2AVPA

Crystal structure of an 8 repeat consensus tpr superhelix
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
68
structure length
68
Chain Sequence
AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords synthetic consensus TPR protein
publication title Structure and stability of designed TPR protein superhelices: unusual crystal packing and implications for natural TPR proteins.
pubmed doi rcsb
total genus 27
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2avpA00
4UQZA 4BWRA 5C1DA 2KCKA 2PQRA 1ZU2A 5ARFA 4I1AA 3WXXA 4N3AA 3CVPA 2LNIA 4G25A 4HOUA 2C0MA 3LPZA 3E4BA 3MEKA 5G04J 3CVLA 4KBQA 4I9EA 2XCCA 3CK8A 3Q49B 4GYYA 3QOUA 5FJYA 2E2EA 2BUGA 2VYIA 3UUXA 4JL0A 5LCWC 3ZGQA 1WM5A 2GW1A 5HI7A 1YA0A 2OOEA 3TG4A 2PQNA 3S7FA 5FZQA 3OXFA 3GZ2A 3CKCA 3LCAA 2YHCA 3LY7A 4NRHB 3S7DA 3LY9A 4GA1A 4Y6CA 3GZ1A 3S7JA 4GCOA 3CKBA 4GCNA 2UY1B 2IFUA 3SF4A 2XPIA 3CEQA 5BNWA 2FBNA 2IF4A 4U04A 4CGVA 5HQ8A 5G05C 4YVQC 1HH8A 4AY5A 1A17A 4GYOA 4AIFA 4G23A 1FCHA 3RKVA 3TGOA 2HO1A 1B89A 4I2ZA 3ASHA 5EKQD 4EQFA 5DBKA 1IYGA 4WUYA 4BTAA 4UQYA 3VTXA 3ZHEA 3FP3A 3ASFA 2YQ8A 5A7DB 4UQXA 2FO7A 5CCLA 5A6CA 4B94A 5D0OD 4XI9A 2KCLA 1Y8MA 3AS4A 3FFLA 3QWWA 4GPKA 5CHEE 2HYZA 3SZ7A 2R5SA 3ZFWA 3IEGA 4BT8A 2C2LA 2Q7FA 4I9CA 4GYWA 4BTBA 2XGMA 4U0SA 4Y6WA 2C0LA 4N5CA 4G1TA 5FZSA 4JA7A 4JA9A 3FWVA 4AM9A 3NF1A 1KT1A 3GYZA 2LSUA 2HR2A 2VQ2A 4I17A 2ONDA 5AYWD 5KJLA 4J8DA 4IN3B 5JJTA 3UPVA 4GZ5A 5KJNA 4GA2A 3ULQA 4WNDA 4UI9C 2I6HA 3EDTB 1NA0A 4KXKB 1KLXA 3ZHEB 1HXIA 1ZBPA 4F3VA 3HYMB 5ARGA 5FTPA 2Y4TA 2KC7A 5CCMA 3KD7A 4UI9K 2XGSA 3CV0A 3CVNA 4BT9A 3QWVA 4RG9A 4HOSA 3U4TA 1TJCA 3MA5A 5KJKA 5BT1A 3RJVA 2WPVA 3QKYA 5KJMA 2KCVA 2LSVA 2VGXB 4HORA 3ZN3A 2UWJG 1KT0A 1ELRA 2L6JA 2AVPA 3Q5MA 3CVQA 3K9IA 3LKUA 2Y4UA 4ME2A 1IHGA 3Q47B 1ELWA 1WAO1 2VSNA 4N3BA 2V5FA 4J0UA 2WQHA 5BW8C 1QQEA 3U3WA 4NQ0A 5LCWJ 4U0ZA 4WNFA 5M72A 4HOTA 2PZIA 2VGXA 3OXLA 4UI9J 4LEUA 3LY8A 4H7YA 3MKRA 3JYSA 4WNEA 3KAEA 4WNGA 2JLBA 3MV2B 1W3BA 5EX0A 4YNDA 4N2QA 2DBAA 3BEEA 3ASDA 5G05J 2XEVA 3OXGA 2MHKA 3TG5A 3TAXA 3CK9A 3PDNA 3CK7A 3Q4AB 2J9QA 3S7BA 3URZA 1NZNA 3PE3A 3UQ3A 4H7XA 3GW4A 1HZ4A 4I2WA 4U07A 3RIBA 3PE4A 4W9RA 4ABNA 3R9AB 4O6FA 3MV3B 3Q15A 4XIFA 1NA3A 3AS8A 4JHRA 1OUVA 1E96B 3RO3A 2NC9A 2P58C 3RU0A 2FEZA 5D0QD 3QWPA 3ESKA 5DIZA 5G04C 1QZ2A 4A1SA 4CGWA 5EX3A 1PC2A 3AS5A 3QDNA 3VTYA 1P5QA 4HOQA 3ASGA 4N39A 5JJ7A 2XGOA 4KYOB 2VSYA 3RO2A 4G2VA 4RG6A 5FT9A 2KATA 4J8EA 2QFCA 4U0UA 4G26A 1XNFA 4APOA 4XI0A 4GZ6A 3LYAA 4N2SA 2UY1A 4J8FA 3ZPJA 3N71A 4AY6A 3O48A 4YVOA 3KS2A 2PL2A 4GA0A 2FF4A 4N3CA 2FI7A 4G24A 2VGYA 5FZRA 4CDRA 5JJ6A 4GZ3A 2XCBA
chains in the Genus database with same CATH superfamily
2IY0C 1LD7A 1DC2A 4UQZA 2L0IA 1Z3YA 4BWRA 3AG1E 3HIZA 1O5MA 5C1DA 4YDYA 3CR3A 1ZU2A 1UG3A 4HB5A 3PNLB 4FJYA 2LNIA 2C0MA 5FINA 4B0ZA 4EBAG 5AARA 3MEKA 4JD2G 5G04J 1TNUA 3JUEA 4DX5D 2XPZA 4I9EA 2CHZA 2XQ0A 2IJGX 2E2EA 5ENNA 1SA5A 4UWFA 1L5JA 3B7RL 4HRMB 4KT6B 1UN8A 2ZXWE 3UUXA 5LCWC 3I5PA 1WM5A 3OTNA 3UINC 3D9IA 3S7FA 5BV0A 4MS6A 3OXFA 4KZCA 3CKCA 3LY7A 4BX8A 2P9LG 3S7JA 3CKBA 4BERA 2IFUA 3MCXA 3SF4A 3FUNA 2WM9A 2XPIA 4XKCA 1O1SA 4U04A 2LXLA 5T4YA 4AOFA 2CFZA 4YVQC 2DCPA 4G23A 5AJLA 4KVMA 3RKVA 4L2LA 4F6RD 2AWIA 4AVXA 1H19A 2NSZA 4EQFA 5BUZA 2QZAA 5KBAA 2CFUA 3E37A 5A7DB 3HRAA 4GTMA 2WQ6A 1LD8A 1BU9A 1QBQA 4XI9A 4NURA 2R17C 3EU5A 3QWWA 4GPKA 5CHEE 4JHKA 2WXFA 2XPYA 4EZLA 2C2LA 4DX1A 4ILGA 3ZIMA 3SI5A 2P9IG 4GYWA 4OVVA 5LX8A 5JHBA 2QYUA 2F37A 4Y6WA 2C0LA 4PUCA 4JA7A 1TNBA 3EUVA 5J08A 1N4SA 1TJFA 4HVBA 3APFA 3L17A 4E85A 2LSUA 3AJIA 3ONKA 2HR2A 3PRZA 3G2UA 2ONDA 4HLLA 5A23A 1O1TA 3L82A 4GZ5A 2J8SD 5KJNA 4BETA 3EDTB 4PS3A 5JHAA 3V2XA 4KXKB 3ZU7B 4HNAD 4EHMA 3DPDA 2IONA 3U9WA 4ILHB 4F3VA 4A3TA 3TWWA 3HYMB 5CCMA 4Z68A 4YDWA 1E8ZA 3RAUA 3LJ3A 1N95A 3CV0A 1QYMA 4RG9A 4HOSA 2NYJA 2WPVA 4OVUA 5AQBA 4K0RA 3CGHA 4F1SA 5BV1A 4EZKA 5KJMA 1N9AA 4HRNA 3UT4A 3FU6A 5CRUA 3QB2A 3CVYA 3DSXA 2BKGA 1ELRA 3FUDA 2AVPA 1OCOE 2IQCA 3Q5MA 2J09A 3G2WA 4ME2A 1IHGA 4B8CB 3UT8A 1Y6IA 4CDMA 2V5FA 4M3OA 3ASNE 4LG6A 1N0RA 1NL4A 3BG1B 3CHSA 3HG0D 1PY1A 3ULYA 2AXVA 3OXLA 3MKQB 3QARA 3MKRA 3JYSA 2CG2A 4WNEA 1H2TC 3KAEA 4HBDA 2LO6A 1W3BA 5ANRA 2XZDG 5EX0A 4N2QA 2XZTG 3NZUA 2J4BA 4BX9A 3I4GA 3NAWA 4FA6A 1MZCA 3TXMA 5ENQD 3TG5A 4U8HA 1MX6A 5FIOA 2J9QA 4GTSA 3PE3A 3UQ3A 4P29A 2XHEA 1UW4B 1SA4A 1V55E 1OCZE 1HZ4A 3D9NA 1H6PA 4TV3A 3W9FA 1E7UA 3RIBA 3PE4A 1ELKA 4W9RA 4E6HA 3IXEA 5ANLA 3TWSA 3DEPA 3PZ1A 4RVBA 1N54A 4A63B 3KSLA 3R9AB 4O6FA 4XIFA 4UWHA 2WXOA 1OUVA 1E96B 2NC9A 2P58C 3RU0A 2FEZA 5D0QD 3C3OA 3QWPA 4DX6D 3EHRA 2DYSE 4A1SA 3FTZA 3FUIA 5EX3A 4B93B 3QDNA 2F8YA 4DRXE 3KEAA 1V54E 4BY6A 4N39A 5JJ7A 2J49A 1H6KA 2XGOA 1X5BA 2RD0A 2LUHA 2R02A 4G2VA 4IULA 4RG6A 3EHMA 3UM0A 4APOA 4TUUA 4AXHA 4L2YA 4DK5A 2R05A 4J7WA 3N71A 3T8MA 3SNXA 3O48A 2BKKB 4YVOA 4JPSA 4GA0A 3LDZA 2FF4A 3SO8A 4U63A 4AP2A 4ANUA 3CHPA 3QJZA 2XCBA 2OV8A 4BSZB 4JW1A 4ATZD 1UOHA 4DLQA 3PVLA 4HS2A 2VSOE 5EIBE 3UM1A 2HM8A 5ARFA 4PS8A 4I1AA 3Q78A 4KMOA 4HOUA 4JEUA 3LPZA 2WXHA 1K1BA 5ITZF 4CYMD 4O1OA 4GYYA 3E33A 3QOUA 2BUGA 3EHNA 3LVQE 4JL0A 1N11A 3V30A 4U96D 5KNHD 4C9BB 2OOEA 2OEVA 5FZQA 1D8EA 2QC9A 2MRIA 3ZVVA 2WXKA 4NRHB 3B95A 3S7DA 3GZ1A 5ENRD 4GCOA 1TN7A 1FVHA 2UY1B 4BFRA 2J08A 5BNWA 2FBNA 2IF4A 2GRQB 3UM3A 5HQ8A 3UKUG 4AY5A 4K5CA 5AQAA 1FCHA 4JVSA 2HO1A 2XRYA 1B89A 2ZU6B 3ASHA 3ABLE 4I2ZA 2KBXA 2WXNA 3DXKG 2CHXA 3UX4A 1HX8A 4WUYA 4FC8A 4DX7D 1JUQA 4NACA 1X81A 3ASFA 2WXJA 2IO2C 3SFZA 3TWTA 2WXGA 1YCSB 4UQXA 5B1AE 2KZTA 1K8KG 2XS8A 4DUIA 2RFMA 1JWGA 1Y8MA 3AS4A 1OXJA 5AAOA 2R5SA 3IEGA 5CMWA 1QNFA 4BT8A 5FWQA 1DCEA 4I9CA 4UUCA 1TNZA 4AJWA 2XGMA 2IOLA 4RLYA 4C0MA 1IQUA 4U0SA 4HI8A 2RFAA 3HVEA 3JXJA 1E8XA 4HLEA 4N5CA 1WY6A 1K1AA 1Q2ZA 2JABA 4G1TA 2V4HC 2LAIA 3Q79A 4GTTA 3FY4A 2LXMA 4EBAA 4ZFHA 5BPPA 1RZ4A 3NF1A 3UXGA 4DLOA 3D9MA 4TRQA 3TWQA 4L1BA 3D9LA 2VQ2A 5KJLA 4IN3B 1JCSA 5JJTA 3UPVA 2RKKA 3PEUB 3FUEA 1OWLA 1HXIA 1NFIE 2B6CA 4A3VA 5CEDB 3ISMC 2MOWA 5ARGA 4IRUA 3FHEA 5FQ6A 1HG2A 2Y4TA 3DSUA 1MJ0A 3RRMB 3WG7E 3KSQA 2IEJA 1HG5A 3QWVA 5KWDA 3U4TA 1TJCA 5KJKA 4LNGA 4GMJA 5BT1A 3FTSA 3QKYA 3NQPA 2DWZA 3ESLA 2KCVA 5AQ7A 3V31A 2ZISA 4MBGA 2X6FA 1UJKA 5EYLA 2Y4UA 3BG0B 3Q47B 1ELWA 2VSNA 3NB2A 4RSYA 4GPMA 3G2TA 4L23A 5BW8C 3CVWA 1QQEA 3HHMA 4U0ZA 4I1OB 5M72A 4HOTA 4Q96A 2PZIA 2BF0X 3AG4E 5HRYA 4LEUA 3FUJA 3FTYA 3FUHA 1H2UA 5G2NA 1H0AA 2YINA 3JQ0A 3W9GA 2JLBA 3MV2B 2A4ZA 4OYSA 3SBTB 2IO3C 4YNDA 4GZDA 4HFGA 2I1JA 3ASDA 5G05J 3SY2A 3OXGA 2GROB 3E34A 3TL5A 3Q4AB 2ZGDA 4K5BA 3S7BA 1K3ZD 3URZA 1G3NB 1NZNA 3OAWA 5EYPF 4I6GA 5ENTD 4A1GA 3ZNGA 5BXUA 5KCMA 3ONLA 4U07A 1GW6A 1JCRA 3TWVA 2HE0A 1RW2A 3C3RA 1NA3A 1TN8A 3R7QA 1SZ9A 3HDXA 3ESKA 2ETBA 3CIAA 4GTPA 3APCA 3FH5A 4JXTA 3FEYA 2RG8A 3AU4A 4F1PA 2X6IA 3FTWA 1PC2A 3L16A 3AS5A 1P5QA 5ENPD 1FPPA 5EIDA 4G8LA 1KPSB 4PH4B 2Y3AA 3PZ4A 3HXDA 4ANXA 4AV7A 2QYJA 1Z6TA 4Q69A 4ZHBA 2P9NG 5B3SE 3ZRHA 3FH7A 4G26A 3SFYA 2WB2A 3BU8A 1IKND 4XI0A 4OAUC 3ZYLA 3LYAA 2OCCE 4FHJA 1HO8A 5JMND 3TWUA 3V79K 3ZKJA 5FZRA 4GZ3A 1NI1A 5HKPA 3SD5A 3D9OA 2YHEA 4EECA 3E30A 2EIME 2KCKA 3ML9A 3T9KA 3U66A 3FUMA 3WXXA 3CVPA 3FUKA 4QQIA 3CVLA 4KBQA 2XRZA 2OVFA 3CK8A 3EIQC 5FJYA 5ENOD 3D9KA 3PNTB 1HU3A 3J5QB 2VYIA 2XS1A 2GW1A 5HI7A 2ZGGA 3Q9UC 5E76A 3GZ2A 3LCAA 2YHCA 4MRUA 4O1PA 3QC1A 1E90A 2X38A 4GTQA 1HFAA 5T8IA 4Y6CA 3EJNA 3ABME 3L9TA 4OAVB 3FU5A 2V0PA 2GRRB 3G2SA 3NOCD 3PH0C 1E8WA 4C48B 3JQ1A 4G8KA 2KXPC 2ETCA 3PUKA 3C5RA 2V5QC 3TGOA 1OCRE 2J07A 4GU5A 2GRLA 5CEAA 4WWPA 5H7PA 5EKQD 5DBKA 4NIKA 1IYGA 3ZEFA 4BTAA 4UQYA 3Q9NC 4JZYA 3FP3A 3ZHEA 1BD8A 1O1RA 4A55A 5CCLA 4APFA 3QAQA 4B94A 4CEMA 3LEWA 4BSXA 5G55A 4KZ0A 3UMVA 2J4DA 1H2VC 4B89A 1H6OA 3ENEA 3FFLA 4CRWA 1DVPA 3R7RA 4GMRA 2AXZA 4I6EA 3Q7FA 3AU5A 1TN6A 3Q7AA 2BTDA 5AN8A 4BTBA 1MHQA 1FT2A 4L7TA 1N94A 3C3QA 3MJWA 4JC8A 2ILRA 3DSSA 4JA9A 2KM4A 4KVOA 4WWNA 2WXRA 1KT1A 1OWPA 4GTVA 3GYZA 5EN5D 4CZ2D 1D8DA 4U7EB 3SGHA 3O4ZA 2VSXE 2V4LA 2R59A 5AYWD 1MYOA 3FH8A 2M63A 3FTUA 1SQMA 2BEDA 2GRNB 3BQOA 4WNDA 4UI9C 2I6HA 1NA0A 2DZNA 4R7LA 1KLXA 3IHYA 1HS6A 2AJAA 4CDNA 1S0PA 2P9KG 2I2OA 1ZBPA 4RQIA 3T5XA 4YDOA 2KZTB 2Y0BG 1S63A 4PDXA 3C72A 3CHQA 3KD7A 3PEVB 3LS8A 4I1MA 4UI9K 2WMOA 3CVNA 2L9BA 3PS6A 4BT9A 2DYRE 2I1KA 4CT0A 3RJVA 5IY5E 3TWRA 5D66A 3UI2A 4AEZC 4HORA 3DXMG 3ZN3A 3HVEB 4LRZA 4UWGA 1KT0A 2L6JA 2XENA 3TJPA 4JEHA 1EPUA 4IYPA 3K9IA 3L6AA 4F53A 2X3MA 3GZSA 3PZDA 2DVWA 5LCWJ 3S2AA 1HE8A 4M7CA 3IHVA 2CHWA 3PZ2A 1KZOA 1SZAA 3B7BA 4UWKA 3CQGB 4DJAA 1TNOA 1DNPA 2AW6A 3C98A 3MX3A 1OT8A 1YYHA 5HS0A 3PREA 2DBAA 2XEVA 4PS7A 4CCAA 1IHBA 2MHKA 3NBNB 4URKA 3TAXA 2H6GA 3CK9A 3BUAA 3PDNA 3PUJA 3HXEA 3Q75A 2VGEA 2WVIA 4H7XA 3DSTA 3TWXA 2P9SG 3X2QE 3AG3E 4I2WA 3CHRA 4MKTA 3LVRE 5B1BE 1N0QA 3QNKA 1EDUA 1EF1C 3MV3B 3Q15A 2DIWA 2GRPB 2NXPA 3RO3A 3UIOC 5CECB 2XEHA 5G04C 1QZ2A 4XE0A 3NZSA 3D9JA 3IBEA 1FVFA 2P9UG 3VLEA 2LAHA 4FJZA 3CHMA 2Y69E 1JWFA 4ANVA 3ASGA 5AIJA 3TXNA 5EDSA 4KYOB 3RRUA 2X6JA 2VSYA 5T3RA 1FT1A 3ZW3A 3DSVA 4LERA 5FT9A 4EPZA 3UIPC 2KATA 3B7TA 4J8EA 5J90A 4U0UA 3ZYQA 2OVBA 1XNFA 4TXRA 1BI7B 3APDA 3DEOA 4FP7A 4GZ6A 2B0OE 4F7AA 3CVXA 4N2SA 1IQRA 3ML8A 3LJNA 3L54A 1INZA 2EQXA 4QFVA 1OWOA 2CG3A 3SQVA 1D9SA 5JA4D 2WXMA 3KS2A 3KEZA 3LXUX 2F0YA 4G24A 1N4PA 5JJ6A 4FHKA 4HXIA 3EIJA 3CLJA 3UKRG 1LTXA 4O60A 4XX5A 1TEZA 3FDHA 1UN9A 1SVXA 3VLDA 2PQRA 1KZPA 3Q73A 4Q94A 4N3AA 3JCKC 3ZYMA 4XKBA 4G25A 3E4BA 3J5PA 1S70B 3ZUVB 4FU3A 4MLPA 2XCCA 3RK6A 3R9MA 5CERB 2DZOA 3Q49B 3SFXA 5LP0A 3FTVA 3ZGQA 4HI9A 1DCQA 1YA0A 5EILA 2WQ7A 2PQNA 3TG4A 4BESA 2PNNA 4GTOA 4DI4A 3FUFA 4DI3A 2ZIRA 1VDYA 3LY9A 4GA1A 1OWNA 3ULEG 4GCNA 4TUMA 3DRAA 1JCQA 3CEQA 2PM6A 4CGVA 5G05C 1HH8A 4U8YD 1A17A 5AJDA 4GYOA 4AIFA 2P9PG 3T8KA 3CSFA 4V3IA 4ACLA 2IU1A 3P1UA 1MX4A 3MGBA 2L6BA 1ZB1A 4DX2A 3HXFA 5LOZA 1U2VG 3VTXA 4FADA 3I4RB 2YQ8A 4XZ4A 4YDEA 2WXPA 4FULA 2FO7A 4TXQA 5A6CA 1S64A 5D0OD 2R03A 1UJJA 5FQ7A 2KCLA 5CRVA 3MYVA 2EIJE 4UWLA 2HYZA 2EIKE 3SZ7A 1JPLA 2AXUA 4I6JA 3ZFWA 3ASOE 1A5EA 2OEWA 5D2MC 2H6FA 2Q7FA 3FEXA 3FULA 4EZJA 3B7UX 5FZSA 4LCTA 2GRMA 3FWVA 2FO1E 4AM9A 1PAQA 4ILIA 2H6IA 4I17A 4J8YA 5LFAA 1MQSA 4J8DA 3ZXPA 4G11A 4GA2A 3ULQA 1TR4A 3D9PA 3MKQA 3G2VA 3ZHEB 1TNYA 3B7SA 3VLFA 4JHJA 4BEPA 4WAFA 3SHFA 4N5QA 2R2LA 3I3NA 1LF8A 3NOGD 2YNQA 1YMPA 3CSTA 5FTPA 4B8AA 2KC7A 2Y1LE 4D10C 2ETAA 1WG0A 2XGSA 4L9PA 4TXPA 3CVVA 4DPRA 1BPOA 4HRLA 5FQ8A 3MA5A 3L13A 4U95D 5ENSD 3EU9A 2PM7A 2WMNA 2LSVA 3PZ3A 2VGXB 4LNUD 2UWJG 3ZYKA 2WXIA 3F6QA 1OWMA 3IKOB 3CVQA 2F8XK 3JUIA 2X6KA 3LKUA 1WAO1 1AWCB 4N3BA 4ACKA 4J0UA 2WQHA 3DBSA 5CMYA 3AG2E 3U3WA 4NQ0A 4WNFA 2H6HA 4K5AB 3ZXSA 2A5UA 1N4RA 5AENA 3DSWA 2FULA 1SW6A 2VGXA 4GB9A 4FLHA 4UI9J 2E0IA 3LY8A 4H7YA 4JB8P 3IV0A 2MYOA 1U3DA 3B13A 3CQCB 4WNGA 3DPYA 2A5EA 3BEEA 4WWOA 1AP7A 1WDYA 1IXVA 1N52A 4X8QA 2JEKA 4GZCA 3UTMA 2QY7A 2WXLA 4GMLA 3CK7A 4LNBA 5E75A 2WXQA 1TYQG 3UT7A 3T5VA 1MX2A 3FU3A 3ABKE 3GW4A 4ATGA 4XEIG 3D3MA 3JXIA 4ABNA 2XEEA 4GAAA 4ANWA 3HXBA 3UM2A 4U8VD 4C0EA 2EILE 3AS8A 5CBOA 4JHRA 1E7VA 2I9CA 3L08A 1U3CA 2VTBB 5DIZA 3FU0A 4J8SA 1Z3XA 3FTXA 4CGWA 5KNGA 1NP7A 4GTRA 1Z5SC 1EYHA 3U64A 3CHOA 3QK0A 3RSEG 5AQ9A 2X6HA 5FQ4A 3VTYA 4HOQA 3L22A 3MZLB 3E32A 1OY3D 4J6IA 5C2YA 3RRNB 3DWLG 3RO2A 3SBSA 1N4QA 1E8YA 3CVUA 4HQDA 4CT4A 3HXCA 2QFCA 3AAAC 2L0TB 4LUNU 1BI8B 5BXOA 3EHQA 3P2BA 3V2OA 2UY1A 2GGFA 2VTBA 4J8FA 4I43A 1BLXB 3ZPJA 1HF8A 2VJ8A 2P2CP 4AY6A 4LSZE 3D9HA 2PL2A 2V8SE 4K03A 4N3CA 2FI7A 1OCCE 2EINE 1XGWA 2IOSA 5CBNA 2VGYA 4CDRA 4FLBA
chains in the Genus database with same CATH topology
3EIJA 2OV8A 3CLJA 4JW1A 3SD5A 3D9OA 4UQZA 2YHEA 2L0IA 1Z3YA 4BWRA 4DLQA 4EECA 3HIZA 3PVLA 4HS2A 4XX5A 3FDHA 5C1DA 1TEZA 1UN9A 3VLDA 2KCKA 2PQRA 2VSOE 3CR3A 1ZU2A 1UG3A 2HM8A 3ML9A 5ARFA 4PS8A 4I1AA 3U66A 3FUMA 4KMOA 3PNLB 4Q94A 3WXXA 4N3AA 4FJYA 3JCKC 3ZYMA 4XKBA 4GZ3A 3CVPA 2LNIA 4G25A 4HOUA 4JEUA 2C0MA 3LPZA 4B0ZA 3E4BA 3FUKA 4EBAG 2WXHA 3MEKA 4FU3A 5G04J 3CVLA 4KBQA 2XPZA 4MLPA 4I9EA 2XCCA 2XRZA 2CHZA 3RK6A 2OVFA 2XQ0A 2IJGX 3CK8A 3EIQC 3Q49B 4GYYA 3QOUA 5FJYA 2E2EA 3D9KA 5ENNA 3PNTB 4UWFA 1HU3A 1L5JA 2BUGA 5LP0A 3B7RL 2VYIA 4KT6B 1UN8A 3EHNA 3LVQE 3FTVA 4JL0A 3UUXA 5LCWC 3ZGQA 3I5PA 1WM5A 3OTNA 2GW1A 5HI7A 1YA0A 2WQ7A 4C9BB 2OOEA 2PQNA 3D9IA 3S7FA 3TG4A 5FZQA 5BV0A 4MS6A 4DI4A 3FUFA 5E76A 4DI3A 5AIJA 3OXFA 3GZ2A 4KZCA 3CKCA 3LCAA 2MRIA 2YHCA 3ZVVA 2WXKA 3LY7A 4MRUA 1VDYA 4NRHB 4BX8A 3S7DA 3QC1A 1E90A 2X38A 3LY9A 1HFAA 4GA1A 5T8IA 4Y6CA 1OWNA 3EJNA 3GZ1A 3S7JA 4GCOA 3CKBA 4GCNA 1FVHA 3FU5A 2UY1B 2IFUA 4BFRA 2J08A 2V0PA 3MCXA 3SF4A 3FUNA 2WM9A 2XPIA 3CEQA 5BNWA 4XKCA 3G2SA 2PM6A 2FBNA 2IF4A 4U04A 3PH0C 1E8WA 5T4YA 4AOFA 4CGVA 3JQ1A 5HQ8A 2CFZA 5G05C 4YVQC 1HH8A 4AY5A 1A17A 5AJDA 4GYOA 2DCPA 4AIFA 3PUKA 4G23A 5AJLA 4KVMA 1FCHA 4JVSA 3CSFA 4V3IA 3RKVA 4ACLA 3TGOA 2HO1A 4L2LA 2AWIA 2XRYA 2IU1A 1H19A 2J07A 3P1UA 4GU5A 4AVXA 1B89A 2ZU6B 3ASHA 4I2ZA 3MGBA 2WXNA 2CHXA 2GRLA 4WWPA 3UX4A 5EKQD 2NSZA 1HX8A 4EQFA 5DBKA 5BUZA 1IYGA 4WUYA 3ZEFA 4BTAA 4FC8A 5LOZA 4UQYA 2CFUA 3VTXA 4FADA 1JUQA 3I4RB 3FP3A 4JZYA 4NACA 3ZHEA 3ASFA 2WXJA 2YQ8A 3SFZA 5A7DB 4XZ4A 2WXGA 4UQXA 4A55A 2WXPA 4FULA 2WQ6A 2FO7A 5CCLA 5A6CA 4APFA 3QAQA 4B94A 5D0OD 4CEMA 2KZTA 3LEWA 4BSXA 5G55A 1UJJA 4KZ0A 3UMVA 5FQ7A 4XI9A 2KCLA 4NURA 2J4DA 2R17C 1H2VC 4B89A 3MYVA 3ENEA 1JWGA 1Y8MA 3AS4A 3FFLA 3QWWA 4CRWA 1DVPA 3R7RA 4GPKA 4UWLA 5CHEE 2HYZA 3SZ7A 1JPLA 4JHKA 2AXUA 2R5SA 4I6JA 3ZFWA 2WXFA 3IEGA 2XPYA 4EZLA 1QNFA 4BT8A 5CMWA 2AXZA 2C2LA 5FWQA 4I6EA 4ILGA 3ZIMA 3AU5A 2Q7FA 4I9CA 3SI5A 4GYWA 3FEXA 4AJWA 2BTDA 4BTBA 4OVVA 5LX8A 1MHQA 2XGMA 3FULA 2IOLA 5JHBA 4C0MA 1IQUA 4U0SA 4EZJA 3HVEA 4Y6WA 1E8XA 2C0LA 4L7TA 4HLEA 4N5CA 1WY6A 3B7UX 3MJWA 4G1TA 4PUCA 4JC8A 5FZSA 2LAIA 4JA7A 3FY4A 2ILRA 4LCTA 2GRMA 4JA9A 4EBAA 3FWVA 2KM4A 5BPPA 4AM9A 3NF1A 4KVOA 4WWNA 1TJFA 5J08A 4HVBA 2WXRA 3APFA 4DLOA 3D9MA 1KT1A 1OWPA 3L17A 3GYZA 4TRQA 2LSUA 4E85A 1PAQA 3ONKA 2HR2A 4ILIA 4L1BA 3PRZA 3D9LA 3G2UA 3SGHA 3O4ZA 2VQ2A 4I17A 2VSXE 2ONDA 2R59A 2V4LA 5AYWD 5KJLA 5A23A 5LFAA 1MQSA 2M63A 3FH8A 3FTUA 4J8DA 1SQMA 4IN3B 4G11A 5JJTA 3UPVA 3PEUB 4GZ5A 5KJNA 4GA2A 3ULQA 4WNDA 4UI9C 2I6HA 3D9PA 3EDTB 4PS3A 5JHAA 1NA0A 3MKQA 4R7LA 4KXKB 1KLXA 3G2VA 3FUEA 4HXIA 3ZHEB 3IHYA 1HS6A 1OWLA 4CDNA 3B7SA 3DPDA 2IONA 1HXIA 3U9WA 1S0PA 3VLFA 4JHJA 4ILHB 2I2OA 1ZBPA 4F3VA 4A3TA 3T5XA 4A3VA 4WAFA 3SHFA 3I3NA 1LF8A 3HYMB 2KZTB 2YNQA 2MOWA 5ARGA 4IRUA 3CSTA 5FTPA 3FHEA 5FQ6A 1HG2A 2Y4TA 4B8AA 2KC7A 4D10C 5CCMA 3RRMB 1E8ZA 4PDXA 3CHQA 3KD7A 3PEVB 4I1MA 3LS8A 4UI9K 3LJ3A 2XGSA 2WMOA 3CVVA 3CV0A 3CVNA 2L9BA 3PS6A 4BT9A 1HG5A 3QWVA 4RG9A 4DPRA 1BPOA 4HOSA 2I1KA 3U4TA 5FQ8A 4CT0A 1TJCA 3MA5A 5KJKA 3L13A 4GMJA 3RJVA 5BT1A 2WPVA 4OVUA 4K0RA 3FTSA 3QKYA 3CGHA 2PM7A 3NQPA 4F1SA 3ESLA 2WMNA 4EZKA 2KCVA 5BV1A 2LSVA 3UT4A 5KJMA 3FU6A 4AEZC 5JJ7A 2VGXB 4HORA 3ZN3A 2UWJG 3HVEB 2WXIA 4LRZA 3ZYKA 3QB2A 3CVYA 1OWMA 3IKOB 4UWGA 1ELRA 1KT0A 2L6JA 3FUDA 2AVPA 3TJPA 2IQCA 3CVQA 3Q5MA 4JEHA 2X6FA 2J09A 1EPUA 4IYPA 3JUIA 3K9IA 2X6KA 3G2WA 3LKUA 3L6AA 1UJKA 2Y4UA 4ME2A 1IHGA 3BG0B 4B8CB 4F53A 2X3MA 3Q47B 3UT8A 1ELWA 1WAO1 1Y6IA 4CDMA 3GZSA 2VSNA 4N3BA 2V5FA 3PZDA 4RSYA 4ACKA 4J0UA 2WQHA 3G2TA 4L23A 5BW8C 4M3OA 3CVWA 3DBSA 5CMYA 1QQEA 3U3WA 3HHMA 4NQ0A 4U0ZA 5LCWJ 4I1OB 4WNFA 5M72A 3S2AA 1HE8A 4HOTA 4Q96A 3ZXSA 2PZIA 2BF0X 2A5UA 5AENA 3BG1B 3IHVA 3CHSA 2CHWA 1PY1A 2FULA 2AXVA 2VGXA 3OXLA 4GB9A 4FLHA 1SZAA 4UI9J 4LEUA 3MKQB 2E0IA 3QARA 3LY8A 4H7YA 3MKRA 3JYSA 2CG2A 3IV0A 1U3DA 4UWKA 3FUJA 1H2TC 3CQGB 3KAEA 4WNEA 3FTYA 4DJAA 1DNPA 3FUHA 1H2UA 1H0AA 3B13A 2LO6A 3CQCB 2AW6A 2YINA 3C98A 3JQ0A 4WNGA 5G2NA 2JLBA 3MX3A 3MV2B 1W3BA 2A4ZA 4OYSA 5ANRA 3PREA 3SBTB 5EX0A 4YNDA 4N2QA 2DBAA 4GZDA 3BEEA 4WWOA 4HFGA 2I1JA 3ASDA 5G05J 2XEVA 3OXGA 4PS7A 3NZUA 3TL5A 2J4BA 1N52A 3I4GA 4BX9A 4FA6A 4CCAA 2MHKA 2JEKA 3TXMA 4GZCA 4URKA 3TG5A 3TAXA 3CK9A 3PDNA 2QY7A 3PUJA 2WXLA 4GMLA 3CK7A 3Q4AB 4U8HA 5E75A 2WXQA 2J9QA 3S7BA 3URZA 3UT7A 3T5VA 1NZNA 3PE3A 2WVIA 3OAWA 4P29A 2XHEA 3UQ3A 4H7XA 3FU3A 1UW4B 3GW4A 4ATGA 4I6GA 4A1GA 3QJZA 1HZ4A 4I2WA 3D3MA 3D9NA 5KCMA 3CHRA 4MKTA 4TV3A 3LVRE 3ONLA 4U07A 1E7UA 1GW6A 3PE4A 1ELKA 4W9RA 3RIBA 4ABNA 4E6HA 5ANLA 4GAAA 4ANWA 3QNKA 4RVBA 1N54A 3R9AB 1EDUA 4O6FA 1EF1C 3MV3B 3Q15A 4XIFA 4C0EA 1NA3A 2DIWA 3AS8A 4UWHA 3R7QA 2WXOA 4JHRA 1OUVA 1E96B 2NXPA 3RO3A 2NC9A 1SZ9A 2P58C 1E7VA 2FEZA 5D0QD 3RU0A 3QWPA 3HDXA 2I9CA 3L08A 1U3CA 3ESKA 2VTBB 5DIZA 3CIAA 1QZ2A 3FU0A 4XE0A 5G04C 3FTZA 3NZSA 4A1SA 4J8SA 3FUIA 3APCA 3FH5A 1Z3XA 3FTXA 4JXTA 4CGWA 3D9JA 3FEYA 5EX3A 2RG8A 1NP7A 3AU4A 1FVFA 3IBEA 2X6IA 3FTWA 1EYHA 1PC2A 3U64A 3CHOA 3L16A 2LAHA 3AS5A 3QDNA 3QK0A 5FQ4A 1P5QA 2X6HA 3VLEA 3VTYA 4HOQA 4FJZA 3CHMA 3L22A 3MZLB 1JWFA 4BY6A 4PH4B 2Y3AA 4ANVA 3ASGA 4J6IA 4N39A 2J49A 1H6KA 5C2YA 2XGOA 3RRNB 3TXNA 4KYOB 1X5BA 2RD0A 2X6JA 3RRUA 4ANXA 5EDSA 4AV7A 2VSYA 5T3RA 3RO2A 4G2VA 3ZW3A 4IULA 3SBSA 4RG6A 4LERA 1E8YA 1Z6TA 3CVUA 5FT9A 4EPZA 2KATA 3EHMA 4CT4A 4Q69A 3B7TA 4J8EA 5J90A 2QFCA 4U0UA 3FH7A 3ZRHA 4G26A 3ZYQA 2OVBA 1XNFA 2L0TB 2WB2A 3APDA 4LUNU 4APOA 4TUUA 4XI0A 3ZYLA 4L2YA 4FP7A 4AXHA 4DK5A 4GZ6A 3LYAA 4F7AA 3CVXA 4N2SA 3P2BA 1IQRA 2UY1A 2GGFA 2VTBA 4J8FA 3ML8A 3L54A 1INZA 4I43A 3ZPJA 1HF8A 4FHJA 3N71A 1HO8A 2EQXA 2VJ8A 4QFVA 1OWOA 2CG3A 3SNXA 3T8MA 4AY6A 3O48A 2WXMA 4YVOA 3KS2A 4JPSA 2PL2A 2V8SE 4GA0A 3KEZA 3LDZA 2FF4A 4K03A 4N3CA 2FI7A 4U63A 3LXUX 4AP2A 1XGWA 4G24A 4ANUA 3CHPA 2IOSA 2VGYA 5FZRA 4CDRA 5JJ6A 4FHKA 4FLBA 2XCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UQZ A;  4BWR A;  5C1D A;  2KCK A;  2PQR A;  1ZU2 A;  5ARF A;  4I1A A;  3WXX A;  4N3A A;  3CVP A;  2LNI A;  4G25 A;  4HOU A;  2C0M A;  3LPZ A;  3E4B A;  3MEK A;  5G04 J;  3CVL A;  4KBQ A;  4I9E A;  2XCC A;  3CK8 A;  3Q49 B;  4GYY A;  3QOU A;  5FJY A;  2E2E A;  2BUG A;  2VYI A;  3UUX A;  4JL0 A;  5LCW C;  3ZGQ A;  1WM5 A;  2GW1 A;  5HI7 A;  1YA0 A;  2OOE A;  3TG4 A;  2PQN A;  3S7F A;  5FZQ A;  3OXF A;  3GZ2 A;  3CKC A;  3LCA A;  2YHC A;  3LY7 A;  4NRH B;  3S7D A;  3LY9 A;  4GA1 A;  4Y6C A;  3GZ1 A;  3S7J A;  4GCO A;  3CKB A;  4GCN A;  2UY1 B;  2IFU A;  3SF4 A;  2XPI A;  3CEQ A;  5BNW A;  2FBN A;  2IF4 A;  4U04 A;  4CGV A;  5HQ8 A;  5G05 C;  4YVQ C;  1HH8 A;  4AY5 A;  1A17 A;  4GYO A;  4AIF A;  4G23 A;  1FCH A;  3RKV A;  3TGO A;  2HO1 A;  1B89 A;  4I2Z A;  3ASH A;  5EKQ D;  4EQF A;  5DBK A;  1IYG A;  4WUY A;  4BTA A;  4UQY A;  3VTX A;  3ZHE A;  3FP3 A;  3ASF A;  2YQ8 A;  5A7D B;  4UQX A;  2FO7 A;  5CCL A;  5A6C A;  4B94 A;  5D0O D;  4XI9 A;  2KCL A;  1Y8M A;  3AS4 A;  3FFL A;  3QWW A;  4GPK A;  5CHE E;  2HYZ A;  3SZ7 A;  2R5S A;  3ZFW A;  3IEG A;  4BT8 A;  2C2L A;  2Q7F A;  4I9C A;  4GYW A;  4BTB A;  2XGM A;  4U0S A;  4Y6W A;  2C0L A;  4N5C A;  4G1T A;  5FZS A;  4JA7 A;  4JA9 A;  3FWV A;  4AM9 A;  3NF1 A;  1KT1 A;  3GYZ A;  2LSU A;  2HR2 A;  2VQ2 A;  4I17 A;  2OND A;  5AYW D;  5KJL A;  4J8D A;  4IN3 B;  5JJT A;  3UPV A;  4GZ5 A;  5KJN A;  4GA2 A;  3ULQ A;  4WND A;  4UI9 C;  2I6H A;  3EDT B;  1NA0 A;  4KXK B;  1KLX A;  3ZHE B;  1HXI A;  1ZBP A;  4F3V A;  3HYM B;  5ARG A;  5FTP A;  2Y4T A;  2KC7 A;  5CCM A;  3KD7 A;  4UI9 K;  2XGS A;  3CV0 A;  3CVN A;  4BT9 A;  3QWV A;  4RG9 A;  4HOS A;  3U4T A;  1TJC A;  3MA5 A;  5KJK A;  5BT1 A;  3RJV A;  2WPV A;  3QKY A;  5KJM A;  2KCV A;  2LSV A;  2VGX B;  4HOR A;  3ZN3 A;  2UWJ G;  1KT0 A;  1ELR A;  2L6J A;  2AVP A;  3Q5M A;  3CVQ A;  3K9I A;  3LKU A;  2Y4U A;  4ME2 A;  1IHG A;  3Q47 B;  1ELW A;  1WAO 1;  2VSN A;  4N3B A;  2V5F A;  4J0U A;  2WQH A;  5BW8 C;  1QQE A;  3U3W A;  4NQ0 A;  5LCW J;  4U0Z A;  4WNF A;  5M72 A;  4HOT A;  2PZI A;  2VGX A;  3OXL A;  4UI9 J;  4LEU A;  3LY8 A;  4H7Y A;  3MKR A;  3JYS A;  4WNE A;  3KAE A;  4WNG A;  2JLB A;  3MV2 B;  1W3B A;  5EX0 A;  4YND A;  4N2Q A;  2DBA A;  3BEE A;  3ASD A;  5G05 J;  2XEV A;  3OXG A;  2MHK A;  3TG5 A;  3TAX A;  3CK9 A;  3PDN A;  3CK7 A;  3Q4A B;  2J9Q A;  3S7B A;  3URZ A;  1NZN A;  3PE3 A;  3UQ3 A;  4H7X A;  3GW4 A;  1HZ4 A;  4I2W A;  4U07 A;  3RIB A;  3PE4 A;  4W9R A;  4ABN A;  3R9A B;  4O6F A;  3MV3 B;  3Q15 A;  4XIF A;  1NA3 A;  3AS8 A;  4JHR A;  1OUV A;  1E96 B;  3RO3 A;  2NC9 A;  2P58 C;  3RU0 A;  2FEZ A;  5D0Q D;  3QWP A;  3ESK A;  5DIZ A;  5G04 C;  1QZ2 A;  4A1S A;  4CGW A;  5EX3 A;  1PC2 A;  3AS5 A;  3QDN A;  3VTY A;  1P5Q A;  4HOQ A;  3ASG A;  4N39 A;  5JJ7 A;  2XGO A;  4KYO B;  2VSY A;  3RO2 A;  4G2V A;  4RG6 A;  5FT9 A;  2KAT A;  4J8E A;  2QFC A;  4U0U A;  4G26 A;  1XNF A;  4APO A;  4XI0 A;  4GZ6 A;  3LYA A;  4N2S A;  2UY1 A;  4J8F A;  3ZPJ A;  3N71 A;  4AY6 A;  3O48 A;  4YVO A;  3KS2 A;  2PL2 A;  4GA0 A;  2FF4 A;  4N3C A;  2FI7 A;  4G24 A;  2VGY A;  5FZR A;  4CDR A;  5JJ6 A;  4GZ3 A;  2XCB A; 
#chains in the Genus database with same CATH topology
 2IY0 C;  1LD7 A;  1DC2 A;  4UQZ A;  2L0I A;  1Z3Y A;  4BWR A;  3AG1 E;  3HIZ A;  1O5M A;  5C1D A;  4YDY A;  3CR3 A;  1ZU2 A;  1UG3 A;  4HB5 A;  3PNL B;  4FJY A;  2LNI A;  2C0M A;  5FIN A;  4B0Z A;  4EBA G;  5AAR A;  3MEK A;  4JD2 G;  5G04 J;  1TNU A;  3JUE A;  4DX5 D;  2XPZ A;  4I9E A;  2CHZ A;  2XQ0 A;  2IJG X;  2E2E A;  5ENN A;  1SA5 A;  4UWF A;  1L5J A;  3B7R L;  4HRM B;  4KT6 B;  1UN8 A;  2ZXW E;  3UUX A;  5LCW C;  3I5P A;  1WM5 A;  3OTN A;  3UIN C;  3D9I A;  3S7F A;  5BV0 A;  4MS6 A;  3OXF A;  4KZC A;  3CKC A;  3LY7 A;  4BX8 A;  2P9L G;  3S7J A;  3CKB A;  4BER A;  2IFU A;  3MCX A;  3SF4 A;  3FUN A;  2WM9 A;  2XPI A;  4XKC A;  1O1S A;  4U04 A;  2LXL A;  5T4Y A;  4AOF A;  2CFZ A;  4YVQ C;  2DCP A;  4G23 A;  5AJL A;  4KVM A;  3RKV A;  4L2L A;  4F6R D;  2AWI A;  4AVX A;  1H19 A;  2NSZ A;  4EQF A;  5BUZ A;  2QZA A;  5KBA A;  2CFU A;  3E37 A;  5A7D B;  3HRA A;  4GTM A;  2WQ6 A;  1LD8 A;  1BU9 A;  1QBQ A;  4XI9 A;  4NUR A;  2R17 C;  3EU5 A;  3QWW A;  4GPK A;  5CHE E;  4JHK A;  2WXF A;  2XPY A;  4EZL A;  2C2L A;  4DX1 A;  4ILG A;  3ZIM A;  3SI5 A;  2P9I G;  4GYW A;  4OVV A;  5LX8 A;  5JHB A;  2QYU A;  2F37 A;  4Y6W A;  2C0L A;  4PUC A;  4JA7 A;  1TNB A;  3EUV A;  5J08 A;  1N4S A;  1TJF A;  4HVB A;  3APF A;  3L17 A;  4E85 A;  2LSU A;  3AJI A;  3ONK A;  2HR2 A;  3PRZ A;  3G2U A;  2OND A;  4HLL A;  5A23 A;  1O1T A;  3L82 A;  4GZ5 A;  2J8S D;  5KJN A;  4BET A;  3EDT B;  4PS3 A;  5JHA A;  3V2X A;  4KXK B;  3ZU7 B;  4HNA D;  4EHM A;  3DPD A;  2ION A;  3U9W A;  4ILH B;  4F3V A;  4A3T A;  3TWW A;  3HYM B;  5CCM A;  4Z68 A;  4YDW A;  1E8Z A;  3RAU A;  3LJ3 A;  1N95 A;  3CV0 A;  1QYM A;  4RG9 A;  4HOS A;  2NYJ A;  2WPV A;  4OVU A;  5AQB A;  4K0R A;  3CGH A;  4F1S A;  5BV1 A;  4EZK A;  5KJM A;  1N9A A;  4HRN A;  3UT4 A;  3FU6 A;  5CRU A;  3QB2 A;  3CVY A;  3DSX A;  2BKG A;  1ELR A;  3FUD A;  2AVP A;  1OCO E;  2IQC A;  3Q5M A;  2J09 A;  3G2W A;  4ME2 A;  1IHG A;  4B8C B;  3UT8 A;  1Y6I A;  4CDM A;  2V5F A;  4M3O A;  3ASN E;  4LG6 A;  1N0R A;  1NL4 A;  3BG1 B;  3CHS A;  3HG0 D;  1PY1 A;  3ULY A;  2AXV A;  3OXL A;  3MKQ B;  3QAR A;  3MKR A;  3JYS A;  2CG2 A;  4WNE A;  1H2T C;  3KAE A;  4HBD A;  2LO6 A;  1W3B A;  5ANR A;  2XZD G;  5EX0 A;  4N2Q A;  2XZT G;  3NZU A;  2J4B A;  4BX9 A;  3I4G A;  3NAW A;  4FA6 A;  1MZC A;  3TXM A;  5ENQ D;  3TG5 A;  4U8H A;  1MX6 A;  5FIO A;  2J9Q A;  4GTS A;  3PE3 A;  3UQ3 A;  4P29 A;  2XHE A;  1UW4 B;  1SA4 A;  1V55 E;  1OCZ E;  1HZ4 A;  3D9N A;  1H6P A;  4TV3 A;  3W9F A;  1E7U A;  3RIB A;  3PE4 A;  1ELK A;  4W9R A;  4E6H A;  3IXE A;  5ANL A;  3TWS A;  3DEP A;  3PZ1 A;  4RVB A;  1N54 A;  4A63 B;  3KSL A;  3R9A B;  4O6F A;  4XIF A;  4UWH A;  2WXO A;  1OUV A;  1E96 B;  2NC9 A;  2P58 C;  3RU0 A;  2FEZ A;  5D0Q D;  3C3O A;  3QWP A;  4DX6 D;  3EHR A;  2DYS E;  4A1S A;  3FTZ A;  3FUI A;  5EX3 A;  4B93 B;  3QDN A;  2F8Y A;  4DRX E;  3KEA A;  1V54 E;  4BY6 A;  4N39 A;  5JJ7 A;  2J49 A;  1H6K A;  2XGO A;  1X5B A;  2RD0 A;  2LUH A;  2R02 A;  4G2V A;  4IUL A;  4RG6 A;  3EHM A;  3UM0 A;  4APO A;  4TUU A;  4AXH A;  4L2Y A;  4DK5 A;  2R05 A;  4J7W A;  3N71 A;  3T8M A;  3SNX A;  3O48 A;  2BKK B;  4YVO A;  4JPS A;  4GA0 A;  3LDZ A;  2FF4 A;  3SO8 A;  4U63 A;  4AP2 A;  4ANU A;  3CHP A;  3QJZ A;  2XCB A;  2OV8 A;  4BSZ B;  4JW1 A;  4ATZ D;  1UOH A;  4DLQ A;  3PVL A;  4HS2 A;  2VSO E;  5EIB E;  3UM1 A;  2HM8 A;  5ARF A;  4PS8 A;  4I1A A;  3Q78 A;  4KMO A;  4HOU A;  4JEU A;  3LPZ A;  2WXH A;  1K1B A;  5ITZ F;  4CYM D;  4O1O A;  4GYY A;  3E33 A;  3QOU A;  2BUG A;  3EHN A;  3LVQ E;  4JL0 A;  1N11 A;  3V30 A;  4U96 D;  5KNH D;  4C9B B;  2OOE A;  2OEV A;  5FZQ A;  1D8E A;  2QC9 A;  2MRI A;  3ZVV A;  2WXK A;  4NRH B;  3B95 A;  3S7D A;  3GZ1 A;  5ENR D;  4GCO A;  1TN7 A;  1FVH A;  2UY1 B;  4BFR A;  2J08 A;  5BNW A;  2FBN A;  2IF4 A;  2GRQ B;  3UM3 A;  5HQ8 A;  3UKU G;  4AY5 A;  4K5C A;  5AQA A;  1FCH A;  4JVS A;  2HO1 A;  2XRY A;  1B89 A;  2ZU6 B;  3ASH A;  3ABL E;  4I2Z A;  2KBX A;  2WXN A;  3DXK G;  2CHX A;  3UX4 A;  1HX8 A;  4WUY A;  4FC8 A;  4DX7 D;  1JUQ A;  4NAC A;  1X81 A;  3ASF A;  2WXJ A;  2IO2 C;  3SFZ A;  3TWT A;  2WXG A;  1YCS B;  4UQX A;  5B1A E;  2KZT A;  1K8K G;  2XS8 A;  4DUI A;  2RFM A;  1JWG A;  1Y8M A;  3AS4 A;  1OXJ A;  5AAO A;  2R5S A;  3IEG A;  5CMW A;  1QNF A;  4BT8 A;  5FWQ A;  1DCE A;  4I9C A;  4UUC A;  1TNZ A;  4AJW A;  2XGM A;  2IOL A;  4RLY A;  4C0M A;  1IQU A;  4U0S A;  4HI8 A;  2RFA A;  3HVE A;  3JXJ A;  1E8X A;  4HLE A;  4N5C A;  1WY6 A;  1K1A A;  1Q2Z A;  2JAB A;  4G1T A;  2V4H C;  2LAI A;  3Q79 A;  4GTT A;  3FY4 A;  2LXM A;  4EBA A;  4ZFH A;  5BPP A;  1RZ4 A;  3NF1 A;  3UXG A;  4DLO A;  3D9M A;  4TRQ A;  3TWQ A;  4L1B A;  3D9L A;  2VQ2 A;  5KJL A;  4IN3 B;  1JCS A;  5JJT A;  3UPV A;  2RKK A;  3PEU B;  3FUE A;  1OWL A;  1HXI A;  1NFI E;  2B6C A;  4A3V A;  5CED B;  3ISM C;  2MOW A;  5ARG A;  4IRU A;  3FHE A;  5FQ6 A;  1HG2 A;  2Y4T A;  3DSU A;  1MJ0 A;  3RRM B;  3WG7 E;  3KSQ A;  2IEJ A;  1HG5 A;  3QWV A;  5KWD A;  3U4T A;  1TJC A;  5KJK A;  4LNG A;  4GMJ A;  5BT1 A;  3FTS A;  3QKY A;  3NQP A;  2DWZ A;  3ESL A;  2KCV A;  5AQ7 A;  3V31 A;  2ZIS A;  4MBG A;  2X6F A;  1UJK A;  5EYL A;  2Y4U A;  3BG0 B;  3Q47 B;  1ELW A;  2VSN A;  3NB2 A;  4RSY A;  4GPM A;  3G2T A;  4L23 A;  5BW8 C;  3CVW A;  1QQE A;  3HHM A;  4U0Z A;  4I1O B;  5M72 A;  4HOT A;  4Q96 A;  2PZI A;  2BF0 X;  3AG4 E;  5HRY A;  4LEU A;  3FUJ A;  3FTY A;  3FUH A;  1H2U A;  5G2N A;  1H0A A;  2YIN A;  3JQ0 A;  3W9G A;  2JLB A;  3MV2 B;  2A4Z A;  4OYS A;  3SBT B;  2IO3 C;  4YND A;  4GZD A;  4HFG A;  2I1J A;  3ASD A;  5G05 J;  3SY2 A;  3OXG A;  2GRO B;  3E34 A;  3TL5 A;  3Q4A B;  2ZGD A;  4K5B A;  3S7B A;  1K3Z D;  3URZ A;  1G3N B;  1NZN A;  3OAW A;  5EYP F;  4I6G A;  5ENT D;  4A1G A;  3ZNG A;  5BXU A;  5KCM A;  3ONL A;  4U07 A;  1GW6 A;  1JCR A;  3TWV A;  2HE0 A;  1RW2 A;  3C3R A;  1NA3 A;  1TN8 A;  3R7Q A;  1SZ9 A;  3HDX A;  3ESK A;  2ETB A;  3CIA A;  4GTP A;  3APC A;  3FH5 A;  4JXT A;  3FEY A;  2RG8 A;  3AU4 A;  4F1P A;  2X6I A;  3FTW A;  1PC2 A;  3L16 A;  3AS5 A;  1P5Q A;  5ENP D;  1FPP A;  5EID A;  4G8L A;  1KPS B;  4PH4 B;  2Y3A A;  3PZ4 A;  3HXD A;  4ANX A;  4AV7 A;  2QYJ A;  1Z6T A;  4Q69 A;  4ZHB A;  2P9N G;  5B3S E;  3ZRH A;  3FH7 A;  4G26 A;  3SFY A;  2WB2 A;  3BU8 A;  1IKN D;  4XI0 A;  4OAU C;  3ZYL A;  3LYA A;  2OCC E;  4FHJ A;  1HO8 A;  5JMN D;  3TWU A;  3V79 K;  3ZKJ A;  5FZR A;  4GZ3 A;  1NI1 A;  5HKP A;  3SD5 A;  3D9O A;  2YHE A;  4EEC A;  3E30 A;  2EIM E;  2KCK A;  3ML9 A;  3T9K A;  3U66 A;  3FUM A;  3WXX A;  3CVP A;  3FUK A;  4QQI A;  3CVL A;  4KBQ A;  2XRZ A;  2OVF A;  3CK8 A;  3EIQ C;  5FJY A;  5ENO D;  3D9K A;  3PNT B;  1HU3 A;  3J5Q B;  2VYI A;  2XS1 A;  2GW1 A;  5HI7 A;  2ZGG A;  3Q9U C;  5E76 A;  3GZ2 A;  3LCA A;  2YHC A;  4MRU A;  4O1P A;  3QC1 A;  1E90 A;  2X38 A;  4GTQ A;  1HFA A;  5T8I A;  4Y6C A;  3EJN A;  3ABM E;  3L9T A;  4OAV B;  3FU5 A;  2V0P A;  2GRR B;  3G2S A;  3NOC D;  3PH0 C;  1E8W A;  4C48 B;  3JQ1 A;  4G8K A;  2KXP C;  2ETC A;  3PUK A;  3C5R A;  2V5Q C;  3TGO A;  1OCR E;  2J07 A;  4GU5 A;  2GRL A;  5CEA A;  4WWP A;  5H7P A;  5EKQ D;  5DBK A;  4NIK A;  1IYG A;  3ZEF A;  4BTA A;  4UQY A;  3Q9N C;  4JZY A;  3FP3 A;  3ZHE A;  1BD8 A;  1O1R A;  4A55 A;  5CCL A;  4APF A;  3QAQ A;  4B94 A;  4CEM A;  3LEW A;  4BSX A;  5G55 A;  4KZ0 A;  3UMV A;  2J4D A;  1H2V C;  4B89 A;  1H6O A;  3ENE A;  3FFL A;  4CRW A;  1DVP A;  3R7R A;  4GMR A;  2AXZ A;  4I6E A;  3Q7F A;  3AU5 A;  1TN6 A;  3Q7A A;  2BTD A;  5AN8 A;  4BTB A;  1MHQ A;  1FT2 A;  4L7T A;  1N94 A;  3C3Q A;  3MJW A;  4JC8 A;  2ILR A;  3DSS A;  4JA9 A;  2KM4 A;  4KVO A;  4WWN A;  2WXR A;  1KT1 A;  1OWP A;  4GTV A;  3GYZ A;  5EN5 D;  4CZ2 D;  1D8D A;  4U7E B;  3SGH A;  3O4Z A;  2VSX E;  2V4L A;  2R59 A;  5AYW D;  1MYO A;  3FH8 A;  2M63 A;  3FTU A;  1SQM A;  2BED A;  2GRN B;  3BQO A;  4WND A;  4UI9 C;  2I6H A;  1NA0 A;  2DZN A;  4R7L A;  1KLX A;  3IHY A;  1HS6 A;  2AJA A;  4CDN A;  1S0P A;  2P9K G;  2I2O A;  1ZBP A;  4RQI A;  3T5X A;  4YDO A;  2KZT B;  2Y0B G;  1S63 A;  4PDX A;  3C72 A;  3CHQ A;  3KD7 A;  3PEV B;  3LS8 A;  4I1M A;  4UI9 K;  2WMO A;  3CVN A;  2L9B A;  3PS6 A;  4BT9 A;  2DYR E;  2I1K A;  4CT0 A;  3RJV A;  5IY5 E;  3TWR A;  5D66 A;  3UI2 A;  4AEZ C;  4HOR A;  3DXM G;  3ZN3 A;  3HVE B;  4LRZ A;  4UWG A;  1KT0 A;  2L6J A;  2XEN A;  3TJP A;  4JEH A;  1EPU A;  4IYP A;  3K9I A;  3L6A A;  4F53 A;  2X3M A;  3GZS A;  3PZD A;  2DVW A;  5LCW J;  3S2A A;  1HE8 A;  4M7C A;  3IHV A;  2CHW A;  3PZ2 A;  1KZO A;  1SZA A;  3B7B A;  4UWK A;  3CQG B;  4DJA A;  1TNO A;  1DNP A;  2AW6 A;  3C98 A;  3MX3 A;  1OT8 A;  1YYH A;  5HS0 A;  3PRE A;  2DBA A;  2XEV A;  4PS7 A;  4CCA A;  1IHB A;  2MHK A;  3NBN B;  4URK A;  3TAX A;  2H6G A;  3CK9 A;  3BUA A;  3PDN A;  3PUJ A;  3HXE A;  3Q75 A;  2VGE A;  2WVI A;  4H7X A;  3DST A;  3TWX A;  2P9S G;  3X2Q E;  3AG3 E;  4I2W A;  3CHR A;  4MKT A;  3LVR E;  5B1B E;  1N0Q A;  3QNK A;  1EDU A;  1EF1 C;  3MV3 B;  3Q15 A;  2DIW A;  2GRP B;  2NXP A;  3RO3 A;  3UIO C;  5CEC B;  2XEH A;  5G04 C;  1QZ2 A;  4XE0 A;  3NZS A;  3D9J A;  3IBE A;  1FVF A;  2P9U G;  3VLE A;  2LAH A;  4FJZ A;  3CHM A;  2Y69 E;  1JWF A;  4ANV A;  3ASG A;  5AIJ A;  3TXN A;  5EDS A;  4KYO B;  3RRU A;  2X6J A;  2VSY A;  5T3R A;  1FT1 A;  3ZW3 A;  3DSV A;  4LER A;  5FT9 A;  4EPZ A;  3UIP C;  2KAT A;  3B7T A;  4J8E A;  5J90 A;  4U0U A;  3ZYQ A;  2OVB A;  1XNF A;  4TXR A;  1BI7 B;  3APD A;  3DEO A;  4FP7 A;  4GZ6 A;  2B0O E;  4F7A A;  3CVX A;  4N2S A;  1IQR A;  3ML8 A;  3LJN A;  3L54 A;  1INZ A;  2EQX A;  4QFV A;  1OWO A;  2CG3 A;  3SQV A;  1D9S A;  5JA4 D;  2WXM A;  3KS2 A;  3KEZ A;  3LXU X;  2F0Y A;  4G24 A;  1N4P A;  5JJ6 A;  4FHK A;  4HXI A;  3EIJ A;  3CLJ A;  3UKR G;  1LTX A;  4O60 A;  4XX5 A;  1TEZ A;  3FDH A;  1UN9 A;  1SVX A;  3VLD A;  2PQR A;  1KZP A;  3Q73 A;  4Q94 A;  4N3A A;  3JCK C;  3ZYM A;  4XKB A;  4G25 A;  3E4B A;  3J5P A;  1S70 B;  3ZUV B;  4FU3 A;  4MLP A;  2XCC A;  3RK6 A;  3R9M A;  5CER B;  2DZO A;  3Q49 B;  3SFX A;  5LP0 A;  3FTV A;  3ZGQ A;  4HI9 A;  1DCQ A;  1YA0 A;  5EIL A;  2WQ7 A;  2PQN A;  3TG4 A;  4BES A;  2PNN A;  4GTO A;  4DI4 A;  3FUF A;  4DI3 A;  2ZIR A;  1VDY A;  3LY9 A;  4GA1 A;  1OWN A;  3ULE G;  4GCN A;  4TUM A;  3DRA A;  1JCQ A;  3CEQ A;  2PM6 A;  4CGV A;  5G05 C;  1HH8 A;  4U8Y D;  1A17 A;  5AJD A;  4GYO A;  4AIF A;  2P9P G;  3T8K A;  3CSF A;  4V3I A;  4ACL A;  2IU1 A;  3P1U A;  1MX4 A;  3MGB A;  2L6B A;  1ZB1 A;  4DX2 A;  3HXF A;  5LOZ A;  1U2V G;  3VTX A;  4FAD A;  3I4R B;  2YQ8 A;  4XZ4 A;  4YDE A;  2WXP A;  4FUL A;  2FO7 A;  4TXQ A;  5A6C A;  1S64 A;  5D0O D;  2R03 A;  1UJJ A;  5FQ7 A;  2KCL A;  5CRV A;  3MYV A;  2EIJ E;  4UWL A;  2HYZ A;  2EIK E;  3SZ7 A;  1JPL A;  2AXU A;  4I6J A;  3ZFW A;  3ASO E;  1A5E A;  2OEW A;  5D2M C;  2H6F A;  2Q7F A;  3FEX A;  3FUL A;  4EZJ A;  3B7U X;  5FZS A;  4LCT A;  2GRM A;  3FWV A;  2FO1 E;  4AM9 A;  1PAQ A;  4ILI A;  2H6I A;  4I17 A;  4J8Y A;  5LFA A;  1MQS A;  4J8D A;  3ZXP A;  4G11 A;  4GA2 A;  3ULQ A;  1TR4 A;  3D9P A;  3MKQ A;  3G2V A;  3ZHE B;  1TNY A;  3B7S A;  3VLF A;  4JHJ A;  4BEP A;  4WAF A;  3SHF A;  4N5Q A;  2R2L A;  3I3N A;  1LF8 A;  3NOG D;  2YNQ A;  1YMP A;  3CST A;  5FTP A;  4B8A A;  2KC7 A;  2Y1L E;  4D10 C;  2ETA A;  1WG0 A;  2XGS A;  4L9P A;  4TXP A;  3CVV A;  4DPR A;  1BPO A;  4HRL A;  5FQ8 A;  3MA5 A;  3L13 A;  4U95 D;  5ENS D;  3EU9 A;  2PM7 A;  2WMN A;  2LSV A;  3PZ3 A;  2VGX B;  4LNU D;  2UWJ G;  3ZYK A;  2WXI A;  3F6Q A;  1OWM A;  3IKO B;  3CVQ A;  2F8X K;  3JUI A;  2X6K A;  3LKU A;  1WAO 1;  1AWC B;  4N3B A;  4ACK A;  4J0U A;  2WQH A;  3DBS A;  5CMY A;  3AG2 E;  3U3W A;  4NQ0 A;  4WNF A;  2H6H A;  4K5A B;  3ZXS A;  2A5U A;  1N4R A;  5AEN A;  3DSW A;  2FUL A;  1SW6 A;  2VGX A;  4GB9 A;  4FLH A;  4UI9 J;  2E0I A;  3LY8 A;  4H7Y A;  4JB8 P;  3IV0 A;  2MYO A;  1U3D A;  3B13 A;  3CQC B;  4WNG A;  3DPY A;  2A5E A;  3BEE A;  4WWO A;  1AP7 A;  1WDY A;  1IXV A;  1N52 A;  4X8Q A;  2JEK A;  4GZC A;  3UTM A;  2QY7 A;  2WXL A;  4GML A;  3CK7 A;  4LNB A;  5E75 A;  2WXQ A;  1TYQ G;  3UT7 A;  3T5V A;  1MX2 A;  3FU3 A;  3ABK E;  3GW4 A;  4ATG A;  4XEI G;  3D3M A;  3JXI A;  4ABN A;  2XEE A;  4GAA A;  4ANW A;  3HXB A;  3UM2 A;  4U8V D;  4C0E A;  2EIL E;  3AS8 A;  5CBO A;  4JHR A;  1E7V A;  2I9C A;  3L08 A;  1U3C A;  2VTB B;  5DIZ A;  3FU0 A;  4J8S A;  1Z3X A;  3FTX A;  4CGW A;  5KNG A;  1NP7 A;  4GTR A;  1Z5S C;  1EYH A;  3U64 A;  3CHO A;  3QK0 A;  3RSE G;  5AQ9 A;  2X6H A;  5FQ4 A;  3VTY A;  4HOQ A;  3L22 A;  3MZL B;  3E32 A;  1OY3 D;  4J6I A;  5C2Y A;  3RRN B;  3DWL G;  3RO2 A;  3SBS A;  1N4Q A;  1E8Y A;  3CVU A;  4HQD A;  4CT4 A;  3HXC A;  2QFC A;  3AAA C;  2L0T B;  4LUN U;  1BI8 B;  5BXO A;  3EHQ A;  3P2B A;  3V2O A;  2UY1 A;  2GGF A;  2VTB A;  4J8F A;  4I43 A;  1BLX B;  3ZPJ A;  1HF8 A;  2VJ8 A;  2P2C P;  4AY6 A;  4LSZ E;  3D9H A;  2PL2 A;  2V8S E;  4K03 A;  4N3C A;  2FI7 A;  1OCC E;  2EIN E;  1XGW A;  2IOS A;  5CBN A;  2VGY A;  4CDR A;  4FLB A; 
#chains in the Genus database with same CATH homology
 3EIJ A;  2OV8 A;  3CLJ A;  4JW1 A;  3SD5 A;  3D9O A;  4UQZ A;  2YHE A;  2L0I A;  1Z3Y A;  4BWR A;  4DLQ A;  4EEC A;  3HIZ A;  3PVL A;  4HS2 A;  4XX5 A;  3FDH A;  5C1D A;  1TEZ A;  1UN9 A;  3VLD A;  2KCK A;  2PQR A;  2VSO E;  3CR3 A;  1ZU2 A;  1UG3 A;  2HM8 A;  3ML9 A;  5ARF A;  4PS8 A;  4I1A A;  3U66 A;  3FUM A;  4KMO A;  3PNL B;  4Q94 A;  3WXX A;  4N3A A;  4FJY A;  3JCK C;  3ZYM A;  4XKB A;  4GZ3 A;  3CVP A;  2LNI A;  4G25 A;  4HOU A;  4JEU A;  2C0M A;  3LPZ A;  4B0Z A;  3E4B A;  3FUK A;  4EBA G;  2WXH A;  3MEK A;  4FU3 A;  5G04 J;  3CVL A;  4KBQ A;  2XPZ A;  4MLP A;  4I9E A;  2XCC A;  2XRZ A;  2CHZ A;  3RK6 A;  2OVF A;  2XQ0 A;  2IJG X;  3CK8 A;  3EIQ C;  3Q49 B;  4GYY A;  3QOU A;  5FJY A;  2E2E A;  3D9K A;  5ENN A;  3PNT B;  4UWF A;  1HU3 A;  1L5J A;  2BUG A;  5LP0 A;  3B7R L;  2VYI A;  4KT6 B;  1UN8 A;  3EHN A;  3LVQ E;  3FTV A;  4JL0 A;  3UUX A;  5LCW C;  3ZGQ A;  3I5P A;  1WM5 A;  3OTN A;  2GW1 A;  5HI7 A;  1YA0 A;  2WQ7 A;  4C9B B;  2OOE A;  2PQN A;  3D9I A;  3S7F A;  3TG4 A;  5FZQ A;  5BV0 A;  4MS6 A;  4DI4 A;  3FUF A;  5E76 A;  4DI3 A;  5AIJ A;  3OXF A;  3GZ2 A;  4KZC A;  3CKC A;  3LCA A;  2MRI A;  2YHC A;  3ZVV A;  2WXK A;  3LY7 A;  4MRU A;  1VDY A;  4NRH B;  4BX8 A;  3S7D A;  3QC1 A;  1E90 A;  2X38 A;  3LY9 A;  1HFA A;  4GA1 A;  5T8I A;  4Y6C A;  1OWN A;  3EJN A;  3GZ1 A;  3S7J A;  4GCO A;  3CKB A;  4GCN A;  1FVH A;  3FU5 A;  2UY1 B;  2IFU A;  4BFR A;  2J08 A;  2V0P A;  3MCX A;  3SF4 A;  3FUN A;  2WM9 A;  2XPI A;  3CEQ A;  5BNW A;  4XKC A;  3G2S A;  2PM6 A;  2FBN A;  2IF4 A;  4U04 A;  3PH0 C;  1E8W A;  5T4Y A;  4AOF A;  4CGV A;  3JQ1 A;  5HQ8 A;  2CFZ A;  5G05 C;  4YVQ C;  1HH8 A;  4AY5 A;  1A17 A;  5AJD A;  4GYO A;  2DCP A;  4AIF A;  3PUK A;  4G23 A;  5AJL A;  4KVM A;  1FCH A;  4JVS A;  3CSF A;  4V3I A;  3RKV A;  4ACL A;  3TGO A;  2HO1 A;  4L2L A;  2AWI A;  2XRY A;  2IU1 A;  1H19 A;  2J07 A;  3P1U A;  4GU5 A;  4AVX A;  1B89 A;  2ZU6 B;  3ASH A;  4I2Z A;  3MGB A;  2WXN A;  2CHX A;  2GRL A;  4WWP A;  3UX4 A;  5EKQ D;  2NSZ A;  1HX8 A;  4EQF A;  5DBK A;  5BUZ A;  1IYG A;  4WUY A;  3ZEF A;  4BTA A;  4FC8 A;  5LOZ A;  4UQY A;  2CFU A;  3VTX A;  4FAD A;  1JUQ A;  3I4R B;  3FP3 A;  4JZY A;  4NAC A;  3ZHE A;  3ASF A;  2WXJ A;  2YQ8 A;  3SFZ A;  5A7D B;  4XZ4 A;  2WXG A;  4UQX A;  4A55 A;  2WXP A;  4FUL A;  2WQ6 A;  2FO7 A;  5CCL A;  5A6C A;  4APF A;  3QAQ A;  4B94 A;  5D0O D;  4CEM A;  2KZT A;  3LEW A;  4BSX A;  5G55 A;  1UJJ A;  4KZ0 A;  3UMV A;  5FQ7 A;  4XI9 A;  2KCL A;  4NUR A;  2J4D A;  2R17 C;  1H2V C;  4B89 A;  3MYV A;  3ENE A;  1JWG A;  1Y8M A;  3AS4 A;  3FFL A;  3QWW A;  4CRW A;  1DVP A;  3R7R A;  4GPK A;  4UWL A;  5CHE E;  2HYZ A;  3SZ7 A;  1JPL A;  4JHK A;  2AXU A;  2R5S A;  4I6J A;  3ZFW A;  2WXF A;  3IEG A;  2XPY A;  4EZL A;  1QNF A;  4BT8 A;  5CMW A;  2AXZ A;  2C2L A;  5FWQ A;  4I6E A;  4ILG A;  3ZIM A;  3AU5 A;  2Q7F A;  4I9C A;  3SI5 A;  4GYW A;  3FEX A;  4AJW A;  2BTD A;  4BTB A;  4OVV A;  5LX8 A;  1MHQ A;  2XGM A;  3FUL A;  2IOL A;  5JHB A;  4C0M A;  1IQU A;  4U0S A;  4EZJ A;  3HVE A;  4Y6W A;  1E8X A;  2C0L A;  4L7T A;  4HLE A;  4N5C A;  1WY6 A;  3B7U X;  3MJW A;  4G1T A;  4PUC A;  4JC8 A;  5FZS A;  2LAI A;  4JA7 A;  3FY4 A;  2ILR A;  4LCT A;  2GRM A;  4JA9 A;  4EBA A;  3FWV A;  2KM4 A;  5BPP A;  4AM9 A;  3NF1 A;  4KVO A;  4WWN A;  1TJF A;  5J08 A;  4HVB A;  2WXR A;  3APF A;  4DLO A;  3D9M A;  1KT1 A;  1OWP A;  3L17 A;  3GYZ A;  4TRQ A;  2LSU A;  4E85 A;  1PAQ A;  3ONK A;  2HR2 A;  4ILI A;  4L1B A;  3PRZ A;  3D9L A;  3G2U A;  3SGH A;  3O4Z A;  2VQ2 A;  4I17 A;  2VSX E;  2OND A;  2R59 A;  2V4L A;  5AYW D;  5KJL A;  5A23 A;  5LFA A;  1MQS A;  2M63 A;  3FH8 A;  3FTU A;  4J8D A;  1SQM A;  4IN3 B;  4G11 A;  5JJT A;  3UPV A;  3PEU B;  4GZ5 A;  5KJN A;  4GA2 A;  3ULQ A;  4WND A;  4UI9 C;  2I6H A;  3D9P A;  3EDT B;  4PS3 A;  5JHA A;  1NA0 A;  3MKQ A;  4R7L A;  4KXK B;  1KLX A;  3G2V A;  3FUE A;  4HXI A;  3ZHE B;  3IHY A;  1HS6 A;  1OWL A;  4CDN A;  3B7S A;  3DPD A;  2ION A;  1HXI A;  3U9W A;  1S0P A;  3VLF A;  4JHJ A;  4ILH B;  2I2O A;  1ZBP A;  4F3V A;  4A3T A;  3T5X A;  4A3V A;  4WAF A;  3SHF A;  3I3N A;  1LF8 A;  3HYM B;  2KZT B;  2YNQ A;  2MOW A;  5ARG A;  4IRU A;  3CST A;  5FTP A;  3FHE A;  5FQ6 A;  1HG2 A;  2Y4T A;  4B8A A;  2KC7 A;  4D10 C;  5CCM A;  3RRM B;  1E8Z A;  4PDX A;  3CHQ A;  3KD7 A;  3PEV B;  4I1M A;  3LS8 A;  4UI9 K;  3LJ3 A;  2XGS A;  2WMO A;  3CVV A;  3CV0 A;  3CVN A;  2L9B A;  3PS6 A;  4BT9 A;  1HG5 A;  3QWV A;  4RG9 A;  4DPR A;  1BPO A;  4HOS A;  2I1K A;  3U4T A;  5FQ8 A;  4CT0 A;  1TJC A;  3MA5 A;  5KJK A;  3L13 A;  4GMJ A;  3RJV A;  5BT1 A;  2WPV A;  4OVU A;  4K0R A;  3FTS A;  3QKY A;  3CGH A;  2PM7 A;  3NQP A;  4F1S A;  3ESL A;  2WMN A;  4EZK A;  2KCV A;  5BV1 A;  2LSV A;  3UT4 A;  5KJM A;  3FU6 A;  4AEZ C;  5JJ7 A;  2VGX B;  4HOR A;  3ZN3 A;  2UWJ G;  3HVE B;  2WXI A;  4LRZ A;  3ZYK A;  3QB2 A;  3CVY A;  1OWM A;  3IKO B;  4UWG A;  1ELR A;  1KT0 A;  2L6J A;  3FUD A;  2AVP A;  3TJP A;  2IQC A;  3CVQ A;  3Q5M A;  4JEH A;  2X6F A;  2J09 A;  1EPU A;  4IYP A;  3JUI A;  3K9I A;  2X6K A;  3G2W A;  3LKU A;  3L6A A;  1UJK A;  2Y4U A;  4ME2 A;  1IHG A;  3BG0 B;  4B8C B;  4F53 A;  2X3M A;  3Q47 B;  3UT8 A;  1ELW A;  1WAO 1;  1Y6I A;  4CDM A;  3GZS A;  2VSN A;  4N3B A;  2V5F A;  3PZD A;  4RSY A;  4ACK A;  4J0U A;  2WQH A;  3G2T A;  4L23 A;  5BW8 C;  4M3O A;  3CVW A;  3DBS A;  5CMY A;  1QQE A;  3U3W A;  3HHM A;  4NQ0 A;  4U0Z A;  5LCW J;  4I1O B;  4WNF A;  5M72 A;  3S2A A;  1HE8 A;  4HOT A;  4Q96 A;  3ZXS A;  2PZI A;  2BF0 X;  2A5U A;  5AEN A;  3BG1 B;  3IHV A;  3CHS A;  2CHW A;  1PY1 A;  2FUL A;  2AXV A;  2VGX A;  3OXL A;  4GB9 A;  4FLH A;  1SZA A;  4UI9 J;  4LEU A;  3MKQ B;  2E0I A;  3QAR A;  3LY8 A;  4H7Y A;  3MKR A;  3JYS A;  2CG2 A;  3IV0 A;  1U3D A;  4UWK A;  3FUJ A;  1H2T C;  3CQG B;  3KAE A;  4WNE A;  3FTY A;  4DJA A;  1DNP A;  3FUH A;  1H2U A;  1H0A A;  3B13 A;  2LO6 A;  3CQC B;  2AW6 A;  2YIN A;  3C98 A;  3JQ0 A;  4WNG A;  5G2N A;  2JLB A;  3MX3 A;  3MV2 B;  1W3B A;  2A4Z A;  4OYS A;  5ANR A;  3PRE A;  3SBT B;  5EX0 A;  4YND A;  4N2Q A;  2DBA A;  4GZD A;  3BEE A;  4WWO A;  4HFG A;  2I1J A;  3ASD A;  5G05 J;  2XEV A;  3OXG A;  4PS7 A;  3NZU A;  3TL5 A;  2J4B A;  1N52 A;  3I4G A;  4BX9 A;  4FA6 A;  4CCA A;  2MHK A;  2JEK A;  3TXM A;  4GZC A;  4URK A;  3TG5 A;  3TAX A;  3CK9 A;  3PDN A;  2QY7 A;  3PUJ A;  2WXL A;  4GML A;  3CK7 A;  3Q4A B;  4U8H A;  5E75 A;  2WXQ A;  2J9Q A;  3S7B A;  3URZ A;  3UT7 A;  3T5V A;  1NZN A;  3PE3 A;  2WVI A;  3OAW A;  4P29 A;  2XHE A;  3UQ3 A;  4H7X A;  3FU3 A;  1UW4 B;  3GW4 A;  4ATG A;  4I6G A;  4A1G A;  3QJZ A;  1HZ4 A;  4I2W A;  3D3M A;  3D9N A;  5KCM A;  3CHR A;  4MKT A;  4TV3 A;  3LVR E;  3ONL A;  4U07 A;  1E7U A;  1GW6 A;  3PE4 A;  1ELK A;  4W9R A;  3RIB A;  4ABN A;  4E6H A;  5ANL A;  4GAA A;  4ANW A;  3QNK A;  4RVB A;  1N54 A;  3R9A B;  1EDU A;  4O6F A;  1EF1 C;  3MV3 B;  3Q15 A;  4XIF A;  4C0E A;  1NA3 A;  2DIW A;  3AS8 A;  4UWH A;  3R7Q A;  2WXO A;  4JHR A;  1OUV A;  1E96 B;  2NXP A;  3RO3 A;  2NC9 A;  1SZ9 A;  2P58 C;  1E7V A;  2FEZ A;  5D0Q D;  3RU0 A;  3QWP A;  3HDX A;  2I9C A;  3L08 A;  1U3C A;  3ESK A;  2VTB B;  5DIZ A;  3CIA A;  1QZ2 A;  3FU0 A;  4XE0 A;  5G04 C;  3FTZ A;  3NZS A;  4A1S A;  4J8S A;  3FUI A;  3APC A;  3FH5 A;  1Z3X A;  3FTX A;  4JXT A;  4CGW A;  3D9J A;  3FEY A;  5EX3 A;  2RG8 A;  1NP7 A;  3AU4 A;  1FVF A;  3IBE A;  2X6I A;  3FTW A;  1EYH A;  1PC2 A;  3U64 A;  3CHO A;  3L16 A;  2LAH A;  3AS5 A;  3QDN A;  3QK0 A;  5FQ4 A;  1P5Q A;  2X6H A;  3VLE A;  3VTY A;  4HOQ A;  4FJZ A;  3CHM A;  3L22 A;  3MZL B;  1JWF A;  4BY6 A;  4PH4 B;  2Y3A A;  4ANV A;  3ASG A;  4J6I A;  4N39 A;  2J49 A;  1H6K A;  5C2Y A;  2XGO A;  3RRN B;  3TXN A;  4KYO B;  1X5B A;  2RD0 A;  2X6J A;  3RRU A;  4ANX A;  5EDS A;  4AV7 A;  2VSY A;  5T3R A;  3RO2 A;  4G2V A;  3ZW3 A;  4IUL A;  3SBS A;  4RG6 A;  4LER A;  1E8Y A;  1Z6T A;  3CVU A;  5FT9 A;  4EPZ A;  2KAT A;  3EHM A;  4CT4 A;  4Q69 A;  3B7T A;  4J8E A;  5J90 A;  2QFC A;  4U0U A;  3FH7 A;  3ZRH A;  4G26 A;  3ZYQ A;  2OVB A;  1XNF A;  2L0T B;  2WB2 A;  3APD A;  4LUN U;  4APO A;  4TUU A;  4XI0 A;  3ZYL A;  4L2Y A;  4FP7 A;  4AXH A;  4DK5 A;  4GZ6 A;  3LYA A;  4F7A A;  3CVX A;  4N2S A;  3P2B A;  1IQR A;  2UY1 A;  2GGF A;  2VTB A;  4J8F A;  3ML8 A;  3L54 A;  1INZ A;  4I43 A;  3ZPJ A;  1HF8 A;  4FHJ A;  3N71 A;  1HO8 A;  2EQX A;  2VJ8 A;  4QFV A;  1OWO A;  2CG3 A;  3SNX A;  3T8M A;  4AY6 A;  3O48 A;  2WXM A;  4YVO A;  3KS2 A;  4JPS A;  2PL2 A;  2V8S E;  4GA0 A;  3KEZ A;  3LDZ A;  2FF4 A;  4K03 A;  4N3C A;  2FI7 A;  4U63 A;  3LXU X;  4AP2 A;  1XGW A;  4G24 A;  4ANU A;  3CHP A;  2IOS A;  2VGY A;  5FZR A;  4CDR A;  5JJ6 A;  4FHK A;  4FLB A;  2XCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...