2LA 3FEXA 4IYPA 3O48A 2XGOA 4WNFA 1IXVA 1Y8MA 3JYSA 4WWPA 1TNZA 4WNEA 2YHEA 3AJIA 3UIOC 4ACKA 2GRMA 4LG6A 1Y6IA 4U0ZA 5G04J 4EECA 4LRZA 5BT1A 4HRLA 3OXLA 2LSVA 3FU6A 3JXJA 1N4SA 2HYZA 2H6FA 3ZHEA 2C0MA 5T8IA 5EIDA 3MV2B 2F0YA 3SFYA 4XEIG 3ZYKA 3K9IA 4U07A 4JHKA 3TGOA 3B7RL 2FO1E 4U8VD 4U8YD 4C0EA 2ZISA 3CHSA 2B6CA 4XKBA 3ONLA 4LNGA 4HI8A 3CVUA 4KVOA 1H6OA 4AOFA 5BXUA 2NXPA 4E85A 5KJMA 4HOSA 2LSUA 4L2LA 3PH0C 3Q49B 4M7CA 4APOA 4ZFHA 3LDZA 4IRUA 2R17C 4EHMA 1E90A 5EN5D 2R02A 4HI9A 3UT7A 1E8XA 3DWLG 2AJAA 3TXMA 3Q9NC 4DX6D 3QOUA 5JJTA 4BERA 4HNAD 3FFLA 3QAQA 4B0ZA 4MBGA 3C72A 4QFVA 3LEWA 4AV7A 2IFUA 3ESKA 1NA3A 3FUJA 3NB2A 2P9PG 3D9MA 1HZ4A 2IQCA 2QYJA 3Q7FA 3B7BA 5HKPA 4GYYA 4B93B 4OAVB 4JZYA 1N11A 3FU5A 3DSTA 4K0RA 3OTNA 3E34A 3PUKA 4DLOA 4DJAA 3SF4A 2P9LG 2VSXE 1WM5A 4ILIA 4UI9J 5HRYA 4UWGA 3HVEB 4UUCA 3UT8A 5IY5E 1TNUA 3ZHEB 3JUIA 4DI4A 3JCKC 4KZCA 2X38A 2VYIA 2MRIA 4GTPA 3KSQA 2VTBA 3E30A 4MRUA 4XE0A 4KZ0A 3ZU7B 3RJVA 5CRVA 1Z6TA 4AVXA 1U2VG 2J49A 3U66A 4KYOB 3IHYA 2WXFA 2RKKA 1ELKA 4JXTA 1NI1A 4FLBA 4CRWA 2WXOA 2J9QA 5FIOA 5C2YA 3FUEA 4AY6A 2L0IA 5BW8C 2XPYA 3TWUA 4N3AA 4L1BA 3VLEA 3O4ZA 3J5QB 3QNKA 5ARFA 4J8SA 3FULA 1YMPA 2BUGA 4YDOA 3S7DA 3LPZA 3E33A 3HXBA 5EX0A 1P5QA 2UY1A 3ZUVB 1OWMA 4JHRA 3PRZA 4L23A 4GYWA 5HQ8A 5KJKA 3MKRA 3C3RA 4IN3B 3FEYA 5EILA 4TUUA 3BG1B 1ELWA 3EHQA 4UWHA 1WAO1 1JUQA 4OYSA 1S63A 3L13A 3Q4AB 4N5QA 4F7AA 1YYHA 4LCTA 3QDNA 4PDXA 4R7LA 2JABA 2XPIA 3V2XA 3T8MA 5E76A 4Y6CA 4AJWA 3HRAA 4GMJA 4W9RA 4PS3A 3PEVB 5JJ6A 3R9MA 3AS8A 2X3MA 4BX8A 2JLBA 3FUDA 4V3IA 2KXPC 3C3QA 4HQDA 3RO3A 1O5MA 4GU5A 4XZ4A 1BLXB 5LCWJ 3CSFA 1ELRA 3DEOA 4JA7A 4CGVA 3CK8A 3W9FA 3TWXA 1A17A 2XCBA 4Z68A 4TXPA 2WM9A 3EHRA 2Y69E 4X8QA 3DSUA 3FTZA 4GTOA 2YNQA 4GCOA 4URKA 1TEZA 5A7DB 2LNIA 4CZ2D 3UKRG 1OY3D 3D9JA 3AG4E 5G05J 4GPKA 1L5JA 3V79K 3NAWA 5CECB 5D0QD 3MCXA 3U3WA 3FWVA 3HXEA 5ANLA 2PZIA 4XI9A 4K03A 3G2WA 2CHXA 3UMVA 4I9CA 3SI5A 4TXQA 3PREA 2PQNA 4DLQA 3B7UX 4RSYA 4FP7A 3CKBA 2AXUA 4I6GA 2LO6A 4ZHBA 2XZDG 4FULA 4O6FA 3L17A 5EX3A 3V2OA 4GZ5A 4G24A 2XRZA 1HXIA 1WDYA 3ZEFA 3PZ4A 4GTMA 5LP0A 2WMOA 1VDYA 2VSOE 5CRUA 5ENTD 2V5QC 5ITZF 1N4PA 3LVQE 2FBNA 5JHAA 2DCPA 4F53A 3SGHA 2ONDA 3GYZA 4IULA 2IONA 2XEEA 1DCQA 1N94A 3UI2A 4CDMA 4N5CA 2OEVA 3SO8A 3HYMB 4O1OA 4ANVA 1BI7B 1K8KG 1OCRE 2IO2C 3UINC 1HFAA 4CCAA 4AY5A 3ESLA 3PZ3A 1IQRA 3NF1A 3FUIA 1JPLA 3B7SA 3DEPA 3KEZA 3Q9UC 5ENNA 4K5AB 5ENOD 3LJNA 3C3OA 3OXGA 4FLHA 3CIAA 2VQ2A 4KVMA 2WVIA 4U0SA 4CDNA 2P9SG 4GTRA 2AW6A 5DBKA 5FZSA 2WXJA 2IEJA 3ISMC 2DYRE 1LTXA 3CVLA 3ASDA 1EPUA 3WXXA 3E32A 4A1SA 3N71A 5CERB 1WY6A 2H6IA 3LY9A 3NBNB 2L9BA 2CG2A 3UM0A 2IO3C 1H2TC 2FO7A 3ZVVA 3DPYA 5AENA 4YVOA 3FU0A 4PS8A 3ZYMA 3HDXA 5FWQA 2F8XK 2GRRB 1GW6A 1H2VC 5JHBA 5J08A 5FQ8A 3NOCD 3CQCB 1UN9A 2VSYA 3IHVA 4K5BA 2RG8A 4ANWA 3MGBA 3RAUA 4HOQA 2VGEA 2X6IA 3AG2E 2IJGX 3PE3A 4L2YA 1H19A 3LKUA 3PUJA 2E2EA 2V4LA 5BV0A 4F6RD 2YHCA 1N0QA 4FC8A 1SVXA 5CMWA 3TWVA 2VSNA 1QZ2A 3L6AA 5KJLA 2DYSE 4XIFA 4I17A 2WXNA 3D3MA 3W9GA 3HVEA 3VTXA 2EIME 3TL5A 3URZA 4C9BB 5AQ9A 4P29A 2ETBA 1BU9A 3CV0A 2H6HA 5A23A 4FA6A 1U3DA 4EPZA 1KLXA 4HFGA 1NL4A 2RFMA 3ZPJA 5FZRA 4BY6A 4UWKA 4UWLA 4OAUC 3HIZA 3ASHA 3U4TA 4PH4B 3IBEA 4EZLA 3PNLB 4A3TA 3DXMG 1E8YA 1OWOA 3DRAA 3CVVA 5KNGA 1SA5A 1BD8A 4L9PA 5ENQD 4WWOA 3SY2A 1H2UA 1KZPA 4I6EA 4F1PA 2QYUA 4U04A 2YQ8A 4UWFA 3I5PA 3UUXA 4ATGA 5D2MC 1N52A 3UX4A 1OCZE 4MKTA 3IKOB 3CK9A 1NP7A 3ABME 3EHMA 5CEAA 1TN6A 3UKUG 3Q75A 4N2QA 4RVBA 3ZKJA 2GRNB 5ARGA 2WQ6A 2XGSA 4GMLA 4Q69A 4FHKA 2XCCA 3D9HA 2NYJA 4UQYA 4BSXA 3ML9A 2P2CP 3EDTB 2DWZA 5BNWA 4J8DA 2LUHA 5LCWC 3FDHA 5G55A 1JCSA 1UW4B 3QWPA 3F6QA 3LY8A 4AM9A 2BKGA 3Q5MA 3ONKA 4CEMA 3FUKA 3FUHA 3FP3A 1KT0A 3CHPA 4HRNA 5LOZA 4EBAA 2VJ8A 4EBAG 5AYWD 2LAHA 3ZRHA 1SZAA 2I1KA 5T4YA 4LNUD 5G05C 1PC2A 2XGMA 1HF8A 4G8KA 2ETAA 3S2AA 3UXGA 3CHMA 4I2ZA 4CYMD 2LXMA 3TXNA 4NQ0A 3BEEA 1SW6A 1WG0A 1LF8A 2Y1LE 4O1PA 3V31A 1Z3XA 1D9SA 2GROB 4HB5A 4RQIA 1TNOA 1H6PA 1KPSB 4GZ3A 4U63A 4TV3A 5B1BE 3JUEA 3QARA 4HLLA 5AQ7A 2ZXWE 3U64A 1EF1C 3P2BA 2J4DA 3CHRA 3SHFA 4G1TA 4U7EB 3TAXA 4A63B 3L82A 1UG3A 4GZCA 1XGWA 1QYMA 3S7BA 4QQIA 2LXLA 5EDSA 1IKND 3D9NA 3UM1A 3QWWA 1H6KA 4AIFA 2J4BA 3E4BA 2DBAA 2C0LA 2HE0A 3ASOE 4E6HA 3CLJA 3FH8A 1HX8A 2I1JA 1TN7A 1TJFA 3G2SA 1SQMA 2IY0C 1DCEA 4NIKA 4U0UA 3UM2A 4CT4A 3SFZA 3D9IA 3DSSA 4YNDA 1AWCB 3AS4A 1YA0A 1SA4A 4DPRA 2R05A 4GPMA 4I2WA 1AP7A 1TNYA 2M63A 4I1MA 2ZU6B 3ASFA 3VLFA 4KXKB 4J0UA 3RRNB 4B8CB 3DBSA 1OCCE 2FULA 3EHNA 3Q15A 3TJPA 5CCMA 3FUFA 4G2VA 1JCRA 2OEWA 2GRLA 4BFRA 5HI7A 4J6IA 3NZUA 4YDEA 3NQPA 2F37A 3ZXSA 3HXFA 5CMYA 2A4ZA 4WUYA 1TNBA 5AN8A 1FT1A 2EILE 3MKQA 4DRXE 2XZTG 4I1OB 4J7WA 5E75A 3FU3A 3VLDA 2P9IG 2AWIA 3IEGA 2E0IA 1IYGA 1EYHA 4TXRA 4GZ6A 1A5EA 1NZNA 3TG5A 5A6CA 4JA9A 2QY7A 2V8SE 3KS2A 5FQ6A 3Q73A 2PL2A 2HR2A 5HS0A 3MX3A 3CEQA 3PZDA 4RLYA 2EINE 1OUVA 2WXIA 3V30A 2IOLA 4N39A 1DC2A 2XS1A 5AAOA 1FCHA 4N3CA 4XI0A 4GB9A 2GRQB 1HG5A 4B8AA 3D9LA 3LS8A 4MS6A 5EYLA 4GYOA 3OXFA 4H7XA 3UTMA 4BTAA 2DIWA 5CBNA 4DX1A 3SQVA 3GW4A 1V54E 3T9KA 4BT8A 4GA2A 3CVPA 3LYAA 1QNFA 4K5CA 2YINA 2AVPA 3EJNA 3DPDA 2I2OA 2AXZA 2P9KG 4YDYA 4DUIA 3CVYA 2BKKB 2VGXB 3JQ0A 3T5XA 1OWNA 3GZSA 4I43A 3PZ1A 4H7YA 4BWRA 4G26A 5AQAA 3RSEG 3Q47B 5AARA 2Y4UA 4C0MA 1NA0A 3X2QE 4EZJA 1TJCA 4JD2G 3HHMA 3B7TA 5KNHD 4C48B 3I4GA 2BTDA 3ULQA 3EIJA 2WXKA 3EUVA 5AIJA 4HS2A 3ENEA 1E8ZA 1TR4A 2B0OE 3JQ1A 4N2SA 4OVVA 3P1UA 4NRHB 4F3VA 1UJJA 3FUNA 3QJZA 3MKQB 2WQHA 3EU5A 3VTYA 4FU3A 5FJYA 2KZTB 1BPOA 1HS6A 3ASNE 4BEPA 3BG0B 4GA0A 4UQZA 4U96D 2ETCA 2P9UG 1H0AA 3ZN3A 2I9CA 1IHBA 4ACLA 1INZA 2J09A 2FI7A 3UQ3A 2DZOA 3AAAC 1E96B 3FHEA 2EQXA 4XX5A 2A5UA 4MLPA 2JEKA 2ILRA 1IQUA 2V5FA 4ME2A 2P9NG 4BTBA 5EIBE 4JC8A 1D8EA 3R7QA 4KT6B 3DSVA 1MX6A 1DVPA 2L6BA 3J5PA 3I4RB 1XNFA 3UPVA 1G3NB 4M3OA 4BESA 2PQRA 1JCQA 5CHEE 5CBOA 1MZCA 4WNGA 1BI8B 1UJKA 3ULYA 4U95D 2PM6A 2V0PA 5B1AE 5LX8A 4EQFA 3APCA 2X6FA 4HVBA 1MHQA 3FH5A 3FY4A 5EKQD 2DZNA 4FADA 3CR3A 3HXDA 2WXGA 5KBAA 1TN8A 3LCAA 3CKCA 2QC9A 2AXVA 5FQ7A 2WXQA 4YDWA 4HORA 3MV3B 1HH8A 4GCNA 3IV0A 3E37A 3MEKA 2LAIA 4AP2A 2EIJE 4FJYA 2OCCE 2J07A 3KSLA 4UQXA 4J8YA 1ZBPA 4WAFA 3ZNGA 4GTQA 4FJZA 3QK0A 4DK5A 2XS8A 1FVHA 1TYQG 5M72A 1N4QA 4ANXA 3APDA 2Y3AA 4GMRA 3L9TA 5ENSD 3LY7A 3QB2A 3EU9A 4JEHA 3G2TA 3AG1E 3PDNA 1X81A 3G2VA 1NFIE 4CDRA 3PE4A 1KZOA 5JA4D 1X5BA 1W3BA 2KBXA 4KBQA 4G23A 1D8DA 5C1DA 4GTTA 2MOWA 1HU3A 1E7VA 1MX2A 1N54A 2ZGDA 3HG0D 1E7UA 3PS6A 4LEUA 2BF0X 3Q7AA 2J08A 2MYOA 4ANUA 3CK7A 4O60A 3TWWA 4F1SA 3BQOA 3DSXA 3BUAA 2CG3A 3C5RA 4G25A 3UM3A 1HO8A 3B13A 3CHOA 3EIQC 1K3ZD 3ZIMA 5KCMA 2XEHA 4Q96A 3SBSA 3L16A 1DNPA 1YCSB 5D0OD 1PY1A 3FTSA 4RG6A 4L7TA 4XKCA 3FTWA 2ZIRA 4JW1A 5EYPF 1S70B 4UI9K 4G11A 3RRMB 3FH7A 3QKYA 1OWPA 2WXRA 3PVLA 2IU1A 3FUMA 4LUNU 3CVWA 3RRUA 2PNNA 1FPPA 4HLEA 5T3RA 3SD5A 1O1RA 1OCOE 2RFAA 2WPVA 3L22A 2R59A 2KCLA 3TWQA 1RZ4A 4OVUA 3SNXA 3DSWA 3KD7A 1OWLA 1HE8A 3OAWA 1OT8A 2RD0A 2WXHA 1SZ9A 2UWJG 4A1GA 4B94A 2XPZA 5FQ4A 4DI3A 4JB8P 3KAEA 3GZ2A 2XENA 1LD8A 2WXPA 4AEZC 4FHJA 2GRPB 4GAAA 3GZ1A 1K1BA 4BSZB 2H6GA 3R9AB 3QWVA 4I6JA 2R5SA 5FINA 1RW2A 3RKVA 5AJDA 1Q2ZA 2Q7FA 2X6JA 2Y0BG 4ILHB 2BEDA 2PM7A 5BXOA 1Z3YA 3MJWA 3D9OA 4LERA 2VGXA 3R7RA 3QC1A 3WG7E 3CVNA 1QBQA 2WB2A 3CVXA 3S7JA 3SZ7A 3NOGD 2X6KA 5G2NA 1B89A 4DX5D 2CFUA 3CSTA 2WXLA 1JWGA 3MZLB 1KT1A 5JJ7A 5FTPA 4JPSA 2XEVA 4DX2A 2NC9A 2NSZA 3FTUA 3Q78A 4DX7D 2FF4A 3RU0A 3IXEA 4APFA 1UN8A 3AU4A 2VTBB 3ZYQA 4Q94A 4TUMA 3CHQA 4JHJA 3ZFWA 4I9EA 3CQGB 3SFXA 1OXJA 4HRMB 2QZAA 4NURA 5BPPA 2R03A 2I6HA 5H7PA 1PAQA 2FEZA 4ATZD 2KZTA 3ML8A 4GA1A 3ZXPA 3ZYLA 4WWNA 3LXUX 4D10C 4I1AA 1FT2A 2HO1A 3ULEG 3D9KA 3APFA 1MYOA 5DIZA 2DVWA 2MHKA 3UT4A 5FZQA 1K1AA 2ZGGA 4A3VA 3CGHA 3JXIA 2WXMA 4YVQC 2CHZA 2KCKA 2L0TB 3TG4A 4HOTA 1ZU2A 4GTVA 5LFAA 5ANRA 1U3CA 3MA5A 1JWFA 3ABLE 2XQ0A 2X6HA 3I3NA 4PUCA 3BU8A 2EIKE 2P58C 4KMOA 4GTSA 3FTVA 2UY1B 4HOUA 4HXIA 4NACA 5G04C 3TWSA 4JEUA 2OVFA 3B95A 3Q79A 4GZDA 1N9AA 2KC7A 1ZB1A 2HM8A 3ABKE 4JVSA 4EZKA 2XRYA 5KWDA 3PNTB 1LD7A 2OV8A 2CFZA 4BT9A 1S64A 3RO2A 2CHWA 3UIPC 5AQBA 2IOSA 1HG2A 4RG9A 1S0PA 4U8HA 3MYVA 2L6JA 2IF4A 5ENPD 1QQEA 3FTXA 3PZ2A 5B3SE 4JL0A 2Y4TA 1MJ0A 3CVQA 2WQ7A 3G2UA 3L08A 4CT0A 5CCLA 1MX4A 5KJNA 3RK6A
chains in the Genus database with same CATH topology
3DSSA 3DSXA 1O1TA 1SA4A 3Q7FA 2H6GA 3E37A 1TNYA 3PZ3A 2BEDA 3DSUA 4GTOA 1D8EA 1TNOA 1N4SA 3DSVA 3KSLA 2H6FA 4GTVA 1QBQA 3DSTA 1TN6A 3Q75A 4GTQA 2F0YA 3SFYA 4YDOA 3E34A 2ZIRA 3PZ1A 1JCRA 3E33A 3HXEA 4GTSA 3HXBA 4YDEA 2ZISA 3HXFA 1N4QA 4LNGA 1TNBA 1FT1A 1TNUA 3Q79A 1JCQA 3Q78A 1N9AA 4GTRA 1MZCA 1FPPA 1LD7A 1O1RA 3EUVA 1N95A 4GTPA 3KSQA 1S64A 2IEJA 2H6HA 3E30A 1S63A 1JCSA 1LTXA 1X81A 1KZOA 3SFXA 4EHMA 1NL4A 3DSWA 1D8DA 3E32A 3Q73A 3PZ4A 2H6IA 4GTTA 4GTMA 1O1SA 3HXCA 3EU5A 3PZ2A 1TN7A 3HXDA 1N4PA 3DPYA 1N4RA 1TN8A 4LNBA 2R2LA 3DRAA 4MBGA 1DCEA 3Q7AA 1SA5A 3C72A 1FT2A 1N94A 4L9PA 1TNZA 1LD8A 1O5MA 1KZPA 1NI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSS A;  3DSX A;  1O1T A;  1SA4 A;  3Q7F A;  2H6G A;  3E37 A;  1TNY A;  3PZ3 A;  2BED A;  3DSU A;  4GTO A;  1D8E A;  1TNO A;  1N4S A;  3DSV A;  3KSL A;  2H6F A;  4GTV A;  1QBQ A;  3DST A;  1TN6 A;  3Q75 A;  4GTQ A;  2F0Y A;  3SFY A;  4YDO A;  3E34 A;  2ZIR A;  3PZ1 A;  1JCR A;  3E33 A;  3HXE A;  4GTS A;  3HXB A;  4YDE A;  2ZIS A;  3HXF A;  1N4Q A;  4LNG A;  1TNB A;  1FT1 A;  1TNU A;  3Q79 A;  1JCQ A;  3Q78 A;  1N9A A;  4GTR A;  1MZC A;  1FPP A;  1LD7 A;  1O1R A;  3EUV A;  1N95 A;  4GTP A;  3KSQ A;  1S64 A;  2IEJ A;  2H6H A;  3E30 A;  1S63 A;  1JCS A;  1LTX A;  1X81 A;  1KZO A;  3SFX A;  4EHM A;  1NL4 A;  3DSW A;  1D8D A;  3E32 A;  3Q73 A;  3PZ4 A;  2H6I A;  4GTT A;  4GTM A;  1O1S A;  3HXC A;  3EU5 A;  3PZ2 A;  1TN7 A;  3HXD A;  1N4P A;  3DPY A;  1N4R A;  1TN8 A;  4LNB A;  2R2L A;  3DRA A;  4MBG A;  1DCE A;  3Q7A A;  1SA5 A;  3C72 A;  1FT2 A;  1N94 A;  4L9P A;  1TNZ A;  1LD8 A;  1O5M A;  1KZP A;  1NI1 A; 
#chains in the Genus database with same CATH topology
 3C98 A;  4LSZ E;  4ABN A;  4HBD A;  4J8F A;  1O1T A;  3AU5 A;  3AG3 E;  2GGF A;  3L54 A;  3SBT B;  3PEU B;  3AS5 A;  3ZW3 A;  3U9W A;  2F8Y A;  1N0R A;  4Y6W A;  3T5V A;  1IHG A;  2GW1 A;  1MQS A;  2OOE A;  3LVR E;  4N3B A;  5CED B;  2A5E A;  5BV1 A;  2QFC A;  4ILG A;  3FTY A;  1EDU A;  3TWT A;  3KEA A;  2KCV A;  3DXK G;  2V4H C;  4A55 A;  2WMN A;  2VGY A;  3NZS A;  5D66 A;  4CGW A;  3D9P A;  1E8W A;  3ZGQ A;  3RIB A;  2XHE A;  1UOH A;  2KM4 A;  4BET A;  2KAT A;  4B89 A;  2OVB A;  1N95 A;  5BUZ A;  5FT9 A;  4WND A;  4BX9 A;  1V55 E;  4AXH A;  3LJ3 A;  5AJL A;  2J8S D;  3T8K A;  4G8L A;  4UI9 C;  1O1S A;  3ASG A;  4J8E A;  1FVF A;  3S7F A;  4TRQ A;  3HXC A;  5JMN D;  5ENR D;  3TWR A;  1N4R A;  4PS7 A;  2C2L A;  4LNB A;  5J90 A;  1Z5S C;  2R2L A;  3FEX A;  4IYP A;  3O48 A;  2XGO A;  4WNF A;  1IXV A;  1Y8M A;  3JYS A;  4WWP A;  1TNZ A;  4WNE A;  2YHE A;  3AJI A;  3UIO C;  4ACK A;  2GRM A;  4LG6 A;  1Y6I A;  4U0Z A;  5G04 J;  4EEC A;  4LRZ A;  5BT1 A;  4HRL A;  3OXL A;  2LSV A;  3FU6 A;  3JXJ A;  1N4S A;  2HYZ A;  2H6F A;  3ZHE A;  2C0M A;  5T8I A;  5EID A;  3MV2 B;  2F0Y A;  3SFY A;  4XEI G;  3ZYK A;  3K9I A;  4U07 A;  4JHK A;  3TGO A;  3B7R L;  2FO1 E;  4U8V D;  4U8Y D;  4C0E A;  2ZIS A;  3CHS A;  2B6C A;  4XKB A;  3ONL A;  4LNG A;  4HI8 A;  3CVU A;  4KVO A;  1H6O A;  4AOF A;  5BXU A;  2NXP A;  4E85 A;  5KJM A;  4HOS A;  2LSU A;  4L2L A;  3PH0 C;  3Q49 B;  4M7C A;  4APO A;  4ZFH A;  3LDZ A;  4IRU A;  2R17 C;  4EHM A;  1E90 A;  5EN5 D;  2R02 A;  4HI9 A;  3UT7 A;  1E8X A;  3DWL G;  2AJA A;  3TXM A;  3Q9N C;  4DX6 D;  3QOU A;  5JJT A;  4BER A;  4HNA D;  3FFL A;  3QAQ A;  4B0Z A;  4MBG A;  3C72 A;  4QFV A;  3LEW A;  4AV7 A;  2IFU A;  3ESK A;  1NA3 A;  3FUJ A;  3NB2 A;  2P9P G;  3D9M A;  1HZ4 A;  2IQC A;  2QYJ A;  3Q7F A;  3B7B A;  5HKP A;  4GYY A;  4B93 B;  4OAV B;  4JZY A;  1N11 A;  3FU5 A;  3DST A;  4K0R A;  3OTN A;  3E34 A;  3PUK A;  4DLO A;  4DJA A;  3SF4 A;  2P9L G;  2VSX E;  1WM5 A;  4ILI A;  4UI9 J;  5HRY A;  4UWG A;  3HVE B;  4UUC A;  3UT8 A;  5IY5 E;  1TNU A;  3ZHE B;  3JUI A;  4DI4 A;  3JCK C;  4KZC A;  2X38 A;  2VYI A;  2MRI A;  4GTP A;  3KSQ A;  2VTB A;  3E30 A;  4MRU A;  4XE0 A;  4KZ0 A;  3ZU7 B;  3RJV A;  5CRV A;  1Z6T A;  4AVX A;  1U2V G;  2J49 A;  3U66 A;  4KYO B;  3IHY A;  2WXF A;  2RKK A;  1ELK A;  4JXT A;  1NI1 A;  4FLB A;  4CRW A;  2WXO A;  2J9Q A;  5FIO A;  5C2Y A;  3FUE A;  4AY6 A;  2L0I A;  5BW8 C;  2XPY A;  3TWU A;  4N3A A;  4L1B A;  3VLE A;  3O4Z A;  3J5Q B;  3QNK A;  5ARF A;  4J8S A;  3FUL A;  1YMP A;  2BUG A;  4YDO A;  3S7D A;  3LPZ A;  3E33 A;  3HXB A;  5EX0 A;  1P5Q A;  2UY1 A;  3ZUV B;  1OWM A;  4JHR A;  3PRZ A;  4L23 A;  4GYW A;  5HQ8 A;  5KJK A;  3MKR A;  3C3R A;  4IN3 B;  3FEY A;  5EIL A;  4TUU A;  3BG1 B;  1ELW A;  3EHQ A;  4UWH A;  1WAO 1;  1JUQ A;  4OYS A;  1S63 A;  3L13 A;  3Q4A B;  4N5Q A;  4F7A A;  1YYH A;  4LCT A;  3QDN A;  4PDX A;  4R7L A;  2JAB A;  2XPI A;  3V2X A;  3T8M A;  5E76 A;  4Y6C A;  4AJW A;  3HRA A;  4GMJ A;  4W9R A;  4PS3 A;  3PEV B;  5JJ6 A;  3R9M A;  3AS8 A;  2X3M A;  4BX8 A;  2JLB A;  3FUD A;  4V3I A;  2KXP C;  3C3Q A;  4HQD A;  3RO3 A;  1O5M A;  4GU5 A;  4XZ4 A;  1BLX B;  5LCW J;  3CSF A;  1ELR A;  3DEO A;  4JA7 A;  4CGV A;  3CK8 A;  3W9F A;  3TWX A;  1A17 A;  2XCB A;  4Z68 A;  4TXP A;  2WM9 A;  3EHR A;  2Y69 E;  4X8Q A;  3DSU A;  3FTZ A;  4GTO A;  2YNQ A;  4GCO A;  4URK A;  1TEZ A;  5A7D B;  2LNI A;  4CZ2 D;  3UKR G;  1OY3 D;  3D9J A;  3AG4 E;  5G05 J;  4GPK A;  1L5J A;  3V79 K;  3NAW A;  5CEC B;  5D0Q D;  3MCX A;  3U3W A;  3FWV A;  3HXE A;  5ANL A;  2PZI A;  4XI9 A;  4K03 A;  3G2W A;  2CHX A;  3UMV A;  4I9C A;  3SI5 A;  4TXQ A;  3PRE A;  2PQN A;  4DLQ A;  3B7U X;  4RSY A;  4FP7 A;  3CKB A;  2AXU A;  4I6G A;  2LO6 A;  4ZHB A;  2XZD G;  4FUL A;  4O6F A;  3L17 A;  5EX3 A;  3V2O A;  4GZ5 A;  4G24 A;  2XRZ A;  1HXI A;  1WDY A;  3ZEF A;  3PZ4 A;  4GTM A;  5LP0 A;  2WMO A;  1VDY A;  2VSO E;  5CRU A;  5ENT D;  2V5Q C;  5ITZ F;  1N4P A;  3LVQ E;  2FBN A;  5JHA A;  2DCP A;  4F53 A;  3SGH A;  2OND A;  3GYZ A;  4IUL A;  2ION A;  2XEE A;  1DCQ A;  1N94 A;  3UI2 A;  4CDM A;  4N5C A;  2OEV A;  3SO8 A;  3HYM B;  4O1O A;  4ANV A;  1BI7 B;  1K8K G;  1OCR E;  2IO2 C;  3UIN C;  1HFA A;  4CCA A;  4AY5 A;  3ESL A;  3PZ3 A;  1IQR A;  3NF1 A;  3FUI A;  1JPL A;  3B7S A;  3DEP A;  3KEZ A;  3Q9U C;  5ENN A;  4K5A B;  5ENO D;  3LJN A;  3C3O A;  3OXG A;  4FLH A;  3CIA A;  2VQ2 A;  4KVM A;  2WVI A;  4U0S A;  4CDN A;  2P9S G;  4GTR A;  2AW6 A;  5DBK A;  5FZS A;  2WXJ A;  2IEJ A;  3ISM C;  2DYR E;  1LTX A;  3CVL A;  3ASD A;  1EPU A;  3WXX A;  3E32 A;  4A1S A;  3N71 A;  5CER B;  1WY6 A;  2H6I A;  3LY9 A;  3NBN B;  2L9B A;  2CG2 A;  3UM0 A;  2IO3 C;  1H2T C;  2FO7 A;  3ZVV A;  3DPY A;  5AEN A;  4YVO A;  3FU0 A;  4PS8 A;  3ZYM A;  3HDX A;  5FWQ A;  2F8X K;  2GRR B;  1GW6 A;  1H2V C;  5JHB A;  5J08 A;  5FQ8 A;  3NOC D;  3CQC B;  1UN9 A;  2VSY A;  3IHV A;  4K5B A;  2RG8 A;  4ANW A;  3MGB A;  3RAU A;  4HOQ A;  2VGE A;  2X6I A;  3AG2 E;  2IJG X;  3PE3 A;  4L2Y A;  1H19 A;  3LKU A;  3PUJ A;  2E2E A;  2V4L A;  5BV0 A;  4F6R D;  2YHC A;  1N0Q A;  4FC8 A;  1SVX A;  5CMW A;  3TWV A;  2VSN A;  1QZ2 A;  3L6A A;  5KJL A;  2DYS E;  4XIF A;  4I17 A;  2WXN A;  3D3M A;  3W9G A;  3HVE A;  3VTX A;  2EIM E;  3TL5 A;  3URZ A;  4C9B B;  5AQ9 A;  4P29 A;  2ETB A;  1BU9 A;  3CV0 A;  2H6H A;  5A23 A;  4FA6 A;  1U3D A;  4EPZ A;  1KLX A;  4HFG A;  1NL4 A;  2RFM A;  3ZPJ A;  5FZR A;  4BY6 A;  4UWK A;  4UWL A;  4OAU C;  3HIZ A;  3ASH A;  3U4T A;  4PH4 B;  3IBE A;  4EZL A;  3PNL B;  4A3T A;  3DXM G;  1E8Y A;  1OWO A;  3DRA A;  3CVV A;  5KNG A;  1SA5 A;  1BD8 A;  4L9P A;  5ENQ D;  4WWO A;  3SY2 A;  1H2U A;  1KZP A;  4I6E A;  4F1P A;  2QYU A;  4U04 A;  2YQ8 A;  4UWF A;  3I5P A;  3UUX A;  4ATG A;  5D2M C;  1N52 A;  3UX4 A;  1OCZ E;  4MKT A;  3IKO B;  3CK9 A;  1NP7 A;  3ABM E;  3EHM A;  5CEA A;  1TN6 A;  3UKU G;  3Q75 A;  4N2Q A;  4RVB A;  3ZKJ A;  2GRN B;  5ARG A;  2WQ6 A;  2XGS A;  4GML A;  4Q69 A;  4FHK A;  2XCC A;  3D9H A;  2NYJ A;  4UQY A;  4BSX A;  3ML9 A;  2P2C P;  3EDT B;  2DWZ A;  5BNW A;  4J8D A;  2LUH A;  5LCW C;  3FDH A;  5G55 A;  1JCS A;  1UW4 B;  3QWP A;  3F6Q A;  3LY8 A;  4AM9 A;  2BKG A;  3Q5M A;  3ONK A;  4CEM A;  3FUK A;  3FUH A;  3FP3 A;  1KT0 A;  3CHP A;  4HRN A;  5LOZ A;  4EBA A;  2VJ8 A;  4EBA G;  5AYW D;  2LAH A;  3ZRH A;  1SZA A;  2I1K A;  5T4Y A;  4LNU D;  5G05 C;  1PC2 A;  2XGM A;  1HF8 A;  4G8K A;  2ETA A;  3S2A A;  3UXG A;  3CHM A;  4I2Z A;  4CYM D;  2LXM A;  3TXN A;  4NQ0 A;  3BEE A;  1SW6 A;  1WG0 A;  1LF8 A;  2Y1L E;  4O1P A;  3V31 A;  1Z3X A;  1D9S A;  2GRO B;  4HB5 A;  4RQI A;  1TNO A;  1H6P A;  1KPS B;  4GZ3 A;  4U63 A;  4TV3 A;  5B1B E;  3JUE A;  3QAR A;  4HLL A;  5AQ7 A;  2ZXW E;  3U64 A;  1EF1 C;  3P2B A;  2J4D A;  3CHR A;  3SHF A;  4G1T A;  4U7E B;  3TAX A;  4A63 B;  3L82 A;  1UG3 A;  4GZC A;  1XGW A;  1QYM A;  3S7B A;  4QQI A;  2LXL A;  5EDS A;  1IKN D;  3D9N A;  3UM1 A;  3QWW A;  1H6K A;  4AIF A;  2J4B A;  3E4B A;  2DBA A;  2C0L A;  2HE0 A;  3ASO E;  4E6H A;  3CLJ A;  3FH8 A;  1HX8 A;  2I1J A;  1TN7 A;  1TJF A;  3G2S A;  1SQM A;  2IY0 C;  1DCE A;  4NIK A;  4U0U A;  3UM2 A;  4CT4 A;  3SFZ A;  3D9I A;  3DSS A;  4YND A;  1AWC B;  3AS4 A;  1YA0 A;  1SA4 A;  4DPR A;  2R05 A;  4GPM A;  4I2W A;  1AP7 A;  1TNY A;  2M63 A;  4I1M A;  2ZU6 B;  3ASF A;  3VLF A;  4KXK B;  4J0U A;  3RRN B;  4B8C B;  3DBS A;  1OCC E;  2FUL A;  3EHN A;  3Q15 A;  3TJP A;  5CCM A;  3FUF A;  4G2V A;  1JCR A;  2OEW A;  2GRL A;  4BFR A;  5HI7 A;  4J6I A;  3NZU A;  4YDE A;  3NQP A;  2F37 A;  3ZXS A;  3HXF A;  5CMY A;  2A4Z A;  4WUY A;  1TNB A;  5AN8 A;  1FT1 A;  2EIL E;  3MKQ A;  4DRX E;  2XZT G;  4I1O B;  4J7W A;  5E75 A;  3FU3 A;  3VLD A;  2P9I G;  2AWI A;  3IEG A;  2E0I A;  1IYG A;  1EYH A;  4TXR A;  4GZ6 A;  1A5E A;  1NZN A;  3TG5 A;  5A6C A;  4JA9 A;  2QY7 A;  2V8S E;  3KS2 A;  5FQ6 A;  3Q73 A;  2PL2 A;  2HR2 A;  5HS0 A;  3MX3 A;  3CEQ A;  3PZD A;  4RLY A;  2EIN E;  1OUV A;  2WXI A;  3V30 A;  2IOL A;  4N39 A;  1DC2 A;  2XS1 A;  5AAO A;  1FCH A;  4N3C A;  4XI0 A;  4GB9 A;  2GRQ B;  1HG5 A;  4B8A A;  3D9L A;  3LS8 A;  4MS6 A;  5EYL A;  4GYO A;  3OXF A;  4H7X A;  3UTM A;  4BTA A;  2DIW A;  5CBN A;  4DX1 A;  3SQV A;  3GW4 A;  1V54 E;  3T9K A;  4BT8 A;  4GA2 A;  3CVP A;  3LYA A;  1QNF A;  4K5C A;  2YIN A;  2AVP A;  3EJN A;  3DPD A;  2I2O A;  2AXZ A;  2P9K G;  4YDY A;  4DUI A;  3CVY A;  2BKK B;  2VGX B;  3JQ0 A;  3T5X A;  1OWN A;  3GZS A;  4I43 A;  3PZ1 A;  4H7Y A;  4BWR A;  4G26 A;  5AQA A;  3RSE G;  3Q47 B;  5AAR A;  2Y4U A;  4C0M A;  1NA0 A;  3X2Q E;  4EZJ A;  1TJC A;  4JD2 G;  3HHM A;  3B7T A;  5KNH D;  4C48 B;  3I4G A;  2BTD A;  3ULQ A;  3EIJ A;  2WXK A;  3EUV A;  5AIJ A;  4HS2 A;  3ENE A;  1E8Z A;  1TR4 A;  2B0O E;  3JQ1 A;  4N2S A;  4OVV A;  3P1U A;  4NRH B;  4F3V A;  1UJJ A;  3FUN A;  3QJZ A;  3MKQ B;  2WQH A;  3EU5 A;  3VTY A;  4FU3 A;  5FJY A;  2KZT B;  1BPO A;  1HS6 A;  3ASN E;  4BEP A;  3BG0 B;  4GA0 A;  4UQZ A;  4U96 D;  2ETC A;  2P9U G;  1H0A A;  3ZN3 A;  2I9C A;  1IHB A;  4ACL A;  1INZ A;  2J09 A;  2FI7 A;  3UQ3 A;  2DZO A;  3AAA C;  1E96 B;  3FHE A;  2EQX A;  4XX5 A;  2A5U A;  4MLP A;  2JEK A;  2ILR A;  1IQU A;  2V5F A;  4ME2 A;  2P9N G;  4BTB A;  5EIB E;  4JC8 A;  1D8E A;  3R7Q A;  4KT6 B;  3DSV A;  1MX6 A;  1DVP A;  2L6B A;  3J5P A;  3I4R B;  1XNF A;  3UPV A;  1G3N B;  4M3O A;  4BES A;  2PQR A;  1JCQ A;  5CHE E;  5CBO A;  1MZC A;  4WNG A;  1BI8 B;  1UJK A;  3ULY A;  4U95 D;  2PM6 A;  2V0P A;  5B1A E;  5LX8 A;  4EQF A;  3APC A;  2X6F A;  4HVB A;  1MHQ A;  3FH5 A;  3FY4 A;  5EKQ D;  2DZN A;  4FAD A;  3CR3 A;  3HXD A;  2WXG A;  5KBA A;  1TN8 A;  3LCA A;  3CKC A;  2QC9 A;  2AXV A;  5FQ7 A;  2WXQ A;  4YDW A;  4HOR A;  3MV3 B;  1HH8 A;  4GCN A;  3IV0 A;  3E37 A;  3MEK A;  2LAI A;  4AP2 A;  2EIJ E;  4FJY A;  2OCC E;  2J07 A;  3KSL A;  4UQX A;  4J8Y A;  1ZBP A;  4WAF A;  3ZNG A;  4GTQ A;  4FJZ A;  3QK0 A;  4DK5 A;  2XS8 A;  1FVH A;  1TYQ G;  5M72 A;  1N4Q A;  4ANX A;  3APD A;  2Y3A A;  4GMR A;  3L9T A;  5ENS D;  3LY7 A;  3QB2 A;  3EU9 A;  4JEH A;  3G2T A;  3AG1 E;  3PDN A;  1X81 A;  3G2V A;  1NFI E;  4CDR A;  3PE4 A;  1KZO A;  5JA4 D;  1X5B A;  1W3B A;  2KBX A;  4KBQ A;  4G23 A;  1D8D A;  5C1D A;  4GTT A;  2MOW A;  1HU3 A;  1E7V A;  1MX2 A;  1N54 A;  2ZGD A;  3HG0 D;  1E7U A;  3PS6 A;  4LEU A;  2BF0 X;  3Q7A A;  2J08 A;  2MYO A;  4ANU A;  3CK7 A;  4O60 A;  3TWW A;  4F1S A;  3BQO A;  3DSX A;  3BUA A;  2CG3 A;  3C5R A;  4G25 A;  3UM3 A;  1HO8 A;  3B13 A;  3CHO A;  3EIQ C;  1K3Z D;  3ZIM A;  5KCM A;  2XEH A;  4Q96 A;  3SBS A;  3L16 A;  1DNP A;  1YCS B;  5D0O D;  1PY1 A;  3FTS A;  4RG6 A;  4L7T A;  4XKC A;  3FTW A;  2ZIR A;  4JW1 A;  5EYP F;  1S70 B;  4UI9 K;  4G11 A;  3RRM B;  3FH7 A;  3QKY A;  1OWP A;  2WXR A;  3PVL A;  2IU1 A;  3FUM A;  4LUN U;  3CVW A;  3RRU A;  2PNN A;  1FPP A;  4HLE A;  5T3R A;  3SD5 A;  1O1R A;  1OCO E;  2RFA A;  2WPV A;  3L22 A;  2R59 A;  2KCL A;  3TWQ A;  1RZ4 A;  4OVU A;  3SNX A;  3DSW A;  3KD7 A;  1OWL A;  1HE8 A;  3OAW A;  1OT8 A;  2RD0 A;  2WXH A;  1SZ9 A;  2UWJ G;  4A1G A;  4B94 A;  2XPZ A;  5FQ4 A;  4DI3 A;  4JB8 P;  3KAE A;  3GZ2 A;  2XEN A;  1LD8 A;  2WXP A;  4AEZ C;  4FHJ A;  2GRP B;  4GAA A;  3GZ1 A;  1K1B A;  4BSZ B;  2H6G A;  3R9A B;  3QWV A;  4I6J A;  2R5S A;  5FIN A;  1RW2 A;  3RKV A;  5AJD A;  1Q2Z A;  2Q7F A;  2X6J A;  2Y0B G;  4ILH B;  2BED A;  2PM7 A;  5BXO A;  1Z3Y A;  3MJW A;  3D9O A;  4LER A;  2VGX A;  3R7R A;  3QC1 A;  3WG7 E;  3CVN A;  1QBQ A;  2WB2 A;  3CVX A;  3S7J A;  3SZ7 A;  3NOG D;  2X6K A;  5G2N A;  1B89 A;  4DX5 D;  2CFU A;  3CST A;  2WXL A;  1JWG A;  3MZL B;  1KT1 A;  5JJ7 A;  5FTP A;  4JPS A;  2XEV A;  4DX2 A;  2NC9 A;  2NSZ A;  3FTU A;  3Q78 A;  4DX7 D;  2FF4 A;  3RU0 A;  3IXE A;  4APF A;  1UN8 A;  3AU4 A;  2VTB B;  3ZYQ A;  4Q94 A;  4TUM A;  3CHQ A;  4JHJ A;  3ZFW A;  4I9E A;  3CQG B;  3SFX A;  1OXJ A;  4HRM B;  2QZA A;  4NUR A;  5BPP A;  2R03 A;  2I6H A;  5H7P A;  1PAQ A;  2FEZ A;  4ATZ D;  2KZT A;  3ML8 A;  4GA1 A;  3ZXP A;  3ZYL A;  4WWN A;  3LXU X;  4D10 C;  4I1A A;  1FT2 A;  2HO1 A;  3ULE G;  3D9K A;  3APF A;  1MYO A;  5DIZ A;  2DVW A;  2MHK A;  3UT4 A;  5FZQ A;  1K1A A;  2ZGG A;  4A3V A;  3CGH A;  3JXI A;  2WXM A;  4YVQ C;  2CHZ A;  2KCK A;  2L0T B;  3TG4 A;  4HOT A;  1ZU2 A;  4GTV A;  5LFA A;  5ANR A;  1U3C A;  3MA5 A;  1JWF A;  3ABL E;  2XQ0 A;  2X6H A;  3I3N A;  4PUC A;  3BU8 A;  2EIK E;  2P58 C;  4KMO A;  4GTS A;  3FTV A;  2UY1 B;  4HOU A;  4HXI A;  4NAC A;  5G04 C;  3TWS A;  4JEU A;  2OVF A;  3B95 A;  3Q79 A;  4GZD A;  1N9A A;  2KC7 A;  1ZB1 A;  2HM8 A;  3ABK E;  4JVS A;  4EZK A;  2XRY A;  5KWD A;  3PNT B;  1LD7 A;  2OV8 A;  2CFZ A;  4BT9 A;  1S64 A;  3RO2 A;  2CHW A;  3UIP C;  5AQB A;  2IOS A;  1HG2 A;  4RG9 A;  1S0P A;  4U8H A;  3MYV A;  2L6J A;  2IF4 A;  5ENP D;  1QQE A;  3FTX A;  3PZ2 A;  5B3S E;  4JL0 A;  2Y4T A;  1MJ0 A;  3CVQ A;  2WQ7 A;  3G2U A;  3L08 A;  4CT0 A;  5CCL A;  1MX4 A;  5KJN A;  3RK6 A; 
#chains in the Genus database with same CATH homology
 3DSS A;  3DSX A;  1O1T A;  1SA4 A;  3Q7F A;  2H6G A;  3E37 A;  1TNY A;  3PZ3 A;  2BED A;  3DSU A;  4GTO A;  1D8E A;  1TNO A;  1N4S A;  3DSV A;  3KSL A;  2H6F A;  4GTV A;  1QBQ A;  3DST A;  1TN6 A;  3Q75 A;  4GTQ A;  2F0Y A;  3SFY A;  4YDO A;  3E34 A;  2ZIR A;  3PZ1 A;  1JCR A;  3E33 A;  3HXE A;  4GTS A;  3HXB A;  4YDE A;  2ZIS A;  3HXF A;  1N4Q A;  4LNG A;  1TNB A;  1FT1 A;  1TNU A;  3Q79 A;  1JCQ A;  3Q78 A;  1N9A A;  4GTR A;  1MZC A;  1FPP A;  1LD7 A;  1O1R A;  3EUV A;  1N95 A;  4GTP A;  3KSQ A;  1S64 A;  2IEJ A;  2H6H A;  3E30 A;  1S63 A;  1JCS A;  1LTX A;  1X81 A;  1KZO A;  3SFX A;  4EHM A;  1NL4 A;  3DSW A;  1D8D A;  3E32 A;  3Q73 A;  3PZ4 A;  2H6I A;  4GTT A;  4GTM A;  1O1S A;  3HXC A;  3EU5 A;  3PZ2 A;  1TN7 A;  3HXD A;  1N4P A;  3DPY A;  1N4R A;  1TN8 A;  4LNB A;  2R2L A;  3DRA A;  4MBG A;  1DCE A;  3Q7A A;  1SA5 A;  3C72 A;  1FT2 A;  1N94 A;  4L9P A;  1TNZ A;  1LD8 A;  1O5M A;  1KZP A;  1NI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...