2AVPA

Crystal structure of an 8 repeat consensus tpr superhelix
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
68
structure length
68
Chain Sequence
b'AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords synthetic consensus TPR protein
publication title Structure and stability of designed TPR protein superhelices: unusual crystal packing and implications for natural TPR proteins.
pubmed doi rcsb
molecule tags De novo protein
total genus 27
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2avpA00
4I1AA 5AYWD 4KXKB 4GYWA 3ZHEB 3GW4A 3CK9A 4BTAA 4IN3B 3EDTB 2IFUA 3ZGQA 3SF4A 3ZN3A 4I2WA 3FP3A 2PQNA 3R9AB 3VTYA 4UI9C 4HOUA 5BT1A 1ZBPA 4GPKA 4NQ0A 2Y4UA 3QDNA 4JA7A 5A7DB 1ZU2A 2VSNA 5JJ6A 4J8DA 4CDRA 5ARFA 5DBKA 5EX3A 2FO7A 2VYIA 3TG5A 4UQXA 4WNEA 4XI9A 2XGOA 4HOTA 4U0ZA 4KYOB 4KBQA 3CV0A 3S7DA 4RG9A 3RKVA 2UY1B 4CGWA 5G04J 3KD7A 3CK7A 3FFLA 3RU0A 1Y8MA 4J8FA 4UI9K 5C1DA 3TG4A 2WQHA 3OXGA 5CCLA 4H7XA 4EQFA 3BEEA 3N71A 3RIBA 3HYMB 4UI9J 4J0UA 3GZ1A 5FZQA 4N2QA 3FWVA 1NA0A 5HI7A 2OOEA 3IEGA 2HYZA 1KT0A 2LSVA 5G05J 5FZSA 1P5QA 2C0MA 4I2ZA 2VGYA 4JL0A 2YQ8A 4WNGA 3ULQA 5JJ7A 2ONDA 2JLBA 3K9IA 4G26A 4G24A 3QKYA 5ARGA 5KJMA 3GYZA 3ASHA 4GA0A 4APOA 2V5FA 4YVQC 3CVPA 2KATA 4HOSA 4N2SA 2PL2A 4G25A 1ELRA 3SZ7A 3UPVA 3QWVA 4AY5A 3Q5MA 4B94A 5EKQD 5DIZA 3TAXA 1OUVA 3S7FA 2DBAA 4AY6A 4XI0A 1YA0A 2YHCA 4Y6WA 2C2LA 3CKCA 2QFCA 4GCOA 3QOUA 4N3CA 1HXIA 4GA2A 1HH8A 3MA5A 4YVOA 2KCKA 5FT9A 4BWRA 4W9RA 2GW1A 2AVPA 3LYAA 5LCWJ 2I6HA 2WPVA 4Y6CA 3S7JA 4U07A 2C0LA 3KAEA 1NA3A 3U3WA 3PE4A 2XPIA 1E96B 3AS8A 3LY9A 2NC9A 3KS2A 2LSUA 4JA9A 3AS5A 1HZ4A 3MV3B 2FI7A 4NRHB 4AM9A 1IYGA 2KCVA 4UQYA 3QWWA 4GCNA 4HOQA 2KCLA 4U0SA 3URZA 1QQEA 2E2EA 3S7BA 1WAO1 3ZFWA 4N3BA 1QZ2A 2J9QA 4H7YA 3RJVA 2FBNA 2VQ2A 3PE3A 2MHKA 3CKBA 3WXXA 3Q15A 5CHEE 1TJCA 3PDNA 4XIFA 3UQ3A 5KJLA 3JYSA 4BTBA 3ZPJA 5JJTA 2XGMA 2UWJG 3CVNA 2IF4A 2XCBA 5FZRA 3UUXA 5KJNA 5BW8C 4I9CA 3LKUA 3E4BA 4O6FA 2HR2A 2UY1A 3CEQA 4UQZA 1NZNA 4GYYA 2FF4A 4U04A 5G04C 5D0QD 2VGXA 4N3AA 5CCMA 3LPZA 3LY7A 3GZ2A 5A6CA 2L6JA 1PC2A 2FEZA 1XNFA 1WM5A 2KC7A 4GZ5A 1FCHA 5M72A 3Q4AB 3LY8A 3LCAA 4BT8A 2PZIA 1IHGA 3RO2A 1W3BA 2XCCA 5G05C 4A1SA 4ABNA 4HORA 1KT1A 5FJYA 3MEKA 2R5SA 3Q49B 2PQRA 4N5CA 3NF1A 5KJKA 3MV2B 5EX0A 3OXLA 3O48A 4G23A 3TGOA 3ZHEA 3OXFA 3RO3A 3ASDA 2XGSA 3CK8A 5FTPA 2VSYA 4GYOA 4J8EA 3VTXA 3ESKA 4I17A 1ELWA 2VGXB 4WNDA 1B89A 3QWPA 4CGVA 1KLXA 4JHRA 3ASGA 3MKRA 4YNDA 4RG6A 4G2VA 3Q47B 3AS4A 4N39A 3CVQA 4LEUA 4GZ6A 3U4TA 4I9EA 5HQ8A 4WUYA 2P58C 4F3VA 4AIFA 5D0OD 2XEVA 4U0UA 2HO1A 2BUGA 4GA1A 4BT9A 5LCWC 2LNIA 5BNWA 2Q7FA 3ASFA 4ME2A 2Y4TA 1A17A 3CVLA 4G1TA 4GZ3A 4WNFA
chains in the Genus database with same CATH superfamily
1H6OA 3BU8A 2HM8A 3T8MA 4XKBA 2B0OE 3C98A 2XS1A 4UWHA 2H6FA 3GW4A 3CK9A 3LJ3A 4IN3B 3EDTB 5ENPD 3CQCB 3ZIMA 3G2UA 3Q9NC 3SD5A 3ZGQA 4I6EA 3ZN3A 2Y1LE 2WXGA 4PH4B 3EIJA 5LOZA 3SHFA 2WQ7A 2PQNA 5JMND 3L6AA 3TWTA 2J09A 4GPKA 2H6GA 3FU3A 5AIJA 4G11A 4AEZC 4NQ0A 3VLEA 4AOFA 1ZU2A 4XEIG 4YDOA 3W9GA 3CHQA 1D8DA 4WNEA 2XGOA 3B7UX 2LUHA 4ACLA 1GW6A 3U64A 1Z6TA 4U8VD 2H6HA 1S70B 2QC9A 2AW6A 3FH8A 3ABKE 2IJGX 4I1OB 2WQ6A 1Y8MA 2WVIA 4J8FA 4UI9K 3V30A 5CMWA 2OVBA 5D66A 5CBOA 4LNGA 4JC8A 3RIBA 3DBSA 3MYVA 3GZ1A 2DVWA 2R2LA 3QAQA 3FWVA 5EYLA 5HI7A 2KBXA 1BLXB 2LSVA 2QZAA 4GMRA 4GTQA 1UJJA 5FZSA 1P5QA 2C0MA 1N4QA 4I2ZA 4P29A 5AENA 4GTSA 3UM0A 1RW2A 4WNGA 5KNGA 4R7LA 5ARGA 3HXDA 5CEDB 3ASHA 5FIOA 4GA0A 4APOA 4FP7A 4TUUA 2NYJA 4DX7D 4LNUD 3R9MA 3PNTB 3TWWA 3SZ7A 3T9KA 4JPSA 5EKQD 1JWFA 4UWGA 5ENSD 3RRUA 1YYHA 4Y6WA 3UXGA 3SO8A 4N3CA 3ABLE 2R03A 1HXIA 3CGHA 3G2WA 4V3IA 5G2NA 3MA5A 3R7RA 4I6GA 1OCRE 3FTWA 4FHKA 4J7WA 3KSQA 4Y6CA 4BERA 3E34A 1OXJA 2XEHA 3KAEA 1NA3A 4EBAA 3DEPA 2H6IA 2WB2A 4ANWA 5FQ4A 4C0MA 3B7RL 2A5UA 1MJ0A 2NC9A 1N11A 1JWGA 3CHMA 1TNUA 4U63A 3LVRE 4JA9A 3AS5A 3RRNB 4FJYA 4AM9A 2AXUA 1IYGA 4HQDA 3RAUA 5BXUA 2X6JA 5AQ9A 3FUNA 3KEAA 4LG6A 4HOQA 3HVEB 3NB2A 4BSZB 3WG7E 3L13A 5ENNA 3B13A 2BEDA 2J4BA 3ZFWA 1QZ2A 4H7YA 3UINC 4HRNA 5T8IA 1FT2A 1SZ9A 2LO6A 3PE3A 4RLYA 4BSXA 3WXXA 3Q15A 5CHEE 4K5BA 3PDNA 3UIOC 5T3RA 3SY2A 4BX8A 3E33A 2WXQA 5ANLA 3ZPJA 5JJTA 2XRYA 4CYMD 1N0QA 4HRLA 2VSOE 5FZRA 3UUXA 4GTRA 4JW1A 4O6FA 3CEQA 2WXPA 3EHMA 3MX3A 1AWCB 2CHZA 4GPMA 1K1BA 5FQ6A 3ZYLA 1QBQA 3FTUA 2JEKA 3ZYKA 1AP7A 3FU6A 1XNFA 3BQOA 3PUKA 2KC7A 1UJKA 4OAVB 3LXUX 3TXMA 5M72A 2CG2A 3NZSA 4MBGA 5JHBA 3FUIA 4O60A 2I9CA 4PUCA 1KT1A 2WXFA 2ETCA 3FTZA 5HS0A 5J90A 1SQMA 5KJKA 4B0ZA 1TJFA 2GRRB 1D8EA 4G23A 1HE8A 3OXFA 4CT0A 3RO3A 3ASDA 3BG0B 4TUMA 4D10C 1E7VA 4J6IA 4A63B 4A1GA 4XKCA 3L22A 4GYOA 3V79K 5BUZA 3PEUB 1ELWA 3CVYA 4UWFA 4DLQA 3ASGA 3T5XA 2X6IA 3J5PA 4RG6A 4DI3A 3AS4A 4N39A 3CVVA 4GZ6A 2AWIA 3ZNGA 4UWLA 3ULYA 4A3VA 4HI9A 4YDWA 4AIFA 5D0OD 3FUFA 4Q69A 1X81A 4CT4A 4U0UA 2WMNA 3PZ1A 4B93B 2XPZA 2R17C 4JD2G 2X6HA 2X38A 4BT9A 5BNWA 2ZU6B 2IONA 2ZISA 3CVLA 4DUIA 2GGFA 1JPLA 3ENEA 5G55A 3PVLA 4EZLA 4JEHA 1XGWA 3S2AA 3ASOE 3EHNA 1S64A 1UN9A 1IXVA 3JUEA 2WXHA 3ONLA 2J08A 3L82A 3TWRA 4DI4A 1YMPA 4UI9C 2KXPC 2AJAA 1MQSA 4HOUA 5BT1A 2ZGDA 3DSUA 2Y4UA 4AVXA 3QDNA 5AQ7A 3L9TA 4GB9A 2XQ0A 4L23A 1ZB1A 3HXEA 5CECB 2RFAA 2FO7A 3O4ZA 2VYIA 4B89A 1LF8A 4UQXA 4XI9A 2IOLA 4UWKA 4GZDA 3CV0A 3S7DA 4RG9A 3RRMB 3MKQA 1MX2A 5ENOD 3C3RA 3SBSA 3FEXA 3FFLA 1LTXA 1UOHA 3NZUA 3UM3A 4H7XA 3BEEA 2EQXA 1KPSB 4J0UA 2DYSE 1A5EA 5FZQA 4DX2A 2DIWA 1NA0A 1KT0A 3JXIA 5G05J 1N9AA 1FT1A 4DX5D 2YQ8A 4OYSA 4ILIA 3LS8A 4IYPA 1OWLA 2LAHA 3K9IA 3EHQA 4G24A 3QKYA 2I1KA 3BG1B 5KJMA 1U3CA 5ANRA 3ZEFA 4F1SA 4IULA 2YNQA 4LERA 3V2XA 2V5FA 4YVQC 2I2OA 2WXRA 1E90A 1S0PA 2GRMA 5JHAA 1TNBA 3ESLA 1E8YA 3TAXA 3S7FA 2VTBA 4FLHA 3AU4A 4OAUC 2YHCA 3GZSA 3CKCA 2QFCA 3CVUA 4GTMA 1BPOA 1TEZA 3FHEA 1KZPA 2XPYA 3BUAA 5CERB 3LEWA 2GW1A 3JCKC 1H6PA 3FTSA 2L0TB 2WXNA 3C3QA 3CSTA 2C0LA 1SW6A 2XZTG 1HG5A 1BI8B 4MKTA 1E96B 3FUEA 2OEWA 3Q75A 3AS8A 2J07A 4DX1A 3KS2A 4GZCA 2ZIRA 4LRZA 4NRHB 2WXJA 3I4RB 4O1PA 2I1JA 1MZCA 3QWWA 1Y6IA 2KCLA 2LXLA 4U0SA 3SGHA 2KZTA 1TN7A 1H0AA 2E2EA 1G3NB 2E0IA 2VTBB 1OCCE 4DRXE 3DXMG 4NIKA 2IEJA 4HS2A 4BY6A 2EINE 2IO3C 1EYHA 2J49A 4M3OA 3NOGD 3RJVA 2ZXWE 4I1MA 5LFAA 4LNBA 2FBNA 4MS6A 4FJZA 2MHKA 2V4LA 3W9FA 4E6HA 3AG3E 1N54A 4HXIA 3AG2E 3LVQE 5KJLA 4I6JA 4BTBA 1K1AA 2XGMA 2UWJG 4M7CA 5AJLA 2GRQB 4C9BB 3B7SA 5EIBE 5KJNA 2Y69E 4I9CA 3CQGB 4PS3A 3E4BA 2BTDA 2HR2A 2UY1A 1D9SA 2EIKE 3CHRA 2YHEA 2FF4A 1SVXA 4U04A 3LPZA 3GZ2A 5A6CA 1QNFA 2L6JA 2IO2C 4RQIA 1H2VC 3L54A 4GTVA 1O5MA 1DNPA 3UM2A 1H2UA 3AG4E 5ENQD 5E76A 3UM1A 1N95A 3TJPA 3Q4AB 1IHBA 1NL4A 1E8ZA 2F0YA 4Q94A 4CDMA 1X5BA 1IHGA 5G05C 2F8YA 4NACA 3QB2A 2WM9A 4ABNA 2F37A 3T5VA 4CZ2D 3QC1A 2R5SA 3EHRA 3V2OA 2PQRA 5EDSA 4BESA 3I5PA 4HLEA 4KMOA 5IY5E 3ZHEA 5AJDA 3QJZA 3D9HA 2XGSA 5FTPA 3D9IA 3V31A 2CFZA 4J8EA 4WWPA 3VTXA 1WY6A 4I17A 1N52A 1VDYA 5AARA 4CGVA 1KLXA 2PM6A 3PNLB 2P9SG 3APFA 4YNDA 3JUIA 4FHJA 3EU5A 1N94A 3VLDA 4TXPA 3ASNE 4LEUA 5B1BE 3SQVA 4EPZA 3UKRG 4L7TA 2XS8A 3DSVA 2FO1E 1NFIE 3ZKJA 2P58C 4F3VA 5KWDA 2XEVA 1UW4B 2HO1A 4GA1A 2VJ8A 3C3OA 2LNIA 2Q7FA 3X2QE 1DCEA 5AQBA 3IXEA 3ASFA 4ME2A 3RK6A 2B6CA 2P9NG 4GTPA 3ULEG 1TN6A 1ELKA 4FULA 5C2YA 3FULA 4AP2A 4IRUA 5AYWD 4KXKB 2EIJE 4GYWA 3ZHEB 3FUJA 1JCSA 5FQ8A 5LX8A 3HXFA 4EBAG 4ZFHA 3HIZA 3FTXA 2P9IG 3FP3A 2LXMA 3JXJA 2GRPB 4TXQA 4L9PA 5B3SE 4U8HA 4I43A 4JZYA 5KCMA 4GTOA 4JA7A 5A7DB 1RZ4A 2VSNA 2WMOA 5JJ6A 2RKKA 4J8DA 4WWOA 4CDRA 2F8XK 3CVXA 3FU0A 3HRAA 4K5AB 4U95D 3LDZA 2ETAA 3DRAA 4F6RD 1OWMA 2GRLA 3CVWA 2NXPA 4JEUA 2P9UG 4ACKA 1OWOA 4LSZE 4CGWA 5G04J 4XZ4A 4NURA 3FDHA 3NBNB 3RU0A 3PS6A 4L2LA 2AXZA 3ML8A 2WQHA 1YCSB 3LJNA 4BX9A 4EQFA 3N71A 1Z5SC 3HYMB 4ILGA 4CDNA 3SFYA 4PS8A 3IEGA 2DCPA 3UKUG 3L08A 1FVFA 3HG0D 2VGYA 5JA4D 2L0IA 3ULQA 4K0RA 2ONDA 2BF0X 2WXLA 3R7QA 2P9KG 5ENTD 3TWSA 2ETBA 3CSFA 3CVPA 2KATA 2X6KA 4HOSA 4HB5A 5EIDA 2PL2A 1BD8A 4G25A 1ELRA 1INZA 2DZNA 4LUNU 4OVUA 1N4PA 3ZYMA 4ATGA 3ONKA 4AY5A 2AXVA 4YDEA 1OUVA 4CCAA 1HF8A 5FINA 4K5CA 3HXBA 4J8YA 4AY6A 1YA0A 3P2BA 3MJWA 2C2LA 4RVBA 2XENA 4GCOA 4KZ0A 3ISMC 4GA2A 1IQUA 4PS7A 4YVOA 4ILHB 3NQPA 4J8SA 4W9RA 2YINA 2IY0C 4O1OA 5LCWJ 3HXCA 5BXOA 2WPVA 4WWNA 1HO8A 3PE4A 4MLPA 5D2MC 3Q78A 3Q7AA 3D9KA 2JABA 2A4ZA 3IKOB 3LY9A 4TV3A 3G2SA 3FTVA 5BV1A 2LSUA 1HZ4A 5A23A 2FI7A 3DEOA 3UT4A 3UX4A 2V8SE 2KCVA 5H7PA 3U66A 3ZRHA 3AJIA 3D9OA 3FEYA 3ZUVB 4UQYA 3KEZA 5EYPF 4GCNA 3MCXA 1U3DA 3T8KA 2R05A 3URZA 1QQEA 3CIAA 3DSWA 2P9PG 3AG1E 1LD8A 3S7BA 3ZW3A 1OY3D 2VSXE 1WAO1 2FULA 4N3BA 3HDXA 4F1PA 3ML9A 3Q9UC 5ENRD 3DSSA 2OV8A 5J08A 4EZKA 4FU3A 1DVPA 4XIFA 3UQ3A 1IKND 1H6KA 2OCCE 3PZDA 3IHYA 3D3MA 5KNHD 3JYSA 3PZ4A 4GTTA 4HFGA 4B8AA 1OT8A 3CVNA 2CHWA 5EN5D 2IF4A 2XCBA 3AAAC 4HRMB 3PREA 5AN8A 3MKQB 3MZLB 1NP7A 5BW8C 3D9NA 3LKUA 3CR3A 4U8YD 3RSEG 3AU5A 4HNAD 3IV0A 4LCTA 5G04C 2VGXA 4N3AA 3LY7A 3NAWA 1UG3A 1PC2A 2QYUA 4KVMA 3NOCD 1TNZA 5FWQA 4X8QA 3G2VA 3J5QB 4HLLA 1OWPA 1H19A 4BT8A 2QYJA 1WG0A 3DSXA 5BV0A 2PZIA 5CRUA 1W3BA 5EILA 4WAFA 4QFVA 4A1SA 4HORA 5FJYA 2BKKB 1DC2A 4ANXA 4A3TA 2A5EA 4HBDA 1MX6A 2LAIA 5CEAA 4KZCA 4DPRA 5EX0A 1EPUA 3O48A 2XRZA 3EJNA 3CK8A 3E30A 3B7BA 4BFRA 4YDYA 4JXTA 3B95A 2WXMA 4L2YA 3FUDA 2DWZA 3ESKA 2VGXB 2XZDG 1B89A 4N5QA 1JCRA 4JHRA 3MKRA 2QY7A 4Q96A 2WXOA 1E8WA 3DWLG 3UI2A 2GRNB 1HX8A 1EF1C 2V0PA 3U4TA 3SNXA 2HE0A 4I9EA 4EECA 3TWVA 3TL5A 4WUYA 3FH5A 1E8XA 1MX4A 2BUGA 2J8SD 3EIQC 2DZOA 4FA6A 5LCWC 5BPPA 1HG2A 2Y4TA 3D9MA 3QK0A 4GZ3A 3FTYA 4I1AA 4L1BA 4URKA 2IOSA 1HS6A 1TNOA 2ILRA 4BTAA 3OAWA 2IFUA 2X6FA 4HVBA 2KZTB 1L5JA 4TXRA 3SF4A 3DPYA 1U2VG 4I2WA 3HVEA 3DPDA 4DK5A 3R9AB 5CMYA 4F7AA 4G8KA 3VTYA 4U7EB 3F6QA 4GAAA 1ZBPA 3APDA 4ZHBA 2XEEA 5T4YA 1Z3XA 4DJAA 1LD7A 5FQ7A 5ARFA 4DX6D 3Q73A 2J4DA 5DBKA 5EX3A 2P2CP 4CEMA 1DCQA 3TG5A 5CBNA 1BI7B 1N4SA 3E37A 4HOTA 4U0ZA 4B8CB 2WXIA 1O1TA 4FLBA 4KYOB 4KBQA 4DLOA 3RKVA 4APFA 2UY1B 5KBAA 4JHJA 2GROB 3KD7A 3CK7A 1HFAA 1V55E 4AXHA 5C1DA 4FC8A 4UUCA 3SBTB 3TG4A 3OXGA 5CCLA 2BKGA 4G8LA 3VLFA 2CHXA 4CRWA 3CHOA 4UI9J 3JQ0A 4U96D 4N2QA 5B1AE 2OOEA 2MOWA 2HYZA 3SFZA 1SA4A 4MRUA 5HRYA 2R59A 2WXKA 1TR4A 4JVSA 4JL0A 3UT8A 3ZXPA 3TWXA 5JJ7A 2JLBA 4G26A 3ABME 3GYZA 1JUQA 2EIME 3PEVB 4PDXA 1FVHA 4C48B 1UN8A 1O1SA 4KT6B 2MYOA 4N2SA 3U9WA 2IU1A 3E32A 3DXKG 3ZVVA 5HKPA 3APCA 3UPVA 2RD0A 2XHEA 2NSZA 3QWVA 3Q5MA 2RFMA 4B94A 5DIZA 2DBAA 5CRVA 4XI0A 3FUKA 3QOUA 1HH8A 3TWQA 1K8KG 4QQIA 3ZU7B 3IBEA 2Y3AA 2CG3A 2KCKA 3IHVA 5FT9A 2DYRE 4BWRA 5AQAA 2AVPA 3LYAA 3ZYQA 1KZOA 1V54E 2I6HA 3CHSA 3S7JA 3PUJA 4U07A 4RSYA 3UIPC 1Q2ZA 3U3WA 4BETA 2XPIA 3D9JA 3D9PA 1IQRA 4GMJA 4A55A 3Q79A 2V4HC 3MV3B 5E75A 4ANVA 2CFUA 1EDUA 1MYOA 4GU5A 4KVOA 3PZ3A 3SI5A 4ANUA 3CHPA 3FU5A 3UMVA 3B7TA 4ATZD 1SA5A 1K3ZD 2J9QA 3C5RA 4XX5A 2VQ2A 3PH0C 3P1UA 3CKBA 3TWUA 1E7UA 2L9BA 1TJCA 3C72A 1H2TC 2PNNA 2R02A 3EU9A 4TRQA 2EILE 3TXNA 2Y0BG 2RG8A 1S63A 2IQCA 3I4GA 4OVVA 2L6BA 3L17A 4UQZA 1NZNA 4GYYA 1HU3A 3G2TA 1OWNA 1TYQG 5D0QD 3L16A 5CCMA 2ZGGA 2KM4A 4FADA 2FEZA 1OCOE 2V5QC 1WM5A 1JCQA 4GZ5A 1FPPA 1FCHA 1NI1A 2MRIA 3PRZA 2OVFA 4JB8P 3LY8A 3Q7FA 3LCAA 4E85A 3HHMA 4BEPA 3UT7A 4GMLA 4HI8A 5AAOA 3RO2A 1O1RA 1Z3YA 2XCCA 1QYMA 3FUHA 3MEKA 1TNYA 4EHMA 3Q49B 3MGBA 1BU9A 4N5CA 3NF1A 4EZJA 1N4RA 3CLJA 3EUVA 5LP0A 3MV2B 3OXLA 3TGOA 3UTMA 5ITZF 3QNKA 4JHKA 3I3NA 2X3MA 3OTNA 3PZ2A 2VSYA 4Z68A 4WNDA 3QWPA 2P9LG 4K03A 3JQ1A 1PAQA 1PY1A 2OEVA 2PM7A 1OCZE 4G2VA 3SFXA 3Q47B 3CVQA 1WDYA 3QARA 4AJWA 5HQ8A 4AV7A 3FH7A 4C0EA 3ZXSA 4XE0A 3FUMA 3FY4A 3D9LA 1SZAA 2M63A 3DSTA 2VGEA 1MHQA 1N0RA 1A17A 4F53A 4G1TA 4WNFA 3KSLA 1TN8A
chains in the Genus database with same CATH topology
3FTYA 4I1AA 4L1BA 2HM8A 4URKA 3T8MA 1JPLA 3ENEA 5G55A 1ELKA 4FULA 5C2YA 3FULA 2IOSA 4AP2A 1HS6A 3PVLA 4XKBA 4EZLA 4IRUA 5AYWD 4JEHA 1XGWA 3C98A 4GYWA 4KXKB 3S2AA 3ZHEB 3EHNA 3FUJA 4UWHA 3GW4A 3CK9A 2ILRA 1UN9A 5FQ8A 3LJ3A 4BTAA 5LX8A 4IN3B 4EBAG 3EDTB 2WXHA 3OAWA 2IFUA 2X6FA 3CQCB 3HIZA 3G2UA 3ZIMA 3SD5A 3ZGQA 3ONLA 4HVBA 2KZTB 3FTXA 2J08A 1L5JA 3SF4A 4I6EA 3ZN3A 4I2WA 3FP3A 3HVEA 3DPDA 2WXGA 4PH4B 3EIJA 5LOZA 3SHFA 4DI4A 4DK5A 2WQ7A 2PQNA 3R9AB 5CMYA 4F7AA 3VTYA 4UI9C 3L6AA 1MQSA 4GAAA 2J09A 4HOUA 5BT1A 1ZBPA 4I43A 3FU3A 4U8HA 4GPKA 3APDA 4JZYA 5KCMA 5AIJA 4G11A 4AEZC 4NQ0A 2Y4UA 3VLEA 4AOFA 4AVXA 3QDNA 4JA7A 1Z3XA 5A7DB 1ZU2A 5T4YA 4DJAA 2VSNA 2WMOA 5FQ7A 5JJ6A 4J8DA 4GB9A 4WWOA 2XQ0A 4L23A 4CDRA 5ARFA 3CVXA 3FU0A 2J4DA 5DBKA 5EX3A 2FO7A 3O4ZA 4CEMA 2VYIA 4B89A 3TG5A 3CHQA 1LF8A 4UQXA 3LDZA 4WNEA 2XGOA 2IOLA 4XI9A 3B7UX 4ACLA 4HOTA 1OWMA 2GRLA 4U0ZA 4B8CB 2NXPA 3CVWA 2WXIA 1GW6A 4UWKA 4FLBA 4JEUA 4KYOB 1Z6TA 4GZDA 4KBQA 3CV0A 3U64A 4ACKA 3S7DA 1OWOA 4RG9A 4DLOA 3RKVA 4APFA 3RRMB 3MKQA 2UY1B 4CGWA 4JHJA 5G04J 2AW6A 4XZ4A 4NURA 3SBSA 3FEXA 3KD7A 3CK7A 3FFLA 1HFAA 3FDHA 2IJGX 3FH8A 3PS6A 4I1OB 1Y8MA 3RU0A 2WVIA 4J8FA 4L2LA 4FC8A 2AXZA 4UI9K 3ML8A 4AXHA 5C1DA 5CMWA 3SBTB 3TG4A 2WQHA 3NZUA 2OVBA 3OXGA 5CCLA 3VLFA 2CHXA 4H7XA 4BX9A 3BEEA 4EQFA 3N71A 2EQXA 4JC8A 3RIBA 4CRWA 3DBSA 3MYVA 3HYMB 3CHOA 4ILGA 4UI9J 4J0UA 4CDNA 3GZ1A 3JQ0A 5FZQA 2DIWA 4PS8A 4N2QA 3QAQA 3FWVA 1NA0A 5HI7A 2OOEA 3IEGA 2MOWA 2HYZA 2DCPA 3L08A 1FVFA 1KT0A 2LSVA 5G05J 3SFZA 1UJJA 4MRUA 5FZSA 1P5QA 2C0MA 2R59A 2WXKA 4I2ZA 2VGYA 4JVSA 4P29A 4JL0A 3UT8A 5AENA 2YQ8A 4OYSA 4ILIA 3LS8A 4WNGA 2L0IA 3ULQA 4IYPA 4K0RA 5JJ7A 1OWLA 2ONDA 2LAHA 2BF0X 2JLBA 3K9IA 4G26A 2WXLA 4G24A 3QKYA 4R7LA 5ARGA 2I1KA 3BG1B 5KJMA 1U3CA 3R7QA 3GYZA 3ASHA 5ANRA 4GA0A 1JUQA 3PEVB 4PDXA 1FVHA 4APOA 3ZEFA 4F1SA 4FP7A 4IULA 4TUUA 1UN8A 4KT6B 2YNQA 4LERA 3CSFA 2V5FA 4YVQC 2I2OA 3CVPA 2KATA 2WXRA 2X6KA 4HOSA 4N2SA 3U9WA 1E90A 1S0PA 2IU1A 3PNTB 2GRMA 2PL2A 5JHAA 4G25A 1ELRA 1INZA 3ZVVA 3SZ7A 4LUNU 3APCA 4OVUA 3UPVA 2RD0A 3ZYMA 2XHEA 2NSZA 3QWVA 3ONKA 3ESLA 4ATGA 2AXVA 1E8YA 4JPSA 3Q5MA 4B94A 4AY5A 5EKQD 5DIZA 1JWFA 1OUVA 4UWGA 3S7FA 3TAXA 4CCAA 1HF8A 3RRUA 2DBAA 2VTBA 4FLHA 3AU4A 4AY6A 4XI0A 1YA0A 3P2BA 2YHCA 3MJWA 2C2LA 3GZSA 3CKCA 4RVBA 2QFCA 3FUKA 4Y6WA 4GCOA 3QOUA 4KZ0A 4N3CA 3CVUA 1HXIA 3CGHA 3G2WA 4GA2A 4V3IA 1HH8A 1BPOA 1TEZA 3FHEA 1IQUA 4PS7A 3IBEA 2Y3AA 3MA5A 2XPYA 4YVOA 5G2NA 2CG3A 2KCKA 3IHVA 3R7RA 3LEWA 5FT9A 4BWRA 4ILHB 3NQPA 4J8SA 4W9RA 2GW1A 2AVPA 2YINA 3JCKC 4I6GA 3FTSA 3LYAA 5LCWJ 3FTWA 4FHKA 3ZYQA 2L0TB 2WXNA 2I6HA 2WPVA 4Y6CA 3CHSA 3CSTA 3S7JA 3PUJA 4U07A 2C0LA 4RSYA 3KAEA 1NA3A 4WWNA 1HO8A 4EBAA 3U3WA 3PE4A 1HG5A 2XPIA 2WB2A 4MLPA 4MKTA 4ANWA 5FQ4A 3D9JA 3D9PA 4C0MA 1E96B 3B7RL 3FUEA 3D9KA 1IQRA 2A5UA 2A4ZA 3AS8A 2J07A 3IKOB 3LY9A 2NC9A 3G2SA 4TV3A 3KS2A 1JWGA 4GZCA 3CHMA 3FTVA 4GMJA 5BV1A 4A55A 4U63A 2LSUA 3LVRE 4JA9A 3AS5A 1HZ4A 3MV3B 4FJYA 4LRZA 5E75A 3RRNB 4ANVA 2FI7A 2CFUA 4NRHB 2WXJA 1EDUA 3UT4A 4AM9A 2AXUA 3I4RB 1IYGA 5A23A 3UX4A 2V8SE 2KCVA 4GU5A 2I1JA 3U66A 4KVOA 3ZRHA 2X6JA 3D9OA 3FEYA 3SI5A 3FUNA 4UQYA 3KEZA 3QWWA 4ANUA 4GCNA 1Y6IA 3CHPA 1U3DA 3FU5A 3HVEB 3MCXA 2KCLA 3B7TA 4HOQA 3UMVA 4U0SA 3URZA 1QQEA 3CIAA 3SGHA 2KZTA 1H0AA 2E2EA 3L13A 5ENNA 2E0IA 2VTBB 3S7BA 3ZW3A 3B13A 2VSXE 4HS2A 4BY6A 1WAO1 2FULA 2J4BA 3ZFWA 4N3BA 1QZ2A 1EYHA 2J9QA 3QK0A 2WQ6A 3HDXA 4H7YA 2J49A 4M3OA 5LFAA 4I1MA 3ML9A 4XX5A 3RJVA 5T8IA 2OV8A 1SZ9A 2FBNA 4MS6A 2VQ2A 2LO6A 3PE3A 5J08A 3PH0C 3P1UA 4FJZA 4BSXA 4EZKA 2MHKA 3CKBA 4FU3A 3WXXA 3Q15A 1DVPA 2V4LA 5CHEE 1E7UA 2L9BA 1TJCA 4E6HA 3PDNA 1N54A 4XIFA 3UQ3A 1H6KA 4HXIA 5T3RA 4BX8A 1H2TC 3LVQE 5KJLA 3PZDA 3IHYA 2WXQA 3D3MA 3JYSA 4I6JA 5ANLA 3ZPJA 4TRQA 4BTBA 2XGMA 5JJTA 4HFGA 2UWJG 4B8AA 3TXNA 2XRYA 2RG8A 3CVNA 2CHWA 2IQCA 2IF4A 2VSOE 2XCBA 5FZRA 5AJLA 3PREA 3I4GA 4C9BB 3MKQB 3B7SA 3UUXA 3MZLB 1NP7A 5KJNA 5BW8C 4I9CA 3D9NA 3LKUA 3CQGB 4PS3A 3E4BA 4OVVA 2BTDA 2HR2A 4JW1A 4O6FA 2UY1A 3CEQA 3L17A 4UQZA 3CR3A 2WXPA 1NZNA 3EHMA 3MX3A 3AU5A 3CHRA 4GYYA 1HU3A 2CHZA 2YHEA 2FF4A 3G2TA 3IV0A 4LCTA 1OWNA 4U04A 5G04C 5D0QD 3L16A 2VGXA 4N3AA 5CCMA 3LPZA 3LY7A 5FQ6A 3GZ2A 5A6CA 3ZYLA 1QNFA 2L6JA 1UG3A 1PC2A 2KM4A 1H2VC 2JEKA 3FTUA 3L54A 4FADA 2FEZA 3ZYKA 4KVMA 1DNPA 3FU6A 1XNFA 1WM5A 1H2UA 3PUKA 2KC7A 4GZ5A 5FWQA 1UJKA 5E76A 1FCHA 3G2VA 3LXUX 3TJPA 3TXMA 2MRIA 3PRZA 2CG2A 5M72A 2OVFA 1OWPA 3NZSA 3Q4AB 1E8ZA 1H19A 3LY8A 3LCAA 4BT8A 4E85A 3HHMA 3UT7A 4Q94A 5JHBA 3FUIA 4GMLA 4CDMA 2PZIA 1X5BA 1IHGA 3RO2A 5BV0A 1W3BA 1Z3YA 2XCCA 5G05C 4NACA 3QB2A 2WM9A 2I9CA 4PUCA 4QFVA 4WAFA 3FUHA 4A1SA 4ABNA 4HORA 1KT1A 5FJYA 2WXFA 3T5VA 3MEKA 3QC1A 2R5SA 3Q49B 4ANXA 3MGBA 2PQRA 3FTZA 4A3TA 4N5CA 3NF1A 5EDSA 4EZJA 5J90A 1SQMA 5KJKA 2LAIA 4B0ZA 3CLJA 1TJFA 5LP0A 3MV2B 4KZCA 4GZ3A 4DPRA 3I5PA 5EX0A 4HLEA 4KMOA 1EPUA 3OXLA 3O48A 4G23A 3TGOA 3ZHEA 5AJDA 1HE8A 3OXFA 4CT0A 3QJZA 3RO3A 3ASDA 3BG0B 2XRZA 3QNKA 3EJNA 4D10C 2XGSA 3CK8A 5FTPA 1E7VA 3D9IA 4JHKA 4BFRA 4J6IA 3I3NA 4JXTA 2X3MA 3OTNA 2WXMA 4A1GA 4L2YA 4XKCA 3L22A 2VSYA 4GYOA 2CFZA 4J8EA 4WWPA 3VTXA 1WY6A 3FUDA 3ESKA 5BUZA 4I17A 3PEUB 1N52A 1VDYA 1ELWA 2VGXB 4WNDA 1B89A 3CVYA 3QWPA 4UWFA 4K03A 4CGVA 1KLXA 2PM6A 3JQ1A 4DLQA 1PAQA 1PY1A 3PNLB 3ASGA 4JHRA 2PM7A 3APFA 3MKRA 3T5XA 2QY7A 4Q96A 2X6IA 2WXOA 4YNDA 4RG6A 4G2VA 3JUIA 1E8WA 4DI3A 4FHJA 3Q47B 3AS4A 1HX8A 1EF1C 3VLDA 4N39A 3CVQA 3CVVA 4LEUA 2V0PA 4GZ6A 3U4TA 2AWIA 4EPZA 3SNXA 3QARA 4I9EA 4EECA 4AJWA 4L7TA 4UWLA 5HQ8A 3TL5A 4A3VA 4WUYA 4AV7A 2P58C 3FH7A 4AIFA 4C0EA 4F3VA 5D0OD 3FUFA 4Q69A 2XEVA 4CT4A 3FH5A 1E8XA 4U0UA 1UW4B 2WMNA 2HO1A 3ZXSA 4XE0A 2XPZA 3FUMA 2R17C 2BUGA 2X6HA 2X38A 3EIQC 3FY4A 2VJ8A 3D9LA 4GA1A 4BT9A 5LCWC 4FA6A 2LNIA 1SZAA 5BNWA 2Q7FA 5BPPA 2M63A 3ASFA 1HG2A 2ZU6B 1MHQA 4ME2A 2IONA 2Y4TA 3RK6A 1A17A 4F53A 3CVLA 3D9MA 4G1TA 2GGFA 4WNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1A A;  5AYW D;  4KXK B;  4GYW A;  3ZHE B;  3GW4 A;  3CK9 A;  4BTA A;  4IN3 B;  3EDT B;  2IFU A;  3ZGQ A;  3SF4 A;  3ZN3 A;  4I2W A;  3FP3 A;  2PQN A;  3R9A B;  3VTY A;  4UI9 C;  4HOU A;  5BT1 A;  1ZBP A;  4GPK A;  4NQ0 A;  2Y4U A;  3QDN A;  4JA7 A;  5A7D B;  1ZU2 A;  2VSN A;  5JJ6 A;  4J8D A;  4CDR A;  5ARF A;  5DBK A;  5EX3 A;  2FO7 A;  2VYI A;  3TG5 A;  4UQX A;  4WNE A;  4XI9 A;  2XGO A;  4HOT A;  4U0Z A;  4KYO B;  4KBQ A;  3CV0 A;  3S7D A;  4RG9 A;  3RKV A;  2UY1 B;  4CGW A;  5G04 J;  3KD7 A;  3CK7 A;  3FFL A;  3RU0 A;  1Y8M A;  4J8F A;  4UI9 K;  5C1D A;  3TG4 A;  2WQH A;  3OXG A;  5CCL A;  4H7X A;  4EQF A;  3BEE A;  3N71 A;  3RIB A;  3HYM B;  4UI9 J;  4J0U A;  3GZ1 A;  5FZQ A;  4N2Q A;  3FWV A;  1NA0 A;  5HI7 A;  2OOE A;  3IEG A;  2HYZ A;  1KT0 A;  2LSV A;  5G05 J;  5FZS A;  1P5Q A;  2C0M A;  4I2Z A;  2VGY A;  4JL0 A;  2YQ8 A;  4WNG A;  3ULQ A;  5JJ7 A;  2OND A;  2JLB A;  3K9I A;  4G26 A;  4G24 A;  3QKY A;  5ARG A;  5KJM A;  3GYZ A;  3ASH A;  4GA0 A;  4APO A;  2V5F A;  4YVQ C;  3CVP A;  2KAT A;  4HOS A;  4N2S A;  2PL2 A;  4G25 A;  1ELR A;  3SZ7 A;  3UPV A;  3QWV A;  4AY5 A;  3Q5M A;  4B94 A;  5EKQ D;  5DIZ A;  3TAX A;  1OUV A;  3S7F A;  2DBA A;  4AY6 A;  4XI0 A;  1YA0 A;  2YHC A;  4Y6W A;  2C2L A;  3CKC A;  2QFC A;  4GCO A;  3QOU A;  4N3C A;  1HXI A;  4GA2 A;  1HH8 A;  3MA5 A;  4YVO A;  2KCK A;  5FT9 A;  4BWR A;  4W9R A;  2GW1 A;  2AVP A;  3LYA A;  5LCW J;  2I6H A;  2WPV A;  4Y6C A;  3S7J A;  4U07 A;  2C0L A;  3KAE A;  1NA3 A;  3U3W A;  3PE4 A;  2XPI A;  1E96 B;  3AS8 A;  3LY9 A;  2NC9 A;  3KS2 A;  2LSU A;  4JA9 A;  3AS5 A;  1HZ4 A;  3MV3 B;  2FI7 A;  4NRH B;  4AM9 A;  1IYG A;  2KCV A;  4UQY A;  3QWW A;  4GCN A;  4HOQ A;  2KCL A;  4U0S A;  3URZ A;  1QQE A;  2E2E A;  3S7B A;  1WAO 1;  3ZFW A;  4N3B A;  1QZ2 A;  2J9Q A;  4H7Y A;  3RJV A;  2FBN A;  2VQ2 A;  3PE3 A;  2MHK A;  3CKB A;  3WXX A;  3Q15 A;  5CHE E;  1TJC A;  3PDN A;  4XIF A;  3UQ3 A;  5KJL A;  3JYS A;  4BTB A;  3ZPJ A;  5JJT A;  2XGM A;  2UWJ G;  3CVN A;  2IF4 A;  2XCB A;  5FZR A;  3UUX A;  5KJN A;  5BW8 C;  4I9C A;  3LKU A;  3E4B A;  4O6F A;  2HR2 A;  2UY1 A;  3CEQ A;  4UQZ A;  1NZN A;  4GYY A;  2FF4 A;  4U04 A;  5G04 C;  5D0Q D;  2VGX A;  4N3A A;  5CCM A;  3LPZ A;  3LY7 A;  3GZ2 A;  5A6C A;  2L6J A;  1PC2 A;  2FEZ A;  1XNF A;  1WM5 A;  2KC7 A;  4GZ5 A;  1FCH A;  5M72 A;  3Q4A B;  3LY8 A;  3LCA A;  4BT8 A;  2PZI A;  1IHG A;  3RO2 A;  1W3B A;  2XCC A;  5G05 C;  4A1S A;  4ABN A;  4HOR A;  1KT1 A;  5FJY A;  3MEK A;  2R5S A;  3Q49 B;  2PQR A;  4N5C A;  3NF1 A;  5KJK A;  3MV2 B;  5EX0 A;  3OXL A;  3O48 A;  4G23 A;  3TGO A;  3ZHE A;  3OXF A;  3RO3 A;  3ASD A;  2XGS A;  3CK8 A;  5FTP A;  2VSY A;  4GYO A;  4J8E A;  3VTX A;  3ESK A;  4I17 A;  1ELW A;  2VGX B;  4WND A;  1B89 A;  3QWP A;  4CGV A;  1KLX A;  4JHR A;  3ASG A;  3MKR A;  4YND A;  4RG6 A;  4G2V A;  3Q47 B;  3AS4 A;  4N39 A;  3CVQ A;  4LEU A;  4GZ6 A;  3U4T A;  4I9E A;  5HQ8 A;  4WUY A;  2P58 C;  4F3V A;  4AIF A;  5D0O D;  2XEV A;  4U0U A;  2HO1 A;  2BUG A;  4GA1 A;  4BT9 A;  5LCW C;  2LNI A;  5BNW A;  2Q7F A;  3ASF A;  4ME2 A;  2Y4T A;  1A17 A;  3CVL A;  4G1T A;  4GZ3 A;  4WNF A; 
#chains in the Genus database with same CATH topology
 1H6O A;  3BU8 A;  2HM8 A;  3T8M A;  4XKB A;  2B0O E;  3C98 A;  2XS1 A;  4UWH A;  2H6F A;  3GW4 A;  3CK9 A;  3LJ3 A;  4IN3 B;  3EDT B;  5ENP D;  3CQC B;  3ZIM A;  3G2U A;  3Q9N C;  3SD5 A;  3ZGQ A;  4I6E A;  3ZN3 A;  2Y1L E;  2WXG A;  4PH4 B;  3EIJ A;  5LOZ A;  3SHF A;  2WQ7 A;  2PQN A;  5JMN D;  3L6A A;  3TWT A;  2J09 A;  4GPK A;  2H6G A;  3FU3 A;  5AIJ A;  4G11 A;  4AEZ C;  4NQ0 A;  3VLE A;  4AOF A;  1ZU2 A;  4XEI G;  4YDO A;  3W9G A;  3CHQ A;  1D8D A;  4WNE A;  2XGO A;  3B7U X;  2LUH A;  4ACL A;  1GW6 A;  3U64 A;  1Z6T A;  4U8V D;  2H6H A;  1S70 B;  2QC9 A;  2AW6 A;  3FH8 A;  3ABK E;  2IJG X;  4I1O B;  2WQ6 A;  1Y8M A;  2WVI A;  4J8F A;  4UI9 K;  3V30 A;  5CMW A;  2OVB A;  5D66 A;  5CBO A;  4LNG A;  4JC8 A;  3RIB A;  3DBS A;  3MYV A;  3GZ1 A;  2DVW A;  2R2L A;  3QAQ A;  3FWV A;  5EYL A;  5HI7 A;  2KBX A;  1BLX B;  2LSV A;  2QZA A;  4GMR A;  4GTQ A;  1UJJ A;  5FZS A;  1P5Q A;  2C0M A;  1N4Q A;  4I2Z A;  4P29 A;  5AEN A;  4GTS A;  3UM0 A;  1RW2 A;  4WNG A;  5KNG A;  4R7L A;  5ARG A;  3HXD A;  5CED B;  3ASH A;  5FIO A;  4GA0 A;  4APO A;  4FP7 A;  4TUU A;  2NYJ A;  4DX7 D;  4LNU D;  3R9M A;  3PNT B;  3TWW A;  3SZ7 A;  3T9K A;  4JPS A;  5EKQ D;  1JWF A;  4UWG A;  5ENS D;  3RRU A;  1YYH A;  4Y6W A;  3UXG A;  3SO8 A;  4N3C A;  3ABL E;  2R03 A;  1HXI A;  3CGH A;  3G2W A;  4V3I A;  5G2N A;  3MA5 A;  3R7R A;  4I6G A;  1OCR E;  3FTW A;  4FHK A;  4J7W A;  3KSQ A;  4Y6C A;  4BER A;  3E34 A;  1OXJ A;  2XEH A;  3KAE A;  1NA3 A;  4EBA A;  3DEP A;  2H6I A;  2WB2 A;  4ANW A;  5FQ4 A;  4C0M A;  3B7R L;  2A5U A;  1MJ0 A;  2NC9 A;  1N11 A;  1JWG A;  3CHM A;  1TNU A;  4U63 A;  3LVR E;  4JA9 A;  3AS5 A;  3RRN B;  4FJY A;  4AM9 A;  2AXU A;  1IYG A;  4HQD A;  3RAU A;  5BXU A;  2X6J A;  5AQ9 A;  3FUN A;  3KEA A;  4LG6 A;  4HOQ A;  3HVE B;  3NB2 A;  4BSZ B;  3WG7 E;  3L13 A;  5ENN A;  3B13 A;  2BED A;  2J4B A;  3ZFW A;  1QZ2 A;  4H7Y A;  3UIN C;  4HRN A;  5T8I A;  1FT2 A;  1SZ9 A;  2LO6 A;  3PE3 A;  4RLY A;  4BSX A;  3WXX A;  3Q15 A;  5CHE E;  4K5B A;  3PDN A;  3UIO C;  5T3R A;  3SY2 A;  4BX8 A;  3E33 A;  2WXQ A;  5ANL A;  3ZPJ A;  5JJT A;  2XRY A;  4CYM D;  1N0Q A;  4HRL A;  2VSO E;  5FZR A;  3UUX A;  4GTR A;  4JW1 A;  4O6F A;  3CEQ A;  2WXP A;  3EHM A;  3MX3 A;  1AWC B;  2CHZ A;  4GPM A;  1K1B A;  5FQ6 A;  3ZYL A;  1QBQ A;  3FTU A;  2JEK A;  3ZYK A;  1AP7 A;  3FU6 A;  1XNF A;  3BQO A;  3PUK A;  2KC7 A;  1UJK A;  4OAV B;  3LXU X;  3TXM A;  5M72 A;  2CG2 A;  3NZS A;  4MBG A;  5JHB A;  3FUI A;  4O60 A;  2I9C A;  4PUC A;  1KT1 A;  2WXF A;  2ETC A;  3FTZ A;  5HS0 A;  5J90 A;  1SQM A;  5KJK A;  4B0Z A;  1TJF A;  2GRR B;  1D8E A;  4G23 A;  1HE8 A;  3OXF A;  4CT0 A;  3RO3 A;  3ASD A;  3BG0 B;  4TUM A;  4D10 C;  1E7V A;  4J6I A;  4A63 B;  4A1G A;  4XKC A;  3L22 A;  4GYO A;  3V79 K;  5BUZ A;  3PEU B;  1ELW A;  3CVY A;  4UWF A;  4DLQ A;  3ASG A;  3T5X A;  2X6I A;  3J5P A;  4RG6 A;  4DI3 A;  3AS4 A;  4N39 A;  3CVV A;  4GZ6 A;  2AWI A;  3ZNG A;  4UWL A;  3ULY A;  4A3V A;  4HI9 A;  4YDW A;  4AIF A;  5D0O D;  3FUF A;  4Q69 A;  1X81 A;  4CT4 A;  4U0U A;  2WMN A;  3PZ1 A;  4B93 B;  2XPZ A;  2R17 C;  4JD2 G;  2X6H A;  2X38 A;  4BT9 A;  5BNW A;  2ZU6 B;  2ION A;  2ZIS A;  3CVL A;  4DUI A;  2GGF A;  1JPL A;  3ENE A;  5G55 A;  3PVL A;  4EZL A;  4JEH A;  1XGW A;  3S2A A;  3ASO E;  3EHN A;  1S64 A;  1UN9 A;  1IXV A;  3JUE A;  2WXH A;  3ONL A;  2J08 A;  3L82 A;  3TWR A;  4DI4 A;  1YMP A;  4UI9 C;  2KXP C;  2AJA A;  1MQS A;  4HOU A;  5BT1 A;  2ZGD A;  3DSU A;  2Y4U A;  4AVX A;  3QDN A;  5AQ7 A;  3L9T A;  4GB9 A;  2XQ0 A;  4L23 A;  1ZB1 A;  3HXE A;  5CEC B;  2RFA A;  2FO7 A;  3O4Z A;  2VYI A;  4B89 A;  1LF8 A;  4UQX A;  4XI9 A;  2IOL A;  4UWK A;  4GZD A;  3CV0 A;  3S7D A;  4RG9 A;  3RRM B;  3MKQ A;  1MX2 A;  5ENO D;  3C3R A;  3SBS A;  3FEX A;  3FFL A;  1LTX A;  1UOH A;  3NZU A;  3UM3 A;  4H7X A;  3BEE A;  2EQX A;  1KPS B;  4J0U A;  2DYS E;  1A5E A;  5FZQ A;  4DX2 A;  2DIW A;  1NA0 A;  1KT0 A;  3JXI A;  5G05 J;  1N9A A;  1FT1 A;  4DX5 D;  2YQ8 A;  4OYS A;  4ILI A;  3LS8 A;  4IYP A;  1OWL A;  2LAH A;  3K9I A;  3EHQ A;  4G24 A;  3QKY A;  2I1K A;  3BG1 B;  5KJM A;  1U3C A;  5ANR A;  3ZEF A;  4F1S A;  4IUL A;  2YNQ A;  4LER A;  3V2X A;  2V5F A;  4YVQ C;  2I2O A;  2WXR A;  1E90 A;  1S0P A;  2GRM A;  5JHA A;  1TNB A;  3ESL A;  1E8Y A;  3TAX A;  3S7F A;  2VTB A;  4FLH A;  3AU4 A;  4OAU C;  2YHC A;  3GZS A;  3CKC A;  2QFC A;  3CVU A;  4GTM A;  1BPO A;  1TEZ A;  3FHE A;  1KZP A;  2XPY A;  3BUA A;  5CER B;  3LEW A;  2GW1 A;  3JCK C;  1H6P A;  3FTS A;  2L0T B;  2WXN A;  3C3Q A;  3CST A;  2C0L A;  1SW6 A;  2XZT G;  1HG5 A;  1BI8 B;  4MKT A;  1E96 B;  3FUE A;  2OEW A;  3Q75 A;  3AS8 A;  2J07 A;  4DX1 A;  3KS2 A;  4GZC A;  2ZIR A;  4LRZ A;  4NRH B;  2WXJ A;  3I4R B;  4O1P A;  2I1J A;  1MZC A;  3QWW A;  1Y6I A;  2KCL A;  2LXL A;  4U0S A;  3SGH A;  2KZT A;  1TN7 A;  1H0A A;  2E2E A;  1G3N B;  2E0I A;  2VTB B;  1OCC E;  4DRX E;  3DXM G;  4NIK A;  2IEJ A;  4HS2 A;  4BY6 A;  2EIN E;  2IO3 C;  1EYH A;  2J49 A;  4M3O A;  3NOG D;  3RJV A;  2ZXW E;  4I1M A;  5LFA A;  4LNB A;  2FBN A;  4MS6 A;  4FJZ A;  2MHK A;  2V4L A;  3W9F A;  4E6H A;  3AG3 E;  1N54 A;  4HXI A;  3AG2 E;  3LVQ E;  5KJL A;  4I6J A;  4BTB A;  1K1A A;  2XGM A;  2UWJ G;  4M7C A;  5AJL A;  2GRQ B;  4C9B B;  3B7S A;  5EIB E;  5KJN A;  2Y69 E;  4I9C A;  3CQG B;  4PS3 A;  3E4B A;  2BTD A;  2HR2 A;  2UY1 A;  1D9S A;  2EIK E;  3CHR A;  2YHE A;  2FF4 A;  1SVX A;  4U04 A;  3LPZ A;  3GZ2 A;  5A6C A;  1QNF A;  2L6J A;  2IO2 C;  4RQI A;  1H2V C;  3L54 A;  4GTV A;  1O5M A;  1DNP A;  3UM2 A;  1H2U A;  3AG4 E;  5ENQ D;  5E76 A;  3UM1 A;  1N95 A;  3TJP A;  3Q4A B;  1IHB A;  1NL4 A;  1E8Z A;  2F0Y A;  4Q94 A;  4CDM A;  1X5B A;  1IHG A;  5G05 C;  2F8Y A;  4NAC A;  3QB2 A;  2WM9 A;  4ABN A;  2F37 A;  3T5V A;  4CZ2 D;  3QC1 A;  2R5S A;  3EHR A;  3V2O A;  2PQR A;  5EDS A;  4BES A;  3I5P A;  4HLE A;  4KMO A;  5IY5 E;  3ZHE A;  5AJD A;  3QJZ A;  3D9H A;  2XGS A;  5FTP A;  3D9I A;  3V31 A;  2CFZ A;  4J8E A;  4WWP A;  3VTX A;  1WY6 A;  4I17 A;  1N52 A;  1VDY A;  5AAR A;  4CGV A;  1KLX A;  2PM6 A;  3PNL B;  2P9S G;  3APF A;  4YND A;  3JUI A;  4FHJ A;  3EU5 A;  1N94 A;  3VLD A;  4TXP A;  3ASN E;  4LEU A;  5B1B E;  3SQV A;  4EPZ A;  3UKR G;  4L7T A;  2XS8 A;  3DSV A;  2FO1 E;  1NFI E;  3ZKJ A;  2P58 C;  4F3V A;  5KWD A;  2XEV A;  1UW4 B;  2HO1 A;  4GA1 A;  2VJ8 A;  3C3O A;  2LNI A;  2Q7F A;  3X2Q E;  1DCE A;  5AQB A;  3IXE A;  3ASF A;  4ME2 A;  3RK6 A;  2B6C A;  2P9N G;  4GTP A;  3ULE G;  1TN6 A;  1ELK A;  4FUL A;  5C2Y A;  3FUL A;  4AP2 A;  4IRU A;  5AYW D;  4KXK B;  2EIJ E;  4GYW A;  3ZHE B;  3FUJ A;  1JCS A;  5FQ8 A;  5LX8 A;  3HXF A;  4EBA G;  4ZFH A;  3HIZ A;  3FTX A;  2P9I G;  3FP3 A;  2LXM A;  3JXJ A;  2GRP B;  4TXQ A;  4L9P A;  5B3S E;  4U8H A;  4I43 A;  4JZY A;  5KCM A;  4GTO A;  4JA7 A;  5A7D B;  1RZ4 A;  2VSN A;  2WMO A;  5JJ6 A;  2RKK A;  4J8D A;  4WWO A;  4CDR A;  2F8X K;  3CVX A;  3FU0 A;  3HRA A;  4K5A B;  4U95 D;  3LDZ A;  2ETA A;  3DRA A;  4F6R D;  1OWM A;  2GRL A;  3CVW A;  2NXP A;  4JEU A;  2P9U G;  4ACK A;  1OWO A;  4LSZ E;  4CGW A;  5G04 J;  4XZ4 A;  4NUR A;  3FDH A;  3NBN B;  3RU0 A;  3PS6 A;  4L2L A;  2AXZ A;  3ML8 A;  2WQH A;  1YCS B;  3LJN A;  4BX9 A;  4EQF A;  3N71 A;  1Z5S C;  3HYM B;  4ILG A;  4CDN A;  3SFY A;  4PS8 A;  3IEG A;  2DCP A;  3UKU G;  3L08 A;  1FVF A;  3HG0 D;  2VGY A;  5JA4 D;  2L0I A;  3ULQ A;  4K0R A;  2OND A;  2BF0 X;  2WXL A;  3R7Q A;  2P9K G;  5ENT D;  3TWS A;  2ETB A;  3CSF A;  3CVP A;  2KAT A;  2X6K A;  4HOS A;  4HB5 A;  5EID A;  2PL2 A;  1BD8 A;  4G25 A;  1ELR A;  1INZ A;  2DZN A;  4LUN U;  4OVU A;  1N4P A;  3ZYM A;  4ATG A;  3ONK A;  4AY5 A;  2AXV A;  4YDE A;  1OUV A;  4CCA A;  1HF8 A;  5FIN A;  4K5C A;  3HXB A;  4J8Y A;  4AY6 A;  1YA0 A;  3P2B A;  3MJW A;  2C2L A;  4RVB A;  2XEN A;  4GCO A;  4KZ0 A;  3ISM C;  4GA2 A;  1IQU A;  4PS7 A;  4YVO A;  4ILH B;  3NQP A;  4J8S A;  4W9R A;  2YIN A;  2IY0 C;  4O1O A;  5LCW J;  3HXC A;  5BXO A;  2WPV A;  4WWN A;  1HO8 A;  3PE4 A;  4MLP A;  5D2M C;  3Q78 A;  3Q7A A;  3D9K A;  2JAB A;  2A4Z A;  3IKO B;  3LY9 A;  4TV3 A;  3G2S A;  3FTV A;  5BV1 A;  2LSU A;  1HZ4 A;  5A23 A;  2FI7 A;  3DEO A;  3UT4 A;  3UX4 A;  2V8S E;  2KCV A;  5H7P A;  3U66 A;  3ZRH A;  3AJI A;  3D9O A;  3FEY A;  3ZUV B;  4UQY A;  3KEZ A;  5EYP F;  4GCN A;  3MCX A;  1U3D A;  3T8K A;  2R05 A;  3URZ A;  1QQE A;  3CIA A;  3DSW A;  2P9P G;  3AG1 E;  1LD8 A;  3S7B A;  3ZW3 A;  1OY3 D;  2VSX E;  1WAO 1;  2FUL A;  4N3B A;  3HDX A;  4F1P A;  3ML9 A;  3Q9U C;  5ENR D;  3DSS A;  2OV8 A;  5J08 A;  4EZK A;  4FU3 A;  1DVP A;  4XIF A;  3UQ3 A;  1IKN D;  1H6K A;  2OCC E;  3PZD A;  3IHY A;  3D3M A;  5KNH D;  3JYS A;  3PZ4 A;  4GTT A;  4HFG A;  4B8A A;  1OT8 A;  3CVN A;  2CHW A;  5EN5 D;  2IF4 A;  2XCB A;  3AAA C;  4HRM B;  3PRE A;  5AN8 A;  3MKQ B;  3MZL B;  1NP7 A;  5BW8 C;  3D9N A;  3LKU A;  3CR3 A;  4U8Y D;  3RSE G;  3AU5 A;  4HNA D;  3IV0 A;  4LCT A;  5G04 C;  2VGX A;  4N3A A;  3LY7 A;  3NAW A;  1UG3 A;  1PC2 A;  2QYU A;  4KVM A;  3NOC D;  1TNZ A;  5FWQ A;  4X8Q A;  3G2V A;  3J5Q B;  4HLL A;  1OWP A;  1H19 A;  4BT8 A;  2QYJ A;  1WG0 A;  3DSX A;  5BV0 A;  2PZI A;  5CRU A;  1W3B A;  5EIL A;  4WAF A;  4QFV A;  4A1S A;  4HOR A;  5FJY A;  2BKK B;  1DC2 A;  4ANX A;  4A3T A;  2A5E A;  4HBD A;  1MX6 A;  2LAI A;  5CEA A;  4KZC A;  4DPR A;  5EX0 A;  1EPU A;  3O48 A;  2XRZ A;  3EJN A;  3CK8 A;  3E30 A;  3B7B A;  4BFR A;  4YDY A;  4JXT A;  3B95 A;  2WXM A;  4L2Y A;  3FUD A;  2DWZ A;  3ESK A;  2VGX B;  2XZD G;  1B89 A;  4N5Q A;  1JCR A;  4JHR A;  3MKR A;  2QY7 A;  4Q96 A;  2WXO A;  1E8W A;  3DWL G;  3UI2 A;  2GRN B;  1HX8 A;  1EF1 C;  2V0P A;  3U4T A;  3SNX A;  2HE0 A;  4I9E A;  4EEC A;  3TWV A;  3TL5 A;  4WUY A;  3FH5 A;  1E8X A;  1MX4 A;  2BUG A;  2J8S D;  3EIQ C;  2DZO A;  4FA6 A;  5LCW C;  5BPP A;  1HG2 A;  2Y4T A;  3D9M A;  3QK0 A;  4GZ3 A;  3FTY A;  4I1A A;  4L1B A;  4URK A;  2IOS A;  1HS6 A;  1TNO A;  2ILR A;  4BTA A;  3OAW A;  2IFU A;  2X6F A;  4HVB A;  2KZT B;  1L5J A;  4TXR A;  3SF4 A;  3DPY A;  1U2V G;  4I2W A;  3HVE A;  3DPD A;  4DK5 A;  3R9A B;  5CMY A;  4F7A A;  4G8K A;  3VTY A;  4U7E B;  3F6Q A;  4GAA A;  1ZBP A;  3APD A;  4ZHB A;  2XEE A;  5T4Y A;  1Z3X A;  4DJA A;  1LD7 A;  5FQ7 A;  5ARF A;  4DX6 D;  3Q73 A;  2J4D A;  5DBK A;  5EX3 A;  2P2C P;  4CEM A;  1DCQ A;  3TG5 A;  5CBN A;  1BI7 B;  1N4S A;  3E37 A;  4HOT A;  4U0Z A;  4B8C B;  2WXI A;  1O1T A;  4FLB A;  4KYO B;  4KBQ A;  4DLO A;  3RKV A;  4APF A;  2UY1 B;  5KBA A;  4JHJ A;  2GRO B;  3KD7 A;  3CK7 A;  1HFA A;  1V55 E;  4AXH A;  5C1D A;  4FC8 A;  4UUC A;  3SBT B;  3TG4 A;  3OXG A;  5CCL A;  2BKG A;  4G8L A;  3VLF A;  2CHX A;  4CRW A;  3CHO A;  4UI9 J;  3JQ0 A;  4U96 D;  4N2Q A;  5B1A E;  2OOE A;  2MOW A;  2HYZ A;  3SFZ A;  1SA4 A;  4MRU A;  5HRY A;  2R59 A;  2WXK A;  1TR4 A;  4JVS A;  4JL0 A;  3UT8 A;  3ZXP A;  3TWX A;  5JJ7 A;  2JLB A;  4G26 A;  3ABM E;  3GYZ A;  1JUQ A;  2EIM E;  3PEV B;  4PDX A;  1FVH A;  4C48 B;  1UN8 A;  1O1S A;  4KT6 B;  2MYO A;  4N2S A;  3U9W A;  2IU1 A;  3E32 A;  3DXK G;  3ZVV A;  5HKP A;  3APC A;  3UPV A;  2RD0 A;  2XHE A;  2NSZ A;  3QWV A;  3Q5M A;  2RFM A;  4B94 A;  5DIZ A;  2DBA A;  5CRV A;  4XI0 A;  3FUK A;  3QOU A;  1HH8 A;  3TWQ A;  1K8K G;  4QQI A;  3ZU7 B;  3IBE A;  2Y3A A;  2CG3 A;  2KCK A;  3IHV A;  5FT9 A;  2DYR E;  4BWR A;  5AQA A;  2AVP A;  3LYA A;  3ZYQ A;  1KZO A;  1V54 E;  2I6H A;  3CHS A;  3S7J A;  3PUJ A;  4U07 A;  4RSY A;  3UIP C;  1Q2Z A;  3U3W A;  4BET A;  2XPI A;  3D9J A;  3D9P A;  1IQR A;  4GMJ A;  4A55 A;  3Q79 A;  2V4H C;  3MV3 B;  5E75 A;  4ANV A;  2CFU A;  1EDU A;  1MYO A;  4GU5 A;  4KVO A;  3PZ3 A;  3SI5 A;  4ANU A;  3CHP A;  3FU5 A;  3UMV A;  3B7T A;  4ATZ D;  1SA5 A;  1K3Z D;  2J9Q A;  3C5R A;  4XX5 A;  2VQ2 A;  3PH0 C;  3P1U A;  3CKB A;  3TWU A;  1E7U A;  2L9B A;  1TJC A;  3C72 A;  1H2T C;  2PNN A;  2R02 A;  3EU9 A;  4TRQ A;  2EIL E;  3TXN A;  2Y0B G;  2RG8 A;  1S63 A;  2IQC A;  3I4G A;  4OVV A;  2L6B A;  3L17 A;  4UQZ A;  1NZN A;  4GYY A;  1HU3 A;  3G2T A;  1OWN A;  1TYQ G;  5D0Q D;  3L16 A;  5CCM A;  2ZGG A;  2KM4 A;  4FAD A;  2FEZ A;  1OCO E;  2V5Q C;  1WM5 A;  1JCQ A;  4GZ5 A;  1FPP A;  1FCH A;  1NI1 A;  2MRI A;  3PRZ A;  2OVF A;  4JB8 P;  3LY8 A;  3Q7F A;  3LCA A;  4E85 A;  3HHM A;  4BEP A;  3UT7 A;  4GML A;  4HI8 A;  5AAO A;  3RO2 A;  1O1R A;  1Z3Y A;  2XCC A;  1QYM A;  3FUH A;  3MEK A;  1TNY A;  4EHM A;  3Q49 B;  3MGB A;  1BU9 A;  4N5C A;  3NF1 A;  4EZJ A;  1N4R A;  3CLJ A;  3EUV A;  5LP0 A;  3MV2 B;  3OXL A;  3TGO A;  3UTM A;  5ITZ F;  3QNK A;  4JHK A;  3I3N A;  2X3M A;  3OTN A;  3PZ2 A;  2VSY A;  4Z68 A;  4WND A;  3QWP A;  2P9L G;  4K03 A;  3JQ1 A;  1PAQ A;  1PY1 A;  2OEV A;  2PM7 A;  1OCZ E;  4G2V A;  3SFX A;  3Q47 B;  3CVQ A;  1WDY A;  3QAR A;  4AJW A;  5HQ8 A;  4AV7 A;  3FH7 A;  4C0E A;  3ZXS A;  4XE0 A;  3FUM A;  3FY4 A;  3D9L A;  1SZA A;  2M63 A;  3DST A;  2VGE A;  1MHQ A;  1N0R A;  1A17 A;  4F53 A;  4G1T A;  4WNF A;  3KSL A;  1TN8 A; 
#chains in the Genus database with same CATH homology
 3FTY A;  4I1A A;  4L1B A;  2HM8 A;  4URK A;  3T8M A;  1JPL A;  3ENE A;  5G55 A;  1ELK A;  4FUL A;  5C2Y A;  3FUL A;  2IOS A;  4AP2 A;  1HS6 A;  3PVL A;  4XKB A;  4EZL A;  4IRU A;  5AYW D;  4JEH A;  1XGW A;  3C98 A;  4GYW A;  4KXK B;  3S2A A;  3ZHE B;  3EHN A;  3FUJ A;  4UWH A;  3GW4 A;  3CK9 A;  2ILR A;  1UN9 A;  5FQ8 A;  3LJ3 A;  4BTA A;  5LX8 A;  4IN3 B;  4EBA G;  3EDT B;  2WXH A;  3OAW A;  2IFU A;  2X6F A;  3CQC B;  3HIZ A;  3G2U A;  3ZIM A;  3SD5 A;  3ZGQ A;  3ONL A;  4HVB A;  2KZT B;  3FTX A;  2J08 A;  1L5J A;  3SF4 A;  4I6E A;  3ZN3 A;  4I2W A;  3FP3 A;  3HVE A;  3DPD A;  2WXG A;  4PH4 B;  3EIJ A;  5LOZ A;  3SHF A;  4DI4 A;  4DK5 A;  2WQ7 A;  2PQN A;  3R9A B;  5CMY A;  4F7A A;  3VTY A;  4UI9 C;  3L6A A;  1MQS A;  4GAA A;  2J09 A;  4HOU A;  5BT1 A;  1ZBP A;  4I43 A;  3FU3 A;  4U8H A;  4GPK A;  3APD A;  4JZY A;  5KCM A;  5AIJ A;  4G11 A;  4AEZ C;  4NQ0 A;  2Y4U A;  3VLE A;  4AOF A;  4AVX A;  3QDN A;  4JA7 A;  1Z3X A;  5A7D B;  1ZU2 A;  5T4Y A;  4DJA A;  2VSN A;  2WMO A;  5FQ7 A;  5JJ6 A;  4J8D A;  4GB9 A;  4WWO A;  2XQ0 A;  4L23 A;  4CDR A;  5ARF A;  3CVX A;  3FU0 A;  2J4D A;  5DBK A;  5EX3 A;  2FO7 A;  3O4Z A;  4CEM A;  2VYI A;  4B89 A;  3TG5 A;  3CHQ A;  1LF8 A;  4UQX A;  3LDZ A;  4WNE A;  2XGO A;  2IOL A;  4XI9 A;  3B7U X;  4ACL A;  4HOT A;  1OWM A;  2GRL A;  4U0Z A;  4B8C B;  2NXP A;  3CVW A;  2WXI A;  1GW6 A;  4UWK A;  4FLB A;  4JEU A;  4KYO B;  1Z6T A;  4GZD A;  4KBQ A;  3CV0 A;  3U64 A;  4ACK A;  3S7D A;  1OWO A;  4RG9 A;  4DLO A;  3RKV A;  4APF A;  3RRM B;  3MKQ A;  2UY1 B;  4CGW A;  4JHJ A;  5G04 J;  2AW6 A;  4XZ4 A;  4NUR A;  3SBS A;  3FEX A;  3KD7 A;  3CK7 A;  3FFL A;  1HFA A;  3FDH A;  2IJG X;  3FH8 A;  3PS6 A;  4I1O B;  1Y8M A;  3RU0 A;  2WVI A;  4J8F A;  4L2L A;  4FC8 A;  2AXZ A;  4UI9 K;  3ML8 A;  4AXH A;  5C1D A;  5CMW A;  3SBT B;  3TG4 A;  2WQH A;  3NZU A;  2OVB A;  3OXG A;  5CCL A;  3VLF A;  2CHX A;  4H7X A;  4BX9 A;  3BEE A;  4EQF A;  3N71 A;  2EQX A;  4JC8 A;  3RIB A;  4CRW A;  3DBS A;  3MYV A;  3HYM B;  3CHO A;  4ILG A;  4UI9 J;  4J0U A;  4CDN A;  3GZ1 A;  3JQ0 A;  5FZQ A;  2DIW A;  4PS8 A;  4N2Q A;  3QAQ A;  3FWV A;  1NA0 A;  5HI7 A;  2OOE A;  3IEG A;  2MOW A;  2HYZ A;  2DCP A;  3L08 A;  1FVF A;  1KT0 A;  2LSV A;  5G05 J;  3SFZ A;  1UJJ A;  4MRU A;  5FZS A;  1P5Q A;  2C0M A;  2R59 A;  2WXK A;  4I2Z A;  2VGY A;  4JVS A;  4P29 A;  4JL0 A;  3UT8 A;  5AEN A;  2YQ8 A;  4OYS A;  4ILI A;  3LS8 A;  4WNG A;  2L0I A;  3ULQ A;  4IYP A;  4K0R A;  5JJ7 A;  1OWL A;  2OND A;  2LAH A;  2BF0 X;  2JLB A;  3K9I A;  4G26 A;  2WXL A;  4G24 A;  3QKY A;  4R7L A;  5ARG A;  2I1K A;  3BG1 B;  5KJM A;  1U3C A;  3R7Q A;  3GYZ A;  3ASH A;  5ANR A;  4GA0 A;  1JUQ A;  3PEV B;  4PDX A;  1FVH A;  4APO A;  3ZEF A;  4F1S A;  4FP7 A;  4IUL A;  4TUU A;  1UN8 A;  4KT6 B;  2YNQ A;  4LER A;  3CSF A;  2V5F A;  4YVQ C;  2I2O A;  3CVP A;  2KAT A;  2WXR A;  2X6K A;  4HOS A;  4N2S A;  3U9W A;  1E90 A;  1S0P A;  2IU1 A;  3PNT B;  2GRM A;  2PL2 A;  5JHA A;  4G25 A;  1ELR A;  1INZ A;  3ZVV A;  3SZ7 A;  4LUN U;  3APC A;  4OVU A;  3UPV A;  2RD0 A;  3ZYM A;  2XHE A;  2NSZ A;  3QWV A;  3ONK A;  3ESL A;  4ATG A;  2AXV A;  1E8Y A;  4JPS A;  3Q5M A;  4B94 A;  4AY5 A;  5EKQ D;  5DIZ A;  1JWF A;  1OUV A;  4UWG A;  3S7F A;  3TAX A;  4CCA A;  1HF8 A;  3RRU A;  2DBA A;  2VTB A;  4FLH A;  3AU4 A;  4AY6 A;  4XI0 A;  1YA0 A;  3P2B A;  2YHC A;  3MJW A;  2C2L A;  3GZS A;  3CKC A;  4RVB A;  2QFC A;  3FUK A;  4Y6W A;  4GCO A;  3QOU A;  4KZ0 A;  4N3C A;  3CVU A;  1HXI A;  3CGH A;  3G2W A;  4GA2 A;  4V3I A;  1HH8 A;  1BPO A;  1TEZ A;  3FHE A;  1IQU A;  4PS7 A;  3IBE A;  2Y3A A;  3MA5 A;  2XPY A;  4YVO A;  5G2N A;  2CG3 A;  2KCK A;  3IHV A;  3R7R A;  3LEW A;  5FT9 A;  4BWR A;  4ILH B;  3NQP A;  4J8S A;  4W9R A;  2GW1 A;  2AVP A;  2YIN A;  3JCK C;  4I6G A;  3FTS A;  3LYA A;  5LCW J;  3FTW A;  4FHK A;  3ZYQ A;  2L0T B;  2WXN A;  2I6H A;  2WPV A;  4Y6C A;  3CHS A;  3CST A;  3S7J A;  3PUJ A;  4U07 A;  2C0L A;  4RSY A;  3KAE A;  1NA3 A;  4WWN A;  1HO8 A;  4EBA A;  3U3W A;  3PE4 A;  1HG5 A;  2XPI A;  2WB2 A;  4MLP A;  4MKT A;  4ANW A;  5FQ4 A;  3D9J A;  3D9P A;  4C0M A;  1E96 B;  3B7R L;  3FUE A;  3D9K A;  1IQR A;  2A5U A;  2A4Z A;  3AS8 A;  2J07 A;  3IKO B;  3LY9 A;  2NC9 A;  3G2S A;  4TV3 A;  3KS2 A;  1JWG A;  4GZC A;  3CHM A;  3FTV A;  4GMJ A;  5BV1 A;  4A55 A;  4U63 A;  2LSU A;  3LVR E;  4JA9 A;  3AS5 A;  1HZ4 A;  3MV3 B;  4FJY A;  4LRZ A;  5E75 A;  3RRN B;  4ANV A;  2FI7 A;  2CFU A;  4NRH B;  2WXJ A;  1EDU A;  3UT4 A;  4AM9 A;  2AXU A;  3I4R B;  1IYG A;  5A23 A;  3UX4 A;  2V8S E;  2KCV A;  4GU5 A;  2I1J A;  3U66 A;  4KVO A;  3ZRH A;  2X6J A;  3D9O A;  3FEY A;  3SI5 A;  3FUN A;  4UQY A;  3KEZ A;  3QWW A;  4ANU A;  4GCN A;  1Y6I A;  3CHP A;  1U3D A;  3FU5 A;  3HVE B;  3MCX A;  2KCL A;  3B7T A;  4HOQ A;  3UMV A;  4U0S A;  3URZ A;  1QQE A;  3CIA A;  3SGH A;  2KZT A;  1H0A A;  2E2E A;  3L13 A;  5ENN A;  2E0I A;  2VTB B;  3S7B A;  3ZW3 A;  3B13 A;  2VSX E;  4HS2 A;  4BY6 A;  1WAO 1;  2FUL A;  2J4B A;  3ZFW A;  4N3B A;  1QZ2 A;  1EYH A;  2J9Q A;  3QK0 A;  2WQ6 A;  3HDX A;  4H7Y A;  2J49 A;  4M3O A;  5LFA A;  4I1M A;  3ML9 A;  4XX5 A;  3RJV A;  5T8I A;  2OV8 A;  1SZ9 A;  2FBN A;  4MS6 A;  2VQ2 A;  2LO6 A;  3PE3 A;  5J08 A;  3PH0 C;  3P1U A;  4FJZ A;  4BSX A;  4EZK A;  2MHK A;  3CKB A;  4FU3 A;  3WXX A;  3Q15 A;  1DVP A;  2V4L A;  5CHE E;  1E7U A;  2L9B A;  1TJC A;  4E6H A;  3PDN A;  1N54 A;  4XIF A;  3UQ3 A;  1H6K A;  4HXI A;  5T3R A;  4BX8 A;  1H2T C;  3LVQ E;  5KJL A;  3PZD A;  3IHY A;  2WXQ A;  3D3M A;  3JYS A;  4I6J A;  5ANL A;  3ZPJ A;  4TRQ A;  4BTB A;  2XGM A;  5JJT A;  4HFG A;  2UWJ G;  4B8A A;  3TXN A;  2XRY A;  2RG8 A;  3CVN A;  2CHW A;  2IQC A;  2IF4 A;  2VSO E;  2XCB A;  5FZR A;  5AJL A;  3PRE A;  3I4G A;  4C9B B;  3MKQ B;  3B7S A;  3UUX A;  3MZL B;  1NP7 A;  5KJN A;  5BW8 C;  4I9C A;  3D9N A;  3LKU A;  3CQG B;  4PS3 A;  3E4B A;  4OVV A;  2BTD A;  2HR2 A;  4JW1 A;  4O6F A;  2UY1 A;  3CEQ A;  3L17 A;  4UQZ A;  3CR3 A;  2WXP A;  1NZN A;  3EHM A;  3MX3 A;  3AU5 A;  3CHR A;  4GYY A;  1HU3 A;  2CHZ A;  2YHE A;  2FF4 A;  3G2T A;  3IV0 A;  4LCT A;  1OWN A;  4U04 A;  5G04 C;  5D0Q D;  3L16 A;  2VGX A;  4N3A A;  5CCM A;  3LPZ A;  3LY7 A;  5FQ6 A;  3GZ2 A;  5A6C A;  3ZYL A;  1QNF A;  2L6J A;  1UG3 A;  1PC2 A;  2KM4 A;  1H2V C;  2JEK A;  3FTU A;  3L54 A;  4FAD A;  2FEZ A;  3ZYK A;  4KVM A;  1DNP A;  3FU6 A;  1XNF A;  1WM5 A;  1H2U A;  3PUK A;  2KC7 A;  4GZ5 A;  5FWQ A;  1UJK A;  5E76 A;  1FCH A;  3G2V A;  3LXU X;  3TJP A;  3TXM A;  2MRI A;  3PRZ A;  2CG2 A;  5M72 A;  2OVF A;  1OWP A;  3NZS A;  3Q4A B;  1E8Z A;  1H19 A;  3LY8 A;  3LCA A;  4BT8 A;  4E85 A;  3HHM A;  3UT7 A;  4Q94 A;  5JHB A;  3FUI A;  4GML A;  4CDM A;  2PZI A;  1X5B A;  1IHG A;  3RO2 A;  5BV0 A;  1W3B A;  1Z3Y A;  2XCC A;  5G05 C;  4NAC A;  3QB2 A;  2WM9 A;  2I9C A;  4PUC A;  4QFV A;  4WAF A;  3FUH A;  4A1S A;  4ABN A;  4HOR A;  1KT1 A;  5FJY A;  2WXF A;  3T5V A;  3MEK A;  3QC1 A;  2R5S A;  3Q49 B;  4ANX A;  3MGB A;  2PQR A;  3FTZ A;  4A3T A;  4N5C A;  3NF1 A;  5EDS A;  4EZJ A;  5J90 A;  1SQM A;  5KJK A;  2LAI A;  4B0Z A;  3CLJ A;  1TJF A;  5LP0 A;  3MV2 B;  4KZC A;  4GZ3 A;  4DPR A;  3I5P A;  5EX0 A;  4HLE A;  4KMO A;  1EPU A;  3OXL A;  3O48 A;  4G23 A;  3TGO A;  3ZHE A;  5AJD A;  1HE8 A;  3OXF A;  4CT0 A;  3QJZ A;  3RO3 A;  3ASD A;  3BG0 B;  2XRZ A;  3QNK A;  3EJN A;  4D10 C;  2XGS A;  3CK8 A;  5FTP A;  1E7V A;  3D9I A;  4JHK A;  4BFR A;  4J6I A;  3I3N A;  4JXT A;  2X3M A;  3OTN A;  2WXM A;  4A1G A;  4L2Y A;  4XKC A;  3L22 A;  2VSY A;  4GYO A;  2CFZ A;  4J8E A;  4WWP A;  3VTX A;  1WY6 A;  3FUD A;  3ESK A;  5BUZ A;  4I17 A;  3PEU B;  1N52 A;  1VDY A;  1ELW A;  2VGX B;  4WND A;  1B89 A;  3CVY A;  3QWP A;  4UWF A;  4K03 A;  4CGV A;  1KLX A;  2PM6 A;  3JQ1 A;  4DLQ A;  1PAQ A;  1PY1 A;  3PNL B;  3ASG A;  4JHR A;  2PM7 A;  3APF A;  3MKR A;  3T5X A;  2QY7 A;  4Q96 A;  2X6I A;  2WXO A;  4YND A;  4RG6 A;  4G2V A;  3JUI A;  1E8W A;  4DI3 A;  4FHJ A;  3Q47 B;  3AS4 A;  1HX8 A;  1EF1 C;  3VLD A;  4N39 A;  3CVQ A;  3CVV A;  4LEU A;  2V0P A;  4GZ6 A;  3U4T A;  2AWI A;  4EPZ A;  3SNX A;  3QAR A;  4I9E A;  4EEC A;  4AJW A;  4L7T A;  4UWL A;  5HQ8 A;  3TL5 A;  4A3V A;  4WUY A;  4AV7 A;  2P58 C;  3FH7 A;  4AIF A;  4C0E A;  4F3V A;  5D0O D;  3FUF A;  4Q69 A;  2XEV A;  4CT4 A;  3FH5 A;  1E8X A;  4U0U A;  1UW4 B;  2WMN A;  2HO1 A;  3ZXS A;  4XE0 A;  2XPZ A;  3FUM A;  2R17 C;  2BUG A;  2X6H A;  2X38 A;  3EIQ C;  3FY4 A;  2VJ8 A;  3D9L A;  4GA1 A;  4BT9 A;  5LCW C;  4FA6 A;  2LNI A;  1SZA A;  5BNW A;  2Q7F A;  5BPP A;  2M63 A;  3ASF A;  1HG2 A;  2ZU6 B;  1MHQ A;  4ME2 A;  2ION A;  2Y4T A;  3RK6 A;  1A17 A;  4F53 A;  3CVL A;  3D9M A;  4G1T A;  2GGF A;  4WNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...