3UUXA

Crystal structure of yeast fis1 in complex with mdv1 fragment containing n-terminal extension and coiled coil domains
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
127
structure length
127
Chain Sequence
KVDFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQKETL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Mitochondria fission 1 protein
publication title Crystal structure of mitochondrial fission complex reveals scaffolding function for mitochondrial division 1 (mdv1) coiled coil.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 52
structure length 127
sequence length 127
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
A PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3uuxA01
3CVQA 2VQ2A 4CDRA 5FTPA 2PZIA 2HYZA 2L6JA 3KS2A 5HI7A 3S7DA 5JJ7A 3QOUA 3MV2B 3RKVA 4RG9A 4GYOA 4HOQA 2UWJG 2XGOA 3BEEA 2UY1B 2HR2A 2VYIA 5DBKA 1ELRA 5FT9A 4A1SA 5G05C 3K9IA 3OXFA 2KATA 4GCOA 2UY1A 4AIFA 4Y6CA 2QFCA 4JA9A 4WNFA 3ASDA 2XCBA 2DBAA 2PL2A 3RO2A 1NZNA 2YQ8A 2FF4A 4JL0A 1XNFA 3ZHEB 5G04J 4WUYA 3GW4A 3U4TA 5FJYA 2XGMA 1HXIA 3LY8A 4GZ5A 3ZHEA 3Q4AB 4G25A 4GA0A 4IN3B 2KCVA 3QWWA 3ZPJA 5EX0A 3CVLA 3UPVA 3LKUA 3RIBA 4J8EA 1TJCA 5M72A 5FZSA 1Y8MA 2VSNA 2XPIA 5BT1A 3SZ7A 4UQZA 1KT0A 5G04C 5CCLA 3KD7A 3PE3A 1KT1A 4KYOB 5ARGA 2WQHA 1KLXA 5KJMA 2E2EA 4UQXA 4G2VA 4HORA 4GPKA 3GYZA 3FP3A 3Q49B 3LY7A 1ZU2A 3TG4A 4GYWA 3CEQA 5JJTA 4YNDA 2PQNA 3WXXA 3AS4A 4W9RA 3R9AB 4EQFA 4Y6WA 5AYWD 4WNEA 2WPVA 4UI9K 3PE4A 4I2WA 1HH8A 2FO7A 5C1DA 4AM9A 5DIZA 1P5QA 4BWRA 2ONDA 4U0ZA 4I1AA 1ZBPA 4XI0A 2LSVA 2XEVA 3UUXA 3TG5A 1ELWA 4ME2A 3TAXA 4NQ0A 4U0UA 3TGOA 1NA0A 2KC7A 5LCWJ 4YVOA 2YHCA 2AVPA 3S7BA 1OUVA 2PQRA 1FCHA 3ASHA 3LY9A 4JHRA 3S7JA 3RU0A 2J9QA 1B89A 3CK7A 2LNIA 3SF4A 4AY5A 4G24A 2C2LA 1A17A 4BT8A 2IFUA 1WAO1 3E4BA 4LEUA 4J8DA 4CGVA 1IHGA 4I9EA 3CK9A 4N2QA 2I6HA 4I17A 3MA5A 3MEKA 4BTAA 3ASGA 5KJKA 3UQ3A 1QQEA 3MV3B 3GZ2A 5FZQA 2FI7A 1HZ4A 4GZ3A 1PC2A 4HOUA 3ULQA 5LCWC 3PDNA 5KJNA 1QZ2A 4G26A 2C0LA 4NRHB 5CCMA 3LCAA 3CVPA 3RO3A 5CHEE 4WNDA 5A7DB 4J0UA 1IYGA 4APOA 4N2SA 3ESKA 4CGWA 4UQYA 2FEZA 4GCNA 3MKRA 5JJ6A 4O6FA 5ARFA 3HYMB 5BW8C 4ABNA 2XGSA 3CKBA 4XIFA 3LPZA 1NA3A 4GYYA 2OOEA 4UI9J 4B94A 5A6CA 4HOTA 5D0OD 2Y4TA 2JLBA 5EKQD 4I2ZA 2XCCA 1YA0A 3OXLA 3OXGA 3ZFWA 3IEGA 3FFLA 3QWPA 2R5SA 3VTXA 2VSYA 4J8FA 4U07A 3KAEA 4H7XA 3CKCA 4I9CA 4G1TA 2VGXB 4U04A 4UI9C 4BTBA 4KXKB 2BUGA 5HQ8A 3Q47B 3ASFA 3URZA 2LSUA 4GA2A 2KCLA 2VGXA 1E96B 4G23A 3ZN3A 4N39A 3FWVA 3Q5MA 2V5FA 3ZGQA 4BT9A 2HO1A 4N3BA 2Q7FA 1W3BA 5BNWA 5KJLA 4H7YA 4RG6A 3N71A 2KCKA 2Y4UA 3NF1A 3U3WA 3GZ1A 3QKYA 3CV0A 2IF4A 3LYAA 4YVQC 4N3AA 4XI9A 4N3CA 2NC9A 3QWVA 2FBNA 4HOSA 2GW1A 2VGYA 5FZRA 3S7FA 2C0MA 3O48A 4N5CA 4GA1A 2P58C 3QDNA 4KBQA 3VTYA 4JA7A 3AS8A 3RJVA 4GZ6A 4U0SA 4AY6A 3Q15A 3CVNA 3AS5A 3JYSA 5D0QD 2MHKA 4WNGA 5EX3A 4F3VA 5G05J 3CK8A 1WM5A 3EDTB
chains in the Genus database with same CATH superfamily
3TWUA 2IONA 1N95A 5ANRA 4CDRA 2QYUA 5EYLA 2HYZA 5BXUA 4JHJA 3QOUA 4XEIG 3JQ1A 2QC9A 4RG9A 3S2AA 4B0ZA 3G2WA 3FH5A 4P29A 1LTXA 3FUHA 2UWJG 3B7UX 3DSUA 1EF1C 3HXCA 2VYIA 4E6HA 1O1TA 5DBKA 4GTQA 1NP7A 4A1SA 3SBSA 4GCOA 2R03A 2UY1A 1BLXB 3DXMG 2QFCA 5AN8A 4JD2G 1NZNA 3UIPC 3F6QA 3ZXPA 2AJAA 2FF4A 2XS1A 5EN5D 2LAIA 3Q9NC 3ZHEB 1HF8A 2J09A 4WUYA 5EYPF 2VGEA 5FJYA 5LFAA 3KEZA 2XGMA 1HXIA 4CDNA 4BY6A 2XZDG 4HI8A 2XRYA 4GPMA 4OVVA 3AG2E 3R9MA 2P9IG 3B7TA 3NOCD 4EZLA 2XPZA 3NOGD 4KVOA 1K1AA 4LNBA 5EX0A 2HE0A 3DWLG 3Q78A 1TNBA 3B95A 3RIBA 4EBAA 4J8EA 4YDEA 3MKQA 2XPYA 3IHVA 5FZSA 3E34A 2VSNA 1DCEA 4IRUA 2L0TB 5BT1A 3UMVA 3C98A 4DRXE 5G04C 5EDSA 2EIME 4XE0A 4KYOB 2Y69E 4JXTA 4G8KA 2WQHA 1KLXA 3RAUA 2XEEA 2CHZA 5ITZF 4HORA 3GYZA 4BFRA 3FP3A 3Q49B 3TL5A 3LY7A 2VTBB 1SA5A 3RSEG 4F1SA 3TG4A 1MX4A 5JJTA 1JWGA 2XQ0A 1UJKA 2P2CP 1S70B 3SBTB 2XHEA 4DLOA 4WNEA 3D9OA 2ZGGA 4I2WA 2CFUA 1AP7A 4I43A 4EBAG 3EHMA 2X6KA 2F37A 4G11A 1H6OA 1FVFA 3OAWA 4BWRA 3PUJA 1TNOA 5T3RA 4U0ZA 1OWOA 1N0QA 3E33A 2X6HA 1S64A 2V4LA 1H19A 1NFIE 3TXNA 3FTVA 3UUXA 2PM6A 1ELWA 3NBNB 4ME2A 2XRZA 3TAXA 3FULA 4NQ0A 2DZOA 3TGOA 4ACLA 5LCWJ 3FTZA 2AVPA 1E90A 2WVIA 2X6JA 1FCHA 3J5QB 4IYPA 3LY9A 1HFAA 1YCSB 2WXGA 4FU3A 3CR3A 3FU5A 3NQPA 3CK7A 2LNIA 3PZ1A 2P9LG 4BT8A 3FUMA 3UT8A 4PS3A 4I9EA 1SW6A 1BI7B 2I6HA 4DX1A 3U66A 4EZJA 5FQ4A 3CQCB 4BTAA 3I4GA 5KJKA 3UQ3A 5AQAA 3MV3B 1NI1A 4GZ3A 1S0PA 4HOUA 3APDA 3LEWA 4BX8A 2GRLA 2P9UG 5KCMA 5KJNA 1N9AA 4J8SA 2C0LA 4A55A 3L6AA 5CHEE 3UM0A 4Q69A 1HE8A 1IYGA 2H6GA 4E85A 5JJ6A 3UT7A 1Z5SC 5BW8C 2Y3AA 2XGSA 5BPPA 4JHKA 3J5PA 4QFVA 3ZYLA 2WQ6A 3D3MA 4K5CA 2OOEA 5KWDA 4B94A 1SZAA 4HOTA 5D0OD 2WMOA 3JCKC 3LDZA 3PZ4A 2H6HA 3CSTA 4MLPA 1JWFA 4I1MA 2XCCA 2V0PA 4JZYA 3CLJA 3OXGA 4AOFA 3FFLA 2VSYA 1HG2A 4MBGA 3T8MA 3V79K 3ZUVB 3KAEA 3ZEFA 1JUQA 2KXPC 3QC1A 3UX4A 4G1TA 3R7QA 2DYRE 1H6KA 4KXKB 4U7EB 4FP7A 3SFXA 5HQ8A 4CT4A 3PEVB 2WMNA 5ENOD 2KCLA 2VGXA 4K5AB 1JCQA 4C48B 3ZVVA 4G23A 1L5JA 4N39A 4NACA 4UWLA 1H2UA 3ZGQA 1SA4A 3ML9A 3NZSA 1K3ZD 3U9WA 1W3BA 3Q73A 3E30A 2AW6A 3UTMA 5AJLA 5FQ7A 1TNZA 2I9CA 2L9BA 3U3WA 3DSTA 3B13A 3GZ1A 5AIJA 3CV0A 2ZU6B 3G2UA 5EIDA 3LYAA 3MX3A 1LD8A 4IULA 4RLYA 3Q79A 4CCAA 4DX5D 4HLLA 4TV3A 2C0MA 2CFZA 1XGWA 3ULYA 1UW4B 1PAQA 4F6RD 2P58C 4UWKA 3FUEA 2DCPA 1EYHA 5KNGA 4JA7A 2DZNA 2NXPA 3RJVA 2ETAA 4GZ6A 1QNFA 4TUMA 3AS5A 3UI2A 4Q94A 3JYSA 5D0QD 4GU5A 4JC8A 1N4SA 3SFZA 1E8WA 5E75A 4LRZA 3SO8A 2KBXA 2QZAA 4OVUA 3JQ0A 3R7RA 4BEPA 2GRPB 2QYJA 3ONLA 3VLFA 2DYSE 5FTPA 3APFA 2PZIA 2L6JA 5HI7A 3S7DA 5JJ7A 4BESA 1OWLA 1UOHA 3CVYA 4HOQA 5EIBE 4A63B 2UY1B 2HR2A 1H0AA 3TWSA 5D66A 1ELRA 3DSVA 2MYOA 3D9KA 2KATA 3I3NA 1U2VG 1KPSB 3IXEA 4JA9A 3ASDA 2XCBA 2PL2A 2RD0A 1FVHA 1XNFA 3PS6A 2VSOE 5G04J 1KZPA 2VJ8A 4J8YA 2I1KA 3U4TA 2DWZA 2I1JA 4TUUA 4WWOA 3T5XA 3Q4AB 4HFGA 2DIWA 4GA0A 4IN3B 2KCVA 5CBNA 1TYQG 1MJ0A 3MKQB 5FWQA 3TWRA 4KZ0A 1S63A 3EIJA 4ACKA 3CVLA 2GRMA 2FULA 2JEKA 3PUKA 1D9SA 1FT2A 1MQSA 2IJGX 3NB2A 1VDYA 3SZ7A 5BUZA 4FADA 3KD7A 2X3MA 3L82A 1V55E 2J4DA 2PNNA 4UWFA 2E2EA 4UQXA 2Y0BG 3PZ3A 3SQVA 1Z3XA 2BEDA 4ATGA 4AVXA 2WXNA 3KSQA 4OYSA 3CEQA 4UWHA 3UIOC 4YNDA 3RK6A 1TJFA 2IQCA 3FEXA 3AG3E 4UI9K 3PE4A 3CQGB 4GZDA 2R2LA 1OT8A 2FO7A 4AP2A 4XX5A 5DIZA 3G2SA 3ABME 4BSXA 4GTPA 3X2QE 4I1AA 4GTVA 2A5EA 2LUHA 2RKKA 5G55A 5HRYA 1MYOA 2YNQA 3D9NA 3ZKJA 2KC7A 1INZA 3IHYA 4FA6A 5EILA 5ENNA 1JCRA 3HG0D 2R02A 5AARA 3ASHA 4OAVB 5T8IA 2J07A 3HHMA 1N4QA 4JVSA 1B89A 4Q96A 4GTOA 2PM7A 3SF4A 4AY5A 4OAUC 1A17A 4LEUA 4CGVA 3W9FA 1UJJA 4N2QA 4I17A 3FUFA 4K5BA 3CVWA 1QQEA 5FZQA 1OCRE 4XKCA 2ZGDA 4L7TA 4G26A 1N52A 1MX2A 4RQIA 3ZIMA 3QAQA 4JEHA 3PRZA 3LCAA 3MZLB 3IV0A 3ONKA 4J0UA 4LERA 1N4RA 4J7WA 4FJYA 4O1OA 4CGWA 4JW1A 4G8LA 3W9GA 3T9KA 4DI4A 4HXIA 3G2TA 1D8DA 3LPZA 4URKA 4GYYA 3ASNE 3PVLA 1E7VA 2WXFA 5A6CA 5LX8A 3E32A 4APFA 4ATZD 2Y4TA 1O1SA 2JLBA 5EKQD 4ANUA 2L6BA 2DVWA 5J08A 4U8HA 2IO2C 1ELKA 4TXQA 2B0OE 1BU9A 4B93B 1HU3A 2WXPA 2CG3A 3FHEA 1HX8A 4I9CA 1KZOA 2VGXB 1IQUA 4UI9C 4BTBA 2XEHA 3T8KA 2BUGA 4YDOA 1OCZE 2LSUA 3G2VA 3HXBA 3FWVA 5JA4D 2V5FA 2IU1A 3TWVA 1X5BA 4PH4B 4CYMD 2Q7FA 3BUAA 3ESLA 5KJLA 1N4PA 4H7YA 4DLQA 3QKYA 3QARA 2IF4A 5KBAA 3LVQE 4LG6A 4ANVA 3PH0C 4N3AA 4XI9A 4WAFA 4L2YA 3QWVA 2FBNA 1HG5A 3ZYKA 3TWQA 2VGYA 5FZRA 5D2MC 4GTSA 3PEUB 2XENA 5C2YA 2RG8A 3C72A 3TWTA 3EU9A 3VTYA 2CHXA 3AS8A 3B7RL 1WY6A 3CVNA 3ML8A 3U64A 4CDMA 5CRVA 4LCTA 4QQIA 3BU8A 2EINE 3AU4A 4EPZA 3DRAA 3BG1B 1SVXA 3LJNA 1IXVA 2VQ2A 3UT4A 1TN8A 3FU0A 4HBDA 4AXHA 1PY1A 5FIOA 3V2XA 3I5PA 1H2VC 1UN9A 3MV2B 5ENRD 3CVXA 2IEJA 4A3TA 3RKVA 3CIAA 4GYOA 3AG4E 4JEUA 4J6IA 4B8AA 3HXFA 2GRQB 4U8YD 5FT9A 1UG3A 1Z3YA 3CHMA 1BPOA 3P2BA 5AQ9A 3UINC 3OXFA 2A5UA 4DJAA 4AIFA 4Y6CA 3LS8A 4WNFA 4U96D 2DBAA 2YQ8A 3PZ2A 1HS6A 4AV7A 4M3OA 3OTNA 5FINA 2A4ZA 3GW4A 2F8YA 3HXDA 3DPYA 3LY8A 4HLEA 2OEWA 4GZ5A 3EIQC 4I1OB 2F0YA 4R7LA 2ZIRA 1DC2A 4BERA 3L54A 3DPDA 2IY0C 4F1PA 3EUVA 3UPVA 3LKUA 2IOSA 3Q7AA 4HRNA 3CHRA 3UXGA 3CVVA 1Y8MA 1NL4A 3LXUX 5LOZA 2XPIA 3TXMA 1KT0A 5ENSD 3PE3A 1KT1A 3D9HA 1O5MA 2ZISA 5KJMA 5B1BE 2WXHA 2WM9A 3L16A 2KM4A 3ZW3A 3FU6A 4GPKA 3HRAA 3JUIA 4WWNA 2KZTB 4GYWA 4M7CA 4ILIA 5JMND 3AS4A 2XZTG 3DSSA 1X81A 3R9AB 5ANLA 2AXZA 5AYWD 3E37A 3WG7E 4CT0A 3CHPA 1Z6TA 4L1BA 4GTRA 3SI5A 2QY7A 4JPSA 3NZUA 5AAOA 4HI9A 5BXOA 1P5QA 2EIKE 3PNTB 4KVMA 4XI0A 5CRUA 1TEZA 4I6GA 2GGFA 3TG5A 3ISMC 4GAAA 2OVBA 1NA0A 2P9SG 5AQBA 4F53A 3MJWA 5A23A 3S7BA 1DCQA 1OUVA 2PQRA 1DNPA 3MCXA 5CMYA 1OWPA 1K1BA 2OVFA 4JHRA 2X6IA 3S7JA 2J9QA 4B8CB 3FUJA 2EIJE 4RSYA 2CHWA 5BV1A 1V54E 3E4BA 5JHAA 2B6CA 2X6FA 1IHGA 2J49A 3MGBA 3MA5A 3MEKA 1OY3D 5E76A 3ASGA 1BI8B 3GZ2A 2FI7A 3ZXSA 1D8EA 1PC2A 2MOWA 3ULQA 4EECA 4GMJA 3ZNGA 2JABA 3V2OA 4NRHB 5CCMA 3ZRHA 1JCSA 3RO3A 5CMWA 4WNDA 2WXOA 5A7DB 3CHSA 2ETBA 4APOA 4N2SA 1N0RA 1LF8A 2YINA 3FUKA 3DEOA 2OCCE 3CHOA 4UQYA 1Y6IA 4GCNA 2E0IA 2LXMA 2IOLA 4ABNA 5CBOA 3CKBA 1NA3A 1TN6A 3DEPA 1TN7A 3RRNB 2KZTA 4JB8P 1IQRA 3MYVA 4UI9J 1QYMA 4U8VD 4NURA 3TWXA 4GTMA 4L9PA 1AWCB 2BKKB 1QBQA 3P1UA 1JPLA 2AXVA 5J90A 1U3DA 4GMLA 4LSZE 3UM2A 3IEGA 4AJWA 3FTUA 3PREA 3Q9UC 1MHQA 4U07A 3DXKG 2WB2A 2J08A 3FH8A 4UUCA 2BF0X 4F7AA 3FTWA 1UN8A 4PS8A 4DUIA 1OWMA 5CERB 3CHQA 1LD7A 1RZ4A 4DX7D 3BG0B 3FUIA 3Q47B 1BD8A 2H6FA 4DX2A 3URZA 4HS2A 4FLHA 1E96B 3BQOA 3Q5MA 2M63A 2HO1A 4HRMB 3CGHA 4ILHB 3TJPA 2P9NG 4ANWA 5CEDB 4HQDA 2LXLA 4RG6A 3N71A 4K0RA 1IHBA 2KCKA 2Y4UA 2BTDA 2V5QC 3LJ3A 3T5VA 3FU3A 4MS6A 4YVQC 1K8KG 4A3VA 4FLBA 4HOSA 3C3RA 1TNUA 3IKOB 3JUEA 3D9PA 3EHNA 3VLEA 3RRMB 3FUDA 1RW2A 3QDNA 2NYJA 2P9KG 2WXQA 4EZKA 3Q15A 5BV0A 4PDXA 1A5EA 5T4YA 5FQ6A 4HVBA 3JXIA 1Q2ZA 4WNGA 4F3VA 3AU5A 3UM1A 3CK8A 3SGHA 2YHEA 3EDTB 4BETA 4BSZB 3CVQA 3SD5A 4I6JA 3KS2A 2R17C 2IO3C 4C0EA 3ABKE 1FT1A 4XZ4A 4CRWA 3Q7FA 3DBSA 2XGOA 3BEEA 2I2OA 4BX9A 1H2TC 3D9IA 5KNHD 3B7SA 5G05C 3K9IA 3C3QA 1YMPA 3SY2A 4D10C 1YYHA 3RO2A 4JL0A 2L0IA 4NIKA 3UKRG 3L17A 3V30A 2CG2A 1OCOE 3ZHEA 4G25A 2RFMA 4KZCA 4TXRA 4KT6B 3QWWA 4UWGA 3C5RA 2BKGA 4L2LA 3QK0A 1N11A 3ZPJA 4FC8A 5ENQD 2XS8A 3FTYA 1TJCA 2AWIA 5M72A 3L08A 3APCA 2WXLA 3KSLA 4DPRA 4UQZA 4U63A 5CCLA 4FULA 2ILRA 1E7UA 3VLDA 5ARGA 4MRUA 1H6PA 4B89A 4ZFHA 1SZ9A 4G2VA 4HB5A 1WDYA 3V31A 1TR4A 3Q75A 4WWPA 1ZU2A 3QB2A 2WXKA 4RVBA 4TRQA 2PQNA 3WXXA 2OV8A 3QJZA 4W9RA 1WG0A 3IBEA 1TNYA 4C9BB 5AENA 2VTBA 4EQFA 4TXPA 4Y6WA 2WPVA 2P9PG 1HH8A 3ABLE 2EILE 5C1DA 2GRRB 4N5QA 4AM9A 3JXJA 3CSFA 5FQ8A 2ONDA 3NAWA 1ZB1A 2FO1E 5HS0A 1GW6A 2V4HC 4GTTA 4GZCA 3UKUG 3L13A 1ZBPA 3B7BA 2NSZA 2LSVA 2GROB 1U3CA 4HNAD 2XEVA 3UM3A 1E8ZA 1MZCA 3HXEA 4U0UA 3FH7A 4YDWA 3SHFA 3AG1E 3DSXA 4GB9A 4YVOA 2YHCA 2RFAA 3RRUA 5HKPA 4PS7A 4V3IA 1EPUA 1G3NB 2OEVA 3PZDA 3RU0A 2R05A 1O1RA 4FJZA 3EHRA 5JHBA 2F8XK 4G24A 2C2LA 5IY5E 2IFUA 1WAO1 2AXUA 3O4ZA 4J8DA 3FY4A 1FPPA 3FDHA 3CK9A 4DK5A 1HZ4A 4DX6D 4O60A 2LO6A 4ZHBA 5LCWC 3PDNA 4CZ2D 2VSXE 1QZ2A 2WQ7A 1SQMA 3D9LA 3CVPA 2Y1LE 5CEAA 1OXJA 3HVEB 3ESKA 4LNUD 3GZSA 4HRLA 4C0MA 5G2NA 3EHQA 2FEZA 3PNLB 3L22A 3MKRA 2WXIA 3ZYMA 4O6FA 5ARFA 4A1GA 3HYMB 4DI3A 4U95D 2EQXA 3AAAC 3C3OA 4Z68A 4XIFA 4ILGA 3CVUA 2MRIA 4ANXA 3TWWA 4I2ZA 4CEMA 3D9MA 5ENPD 5AQ7A 4LNGA 1YA0A 3OXLA 4KMOA 3ZFWA 1EDUA 3QWPA 4FHKA 2R5SA 4L23A 3VTXA 3HIZA 3SFYA 4J8FA 2J4BA 3HDXA 2HM8A 3EU5A 1E8XA 3ASOE 3ZU7B 5B3SE 4H7XA 3FTSA 3EJNA 3CKCA 3FTXA 1HO8A 4U04A 4I6EA 2WXJA 2R59A 3ASFA 4YDYA 5CECB 4AEZC 4GA2A 4LUNU 3ZYQA 2ETCA 2LAHA 1N54A 2WXMA 5AJDA 3ZN3A 1MX6A 2X38A 1DVPA 4FHJA 3FUNA 3KEAA 4BT9A 5B1AE 4N3BA 5BNWA 5LP0A 4XKBA 1E8YA 1N94A 3NF1A 1OWNA 3L9TA 3DSWA 2H6IA 3ENEA 3ULEG 4N3CA 2NC9A 3LVRE 2GRNB 3D9JA 3I4RB 3FEYA 2GW1A 3S7FA 3O48A 4N5CA 2J8SD 2WXRA 3SNXA 4GA1A 3QNKA 4K03A 4MKTA 1IKND 3HVEA 4KBQA 5ENTD 3AJIA 4U0SA 4AY6A 2MHKA 4GMRA 2V8SE 5EX3A 5H7PA 4PUCA 5G05J 4X8QA 1WM5A 1OCCE 4EHMA 2ZXWE 4O1PA
chains in the Genus database with same CATH topology
3CVQA 3SD5A 2VQ2A 3ONLA 2IONA 3UT4A 3VLFA 5ANRA 4I6JA 4CDRA 5FTPA 3APFA 2PZIA 3FU0A 2HYZA 2L6JA 4AXHA 3KS2A 1PY1A 2R17C 4C0EA 3I5PA 5HI7A 3S7DA 5JJ7A 4JHJA 3QOUA 1H2VC 1UN9A 3MV2B 3CVXA 1OWLA 4A3TA 4XZ4A 3JQ1A 3RKVA 4RG9A 3S2AA 4B0ZA 3CIAA 4CRWA 3G2WA 3FH5A 4P29A 3DBSA 4GYOA 3FUHA 3CVYA 4HOQA 2UWJG 4JEUA 2XGOA 3BEEA 2I2OA 3B7UX 4J6IA 4B8AA 2UY1B 2HR2A 1EF1C 1H0AA 2VYIA 4BX9A 4E6HA 5DBKA 1ELRA 1H2TC 3D9IA 5FT9A 1NP7A 3D9KA 1UG3A 1Z3YA 3CHMA 1BPOA 3B7SA 3P2BA 3K9IA 5G05C 4A1SA 3OXFA 2A5UA 3SBSA 2KATA 3I3NA 4GCOA 4DJAA 2UY1A 4AIFA 4D10C 4Y6CA 3LS8A 2QFCA 4JA9A 4WNFA 3ASDA 2XCBA 2DBAA 2PL2A 3RO2A 1NZNA 2YQ8A 2FF4A 2RD0A 1HS6A 4JL0A 1FVHA 2L0IA 4AV7A 1XNFA 3PS6A 3L17A 2LAIA 3ZHEB 4M3OA 2VSOE 5G04J 1HF8A 2J09A 3OTNA 2A4ZA 4WUYA 3GW4A 2VJ8A 3U4TA 2I1KA 5FJYA 2I1JA 5LFAA 3KEZA 2XGMA 2CG2A 4TUUA 1HXIA 4CDNA 4WWOA 3LY8A 4HLEA 4BY6A 4GZ5A 3ZHEA 3T5XA 3Q4AB 4G25A 4HFGA 2DIWA 3EIQC 4I1OB 2XRYA 4GA0A 4OVVA 4KZCA 4IN3B 4R7LA 2KCVA 4KT6B 3B7TA 3QWWA 3L54A 4UWGA 3MKQB 3DPDA 5FWQA 4KZ0A 2XPZA 4L2LA 3QK0A 4EZLA 4KVOA 3EIJA 3ZPJA 4ACKA 5EX0A 4FC8A 3CVLA 2GRMA 2FULA 2JEKA 3UPVA 3LKUA 2IOSA 3PUKA 3RIBA 4EBAA 4J8EA 1MQSA 3FTYA 3MKQA 1TJCA 2XPYA 2IJGX 3IHVA 2AWIA 5M72A 1VDYA 3L08A 3CHRA 5FZSA 3CVVA 1Y8MA 3APCA 3LXUX 5LOZA 2VSNA 2WXLA 2XPIA 4IRUA 3TXMA 4DPRA 2L0TB 5BT1A 3UMVA 3SZ7A 3C98A 1KT0A 4UQZA 5G04C 5BUZA 5EDSA 4U63A 4FADA 5CCLA 3KD7A 4FULA 4XE0A 3PE3A 2ILRA 1E7UA 1KT1A 2X3MA 4KYOB 3VLDA 5ARGA 4JXTA 4MRUA 4B89A 2J4DA 2WQHA 1KLXA 4UWFA 5KJMA 2WXHA 2WM9A 1SZ9A 2E2EA 4UQXA 4G2VA 3L16A 2KM4A 2CHZA 1Z3XA 4HORA 3ZW3A 3FU6A 4GPKA 3GYZA 4ATGA 4BFRA 4AVXA 2WXNA 3FP3A 3Q49B 3TL5A 4WWPA 3JUIA 4WWNA 3LY7A 2VTBB 2KZTB 1ZU2A 4OYSA 3QB2A 3TG4A 4F1SA 4GYWA 3CEQA 2WXKA 4ILIA 4UWHA 5JJTA 4YNDA 4RVBA 1JWGA 2PQNA 4TRQA 3WXXA 2OV8A 2XQ0A 3AS4A 3QJZA 4W9RA 3RK6A 3IBEA 3R9AB 4C9BB 1UJKA 5AENA 5ANLA 1TJFA 2VTBA 3SBTB 4EQFA 2IQCA 2XHEA 4Y6WA 2AXZA 4DLOA 5AYWD 3FEXA 4WNEA 3D9OA 4CT0A 2WPVA 3CHPA 1Z6TA 4L1BA 4UI9K 3PE4A 4I2WA 2CFUA 1HH8A 3SI5A 2QY7A 4I43A 4JPSA 3CQGB 4GZDA 2FO7A 3NZUA 4EBAG 3EHMA 4AP2A 2X6KA 4XX5A 5C1DA 4G11A 4AM9A 5DIZA 1FVFA 3OAWA 3CSFA 3G2SA 4BSXA 1P5QA 3PNTB 4BWRA 5FQ8A 3PUJA 2ONDA 4KVMA 5T3RA 4U0ZA 1OWOA 1GW6A 4I1AA 4GZCA 3L13A 2X6HA 1ZBPA 4XI0A 1TEZA 2NSZA 2LSVA 5G55A 1U3CA 2V4LA 1H19A 4I6GA 2GGFA 3FTVA 3TXNA 2XEVA 3UUXA 2PM6A 3TG5A 1ELWA 1E8ZA 4ME2A 2XRZA 3TAXA 4GAAA 3FULA 4NQ0A 4U0UA 2YNQA 3FH7A 2OVBA 3SHFA 4ACLA 3TGOA 1NA0A 3D9NA 2KC7A 4GB9A 3IHYA 1INZA 4FA6A 5LCWJ 4YVOA 4F53A 2YHCA 3MJWA 3FTZA 5ENNA 2AVPA 5A23A 3S7BA 3RRUA 1E90A 1OUVA 2PQRA 2WVIA 2X6JA 4PS7A 1FCHA 1DNPA 4V3IA 3ASHA 3MCXA 4IYPA 5CMYA 1EPUA 1OWPA 2OVFA 3LY9A 1HFAA 4JHRA 2X6IA 5T8IA 3PZDA 3S7JA 3RU0A 2J07A 2J9QA 3HHMA 4B8CB 3FUJA 4JVSA 1B89A 4Q96A 4RSYA 2WXGA 4FU3A 3CR3A 2PM7A 3FU5A 3NQPA 2CHWA 3CK7A 4FJZA 5BV1A 2LNIA 3SF4A 4AY5A 5JHBA 4G24A 2C2LA 1A17A 4BT8A 2IFUA 3FUMA 1WAO1 2AXUA 3O4ZA 3E4BA 3UT8A 5JHAA 4LEUA 4J8DA 3FY4A 4PS3A 4CGVA 2X6FA 1UJJA 3FDHA 1IHGA 4I9EA 3CK9A 2J49A 4N2QA 4DK5A 3MGBA 2I6HA 3U66A 4EZJA 4I17A 3MA5A 3FUFA 5FQ4A 3MEKA 3CQCB 5E76A 4BTAA 3ASGA 3I4GA 5KJKA 3UQ3A 3CVWA 1QQEA 3MV3B 3GZ2A 5FZQA 2FI7A 1HZ4A 3ZXSA 4GZ3A 1PC2A 1S0PA 4HOUA 3APDA 2MOWA 3ULQA 2LO6A 3LEWA 5LCWC 3PDNA 4BX8A 4EECA 2GRLA 4XKCA 2VSXE 4GMJA 4L7TA 5KCMA 5KJNA 1QZ2A 4G26A 4J8SA 2WQ7A 1N52A 2C0LA 3ZIMA 4A55A 3QAQA 4NRHB 5CCMA 3ZRHA 1SQMA 3D9LA 3PRZA 3L6AA 4JEHA 3LCAA 3CVPA 3RO3A 5CHEE 5CMWA 3MZLB 4WNDA 3IV0A 3ONKA 2WXOA 4J0UA 3CHSA 4LERA 1HE8A 5A7DB 4Q69A 1IYGA 4APOA 4N2SA 3HVEB 4FJYA 1LF8A 2YINA 3ESKA 4JW1A 3FUKA 4CGWA 3GZSA 4C0MA 5G2NA 3CHOA 2FEZA 1Y6IA 3PNLB 3L22A 4GCNA 3MKRA 4UQYA 4E85A 5JJ6A 2WXIA 3ZYMA 4O6FA 5ARFA 4A1GA 3HYMB 3UT7A 2E0IA 4DI4A 4DI3A 4HXIA 2IOLA 5BW8C 4ABNA 2EQXA 3G2TA 2Y3AA 2XGSA 3CKBA 5BPPA 4XIFA 3LPZA 4ILGA 4JHKA 4URKA 1NA3A 4GYYA 4QFVA 3ZYLA 3PVLA 2WQ6A 3D3MA 1E7VA 3CVUA 3RRNB 2KZTA 2OOEA 1IQRA 2MRIA 2WXFA 3MYVA 4UI9J 4B94A 4NURA 1SZAA 5A6CA 5LX8A 4HOTA 5D0OD 2WMOA 4APFA 2Y4TA 4ANXA 3JCKC 2JLBA 3LDZA 5EKQD 4I2ZA 4CEMA 3P1UA 4ANUA 1JPLA 3D9MA 3CSTA 2AXVA 1JWFA 4MLPA 5J08A 1U3DA 4U8HA 5J90A 4I1MA 2XCCA 4GMLA 2V0PA 1YA0A 4JZYA 1ELKA 3OXLA 4KMOA 3CLJA 3OXGA 3IEGA 1EDUA 3ZFWA 3FTUA 3FFLA 4AOFA 3PREA 3QWPA 4FHKA 4AJWA 2R5SA 4L23A 3VTXA 3HIZA 2VSYA 1HG2A 1MHQA 4J8FA 4U07A 2J4BA 1HU3A 2WXPA 2CG3A 3FHEA 3HDXA 2HM8A 3T8MA 2WB2A 1E8XA 1HX8A 3KAEA 3ZEFA 1JUQA 2J08A 4H7XA 3FH8A 2BF0X 4F7AA 3FTWA 3FTSA 3EJNA 3QC1A 1UN8A 4PS8A 3CKCA 1OWMA 3FTXA 3UX4A 4I9CA 4G1TA 3R7QA 2VGXB 3CHQA 1IQUA 1H6KA 1HO8A 4U04A 4I6EA 4UI9C 4BTBA 4KXKB 2BUGA 4FP7A 2WXJA 2R59A 5HQ8A 3BG0B 3FUIA 3Q47B 3ASFA 4CT4A 3PEVB 3URZA 2LSUA 4AEZC 4GA2A 4HS2A 4LUNU 2WMNA 2KCLA 3ZYQA 2VGXA 3G2VA 4FLHA 1E96B 2LAHA 1N54A 2WXMA 3ZVVA 4G23A 1L5JA 5AJDA 3ZN3A 4N39A 3FWVA 4NACA 3Q5MA 2M63A 2X38A 1DVPA 4UWLA 1H2UA 2V5FA 3ZGQA 2IU1A 3ML9A 1X5BA 4FHJA 3FUNA 4BT9A 2HO1A 3NZSA 4PH4B 4N3BA 2Q7FA 3ESLA 3U9WA 1W3BA 3CGHA 5BNWA 4ILHB 3TJPA 5LP0A 2AW6A 4ANWA 5KJLA 4XKBA 1E8YA 5AJLA 4H7YA 4RG6A 5FQ7A 3N71A 2I9CA 4K0RA 2L9BA 2KCKA 2Y4UA 2BTDA 3NF1A 1OWNA 3GZ1A 3B13A 3QKYA 4DLQA 3QARA 5AIJA 3U3WA 3CV0A 2ZU6B 3LJ3A 3G2UA 3T5VA 3FU3A 2IF4A 4MS6A 3LVQE 3ENEA 3LYAA 4YVQC 4ANVA 3PH0C 4N3AA 4XI9A 4A3VA 3MX3A 4WAFA 4L2YA 4N3CA 2NC9A 3LVRE 4IULA 3QWVA 4FLBA 3D9JA 2FBNA 4HOSA 4CCAA 1HG5A 3ZYKA 3I4RB 3FEYA 2GW1A 3IKOB 2VGYA 5FZRA 3S7FA 4TV3A 3D9PA 3PEUB 2C0MA 2CFZA 3O48A 5C2YA 2RG8A 1XGWA 3EHNA 4N5CA 2WXRA 3SNXA 1UW4B 1PAQA 4GA1A 3VLEA 3RRMB 3FUDA 2P58C 4UWKA 3QNKA 3QDNA 4K03A 4MKTA 3FUEA 2DCPA 3HVEA 4KBQA 1EYHA 3VTYA 4JA7A 2CHXA 3AS8A 3B7RL 2NXPA 3RJVA 2WXQA 4EZKA 1WY6A 4GZ6A 4U0SA 4AY6A 3Q15A 1QNFA 3CVNA 5BV0A 3AS5A 3ML8A 3U64A 4Q94A 3JYSA 4PDXA 5T4YA 5D0QD 5FQ6A 4GU5A 4CDMA 4HVBA 4JC8A 2MHKA 4LCTA 2V8SE 3SFZA 1E8WA 4WNGA 5EX3A 4F3VA 4PUCA 5E75A 5G05J 3AU5A 4LRZA 3CK8A 3SGHA 3AU4A 4EPZA 1WM5A 2YHEA 4OVUA 3BG1B 3EDTB 3JQ0A 3R7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CVQ A;  2VQ2 A;  4CDR A;  5FTP A;  2PZI A;  2HYZ A;  2L6J A;  3KS2 A;  5HI7 A;  3S7D A;  5JJ7 A;  3QOU A;  3MV2 B;  3RKV A;  4RG9 A;  4GYO A;  4HOQ A;  2UWJ G;  2XGO A;  3BEE A;  2UY1 B;  2HR2 A;  2VYI A;  5DBK A;  1ELR A;  5FT9 A;  4A1S A;  5G05 C;  3K9I A;  3OXF A;  2KAT A;  4GCO A;  2UY1 A;  4AIF A;  4Y6C A;  2QFC A;  4JA9 A;  4WNF A;  3ASD A;  2XCB A;  2DBA A;  2PL2 A;  3RO2 A;  1NZN A;  2YQ8 A;  2FF4 A;  4JL0 A;  1XNF A;  3ZHE B;  5G04 J;  4WUY A;  3GW4 A;  3U4T A;  5FJY A;  2XGM A;  1HXI A;  3LY8 A;  4GZ5 A;  3ZHE A;  3Q4A B;  4G25 A;  4GA0 A;  4IN3 B;  2KCV A;  3QWW A;  3ZPJ A;  5EX0 A;  3CVL A;  3UPV A;  3LKU A;  3RIB A;  4J8E A;  1TJC A;  5M72 A;  5FZS A;  1Y8M A;  2VSN A;  2XPI A;  5BT1 A;  3SZ7 A;  4UQZ A;  1KT0 A;  5G04 C;  5CCL A;  3KD7 A;  3PE3 A;  1KT1 A;  4KYO B;  5ARG A;  2WQH A;  1KLX A;  5KJM A;  2E2E A;  4UQX A;  4G2V A;  4HOR A;  4GPK A;  3GYZ A;  3FP3 A;  3Q49 B;  3LY7 A;  1ZU2 A;  3TG4 A;  4GYW A;  3CEQ A;  5JJT A;  4YND A;  2PQN A;  3WXX A;  3AS4 A;  4W9R A;  3R9A B;  4EQF A;  4Y6W A;  5AYW D;  4WNE A;  2WPV A;  4UI9 K;  3PE4 A;  4I2W A;  1HH8 A;  2FO7 A;  5C1D A;  4AM9 A;  5DIZ A;  1P5Q A;  4BWR A;  2OND A;  4U0Z A;  4I1A A;  1ZBP A;  4XI0 A;  2LSV A;  2XEV A;  3UUX A;  3TG5 A;  1ELW A;  4ME2 A;  3TAX A;  4NQ0 A;  4U0U A;  3TGO A;  1NA0 A;  2KC7 A;  5LCW J;  4YVO A;  2YHC A;  2AVP A;  3S7B A;  1OUV A;  2PQR A;  1FCH A;  3ASH A;  3LY9 A;  4JHR A;  3S7J A;  3RU0 A;  2J9Q A;  1B89 A;  3CK7 A;  2LNI A;  3SF4 A;  4AY5 A;  4G24 A;  2C2L A;  1A17 A;  4BT8 A;  2IFU A;  1WAO 1;  3E4B A;  4LEU A;  4J8D A;  4CGV A;  1IHG A;  4I9E A;  3CK9 A;  4N2Q A;  2I6H A;  4I17 A;  3MA5 A;  3MEK A;  4BTA A;  3ASG A;  5KJK A;  3UQ3 A;  1QQE A;  3MV3 B;  3GZ2 A;  5FZQ A;  2FI7 A;  1HZ4 A;  4GZ3 A;  1PC2 A;  4HOU A;  3ULQ A;  5LCW C;  3PDN A;  5KJN A;  1QZ2 A;  4G26 A;  2C0L A;  4NRH B;  5CCM A;  3LCA A;  3CVP A;  3RO3 A;  5CHE E;  4WND A;  5A7D B;  4J0U A;  1IYG A;  4APO A;  4N2S A;  3ESK A;  4CGW A;  4UQY A;  2FEZ A;  4GCN A;  3MKR A;  5JJ6 A;  4O6F A;  5ARF A;  3HYM B;  5BW8 C;  4ABN A;  2XGS A;  3CKB A;  4XIF A;  3LPZ A;  1NA3 A;  4GYY A;  2OOE A;  4UI9 J;  4B94 A;  5A6C A;  4HOT A;  5D0O D;  2Y4T A;  2JLB A;  5EKQ D;  4I2Z A;  2XCC A;  1YA0 A;  3OXL A;  3OXG A;  3ZFW A;  3IEG A;  3FFL A;  3QWP A;  2R5S A;  3VTX A;  2VSY A;  4J8F A;  4U07 A;  3KAE A;  4H7X A;  3CKC A;  4I9C A;  4G1T A;  2VGX B;  4U04 A;  4UI9 C;  4BTB A;  4KXK B;  2BUG A;  5HQ8 A;  3Q47 B;  3ASF A;  3URZ A;  2LSU A;  4GA2 A;  2KCL A;  2VGX A;  1E96 B;  4G23 A;  3ZN3 A;  4N39 A;  3FWV A;  3Q5M A;  2V5F A;  3ZGQ A;  4BT9 A;  2HO1 A;  4N3B A;  2Q7F A;  1W3B A;  5BNW A;  5KJL A;  4H7Y A;  4RG6 A;  3N71 A;  2KCK A;  2Y4U A;  3NF1 A;  3U3W A;  3GZ1 A;  3QKY A;  3CV0 A;  2IF4 A;  3LYA A;  4YVQ C;  4N3A A;  4XI9 A;  4N3C A;  2NC9 A;  3QWV A;  2FBN A;  4HOS A;  2GW1 A;  2VGY A;  5FZR A;  3S7F A;  2C0M A;  3O48 A;  4N5C A;  4GA1 A;  2P58 C;  3QDN A;  4KBQ A;  3VTY A;  4JA7 A;  3AS8 A;  3RJV A;  4GZ6 A;  4U0S A;  4AY6 A;  3Q15 A;  3CVN A;  3AS5 A;  3JYS A;  5D0Q D;  2MHK A;  4WNG A;  5EX3 A;  4F3V A;  5G05 J;  3CK8 A;  1WM5 A;  3EDT B; 
#chains in the Genus database with same CATH topology
 3TWU A;  2ION A;  1N95 A;  5ANR A;  4CDR A;  2QYU A;  5EYL A;  2HYZ A;  5BXU A;  4JHJ A;  3QOU A;  4XEI G;  3JQ1 A;  2QC9 A;  4RG9 A;  3S2A A;  4B0Z A;  3G2W A;  3FH5 A;  4P29 A;  1LTX A;  3FUH A;  2UWJ G;  3B7U X;  3DSU A;  1EF1 C;  3HXC A;  2VYI A;  4E6H A;  1O1T A;  5DBK A;  4GTQ A;  1NP7 A;  4A1S A;  3SBS A;  4GCO A;  2R03 A;  2UY1 A;  1BLX B;  3DXM G;  2QFC A;  5AN8 A;  4JD2 G;  1NZN A;  3UIP C;  3F6Q A;  3ZXP A;  2AJA A;  2FF4 A;  2XS1 A;  5EN5 D;  2LAI A;  3Q9N C;  3ZHE B;  1HF8 A;  2J09 A;  4WUY A;  5EYP F;  2VGE A;  5FJY A;  5LFA A;  3KEZ A;  2XGM A;  1HXI A;  4CDN A;  4BY6 A;  2XZD G;  4HI8 A;  2XRY A;  4GPM A;  4OVV A;  3AG2 E;  3R9M A;  2P9I G;  3B7T A;  3NOC D;  4EZL A;  2XPZ A;  3NOG D;  4KVO A;  1K1A A;  4LNB A;  5EX0 A;  2HE0 A;  3DWL G;  3Q78 A;  1TNB A;  3B95 A;  3RIB A;  4EBA A;  4J8E A;  4YDE A;  3MKQ A;  2XPY A;  3IHV A;  5FZS A;  3E34 A;  2VSN A;  1DCE A;  4IRU A;  2L0T B;  5BT1 A;  3UMV A;  3C98 A;  4DRX E;  5G04 C;  5EDS A;  2EIM E;  4XE0 A;  4KYO B;  2Y69 E;  4JXT A;  4G8K A;  2WQH A;  1KLX A;  3RAU A;  2XEE A;  2CHZ A;  5ITZ F;  4HOR A;  3GYZ A;  4BFR A;  3FP3 A;  3Q49 B;  3TL5 A;  3LY7 A;  2VTB B;  1SA5 A;  3RSE G;  4F1S A;  3TG4 A;  1MX4 A;  5JJT A;  1JWG A;  2XQ0 A;  1UJK A;  2P2C P;  1S70 B;  3SBT B;  2XHE A;  4DLO A;  4WNE A;  3D9O A;  2ZGG A;  4I2W A;  2CFU A;  1AP7 A;  4I43 A;  4EBA G;  3EHM A;  2X6K A;  2F37 A;  4G11 A;  1H6O A;  1FVF A;  3OAW A;  4BWR A;  3PUJ A;  1TNO A;  5T3R A;  4U0Z A;  1OWO A;  1N0Q A;  3E33 A;  2X6H A;  1S64 A;  2V4L A;  1H19 A;  1NFI E;  3TXN A;  3FTV A;  3UUX A;  2PM6 A;  1ELW A;  3NBN B;  4ME2 A;  2XRZ A;  3TAX A;  3FUL A;  4NQ0 A;  2DZO A;  3TGO A;  4ACL A;  5LCW J;  3FTZ A;  2AVP A;  1E90 A;  2WVI A;  2X6J A;  1FCH A;  3J5Q B;  4IYP A;  3LY9 A;  1HFA A;  1YCS B;  2WXG A;  4FU3 A;  3CR3 A;  3FU5 A;  3NQP A;  3CK7 A;  2LNI A;  3PZ1 A;  2P9L G;  4BT8 A;  3FUM A;  3UT8 A;  4PS3 A;  4I9E A;  1SW6 A;  1BI7 B;  2I6H A;  4DX1 A;  3U66 A;  4EZJ A;  5FQ4 A;  3CQC B;  4BTA A;  3I4G A;  5KJK A;  3UQ3 A;  5AQA A;  3MV3 B;  1NI1 A;  4GZ3 A;  1S0P A;  4HOU A;  3APD A;  3LEW A;  4BX8 A;  2GRL A;  2P9U G;  5KCM A;  5KJN A;  1N9A A;  4J8S A;  2C0L A;  4A55 A;  3L6A A;  5CHE E;  3UM0 A;  4Q69 A;  1HE8 A;  1IYG A;  2H6G A;  4E85 A;  5JJ6 A;  3UT7 A;  1Z5S C;  5BW8 C;  2Y3A A;  2XGS A;  5BPP A;  4JHK A;  3J5P A;  4QFV A;  3ZYL A;  2WQ6 A;  3D3M A;  4K5C A;  2OOE A;  5KWD A;  4B94 A;  1SZA A;  4HOT A;  5D0O D;  2WMO A;  3JCK C;  3LDZ A;  3PZ4 A;  2H6H A;  3CST A;  4MLP A;  1JWF A;  4I1M A;  2XCC A;  2V0P A;  4JZY A;  3CLJ A;  3OXG A;  4AOF A;  3FFL A;  2VSY A;  1HG2 A;  4MBG A;  3T8M A;  3V79 K;  3ZUV B;  3KAE A;  3ZEF A;  1JUQ A;  2KXP C;  3QC1 A;  3UX4 A;  4G1T A;  3R7Q A;  2DYR E;  1H6K A;  4KXK B;  4U7E B;  4FP7 A;  3SFX A;  5HQ8 A;  4CT4 A;  3PEV B;  2WMN A;  5ENO D;  2KCL A;  2VGX A;  4K5A B;  1JCQ A;  4C48 B;  3ZVV A;  4G23 A;  1L5J A;  4N39 A;  4NAC A;  4UWL A;  1H2U A;  3ZGQ A;  1SA4 A;  3ML9 A;  3NZS A;  1K3Z D;  3U9W A;  1W3B A;  3Q73 A;  3E30 A;  2AW6 A;  3UTM A;  5AJL A;  5FQ7 A;  1TNZ A;  2I9C A;  2L9B A;  3U3W A;  3DST A;  3B13 A;  3GZ1 A;  5AIJ A;  3CV0 A;  2ZU6 B;  3G2U A;  5EID A;  3LYA A;  3MX3 A;  1LD8 A;  4IUL A;  4RLY A;  3Q79 A;  4CCA A;  4DX5 D;  4HLL A;  4TV3 A;  2C0M A;  2CFZ A;  1XGW A;  3ULY A;  1UW4 B;  1PAQ A;  4F6R D;  2P58 C;  4UWK A;  3FUE A;  2DCP A;  1EYH A;  5KNG A;  4JA7 A;  2DZN A;  2NXP A;  3RJV A;  2ETA A;  4GZ6 A;  1QNF A;  4TUM A;  3AS5 A;  3UI2 A;  4Q94 A;  3JYS A;  5D0Q D;  4GU5 A;  4JC8 A;  1N4S A;  3SFZ A;  1E8W A;  5E75 A;  4LRZ A;  3SO8 A;  2KBX A;  2QZA A;  4OVU A;  3JQ0 A;  3R7R A;  4BEP A;  2GRP B;  2QYJ A;  3ONL A;  3VLF A;  2DYS E;  5FTP A;  3APF A;  2PZI A;  2L6J A;  5HI7 A;  3S7D A;  5JJ7 A;  4BES A;  1OWL A;  1UOH A;  3CVY A;  4HOQ A;  5EIB E;  4A63 B;  2UY1 B;  2HR2 A;  1H0A A;  3TWS A;  5D66 A;  1ELR A;  3DSV A;  2MYO A;  3D9K A;  2KAT A;  3I3N A;  1U2V G;  1KPS B;  3IXE A;  4JA9 A;  3ASD A;  2XCB A;  2PL2 A;  2RD0 A;  1FVH A;  1XNF A;  3PS6 A;  2VSO E;  5G04 J;  1KZP A;  2VJ8 A;  4J8Y A;  2I1K A;  3U4T A;  2DWZ A;  2I1J A;  4TUU A;  4WWO A;  3T5X A;  3Q4A B;  4HFG A;  2DIW A;  4GA0 A;  4IN3 B;  2KCV A;  5CBN A;  1TYQ G;  1MJ0 A;  3MKQ B;  5FWQ A;  3TWR A;  4KZ0 A;  1S63 A;  3EIJ A;  4ACK A;  3CVL A;  2GRM A;  2FUL A;  2JEK A;  3PUK A;  1D9S A;  1FT2 A;  1MQS A;  2IJG X;  3NB2 A;  1VDY A;  3SZ7 A;  5BUZ A;  4FAD A;  3KD7 A;  2X3M A;  3L82 A;  1V55 E;  2J4D A;  2PNN A;  4UWF A;  2E2E A;  4UQX A;  2Y0B G;  3PZ3 A;  3SQV A;  1Z3X A;  2BED A;  4ATG A;  4AVX A;  2WXN A;  3KSQ A;  4OYS A;  3CEQ A;  4UWH A;  3UIO C;  4YND A;  3RK6 A;  1TJF A;  2IQC A;  3FEX A;  3AG3 E;  4UI9 K;  3PE4 A;  3CQG B;  4GZD A;  2R2L A;  1OT8 A;  2FO7 A;  4AP2 A;  4XX5 A;  5DIZ A;  3G2S A;  3ABM E;  4BSX A;  4GTP A;  3X2Q E;  4I1A A;  4GTV A;  2A5E A;  2LUH A;  2RKK A;  5G55 A;  5HRY A;  1MYO A;  2YNQ A;  3D9N A;  3ZKJ A;  2KC7 A;  1INZ A;  3IHY A;  4FA6 A;  5EIL A;  5ENN A;  1JCR A;  3HG0 D;  2R02 A;  5AAR A;  3ASH A;  4OAV B;  5T8I A;  2J07 A;  3HHM A;  1N4Q A;  4JVS A;  1B89 A;  4Q96 A;  4GTO A;  2PM7 A;  3SF4 A;  4AY5 A;  4OAU C;  1A17 A;  4LEU A;  4CGV A;  3W9F A;  1UJJ A;  4N2Q A;  4I17 A;  3FUF A;  4K5B A;  3CVW A;  1QQE A;  5FZQ A;  1OCR E;  4XKC A;  2ZGD A;  4L7T A;  4G26 A;  1N52 A;  1MX2 A;  4RQI A;  3ZIM A;  3QAQ A;  4JEH A;  3PRZ A;  3LCA A;  3MZL B;  3IV0 A;  3ONK A;  4J0U A;  4LER A;  1N4R A;  4J7W A;  4FJY A;  4O1O A;  4CGW A;  4JW1 A;  4G8L A;  3W9G A;  3T9K A;  4DI4 A;  4HXI A;  3G2T A;  1D8D A;  3LPZ A;  4URK A;  4GYY A;  3ASN E;  3PVL A;  1E7V A;  2WXF A;  5A6C A;  5LX8 A;  3E32 A;  4APF A;  4ATZ D;  2Y4T A;  1O1S A;  2JLB A;  5EKQ D;  4ANU A;  2L6B A;  2DVW A;  5J08 A;  4U8H A;  2IO2 C;  1ELK A;  4TXQ A;  2B0O E;  1BU9 A;  4B93 B;  1HU3 A;  2WXP A;  2CG3 A;  3FHE A;  1HX8 A;  4I9C A;  1KZO A;  2VGX B;  1IQU A;  4UI9 C;  4BTB A;  2XEH A;  3T8K A;  2BUG A;  4YDO A;  1OCZ E;  2LSU A;  3G2V A;  3HXB A;  3FWV A;  5JA4 D;  2V5F A;  2IU1 A;  3TWV A;  1X5B A;  4PH4 B;  4CYM D;  2Q7F A;  3BUA A;  3ESL A;  5KJL A;  1N4P A;  4H7Y A;  4DLQ A;  3QKY A;  3QAR A;  2IF4 A;  5KBA A;  3LVQ E;  4LG6 A;  4ANV A;  3PH0 C;  4N3A A;  4XI9 A;  4WAF A;  4L2Y A;  3QWV A;  2FBN A;  1HG5 A;  3ZYK A;  3TWQ A;  2VGY A;  5FZR A;  5D2M C;  4GTS A;  3PEU B;  2XEN A;  5C2Y A;  2RG8 A;  3C72 A;  3TWT A;  3EU9 A;  3VTY A;  2CHX A;  3AS8 A;  3B7R L;  1WY6 A;  3CVN A;  3ML8 A;  3U64 A;  4CDM A;  5CRV A;  4LCT A;  4QQI A;  3BU8 A;  2EIN E;  3AU4 A;  4EPZ A;  3DRA A;  3BG1 B;  1SVX A;  3LJN A;  1IXV A;  2VQ2 A;  3UT4 A;  1TN8 A;  3FU0 A;  4HBD A;  4AXH A;  1PY1 A;  5FIO A;  3V2X A;  3I5P A;  1H2V C;  1UN9 A;  3MV2 B;  5ENR D;  3CVX A;  2IEJ A;  4A3T A;  3RKV A;  3CIA A;  4GYO A;  3AG4 E;  4JEU A;  4J6I A;  4B8A A;  3HXF A;  2GRQ B;  4U8Y D;  5FT9 A;  1UG3 A;  1Z3Y A;  3CHM A;  1BPO A;  3P2B A;  5AQ9 A;  3UIN C;  3OXF A;  2A5U A;  4DJA A;  4AIF A;  4Y6C A;  3LS8 A;  4WNF A;  4U96 D;  2DBA A;  2YQ8 A;  3PZ2 A;  1HS6 A;  4AV7 A;  4M3O A;  3OTN A;  5FIN A;  2A4Z A;  3GW4 A;  2F8Y A;  3HXD A;  3DPY A;  3LY8 A;  4HLE A;  2OEW A;  4GZ5 A;  3EIQ C;  4I1O B;  2F0Y A;  4R7L A;  2ZIR A;  1DC2 A;  4BER A;  3L54 A;  3DPD A;  2IY0 C;  4F1P A;  3EUV A;  3UPV A;  3LKU A;  2IOS A;  3Q7A A;  4HRN A;  3CHR A;  3UXG A;  3CVV A;  1Y8M A;  1NL4 A;  3LXU X;  5LOZ A;  2XPI A;  3TXM A;  1KT0 A;  5ENS D;  3PE3 A;  1KT1 A;  3D9H A;  1O5M A;  2ZIS A;  5KJM A;  5B1B E;  2WXH A;  2WM9 A;  3L16 A;  2KM4 A;  3ZW3 A;  3FU6 A;  4GPK A;  3HRA A;  3JUI A;  4WWN A;  2KZT B;  4GYW A;  4M7C A;  4ILI A;  5JMN D;  3AS4 A;  2XZT G;  3DSS A;  1X81 A;  3R9A B;  5ANL A;  2AXZ A;  5AYW D;  3E37 A;  3WG7 E;  4CT0 A;  3CHP A;  1Z6T A;  4L1B A;  4GTR A;  3SI5 A;  2QY7 A;  4JPS A;  3NZU A;  5AAO A;  4HI9 A;  5BXO A;  1P5Q A;  2EIK E;  3PNT B;  4KVM A;  4XI0 A;  5CRU A;  1TEZ A;  4I6G A;  2GGF A;  3TG5 A;  3ISM C;  4GAA A;  2OVB A;  1NA0 A;  2P9S G;  5AQB A;  4F53 A;  3MJW A;  5A23 A;  3S7B A;  1DCQ A;  1OUV A;  2PQR A;  1DNP A;  3MCX A;  5CMY A;  1OWP A;  1K1B A;  2OVF A;  4JHR A;  2X6I A;  3S7J A;  2J9Q A;  4B8C B;  3FUJ A;  2EIJ E;  4RSY A;  2CHW A;  5BV1 A;  1V54 E;  3E4B A;  5JHA A;  2B6C A;  2X6F A;  1IHG A;  2J49 A;  3MGB A;  3MA5 A;  3MEK A;  1OY3 D;  5E76 A;  3ASG A;  1BI8 B;  3GZ2 A;  2FI7 A;  3ZXS A;  1D8E A;  1PC2 A;  2MOW A;  3ULQ A;  4EEC A;  4GMJ A;  3ZNG A;  2JAB A;  3V2O A;  4NRH B;  5CCM A;  3ZRH A;  1JCS A;  3RO3 A;  5CMW A;  4WND A;  2WXO A;  5A7D B;  3CHS A;  2ETB A;  4APO A;  4N2S A;  1N0R A;  1LF8 A;  2YIN A;  3FUK A;  3DEO A;  2OCC E;  3CHO A;  4UQY A;  1Y6I A;  4GCN A;  2E0I A;  2LXM A;  2IOL A;  4ABN A;  5CBO A;  3CKB A;  1NA3 A;  1TN6 A;  3DEP A;  1TN7 A;  3RRN B;  2KZT A;  4JB8 P;  1IQR A;  3MYV A;  4UI9 J;  1QYM A;  4U8V D;  4NUR A;  3TWX A;  4GTM A;  4L9P A;  1AWC B;  2BKK B;  1QBQ A;  3P1U A;  1JPL A;  2AXV A;  5J90 A;  1U3D A;  4GML A;  4LSZ E;  3UM2 A;  3IEG A;  4AJW A;  3FTU A;  3PRE A;  3Q9U C;  1MHQ A;  4U07 A;  3DXK G;  2WB2 A;  2J08 A;  3FH8 A;  4UUC A;  2BF0 X;  4F7A A;  3FTW A;  1UN8 A;  4PS8 A;  4DUI A;  1OWM A;  5CER B;  3CHQ A;  1LD7 A;  1RZ4 A;  4DX7 D;  3BG0 B;  3FUI A;  3Q47 B;  1BD8 A;  2H6F A;  4DX2 A;  3URZ A;  4HS2 A;  4FLH A;  1E96 B;  3BQO A;  3Q5M A;  2M63 A;  2HO1 A;  4HRM B;  3CGH A;  4ILH B;  3TJP A;  2P9N G;  4ANW A;  5CED B;  4HQD A;  2LXL A;  4RG6 A;  3N71 A;  4K0R A;  1IHB A;  2KCK A;  2Y4U A;  2BTD A;  2V5Q C;  3LJ3 A;  3T5V A;  3FU3 A;  4MS6 A;  4YVQ C;  1K8K G;  4A3V A;  4FLB A;  4HOS A;  3C3R A;  1TNU A;  3IKO B;  3JUE A;  3D9P A;  3EHN A;  3VLE A;  3RRM B;  3FUD A;  1RW2 A;  3QDN A;  2NYJ A;  2P9K G;  2WXQ A;  4EZK A;  3Q15 A;  5BV0 A;  4PDX A;  1A5E A;  5T4Y A;  5FQ6 A;  4HVB A;  3JXI A;  1Q2Z A;  4WNG A;  4F3V A;  3AU5 A;  3UM1 A;  3CK8 A;  3SGH A;  2YHE A;  3EDT B;  4BET A;  4BSZ B;  3CVQ A;  3SD5 A;  4I6J A;  3KS2 A;  2R17 C;  2IO3 C;  4C0E A;  3ABK E;  1FT1 A;  4XZ4 A;  4CRW A;  3Q7F A;  3DBS A;  2XGO A;  3BEE A;  2I2O A;  4BX9 A;  1H2T C;  3D9I A;  5KNH D;  3B7S A;  5G05 C;  3K9I A;  3C3Q A;  1YMP A;  3SY2 A;  4D10 C;  1YYH A;  3RO2 A;  4JL0 A;  2L0I A;  4NIK A;  3UKR G;  3L17 A;  3V30 A;  2CG2 A;  1OCO E;  3ZHE A;  4G25 A;  2RFM A;  4KZC A;  4TXR A;  4KT6 B;  3QWW A;  4UWG A;  3C5R A;  2BKG A;  4L2L A;  3QK0 A;  1N11 A;  3ZPJ A;  4FC8 A;  5ENQ D;  2XS8 A;  3FTY A;  1TJC A;  2AWI A;  5M72 A;  3L08 A;  3APC A;  2WXL A;  3KSL A;  4DPR A;  4UQZ A;  4U63 A;  5CCL A;  4FUL A;  2ILR A;  1E7U A;  3VLD A;  5ARG A;  4MRU A;  1H6P A;  4B89 A;  4ZFH A;  1SZ9 A;  4G2V A;  4HB5 A;  1WDY A;  3V31 A;  1TR4 A;  3Q75 A;  4WWP A;  1ZU2 A;  3QB2 A;  2WXK A;  4RVB A;  4TRQ A;  2PQN A;  3WXX A;  2OV8 A;  3QJZ A;  4W9R A;  1WG0 A;  3IBE A;  1TNY A;  4C9B B;  5AEN A;  2VTB A;  4EQF A;  4TXP A;  4Y6W A;  2WPV A;  2P9P G;  1HH8 A;  3ABL E;  2EIL E;  5C1D A;  2GRR B;  4N5Q A;  4AM9 A;  3JXJ A;  3CSF A;  5FQ8 A;  2OND A;  3NAW A;  1ZB1 A;  2FO1 E;  5HS0 A;  1GW6 A;  2V4H C;  4GTT A;  4GZC A;  3UKU G;  3L13 A;  1ZBP A;  3B7B A;  2NSZ A;  2LSV A;  2GRO B;  1U3C A;  4HNA D;  2XEV A;  3UM3 A;  1E8Z A;  1MZC A;  3HXE A;  4U0U A;  3FH7 A;  4YDW A;  3SHF A;  3AG1 E;  3DSX A;  4GB9 A;  4YVO A;  2YHC A;  2RFA A;  3RRU A;  5HKP A;  4PS7 A;  4V3I A;  1EPU A;  1G3N B;  2OEV A;  3PZD A;  3RU0 A;  2R05 A;  1O1R A;  4FJZ A;  3EHR A;  5JHB A;  2F8X K;  4G24 A;  2C2L A;  5IY5 E;  2IFU A;  1WAO 1;  2AXU A;  3O4Z A;  4J8D A;  3FY4 A;  1FPP A;  3FDH A;  3CK9 A;  4DK5 A;  1HZ4 A;  4DX6 D;  4O60 A;  2LO6 A;  4ZHB A;  5LCW C;  3PDN A;  4CZ2 D;  2VSX E;  1QZ2 A;  2WQ7 A;  1SQM A;  3D9L A;  3CVP A;  2Y1L E;  5CEA A;  1OXJ A;  3HVE B;  3ESK A;  4LNU D;  3GZS A;  4HRL A;  4C0M A;  5G2N A;  3EHQ A;  2FEZ A;  3PNL B;  3L22 A;  3MKR A;  2WXI A;  3ZYM A;  4O6F A;  5ARF A;  4A1G A;  3HYM B;  4DI3 A;  4U95 D;  2EQX A;  3AAA C;  3C3O A;  4Z68 A;  4XIF A;  4ILG A;  3CVU A;  2MRI A;  4ANX A;  3TWW A;  4I2Z A;  4CEM A;  3D9M A;  5ENP D;  5AQ7 A;  4LNG A;  1YA0 A;  3OXL A;  4KMO A;  3ZFW A;  1EDU A;  3QWP A;  4FHK A;  2R5S A;  4L23 A;  3VTX A;  3HIZ A;  3SFY A;  4J8F A;  2J4B A;  3HDX A;  2HM8 A;  3EU5 A;  1E8X A;  3ASO E;  3ZU7 B;  5B3S E;  4H7X A;  3FTS A;  3EJN A;  3CKC A;  3FTX A;  1HO8 A;  4U04 A;  4I6E A;  2WXJ A;  2R59 A;  3ASF A;  4YDY A;  5CEC B;  4AEZ C;  4GA2 A;  4LUN U;  3ZYQ A;  2ETC A;  2LAH A;  1N54 A;  2WXM A;  5AJD A;  3ZN3 A;  1MX6 A;  2X38 A;  1DVP A;  4FHJ A;  3FUN A;  3KEA A;  4BT9 A;  5B1A E;  4N3B A;  5BNW A;  5LP0 A;  4XKB A;  1E8Y A;  1N94 A;  3NF1 A;  1OWN A;  3L9T A;  3DSW A;  2H6I A;  3ENE A;  3ULE G;  4N3C A;  2NC9 A;  3LVR E;  2GRN B;  3D9J A;  3I4R B;  3FEY A;  2GW1 A;  3S7F A;  3O48 A;  4N5C A;  2J8S D;  2WXR A;  3SNX A;  4GA1 A;  3QNK A;  4K03 A;  4MKT A;  1IKN D;  3HVE A;  4KBQ A;  5ENT D;  3AJI A;  4U0S A;  4AY6 A;  2MHK A;  4GMR A;  2V8S E;  5EX3 A;  5H7P A;  4PUC A;  5G05 J;  4X8Q A;  1WM5 A;  1OCC E;  4EHM A;  2ZXW E;  4O1P A; 
#chains in the Genus database with same CATH homology
 3CVQ A;  3SD5 A;  2VQ2 A;  3ONL A;  2ION A;  3UT4 A;  3VLF A;  5ANR A;  4I6J A;  4CDR A;  5FTP A;  3APF A;  2PZI A;  3FU0 A;  2HYZ A;  2L6J A;  4AXH A;  3KS2 A;  1PY1 A;  2R17 C;  4C0E A;  3I5P A;  5HI7 A;  3S7D A;  5JJ7 A;  4JHJ A;  3QOU A;  1H2V C;  1UN9 A;  3MV2 B;  3CVX A;  1OWL A;  4A3T A;  4XZ4 A;  3JQ1 A;  3RKV A;  4RG9 A;  3S2A A;  4B0Z A;  3CIA A;  4CRW A;  3G2W A;  3FH5 A;  4P29 A;  3DBS A;  4GYO A;  3FUH A;  3CVY A;  4HOQ A;  2UWJ G;  4JEU A;  2XGO A;  3BEE A;  2I2O A;  3B7U X;  4J6I A;  4B8A A;  2UY1 B;  2HR2 A;  1EF1 C;  1H0A A;  2VYI A;  4BX9 A;  4E6H A;  5DBK A;  1ELR A;  1H2T C;  3D9I A;  5FT9 A;  1NP7 A;  3D9K A;  1UG3 A;  1Z3Y A;  3CHM A;  1BPO A;  3B7S A;  3P2B A;  3K9I A;  5G05 C;  4A1S A;  3OXF A;  2A5U A;  3SBS A;  2KAT A;  3I3N A;  4GCO A;  4DJA A;  2UY1 A;  4AIF A;  4D10 C;  4Y6C A;  3LS8 A;  2QFC A;  4JA9 A;  4WNF A;  3ASD A;  2XCB A;  2DBA A;  2PL2 A;  3RO2 A;  1NZN A;  2YQ8 A;  2FF4 A;  2RD0 A;  1HS6 A;  4JL0 A;  1FVH A;  2L0I A;  4AV7 A;  1XNF A;  3PS6 A;  3L17 A;  2LAI A;  3ZHE B;  4M3O A;  2VSO E;  5G04 J;  1HF8 A;  2J09 A;  3OTN A;  2A4Z A;  4WUY A;  3GW4 A;  2VJ8 A;  3U4T A;  2I1K A;  5FJY A;  2I1J A;  5LFA A;  3KEZ A;  2XGM A;  2CG2 A;  4TUU A;  1HXI A;  4CDN A;  4WWO A;  3LY8 A;  4HLE A;  4BY6 A;  4GZ5 A;  3ZHE A;  3T5X A;  3Q4A B;  4G25 A;  4HFG A;  2DIW A;  3EIQ C;  4I1O B;  2XRY A;  4GA0 A;  4OVV A;  4KZC A;  4IN3 B;  4R7L A;  2KCV A;  4KT6 B;  3B7T A;  3QWW A;  3L54 A;  4UWG A;  3MKQ B;  3DPD A;  5FWQ A;  4KZ0 A;  2XPZ A;  4L2L A;  3QK0 A;  4EZL A;  4KVO A;  3EIJ A;  3ZPJ A;  4ACK A;  5EX0 A;  4FC8 A;  3CVL A;  2GRM A;  2FUL A;  2JEK A;  3UPV A;  3LKU A;  2IOS A;  3PUK A;  3RIB A;  4EBA A;  4J8E A;  1MQS A;  3FTY A;  3MKQ A;  1TJC A;  2XPY A;  2IJG X;  3IHV A;  2AWI A;  5M72 A;  1VDY A;  3L08 A;  3CHR A;  5FZS A;  3CVV A;  1Y8M A;  3APC A;  3LXU X;  5LOZ A;  2VSN A;  2WXL A;  2XPI A;  4IRU A;  3TXM A;  4DPR A;  2L0T B;  5BT1 A;  3UMV A;  3SZ7 A;  3C98 A;  1KT0 A;  4UQZ A;  5G04 C;  5BUZ A;  5EDS A;  4U63 A;  4FAD A;  5CCL A;  3KD7 A;  4FUL A;  4XE0 A;  3PE3 A;  2ILR A;  1E7U A;  1KT1 A;  2X3M A;  4KYO B;  3VLD A;  5ARG A;  4JXT A;  4MRU A;  4B89 A;  2J4D A;  2WQH A;  1KLX A;  4UWF A;  5KJM A;  2WXH A;  2WM9 A;  1SZ9 A;  2E2E A;  4UQX A;  4G2V A;  3L16 A;  2KM4 A;  2CHZ A;  1Z3X A;  4HOR A;  3ZW3 A;  3FU6 A;  4GPK A;  3GYZ A;  4ATG A;  4BFR A;  4AVX A;  2WXN A;  3FP3 A;  3Q49 B;  3TL5 A;  4WWP A;  3JUI A;  4WWN A;  3LY7 A;  2VTB B;  2KZT B;  1ZU2 A;  4OYS A;  3QB2 A;  3TG4 A;  4F1S A;  4GYW A;  3CEQ A;  2WXK A;  4ILI A;  4UWH A;  5JJT A;  4YND A;  4RVB A;  1JWG A;  2PQN A;  4TRQ A;  3WXX A;  2OV8 A;  2XQ0 A;  3AS4 A;  3QJZ A;  4W9R A;  3RK6 A;  3IBE A;  3R9A B;  4C9B B;  1UJK A;  5AEN A;  5ANL A;  1TJF A;  2VTB A;  3SBT B;  4EQF A;  2IQC A;  2XHE A;  4Y6W A;  2AXZ A;  4DLO A;  5AYW D;  3FEX A;  4WNE A;  3D9O A;  4CT0 A;  2WPV A;  3CHP A;  1Z6T A;  4L1B A;  4UI9 K;  3PE4 A;  4I2W A;  2CFU A;  1HH8 A;  3SI5 A;  2QY7 A;  4I43 A;  4JPS A;  3CQG B;  4GZD A;  2FO7 A;  3NZU A;  4EBA G;  3EHM A;  4AP2 A;  2X6K A;  4XX5 A;  5C1D A;  4G11 A;  4AM9 A;  5DIZ A;  1FVF A;  3OAW A;  3CSF A;  3G2S A;  4BSX A;  1P5Q A;  3PNT B;  4BWR A;  5FQ8 A;  3PUJ A;  2OND A;  4KVM A;  5T3R A;  4U0Z A;  1OWO A;  1GW6 A;  4I1A A;  4GZC A;  3L13 A;  2X6H A;  1ZBP A;  4XI0 A;  1TEZ A;  2NSZ A;  2LSV A;  5G55 A;  1U3C A;  2V4L A;  1H19 A;  4I6G A;  2GGF A;  3FTV A;  3TXN A;  2XEV A;  3UUX A;  2PM6 A;  3TG5 A;  1ELW A;  1E8Z A;  4ME2 A;  2XRZ A;  3TAX A;  4GAA A;  3FUL A;  4NQ0 A;  4U0U A;  2YNQ A;  3FH7 A;  2OVB A;  3SHF A;  4ACL A;  3TGO A;  1NA0 A;  3D9N A;  2KC7 A;  4GB9 A;  3IHY A;  1INZ A;  4FA6 A;  5LCW J;  4YVO A;  4F53 A;  2YHC A;  3MJW A;  3FTZ A;  5ENN A;  2AVP A;  5A23 A;  3S7B A;  3RRU A;  1E90 A;  1OUV A;  2PQR A;  2WVI A;  2X6J A;  4PS7 A;  1FCH A;  1DNP A;  4V3I A;  3ASH A;  3MCX A;  4IYP A;  5CMY A;  1EPU A;  1OWP A;  2OVF A;  3LY9 A;  1HFA A;  4JHR A;  2X6I A;  5T8I A;  3PZD A;  3S7J A;  3RU0 A;  2J07 A;  2J9Q A;  3HHM A;  4B8C B;  3FUJ A;  4JVS A;  1B89 A;  4Q96 A;  4RSY A;  2WXG A;  4FU3 A;  3CR3 A;  2PM7 A;  3FU5 A;  3NQP A;  2CHW A;  3CK7 A;  4FJZ A;  5BV1 A;  2LNI A;  3SF4 A;  4AY5 A;  5JHB A;  4G24 A;  2C2L A;  1A17 A;  4BT8 A;  2IFU A;  3FUM A;  1WAO 1;  2AXU A;  3O4Z A;  3E4B A;  3UT8 A;  5JHA A;  4LEU A;  4J8D A;  3FY4 A;  4PS3 A;  4CGV A;  2X6F A;  1UJJ A;  3FDH A;  1IHG A;  4I9E A;  3CK9 A;  2J49 A;  4N2Q A;  4DK5 A;  3MGB A;  2I6H A;  3U66 A;  4EZJ A;  4I17 A;  3MA5 A;  3FUF A;  5FQ4 A;  3MEK A;  3CQC B;  5E76 A;  4BTA A;  3ASG A;  3I4G A;  5KJK A;  3UQ3 A;  3CVW A;  1QQE A;  3MV3 B;  3GZ2 A;  5FZQ A;  2FI7 A;  1HZ4 A;  3ZXS A;  4GZ3 A;  1PC2 A;  1S0P A;  4HOU A;  3APD A;  2MOW A;  3ULQ A;  2LO6 A;  3LEW A;  5LCW C;  3PDN A;  4BX8 A;  4EEC A;  2GRL A;  4XKC A;  2VSX E;  4GMJ A;  4L7T A;  5KCM A;  5KJN A;  1QZ2 A;  4G26 A;  4J8S A;  2WQ7 A;  1N52 A;  2C0L A;  3ZIM A;  4A55 A;  3QAQ A;  4NRH B;  5CCM A;  3ZRH A;  1SQM A;  3D9L A;  3PRZ A;  3L6A A;  4JEH A;  3LCA A;  3CVP A;  3RO3 A;  5CHE E;  5CMW A;  3MZL B;  4WND A;  3IV0 A;  3ONK A;  2WXO A;  4J0U A;  3CHS A;  4LER A;  1HE8 A;  5A7D B;  4Q69 A;  1IYG A;  4APO A;  4N2S A;  3HVE B;  4FJY A;  1LF8 A;  2YIN A;  3ESK A;  4JW1 A;  3FUK A;  4CGW A;  3GZS A;  4C0M A;  5G2N A;  3CHO A;  2FEZ A;  1Y6I A;  3PNL B;  3L22 A;  4GCN A;  3MKR A;  4UQY A;  4E85 A;  5JJ6 A;  2WXI A;  3ZYM A;  4O6F A;  5ARF A;  4A1G A;  3HYM B;  3UT7 A;  2E0I A;  4DI4 A;  4DI3 A;  4HXI A;  2IOL A;  5BW8 C;  4ABN A;  2EQX A;  3G2T A;  2Y3A A;  2XGS A;  3CKB A;  5BPP A;  4XIF A;  3LPZ A;  4ILG A;  4JHK A;  4URK A;  1NA3 A;  4GYY A;  4QFV A;  3ZYL A;  3PVL A;  2WQ6 A;  3D3M A;  1E7V A;  3CVU A;  3RRN B;  2KZT A;  2OOE A;  1IQR A;  2MRI A;  2WXF A;  3MYV A;  4UI9 J;  4B94 A;  4NUR A;  1SZA A;  5A6C A;  5LX8 A;  4HOT A;  5D0O D;  2WMO A;  4APF A;  2Y4T A;  4ANX A;  3JCK C;  2JLB A;  3LDZ A;  5EKQ D;  4I2Z A;  4CEM A;  3P1U A;  4ANU A;  1JPL A;  3D9M A;  3CST A;  2AXV A;  1JWF A;  4MLP A;  5J08 A;  1U3D A;  4U8H A;  5J90 A;  4I1M A;  2XCC A;  4GML A;  2V0P A;  1YA0 A;  4JZY A;  1ELK A;  3OXL A;  4KMO A;  3CLJ A;  3OXG A;  3IEG A;  1EDU A;  3ZFW A;  3FTU A;  3FFL A;  4AOF A;  3PRE A;  3QWP A;  4FHK A;  4AJW A;  2R5S A;  4L23 A;  3VTX A;  3HIZ A;  2VSY A;  1HG2 A;  1MHQ A;  4J8F A;  4U07 A;  2J4B A;  1HU3 A;  2WXP A;  2CG3 A;  3FHE A;  3HDX A;  2HM8 A;  3T8M A;  2WB2 A;  1E8X A;  1HX8 A;  3KAE A;  3ZEF A;  1JUQ A;  2J08 A;  4H7X A;  3FH8 A;  2BF0 X;  4F7A A;  3FTW A;  3FTS A;  3EJN A;  3QC1 A;  1UN8 A;  4PS8 A;  3CKC A;  1OWM A;  3FTX A;  3UX4 A;  4I9C A;  4G1T A;  3R7Q A;  2VGX B;  3CHQ A;  1IQU A;  1H6K A;  1HO8 A;  4U04 A;  4I6E A;  4UI9 C;  4BTB A;  4KXK B;  2BUG A;  4FP7 A;  2WXJ A;  2R59 A;  5HQ8 A;  3BG0 B;  3FUI A;  3Q47 B;  3ASF A;  4CT4 A;  3PEV B;  3URZ A;  2LSU A;  4AEZ C;  4GA2 A;  4HS2 A;  4LUN U;  2WMN A;  2KCL A;  3ZYQ A;  2VGX A;  3G2V A;  4FLH A;  1E96 B;  2LAH A;  1N54 A;  2WXM A;  3ZVV A;  4G23 A;  1L5J A;  5AJD A;  3ZN3 A;  4N39 A;  3FWV A;  4NAC A;  3Q5M A;  2M63 A;  2X38 A;  1DVP A;  4UWL A;  1H2U A;  2V5F A;  3ZGQ A;  2IU1 A;  3ML9 A;  1X5B A;  4FHJ A;  3FUN A;  4BT9 A;  2HO1 A;  3NZS A;  4PH4 B;  4N3B A;  2Q7F A;  3ESL A;  3U9W A;  1W3B A;  3CGH A;  5BNW A;  4ILH B;  3TJP A;  5LP0 A;  2AW6 A;  4ANW A;  5KJL A;  4XKB A;  1E8Y A;  5AJL A;  4H7Y A;  4RG6 A;  5FQ7 A;  3N71 A;  2I9C A;  4K0R A;  2L9B A;  2KCK A;  2Y4U A;  2BTD A;  3NF1 A;  1OWN A;  3GZ1 A;  3B13 A;  3QKY A;  4DLQ A;  3QAR A;  5AIJ A;  3U3W A;  3CV0 A;  2ZU6 B;  3LJ3 A;  3G2U A;  3T5V A;  3FU3 A;  2IF4 A;  4MS6 A;  3LVQ E;  3ENE A;  3LYA A;  4YVQ C;  4ANV A;  3PH0 C;  4N3A A;  4XI9 A;  4A3V A;  3MX3 A;  4WAF A;  4L2Y A;  4N3C A;  2NC9 A;  3LVR E;  4IUL A;  3QWV A;  4FLB A;  3D9J A;  2FBN A;  4HOS A;  4CCA A;  1HG5 A;  3ZYK A;  3I4R B;  3FEY A;  2GW1 A;  3IKO B;  2VGY A;  5FZR A;  3S7F A;  4TV3 A;  3D9P A;  3PEU B;  2C0M A;  2CFZ A;  3O48 A;  5C2Y A;  2RG8 A;  1XGW A;  3EHN A;  4N5C A;  2WXR A;  3SNX A;  1UW4 B;  1PAQ A;  4GA1 A;  3VLE A;  3RRM B;  3FUD A;  2P58 C;  4UWK A;  3QNK A;  3QDN A;  4K03 A;  4MKT A;  3FUE A;  2DCP A;  3HVE A;  4KBQ A;  1EYH A;  3VTY A;  4JA7 A;  2CHX A;  3AS8 A;  3B7R L;  2NXP A;  3RJV A;  2WXQ A;  4EZK A;  1WY6 A;  4GZ6 A;  4U0S A;  4AY6 A;  3Q15 A;  1QNF A;  3CVN A;  5BV0 A;  3AS5 A;  3ML8 A;  3U64 A;  4Q94 A;  3JYS A;  4PDX A;  5T4Y A;  5D0Q D;  5FQ6 A;  4GU5 A;  4CDM A;  4HVB A;  4JC8 A;  2MHK A;  4LCT A;  2V8S E;  3SFZ A;  1E8W A;  4WNG A;  5EX3 A;  4F3V A;  4PUC A;  5E75 A;  5G05 J;  3AU5 A;  4LRZ A;  3CK8 A;  3SGH A;  3AU4 A;  4EPZ A;  1WM5 A;  2YHE A;  4OVU A;  3BG1 B;  3EDT B;  3JQ0 A;  3R7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...