3UUXA

Crystal structure of yeast fis1 in complex with mdv1 fragment containing n-terminal extension and coiled coil domains
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
127
structure length
127
Chain Sequence
KVDFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQKETL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondria fission 1 protein
publication title Crystal structure of mitochondrial fission complex reveals scaffolding function for mitochondrial division 1 (mdv1) coiled coil.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Apoptosis
total genus 52
structure length 127
sequence length 127
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
A PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3uuxA01
3GYZA 2VSNA 2V5FA 2VYIA 3N71A 2J9QA 4NQ0A 2XCBA 1NA0A 5D0OD 3NF1A 4JA9A 2UWJG 5D0QD 3CV0A 4XI0A 2KATA 4N3BA 3K9IA 5HQ8A 3ASHA 4CGVA 3UUXA 4HORA 3PDNA 4ABNA 2UY1B 3MV3B 3CK7A 2VSYA 3PE3A 4U0SA 3WXXA 4I1AA 3Q47B 3GZ1A 1P5QA 5FZQA 5M72A 3AS5A 5JJ6A 5CHEE 2XGSA 4W9RA 4BT9A 3CK8A 3OXFA 3ASFA 4JHRA 4BTAA 4AY5A 3SZ7A 4APOA 3E4BA 3FFLA 5CCLA 2UY1A 4J0UA 4N2SA 1YA0A 3RJVA 4G2VA 2IF4A 5EKQD 1KLXA 1OUVA 4I9EA 3URZA 2FBNA 3LYAA 4GA1A 4GZ5A 4UI9C 2Q7FA 4J8FA 1ZU2A 2R5SA 4GZ6A 4BTBA 4WNGA 5A6CA 1XNFA 4BT8A 4Y6CA 3RU0A 4N3CA 3R9AB 4NRHB 1HH8A 2HYZA 4GYYA 5G05C 4I2ZA 3HYMB 2C0MA 4G1TA 3TGOA 5FZSA 4JL0A 4GCOA 5EX3A 2XCCA 4GYOA 3KAEA 4XI9A 3PE4A 4J8EA 3ESKA 4GYWA 1B89A 4A1SA 3Q49B 3CEQA 3LPZA 4G26A 4B94A 4J8DA 5DBKA 1NA3A 1WAO1 2XEVA 4UQYA 3QWVA 4GZ3A 3CKBA 3GW4A 1QZ2A 4WNFA 5JJTA 5ARGA 4CDRA 4HOQA 4YVOA 4JA7A 3VTYA 5G05J 2FF4A 4U04A 1Y8MA 1ELRA 1KT0A 4WUYA 4IN3B 2HR2A 2LSUA 4N39A 2KCLA 3LKUA 4AM9A 4YNDA 3S7BA 4Y6WA 2WPVA 5HI7A 2Y4TA 5FT9A 2XGOA 3ZPJA 1WM5A 1HZ4A 3LCAA 2YHCA 4KYOB 3ZFWA 3QWPA 5KJMA 4AIFA 2XGMA 2PQRA 4EQFA 5FZRA 3QOUA 2FO7A 5KJKA 2IFUA 4I17A 4GPKA 1IHGA 2LNIA 3IEGA 3MKRA 4RG9A 3MV2B 2KCKA 5FJYA 1ZBPA 4I9CA 1PC2A 3ASGA 2NC9A 3CVPA 2HO1A 2ONDA 3ULQA 3S7FA 1FCHA 5BW8C 4LEUA 5KJLA 1E96B 4YVQC 3FP3A 3UQ3A 3CKCA 3Q4AB 3SF4A 3FWVA 4WNEA 1W3BA 2KCVA 3S7JA 3RO3A 5A7DB 2XPIA 4GA0A 4GCNA 4UI9K 3RIBA 2C2LA 4UI9J 3ZHEB 4H7YA 2C0LA 3LY9A 3EDTB 2KC7A 4G25A 2VGYA 4KBQA 2WQHA 5C1DA 3AS8A 2I6HA 4F3VA 3LY7A 1KT1A 3CVNA 4HOTA 1HXIA 4UQXA 5LCWC 1TJCA 2PZIA 4H7XA 4KXKB 2MHKA 3MA5A 3KS2A 2E2EA 2JLBA 2DBAA 3TG4A 3KD7A 5BNWA 5ARFA 4G23A 3MEKA 4G24A 3RKVA 3RO2A 4ME2A 4WNDA 3O48A 2PQNA 5CCMA 3CK9A 5G04C 3ZGQA 2PL2A 4N3AA 3JYSA 4RG6A 2QFCA 1IYGA 4U0ZA 5DIZA 5KJNA 1NZNA 3S7DA 3ZHEA 3ASDA 2VGXB 3VTXA 4N5CA 4AY6A 3U3WA 4U07A 3GZ2A 4U0UA 3UPVA 4I2WA 2BUGA 5LCWJ 3QKYA 4O6FA 2AVPA 4XIFA 3CVQA 1QQEA 4HOUA 3TAXA 2YQ8A 5AYWD 1ELWA 3AS4A 3LY8A 4CGWA 5BT1A 5JJ7A 5G04J 2P58C 2LSVA 2L6JA 3U4TA 4N2QA 4HOSA 2VGXA 3QWWA 3OXGA 2FI7A 3TG5A 3QDNA 2Y4UA 3CVLA 2GW1A 2VQ2A 4BWRA 2FEZA 3Q5MA 4GA2A 5FTPA 1A17A 5EX0A 3BEEA 3ZN3A 2OOEA 4UQZA 3OXLA 3Q15A
chains in the Genus database with same CATH superfamily
1UJJA 3DEPA 3FU5A 2BF0X 3SD5A 2LUHA 3DSVA 3B7RL 2H6IA 1SVXA 5D0OD 4ILHB 5E75A 3PVLA 3I4RB 3IBEA 3SBSA 2HM8A 3CV0A 3UINC 4BESA 4XI0A 2YHEA 3Q73A 4G8LA 2KBXA 3RRUA 3K9IA 1SW6A 4GTQA 4GMRA 3CK7A 4YDWA 4LUNU 4U0SA 5J90A 2L0TB 2GRNB 3Q47B 1OWPA 1OCZE 2GRQB 5FZQA 3UM3A 4U8YD 2P9LG 5FINA 4HRMB 4QQIA 4HI9A 3AS5A 1H6PA 1UN9A 5CHEE 4W9RA 1XGWA 4OAVB 1N4SA 3D9HA 5AAOA 1U2VG 2A5UA 2F8YA 1WY6A 2MRIA 3FFLA 4APOA 2UY1A 3PREA 1S63A 1YA0A 1BU9A 3RJVA 3F6QA 1TEZA 2IF4A 5EKQD 4K5BA 5CERB 4O60A 4I9EA 4HFGA 5AQBA 3UIOC 2DWZA 2FBNA 4GTTA 3LYAA 4L9PA 3L9TA 3X2QE 4MBGA 4WNGA 5A6CA 1E90A 3ZW3A 4I43A 1N52A 1H2VC 3ML9A 2OCCE 4GYYA 3AG2E 4A1GA 4B0ZA 5KBAA 3B13A 2AXZA 4JZYA 4TXQA 1A5EA 4HB5A 2J4BA 4GCOA 3NBNB 3TWRA 4GYOA 3KAEA 4XI9A 2MYOA 4J8EA 1B89A 1DNPA 3ULYA 4LNBA 3FTZA 5BV1A 4MS6A 3C72A 4G26A 1NA3A 3E37A 1RZ4A 3QWVA 5BPPA 3V2OA 1QZ2A 3TWQA 5JJTA 1K1AA 4CDRA 3HXBA 4JB8P 4YVOA 4KZCA 3HXFA 4CT4A 3NB2A 2JABA 1YCSB 4U04A 2Y0BG 1OWLA 2WXPA 3HDXA 4WAFA 1KZOA 4N5QA 3ZYKA 4XKCA 4AOFA 4WUYA 5FQ8A 4IN3B 4YNDA 4Y6WA 5CBNA 2ETBA 3U9WA 1O5MA 1FT1A 2KZTB 4J8SA 4RQIA 4PDXA 3OTNA 1N9AA 5FT9A 4BSXA 1HZ4A 4IRUA 3ZYQA 2CHXA 1DVPA 5BUZA 2VJ8A 2FO7A 4DRXE 5ENQD 2X6KA 4A63B 2IFUA 3B7UX 2WXJA 4HS2A 4FP7A 3TXNA 4OAUC 2LNIA 4FHKA 5EDSA 5D2MC 4I6EA 4GPMA 1K3ZD 1PC2A 4JW1A 4C48B 5T3RA 3TWUA 2XPZA 2HO1A 2YINA 4OVUA 3ULQA 4GTVA 1FVFA 1E96B 2AWIA 5G2NA 3MJWA 1OY3D 1TN6A 4I1OB 5CEDB 3L6AA 4EBAA 3S7JA 1BI8B 4JVSA 2C2LA 3ZHEB 1V54E 2WB2A 2NSZA 3Q7AA 4G25A 2IU1A 4HNAD 3AU4A 3FTXA 4F3VA 3CHRA 1KT1A 4HBDA 4LG6A 3UT7A 1TJCA 3FU6A 4H7XA 3KSQA 1U3DA 4KXKB 3MCXA 3TG4A 3UM0A 5AQ9A 3SNXA 3MEKA 4G24A 3RKVA 4ME2A 3V30A 2PQNA 3IHYA 5CCMA 5JA4D 4MLPA 2WXMA 3MKQA 3RAUA 4N3AA 2IJGX 2QFCA 5KJNA 1NZNA 2IOSA 2IY0C 3KSLA 4B8CB 2XHEA 3APFA 5LX8A 3R7QA 2J4DA 2P9PG 3UM2A 4F53A 4U63A 3AG4E 3UT4A 2P9KG 3UKRG 5LCWJ 3QKYA 1MYOA 2AVPA 3E34A 2BTDA 4HOUA 3TAXA 2QYJA 3VLDA 4XE0A 3Q9NC 3DWLG 4CGWA 5G04J 3MYVA 4UWFA 5D66A 3C3OA 4C9BB 2EQXA 4HQDA 3VLEA 1UOHA 5ENNA 4DI4A 3DBSA 3CGHA 5FTPA 1A17A 4J8YA 4PS8A 1S70B 1N4RA 2F37A 3ZNGA 3SFYA 4HI8A 2DZNA 3EU9A 3T9KA 3LVQE 3G2VA 1TNYA 3NOCD 1LF8A 3GYZA 2VSNA 3Q7FA 4L2YA 3V31A 2XZTG 2LAIA 2VTBB 2XRZA 3UTMA 4JA9A 3B7SA 3JUEA 1LTXA 3PNLB 5ANLA 4N3BA 2I9CA 3L17A 2IEJA 3ASHA 4U7EB 4K03A 3PE3A 4I1AA 4MKTA 4DLOA 4JC8A 1TNZA 3NZUA 2J09A 3W9GA 5M72A 3PZ4A 4ANVA 2CHZA 1O1TA 4BT9A 3SFZA 3OXFA 4BSZB 3NAWA 4PH4B 5AJLA 3O4ZA 2I1JA 4RLYA 4LSZE 5AJDA 2XENA 1E8ZA 1MZCA 1K8KG 4DLQA 3L13A 1E8WA 2J07A 4G2VA 1KLXA 2WMNA 3UMVA 5AQ7A 4GZ5A 3CR3A 4J8FA 4GZ6A 1XNFA 4Y6CA 3SFXA 2WXQA 4CDMA 3R9AB 5EIBE 1LD8A 5CECB 4NIKA 5ENRD 2WXIA 3UI2A 4JHKA 2LXLA 5G05C 3C5RA 3DXKG 3HYMB 2H6GA 3SBTB 5FQ6A 3G2SA 1IQRA 3TGOA 4DX6D 3L22A 1JWFA 2J08A 4KVOA 2JEKA 1TN8A 2B0OE 5AQAA 3LS8A 2XS1A 3SY2A 5EYPF 1DCEA 3CEQA 2V8SE 2R17C 4QFVA 3SI5A 3ZRHA 3LPZA 1WAO1 4UQYA 4GU5A 1E8YA 1N54A 4AV7A 3IXEA 4GTSA 3TL5A 5HKPA 5CMWA 3VTYA 2BKKB 3ZYMA 1SZAA 3R9MA 3ABLE 1JCQA 2XRYA 2CFZA 5EILA 1ELRA 1TNUA 1KT0A 3GZSA 4EHMA 1OWOA 4JEUA 5E76A 2LSUA 4AM9A 2OEVA 3S7BA 4HVBA 5EYLA 1HE8A 2WXKA 3MGBA 2XGOA 3ZPJA 1OCRE 4G11A 5ENSD 2XPYA 4F1SA 5HRYA 3HIZA 4KYOB 4ATGA 3TXMA 3QWPA 3LXUX 4X8QA 4KMOA 3QC1A 5FZRA 4BX8A 2IO2C 5KWDA 3QOUA 4Q69A 1EDUA 3DSWA 2GRMA 2YNQA 4I17A 3C3QA 2KZTA 3D9PA 4RG9A 3P1UA 2ZXWE 2RFMA 3HXDA 1O1SA 4ILIA 3ASGA 3DSXA 1TN7A 2KM4A 3CVPA 4PS3A 3FY4A 3ULEG 4EZLA 1FCHA 3FTUA 3JXJA 3JQ1A 4ATZD 3CKCA 3Q4AB 3FWVA 4ANWA 1SA5A 5A7DB 2XPIA 4GA0A 4GCNA 1H0AA 4UI9J 1N4PA 2C0LA 3EDTB 4CT0A 3UX4A 4OYSA 3UXGA 3LDZA 1HX8A 2ZISA 4P29A 2I6HA 2VSOE 5KNGA 4UWLA 4UQXA 3FUJA 2RKKA 2PZIA 2BEDA 4TXRA 1HFAA 2JLBA 4XEIG 3KD7A 2GRRB 4U95D 5ARFA 2X6JA 4LRZA 3ZXPA 3RO2A 1DC2A 3TWVA 3B95A 2HE0A 4HLEA 2X6FA 3D9OA 4EBAG 4AXHA 3JYSA 4RG6A 2GGFA 3KEAA 4U0ZA 1HU3A 4BERA 3ZHEA 4BFRA 1OWMA 2F8XK 4CRWA 3DSTA 4N5CA 3CVXA 2WM9A 1NI1A 4DPRA 4AY6A 4U8HA 3RK6A 1FPPA 3S2AA 4E6HA 3ZXSA 3UPVA 1JCRA 4KVMA 4ZFHA 4XIFA 3FTWA 3I5PA 3CVQA 1QQEA 4FLHA 2EINE 3I3NA 4WWOA 1N0QA 1AP7A 2DVWA 1OCOE 5LOZA 3HVEB 3RRNB 3AS4A 3LY8A 2QYUA 2P58C 2CFUA 2EIKE 1N11A 1MQSA 4KT6B 4K0RA 3V2XA 4HOSA 2EILE 3QDNA 2PM7A 4HRLA 3CVLA 3PZDA 1IKND 5CRUA 5KCMA 2X38A 4O1OA 3MZLB 4CCAA 1DCQA 2R03A 4A3VA 3PH0C 5CBOA 4CDNA 2L6BA 3N71A 4LCTA 4LNGA 3LJ3A 3CHMA 3FUNA 3FUDA 1LD7A 4K5CA 3ESLA 3NF1A 2V5QC 4GZCA 1IXVA 3NZSA 5ITZF 4FHJA 1O1RA 4RSYA 5D0QD 3HXEA 1Z3YA 2WXLA 3CVUA 2V0PA 5HQ8A 4GMLA 4CGVA 4YDOA 1NP7A 2WXHA 1OXJA 1EYHA 2X6HA 5B1AE 4AP2A 3ABME 3FEYA 4L2LA 1HG2A 1E8XA 2CHWA 4JXTA 2VTBA 3FUIA 4GTMA 5AARA 2IO3C 3APCA 1D8EA 3E33A 4FJZA 1MJ0A 1E7VA 3ASFA 2R05A 3IKOB 3NOGD 4TRQA 5KNHD 5CMYA 4BTAA 2WQ7A 4AY5A 3QARA 2H6FA 5ENPD 3E4BA 2J8SD 5CCLA 1BLXB 3LEWA 2ZGGA 4EZJA 3ML8A 2ETCA 4J0UA 4N2SA 1HG5A 3D9MA 1H19A 3URZA 2GRPB 2XEEA 4TXPA 4GA1A 3FUEA 1Z6TA 1ZU2A 2R5SA 3PZ3A 3L08A 4BTBA 4NURA 2I1KA 1JPLA 3QK0A 4BT8A 4N3CA 4HXIA 3AU5A 3AG3E 2HYZA 4WWPA 3KEZA 3PUJA 3Q75A 4GMJA 3T5XA 2Y69E 4MRUA 2C0MA 4U96D 3AG1E 4G1TA 5FZSA 4JL0A 5BV0A 3IV0A 1TNBA 5EX3A 5J08A 1H2UA 5H7PA 4GYWA 4A3TA 4A1SA 4Z68A 3EHMA 2FO1E 3ABKE 4CZ2D 2LO6A 4M3OA 4L23A 5EN5D 2I2OA 1PAQA 2LXMA 4GZ3A 4RVBA 2AXVA 4FU3A 3GW4A 4WNFA 3EUVA 3V79K 4XZ4A 3FTYA 5ARGA 1H2TC 1ELKA 1AWCB 4JA7A 4V3IA 2ETAA 2KXPC 5G05J 2FF4A 2OEWA 3T8KA 3QB2A 2P9IG 1FT2A 4EZKA 5CEAA 1VDYA 1KZPA 1HO8A 2HR2A 4YDYA 4N39A 2KCLA 2WPVA 4BETA 3ASNE 2Y4TA 2NXPA 2CG2A 3FUHA 5ANRA 1UW4B 2P9SG 1WM5A 3CHSA 3QJZA 3LCAA 4FLBA 3ZFWA 3L16A 1TYQG 2CG3A 4AIFA 2XGMA 3PEUB 2PQRA 4ANUA 3ZUVB 4EQFA 5G55A 3G2TA 1BI7B 2DZOA 3CVWA 3U64A 2IOLA 4CYMD 4UWKA 5KJKA 2WMOA 3BUAA 5CRVA 1E7UA 1IHGA 3T5VA 3IHVA 2DCPA 3ONKA 5FJYA 1ZBPA 2NC9A 4G8KA 3EIQC 4F6RD 4DJAA 2Y3AA 3S7FA 2RD0A 1JCSA 4Q96A 4LEUA 4BY6A 5KJLA 3AJIA 4PUCA 3FP3A 3UQ3A 3SF4A 4B93B 3Q78A 1S0PA 3D9JA 3ASOE 2GROB 4LERA 1UJKA 4DX1A 3CVYA 2KC7A 3D9KA 4KBQA 1K1BA 1YYHA 3E32A 2WQHA 3DSUA 1N4QA 3AS8A 3VLFA 3LY7A 3CVNA 4R7LA 1HXIA 2X6IA 3CSFA 3HHMA 2ZGDA 4EECA 3KS2A 2E2EA 5FIOA 2DBAA 2P9UG 3PS6A 5BNWA 4GB9A 4O1PA 4JEHA 4G23A 3Q9UC 3O48A 3PEVB 3CK9A 3TJPA 5IY5E 2H6HA 2PL2A 4TUUA 3TWTA 1IYGA 3FHEA 5DIZA 5C2YA 1SA4A 2EIJE 4GTOA 3S7DA 5B3SE 3FTSA 3DXMG 2RG8A 2VGXB 3VTXA 5A23A 3D3MA 3QAQA 2VSXE 4NACA 2AW6A 4I2WA 1QNFA 2BUGA 3JQ0A 3JCKC 4UWGA 3APDA 4FA6A 3ZVVA 3CQGB 2EIME 1TNOA 5AYWD 4UUCA 3LJNA 3LVRE 1U3CA 1QBQA 5JJ7A 3U4TA 4C0MA 3SQVA 3MX3A 4AJWA 4D10C 4N2QA 3EIJA 3OXGA 3QWWA 3CVVA 3TG5A 3J5QB 5ENOD 2ZU6B 2Y4UA 5BXOA 2GW1A 1IQUA 2VQ2A 4BWRA 2XZDG 2FEZA 3PRZA 5LP0A 5AN8A 3UIPC 5EX0A 3E30A 3ZKJA 3BEEA 3ZN3A 5JHAA 2XQ0A 4UQZA 1Z5SC 2PNNA 3OXLA 3Q15A 3I4GA 5T8IA 3HVEA 3FU3A 2DYSE 2V5FA 2VYIA 2WXOA 2J9QA 4NQ0A 2XCBA 2OVBA 1NA0A 2BKGA 3C98A 4DX7D 2UWJG 4L1BA 1D8DA 5JMND 3PNTB 2KATA 4ANXA 3UUXA 4FULA 4HORA 3PDNA 4ABNA 4APFA 2UY1B 3MV3B 2VSYA 2AXUA 3WXXA 2Y1LE 1OT8A 3CHOA 3EU5A 3GZ1A 2M63A 1P5QA 3HG0D 3G2WA 4DX2A 3ZYLA 1N94A 5T4YA 2FULA 4I1MA 3RSEG 2WXFA 5JJ6A 4JD2G 3FDHA 2XGSA 3D9IA 3CK8A 2PM6A 4GTPA 1MHQA 2IQCA 3FH5A 5LFAA 4JHRA 4B89A 5EIDA 3SZ7A 1INZA 1OWNA 3PZ1A 1NL4A 2QZAA 4DI3A 4BX9A 1OUVA 3ZEFA 4HRNA 2V4HC 4UI9C 4LNUD 2Q7FA 1BPOA 4FC8A 4B8AA 3W9FA 3EHNA 3RU0A 2NYJA 1S64A 1HS6A 4NRHB 1HH8A 4DUIA 1JWGA 3CSTA 4UWHA 1SZ9A 2XEHA 2R02A 4I2ZA 4KZ0A 2DIWA 3ISMC 3G2UA 1WDYA 4I6JA 3FH7A 2WXRA 4JPSA 2XCCA 3FUFA 3PE4A 3ESKA 3FULA 3FTVA 2A4ZA 3Q49B 4YDEA 1D9SA 3BG1B 3UM1A 4C0EA 4B94A 4J8DA 5DBKA 1Y6IA 2XEVA 3CKBA 3TWWA 2B6CA 3CHPA 3R7RA 3U66A 4HOQA 2GRLA 3P2BA 4U8VD 1L5JA 4GZDA 3J5PA 3SO8A 1JUQA 3TWXA 2IONA 3QNKA 1Y8MA 3DPYA 4IULA 3L82A 3DRAA 1MX6A 3LKUA 2AJAA 5AENA 1N95A 3SGHA 4ILGA 3CHQA 5HI7A 5FQ4A 5JHBA 5BXUA 1SQMA 4K5AB 2F0YA 1Q2ZA 1UG3A 2ZIRA 4E85A 2YHCA 3NQPA 4DK5A 5KJMA 4FJYA 4XKBA 3OAWA 4OVVA 1H6OA 2P9NG 2WXNA 2LAHA 3HXCA 4DX5D 4TV3A 4ACLA 3CQCB 1EPUA 1Z3XA 3T8MA 3EHRA 2ILRA 4Q94A 1HF8A 4A55A 3WG7E 3JUIA 3PZ2A 5ENTD 4GPKA 4M7CA 3IEGA 3MKRA 3MV2B 2KCKA 4EPZA 4HLLA 4I9CA 3UT8A 1N0RA 5HS0A 1OCCE 2P2CP 2ONDA 2XS8A 5BW8C 3D9NA 1H6KA 1NFIE 4YVQC 1FVHA 3HRAA 1X5BA 3ZU7B 2A5EA 4F1PA 4WNEA 1W3BA 1TJFA 4CEMA 2R59A 2KCVA 3MKQB 2QY7A 3FH8A 4AEZC 4IYPA 3RO3A 1EF1C 4FADA 4UI9K 3RIBA 4H7YA 3LY9A 5FQ7A 2VGYA 2E0IA 2MOWA 2RFAA 1TR4A 4GTRA 4WWNA 5C1DA 4GAAA 3PUKA 1GW6A 4HOTA 5LCWC 3RRMB 3DEOA 3AAAC 4I6GA 1PY1A 2MHKA 4TUMA 3MA5A 1WG0A 4AVXA 4JHJA 3ONLA 4WNDA 1IHBA 4URKA 5G04C 3ZGQA 2OV8A 3C3RA 1YMPA 4ACKA 3DPDA 2J49A 3Q79A 3EHQA 5FWQA 3TWSA 3FEXA 3ASDA 1BD8A 3FU0A 1MX2A 2QC9A 2L9BA 2OVFA 4J6IA 3U3WA 4U07A 3GZ2A 4U0UA 1X81A 4PS7A 3B7TA 1G3NB 5AIJA 4O6FA 4ZHBA 1V55E 3ZIMA 4BEPA 3SHFA 2WQ6A 3FUKA 1MX4A 2YQ8A 3DSSA 3UKUG 2L0IA 3JXIA 3EJNA 2X3MA 1ELWA 4L7TA 5BT1A 2LSVA 2L6JA 2WVIA 2WXGA 4F7AA 3ENEA 1UN8A 2VGXA 3CLJA 4XX5A 2FI7A 2DYRE 3L54A 4J7WA 2VGEA 1RW2A 3CIAA 2V4LA 3D9LA 3Q5MA 4GA2A 3FUMA 5B1BE 3BQOA 3BG0B 1ZB1A 2OOEA 1KPSB 3B7BA 2R2LA 3BU8A 1QYMA
chains in the Genus database with same CATH topology
3I4GA 3PH0C 1UJJA 3FU5A 1LF8A 2BF0X 3GYZA 3HVEA 5T8IA 3FU3A 2VSNA 2V5FA 2VYIA 4CDNA 2WXOA 4L2YA 3SD5A 3N71A 4LCTA 3B7RL 3CHMA 3LJ3A 2J9QA 4NQ0A 2XCBA 3FUNA 3FUDA 2OVBA 1NA0A 3ESLA 2LAIA 2VTBB 5D0OD 3C98A 3NF1A 2XRZA 4ILHB 5E75A 4GZCA 3PVLA 4JA9A 3B7SA 3NZSA 2UWJG 3I4RB 3IBEA 4FHJA 4RSYA 5D0QD 3SBSA 2HM8A 3CV0A 4L1BA 3PNLB 4XI0A 5ANLA 2YHEA 3PNTB 2KATA 1Z3YA 2WXLA 2I9CA 3L17A 4N3BA 3CVUA 3RRUA 3K9IA 2V0PA 5HQ8A 3ASHA 4ANXA 4GMLA 4CGVA 3UUXA 4FULA 4HORA 3PDNA 4ABNA 4APFA 2UY1B 3MV3B 3CK7A 2VSYA 2AXUA 1NP7A 4LUNU 2WXHA 4K03A 3PE3A 4U0SA 3WXXA 1EYHA 4I1AA 4MKTA 5J90A 2X6HA 3CHOA 2L0TB 4DLOA 3Q47B 1OWPA 4JC8A 3GZ1A 2M63A 1P5QA 3NZUA 2J09A 3G2WA 4AP2A 3ZYLA 3FEYA 4L2LA 5FZQA 1HG2A 5T4YA 5M72A 1E8XA 2FULA 2CHWA 4JXTA 4ANVA 4I1MA 2VTBA 2CHZA 3FUIA 3AS5A 2WXFA 5JJ6A 1UN9A 5CHEE 3FDHA 2XGSA 4W9RA 3APCA 1XGWA 3D9IA 4BT9A 3CK8A 3SFZA 2PM6A 3OXFA 4FJZA 1MHQA 1E7VA 3ASFA 2IQCA 3FH5A 5LFAA 4JHRA 4B89A 3IKOB 4TRQA 5CMYA 4BTAA 4PH4B 5AJLA 2WQ7A 3O4ZA 4AY5A 3SZ7A 1INZA 2A5UA 3QARA 2I1JA 1WY6A 1OWNA 2MRIA 3E4BA 3FFLA 4APOA 5AJDA 5CCLA 3LEWA 4EZJA 1E8ZA 3ML8A 2UY1A 4DLQA 3PREA 4J0UA 4N2SA 3L13A 1E8WA 1HG5A 1YA0A 3RJVA 4DI3A 3D9MA 2J07A 4G2VA 1H19A 2IF4A 1TEZA 5EKQD 4BX9A 1KLXA 1OUVA 3ZEFA 4I9EA 4HFGA 3URZA 2WMNA 2FBNA 3UMVA 3LYAA 4GA1A 4GZ5A 3FUEA 3CR3A 2Q7FA 1Z6TA 4J8FA 4UI9C 1ZU2A 2R5SA 3L08A 4GZ6A 4BTBA 1BPOA 4FC8A 4B8AA 4NURA 4WNGA 5A6CA 1XNFA 1JPLA 2I1KA 1E90A 3EHNA 3QK0A 4Y6CA 3RU0A 4I43A 3ZW3A 4N3CA 4HXIA 1N52A 2WXQA 1H2VC 4CDMA 3ML9A 1HS6A 3R9AB 3AU5A 4NRHB 1HH8A 2WXIA 2HYZA 4WWPA 3KEZA 4GYYA 1JWGA 3CSTA 4JHKA 4UWHA 4A1GA 4B0ZA 1SZ9A 5G05C 3PUJA 3B13A 4I2ZA 4KZ0A 3HYMB 4GMJA 2AXZA 4JZYA 3T5XA 3SBTB 2DIWA 5FQ6A 3G2UA 4MRUA 2C0MA 3G2SA 4I6JA 3FH7A 2WXRA 1IQRA 4G1TA 3TGOA 5FZSA 4JL0A 3L22A 2J4BA 4GCOA 5BV0A 3IV0A 4BT8A 1JWFA 5EX3A 2J08A 4KVOA 4JPSA 2XCCA 2JEKA 4GYOA 3KAEA 3FUFA 5J08A 1H2UA 4XI9A 3PE4A 4J8EA 3ESKA 3LS8A 3FULA 4GYWA 1B89A 3FTVA 4A3TA 1DNPA 2A4ZA 4A1SA 3Q49B 3CEQA 3FTZA 2V8SE 3EHMA 2R17C 3BG1B 4QFVA 5BV1A 3SI5A 3ZRHA 4MS6A 4C0EA 3LPZA 4G26A 2LO6A 4M3OA 4B94A 4J8DA 4L23A 5DBKA 1NA3A 1WAO1 1Y6IA 2I2OA 1PAQA 2XEVA 4UQYA 4GU5A 1E8YA 3QWVA 4GZ3A 1N54A 4RVBA 3CKBA 2AXVA 5BPPA 4AV7A 4FU3A 3CHPA 3GW4A 1QZ2A 4WNFA 3R7RA 5JJTA 3U66A 4XZ4A 3FTYA 5ARGA 4CDRA 3TL5A 4HOQA 2GRLA 1H2TC 1ELKA 3P2BA 4YVOA 4JA7A 5CMWA 4KZCA 4V3IA 3VTYA 1L5JA 3ZYMA 4GZDA 5G05J 4CT4A 1SZAA 2FF4A 3QB2A 1JUQA 4U04A 1OWLA 2WXPA 2XRYA 3HDXA 4EZKA 4WAFA 3ZYKA 2CFZA 4XKCA 2IONA 1VDYA 1Y8MA 3QNKA 1ELRA 1KT0A 4WUYA 4AOFA 4IULA 5FQ8A 1HO8A 3GZSA 4IN3B 1OWOA 2HR2A 4JEUA 5E76A 2LSUA 4N39A 2KCLA 3LKUA 5AENA 3SGHA 4AM9A 4YNDA 4ILGA 3S7BA 4HVBA 4Y6WA 2WPVA 3CHQA 3U9WA 2KZTB 4J8SA 5HI7A 4PDXA 5FQ4A 1HE8A 2Y4TA 5JHBA 3OTNA 2NXPA 2CG2A 5FT9A 3FUHA 5ANRA 2WXKA 4BSXA 3MGBA 1UW4B 2XGOA 3ZPJA 1SQMA 1WM5A 1HZ4A 3CHSA 4G11A 3QJZA 2XPYA 1UG3A 4F1SA 4E85A 3LCAA 4IRUA 3HIZA 2YHCA 4FLBA 4KYOB 3ZFWA 3L16A 3NQPA 4ATGA 4DK5A 3TXMA 3QWPA 5KJMA 4FJYA 2CG3A 3LXUX 4XKBA 4AIFA 3OAWA 4OVVA 4KMOA 2CHXA 2XGMA 3PEUB 3ZYQA 1DVPA 2PQRA 3QC1A 4ANUA 5BUZA 4EQFA 2VJ8A 5FZRA 5G55A 2WXNA 4BX8A 3G2TA 2LAHA 4TV3A 3QOUA 4ACLA 3CQCB 2FO7A 4Q69A 1EPUA 1Z3XA 3CVWA 1EDUA 3U64A 2IOLA 3T8MA 2X6KA 4UWKA 2GRMA 5KJKA 2WMOA 2IFUA 3B7UX 2ILRA 4Q94A 2WXJA 1HF8A 4HS2A 2YNQA 4I17A 4A55A 3JUIA 1E7UA 4FP7A 4GPKA 3TXNA 1IHGA 2LNIA 2KZTA 4FHKA 3IEGA 3MKRA 3D9PA 3T5VA 3IHVA 5EDSA 2DCPA 4RG9A 3P1UA 3ONKA 3MV2B 2KCKA 5FJYA 4I6EA 4EPZA 1ZBPA 4I9CA 1PC2A 3UT8A 4ILIA 3ASGA 2NC9A 4JW1A 2KM4A 5T3RA 3CVPA 4PS3A 2XPZA 3EIQC 3FY4A 4EZLA 2HO1A 4DJAA 2YINA 2ONDA 2Y3AA 4OVUA 3S7FA 3ULQA 1FCHA 1FVFA 2RD0A 3FTUA 4Q96A 3D9NA 4LEUA 5BW8C 4BY6A 5KJLA 1H6KA 4PUCA 1E96B 3JQ1A 1FVHA 4YVQC 2AWIA 3FP3A 3UQ3A 1X5BA 5G2NA 3CKCA 3MJWA 3Q4AB 3SF4A 3FWVA 4WNEA 1W3BA 1TJFA 4ANWA 4CEMA 2R59A 2KCVA 4I1OB 3L6AA 3MKQB 1S0PA 2QY7A 3S7JA 4EBAA 3FH8A 4AEZC 4IYPA 3RO3A 5A7DB 3D9JA 2XPIA 1EF1C 4GA0A 4JVSA 4LERA 4GCNA 4FADA 4UI9K 3RIBA 1H0AA 2C2LA 1UJKA 4UI9J 4H7YA 3ZHEB 2C0LA 3LY9A 3CVYA 3EDTB 4CT0A 2WB2A 3UX4A 2NSZA 4OYSA 2KC7A 4G25A 2VGYA 3D9KA 4KBQA 3LDZA 5FQ7A 2E0IA 1HX8A 2MOWA 2IU1A 2WQHA 4WWNA 5C1DA 3AS8A 4GAAA 3AU4A 3FTXA 4P29A 3PUKA 2I6HA 4F3VA 2VSOE 3CHRA 1GW6A 3VLFA 3LY7A 1KT1A 3CVNA 4R7LA 4HOTA 1HXIA 2X6IA 4UQXA 4UWLA 3UT7A 3FUJA 5LCWC 3CSFA 1TJCA 2PZIA 3FU6A 3RRMB 4H7XA 4I6GA 3HHMA 1HFAA 1U3DA 4EECA 4KXKB 1PY1A 2MHKA 3MA5A 3KS2A 3MCXA 2E2EA 2JLBA 2DBAA 3TG4A 4AVXA 3KD7A 4JHJA 3PS6A 5BNWA 4GB9A 4JEHA 3SNXA 5ARFA 2X6JA 4G23A 3MEKA 4LRZA 3ONLA 4G24A 3RKVA 3RO2A 4ME2A 4WNDA 3O48A 2PQNA 3PEVB 3IHYA 5CCMA 4URKA 3CK9A 3TJPA 5G04C 4HLEA 2X6FA 3ZGQA 4MLPA 2WXMA 3MKQA 2OV8A 3D9OA 2PL2A 4EBAG 4TUUA 4N3AA 3JYSA 4RG6A 2IJGX 4AXHA 2QFCA 4ACKA 3DPDA 2GGFA 2J49A 1IYGA 3FHEA 4U0ZA 1HU3A 5DIZA 5C2YA 5KJNA 1NZNA 2IOSA 3S7DA 3ZHEA 5FWQA 4BFRA 3FEXA 3FTSA 1OWMA 4B8CB 4CRWA 2RG8A 2XHEA 3ASDA 2VGXB 3APFA 5LX8A 3VTXA 3R7QA 5A23A 2J4DA 4N5CA 3CVXA 3FU0A 2WM9A 3D3MA 4F53A 4DPRA 2L9BA 2OVFA 4AY6A 4J6IA 4U63A 3U3WA 4U8HA 3QAQA 3GZ2A 4U07A 4U0UA 3RK6A 3S2AA 2VSXE 3ZXSA 4E6HA 3UPVA 3UT4A 4NACA 2AW6A 4I2WA 4PS7A 1QNFA 2BUGA 3B7TA 5LCWJ 4KVMA 3JQ0A 3JCKC 3QKYA 5AIJA 4O6FA 2AVPA 3FTWA 4XIFA 3I5PA 4UWGA 3CVQA 3ZIMA 1QQEA 2BTDA 3SHFA 2WQ6A 3APDA 3FUKA 4FA6A 4FLHA 4HOUA 3TAXA 3CQGB 3ZVVA 3I3NA 4WWOA 3VLDA 2YQ8A 4XE0A 2L0IA 5AYWD 5LOZA 3EJNA 2X3MA 1ELWA 3HVEB 4L7TA 3RRNB 3LVRE 3AS4A 3LY8A 4CGWA 1U3CA 5BT1A 5JJ7A 5G04J 2P58C 2LSVA 2L6JA 3MYVA 2WVIA 3U4TA 4C0MA 4UWFA 3MX3A 2CFUA 2WXGA 4F7AA 3ENEA 4AJWA 1MQSA 4KT6B 4C9BB 2EQXA 4D10C 4N2QA 3VLEA 1UN8A 4K0RA 4HOSA 2VGXA 3EIJA 3OXGA 3QWWA 3CVVA 3CLJA 4XX5A 2FI7A 5ENNA 3TG5A 3QDNA 4DI4A 2PM7A 3L54A 2ZU6B 2Y4UA 3CVLA 3PZDA 3DBSA 3CIAA 2V4LA 2GW1A 1IQUA 2VQ2A 3D9LA 4BWRA 3CGHA 2FEZA 3Q5MA 3PRZA 4GA2A 5LP0A 5FTPA 1A17A 5KCMA 2X38A 3FUMA 4PS8A 5EX0A 3MZLB 4CCAA 3BG0B 3BEEA 3ZN3A 5JHAA 2XQ0A 2OOEA 4UQZA 3OXLA 3Q15A 3LVQE 4A3VA 3G2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYZ A;  2VSN A;  2V5F A;  2VYI A;  3N71 A;  2J9Q A;  4NQ0 A;  2XCB A;  1NA0 A;  5D0O D;  3NF1 A;  4JA9 A;  2UWJ G;  5D0Q D;  3CV0 A;  4XI0 A;  2KAT A;  4N3B A;  3K9I A;  5HQ8 A;  3ASH A;  4CGV A;  3UUX A;  4HOR A;  3PDN A;  4ABN A;  2UY1 B;  3MV3 B;  3CK7 A;  2VSY A;  3PE3 A;  4U0S A;  3WXX A;  4I1A A;  3Q47 B;  3GZ1 A;  1P5Q A;  5FZQ A;  5M72 A;  3AS5 A;  5JJ6 A;  5CHE E;  2XGS A;  4W9R A;  4BT9 A;  3CK8 A;  3OXF A;  3ASF A;  4JHR A;  4BTA A;  4AY5 A;  3SZ7 A;  4APO A;  3E4B A;  3FFL A;  5CCL A;  2UY1 A;  4J0U A;  4N2S A;  1YA0 A;  3RJV A;  4G2V A;  2IF4 A;  5EKQ D;  1KLX A;  1OUV A;  4I9E A;  3URZ A;  2FBN A;  3LYA A;  4GA1 A;  4GZ5 A;  4UI9 C;  2Q7F A;  4J8F A;  1ZU2 A;  2R5S A;  4GZ6 A;  4BTB A;  4WNG A;  5A6C A;  1XNF A;  4BT8 A;  4Y6C A;  3RU0 A;  4N3C A;  3R9A B;  4NRH B;  1HH8 A;  2HYZ A;  4GYY A;  5G05 C;  4I2Z A;  3HYM B;  2C0M A;  4G1T A;  3TGO A;  5FZS A;  4JL0 A;  4GCO A;  5EX3 A;  2XCC A;  4GYO A;  3KAE A;  4XI9 A;  3PE4 A;  4J8E A;  3ESK A;  4GYW A;  1B89 A;  4A1S A;  3Q49 B;  3CEQ A;  3LPZ A;  4G26 A;  4B94 A;  4J8D A;  5DBK A;  1NA3 A;  1WAO 1;  2XEV A;  4UQY A;  3QWV A;  4GZ3 A;  3CKB A;  3GW4 A;  1QZ2 A;  4WNF A;  5JJT A;  5ARG A;  4CDR A;  4HOQ A;  4YVO A;  4JA7 A;  3VTY A;  5G05 J;  2FF4 A;  4U04 A;  1Y8M A;  1ELR A;  1KT0 A;  4WUY A;  4IN3 B;  2HR2 A;  2LSU A;  4N39 A;  2KCL A;  3LKU A;  4AM9 A;  4YND A;  3S7B A;  4Y6W A;  2WPV A;  5HI7 A;  2Y4T A;  5FT9 A;  2XGO A;  3ZPJ A;  1WM5 A;  1HZ4 A;  3LCA A;  2YHC A;  4KYO B;  3ZFW A;  3QWP A;  5KJM A;  4AIF A;  2XGM A;  2PQR A;  4EQF A;  5FZR A;  3QOU A;  2FO7 A;  5KJK A;  2IFU A;  4I17 A;  4GPK A;  1IHG A;  2LNI A;  3IEG A;  3MKR A;  4RG9 A;  3MV2 B;  2KCK A;  5FJY A;  1ZBP A;  4I9C A;  1PC2 A;  3ASG A;  2NC9 A;  3CVP A;  2HO1 A;  2OND A;  3ULQ A;  3S7F A;  1FCH A;  5BW8 C;  4LEU A;  5KJL A;  1E96 B;  4YVQ C;  3FP3 A;  3UQ3 A;  3CKC A;  3Q4A B;  3SF4 A;  3FWV A;  4WNE A;  1W3B A;  2KCV A;  3S7J A;  3RO3 A;  5A7D B;  2XPI A;  4GA0 A;  4GCN A;  4UI9 K;  3RIB A;  2C2L A;  4UI9 J;  3ZHE B;  4H7Y A;  2C0L A;  3LY9 A;  3EDT B;  2KC7 A;  4G25 A;  2VGY A;  4KBQ A;  2WQH A;  5C1D A;  3AS8 A;  2I6H A;  4F3V A;  3LY7 A;  1KT1 A;  3CVN A;  4HOT A;  1HXI A;  4UQX A;  5LCW C;  1TJC A;  2PZI A;  4H7X A;  4KXK B;  2MHK A;  3MA5 A;  3KS2 A;  2E2E A;  2JLB A;  2DBA A;  3TG4 A;  3KD7 A;  5BNW A;  5ARF A;  4G23 A;  3MEK A;  4G24 A;  3RKV A;  3RO2 A;  4ME2 A;  4WND A;  3O48 A;  2PQN A;  5CCM A;  3CK9 A;  5G04 C;  3ZGQ A;  2PL2 A;  4N3A A;  3JYS A;  4RG6 A;  2QFC A;  1IYG A;  4U0Z A;  5DIZ A;  5KJN A;  1NZN A;  3S7D A;  3ZHE A;  3ASD A;  2VGX B;  3VTX A;  4N5C A;  4AY6 A;  3U3W A;  4U07 A;  3GZ2 A;  4U0U A;  3UPV A;  4I2W A;  2BUG A;  5LCW J;  3QKY A;  4O6F A;  2AVP A;  4XIF A;  3CVQ A;  1QQE A;  4HOU A;  3TAX A;  2YQ8 A;  5AYW D;  1ELW A;  3AS4 A;  3LY8 A;  4CGW A;  5BT1 A;  5JJ7 A;  5G04 J;  2P58 C;  2LSV A;  2L6J A;  3U4T A;  4N2Q A;  4HOS A;  2VGX A;  3QWW A;  3OXG A;  2FI7 A;  3TG5 A;  3QDN A;  2Y4U A;  3CVL A;  2GW1 A;  2VQ2 A;  4BWR A;  2FEZ A;  3Q5M A;  4GA2 A;  5FTP A;  1A17 A;  5EX0 A;  3BEE A;  3ZN3 A;  2OOE A;  4UQZ A;  3OXL A;  3Q15 A; 
#chains in the Genus database with same CATH topology
 1UJJ A;  3DEP A;  3FU5 A;  2BF0 X;  3SD5 A;  2LUH A;  3DSV A;  3B7R L;  2H6I A;  1SVX A;  5D0O D;  4ILH B;  5E75 A;  3PVL A;  3I4R B;  3IBE A;  3SBS A;  2HM8 A;  3CV0 A;  3UIN C;  4BES A;  4XI0 A;  2YHE A;  3Q73 A;  4G8L A;  2KBX A;  3RRU A;  3K9I A;  1SW6 A;  4GTQ A;  4GMR A;  3CK7 A;  4YDW A;  4LUN U;  4U0S A;  5J90 A;  2L0T B;  2GRN B;  3Q47 B;  1OWP A;  1OCZ E;  2GRQ B;  5FZQ A;  3UM3 A;  4U8Y D;  2P9L G;  5FIN A;  4HRM B;  4QQI A;  4HI9 A;  3AS5 A;  1H6P A;  1UN9 A;  5CHE E;  4W9R A;  1XGW A;  4OAV B;  1N4S A;  3D9H A;  5AAO A;  1U2V G;  2A5U A;  2F8Y A;  1WY6 A;  2MRI A;  3FFL A;  4APO A;  2UY1 A;  3PRE A;  1S63 A;  1YA0 A;  1BU9 A;  3RJV A;  3F6Q A;  1TEZ A;  2IF4 A;  5EKQ D;  4K5B A;  5CER B;  4O60 A;  4I9E A;  4HFG A;  5AQB A;  3UIO C;  2DWZ A;  2FBN A;  4GTT A;  3LYA A;  4L9P A;  3L9T A;  3X2Q E;  4MBG A;  4WNG A;  5A6C A;  1E90 A;  3ZW3 A;  4I43 A;  1N52 A;  1H2V C;  3ML9 A;  2OCC E;  4GYY A;  3AG2 E;  4A1G A;  4B0Z A;  5KBA A;  3B13 A;  2AXZ A;  4JZY A;  4TXQ A;  1A5E A;  4HB5 A;  2J4B A;  4GCO A;  3NBN B;  3TWR A;  4GYO A;  3KAE A;  4XI9 A;  2MYO A;  4J8E A;  1B89 A;  1DNP A;  3ULY A;  4LNB A;  3FTZ A;  5BV1 A;  4MS6 A;  3C72 A;  4G26 A;  1NA3 A;  3E37 A;  1RZ4 A;  3QWV A;  5BPP A;  3V2O A;  1QZ2 A;  3TWQ A;  5JJT A;  1K1A A;  4CDR A;  3HXB A;  4JB8 P;  4YVO A;  4KZC A;  3HXF A;  4CT4 A;  3NB2 A;  2JAB A;  1YCS B;  4U04 A;  2Y0B G;  1OWL A;  2WXP A;  3HDX A;  4WAF A;  1KZO A;  4N5Q A;  3ZYK A;  4XKC A;  4AOF A;  4WUY A;  5FQ8 A;  4IN3 B;  4YND A;  4Y6W A;  5CBN A;  2ETB A;  3U9W A;  1O5M A;  1FT1 A;  2KZT B;  4J8S A;  4RQI A;  4PDX A;  3OTN A;  1N9A A;  5FT9 A;  4BSX A;  1HZ4 A;  4IRU A;  3ZYQ A;  2CHX A;  1DVP A;  5BUZ A;  2VJ8 A;  2FO7 A;  4DRX E;  5ENQ D;  2X6K A;  4A63 B;  2IFU A;  3B7U X;  2WXJ A;  4HS2 A;  4FP7 A;  3TXN A;  4OAU C;  2LNI A;  4FHK A;  5EDS A;  5D2M C;  4I6E A;  4GPM A;  1K3Z D;  1PC2 A;  4JW1 A;  4C48 B;  5T3R A;  3TWU A;  2XPZ A;  2HO1 A;  2YIN A;  4OVU A;  3ULQ A;  4GTV A;  1FVF A;  1E96 B;  2AWI A;  5G2N A;  3MJW A;  1OY3 D;  1TN6 A;  4I1O B;  5CED B;  3L6A A;  4EBA A;  3S7J A;  1BI8 B;  4JVS A;  2C2L A;  3ZHE B;  1V54 E;  2WB2 A;  2NSZ A;  3Q7A A;  4G25 A;  2IU1 A;  4HNA D;  3AU4 A;  3FTX A;  4F3V A;  3CHR A;  1KT1 A;  4HBD A;  4LG6 A;  3UT7 A;  1TJC A;  3FU6 A;  4H7X A;  3KSQ A;  1U3D A;  4KXK B;  3MCX A;  3TG4 A;  3UM0 A;  5AQ9 A;  3SNX A;  3MEK A;  4G24 A;  3RKV A;  4ME2 A;  3V30 A;  2PQN A;  3IHY A;  5CCM A;  5JA4 D;  4MLP A;  2WXM A;  3MKQ A;  3RAU A;  4N3A A;  2IJG X;  2QFC A;  5KJN A;  1NZN A;  2IOS A;  2IY0 C;  3KSL A;  4B8C B;  2XHE A;  3APF A;  5LX8 A;  3R7Q A;  2J4D A;  2P9P G;  3UM2 A;  4F53 A;  4U63 A;  3AG4 E;  3UT4 A;  2P9K G;  3UKR G;  5LCW J;  3QKY A;  1MYO A;  2AVP A;  3E34 A;  2BTD A;  4HOU A;  3TAX A;  2QYJ A;  3VLD A;  4XE0 A;  3Q9N C;  3DWL G;  4CGW A;  5G04 J;  3MYV A;  4UWF A;  5D66 A;  3C3O A;  4C9B B;  2EQX A;  4HQD A;  3VLE A;  1UOH A;  5ENN A;  4DI4 A;  3DBS A;  3CGH A;  5FTP A;  1A17 A;  4J8Y A;  4PS8 A;  1S70 B;  1N4R A;  2F37 A;  3ZNG A;  3SFY A;  4HI8 A;  2DZN A;  3EU9 A;  3T9K A;  3LVQ E;  3G2V A;  1TNY A;  3NOC D;  1LF8 A;  3GYZ A;  2VSN A;  3Q7F A;  4L2Y A;  3V31 A;  2XZT G;  2LAI A;  2VTB B;  2XRZ A;  3UTM A;  4JA9 A;  3B7S A;  3JUE A;  1LTX A;  3PNL B;  5ANL A;  4N3B A;  2I9C A;  3L17 A;  2IEJ A;  3ASH A;  4U7E B;  4K03 A;  3PE3 A;  4I1A A;  4MKT A;  4DLO A;  4JC8 A;  1TNZ A;  3NZU A;  2J09 A;  3W9G A;  5M72 A;  3PZ4 A;  4ANV A;  2CHZ A;  1O1T A;  4BT9 A;  3SFZ A;  3OXF A;  4BSZ B;  3NAW A;  4PH4 B;  5AJL A;  3O4Z A;  2I1J A;  4RLY A;  4LSZ E;  5AJD A;  2XEN A;  1E8Z A;  1MZC A;  1K8K G;  4DLQ A;  3L13 A;  1E8W A;  2J07 A;  4G2V A;  1KLX A;  2WMN A;  3UMV A;  5AQ7 A;  4GZ5 A;  3CR3 A;  4J8F A;  4GZ6 A;  1XNF A;  4Y6C A;  3SFX A;  2WXQ A;  4CDM A;  3R9A B;  5EIB E;  1LD8 A;  5CEC B;  4NIK A;  5ENR D;  2WXI A;  3UI2 A;  4JHK A;  2LXL A;  5G05 C;  3C5R A;  3DXK G;  3HYM B;  2H6G A;  3SBT B;  5FQ6 A;  3G2S A;  1IQR A;  3TGO A;  4DX6 D;  3L22 A;  1JWF A;  2J08 A;  4KVO A;  2JEK A;  1TN8 A;  2B0O E;  5AQA A;  3LS8 A;  2XS1 A;  3SY2 A;  5EYP F;  1DCE A;  3CEQ A;  2V8S E;  2R17 C;  4QFV A;  3SI5 A;  3ZRH A;  3LPZ A;  1WAO 1;  4UQY A;  4GU5 A;  1E8Y A;  1N54 A;  4AV7 A;  3IXE A;  4GTS A;  3TL5 A;  5HKP A;  5CMW A;  3VTY A;  2BKK B;  3ZYM A;  1SZA A;  3R9M A;  3ABL E;  1JCQ A;  2XRY A;  2CFZ A;  5EIL A;  1ELR A;  1TNU A;  1KT0 A;  3GZS A;  4EHM A;  1OWO A;  4JEU A;  5E76 A;  2LSU A;  4AM9 A;  2OEV A;  3S7B A;  4HVB A;  5EYL A;  1HE8 A;  2WXK A;  3MGB A;  2XGO A;  3ZPJ A;  1OCR E;  4G11 A;  5ENS D;  2XPY A;  4F1S A;  5HRY A;  3HIZ A;  4KYO B;  4ATG A;  3TXM A;  3QWP A;  3LXU X;  4X8Q A;  4KMO A;  3QC1 A;  5FZR A;  4BX8 A;  2IO2 C;  5KWD A;  3QOU A;  4Q69 A;  1EDU A;  3DSW A;  2GRM A;  2YNQ A;  4I17 A;  3C3Q A;  2KZT A;  3D9P A;  4RG9 A;  3P1U A;  2ZXW E;  2RFM A;  3HXD A;  1O1S A;  4ILI A;  3ASG A;  3DSX A;  1TN7 A;  2KM4 A;  3CVP A;  4PS3 A;  3FY4 A;  3ULE G;  4EZL A;  1FCH A;  3FTU A;  3JXJ A;  3JQ1 A;  4ATZ D;  3CKC A;  3Q4A B;  3FWV A;  4ANW A;  1SA5 A;  5A7D B;  2XPI A;  4GA0 A;  4GCN A;  1H0A A;  4UI9 J;  1N4P A;  2C0L A;  3EDT B;  4CT0 A;  3UX4 A;  4OYS A;  3UXG A;  3LDZ A;  1HX8 A;  2ZIS A;  4P29 A;  2I6H A;  2VSO E;  5KNG A;  4UWL A;  4UQX A;  3FUJ A;  2RKK A;  2PZI A;  2BED A;  4TXR A;  1HFA A;  2JLB A;  4XEI G;  3KD7 A;  2GRR B;  4U95 D;  5ARF A;  2X6J A;  4LRZ A;  3ZXP A;  3RO2 A;  1DC2 A;  3TWV A;  3B95 A;  2HE0 A;  4HLE A;  2X6F A;  3D9O A;  4EBA G;  4AXH A;  3JYS A;  4RG6 A;  2GGF A;  3KEA A;  4U0Z A;  1HU3 A;  4BER A;  3ZHE A;  4BFR A;  1OWM A;  2F8X K;  4CRW A;  3DST A;  4N5C A;  3CVX A;  2WM9 A;  1NI1 A;  4DPR A;  4AY6 A;  4U8H A;  3RK6 A;  1FPP A;  3S2A A;  4E6H A;  3ZXS A;  3UPV A;  1JCR A;  4KVM A;  4ZFH A;  4XIF A;  3FTW A;  3I5P A;  3CVQ A;  1QQE A;  4FLH A;  2EIN E;  3I3N A;  4WWO A;  1N0Q A;  1AP7 A;  2DVW A;  1OCO E;  5LOZ A;  3HVE B;  3RRN B;  3AS4 A;  3LY8 A;  2QYU A;  2P58 C;  2CFU A;  2EIK E;  1N11 A;  1MQS A;  4KT6 B;  4K0R A;  3V2X A;  4HOS A;  2EIL E;  3QDN A;  2PM7 A;  4HRL A;  3CVL A;  3PZD A;  1IKN D;  5CRU A;  5KCM A;  2X38 A;  4O1O A;  3MZL B;  4CCA A;  1DCQ A;  2R03 A;  4A3V A;  3PH0 C;  5CBO A;  4CDN A;  2L6B A;  3N71 A;  4LCT A;  4LNG A;  3LJ3 A;  3CHM A;  3FUN A;  3FUD A;  1LD7 A;  4K5C A;  3ESL A;  3NF1 A;  2V5Q C;  4GZC A;  1IXV A;  3NZS A;  5ITZ F;  4FHJ A;  1O1R A;  4RSY A;  5D0Q D;  3HXE A;  1Z3Y A;  2WXL A;  3CVU A;  2V0P A;  5HQ8 A;  4GML A;  4CGV A;  4YDO A;  1NP7 A;  2WXH A;  1OXJ A;  1EYH A;  2X6H A;  5B1A E;  4AP2 A;  3ABM E;  3FEY A;  4L2L A;  1HG2 A;  1E8X A;  2CHW A;  4JXT A;  2VTB A;  3FUI A;  4GTM A;  5AAR A;  2IO3 C;  3APC A;  1D8E A;  3E33 A;  4FJZ A;  1MJ0 A;  1E7V A;  3ASF A;  2R05 A;  3IKO B;  3NOG D;  4TRQ A;  5KNH D;  5CMY A;  4BTA A;  2WQ7 A;  4AY5 A;  3QAR A;  2H6F A;  5ENP D;  3E4B A;  2J8S D;  5CCL A;  1BLX B;  3LEW A;  2ZGG A;  4EZJ A;  3ML8 A;  2ETC A;  4J0U A;  4N2S A;  1HG5 A;  3D9M A;  1H19 A;  3URZ A;  2GRP B;  2XEE A;  4TXP A;  4GA1 A;  3FUE A;  1Z6T A;  1ZU2 A;  2R5S A;  3PZ3 A;  3L08 A;  4BTB A;  4NUR A;  2I1K A;  1JPL A;  3QK0 A;  4BT8 A;  4N3C A;  4HXI A;  3AU5 A;  3AG3 E;  2HYZ A;  4WWP A;  3KEZ A;  3PUJ A;  3Q75 A;  4GMJ A;  3T5X A;  2Y69 E;  4MRU A;  2C0M A;  4U96 D;  3AG1 E;  4G1T A;  5FZS A;  4JL0 A;  5BV0 A;  3IV0 A;  1TNB A;  5EX3 A;  5J08 A;  1H2U A;  5H7P A;  4GYW A;  4A3T A;  4A1S A;  4Z68 A;  3EHM A;  2FO1 E;  3ABK E;  4CZ2 D;  2LO6 A;  4M3O A;  4L23 A;  5EN5 D;  2I2O A;  1PAQ A;  2LXM A;  4GZ3 A;  4RVB A;  2AXV A;  4FU3 A;  3GW4 A;  4WNF A;  3EUV A;  3V79 K;  4XZ4 A;  3FTY A;  5ARG A;  1H2T C;  1ELK A;  1AWC B;  4JA7 A;  4V3I A;  2ETA A;  2KXP C;  5G05 J;  2FF4 A;  2OEW A;  3T8K A;  3QB2 A;  2P9I G;  1FT2 A;  4EZK A;  5CEA A;  1VDY A;  1KZP A;  1HO8 A;  2HR2 A;  4YDY A;  4N39 A;  2KCL A;  2WPV A;  4BET A;  3ASN E;  2Y4T A;  2NXP A;  2CG2 A;  3FUH A;  5ANR A;  1UW4 B;  2P9S G;  1WM5 A;  3CHS A;  3QJZ A;  3LCA A;  4FLB A;  3ZFW A;  3L16 A;  1TYQ G;  2CG3 A;  4AIF A;  2XGM A;  3PEU B;  2PQR A;  4ANU A;  3ZUV B;  4EQF A;  5G55 A;  3G2T A;  1BI7 B;  2DZO A;  3CVW A;  3U64 A;  2IOL A;  4CYM D;  4UWK A;  5KJK A;  2WMO A;  3BUA A;  5CRV A;  1E7U A;  1IHG A;  3T5V A;  3IHV A;  2DCP A;  3ONK A;  5FJY A;  1ZBP A;  2NC9 A;  4G8K A;  3EIQ C;  4F6R D;  4DJA A;  2Y3A A;  3S7F A;  2RD0 A;  1JCS A;  4Q96 A;  4LEU A;  4BY6 A;  5KJL A;  3AJI A;  4PUC A;  3FP3 A;  3UQ3 A;  3SF4 A;  4B93 B;  3Q78 A;  1S0P A;  3D9J A;  3ASO E;  2GRO B;  4LER A;  1UJK A;  4DX1 A;  3CVY A;  2KC7 A;  3D9K A;  4KBQ A;  1K1B A;  1YYH A;  3E32 A;  2WQH A;  3DSU A;  1N4Q A;  3AS8 A;  3VLF A;  3LY7 A;  3CVN A;  4R7L A;  1HXI A;  2X6I A;  3CSF A;  3HHM A;  2ZGD A;  4EEC A;  3KS2 A;  2E2E A;  5FIO A;  2DBA A;  2P9U G;  3PS6 A;  5BNW A;  4GB9 A;  4O1P A;  4JEH A;  4G23 A;  3Q9U C;  3O48 A;  3PEV B;  3CK9 A;  3TJP A;  5IY5 E;  2H6H A;  2PL2 A;  4TUU A;  3TWT A;  1IYG A;  3FHE A;  5DIZ A;  5C2Y A;  1SA4 A;  2EIJ E;  4GTO A;  3S7D A;  5B3S E;  3FTS A;  3DXM G;  2RG8 A;  2VGX B;  3VTX A;  5A23 A;  3D3M A;  3QAQ A;  2VSX E;  4NAC A;  2AW6 A;  4I2W A;  1QNF A;  2BUG A;  3JQ0 A;  3JCK C;  4UWG A;  3APD A;  4FA6 A;  3ZVV A;  3CQG B;  2EIM E;  1TNO A;  5AYW D;  4UUC A;  3LJN A;  3LVR E;  1U3C A;  1QBQ A;  5JJ7 A;  3U4T A;  4C0M A;  3SQV A;  3MX3 A;  4AJW A;  4D10 C;  4N2Q A;  3EIJ A;  3OXG A;  3QWW A;  3CVV A;  3TG5 A;  3J5Q B;  5ENO D;  2ZU6 B;  2Y4U A;  5BXO A;  2GW1 A;  1IQU A;  2VQ2 A;  4BWR A;  2XZD G;  2FEZ A;  3PRZ A;  5LP0 A;  5AN8 A;  3UIP C;  5EX0 A;  3E30 A;  3ZKJ A;  3BEE A;  3ZN3 A;  5JHA A;  2XQ0 A;  4UQZ A;  1Z5S C;  2PNN A;  3OXL A;  3Q15 A;  3I4G A;  5T8I A;  3HVE A;  3FU3 A;  2DYS E;  2V5F A;  2VYI A;  2WXO A;  2J9Q A;  4NQ0 A;  2XCB A;  2OVB A;  1NA0 A;  2BKG A;  3C98 A;  4DX7 D;  2UWJ G;  4L1B A;  1D8D A;  5JMN D;  3PNT B;  2KAT A;  4ANX A;  3UUX A;  4FUL A;  4HOR A;  3PDN A;  4ABN A;  4APF A;  2UY1 B;  3MV3 B;  2VSY A;  2AXU A;  3WXX A;  2Y1L E;  1OT8 A;  3CHO A;  3EU5 A;  3GZ1 A;  2M63 A;  1P5Q A;  3HG0 D;  3G2W A;  4DX2 A;  3ZYL A;  1N94 A;  5T4Y A;  2FUL A;  4I1M A;  3RSE G;  2WXF A;  5JJ6 A;  4JD2 G;  3FDH A;  2XGS A;  3D9I A;  3CK8 A;  2PM6 A;  4GTP A;  1MHQ A;  2IQC A;  3FH5 A;  5LFA A;  4JHR A;  4B89 A;  5EID A;  3SZ7 A;  1INZ A;  1OWN A;  3PZ1 A;  1NL4 A;  2QZA A;  4DI3 A;  4BX9 A;  1OUV A;  3ZEF A;  4HRN A;  2V4H C;  4UI9 C;  4LNU D;  2Q7F A;  1BPO A;  4FC8 A;  4B8A A;  3W9F A;  3EHN A;  3RU0 A;  2NYJ A;  1S64 A;  1HS6 A;  4NRH B;  1HH8 A;  4DUI A;  1JWG A;  3CST A;  4UWH A;  1SZ9 A;  2XEH A;  2R02 A;  4I2Z A;  4KZ0 A;  2DIW A;  3ISM C;  3G2U A;  1WDY A;  4I6J A;  3FH7 A;  2WXR A;  4JPS A;  2XCC A;  3FUF A;  3PE4 A;  3ESK A;  3FUL A;  3FTV A;  2A4Z A;  3Q49 B;  4YDE A;  1D9S A;  3BG1 B;  3UM1 A;  4C0E A;  4B94 A;  4J8D A;  5DBK A;  1Y6I A;  2XEV A;  3CKB A;  3TWW A;  2B6C A;  3CHP A;  3R7R A;  3U66 A;  4HOQ A;  2GRL A;  3P2B A;  4U8V D;  1L5J A;  4GZD A;  3J5P A;  3SO8 A;  1JUQ A;  3TWX A;  2ION A;  3QNK A;  1Y8M A;  3DPY A;  4IUL A;  3L82 A;  3DRA A;  1MX6 A;  3LKU A;  2AJA A;  5AEN A;  1N95 A;  3SGH A;  4ILG A;  3CHQ A;  5HI7 A;  5FQ4 A;  5JHB A;  5BXU A;  1SQM A;  4K5A B;  2F0Y A;  1Q2Z A;  1UG3 A;  2ZIR A;  4E85 A;  2YHC A;  3NQP A;  4DK5 A;  5KJM A;  4FJY A;  4XKB A;  3OAW A;  4OVV A;  1H6O A;  2P9N G;  2WXN A;  2LAH A;  3HXC A;  4DX5 D;  4TV3 A;  4ACL A;  3CQC B;  1EPU A;  1Z3X A;  3T8M A;  3EHR A;  2ILR A;  4Q94 A;  1HF8 A;  4A55 A;  3WG7 E;  3JUI A;  3PZ2 A;  5ENT D;  4GPK A;  4M7C A;  3IEG A;  3MKR A;  3MV2 B;  2KCK A;  4EPZ A;  4HLL A;  4I9C A;  3UT8 A;  1N0R A;  5HS0 A;  1OCC E;  2P2C P;  2OND A;  2XS8 A;  5BW8 C;  3D9N A;  1H6K A;  1NFI E;  4YVQ C;  1FVH A;  3HRA A;  1X5B A;  3ZU7 B;  2A5E A;  4F1P A;  4WNE A;  1W3B A;  1TJF A;  4CEM A;  2R59 A;  2KCV A;  3MKQ B;  2QY7 A;  3FH8 A;  4AEZ C;  4IYP A;  3RO3 A;  1EF1 C;  4FAD A;  4UI9 K;  3RIB A;  4H7Y A;  3LY9 A;  5FQ7 A;  2VGY A;  2E0I A;  2MOW A;  2RFA A;  1TR4 A;  4GTR A;  4WWN A;  5C1D A;  4GAA A;  3PUK A;  1GW6 A;  4HOT A;  5LCW C;  3RRM B;  3DEO A;  3AAA C;  4I6G A;  1PY1 A;  2MHK A;  4TUM A;  3MA5 A;  1WG0 A;  4AVX A;  4JHJ A;  3ONL A;  4WND A;  1IHB A;  4URK A;  5G04 C;  3ZGQ A;  2OV8 A;  3C3R A;  1YMP A;  4ACK A;  3DPD A;  2J49 A;  3Q79 A;  3EHQ A;  5FWQ A;  3TWS A;  3FEX A;  3ASD A;  1BD8 A;  3FU0 A;  1MX2 A;  2QC9 A;  2L9B A;  2OVF A;  4J6I A;  3U3W A;  4U07 A;  3GZ2 A;  4U0U A;  1X81 A;  4PS7 A;  3B7T A;  1G3N B;  5AIJ A;  4O6F A;  4ZHB A;  1V55 E;  3ZIM A;  4BEP A;  3SHF A;  2WQ6 A;  3FUK A;  1MX4 A;  2YQ8 A;  3DSS A;  3UKU G;  2L0I A;  3JXI A;  3EJN A;  2X3M A;  1ELW A;  4L7T A;  5BT1 A;  2LSV A;  2L6J A;  2WVI A;  2WXG A;  4F7A A;  3ENE A;  1UN8 A;  2VGX A;  3CLJ A;  4XX5 A;  2FI7 A;  2DYR E;  3L54 A;  4J7W A;  2VGE A;  1RW2 A;  3CIA A;  2V4L A;  3D9L A;  3Q5M A;  4GA2 A;  3FUM A;  5B1B E;  3BQO A;  3BG0 B;  1ZB1 A;  2OOE A;  1KPS B;  3B7B A;  2R2L A;  3BU8 A;  1QYM A; 
#chains in the Genus database with same CATH homology
 3I4G A;  3PH0 C;  1UJJ A;  3FU5 A;  1LF8 A;  2BF0 X;  3GYZ A;  3HVE A;  5T8I A;  3FU3 A;  2VSN A;  2V5F A;  2VYI A;  4CDN A;  2WXO A;  4L2Y A;  3SD5 A;  3N71 A;  4LCT A;  3B7R L;  3CHM A;  3LJ3 A;  2J9Q A;  4NQ0 A;  2XCB A;  3FUN A;  3FUD A;  2OVB A;  1NA0 A;  3ESL A;  2LAI A;  2VTB B;  5D0O D;  3C98 A;  3NF1 A;  2XRZ A;  4ILH B;  5E75 A;  4GZC A;  3PVL A;  4JA9 A;  3B7S A;  3NZS A;  2UWJ G;  3I4R B;  3IBE A;  4FHJ A;  4RSY A;  5D0Q D;  3SBS A;  2HM8 A;  3CV0 A;  4L1B A;  3PNL B;  4XI0 A;  5ANL A;  2YHE A;  3PNT B;  2KAT A;  1Z3Y A;  2WXL A;  2I9C A;  3L17 A;  4N3B A;  3CVU A;  3RRU A;  3K9I A;  2V0P A;  5HQ8 A;  3ASH A;  4ANX A;  4GML A;  4CGV A;  3UUX A;  4FUL A;  4HOR A;  3PDN A;  4ABN A;  4APF A;  2UY1 B;  3MV3 B;  3CK7 A;  2VSY A;  2AXU A;  1NP7 A;  4LUN U;  2WXH A;  4K03 A;  3PE3 A;  4U0S A;  3WXX A;  1EYH A;  4I1A A;  4MKT A;  5J90 A;  2X6H A;  3CHO A;  2L0T B;  4DLO A;  3Q47 B;  1OWP A;  4JC8 A;  3GZ1 A;  2M63 A;  1P5Q A;  3NZU A;  2J09 A;  3G2W A;  4AP2 A;  3ZYL A;  3FEY A;  4L2L A;  5FZQ A;  1HG2 A;  5T4Y A;  5M72 A;  1E8X A;  2FUL A;  2CHW A;  4JXT A;  4ANV A;  4I1M A;  2VTB A;  2CHZ A;  3FUI A;  3AS5 A;  2WXF A;  5JJ6 A;  1UN9 A;  5CHE E;  3FDH A;  2XGS A;  4W9R A;  3APC A;  1XGW A;  3D9I A;  4BT9 A;  3CK8 A;  3SFZ A;  2PM6 A;  3OXF A;  4FJZ A;  1MHQ A;  1E7V A;  3ASF A;  2IQC A;  3FH5 A;  5LFA A;  4JHR A;  4B89 A;  3IKO B;  4TRQ A;  5CMY A;  4BTA A;  4PH4 B;  5AJL A;  2WQ7 A;  3O4Z A;  4AY5 A;  3SZ7 A;  1INZ A;  2A5U A;  3QAR A;  2I1J A;  1WY6 A;  1OWN A;  2MRI A;  3E4B A;  3FFL A;  4APO A;  5AJD A;  5CCL A;  3LEW A;  4EZJ A;  1E8Z A;  3ML8 A;  2UY1 A;  4DLQ A;  3PRE A;  4J0U A;  4N2S A;  3L13 A;  1E8W A;  1HG5 A;  1YA0 A;  3RJV A;  4DI3 A;  3D9M A;  2J07 A;  4G2V A;  1H19 A;  2IF4 A;  1TEZ A;  5EKQ D;  4BX9 A;  1KLX A;  1OUV A;  3ZEF A;  4I9E A;  4HFG A;  3URZ A;  2WMN A;  2FBN A;  3UMV A;  3LYA A;  4GA1 A;  4GZ5 A;  3FUE A;  3CR3 A;  2Q7F A;  1Z6T A;  4J8F A;  4UI9 C;  1ZU2 A;  2R5S A;  3L08 A;  4GZ6 A;  4BTB A;  1BPO A;  4FC8 A;  4B8A A;  4NUR A;  4WNG A;  5A6C A;  1XNF A;  1JPL A;  2I1K A;  1E90 A;  3EHN A;  3QK0 A;  4Y6C A;  3RU0 A;  4I43 A;  3ZW3 A;  4N3C A;  4HXI A;  1N52 A;  2WXQ A;  1H2V C;  4CDM A;  3ML9 A;  1HS6 A;  3R9A B;  3AU5 A;  4NRH B;  1HH8 A;  2WXI A;  2HYZ A;  4WWP A;  3KEZ A;  4GYY A;  1JWG A;  3CST A;  4JHK A;  4UWH A;  4A1G A;  4B0Z A;  1SZ9 A;  5G05 C;  3PUJ A;  3B13 A;  4I2Z A;  4KZ0 A;  3HYM B;  4GMJ A;  2AXZ A;  4JZY A;  3T5X A;  3SBT B;  2DIW A;  5FQ6 A;  3G2U A;  4MRU A;  2C0M A;  3G2S A;  4I6J A;  3FH7 A;  2WXR A;  1IQR A;  4G1T A;  3TGO A;  5FZS A;  4JL0 A;  3L22 A;  2J4B A;  4GCO A;  5BV0 A;  3IV0 A;  4BT8 A;  1JWF A;  5EX3 A;  2J08 A;  4KVO A;  4JPS A;  2XCC A;  2JEK A;  4GYO A;  3KAE A;  3FUF A;  5J08 A;  1H2U A;  4XI9 A;  3PE4 A;  4J8E A;  3ESK A;  3LS8 A;  3FUL A;  4GYW A;  1B89 A;  3FTV A;  4A3T A;  1DNP A;  2A4Z A;  4A1S A;  3Q49 B;  3CEQ A;  3FTZ A;  2V8S E;  3EHM A;  2R17 C;  3BG1 B;  4QFV A;  5BV1 A;  3SI5 A;  3ZRH A;  4MS6 A;  4C0E A;  3LPZ A;  4G26 A;  2LO6 A;  4M3O A;  4B94 A;  4J8D A;  4L23 A;  5DBK A;  1NA3 A;  1WAO 1;  1Y6I A;  2I2O A;  1PAQ A;  2XEV A;  4UQY A;  4GU5 A;  1E8Y A;  3QWV A;  4GZ3 A;  1N54 A;  4RVB A;  3CKB A;  2AXV A;  5BPP A;  4AV7 A;  4FU3 A;  3CHP A;  3GW4 A;  1QZ2 A;  4WNF A;  3R7R A;  5JJT A;  3U66 A;  4XZ4 A;  3FTY A;  5ARG A;  4CDR A;  3TL5 A;  4HOQ A;  2GRL A;  1H2T C;  1ELK A;  3P2B A;  4YVO A;  4JA7 A;  5CMW A;  4KZC A;  4V3I A;  3VTY A;  1L5J A;  3ZYM A;  4GZD A;  5G05 J;  4CT4 A;  1SZA A;  2FF4 A;  3QB2 A;  1JUQ A;  4U04 A;  1OWL A;  2WXP A;  2XRY A;  3HDX A;  4EZK A;  4WAF A;  3ZYK A;  2CFZ A;  4XKC A;  2ION A;  1VDY A;  1Y8M A;  3QNK A;  1ELR A;  1KT0 A;  4WUY A;  4AOF A;  4IUL A;  5FQ8 A;  1HO8 A;  3GZS A;  4IN3 B;  1OWO A;  2HR2 A;  4JEU A;  5E76 A;  2LSU A;  4N39 A;  2KCL A;  3LKU A;  5AEN A;  3SGH A;  4AM9 A;  4YND A;  4ILG A;  3S7B A;  4HVB A;  4Y6W A;  2WPV A;  3CHQ A;  3U9W A;  2KZT B;  4J8S A;  5HI7 A;  4PDX A;  5FQ4 A;  1HE8 A;  2Y4T A;  5JHB A;  3OTN A;  2NXP A;  2CG2 A;  5FT9 A;  3FUH A;  5ANR A;  2WXK A;  4BSX A;  3MGB A;  1UW4 B;  2XGO A;  3ZPJ A;  1SQM A;  1WM5 A;  1HZ4 A;  3CHS A;  4G11 A;  3QJZ A;  2XPY A;  1UG3 A;  4F1S A;  4E85 A;  3LCA A;  4IRU A;  3HIZ A;  2YHC A;  4FLB A;  4KYO B;  3ZFW A;  3L16 A;  3NQP A;  4ATG A;  4DK5 A;  3TXM A;  3QWP A;  5KJM A;  4FJY A;  2CG3 A;  3LXU X;  4XKB A;  4AIF A;  3OAW A;  4OVV A;  4KMO A;  2CHX A;  2XGM A;  3PEU B;  3ZYQ A;  1DVP A;  2PQR A;  3QC1 A;  4ANU A;  5BUZ A;  4EQF A;  2VJ8 A;  5FZR A;  5G55 A;  2WXN A;  4BX8 A;  3G2T A;  2LAH A;  4TV3 A;  3QOU A;  4ACL A;  3CQC B;  2FO7 A;  4Q69 A;  1EPU A;  1Z3X A;  3CVW A;  1EDU A;  3U64 A;  2IOL A;  3T8M A;  2X6K A;  4UWK A;  2GRM A;  5KJK A;  2WMO A;  2IFU A;  3B7U X;  2ILR A;  4Q94 A;  2WXJ A;  1HF8 A;  4HS2 A;  2YNQ A;  4I17 A;  4A55 A;  3JUI A;  1E7U A;  4FP7 A;  4GPK A;  3TXN A;  1IHG A;  2LNI A;  2KZT A;  4FHK A;  3IEG A;  3MKR A;  3D9P A;  3T5V A;  3IHV A;  5EDS A;  2DCP A;  4RG9 A;  3P1U A;  3ONK A;  3MV2 B;  2KCK A;  5FJY A;  4I6E A;  4EPZ A;  1ZBP A;  4I9C A;  1PC2 A;  3UT8 A;  4ILI A;  3ASG A;  2NC9 A;  4JW1 A;  2KM4 A;  5T3R A;  3CVP A;  4PS3 A;  2XPZ A;  3EIQ C;  3FY4 A;  4EZL A;  2HO1 A;  4DJA A;  2YIN A;  2OND A;  2Y3A A;  4OVU A;  3S7F A;  3ULQ A;  1FCH A;  1FVF A;  2RD0 A;  3FTU A;  4Q96 A;  3D9N A;  4LEU A;  5BW8 C;  4BY6 A;  5KJL A;  1H6K A;  4PUC A;  1E96 B;  3JQ1 A;  1FVH A;  4YVQ C;  2AWI A;  3FP3 A;  3UQ3 A;  1X5B A;  5G2N A;  3CKC A;  3MJW A;  3Q4A B;  3SF4 A;  3FWV A;  4WNE A;  1W3B A;  1TJF A;  4ANW A;  4CEM A;  2R59 A;  2KCV A;  4I1O B;  3L6A A;  3MKQ B;  1S0P A;  2QY7 A;  3S7J A;  4EBA A;  3FH8 A;  4AEZ C;  4IYP A;  3RO3 A;  5A7D B;  3D9J A;  2XPI A;  1EF1 C;  4GA0 A;  4JVS A;  4LER A;  4GCN A;  4FAD A;  4UI9 K;  3RIB A;  1H0A A;  2C2L A;  1UJK A;  4UI9 J;  4H7Y A;  3ZHE B;  2C0L A;  3LY9 A;  3CVY A;  3EDT B;  4CT0 A;  2WB2 A;  3UX4 A;  2NSZ A;  4OYS A;  2KC7 A;  4G25 A;  2VGY A;  3D9K A;  4KBQ A;  3LDZ A;  5FQ7 A;  2E0I A;  1HX8 A;  2MOW A;  2IU1 A;  2WQH A;  4WWN A;  5C1D A;  3AS8 A;  4GAA A;  3AU4 A;  3FTX A;  4P29 A;  3PUK A;  2I6H A;  4F3V A;  2VSO E;  3CHR A;  1GW6 A;  3VLF A;  3LY7 A;  1KT1 A;  3CVN A;  4R7L A;  4HOT A;  1HXI A;  2X6I A;  4UQX A;  4UWL A;  3UT7 A;  3FUJ A;  5LCW C;  3CSF A;  1TJC A;  2PZI A;  3FU6 A;  3RRM B;  4H7X A;  4I6G A;  3HHM A;  1HFA A;  1U3D A;  4EEC A;  4KXK B;  1PY1 A;  2MHK A;  3MA5 A;  3KS2 A;  3MCX A;  2E2E A;  2JLB A;  2DBA A;  3TG4 A;  4AVX A;  3KD7 A;  4JHJ A;  3PS6 A;  5BNW A;  4GB9 A;  4JEH A;  3SNX A;  5ARF A;  2X6J A;  4G23 A;  3MEK A;  4LRZ A;  3ONL A;  4G24 A;  3RKV A;  3RO2 A;  4ME2 A;  4WND A;  3O48 A;  2PQN A;  3PEV B;  3IHY A;  5CCM A;  4URK A;  3CK9 A;  3TJP A;  5G04 C;  4HLE A;  2X6F A;  3ZGQ A;  4MLP A;  2WXM A;  3MKQ A;  2OV8 A;  3D9O A;  2PL2 A;  4EBA G;  4TUU A;  4N3A A;  3JYS A;  4RG6 A;  2IJG X;  4AXH A;  2QFC A;  4ACK A;  3DPD A;  2GGF A;  2J49 A;  1IYG A;  3FHE A;  4U0Z A;  1HU3 A;  5DIZ A;  5C2Y A;  5KJN A;  1NZN A;  2IOS A;  3S7D A;  3ZHE A;  5FWQ A;  4BFR A;  3FEX A;  3FTS A;  1OWM A;  4B8C B;  4CRW A;  2RG8 A;  2XHE A;  3ASD A;  2VGX B;  3APF A;  5LX8 A;  3VTX A;  3R7Q A;  5A23 A;  2J4D A;  4N5C A;  3CVX A;  3FU0 A;  2WM9 A;  3D3M A;  4F53 A;  4DPR A;  2L9B A;  2OVF A;  4AY6 A;  4J6I A;  4U63 A;  3U3W A;  4U8H A;  3QAQ A;  3GZ2 A;  4U07 A;  4U0U A;  3RK6 A;  3S2A A;  2VSX E;  3ZXS A;  4E6H A;  3UPV A;  3UT4 A;  4NAC A;  2AW6 A;  4I2W A;  4PS7 A;  1QNF A;  2BUG A;  3B7T A;  5LCW J;  4KVM A;  3JQ0 A;  3JCK C;  3QKY A;  5AIJ A;  4O6F A;  2AVP A;  3FTW A;  4XIF A;  3I5P A;  4UWG A;  3CVQ A;  3ZIM A;  1QQE A;  2BTD A;  3SHF A;  2WQ6 A;  3APD A;  3FUK A;  4FA6 A;  4FLH A;  4HOU A;  3TAX A;  3CQG B;  3ZVV A;  3I3N A;  4WWO A;  3VLD A;  2YQ8 A;  4XE0 A;  2L0I A;  5AYW D;  5LOZ A;  3EJN A;  2X3M A;  1ELW A;  3HVE B;  4L7T A;  3RRN B;  3LVR E;  3AS4 A;  3LY8 A;  4CGW A;  1U3C A;  5BT1 A;  5JJ7 A;  5G04 J;  2P58 C;  2LSV A;  2L6J A;  3MYV A;  2WVI A;  3U4T A;  4C0M A;  4UWF A;  3MX3 A;  2CFU A;  2WXG A;  4F7A A;  3ENE A;  4AJW A;  1MQS A;  4KT6 B;  4C9B B;  2EQX A;  4D10 C;  4N2Q A;  3VLE A;  1UN8 A;  4K0R A;  4HOS A;  2VGX A;  3EIJ A;  3OXG A;  3QWW A;  3CVV A;  3CLJ A;  4XX5 A;  2FI7 A;  5ENN A;  3TG5 A;  3QDN A;  4DI4 A;  2PM7 A;  3L54 A;  2ZU6 B;  2Y4U A;  3CVL A;  3PZD A;  3DBS A;  3CIA A;  2V4L A;  2GW1 A;  1IQU A;  2VQ2 A;  3D9L A;  4BWR A;  3CGH A;  2FEZ A;  3Q5M A;  3PRZ A;  4GA2 A;  5LP0 A;  5FTP A;  1A17 A;  5KCM A;  2X38 A;  3FUM A;  4PS8 A;  5EX0 A;  3MZL B;  4CCA A;  3BG0 B;  3BEE A;  3ZN3 A;  5JHA A;  2XQ0 A;  2OOE A;  4UQZ A;  3OXL A;  3Q15 A;  3LVQ E;  4A3V A;  3G2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...