3V79K

Structure of human notch1 transcription complex including csl, ram, ank, and maml-1 on hes-1 promoter dna sequence
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
237
structure length
218
Chain Sequence
TPLMIASCSAVISDFIYSLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYNLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational Locking upon Cooperative Assembly of Notch Transcription Complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Neurogenic locus notch homolog protein 1
total genus 64
structure length 218
sequence length 237
ec nomenclature
pdb deposition date 2011-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00023 Ank Ankyrin repeat
K PF12796 Ank_2 Ankyrin repeats (3 copies)
K PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3v79K00
5ITZF 3T8KA 3V31A 1MX6A 2DWZA 2F37A 3ZU7B 4NIKA 5FINA 3TWSA 2Y0BG 3W9FA 3B95A 1MX4A 3SO8A 2VGEA 2XENA 4K5BA 5CEDB 1A5EA 3TWUA 1N0QA 1MJ0A 4OAUC 3V30A 3TWXA 2ZGGA 4DUIA 4F1PA 3NBNB 4HI9A 2V4HC 3TWVA 2BKGA 2XEHA 4J8YA 4YDYA 3V2XA 5EN5D 3UI2A 1OT8A 4DRXE 5AQ7A 2JABA 4BEPA 3DEPA 4RLYA 2XZTG 5KWDA 3ZNGA 1YCSB 3HRAA 2A5EA 4HBDA 1DCQA 2ETCA 1UOHA 5EYLA 4HRNA 3TWTA 5D66A 4G8KA 4YDWA 5JMND 3V79K 3NOCD 3NOGD 4OAVB 3B7BA 4JB8P 2F8YA 1NFIE 1BLXB 3AJIA 3C5RA 4CYMD 2QYJA 3Q9NC 2HE0A 5ENPD 5AQ9A 5EIBE 4BESA 4O1OA 4ZHBA 3HG0D 1YYHA 4DX5D 2V5QC 1YMPA 5CBNA 3D9HA 4HQDA 5HRYA 1BU9A 1BD8A 1S70B 2RFAA 3JXJA 2J8SD 4F6RD 2PNNA 5KNHD 2QC9A 1K3ZD 1G3NB 4QQIA 4HB5A 4U8VD 2FO1E 3KEAA 1IKND 5CEAA 2BKKB 3UXGA 3Q9UC 4TUMA 4QFVA 2XZDG 4B93B 1MX2A 1BI8B 1AWCB 2KXPC 1BI7B 1IXVA 4BERA 1SW6A 5ENSD 4HRLA 2KBXA 4O60A 1N11A 4GPMA 1IHBA 4J7WA 5KNGA 1K1AA 1WG0A 1MYOA 3JXIA 1SVXA 1N0RA 2DVWA 2ETAA 2ETBA 2L6BA 2XEEA 2ZGDA 1K1BA 5ENQD 4CZ2D 4Z68A 4K5AB 4LG6A 4LSZE 5AQBA 4GMRA 4HI8A 4K5CA 3UTMA 3T9KA 5ENRD 3ZUVB 5HS0A 3W9GA 4N5QA 1TR4A 4U96D 5AARA 5JA4D 3TWRA 5AAOA 5ENOD 4HRMB 4DX7D 3EHRA 4UUCA 4O1PA 3J5QB 3IXEA 5AQAA 2RFMA 4A63B 3ZKJA 4HLLA 4HNAD 5BXUA 3EHQA 4U95D 3TWQA 2DZNA 5CBOA 4ATZD 4LNUD 2MYOA 5BXOA 3F6QA 4BSZB 2Y1LE 3TWWA 4ZFHA 5EYPF 3AAAC 4BETA 5EIDA 4DX2A 1OY3D 2DZOA 4U8YD 2B0OE 3J5PA 5FIOA 2NYJA 5KBAA 3V2OA 4DX1A 1AP7A 3LJNA 4DX6D 5AN8A 2P2CP 1D9SA 1WDYA 3EU9A 5EILA 2F8XK 3JUEA 5HKPA 2AJAA 4G8LA 5ENTD 5CECB 1DC2A 3DEOA 4C48B 5CERB 1QYMA
chains in the Genus database with same CATH superfamily
3ZRHA 1UJKA 4U63A 4C9BB 1EF1C 1HX8A 3SO8A 3KSQA 4ATGA 4KMOA 4YVOA 3JUIA 4RLYA 1HG5A 2L0IA 3TWTA 3AG3E 2GRPB 4KT6B 3FY4A 2R05A 2XHEA 3QDNA 2BF0X 2J4DA 2VJ8A 3TJPA 1TN7A 5A23A 2PNNA 4QQIA 4AJWA 1HE8A 4M3OA 3HXCA 3SFZA 3DPDA 4OVUA 2J4BA 3FUKA 1IQUA 4HRLA 1D8DA 3E32A 3ULQA 3TGOA 1PC2A 4HI8A 3UTMA 5HS0A 4HRMB 4D10C 2VTBB 5JJTA 3ZEFA 3O4ZA 3FUMA 5BUZA 1TNYA 1JCSA 5BXOA 3MZLB 4XKBA 1O5MA 2LAIA 4DK5A 3B7TA 3G2SA 4B94A 3TG5A 2NSZA 3EU9A 4BX8A 4UI9J 4O6FA 3ABLE 4ME2A 1SA4A 3TWSA 3DXMG 1A5EA 3MA5A 4WUYA 1V54E 3GZSA 2DCPA 3KAEA 3DWLG 4YDYA 2DBAA 1OT8A 4DRXE 3TAXA 4HBDA 4ILHB 1OWLA 4MRUA 4N2SA 4G8KA 5JMND 3NOCD 2UWJG 3SHFA 1HFAA 2WXKA 3D9HA 5ANLA 3LEWA 4GPKA 1FVHA 2WXQA 4HB5A 2PQRA 4CDRA 3KEAA 2IEJA 2GRNB 5FQ7A 4TXRA 4GTSA 4B93B 4R7LA 1OCCE 4BX9A 3CVQA 3ZW3A 4WNDA 4JL0A 1H2VC 2E2EA 1HF8A 1H2TC 4FU3A 3AG1E 4A55A 4KBQA 4LUNU 3LCAA 1E8YA 3J5QB 3PNLB 3Q79A 5AQAA 3WXXA 1TNBA 2GRLA 1ELKA 4B0ZA 2VGYA 3RRNB 3UM3A 4FP7A 4XKCA 5FIOA 1NL4A 1L5JA 3JCKC 4Y6CA 4U7EB 2GROB 3D9LA 4ILIA 3G2UA 4G8LA 2CHXA 1DC2A 5AJDA 1N54A 2RD0A 1U3DA 3R7RA 4AIFA 3TWUA 4Q69A 3GZ1A 4J8YA 3PZ3A 5B1BE 4URKA 3ISMC 1KZOA 2JABA 2QY7A 2LXLA 4MKTA 4I17A 3MKRA 4FHJA 3NOGD 3E37A 3HXBA 4AY5A 4XX5A 4DX5D 2JLBA 2AXZA 2XEVA 4PH4B 3TL5A 2X6HA 3CHRA 5B1AE 3UUXA 5FZRA 3FU5A 1HH8A 3ULYA 4RQIA 3ZYLA 4HLEA 2DYRE 1AWCB 3CVPA 1DVPA 4O60A 5KNGA 1MYOA 3E33A 5EDSA 3FUHA 4JA7A 4K5CA 4U96D 4TXQA 2WQ6A 4FHKA 4U0SA 5M72A 4KZCA 4HNAD 1EYHA 3PEUB 3VTXA 4JEUA 3BU8A 1S63A 3F6QA 3ABKE 2B0OE 4AOFA 4JC8A 4IYPA 3CHOA 3DSUA 3FH8A 4NIKA 2R17C 2GRMA 1HS6A 1U2VG 3HVEA 3MV2B 4F1PA 3DSWA 4HOQA 2BKGA 2XS8A 4WWOA 2ZU6B 3FHEA 3PS6A 3DEPA 3B7RL 3K9IA 3PUJA 3Q49B 3FTUA 2PZIA 3MJWA 3MX3A 1BLXB 2HYZA 1KZPA 1FPPA 1NP7A 3VLEA 1TNOA 4GMLA 1BD8A 2YHEA 3OTNA 1HG2A 1G3NB 3SQVA 4KYOB 4QFVA 5G2NA 1BI8B 1UN8A 2WXLA 2V4LA 2FBNA 2VYIA 2KBXA 1PY1A 2ZGDA 5ENQD 2KCVA 4LSZE 3S7BA 2VGXB 3PNTB 4J8EA 4BT9A 4EPZA 4C0EA 2J08A 1JCQA 3OXLA 4U07A 3CQCB 2KATA 3FTVA 4ANXA 4E6HA 4B8AA 2V8SE 5G04J 3E4BA 3QK0A 1H6OA 1LD7A 1JCRA 1K8KG 4F7AA 1INZA 2EQXA 1WAO1 3LYAA 4G1TA 2A5UA 5LCWJ 2VGEA 5ENNA 2P9NG 1V55E 2V4HC 2CFZA 3V2XA 3CEQA 2WXNA 4PS3A 4HRNA 2UY1B 3B7BA 2QYJA 3MKQA 2V0PA 5BW8C 4PUCA 5LOZA 4YVQC 1RW2A 3VLFA 4GA1A 4EBAA 3SBSA 1FT1A 4F6RD 1K3ZD 3QWPA 3UXGA 2YNQA 3QKYA 3U64A 4APOA 3CIAA 4LEUA 3SGHA 2L6BA 3PH0C 3JQ1A 1QQEA 5C2YA 2X3MA 2WQHA 3EDTB 4GYWA 4GZ5A 1JWGA 5AARA 3ZPJA 5ENOD 5BNWA 3IXEA 2OEWA 3EHQA 2YINA 3Q7FA 3T8MA 3BQOA 5LP0A 3I5PA 1X81A 4GA2A 4U8HA 1B89A 3I4GA 4DX6D 5AN8A 4H7XA 1D8EA 2F8XK 2OVFA 4GTVA 4UI9C 2FF4A 1QNFA 2XRZA 5AJLA 3UKRG 1YA0A 3LVRE 3PVLA 2VSNA 2LSUA 1TN6A 4GCOA 4WWNA 3NBNB 4HI9A 3ML8A 4ANVA 3LY9A 3HRAA 3LS8A 3ML9A 2J9QA 3PRZA 2F8YA 3CVNA 5FQ6A 2WXIA 1H19A 3ZHEA 5FZSA 3CVWA 5CBNA 3R9MA 5J90A 3SFYA 3R7QA 1S70B 2ILRA 3SFXA 3UIOC 2VSXE 4U0ZA 4J8DA 5CEAA 3WG7E 1H0AA 4IULA 2I9CA 4GYOA 4HFGA 1S64A 4N5CA 2WXRA 3L9TA 1N11A 1Y6IA 1K1AA 4DJAA 2XEEA 4APFA 4GYYA 4K5AB 5KJNA 3CVYA 2C0MA 1TR4A 3QNKA 1Z3YA 3CK9A 4DX7D 1FCHA 3FDHA 3DSSA 3MEKA 1OXJA 3S7JA 4CT4A 3FTZA 3C3QA 1S0PA 3MKQB 1OUVA 3TG4A 2B6CA 4CDMA 4NACA 2IF4A 3ZVVA 1NI1A 1Y8MA 4UWKA 4U0UA 5G55A 2X6IA 4G25A 4JPSA 5CERB 1QYMA 3Q78A 2Y4TA 2FULA 5FINA 4F1SA 3DSTA 2XGOA 4OAUC 3V30A 2IONA 2LSVA 3EJNA 2XZTG 3U4TA 3CHMA 1E8XA 4N2QA 3DBSA 3DSVA 3IV0A 1WY6A 5CHEE 4Y6WA 3U9WA 2A4ZA 4CGWA 3AG2E 1NA3A 3Q9NC 3RKVA 1UW4B 3HG0D 3UM1A 3RSEG 3I4RB 1IYGA 2KM4A 3LY7A 2DIWA 2WXMA 3ZFWA 1HO8A 4HXIA 3T5VA 4GZCA 2OVBA 4L9PA 3Q47B 1TJCA 2IO2C 2IU1A 3L16A 4XEIG 2KZTB 5LFAA 1BI7B 4JHKA 5BT1A 4KVMA 2WXOA 3ASGA 2YHCA 1W3BA 4G11A 1BPOA 1EPUA 3PZ1A 4IRUA 3MGBA 3L54A 3PZDA 4L2LA 3RO2A 4P29A 3FU0A 3QWWA 4A63B 3HXDA 4HLLA 3B7UX 2I1KA 2XPIA 3UMVA 4FLHA 2OOEA 1RZ4A 1SQMA 5EIDA 1OY3D 2J49A 2VTBA 5HQ8A 1UG3A 1DNPA 5KBAA 4DX1A 3CSFA 4XZ4A 3UQ3A 3AU5A 5C1DA 4FJYA 5E75A 5IY5E 4ACKA 4AVXA 4I1MA 1N95A 5G05C 4DPRA 3W9FA 2VSOE 4JHJA 3SZ7A 5JHBA 2XRYA 4GZ6A 4NRHB 3HXFA 3CK8A 4GTOA 1OCOE 2OCCE 2X38A 1HXIA 2WM9A 3NF1A 3RK6A 2ONDA 4OAVB 4LCTA 4GA0A 2C2LA 2NC9A 3PREA 4YNDA 3APCA 4N3CA 3NB2A 2LO6A 1KT0A 1E7VA 5ARGA 2F0YA 1DCEA 2FO1E 4I6GA 2CHZA 2R59A 3C72A 4XE0A 2OEVA 1ZBPA 2XCCA 4U04A 3CKBA 1QBQA 3Q75A 3CV0A 1OWOA 3HHMA 3TWRA 3LPZA 2L9BA 4AM9A 3ZKJA 1N4SA 4U95D 3TWQA 5CBOA 4KVOA 4EBAG 4ZFHA 3GW4A 3FUIA 2NYJA 4J8FA 3IHYA 2WQ7A 1WDYA 4I2WA 3EHMA 3JUEA 2PL2A 3IHVA 3UT4A 4UWHA 2KZTA 3ZU7B 5CMYA 1MX4A 2ZIRA 3L82A 3TWVA 3C3OA 3UI2A 2A5EA 4B89A 4K03A 4F53A 3TXNA 4BTBA 2CFUA 2BEDA 4AP2A 3CGHA 2IO3C 1A17A 2EIKE 3UKUG 5J08A 4FADA 2QZAA 1E8ZA 3MCXA 4GTPA 1MX2A 4BFRA 3QOUA 1TJFA 5KJMA 3D9PA 4JEHA 3HYMB 2DVWA 3FUJA 2HR2A 4XI0A 1UN9A 3D9IA 2XCBA 3AS5A 2WXHA 2DZNA 4ILGA 1TEZA 3TWWA 3SNXA 4OVVA 4DX2A 1H6PA 2P9IG 2R2LA 3FUEA 3V2OA 3FTWA 1AP7A 2UY1A 4HS2A 3ZYMA 5EX3A 5HKPA 3D9KA 2FI7A 3L6AA 3ZXSA 2EIME 5CECB 2LXMA 4GTRA 2QYUA 2IQCA 1H2UA 1QZ2A 3GYZA 1KLXA 4L7TA 3CKCA 4GTQA 3LY8A 2XEHA 3ZXPA 2AXUA 4XI9A 3ZNGA 1YCSB 5JJ7A 1UOHA 3UT8A 3HVEB 4UWLA 5AYWD 4BESA 1UJJA 1YYHA 3QARA 1OCZE 2V5QC 1YMPA 3UM2A 4HQDA 2AWIA 3FH7A 2RFAA 3OXFA 3QJZA 2WXJA 2GRQB 4UQXA 3KEZA 1N9AA 2JEKA 3NZUA 5ENSD 5AIJA 3RRMB 4A1SA 2R03A 4JZYA 1O1RA 5KJLA 1N0RA 2XS1A 1X5BA 3NZSA 4CZ2D 1OWMA 1JUQA 2FEZA 4ABNA 5A7DB 4RG6A 1N4QA 2CG2A 2R5SA 4UI9K 3PUKA 2YQ8A 2VGXA 4HVBA 2HO1A 3PDNA 4HORA 2IY0C 5DIZA 2P9SG 2IFUA 3S7FA 4DLOA 3G2TA 3L17A 1IHGA 3E30A 5FQ8A 4ACLA 4AXHA 2GW1A 3RIBA 2F37A 3EHNA 2Q7FA 4K5BA 3ZN3A 4G26A 4J8SA 3DRAA 1KPSB 2NXPA 5EN5D 4LRZA 3BEEA 4I6EA 3PZ4A 2ETCA 5BV1A 4NURA 3VLDA 2OV8A 4RVBA 3NAWA 3ABME 1Z6TA 3ASFA 2LAHA 2RKKA 3SBTB 3JXJA 3RO3A 3D3MA 2QC9A 2WB2A 4WAFA 3L13A 3KSLA 3ESLA 5CEDB 3JXIA 2P9PG 2ETAA 2ETBA 3CLJA 3ZGQA 2QFCA 3PZ2A 2J09A 3EHRA 4UUCA 3UM0A 2IOLA 4G24A 4ATZD 3PEVB 1SZAA 2AW6A 4N39A 5EYPF 3AAAC 4AY6A 2I1JA 2DZOA 3FTXA 3J5PA 3EU5A 2EIJE 1FT2A 2P2CP 4BY6A 2M63A 1SA5A 3Q4AB 4K0RA 3VTYA 4BSXA 4C48B 3U3WA 3P1UA 3QC1A 1JWFA 2P58C 4I43A 4DI4A 1OWPA 4YDEA 3HXEA 3SI5A 3I3NA 2L6JA 1N4PA 2WXPA 2ZXWE 4C0MA 5KJKA 5CRVA 4UWGA 5AQ7A 2AVPA 4F3VA 5B3SE 3N71A 4N3AA 3APFA 4GTTA 4TRQA 4EZKA 5T3RA 4NQ0A 4GB9A 4V3IA 5EIBE 3UX4A 3AU4A 3JYSA 3KS2A 1EDUA 2PQNA 2H6FA 4I9CA 4CRWA 4EQFA 2KXPC 4GTMA 3RJVA 4JD2G 3L22A 1H6KA 1IHBA 3LVQE 4HOTA 3QWVA 1ELWA 3CHPA 5AQBA 3BG0B 3W9GA 3ZIMA 4I6JA 5D0QD 3ASNE 3L08A 2WXGA 2AXVA 4Q96A 4WWPA 2RFMA 2BUGA 3ULEG 3CR3A 4RG9A 3ONKA 4G2VA 2MOWA 4BWRA 3UINC 2X6FA 3O48A 4CCAA 1OCRE 1PAQA 1TNZA 2WXFA 3B13A 5CCLA 4PDXA 5EILA 5ANRA 1NA0A 4E85A 3CVXA 5JJ6A 2Y3AA 4IN3B 5JHAA 3T8KA 2H6GA 1MX6A 3G2VA 5D0OD 2LUHA 4FJZA 4I2ZA 3B95A 2P9UG 4N3BA 4EZLA 4GZ3A 2WPVA 3S2AA 3CK7A 3FH5A 4JVSA 5G04C 3UIPC 4BEPA 5KWDA 3PE3A 1O1TA 1TN8A 3APDA 3QB2A 4WNFA 4BTAA 4CYMD 3MV3B 3CVUA 4DLQA 4CGVA 5ENPD 5AQ9A 4Q94A 2MRIA 4O1OA 5HRYA 1E90A 3AS4A 1N4RA 3ESKA 3ZYQA 2IJGX 1E96B 1TNUA 4ANWA 4TUMA 3FU6A 4JA9A 3CVLA 3HDXA 1IXVA 1ZU2A 1GW6A 3CQGB 5T8IA 3MYVA 2J07A 4J7WA 4GZDA 4WNEA 2R02A 3URZA 1VDYA 3DSXA 4OYSA 4L23A 1LTXA 2GGFA 2EILE 1MZCA 4UWFA 3SF4A 3ZUVB 5ENRD 3E34A 4MLPA 3D9OA 4LNBA 3HIZA 2EINE 3IEGA 3CSTA 2XPYA 3FUNA 3FWVA 4J6IA 3Q5MA 1MHQA 4TXPA 4X8QA 4GCNA 3LKUA 5LX8A 3UT7A 1NZNA 3D9MA 3IKOB 5FWQA 5ITZF 4UQYA 5A6CA 1JPLA 2DWZA 4CEMA 3IBEA 1ELRA 3ZYKA 2WVIA 1KT1A 3Q7AA 4HOUA 2I2OA 2DYSE 3UPVA 4H7YA 3ASHA 3RRUA 3EIQC 1LD8A 3AG4E 1Q2ZA 3ENEA 4B8CB 2XGMA 1DCQA 4CT0A 3EUVA 5EYLA 2P9KG 5LCWC 5D66A 1LF8A 4G23A 3V79K 3C5RA 5DBKA 4UQZA 2HE0A 4GU5A 2KC7A 1U3CA 2Y69E 3C3RA 2E0IA 4TV3A 2L0TB 2VQ2A 3FFLA 4FA6A 3FULA 4XIFA 5FZQA 4GPMA 3FEXA 4LG6A 1E8WA 3P2BA 4GMRA 4FLBA 4JW1A 4RSYA 1FVFA 1O1SA 4LNUD 4EECA 4A3TA 4I1AA 4BETA 4U8YD 1ZB1A 5EX0A 4KXKB 2KCKA 3ASDA 2PM7A 5H7PA 3EIJA 5BPPA 2XPZA 3LDZA 2RG8A 3SY2A 1MJ0A 4DUIA 2ZGGA 4GMJA 3DPYA 4YDOA 5CCMA 2H6IA 5BV0A 5CMWA 1WM5A 3C98A 3CHSA 4YDWA 4HOSA 4KZ0A 3AJIA 2PM6A 1N94A 4DI3A 3RU0A 3GZ2A 5CRUA 3RAUA 3X2QE 5FT9A 5E76A 1SZ9A 2WMNA 3FEYA 3KD7A 5T4YA 5KNHD 3ONLA 4U8VD 5HI7A 2P9LG 2Y4UA 2BKKB 3PE4A 4BERA 4JXTA 3G2WA 1HU3A 1MQSA 3Q15A 1P5QA 1WG0A 1SVXA 2H6HA 4FC8A 4LNGA 4Z68A 2FO7A 5D2MC 3R9AB 3T9KA 3SD5A 4I9EA 4PS7A 5FQ4A 4GAAA 1N52A 3BUAA 4WNGA 5G05J 4O1PA 2HM8A 2CG3A 2CHWA 4AEZC 4J0UA 4LERA 2ZISA 3BG1B 3TXMA 2XGSA 2X6JA 2V5FA 1XGWA 3JQ0A 4W9RA 2C0LA 2AJAA 3S7DA 3D9NA 4EHMA 2MHKA 5ENTD 3V31A 4JHRA 2Y0BG 3QAQA 2XENA 2KCLA 3U66A 1N0QA 3TWXA 1IQRA 5FJYA 3ZHEB 4FULA 2I6HA 5AENA 4EZJA 4CDNA 5KCMA 4ANUA 3LXUX 4MS6A 4JB8P 1NFIE 4A1GA 2XQ0A 2IOSA 3CHQA 4PS8A 3FTSA 4ZHBA 1XNFA 4I1OB 4L2YA 3DXKG 1BU9A 3Q73A 5ARFA 2J8SD 5EKQD 3T5XA 2GRRB 1OWNA 3FUFA 4M7CA 1IKND 3Q9UC 2VSYA 3FUDA 2XZDG 1SW6A 3OXGA 2BTDA 5FTPA 3NQPA 1K1BA 3AS8A 3FTYA 2WMOA 4N5QA 5JA4D 1E7UA 1Z5SC 3FP3A 5AAOA 3LJ3A 5BXUA 2MYOA 4AV7A 4BSZB 1Z3XA 2Y1LE 2X6KA 3FU3A 1HZ4A 3CVVA 4BT8A 3LJNA 1TYQG 4TUUA 3OAWA 1D9SA 3D9JA 3ASOE 4MBGA 4L1BA 2LNIA 3B7SA 3DEOA 4A3VA
chains in the Genus database with same CATH topology
5ITZF 3T8KA 3V31A 1MX6A 2DWZA 2F37A 3ZU7B 4NIKA 5FINA 3TWSA 2Y0BG 3W9FA 3B95A 1MX4A 3SO8A 2VGEA 2XENA 4K5BA 5CEDB 1A5EA 3TWUA 1N0QA 1MJ0A 4OAUC 3V30A 3TWXA 2ZGGA 4DUIA 4F1PA 3NBNB 4HI9A 2V4HC 3TWVA 2BKGA 2XEHA 4J8YA 4YDYA 3V2XA 5EN5D 3UI2A 1OT8A 4DRXE 5AQ7A 2JABA 4BEPA 3DEPA 4RLYA 2XZTG 5KWDA 3ZNGA 1YCSB 3HRAA 2A5EA 4HBDA 1DCQA 2ETCA 1UOHA 5EYLA 4HRNA 3TWTA 5D66A 4G8KA 4YDWA 5JMND 3V79K 3NOCD 3NOGD 4OAVB 3B7BA 4JB8P 2F8YA 1NFIE 1BLXB 3AJIA 3C5RA 4CYMD 2QYJA 3Q9NC 2HE0A 5ENPD 5AQ9A 5EIBE 4BESA 4O1OA 4ZHBA 3HG0D 1YYHA 4DX5D 2V5QC 1YMPA 5CBNA 3D9HA 4HQDA 5HRYA 1BU9A 1BD8A 1S70B 2RFAA 3JXJA 2J8SD 4F6RD 2PNNA 5KNHD 2QC9A 1K3ZD 1G3NB 4QQIA 4HB5A 4U8VD 2FO1E 3KEAA 1IKND 5CEAA 2BKKB 3UXGA 3Q9UC 4TUMA 4QFVA 2XZDG 4B93B 1MX2A 1BI8B 1AWCB 2KXPC 1BI7B 1IXVA 4BERA 1SW6A 5ENSD 4HRLA 2KBXA 4O60A 1N11A 4GPMA 1IHBA 4J7WA 5KNGA 1K1AA 1WG0A 1MYOA 3JXIA 1SVXA 1N0RA 2DVWA 2ETAA 2ETBA 2L6BA 2XEEA 2ZGDA 1K1BA 5ENQD 4CZ2D 4Z68A 4K5AB 4LG6A 4LSZE 5AQBA 4GMRA 4HI8A 4K5CA 3UTMA 3T9KA 5ENRD 3ZUVB 5HS0A 3W9GA 4N5QA 1TR4A 4U96D 5AARA 5JA4D 3TWRA 5AAOA 5ENOD 4HRMB 4DX7D 3EHRA 4UUCA 4O1PA 3J5QB 3IXEA 5AQAA 2RFMA 4A63B 3ZKJA 4HLLA 4HNAD 5BXUA 3EHQA 4U95D 3TWQA 2DZNA 5CBOA 4ATZD 4LNUD 2MYOA 5BXOA 3F6QA 4BSZB 2Y1LE 3TWWA 4ZFHA 5EYPF 3AAAC 4BETA 5EIDA 4DX2A 1OY3D 2DZOA 4U8YD 2B0OE 3J5PA 5FIOA 2NYJA 5KBAA 3V2OA 4DX1A 1AP7A 3LJNA 4DX6D 5AN8A 2P2CP 1D9SA 1WDYA 3EU9A 5EILA 2F8XK 3JUEA 5HKPA 2AJAA 4G8LA 5ENTD 5CECB 1DC2A 3DEOA 4C48B 5CERB 1QYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITZ F;  3T8K A;  3V31 A;  1MX6 A;  2DWZ A;  2F37 A;  3ZU7 B;  4NIK A;  5FIN A;  3TWS A;  2Y0B G;  3W9F A;  3B95 A;  1MX4 A;  3SO8 A;  2VGE A;  2XEN A;  4K5B A;  5CED B;  1A5E A;  3TWU A;  1N0Q A;  1MJ0 A;  4OAU C;  3V30 A;  3TWX A;  2ZGG A;  4DUI A;  4F1P A;  3NBN B;  4HI9 A;  2V4H C;  3TWV A;  2BKG A;  2XEH A;  4J8Y A;  4YDY A;  3V2X A;  5EN5 D;  3UI2 A;  1OT8 A;  4DRX E;  5AQ7 A;  2JAB A;  4BEP A;  3DEP A;  4RLY A;  2XZT G;  5KWD A;  3ZNG A;  1YCS B;  3HRA A;  2A5E A;  4HBD A;  1DCQ A;  2ETC A;  1UOH A;  5EYL A;  4HRN A;  3TWT A;  5D66 A;  4G8K A;  4YDW A;  5JMN D;  3V79 K;  3NOC D;  3NOG D;  4OAV B;  3B7B A;  4JB8 P;  2F8Y A;  1NFI E;  1BLX B;  3AJI A;  3C5R A;  4CYM D;  2QYJ A;  3Q9N C;  2HE0 A;  5ENP D;  5AQ9 A;  5EIB E;  4BES A;  4O1O A;  4ZHB A;  3HG0 D;  1YYH A;  4DX5 D;  2V5Q C;  1YMP A;  5CBN A;  3D9H A;  4HQD A;  5HRY A;  1BU9 A;  1BD8 A;  1S70 B;  2RFA A;  3JXJ A;  2J8S D;  4F6R D;  2PNN A;  5KNH D;  2QC9 A;  1K3Z D;  1G3N B;  4QQI A;  4HB5 A;  4U8V D;  2FO1 E;  3KEA A;  1IKN D;  5CEA A;  2BKK B;  3UXG A;  3Q9U C;  4TUM A;  4QFV A;  2XZD G;  4B93 B;  1MX2 A;  1BI8 B;  1AWC B;  2KXP C;  1BI7 B;  1IXV A;  4BER A;  1SW6 A;  5ENS D;  4HRL A;  2KBX A;  4O60 A;  1N11 A;  4GPM A;  1IHB A;  4J7W A;  5KNG A;  1K1A A;  1WG0 A;  1MYO A;  3JXI A;  1SVX A;  1N0R A;  2DVW A;  2ETA A;  2ETB A;  2L6B A;  2XEE A;  2ZGD A;  1K1B A;  5ENQ D;  4CZ2 D;  4Z68 A;  4K5A B;  4LG6 A;  4LSZ E;  5AQB A;  4GMR A;  4HI8 A;  4K5C A;  3UTM A;  3T9K A;  5ENR D;  3ZUV B;  5HS0 A;  3W9G A;  4N5Q A;  1TR4 A;  4U96 D;  5AAR A;  5JA4 D;  3TWR A;  5AAO A;  5ENO D;  4HRM B;  4DX7 D;  3EHR A;  4UUC A;  4O1P A;  3J5Q B;  3IXE A;  5AQA A;  2RFM A;  4A63 B;  3ZKJ A;  4HLL A;  4HNA D;  5BXU A;  3EHQ A;  4U95 D;  3TWQ A;  2DZN A;  5CBO A;  4ATZ D;  4LNU D;  2MYO A;  5BXO A;  3F6Q A;  4BSZ B;  2Y1L E;  3TWW A;  4ZFH A;  5EYP F;  3AAA C;  4BET A;  5EID A;  4DX2 A;  1OY3 D;  2DZO A;  4U8Y D;  2B0O E;  3J5P A;  5FIO A;  2NYJ A;  5KBA A;  3V2O A;  4DX1 A;  1AP7 A;  3LJN A;  4DX6 D;  5AN8 A;  2P2C P;  1D9S A;  1WDY A;  3EU9 A;  5EIL A;  2F8X K;  3JUE A;  5HKP A;  2AJA A;  4G8L A;  5ENT D;  5CEC B;  1DC2 A;  3DEO A;  4C48 B;  5CER B;  1QYM A; 
#chains in the Genus database with same CATH topology
 3ZRH A;  1UJK A;  4U63 A;  4C9B B;  1EF1 C;  1HX8 A;  3SO8 A;  3KSQ A;  4ATG A;  4KMO A;  4YVO A;  3JUI A;  4RLY A;  1HG5 A;  2L0I A;  3TWT A;  3AG3 E;  2GRP B;  4KT6 B;  3FY4 A;  2R05 A;  2XHE A;  3QDN A;  2BF0 X;  2J4D A;  2VJ8 A;  3TJP A;  1TN7 A;  5A23 A;  2PNN A;  4QQI A;  4AJW A;  1HE8 A;  4M3O A;  3HXC A;  3SFZ A;  3DPD A;  4OVU A;  2J4B A;  3FUK A;  1IQU A;  4HRL A;  1D8D A;  3E32 A;  3ULQ A;  3TGO A;  1PC2 A;  4HI8 A;  3UTM A;  5HS0 A;  4HRM B;  4D10 C;  2VTB B;  5JJT A;  3ZEF A;  3O4Z A;  3FUM A;  5BUZ A;  1TNY A;  1JCS A;  5BXO A;  3MZL B;  4XKB A;  1O5M A;  2LAI A;  4DK5 A;  3B7T A;  3G2S A;  4B94 A;  3TG5 A;  2NSZ A;  3EU9 A;  4BX8 A;  4UI9 J;  4O6F A;  3ABL E;  4ME2 A;  1SA4 A;  3TWS A;  3DXM G;  1A5E A;  3MA5 A;  4WUY A;  1V54 E;  3GZS A;  2DCP A;  3KAE A;  3DWL G;  4YDY A;  2DBA A;  1OT8 A;  4DRX E;  3TAX A;  4HBD A;  4ILH B;  1OWL A;  4MRU A;  4N2S A;  4G8K A;  5JMN D;  3NOC D;  2UWJ G;  3SHF A;  1HFA A;  2WXK A;  3D9H A;  5ANL A;  3LEW A;  4GPK A;  1FVH A;  2WXQ A;  4HB5 A;  2PQR A;  4CDR A;  3KEA A;  2IEJ A;  2GRN B;  5FQ7 A;  4TXR A;  4GTS A;  4B93 B;  4R7L A;  1OCC E;  4BX9 A;  3CVQ A;  3ZW3 A;  4WND A;  4JL0 A;  1H2V C;  2E2E A;  1HF8 A;  1H2T C;  4FU3 A;  3AG1 E;  4A55 A;  4KBQ A;  4LUN U;  3LCA A;  1E8Y A;  3J5Q B;  3PNL B;  3Q79 A;  5AQA A;  3WXX A;  1TNB A;  2GRL A;  1ELK A;  4B0Z A;  2VGY A;  3RRN B;  3UM3 A;  4FP7 A;  4XKC A;  5FIO A;  1NL4 A;  1L5J A;  3JCK C;  4Y6C A;  4U7E B;  2GRO B;  3D9L A;  4ILI A;  3G2U A;  4G8L A;  2CHX A;  1DC2 A;  5AJD A;  1N54 A;  2RD0 A;  1U3D A;  3R7R A;  4AIF A;  3TWU A;  4Q69 A;  3GZ1 A;  4J8Y A;  3PZ3 A;  5B1B E;  4URK A;  3ISM C;  1KZO A;  2JAB A;  2QY7 A;  2LXL A;  4MKT A;  4I17 A;  3MKR A;  4FHJ A;  3NOG D;  3E37 A;  3HXB A;  4AY5 A;  4XX5 A;  4DX5 D;  2JLB A;  2AXZ A;  2XEV A;  4PH4 B;  3TL5 A;  2X6H A;  3CHR A;  5B1A E;  3UUX A;  5FZR A;  3FU5 A;  1HH8 A;  3ULY A;  4RQI A;  3ZYL A;  4HLE A;  2DYR E;  1AWC B;  3CVP A;  1DVP A;  4O60 A;  5KNG A;  1MYO A;  3E33 A;  5EDS A;  3FUH A;  4JA7 A;  4K5C A;  4U96 D;  4TXQ A;  2WQ6 A;  4FHK A;  4U0S A;  5M72 A;  4KZC A;  4HNA D;  1EYH A;  3PEU B;  3VTX A;  4JEU A;  3BU8 A;  1S63 A;  3F6Q A;  3ABK E;  2B0O E;  4AOF A;  4JC8 A;  4IYP A;  3CHO A;  3DSU A;  3FH8 A;  4NIK A;  2R17 C;  2GRM A;  1HS6 A;  1U2V G;  3HVE A;  3MV2 B;  4F1P A;  3DSW A;  4HOQ A;  2BKG A;  2XS8 A;  4WWO A;  2ZU6 B;  3FHE A;  3PS6 A;  3DEP A;  3B7R L;  3K9I A;  3PUJ A;  3Q49 B;  3FTU A;  2PZI A;  3MJW A;  3MX3 A;  1BLX B;  2HYZ A;  1KZP A;  1FPP A;  1NP7 A;  3VLE A;  1TNO A;  4GML A;  1BD8 A;  2YHE A;  3OTN A;  1HG2 A;  1G3N B;  3SQV A;  4KYO B;  4QFV A;  5G2N A;  1BI8 B;  1UN8 A;  2WXL A;  2V4L A;  2FBN A;  2VYI A;  2KBX A;  1PY1 A;  2ZGD A;  5ENQ D;  2KCV A;  4LSZ E;  3S7B A;  2VGX B;  3PNT B;  4J8E A;  4BT9 A;  4EPZ A;  4C0E A;  2J08 A;  1JCQ A;  3OXL A;  4U07 A;  3CQC B;  2KAT A;  3FTV A;  4ANX A;  4E6H A;  4B8A A;  2V8S E;  5G04 J;  3E4B A;  3QK0 A;  1H6O A;  1LD7 A;  1JCR A;  1K8K G;  4F7A A;  1INZ A;  2EQX A;  1WAO 1;  3LYA A;  4G1T A;  2A5U A;  5LCW J;  2VGE A;  5ENN A;  2P9N G;  1V55 E;  2V4H C;  2CFZ A;  3V2X A;  3CEQ A;  2WXN A;  4PS3 A;  4HRN A;  2UY1 B;  3B7B A;  2QYJ A;  3MKQ A;  2V0P A;  5BW8 C;  4PUC A;  5LOZ A;  4YVQ C;  1RW2 A;  3VLF A;  4GA1 A;  4EBA A;  3SBS A;  1FT1 A;  4F6R D;  1K3Z D;  3QWP A;  3UXG A;  2YNQ A;  3QKY A;  3U64 A;  4APO A;  3CIA A;  4LEU A;  3SGH A;  2L6B A;  3PH0 C;  3JQ1 A;  1QQE A;  5C2Y A;  2X3M A;  2WQH A;  3EDT B;  4GYW A;  4GZ5 A;  1JWG A;  5AAR A;  3ZPJ A;  5ENO D;  5BNW A;  3IXE A;  2OEW A;  3EHQ A;  2YIN A;  3Q7F A;  3T8M A;  3BQO A;  5LP0 A;  3I5P A;  1X81 A;  4GA2 A;  4U8H A;  1B89 A;  3I4G A;  4DX6 D;  5AN8 A;  4H7X A;  1D8E A;  2F8X K;  2OVF A;  4GTV A;  4UI9 C;  2FF4 A;  1QNF A;  2XRZ A;  5AJL A;  3UKR G;  1YA0 A;  3LVR E;  3PVL A;  2VSN A;  2LSU A;  1TN6 A;  4GCO A;  4WWN A;  3NBN B;  4HI9 A;  3ML8 A;  4ANV A;  3LY9 A;  3HRA A;  3LS8 A;  3ML9 A;  2J9Q A;  3PRZ A;  2F8Y A;  3CVN A;  5FQ6 A;  2WXI A;  1H19 A;  3ZHE A;  5FZS A;  3CVW A;  5CBN A;  3R9M A;  5J90 A;  3SFY A;  3R7Q A;  1S70 B;  2ILR A;  3SFX A;  3UIO C;  2VSX E;  4U0Z A;  4J8D A;  5CEA A;  3WG7 E;  1H0A A;  4IUL A;  2I9C A;  4GYO A;  4HFG A;  1S64 A;  4N5C A;  2WXR A;  3L9T A;  1N11 A;  1Y6I A;  1K1A A;  4DJA A;  2XEE A;  4APF A;  4GYY A;  4K5A B;  5KJN A;  3CVY A;  2C0M A;  1TR4 A;  3QNK A;  1Z3Y A;  3CK9 A;  4DX7 D;  1FCH A;  3FDH A;  3DSS A;  3MEK A;  1OXJ A;  3S7J A;  4CT4 A;  3FTZ A;  3C3Q A;  1S0P A;  3MKQ B;  1OUV A;  3TG4 A;  2B6C A;  4CDM A;  4NAC A;  2IF4 A;  3ZVV A;  1NI1 A;  1Y8M A;  4UWK A;  4U0U A;  5G55 A;  2X6I A;  4G25 A;  4JPS A;  5CER B;  1QYM A;  3Q78 A;  2Y4T A;  2FUL A;  5FIN A;  4F1S A;  3DST A;  2XGO A;  4OAU C;  3V30 A;  2ION A;  2LSV A;  3EJN A;  2XZT G;  3U4T A;  3CHM A;  1E8X A;  4N2Q A;  3DBS A;  3DSV A;  3IV0 A;  1WY6 A;  5CHE E;  4Y6W A;  3U9W A;  2A4Z A;  4CGW A;  3AG2 E;  1NA3 A;  3Q9N C;  3RKV A;  1UW4 B;  3HG0 D;  3UM1 A;  3RSE G;  3I4R B;  1IYG A;  2KM4 A;  3LY7 A;  2DIW A;  2WXM A;  3ZFW A;  1HO8 A;  4HXI A;  3T5V A;  4GZC A;  2OVB A;  4L9P A;  3Q47 B;  1TJC A;  2IO2 C;  2IU1 A;  3L16 A;  4XEI G;  2KZT B;  5LFA A;  1BI7 B;  4JHK A;  5BT1 A;  4KVM A;  2WXO A;  3ASG A;  2YHC A;  1W3B A;  4G11 A;  1BPO A;  1EPU A;  3PZ1 A;  4IRU A;  3MGB A;  3L54 A;  3PZD A;  4L2L A;  3RO2 A;  4P29 A;  3FU0 A;  3QWW A;  4A63 B;  3HXD A;  4HLL A;  3B7U X;  2I1K A;  2XPI A;  3UMV A;  4FLH A;  2OOE A;  1RZ4 A;  1SQM A;  5EID A;  1OY3 D;  2J49 A;  2VTB A;  5HQ8 A;  1UG3 A;  1DNP A;  5KBA A;  4DX1 A;  3CSF A;  4XZ4 A;  3UQ3 A;  3AU5 A;  5C1D A;  4FJY A;  5E75 A;  5IY5 E;  4ACK A;  4AVX A;  4I1M A;  1N95 A;  5G05 C;  4DPR A;  3W9F A;  2VSO E;  4JHJ A;  3SZ7 A;  5JHB A;  2XRY A;  4GZ6 A;  4NRH B;  3HXF A;  3CK8 A;  4GTO A;  1OCO E;  2OCC E;  2X38 A;  1HXI A;  2WM9 A;  3NF1 A;  3RK6 A;  2OND A;  4OAV B;  4LCT A;  4GA0 A;  2C2L A;  2NC9 A;  3PRE A;  4YND A;  3APC A;  4N3C A;  3NB2 A;  2LO6 A;  1KT0 A;  1E7V A;  5ARG A;  2F0Y A;  1DCE A;  2FO1 E;  4I6G A;  2CHZ A;  2R59 A;  3C72 A;  4XE0 A;  2OEV A;  1ZBP A;  2XCC A;  4U04 A;  3CKB A;  1QBQ A;  3Q75 A;  3CV0 A;  1OWO A;  3HHM A;  3TWR A;  3LPZ A;  2L9B A;  4AM9 A;  3ZKJ A;  1N4S A;  4U95 D;  3TWQ A;  5CBO A;  4KVO A;  4EBA G;  4ZFH A;  3GW4 A;  3FUI A;  2NYJ A;  4J8F A;  3IHY A;  2WQ7 A;  1WDY A;  4I2W A;  3EHM A;  3JUE A;  2PL2 A;  3IHV A;  3UT4 A;  4UWH A;  2KZT A;  3ZU7 B;  5CMY A;  1MX4 A;  2ZIR A;  3L82 A;  3TWV A;  3C3O A;  3UI2 A;  2A5E A;  4B89 A;  4K03 A;  4F53 A;  3TXN A;  4BTB A;  2CFU A;  2BED A;  4AP2 A;  3CGH A;  2IO3 C;  1A17 A;  2EIK E;  3UKU G;  5J08 A;  4FAD A;  2QZA A;  1E8Z A;  3MCX A;  4GTP A;  1MX2 A;  4BFR A;  3QOU A;  1TJF A;  5KJM A;  3D9P A;  4JEH A;  3HYM B;  2DVW A;  3FUJ A;  2HR2 A;  4XI0 A;  1UN9 A;  3D9I A;  2XCB A;  3AS5 A;  2WXH A;  2DZN A;  4ILG A;  1TEZ A;  3TWW A;  3SNX A;  4OVV A;  4DX2 A;  1H6P A;  2P9I G;  2R2L A;  3FUE A;  3V2O A;  3FTW A;  1AP7 A;  2UY1 A;  4HS2 A;  3ZYM A;  5EX3 A;  5HKP A;  3D9K A;  2FI7 A;  3L6A A;  3ZXS A;  2EIM E;  5CEC B;  2LXM A;  4GTR A;  2QYU A;  2IQC A;  1H2U A;  1QZ2 A;  3GYZ A;  1KLX A;  4L7T A;  3CKC A;  4GTQ A;  3LY8 A;  2XEH A;  3ZXP A;  2AXU A;  4XI9 A;  3ZNG A;  1YCS B;  5JJ7 A;  1UOH A;  3UT8 A;  3HVE B;  4UWL A;  5AYW D;  4BES A;  1UJJ A;  1YYH A;  3QAR A;  1OCZ E;  2V5Q C;  1YMP A;  3UM2 A;  4HQD A;  2AWI A;  3FH7 A;  2RFA A;  3OXF A;  3QJZ A;  2WXJ A;  2GRQ B;  4UQX A;  3KEZ A;  1N9A A;  2JEK A;  3NZU A;  5ENS D;  5AIJ A;  3RRM B;  4A1S A;  2R03 A;  4JZY A;  1O1R A;  5KJL A;  1N0R A;  2XS1 A;  1X5B A;  3NZS A;  4CZ2 D;  1OWM A;  1JUQ A;  2FEZ A;  4ABN A;  5A7D B;  4RG6 A;  1N4Q A;  2CG2 A;  2R5S A;  4UI9 K;  3PUK A;  2YQ8 A;  2VGX A;  4HVB A;  2HO1 A;  3PDN A;  4HOR A;  2IY0 C;  5DIZ A;  2P9S G;  2IFU A;  3S7F A;  4DLO A;  3G2T A;  3L17 A;  1IHG A;  3E30 A;  5FQ8 A;  4ACL A;  4AXH A;  2GW1 A;  3RIB A;  2F37 A;  3EHN A;  2Q7F A;  4K5B A;  3ZN3 A;  4G26 A;  4J8S A;  3DRA A;  1KPS B;  2NXP A;  5EN5 D;  4LRZ A;  3BEE A;  4I6E A;  3PZ4 A;  2ETC A;  5BV1 A;  4NUR A;  3VLD A;  2OV8 A;  4RVB A;  3NAW A;  3ABM E;  1Z6T A;  3ASF A;  2LAH A;  2RKK A;  3SBT B;  3JXJ A;  3RO3 A;  3D3M A;  2QC9 A;  2WB2 A;  4WAF A;  3L13 A;  3KSL A;  3ESL A;  5CED B;  3JXI A;  2P9P G;  2ETA A;  2ETB A;  3CLJ A;  3ZGQ A;  2QFC A;  3PZ2 A;  2J09 A;  3EHR A;  4UUC A;  3UM0 A;  2IOL A;  4G24 A;  4ATZ D;  3PEV B;  1SZA A;  2AW6 A;  4N39 A;  5EYP F;  3AAA C;  4AY6 A;  2I1J A;  2DZO A;  3FTX A;  3J5P A;  3EU5 A;  2EIJ E;  1FT2 A;  2P2C P;  4BY6 A;  2M63 A;  1SA5 A;  3Q4A B;  4K0R A;  3VTY A;  4BSX A;  4C48 B;  3U3W A;  3P1U A;  3QC1 A;  1JWF A;  2P58 C;  4I43 A;  4DI4 A;  1OWP A;  4YDE A;  3HXE A;  3SI5 A;  3I3N A;  2L6J A;  1N4P A;  2WXP A;  2ZXW E;  4C0M A;  5KJK A;  5CRV A;  4UWG A;  5AQ7 A;  2AVP A;  4F3V A;  5B3S E;  3N71 A;  4N3A A;  3APF A;  4GTT A;  4TRQ A;  4EZK A;  5T3R A;  4NQ0 A;  4GB9 A;  4V3I A;  5EIB E;  3UX4 A;  3AU4 A;  3JYS A;  3KS2 A;  1EDU A;  2PQN A;  2H6F A;  4I9C A;  4CRW A;  4EQF A;  2KXP C;  4GTM A;  3RJV A;  4JD2 G;  3L22 A;  1H6K A;  1IHB A;  3LVQ E;  4HOT A;  3QWV A;  1ELW A;  3CHP A;  5AQB A;  3BG0 B;  3W9G A;  3ZIM A;  4I6J A;  5D0Q D;  3ASN E;  3L08 A;  2WXG A;  2AXV A;  4Q96 A;  4WWP A;  2RFM A;  2BUG A;  3ULE G;  3CR3 A;  4RG9 A;  3ONK A;  4G2V A;  2MOW A;  4BWR A;  3UIN C;  2X6F A;  3O48 A;  4CCA A;  1OCR E;  1PAQ A;  1TNZ A;  2WXF A;  3B13 A;  5CCL A;  4PDX A;  5EIL A;  5ANR A;  1NA0 A;  4E85 A;  3CVX A;  5JJ6 A;  2Y3A A;  4IN3 B;  5JHA A;  3T8K A;  2H6G A;  1MX6 A;  3G2V A;  5D0O D;  2LUH A;  4FJZ A;  4I2Z A;  3B95 A;  2P9U G;  4N3B A;  4EZL A;  4GZ3 A;  2WPV A;  3S2A A;  3CK7 A;  3FH5 A;  4JVS A;  5G04 C;  3UIP C;  4BEP A;  5KWD A;  3PE3 A;  1O1T A;  1TN8 A;  3APD A;  3QB2 A;  4WNF A;  4BTA A;  4CYM D;  3MV3 B;  3CVU A;  4DLQ A;  4CGV A;  5ENP D;  5AQ9 A;  4Q94 A;  2MRI A;  4O1O A;  5HRY A;  1E90 A;  3AS4 A;  1N4R A;  3ESK A;  3ZYQ A;  2IJG X;  1E96 B;  1TNU A;  4ANW A;  4TUM A;  3FU6 A;  4JA9 A;  3CVL A;  3HDX A;  1IXV A;  1ZU2 A;  1GW6 A;  3CQG B;  5T8I A;  3MYV A;  2J07 A;  4J7W A;  4GZD A;  4WNE A;  2R02 A;  3URZ A;  1VDY A;  3DSX A;  4OYS A;  4L23 A;  1LTX A;  2GGF A;  2EIL E;  1MZC A;  4UWF A;  3SF4 A;  3ZUV B;  5ENR D;  3E34 A;  4MLP A;  3D9O A;  4LNB A;  3HIZ A;  2EIN E;  3IEG A;  3CST A;  2XPY A;  3FUN A;  3FWV A;  4J6I A;  3Q5M A;  1MHQ A;  4TXP A;  4X8Q A;  4GCN A;  3LKU A;  5LX8 A;  3UT7 A;  1NZN A;  3D9M A;  3IKO B;  5FWQ A;  5ITZ F;  4UQY A;  5A6C A;  1JPL A;  2DWZ A;  4CEM A;  3IBE A;  1ELR A;  3ZYK A;  2WVI A;  1KT1 A;  3Q7A A;  4HOU A;  2I2O A;  2DYS E;  3UPV A;  4H7Y A;  3ASH A;  3RRU A;  3EIQ C;  1LD8 A;  3AG4 E;  1Q2Z A;  3ENE A;  4B8C B;  2XGM A;  1DCQ A;  4CT0 A;  3EUV A;  5EYL A;  2P9K G;  5LCW C;  5D66 A;  1LF8 A;  4G23 A;  3V79 K;  3C5R A;  5DBK A;  4UQZ A;  2HE0 A;  4GU5 A;  2KC7 A;  1U3C A;  2Y69 E;  3C3R A;  2E0I A;  4TV3 A;  2L0T B;  2VQ2 A;  3FFL A;  4FA6 A;  3FUL A;  4XIF A;  5FZQ A;  4GPM A;  3FEX A;  4LG6 A;  1E8W A;  3P2B A;  4GMR A;  4FLB A;  4JW1 A;  4RSY A;  1FVF A;  1O1S A;  4LNU D;  4EEC A;  4A3T A;  4I1A A;  4BET A;  4U8Y D;  1ZB1 A;  5EX0 A;  4KXK B;  2KCK A;  3ASD A;  2PM7 A;  5H7P A;  3EIJ A;  5BPP A;  2XPZ A;  3LDZ A;  2RG8 A;  3SY2 A;  1MJ0 A;  4DUI A;  2ZGG A;  4GMJ A;  3DPY A;  4YDO A;  5CCM A;  2H6I A;  5BV0 A;  5CMW A;  1WM5 A;  3C98 A;  3CHS A;  4YDW A;  4HOS A;  4KZ0 A;  3AJI A;  2PM6 A;  1N94 A;  4DI3 A;  3RU0 A;  3GZ2 A;  5CRU A;  3RAU A;  3X2Q E;  5FT9 A;  5E76 A;  1SZ9 A;  2WMN A;  3FEY A;  3KD7 A;  5T4Y A;  5KNH D;  3ONL A;  4U8V D;  5HI7 A;  2P9L G;  2Y4U A;  2BKK B;  3PE4 A;  4BER A;  4JXT A;  3G2W A;  1HU3 A;  1MQS A;  3Q15 A;  1P5Q A;  1WG0 A;  1SVX A;  2H6H A;  4FC8 A;  4LNG A;  4Z68 A;  2FO7 A;  5D2M C;  3R9A B;  3T9K A;  3SD5 A;  4I9E A;  4PS7 A;  5FQ4 A;  4GAA A;  1N52 A;  3BUA A;  4WNG A;  5G05 J;  4O1P A;  2HM8 A;  2CG3 A;  2CHW A;  4AEZ C;  4J0U A;  4LER A;  2ZIS A;  3BG1 B;  3TXM A;  2XGS A;  2X6J A;  2V5F A;  1XGW A;  3JQ0 A;  4W9R A;  2C0L A;  2AJA A;  3S7D A;  3D9N A;  4EHM A;  2MHK A;  5ENT D;  3V31 A;  4JHR A;  2Y0B G;  3QAQ A;  2XEN A;  2KCL A;  3U66 A;  1N0Q A;  3TWX A;  1IQR A;  5FJY A;  3ZHE B;  4FUL A;  2I6H A;  5AEN A;  4EZJ A;  4CDN A;  5KCM A;  4ANU A;  3LXU X;  4MS6 A;  4JB8 P;  1NFI E;  4A1G A;  2XQ0 A;  2IOS A;  3CHQ A;  4PS8 A;  3FTS A;  4ZHB A;  1XNF A;  4I1O B;  4L2Y A;  3DXK G;  1BU9 A;  3Q73 A;  5ARF A;  2J8S D;  5EKQ D;  3T5X A;  2GRR B;  1OWN A;  3FUF A;  4M7C A;  1IKN D;  3Q9U C;  2VSY A;  3FUD A;  2XZD G;  1SW6 A;  3OXG A;  2BTD A;  5FTP A;  3NQP A;  1K1B A;  3AS8 A;  3FTY A;  2WMO A;  4N5Q A;  5JA4 D;  1E7U A;  1Z5S C;  3FP3 A;  5AAO A;  3LJ3 A;  5BXU A;  2MYO A;  4AV7 A;  4BSZ B;  1Z3X A;  2Y1L E;  2X6K A;  3FU3 A;  1HZ4 A;  3CVV A;  4BT8 A;  3LJN A;  1TYQ G;  4TUU A;  3OAW A;  1D9S A;  3D9J A;  3ASO E;  4MBG A;  4L1B A;  2LNI A;  3B7S A;  3DEO A;  4A3V A; 
#chains in the Genus database with same CATH homology
 5ITZ F;  3T8K A;  3V31 A;  1MX6 A;  2DWZ A;  2F37 A;  3ZU7 B;  4NIK A;  5FIN A;  3TWS A;  2Y0B G;  3W9F A;  3B95 A;  1MX4 A;  3SO8 A;  2VGE A;  2XEN A;  4K5B A;  5CED B;  1A5E A;  3TWU A;  1N0Q A;  1MJ0 A;  4OAU C;  3V30 A;  3TWX A;  2ZGG A;  4DUI A;  4F1P A;  3NBN B;  4HI9 A;  2V4H C;  3TWV A;  2BKG A;  2XEH A;  4J8Y A;  4YDY A;  3V2X A;  5EN5 D;  3UI2 A;  1OT8 A;  4DRX E;  5AQ7 A;  2JAB A;  4BEP A;  3DEP A;  4RLY A;  2XZT G;  5KWD A;  3ZNG A;  1YCS B;  3HRA A;  2A5E A;  4HBD A;  1DCQ A;  2ETC A;  1UOH A;  5EYL A;  4HRN A;  3TWT A;  5D66 A;  4G8K A;  4YDW A;  5JMN D;  3V79 K;  3NOC D;  3NOG D;  4OAV B;  3B7B A;  4JB8 P;  2F8Y A;  1NFI E;  1BLX B;  3AJI A;  3C5R A;  4CYM D;  2QYJ A;  3Q9N C;  2HE0 A;  5ENP D;  5AQ9 A;  5EIB E;  4BES A;  4O1O A;  4ZHB A;  3HG0 D;  1YYH A;  4DX5 D;  2V5Q C;  1YMP A;  5CBN A;  3D9H A;  4HQD A;  5HRY A;  1BU9 A;  1BD8 A;  1S70 B;  2RFA A;  3JXJ A;  2J8S D;  4F6R D;  2PNN A;  5KNH D;  2QC9 A;  1K3Z D;  1G3N B;  4QQI A;  4HB5 A;  4U8V D;  2FO1 E;  3KEA A;  1IKN D;  5CEA A;  2BKK B;  3UXG A;  3Q9U C;  4TUM A;  4QFV A;  2XZD G;  4B93 B;  1MX2 A;  1BI8 B;  1AWC B;  2KXP C;  1BI7 B;  1IXV A;  4BER A;  1SW6 A;  5ENS D;  4HRL A;  2KBX A;  4O60 A;  1N11 A;  4GPM A;  1IHB A;  4J7W A;  5KNG A;  1K1A A;  1WG0 A;  1MYO A;  3JXI A;  1SVX A;  1N0R A;  2DVW A;  2ETA A;  2ETB A;  2L6B A;  2XEE A;  2ZGD A;  1K1B A;  5ENQ D;  4CZ2 D;  4Z68 A;  4K5A B;  4LG6 A;  4LSZ E;  5AQB A;  4GMR A;  4HI8 A;  4K5C A;  3UTM A;  3T9K A;  5ENR D;  3ZUV B;  5HS0 A;  3W9G A;  4N5Q A;  1TR4 A;  4U96 D;  5AAR A;  5JA4 D;  3TWR A;  5AAO A;  5ENO D;  4HRM B;  4DX7 D;  3EHR A;  4UUC A;  4O1P A;  3J5Q B;  3IXE A;  5AQA A;  2RFM A;  4A63 B;  3ZKJ A;  4HLL A;  4HNA D;  5BXU A;  3EHQ A;  4U95 D;  3TWQ A;  2DZN A;  5CBO A;  4ATZ D;  4LNU D;  2MYO A;  5BXO A;  3F6Q A;  4BSZ B;  2Y1L E;  3TWW A;  4ZFH A;  5EYP F;  3AAA C;  4BET A;  5EID A;  4DX2 A;  1OY3 D;  2DZO A;  4U8Y D;  2B0O E;  3J5P A;  5FIO A;  2NYJ A;  5KBA A;  3V2O A;  4DX1 A;  1AP7 A;  3LJN A;  4DX6 D;  5AN8 A;  2P2C P;  1D9S A;  1WDY A;  3EU9 A;  5EIL A;  2F8X K;  3JUE A;  5HKP A;  2AJA A;  4G8L A;  5ENT D;  5CEC B;  1DC2 A;  3DEO A;  4C48 B;  5CER B;  1QYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...