4I17A

Crystal structure of a tpr repeats protein (bf2334) from bacteroides fragilis nctc 9343 at 1.50 a resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
224
structure length
224
Chain Sequence
TTDPNQLKNEGNDALNAKNYAVAFEKYSEYLKLTNNQDSVTAYNCGVCADNIKKYKEAADYFDIAIKKNYNLANAYIGKSAAYRDMKNNQEYIATLTEGIKAVPGNATIEKLYAIYYLKEGQKFQQAGNIEKAEENYKHATDVTSKKWKTDALYSLGVLFYNNGADVLRKATPLASSNKEKYASEKAKADAAFKKAVDYLGEAVTLSPNRTEIKQMQDQVKAMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BF2334) from Bacteroides fragilis NCTC 9343 at 1.50 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
total genus 95
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2012-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i17A00
2XGMA 2PL2A 2VSYA 5M72A 3CK9A 4UI9C 3GZ2A 3MEKA 5DIZA 3QWVA 3UUXA 1HZ4A 2XCBA 4N2SA 3Q47B 3QKYA 3O48A 1B89A 4HOTA 1TJCA 4GCOA 4N3BA 3TGOA 1KT0A 2UY1A 3ASDA 2FBNA 3CEQA 3CVQA 4I17A 3UQ3A 2WPVA 4ABNA 5BNWA 4N5CA 1WAO1 3SF4A 4GA0A 3ZGQA 3FP3A 3GYZA 2VGXA 2Y4TA 3LYAA 3RKVA 5FZRA 3AS4A 2L6JA 3TG4A 3FWVA 4B94A 1W3BA 3RO3A 2PZIA 2NC9A 2FEZA 2R5SA 4Y6CA 3LKUA 2XEVA 4JL0A 3ZN3A 3ZHEA 1E96B 5KJMA 5HI7A 2IFUA 3NF1A 3PDNA 1IYGA 4WNFA 4UI9K 3CVPA 3QOUA 4UQXA 5G05J 4F3VA 4J0UA 4CGVA 5HQ8A 3KD7A 3IEGA 3U3WA 1ZBPA 3U4TA 2VGYA 2J9QA 4IN3B 2C2LA 2HYZA 3KAEA 5CHEE 2P58C 2C0LA 1NA3A 3K9IA 2IF4A 3MV3B 4U0SA 4YVOA 1QQEA 2PQRA 4GCNA 4RG6A 3TG5A 4EQFA 2KCVA 5BT1A 3QDNA 3CVNA 2LSUA 5EX0A 3JYSA 2Y4UA 3KS2A 1KLXA 3CKCA 4W9RA 4BT9A 4JHRA 3GZ1A 4WUYA 1ELRA 2FI7A 2YHCA 4Y6WA 2KCLA 5G05C 4A1SA 2VQ2A 4KXKB 4N3CA 4U0UA 3SZ7A 2UY1B 5KJLA 4GPKA 5EX3A 2KATA 2YQ8A 3CVLA 3UPVA 1Y8MA 3Q15A 3HYMB 3ZFWA 5BW8C 2XGOA 5FT9A 3CK7A 4U07A 3S7FA 2UWJG 3E4BA 1HH8A 4YVQC 2V5FA 1IHGA 4GA1A 2GW1A 5CCMA 5LCWC 2AVPA 3MV2B 3RU0A 4G24A 4G1TA 5ARGA 3N71A 5FJYA 4APOA 4BWRA 4BT8A 3RJVA 3VTYA 1KT1A 2WQHA 3ESKA 2XGSA 2XCCA 3GW4A 3PE3A 4G2VA 4GYYA 5A7DB 4U04A 3TAXA 1HXIA 2QFCA 5G04J 3WXXA 3ZPJA 4HOSA 2E2EA 3ASFA 3CV0A 4GZ6A 4CDRA 5JJTA 5A6CA 2KCKA 4CGWA 1FCHA 4J8EA 4G25A 4JA9A 4HORA 4GYOA 2DBAA 1A17A 3ASHA 1WM5A 1YA0A 2HO1A 3CK8A 4XI9A 1XNFA 5JJ6A 1ELWA 4GYWA 4GZ3A 4H7XA 3S7BA 5KJKA 4AY6A 4AM9A 1P5QA 3AS8A 3FFLA 4HOUA 1NA0A 3CKBA 2FF4A 4J8DA 4J8FA 4WNEA 2PQNA 5FZSA 3RIBA 3VTXA 4AY5A 3QWWA 3OXGA 4GA2A 4N3AA 4NQ0A 3LY7A 5FTPA 3URZA 4U0ZA 2C0MA 3LPZA 2VYIA 1ZU2A 5G04C 2JLBA 4I1AA 4O6FA 2KC7A 4UQYA 4HOQA 3LCAA 4RG9A 5DBKA 4YNDA 5AYWD 3OXLA 1PC2A 4KBQA 2BUGA 4I2WA 4LEUA 4UQZA 5EKQD 4XIFA 4BTBA 4G26A 5CCLA 5KJNA 5JJ7A 2VSNA 4UI9J 4ME2A 3AS5A 2ONDA 4KYOB 3ZHEB 4JA7A 4NRHB 3EDTB 4N39A 4I2ZA 4XI0A 3ULQA 4N2QA 3BEEA 3OXFA 5D0QD 4AIFA 3LY9A 2I6HA 4G23A 3ASGA 5C1DA 4H7YA 4BTAA 3Q4AB 5D0OD 3RO2A 3MKRA 3S7DA 3S7JA 4GZ5A 3Q49B 5LCWJ 1NZNA 2MHKA 3MA5A 2VGXB 2XPIA 3QWPA 4I9EA 5FZQA 2LSVA 2FO7A 3R9AB 3LY8A 2OOEA 4WNDA 2LNIA 1OUVA 4I9CA 1QZ2A 5ARFA 2Q7FA 3PE4A 3Q5MA 4WNGA 2HR2A
chains in the Genus database with same CATH superfamily
2IO2C 1OCCE 3CQCB 3PUKA 4Z68A 4GTQA 3CHQA 3FUHA 1MZCA 3DXKG 1W3BA 3QAQA 2F8XK 4DX5D 2WM9A 2V0PA 1IQRA 3L54A 1JPLA 4FLBA 2J9QA 2KXPC 4ILGA 1NA3A 1MX4A 1Z6TA 3CVNA 2BEDA 3CLJA 3VLFA 4JC8A 2UY1B 5FT9A 3CK7A 4BESA 5ENOD 1HH8A 2M63A 2WMOA 3JQ1A 4A55A 1S64A 5CERB 1FPPA 1MYOA 3AU4A 2FULA 1GW6A 3RJVA 2B0OE 2I1KA 2XEHA 4IYPA 4CGWA 1FCHA 3TWRA 3D9MA 4XE0A 2PNNA 2VYIA 1H2VC 1E8YA 1OT8A 4HOQA 3FU0A 4CRWA 3CVWA 4DK5A 3ZHEB 4NRHB 3C5RA 3Q4AB 4GZDA 2OEVA 3Q49B 2A5EA 2LNIA 2GROB 2J4BA 5KCMA 3ZYMA 2R17C 4F53A 3TWWA 4U96D 3B7RL 4JW1A 1WAO1 3L82A 3ZVVA 2R5SA 3G2VA 4HRLA 2IEJA 1IYGA 4FC8A 1SW6A 5CHEE 1BI8B 3BG0B 4U0SA 3FUNA 2Y1LE 1BD8A 2XS1A 3ZIMA 2XZDG 2Y4UA 3SI5A 1SA4A 3PZ1A 3UXGA 5AARA 4APFA 2B6CA 4ILIA 2OCCE 4U07A 2F37A 4TUUA 4UWKA 5ENNA 4CCAA 5AJLA 2DZOA 4GYYA 2X6JA 2KM4A 1MX2A 4BFRA 1YA0A 1HG2A 4J8FA 1O1TA 3ZYLA 2ZIRA 4P29A 4RG9A 5AQAA 5JJ7A 3QARA 3V79K 4ANUA 1O5MA 1N54A 3CSFA 3HHMA 1HFAA 4XI0A 5FINA 1LTXA 5C1DA 5C2YA 3LS8A 2L0IA 2NXPA 2OEWA 1NZNA 3SFXA 4B8AA 1TNUA 1N4SA 1YMPA 4MBGA 3DSWA 1IHBA 5BXOA 2KZTB 3V2XA 3D9IA 2XQ0A 3GZ2A 4FA6A 3R9MA 3KSLA 3SF4A 1UG3A 4I43A 4A63B 5FZRA 3OAWA 4GAAA 4B8CB 2FEZA 1HU3A 5ITZF 3DEPA 3NF1A 4UI9K 2WQ6A 4MLPA 3U64A 3KD7A 3CSTA 3IEGA 2C0LA 3QJZA 2H6GA 4RG6A 3UI2A 4LG6A 1TN6A 2KCLA 3V2OA 4K5BA 1BLXB 3HG0D 4TUMA 1AP7A 3R7QA 3CGHA 3JQ0A 3TXNA 3B7SA 2I9CA 4EZLA 5AN8A 3O4ZA 4BWRA 3SFZA 4U04A 3SNXA 3TWVA 3UT8A 5B1BE 2XPYA 3B7BA 2DBAA 3D9LA 1WG0A 5JJ6A 1ELWA 4FJZA 4PDXA 3E34A 3AS8A 1OWOA 3PNTB 1IQUA 5CEDB 3T9KA 2PM6A 4UQYA 1BI7B 3LVRE 1K1BA 4KBQA 1S70B 4LERA 2GRRB 4O1OA 4GZCA 1SZ9A 4EZJA 3APFA 3EDTB 4N2QA 1ELKA 2BTDA 1PY1A 2LSVA 4R7LA 4CT0A 4EBAG 4WNDA 3TJPA 1JCRA 3FUEA 4CZ2D 2Y69E 4U8VD 3ZRHA 3UUXA 2XCBA 2V4HC 2WXHA 3Q47B 3BUAA 3D9OA 4HS2A 2YNQA 4GCOA 3DSVA 3UQ3A 3Q75A 3TL5A 4J7WA 3IBEA 2PZIA 5EYLA 3ZN3A 3FDHA 3ZKJA 4DX7D 3UIOC 4U8YD 3UKRG 4OVUA 3ML9A 3ABLE 1D8DA 2OV8A 2ILRA 3FU3A 4GCNA 3LJ3A 2MRIA 3EU9A 3TWXA 1KLXA 3PVLA 5EN5D 4DX2A 4GPKA 4L2LA 3LDZA 2XGOA 3PRZA 2IU1A 1Z3XA 2UWJG 1IHGA 4NIKA 3MV2B 2BF0X 3KEZA 5FJYA 4LNGA 2DZNA 3VTYA 3S2AA 4G2VA 1X81A 4N5QA 3ASFA 4QQIA 4RLYA 3ZNGA 5JJTA 4HNAD 4JXTA 3T8KA 3Q7FA 4O1PA 3CK8A 4GYWA 4GZ3A 4AM9A 4PH4B 2CHWA 2PQNA 4BY6A 3DSSA 1OWPA 1PC2A 1N0RA 4G26A 2LUHA 4C9BB 3EIJA 3MA5A 1JWGA 4DPRA 2J4DA 4B93B 2P9KG 1SQMA 4UWGA 4J8SA 3GZSA 3W9GA 3MCXA 4OAVB 3ENEA 4V3IA 3L22A 4HRNA 3CEQA 1MX6A 4N5CA 4KVOA 3FWVA 4ZHBA 3UKUG 5AENA 2ZGGA 4L1BA 3SO8A 1X5BA 3FULA 4J0UA 5HQ8A 3JXIA 1FVFA 2C2LA 3KAEA 3K9IA 1K1AA 2L9BA 4M3OA 4EBAA 3ABKE 3GZ1A 1A5EA 3D9PA 2LAHA 3EUVA 1H2UA 2IOLA 5EX3A 2AW6A 1TN8A 5BW8C 3ZFWA 4WAFA 3RRNB 3G2UA 5H7PA 4JHJA 5CCMA 1UOHA 1DVPA 5ENTD 4CT4A 3RRMB 2DCPA 2I2OA 5B1AE 3FUFA 5BPPA 4JA9A 3ONLA 3HDXA 1EF1C 1JCSA 4QFVA 4AY5A 2F0YA 2C0MA 3NB2A 1UN8A 2L0TB 4BTBA 5KJNA 3L16A 4DX1A 1UW4B 1NL4A 4G8LA 4JA7A 3BQOA 2Y0BG 3JUIA 3UT7A 2IQCA 3C3RA 2J8SD 1Y6IA 3PE4A 3Q5MA 1V54E 1OXJA 5T3RA 2XRYA 4LUNU 4HLLA 2IY0C 3SGHA 1KT0A 3ASDA 2R03A 3R7RA 3ZGQA 3EJNA 2VGXA 4B94A 3B7UX 3FH5A 4DRXE 4L23A 4WWOA 3HXFA 1OWLA 3DPYA 4I6EA 3D9NA 5ENSD 2IF4A 2QZAA 2LSUA 3ZXPA 4JHRA 3G2TA 3CVXA 4AEZC 3Q9UC 2WXJA 1JWFA 2VSOE 4OYSA 3NAWA 2KZTA 2NSZA 4BT8A 3IXEA 3ESKA 2AWIA 2WXLA 4G11A 4PS7A 5A7DB 4CDNA 4DX6D 2ZXWE 2LO6A 1D9SA 1OCRE 3ASHA 1XNFA 3NOCD 3ONKA 3PH0C 4HOUA 4DLOA 3NZUA 4BERA 2X38A 3P2BA 3CQGB 4WWPA 2WXNA 4FLHA 3UM1A 5KBAA 2HM8A 4BSXA 4DJAA 1H2TC 3D9KA 2GRLA 3TWQA 3OXFA 4AIFA 2EILE 2I6HA 2RD0A 5D0OD 2CG2A 1OWMA 2XPIA 4Q96A 4JEHA 1OUVA 1V55E 2DIWA 3Q7AA 3EIQC 5ENQD 5KWDA 2FO1E 4KZ0A 5JHAA 3AG4E 4CDMA 4N3BA 4BSZB 5CBOA 2LXMA 4ATZD 3FUDA 3PS6A 2J49A 3FHEA 2IONA 1N9AA 2XHEA 4XEIG 3PZ4A 1MQSA 3SBTB 1AWCB 3C72A 3HXEA 2P9PG 4JD2G 2VQ2A 4RSYA 3U66A 4MS6A 2RFAA 5CBNA 1TNOA 2YQ8A 3Q15A 2MOWA 4FHKA 1G3NB 4JPSA 2J09A 4G24A 4G1TA 2JABA 3I5PA 3CHMA 3PE3A 2P9NG 3CHRA 3ZPJA 4UWHA 2X6FA 4GYOA 4JZYA 2QC9A 1P5QA 1NA0A 4WNEA 5FTPA 2CFZA 5G04C 4C48B 2WXIA 3C3OA 1EPUA 4K0RA 4AVXA 5CRVA 2WXFA 3ISMC 3ASGA 1LD8A 4FADA 3RO2A 3C98A 3CVUA 3FTSA 4I9EA 4YDWA 4K5AB 1Z5SC 3NQPA 3JCKC 3WG7E 2WMNA 4HQDA 2ZISA 3QKYA 3O48A 3NOGD 3IKOB 5E76A 3FTYA 2UY1A 4I17A 1N95A 5BNWA 1YCSB 2EINE 2NC9A 4ATGA 1HE8A 1OCZE 3PNLB 4UUCA 4U7EB 4HXIA 1RW2A 1HF8A 3MV3B 4M7CA 4URKA 4YDYA 3AAAC 3QB2A 3KS2A 3X2QE 2QY7A 5BV1A 4A1SA 1N0QA 3L17A 5KJLA 2KATA 5KNHD 4E6HA 4NURA 2H6HA 1TR4A 2V8SE 1U3DA 3L6AA 4ZFHA 5M72A 5CMYA 5A6CA 3PZ2A 2KCKA 1JUQA 3CVVA 4A3VA 3FUJA 5FQ8A 3D3MA 5KJKA 4X8QA 5ANRA 4GMJA 3UT4A 4U8HA 2R02A 5JMND 3C3QA 4XIFA 1TYQG 3NZSA 3AU5A 3ULQA 3RSEG 5D0QD 3LY9A 5HS0A 4HVBA 2BKGA 3S7JA 2QYUA 4O60A 1Z3YA 2ZU6B 2OOEA 3G2SA 5ARFA 3QOUA 2AXVA 4G8KA 1HZ4A 4I1OB 4HOTA 1HS6A 2LXLA 4C0EA 4XZ4A 4EPZA 5EDSA 4B89A 3TWTA 2L6JA 5HRYA 4LRZA 3SFYA 1VDYA 2X6KA 3ZHEA 1FVHA 3PDNA 4HI9A 5EILA 1UJKA 1YYHA 1DNPA 2Y3AA 3ZU7B 2NYJA 4I6JA 1N94A 4IULA 3EU5A 4UWFA 1DCEA 4BT9A 3FTUA 2VSXE 3HXDA 1EYHA 5A23A 2DVWA 2AVPA 5ARGA 2GGFA 2XCCA 1HXIA 4J8EA 4G25A 4GTTA 1K3ZD 4N2SA 4H7XA 3Q9NC 3JUEA 4FJYA 4J8DA 1SA5A 3LPZA 4OAUC 2VTBB 3VLEA 4ABNA 3I3NA 2EIJE 4UI9J 4ME2A 3AS5A 1TN7A 3B95A 4Q69A 4KMOA 2H6FA 3R9AB 3P1UA 4C0MA 3PEUB 1JCQA 4TV3A 3FUMA 1HX8A 3CK9A 3MEKA 5DIZA 3ULYA 5LX8A 3TGOA 3CVQA 1WY6A 2IJGX 1H0AA 4B0ZA 3UTMA 3IHVA 4TXPA 4JL0A 4BEPA 3AJIA 3CVPA 4UQXA 1N52A 5CECB 1TNBA 3HVEB 4HFGA 2RG8A 1SVXA 2PQRA 3PZDA 2KCVA 3MYVA 5G05C 2KBXA 5FQ4A 1E8XA 1QNFA 1KPSB 4XKBA 2CFUA 1O1RA 2WB2A 3UM3A 2ZGDA 4DI3A 3EHRA 4KVMA 3WXXA 3MZLB 4U95D 5J08A 1OY3D 4HORA 1N4RA 3MKQA 2XPZA 2XENA 2WXPA 4AY6A 4L2YA 3G2WA 4JEUA 2GRQB 2JLBA 3UM0A 5ENPD 2P9SG 2ONDA 2XS8A 2WXMA 3BEEA 3SHFA 1LF8A 4GTOA 3MKRA 4GZ5A 2FO7A 4XKCA 2PL2A 4WWNA 3UIPC 4YDOA 1O1SA 3DSUA 3FP3A 2Y4TA 4HBDA 4Y6CA 2XEVA 5T4YA 3RK6A 4AOFA 2VGEA 1OWNA 4WNFA 4AXHA 4D10C 3U3WA 2R05A 2VGYA 2P58C 3UINC 1QQEA 2WXOA 3QDNA 2P9LG 4FULA 3ZXSA 3CKCA 4W9RA 4OVVA 4F6RD 3EHQA 1TNYA 4GA1A 3TWUA 3EHMA 2V4LA 3ASNE 1E90A 3FTWA 3APDA 2CHZA 4YDEA 5G55A 3EHNA 2WXQA 2XEEA 3CKBA 3RIBA 3UM2A 3E33A 4L7TA 2OVBA 3L13A 3HXBA 4J8YA 2E0IA 3LEWA 5ENRD 2BUGA 4I2WA 4PS3A 1TJFA 1IKND 3T5XA 2WVIA 4MKTA 3L08A 5G2NA 5E75A 3W9FA 5FZQA 4GMRA 1SZAA 1U3CA 3V31A 2XGMA 3ZW3A 4ANXA 4UI9C 1H6KA 5LFAA 1H6OA 2FBNA 1BU9A 2WPVA 2R2LA 3CIAA 3RKVA 3ZUVB 2X6HA 3TG4A 5HI7A 1S63A 2AXUA 2IOSA 4CGVA 3IV0A 2EQXA 4TRQA 2YINA 3T5VA 4IN3B 2PM7A 1TNZA 4ACLA 1E7UA 1QYMA 3E37A 1U2VG 2X6IA 4WUYA 3MKQB 1QBQA 3UX4A 1FT1A 3F6QA 3SY2A 5LCWC 3KSQA 1L5JA 1EDUA 3SD5A 1KT1A 2BKKB 2RKKA 2E2EA 3CV0A 4EECA 3PEVB 1H6PA 2ETBA 1INZA 3PZ3A 3HIZA 4GTRA 3VTXA 3ZYQA 3QWWA 2RFMA 4JHKA 3FEYA 5AYWD 1H19A 3OXLA 3CHPA 5CCLA 1HG5A 3AG1E 3FTZA 5EYPF 5AIJA 3CVYA 4G23A 2WXGA 4BX9A 2WXRA 3LY8A 1E8ZA 1WDYA 3NBNB 1QZ2A 3SBSA 2VSYA 3PUJA 3I4GA 5CMWA 3FUIA 3DSTA 3QWVA 1KZOA 5AAOA 1TJCA 3AG2E 3CR3A 4I6GA 4GA0A 3GYZA 4GTVA 4LSZE 3LKUA 3J5QB 5FWQA 4HRMB 2X3MA 4JB8P 4F3VA 2CHXA 2WQ7A 1BPOA 3U4TA 4I1MA 2A4ZA 3DXMG 2VTBA 5FQ7A 4EQFA 3JYSA 3Q79A 1ELRA 4KXKB 4GTPA 4AP2A 3SZ7A 4DLQA 3CVLA 2JEKA 3FY4A 3BU8A 3E4BA 3FH8A 5EIBE 1RZ4A 3BG1B 3N71A 3TAXA 5G04J 4HOSA 1N11A 3FH7A 5JHBA 1S0PA 5CEAA 3S7BA 2I1JA 2FF4A 5FZSA 4F1PA 4N3AA 1HO8A 1ZU2A 5B3SE 2P9IG 4ACKA 3LVQE 2QYJA 4JVSA 5LOZA 4KYOB 3J5PA 4N39A 3DRAA 2HE0A 4BTAA 4K5CA 5LCWJ 3DEOA 3QWPA 3V30A 4I9CA 2LAIA 4FP7A 4MRUA 3DWLG 5EIDA 4TXQA 2WXKA 4EZKA 3Q73A 5LP0A 2F8YA 2AJAA 5KJMA 4PUCA 2CG3A 1MJ0A 3PREA 5AQ9A 1ZBPA 2YHEA 3TWSA 3HVEA 4YVOA 3UMVA 5EX0A 5FIOA 3FU5A 4BX8A 1KZPA 3D9JA 4AJWA 4A3TA 4XX5A 1NI1A 2EIKE 3DPDA 3QNKA 3CHOA 1K8KG 2GW1A 2XRZA 2P2CP 4CDRA 4GMLA 4EHMA 4GTMA 1A17A 4XI9A 4GPMA 1PAQA 4ANVA 1N4PA 1D8EA 5CRUA 3FU6A 5DBKA 4UQZA 3HRAA 4FU3A 5JA4D 2L6BA 4J6IA 3CHSA 1DC2A 4TXRA 4IRUA 1NP7A 3TXMA 4Q94A 2MHKA 2EIME 3MX3A 4HB5A 4HLEA 3ESLA 4FHJA 1MHQA 4PS8A 2A5UA 2P9UG 5D66A 1LD7A 1FT2A 5BUZA 3L9TA 3JXJA 3KEAA 3LYAA 2DYSE 3ULEG 4F1SA 3FUKA 3Q78A 2IFUA 3ASOE 3MJWA 2IO3C 4ANWA 4GTSA 4LCTA 3AG3E 5KNGA 5BT1A 2FI7A 4Y6WA 2AXZA 4F7AA 3ZEFA 3UPVA 1N4QA 1NFIE 3HYMB 1Q2ZA 2V5FA 3E32A 2XZTG 3B13A 3RU0A 5AQ7A 2J08A 1UN9A 2WQHA 2XGSA 3GW4A 3B7TA 3APCA 2QFCA 3HXCA 3RRUA 4GZ6A 5AQBA 1DCQA 1WM5A 2HO1A 2GRPB 3ABME 3LY7A 3LXUX 4U0ZA 4BETA 3ZYKA 4K03A 4I1AA 4O6FA 3SQVA 3QC1A 4YNDA 2VSNA 2GRNB 4A1GA 4DUIA 3FEXA 1E8WA 2V5QC 3ML8A 3S7DA 4RVBA 3D9HA 3FTVA 2DWZA 4RQIA 2HR2A 5FQ6A 2OVFA 1B89A 4U63A 5AJDA 3QK0A 3DBSA 5IY5E 3AS4A 3RO3A 3U9WA 3VLDA 4AV7A 1E96B 4DI4A 5G05J 5BV0A 2DYRE 4KZCA 2ETAA 3MGBA 2HYZA 4ILHB 3TG5A 3OTNA 4E85A 1TEZA 2YHCA 4N3CA 4U0UA 4L9PA 1ZB1A 2VJ8A 2MYOA 1OCOE 1XGWA 1Y8MA 5BXUA 4GB9A 3S7FA 3RAUA 5HKPA 4LNBA 4YVQC 3E30A 2GRMA 4APOA 2R59A 3DSXA 4CYMD 2J07A 4LNUD 3T8MA 1UJJA 3I4RB 4UWLA 2ETCA 1E7VA 3FFLA 3OXGA 4GA2A 5J90A 4NQ0A 3URZA 4HI8A 5ANLA 4GU5A 2KC7A 3LCAA 4CEMA 4LEUA 5EKQD 5D2MC 1IXVA 3FTXA 3IHYA 4I2ZA 4KT6B 4NACA 4H7YA 3LJNA 2VGXB 5T8IA 2Q7FA 4WNGA 2H6IA
chains in the Genus database with same CATH topology
2AXVA 3GZSA 3SBSA 2VSYA 3MCXA 3PUJA 3I4GA 5CMWA 3FUIA 3QWVA 1HZ4A 3PUKA 3CQCB 3ENEA 4I1OB 4V3IA 3L22A 4HOTA 1HS6A 1TJCA 4C0EA 3CEQA 4XZ4A 4EPZA 3CR3A 4N5CA 4I6GA 5EDSA 4GA0A 3CHQA 4KVOA 4B89A 3FUHA 3GYZA 2L6JA 3FWVA 4LRZA 1W3BA 3QAQA 1VDYA 3LKUA 2X6KA 2WM9A 5FWQA 3ZHEA 5AENA 4L1BA 2V0PA 1FVHA 2X3MA 3PDNA 1IQRA 1X5BA 4F3VA 3L54A 2CHXA 3FULA 4J0UA 5HQ8A 1UJKA 2WQ7A 1JPLA 4FLBA 1BPOA 1DNPA 3U4TA 1FVFA 2J9QA 2C2LA 3KAEA 4ILGA 1NA3A 3K9IA 2Y3AA 4I1MA 2A4ZA 1Z6TA 2VTBA 5FQ7A 4EQFA 2L9BA 4M3OA 3CVNA 4EBAA 3CLJA 4I6JA 3JYSA 4IULA 4UWFA 4BT9A 3GZ1A 3VLFA 1ELRA 3FTUA 4JC8A 4KXKB 3D9PA 2LAHA 4AP2A 3SZ7A 2UY1B 2VSXE 4DLQA 1H2UA 2IOLA 5EX3A 3CVLA 2JEKA 2AW6A 1EYHA 3FY4A 3ZFWA 5BW8C 4WAFA 5FT9A 3RRNB 3CK7A 5A23A 3E4BA 3G2UA 1HH8A 2M63A 2WMOA 3JQ1A 4JHJA 3FH8A 4A55A 5CCMA 2AVPA 3AU4A 2FULA 3BG1B 5ARGA 3N71A 1GW6A 2GGFA 3RJVA 1DVPA 4CT4A 2I1KA 2XCCA 3TAXA 1HXIA 5G04J 4HOSA 3RRMB 2DCPA 4IYPA 3FH7A 5JHBA 2I2OA 3FUFA 4CGWA 1FCHA 5BPPA 4J8EA 4G25A 4JA9A 1S0PA 3D9MA 3ONLA 4N2SA 3S7BA 4H7XA 3HDXA 1EF1C 2I1JA 4FJYA 4J8DA 2FF4A 4XE0A 4QFVA 5FZSA 4AY5A 4N3AA 2C0MA 3LPZA 1HO8A 2VYIA 1UN8A 1H2VC 1ZU2A 1E8YA 2VTBB 4ACKA 4HOQA 3VLEA 2L0TB 4ABNA 3LVQE 4BTBA 3FU0A 5KJNA 3L16A 4CRWA 3I3NA 4JVSA 1UW4B 3CVWA 4UI9J 4ME2A 3AS5A 5LOZA 4KYOB 3ZHEB 4DK5A 4JA7A 4NRHB 4N39A 4BTAA 3Q4AB 4GZDA 4Q69A 3Q49B 5LCWJ 3JUIA 3UT7A 4KMOA 2IQCA 3QWPA 3R9AB 3P1UA 1Y6IA 2LNIA 4C0MA 3PEUB 4I9CA 2J4BA 3PE4A 3Q5MA 4TV3A 2LAIA 3FUMA 5T3RA 1HX8A 3CK9A 3MEKA 5DIZA 5KCMA 2XRYA 4LUNU 3ZYMA 4FP7A 2R17C 4MRUA 5LX8A 4F53A 3SGHA 3TGOA 1KT0A 3ASDA 3B7RL 3CVQA 4JW1A 1WY6A 1WAO1 1H0AA 2IJGX 3R7RA 2WXKA 3EJNA 3ZGQA 2VGXA 4B94A 4EZKA 3B7UX 3FH5A 4B0ZA 5LP0A 3ZVVA 2R5SA 3IHVA 4L23A 4JL0A 4WWOA 1OWLA 5KJMA 3G2VA 4I6EA 1IYGA 4FC8A 4PUCA 3CVPA 4UQXA 3D9NA 2CG3A 3PREA 1N52A 1ZBPA 2YHEA 3HVEB 5CHEE 4HFGA 3BG0B 2IF4A 2RG8A 3HVEA 4U0SA 3FUNA 4YVOA 2PQRA 3PZDA 3UMVA 2KCVA 3ZIMA 2LSUA 5EX0A 2Y4UA 3SI5A 4JHRA 3MYVA 3G2TA 3FU5A 5G05C 4BX8A 5FQ4A 3CVXA 1E8XA 4AEZC 4APFA 3D9JA 1QNFA 4AJWA 4XKBA 4A3TA 4ILIA 2CFUA 4XX5A 3DPDA 2WXJA 1JWFA 2VSOE 3QNKA 2WB2A 3CHOA 4U07A 4OYSA 4TUUA 2GW1A 4DI3A 4UWKA 4KVMA 5ENNA 4CCAA 5AJLA 2XRZA 2KZTA 2NSZA 4BT8A 3ESKA 4GYYA 2AWIA 2WXLA 4G11A 4PS7A 5A7DB 3MZLB 3WXXA 4CDNA 5J08A 2X6JA 4CDRA 2KM4A 4GMLA 2LO6A 4HORA 1A17A 3ASHA 4BFRA 1YA0A 3MKQA 2XPZA 4XI9A 1XNFA 2WXPA 1HG2A 4AY6A 3ONKA 3PH0C 4HOUA 4L2YA 1PAQA 3NZUA 4J8FA 4DLOA 4ANVA 3G2WA 3ZYLA 2X38A 3P2BA 4JEUA 3CQGB 4WWPA 2JLBA 2WXNA 3FU6A 4FLHA 4P29A 4RG9A 5DBKA 4UQZA 2HM8A 4FU3A 5JJ7A 3QARA 4ANUA 4J6IA 2ONDA 4BSXA 4DJAA 1N54A 1H2TC 3CSFA 3D9KA 1HFAA 2GRLA 3CHSA 3HHMA 4XI0A 2WXMA 3BEEA 3OXFA 4IRUA 4AIFA 1NP7A 3SHFA 2I6HA 3TXMA 5C1DA 2RD0A 5C2YA 1LF8A 3LS8A 2L0IA 5D0OD 2CG2A 2NXPA 3MKRA 4Q94A 4GZ5A 1NZNA 1OWMA 2MHKA 2XPIA 4Q96A 4B8AA 2FO7A 4JEHA 1OUVA 3MX3A 4XKCA 4HLEA 2DIWA 2KZTB 3ESLA 4FHJA 3EIQC 2PL2A 4WWNA 1MHQA 4PS8A 3D9IA 2A5UA 2XQ0A 3GZ2A 4FA6A 4KZ0A 5JHAA 5BUZA 4CDMA 4N3BA 3SF4A 1UG3A 3FP3A 3LYAA 2Y4TA 4I43A 3FUDA 5FZRA 4F1SA 3OAWA 3PS6A 2J49A 4GAAA 4B8CB 2FEZA 3FHEA 3FUKA 4Y6CA 2XEVA 1HU3A 2IONA 5T4YA 3RK6A 4AOFA 1OWNA 2IFUA 3NF1A 4WNFA 4UI9K 2WQ6A 4MLPA 3U64A 2XHEA 3MJWA 4AXHA 3KD7A 3CSTA 3IEGA 4D10C 3U3WA 1MQSA 3SBTB 2VGYA 4ANWA 2P58C 2C0LA 3QJZA 4LCTA 1QQEA 4RG6A 2WXOA 5BT1A 3QDNA 4FULA 3ZXSA 3CKCA 4W9RA 2FI7A 4Y6WA 2KCLA 3U66A 2VQ2A 4RSYA 2AXZA 4MS6A 4F7AA 4OVVA 2YQ8A 3ZEFA 3UPVA 3R7QA 3Q15A 3HYMB 2MOWA 4FHKA 3CGHA 3JQ0A 2V5FA 4GA1A 4JPSA 3TXNA 3B13A 3B7SA 3RU0A 2I9CA 2J09A 4EZLA 4G24A 4G1TA 2J08A 3O4ZA 1UN9A 4BWRA 3EHMA 3CHMA 2V4LA 2WQHA 3I5PA 2XGSA 3GW4A 3PE3A 3SFZA 3B7TA 3CHRA 3APCA 2QFCA 4U04A 3ZPJA 1E90A 3FTWA 3APDA 3SNXA 3RRUA 2CHZA 4GZ6A 3UT8A 4UWHA 2XPYA 2X6FA 4GYOA 2DBAA 3D9LA 1WM5A 2HO1A 5G55A 3EHNA 5JJ6A 2WXQA 1ELWA 4FJZA 4JZYA 4PDXA 1P5QA 3AS8A 1OWOA 1NA0A 3CKBA 4WNEA 3RIBA 4L7TA 2OVBA 5FTPA 3L13A 2CFZA 3LY7A 3LXUX 4U0ZA 3PNTB 1IQUA 2E0IA 5G04C 4K03A 2PM6A 4I1AA 4O6FA 4UQYA 3ZYKA 3LEWA 2WXIA 3LVRE 3QC1A 4YNDA 4KBQA 2BUGA 4I2WA 1EPUA 4PS3A 4K0RA 4LERA 4GZCA 1TJFA 2VSNA 3T5XA 1SZ9A 4EZJA 3APFA 4A1GA 2WVIA 3EDTB 4MKTA 3FEXA 1E8WA 3L08A 4N2QA 4AVXA 5G2NA 2WXFA 1ELKA 3ASGA 4FADA 5E75A 3RO2A 3ML8A 3C98A 3S7DA 2BTDA 3CVUA 4RVBA 3FTSA 4I9EA 5FZQA 1PY1A 2LSVA 4R7LA 4CT0A 4EBAG 4WNDA 3FTVA 3TJPA 1SZAA 1U3CA 3FUEA 3NQPA 3JCKC 2HR2A 2WMNA 2XGMA 3ZW3A 3ZRHA 4ANXA 4UI9C 3UUXA 2XCBA 2WXHA 3Q47B 5FQ6A 2OVFA 3QKYA 3D9OA 3O48A 4HS2A 1H6KA 2YNQA 1B89A 4U63A 4GCOA 5LFAA 3IKOB 5AJDA 3FTYA 5E76A 2UY1A 4I17A 2FBNA 3UQ3A 3QK0A 5BNWA 2WPVA 3TL5A 3CIAA 3DBSA 3RKVA 2X6HA 3AS4A 3IBEA 3TG4A 3RO3A 2PZIA 3U9WA 3VLDA 2NC9A 4AV7A 3ZN3A 4ATGA 1E96B 3FDHA 4DI4A 5HI7A 1HE8A 5G05J 3PNLB 2AXUA 2IOSA 4CGVA 3IV0A 5BV0A 2EQXA 4KZCA 4OVUA 4TRQA 2YINA 3ML9A 4HXIA 3T5VA 3MGBA 4IN3B 2HYZA 4ILHB 2ILRA 2OV8A 1HF8A 3MV3B 4URKA 3FU3A 4GCNA 3TG5A 3LJ3A 3OTNA 2PM7A 4E85A 2MRIA 3QB2A 3KS2A 1KLXA 1E7UA 4ACLA 2QY7A 1TEZA 5BV1A 3PVLA 2X6IA 2YHCA 4WUYA 4A1SA 4N3CA 4U0UA 3MKQB 3L17A 5KJLA 2VJ8A 4GPKA 4L2LA 2KATA 1XGWA 1Y8MA 3UX4A 3LDZA 2XGOA 3PRZA 4GB9A 2IU1A 3S7FA 1Z3XA 2UWJG 4E6HA 4YVQC 4NURA 1IHGA 5LCWC 1L5JA 2GRMA 3MV2B 1EDUA 2BF0X 2V8SE 2R59A 3KEZA 1U3DA 5FJYA 4APOA 3SD5A 3L6AA 3VTYA 1KT1A 3S2AA 4G2VA 5M72A 5CMYA 2E2EA 3ASFA 3CV0A 2J07A 5JJTA 5A6CA 3T8MA 1UJJA 2KCKA 3I4RB 4JXTA 4EECA 4UWLA 1JUQA 3PEVB 1E7VA 3CVVA 3CK8A 4A3VA 1INZA 3FUJA 4GZ3A 4GYWA 5FQ8A 3D3MA 4AM9A 3HIZA 5KJKA 3FFLA 4PH4B 2CHWA 2PQNA 4BY6A 5ANRA 3VTXA 3ZYQA 3QWWA 3OXGA 4GA2A 5J90A 4NQ0A 4GMJA 3URZA 5ANLA 3UT4A 4JHKA 4GU5A 2KC7A 4U8HA 3FEYA 3LCAA 5AYWD 1H19A 4CEMA 3OXLA 1OWPA 1PC2A 4LEUA 3CHPA 1HG5A 5EKQD 4XIFA 5CCLA 4G26A 3FTXA 3NZSA 3IHYA 3AU5A 3FTZA 4I2ZA 4C9BB 3ULQA 3EIJA 5AIJA 5D0QD 4KT6B 3CVYA 4NACA 3LY9A 4G23A 4HVBA 4H7YA 3S7JA 2WXGA 4BX9A 3MA5A 1JWGA 2VGXB 1Z3YA 2WXRA 4DPRA 5T8IA 2ZU6B 2J4DA 3LY8A 2OOEA 1E8ZA 3G2SA 5ARFA 1QZ2A 1SQMA 2Q7FA 4UWGA 4WNGA 3QOUA 4J8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGM A;  2PL2 A;  2VSY A;  5M72 A;  3CK9 A;  4UI9 C;  3GZ2 A;  3MEK A;  5DIZ A;  3QWV A;  3UUX A;  1HZ4 A;  2XCB A;  4N2S A;  3Q47 B;  3QKY A;  3O48 A;  1B89 A;  4HOT A;  1TJC A;  4GCO A;  4N3B A;  3TGO A;  1KT0 A;  2UY1 A;  3ASD A;  2FBN A;  3CEQ A;  3CVQ A;  4I17 A;  3UQ3 A;  2WPV A;  4ABN A;  5BNW A;  4N5C A;  1WAO 1;  3SF4 A;  4GA0 A;  3ZGQ A;  3FP3 A;  3GYZ A;  2VGX A;  2Y4T A;  3LYA A;  3RKV A;  5FZR A;  3AS4 A;  2L6J A;  3TG4 A;  3FWV A;  4B94 A;  1W3B A;  3RO3 A;  2PZI A;  2NC9 A;  2FEZ A;  2R5S A;  4Y6C A;  3LKU A;  2XEV A;  4JL0 A;  3ZN3 A;  3ZHE A;  1E96 B;  5KJM A;  5HI7 A;  2IFU A;  3NF1 A;  3PDN A;  1IYG A;  4WNF A;  4UI9 K;  3CVP A;  3QOU A;  4UQX A;  5G05 J;  4F3V A;  4J0U A;  4CGV A;  5HQ8 A;  3KD7 A;  3IEG A;  3U3W A;  1ZBP A;  3U4T A;  2VGY A;  2J9Q A;  4IN3 B;  2C2L A;  2HYZ A;  3KAE A;  5CHE E;  2P58 C;  2C0L A;  1NA3 A;  3K9I A;  2IF4 A;  3MV3 B;  4U0S A;  4YVO A;  1QQE A;  2PQR A;  4GCN A;  4RG6 A;  3TG5 A;  4EQF A;  2KCV A;  5BT1 A;  3QDN A;  3CVN A;  2LSU A;  5EX0 A;  3JYS A;  2Y4U A;  3KS2 A;  1KLX A;  3CKC A;  4W9R A;  4BT9 A;  4JHR A;  3GZ1 A;  4WUY A;  1ELR A;  2FI7 A;  2YHC A;  4Y6W A;  2KCL A;  5G05 C;  4A1S A;  2VQ2 A;  4KXK B;  4N3C A;  4U0U A;  3SZ7 A;  2UY1 B;  5KJL A;  4GPK A;  5EX3 A;  2KAT A;  2YQ8 A;  3CVL A;  3UPV A;  1Y8M A;  3Q15 A;  3HYM B;  3ZFW A;  5BW8 C;  2XGO A;  5FT9 A;  3CK7 A;  4U07 A;  3S7F A;  2UWJ G;  3E4B A;  1HH8 A;  4YVQ C;  2V5F A;  1IHG A;  4GA1 A;  2GW1 A;  5CCM A;  5LCW C;  2AVP A;  3MV2 B;  3RU0 A;  4G24 A;  4G1T A;  5ARG A;  3N71 A;  5FJY A;  4APO A;  4BWR A;  4BT8 A;  3RJV A;  3VTY A;  1KT1 A;  2WQH A;  3ESK A;  2XGS A;  2XCC A;  3GW4 A;  3PE3 A;  4G2V A;  4GYY A;  5A7D B;  4U04 A;  3TAX A;  1HXI A;  2QFC A;  5G04 J;  3WXX A;  3ZPJ A;  4HOS A;  2E2E A;  3ASF A;  3CV0 A;  4GZ6 A;  4CDR A;  5JJT A;  5A6C A;  2KCK A;  4CGW A;  1FCH A;  4J8E A;  4G25 A;  4JA9 A;  4HOR A;  4GYO A;  2DBA A;  1A17 A;  3ASH A;  1WM5 A;  1YA0 A;  2HO1 A;  3CK8 A;  4XI9 A;  1XNF A;  5JJ6 A;  1ELW A;  4GYW A;  4GZ3 A;  4H7X A;  3S7B A;  5KJK A;  4AY6 A;  4AM9 A;  1P5Q A;  3AS8 A;  3FFL A;  4HOU A;  1NA0 A;  3CKB A;  2FF4 A;  4J8D A;  4J8F A;  4WNE A;  2PQN A;  5FZS A;  3RIB A;  3VTX A;  4AY5 A;  3QWW A;  3OXG A;  4GA2 A;  4N3A A;  4NQ0 A;  3LY7 A;  5FTP A;  3URZ A;  4U0Z A;  2C0M A;  3LPZ A;  2VYI A;  1ZU2 A;  5G04 C;  2JLB A;  4I1A A;  4O6F A;  2KC7 A;  4UQY A;  4HOQ A;  3LCA A;  4RG9 A;  5DBK A;  4YND A;  5AYW D;  3OXL A;  1PC2 A;  4KBQ A;  2BUG A;  4I2W A;  4LEU A;  4UQZ A;  5EKQ D;  4XIF A;  4BTB A;  4G26 A;  5CCL A;  5KJN A;  5JJ7 A;  2VSN A;  4UI9 J;  4ME2 A;  3AS5 A;  2OND A;  4KYO B;  3ZHE B;  4JA7 A;  4NRH B;  3EDT B;  4N39 A;  4I2Z A;  4XI0 A;  3ULQ A;  4N2Q A;  3BEE A;  3OXF A;  5D0Q D;  4AIF A;  3LY9 A;  2I6H A;  4G23 A;  3ASG A;  5C1D A;  4H7Y A;  4BTA A;  3Q4A B;  5D0O D;  3RO2 A;  3MKR A;  3S7D A;  3S7J A;  4GZ5 A;  3Q49 B;  5LCW J;  1NZN A;  2MHK A;  3MA5 A;  2VGX B;  2XPI A;  3QWP A;  4I9E A;  5FZQ A;  2LSV A;  2FO7 A;  3R9A B;  3LY8 A;  2OOE A;  4WND A;  2LNI A;  1OUV A;  4I9C A;  1QZ2 A;  5ARF A;  2Q7F A;  3PE4 A;  3Q5M A;  4WNG A;  2HR2 A; 
#chains in the Genus database with same CATH topology
 2IO2 C;  1OCC E;  3CQC B;  3PUK A;  4Z68 A;  4GTQ A;  3CHQ A;  3FUH A;  1MZC A;  3DXK G;  1W3B A;  3QAQ A;  2F8X K;  4DX5 D;  2WM9 A;  2V0P A;  1IQR A;  3L54 A;  1JPL A;  4FLB A;  2J9Q A;  2KXP C;  4ILG A;  1NA3 A;  1MX4 A;  1Z6T A;  3CVN A;  2BED A;  3CLJ A;  3VLF A;  4JC8 A;  2UY1 B;  5FT9 A;  3CK7 A;  4BES A;  5ENO D;  1HH8 A;  2M63 A;  2WMO A;  3JQ1 A;  4A55 A;  1S64 A;  5CER B;  1FPP A;  1MYO A;  3AU4 A;  2FUL A;  1GW6 A;  3RJV A;  2B0O E;  2I1K A;  2XEH A;  4IYP A;  4CGW A;  1FCH A;  3TWR A;  3D9M A;  4XE0 A;  2PNN A;  2VYI A;  1H2V C;  1E8Y A;  1OT8 A;  4HOQ A;  3FU0 A;  4CRW A;  3CVW A;  4DK5 A;  3ZHE B;  4NRH B;  3C5R A;  3Q4A B;  4GZD A;  2OEV A;  3Q49 B;  2A5E A;  2LNI A;  2GRO B;  2J4B A;  5KCM A;  3ZYM A;  2R17 C;  4F53 A;  3TWW A;  4U96 D;  3B7R L;  4JW1 A;  1WAO 1;  3L82 A;  3ZVV A;  2R5S A;  3G2V A;  4HRL A;  2IEJ A;  1IYG A;  4FC8 A;  1SW6 A;  5CHE E;  1BI8 B;  3BG0 B;  4U0S A;  3FUN A;  2Y1L E;  1BD8 A;  2XS1 A;  3ZIM A;  2XZD G;  2Y4U A;  3SI5 A;  1SA4 A;  3PZ1 A;  3UXG A;  5AAR A;  4APF A;  2B6C A;  4ILI A;  2OCC E;  4U07 A;  2F37 A;  4TUU A;  4UWK A;  5ENN A;  4CCA A;  5AJL A;  2DZO A;  4GYY A;  2X6J A;  2KM4 A;  1MX2 A;  4BFR A;  1YA0 A;  1HG2 A;  4J8F A;  1O1T A;  3ZYL A;  2ZIR A;  4P29 A;  4RG9 A;  5AQA A;  5JJ7 A;  3QAR A;  3V79 K;  4ANU A;  1O5M A;  1N54 A;  3CSF A;  3HHM A;  1HFA A;  4XI0 A;  5FIN A;  1LTX A;  5C1D A;  5C2Y A;  3LS8 A;  2L0I A;  2NXP A;  2OEW A;  1NZN A;  3SFX A;  4B8A A;  1TNU A;  1N4S A;  1YMP A;  4MBG A;  3DSW A;  1IHB A;  5BXO A;  2KZT B;  3V2X A;  3D9I A;  2XQ0 A;  3GZ2 A;  4FA6 A;  3R9M A;  3KSL A;  3SF4 A;  1UG3 A;  4I43 A;  4A63 B;  5FZR A;  3OAW A;  4GAA A;  4B8C B;  2FEZ A;  1HU3 A;  5ITZ F;  3DEP A;  3NF1 A;  4UI9 K;  2WQ6 A;  4MLP A;  3U64 A;  3KD7 A;  3CST A;  3IEG A;  2C0L A;  3QJZ A;  2H6G A;  4RG6 A;  3UI2 A;  4LG6 A;  1TN6 A;  2KCL A;  3V2O A;  4K5B A;  1BLX B;  3HG0 D;  4TUM A;  1AP7 A;  3R7Q A;  3CGH A;  3JQ0 A;  3TXN A;  3B7S A;  2I9C A;  4EZL A;  5AN8 A;  3O4Z A;  4BWR A;  3SFZ A;  4U04 A;  3SNX A;  3TWV A;  3UT8 A;  5B1B E;  2XPY A;  3B7B A;  2DBA A;  3D9L A;  1WG0 A;  5JJ6 A;  1ELW A;  4FJZ A;  4PDX A;  3E34 A;  3AS8 A;  1OWO A;  3PNT B;  1IQU A;  5CED B;  3T9K A;  2PM6 A;  4UQY A;  1BI7 B;  3LVR E;  1K1B A;  4KBQ A;  1S70 B;  4LER A;  2GRR B;  4O1O A;  4GZC A;  1SZ9 A;  4EZJ A;  3APF A;  3EDT B;  4N2Q A;  1ELK A;  2BTD A;  1PY1 A;  2LSV A;  4R7L A;  4CT0 A;  4EBA G;  4WND A;  3TJP A;  1JCR A;  3FUE A;  4CZ2 D;  2Y69 E;  4U8V D;  3ZRH A;  3UUX A;  2XCB A;  2V4H C;  2WXH A;  3Q47 B;  3BUA A;  3D9O A;  4HS2 A;  2YNQ A;  4GCO A;  3DSV A;  3UQ3 A;  3Q75 A;  3TL5 A;  4J7W A;  3IBE A;  2PZI A;  5EYL A;  3ZN3 A;  3FDH A;  3ZKJ A;  4DX7 D;  3UIO C;  4U8Y D;  3UKR G;  4OVU A;  3ML9 A;  3ABL E;  1D8D A;  2OV8 A;  2ILR A;  3FU3 A;  4GCN A;  3LJ3 A;  2MRI A;  3EU9 A;  3TWX A;  1KLX A;  3PVL A;  5EN5 D;  4DX2 A;  4GPK A;  4L2L A;  3LDZ A;  2XGO A;  3PRZ A;  2IU1 A;  1Z3X A;  2UWJ G;  1IHG A;  4NIK A;  3MV2 B;  2BF0 X;  3KEZ A;  5FJY A;  4LNG A;  2DZN A;  3VTY A;  3S2A A;  4G2V A;  1X81 A;  4N5Q A;  3ASF A;  4QQI A;  4RLY A;  3ZNG A;  5JJT A;  4HNA D;  4JXT A;  3T8K A;  3Q7F A;  4O1P A;  3CK8 A;  4GYW A;  4GZ3 A;  4AM9 A;  4PH4 B;  2CHW A;  2PQN A;  4BY6 A;  3DSS A;  1OWP A;  1PC2 A;  1N0R A;  4G26 A;  2LUH A;  4C9B B;  3EIJ A;  3MA5 A;  1JWG A;  4DPR A;  2J4D A;  4B93 B;  2P9K G;  1SQM A;  4UWG A;  4J8S A;  3GZS A;  3W9G A;  3MCX A;  4OAV B;  3ENE A;  4V3I A;  3L22 A;  4HRN A;  3CEQ A;  1MX6 A;  4N5C A;  4KVO A;  3FWV A;  4ZHB A;  3UKU G;  5AEN A;  2ZGG A;  4L1B A;  3SO8 A;  1X5B A;  3FUL A;  4J0U A;  5HQ8 A;  3JXI A;  1FVF A;  2C2L A;  3KAE A;  3K9I A;  1K1A A;  2L9B A;  4M3O A;  4EBA A;  3ABK E;  3GZ1 A;  1A5E A;  3D9P A;  2LAH A;  3EUV A;  1H2U A;  2IOL A;  5EX3 A;  2AW6 A;  1TN8 A;  5BW8 C;  3ZFW A;  4WAF A;  3RRN B;  3G2U A;  5H7P A;  4JHJ A;  5CCM A;  1UOH A;  1DVP A;  5ENT D;  4CT4 A;  3RRM B;  2DCP A;  2I2O A;  5B1A E;  3FUF A;  5BPP A;  4JA9 A;  3ONL A;  3HDX A;  1EF1 C;  1JCS A;  4QFV A;  4AY5 A;  2F0Y A;  2C0M A;  3NB2 A;  1UN8 A;  2L0T B;  4BTB A;  5KJN A;  3L16 A;  4DX1 A;  1UW4 B;  1NL4 A;  4G8L A;  4JA7 A;  3BQO A;  2Y0B G;  3JUI A;  3UT7 A;  2IQC A;  3C3R A;  2J8S D;  1Y6I A;  3PE4 A;  3Q5M A;  1V54 E;  1OXJ A;  5T3R A;  2XRY A;  4LUN U;  4HLL A;  2IY0 C;  3SGH A;  1KT0 A;  3ASD A;  2R03 A;  3R7R A;  3ZGQ A;  3EJN A;  2VGX A;  4B94 A;  3B7U X;  3FH5 A;  4DRX E;  4L23 A;  4WWO A;  3HXF A;  1OWL A;  3DPY A;  4I6E A;  3D9N A;  5ENS D;  2IF4 A;  2QZA A;  2LSU A;  3ZXP A;  4JHR A;  3G2T A;  3CVX A;  4AEZ C;  3Q9U C;  2WXJ A;  1JWF A;  2VSO E;  4OYS A;  3NAW A;  2KZT A;  2NSZ A;  4BT8 A;  3IXE A;  3ESK A;  2AWI A;  2WXL A;  4G11 A;  4PS7 A;  5A7D B;  4CDN A;  4DX6 D;  2ZXW E;  2LO6 A;  1D9S A;  1OCR E;  3ASH A;  1XNF A;  3NOC D;  3ONK A;  3PH0 C;  4HOU A;  4DLO A;  3NZU A;  4BER A;  2X38 A;  3P2B A;  3CQG B;  4WWP A;  2WXN A;  4FLH A;  3UM1 A;  5KBA A;  2HM8 A;  4BSX A;  4DJA A;  1H2T C;  3D9K A;  2GRL A;  3TWQ A;  3OXF A;  4AIF A;  2EIL E;  2I6H A;  2RD0 A;  5D0O D;  2CG2 A;  1OWM A;  2XPI A;  4Q96 A;  4JEH A;  1OUV A;  1V55 E;  2DIW A;  3Q7A A;  3EIQ C;  5ENQ D;  5KWD A;  2FO1 E;  4KZ0 A;  5JHA A;  3AG4 E;  4CDM A;  4N3B A;  4BSZ B;  5CBO A;  2LXM A;  4ATZ D;  3FUD A;  3PS6 A;  2J49 A;  3FHE A;  2ION A;  1N9A A;  2XHE A;  4XEI G;  3PZ4 A;  1MQS A;  3SBT B;  1AWC B;  3C72 A;  3HXE A;  2P9P G;  4JD2 G;  2VQ2 A;  4RSY A;  3U66 A;  4MS6 A;  2RFA A;  5CBN A;  1TNO A;  2YQ8 A;  3Q15 A;  2MOW A;  4FHK A;  1G3N B;  4JPS A;  2J09 A;  4G24 A;  4G1T A;  2JAB A;  3I5P A;  3CHM A;  3PE3 A;  2P9N G;  3CHR A;  3ZPJ A;  4UWH A;  2X6F A;  4GYO A;  4JZY A;  2QC9 A;  1P5Q A;  1NA0 A;  4WNE A;  5FTP A;  2CFZ A;  5G04 C;  4C48 B;  2WXI A;  3C3O A;  1EPU A;  4K0R A;  4AVX A;  5CRV A;  2WXF A;  3ISM C;  3ASG A;  1LD8 A;  4FAD A;  3RO2 A;  3C98 A;  3CVU A;  3FTS A;  4I9E A;  4YDW A;  4K5A B;  1Z5S C;  3NQP A;  3JCK C;  3WG7 E;  2WMN A;  4HQD A;  2ZIS A;  3QKY A;  3O48 A;  3NOG D;  3IKO B;  5E76 A;  3FTY A;  2UY1 A;  4I17 A;  1N95 A;  5BNW A;  1YCS B;  2EIN E;  2NC9 A;  4ATG A;  1HE8 A;  1OCZ E;  3PNL B;  4UUC A;  4U7E B;  4HXI A;  1RW2 A;  1HF8 A;  3MV3 B;  4M7C A;  4URK A;  4YDY A;  3AAA C;  3QB2 A;  3KS2 A;  3X2Q E;  2QY7 A;  5BV1 A;  4A1S A;  1N0Q A;  3L17 A;  5KJL A;  2KAT A;  5KNH D;  4E6H A;  4NUR A;  2H6H A;  1TR4 A;  2V8S E;  1U3D A;  3L6A A;  4ZFH A;  5M72 A;  5CMY A;  5A6C A;  3PZ2 A;  2KCK A;  1JUQ A;  3CVV A;  4A3V A;  3FUJ A;  5FQ8 A;  3D3M A;  5KJK A;  4X8Q A;  5ANR A;  4GMJ A;  3UT4 A;  4U8H A;  2R02 A;  5JMN D;  3C3Q A;  4XIF A;  1TYQ G;  3NZS A;  3AU5 A;  3ULQ A;  3RSE G;  5D0Q D;  3LY9 A;  5HS0 A;  4HVB A;  2BKG A;  3S7J A;  2QYU A;  4O60 A;  1Z3Y A;  2ZU6 B;  2OOE A;  3G2S A;  5ARF A;  3QOU A;  2AXV A;  4G8K A;  1HZ4 A;  4I1O B;  4HOT A;  1HS6 A;  2LXL A;  4C0E A;  4XZ4 A;  4EPZ A;  5EDS A;  4B89 A;  3TWT A;  2L6J A;  5HRY A;  4LRZ A;  3SFY A;  1VDY A;  2X6K A;  3ZHE A;  1FVH A;  3PDN A;  4HI9 A;  5EIL A;  1UJK A;  1YYH A;  1DNP A;  2Y3A A;  3ZU7 B;  2NYJ A;  4I6J A;  1N94 A;  4IUL A;  3EU5 A;  4UWF A;  1DCE A;  4BT9 A;  3FTU A;  2VSX E;  3HXD A;  1EYH A;  5A23 A;  2DVW A;  2AVP A;  5ARG A;  2GGF A;  2XCC A;  1HXI A;  4J8E A;  4G25 A;  4GTT A;  1K3Z D;  4N2S A;  4H7X A;  3Q9N C;  3JUE A;  4FJY A;  4J8D A;  1SA5 A;  3LPZ A;  4OAU C;  2VTB B;  3VLE A;  4ABN A;  3I3N A;  2EIJ E;  4UI9 J;  4ME2 A;  3AS5 A;  1TN7 A;  3B95 A;  4Q69 A;  4KMO A;  2H6F A;  3R9A B;  3P1U A;  4C0M A;  3PEU B;  1JCQ A;  4TV3 A;  3FUM A;  1HX8 A;  3CK9 A;  3MEK A;  5DIZ A;  3ULY A;  5LX8 A;  3TGO A;  3CVQ A;  1WY6 A;  2IJG X;  1H0A A;  4B0Z A;  3UTM A;  3IHV A;  4TXP A;  4JL0 A;  4BEP A;  3AJI A;  3CVP A;  4UQX A;  1N52 A;  5CEC B;  1TNB A;  3HVE B;  4HFG A;  2RG8 A;  1SVX A;  2PQR A;  3PZD A;  2KCV A;  3MYV A;  5G05 C;  2KBX A;  5FQ4 A;  1E8X A;  1QNF A;  1KPS B;  4XKB A;  2CFU A;  1O1R A;  2WB2 A;  3UM3 A;  2ZGD A;  4DI3 A;  3EHR A;  4KVM A;  3WXX A;  3MZL B;  4U95 D;  5J08 A;  1OY3 D;  4HOR A;  1N4R A;  3MKQ A;  2XPZ A;  2XEN A;  2WXP A;  4AY6 A;  4L2Y A;  3G2W A;  4JEU A;  2GRQ B;  2JLB A;  3UM0 A;  5ENP D;  2P9S G;  2OND A;  2XS8 A;  2WXM A;  3BEE A;  3SHF A;  1LF8 A;  4GTO A;  3MKR A;  4GZ5 A;  2FO7 A;  4XKC A;  2PL2 A;  4WWN A;  3UIP C;  4YDO A;  1O1S A;  3DSU A;  3FP3 A;  2Y4T A;  4HBD A;  4Y6C A;  2XEV A;  5T4Y A;  3RK6 A;  4AOF A;  2VGE A;  1OWN A;  4WNF A;  4AXH A;  4D10 C;  3U3W A;  2R05 A;  2VGY A;  2P58 C;  3UIN C;  1QQE A;  2WXO A;  3QDN A;  2P9L G;  4FUL A;  3ZXS A;  3CKC A;  4W9R A;  4OVV A;  4F6R D;  3EHQ A;  1TNY A;  4GA1 A;  3TWU A;  3EHM A;  2V4L A;  3ASN E;  1E90 A;  3FTW A;  3APD A;  2CHZ A;  4YDE A;  5G55 A;  3EHN A;  2WXQ A;  2XEE A;  3CKB A;  3RIB A;  3UM2 A;  3E33 A;  4L7T A;  2OVB A;  3L13 A;  3HXB A;  4J8Y A;  2E0I A;  3LEW A;  5ENR D;  2BUG A;  4I2W A;  4PS3 A;  1TJF A;  1IKN D;  3T5X A;  2WVI A;  4MKT A;  3L08 A;  5G2N A;  5E75 A;  3W9F A;  5FZQ A;  4GMR A;  1SZA A;  1U3C A;  3V31 A;  2XGM A;  3ZW3 A;  4ANX A;  4UI9 C;  1H6K A;  5LFA A;  1H6O A;  2FBN A;  1BU9 A;  2WPV A;  2R2L A;  3CIA A;  3RKV A;  3ZUV B;  2X6H A;  3TG4 A;  5HI7 A;  1S63 A;  2AXU A;  2IOS A;  4CGV A;  3IV0 A;  2EQX A;  4TRQ A;  2YIN A;  3T5V A;  4IN3 B;  2PM7 A;  1TNZ A;  4ACL A;  1E7U A;  1QYM A;  3E37 A;  1U2V G;  2X6I A;  4WUY A;  3MKQ B;  1QBQ A;  3UX4 A;  1FT1 A;  3F6Q A;  3SY2 A;  5LCW C;  3KSQ A;  1L5J A;  1EDU A;  3SD5 A;  1KT1 A;  2BKK B;  2RKK A;  2E2E A;  3CV0 A;  4EEC A;  3PEV B;  1H6P A;  2ETB A;  1INZ A;  3PZ3 A;  3HIZ A;  4GTR A;  3VTX A;  3ZYQ A;  3QWW A;  2RFM A;  4JHK A;  3FEY A;  5AYW D;  1H19 A;  3OXL A;  3CHP A;  5CCL A;  1HG5 A;  3AG1 E;  3FTZ A;  5EYP F;  5AIJ A;  3CVY A;  4G23 A;  2WXG A;  4BX9 A;  2WXR A;  3LY8 A;  1E8Z A;  1WDY A;  3NBN B;  1QZ2 A;  3SBS A;  2VSY A;  3PUJ A;  3I4G A;  5CMW A;  3FUI A;  3DST A;  3QWV A;  1KZO A;  5AAO A;  1TJC A;  3AG2 E;  3CR3 A;  4I6G A;  4GA0 A;  3GYZ A;  4GTV A;  4LSZ E;  3LKU A;  3J5Q B;  5FWQ A;  4HRM B;  2X3M A;  4JB8 P;  4F3V A;  2CHX A;  2WQ7 A;  1BPO A;  3U4T A;  4I1M A;  2A4Z A;  3DXM G;  2VTB A;  5FQ7 A;  4EQF A;  3JYS A;  3Q79 A;  1ELR A;  4KXK B;  4GTP A;  4AP2 A;  3SZ7 A;  4DLQ A;  3CVL A;  2JEK A;  3FY4 A;  3BU8 A;  3E4B A;  3FH8 A;  5EIB E;  1RZ4 A;  3BG1 B;  3N71 A;  3TAX A;  5G04 J;  4HOS A;  1N11 A;  3FH7 A;  5JHB A;  1S0P A;  5CEA A;  3S7B A;  2I1J A;  2FF4 A;  5FZS A;  4F1P A;  4N3A A;  1HO8 A;  1ZU2 A;  5B3S E;  2P9I G;  4ACK A;  3LVQ E;  2QYJ A;  4JVS A;  5LOZ A;  4KYO B;  3J5P A;  4N39 A;  3DRA A;  2HE0 A;  4BTA A;  4K5C A;  5LCW J;  3DEO A;  3QWP A;  3V30 A;  4I9C A;  2LAI A;  4FP7 A;  4MRU A;  3DWL G;  5EID A;  4TXQ A;  2WXK A;  4EZK A;  3Q73 A;  5LP0 A;  2F8Y A;  2AJA A;  5KJM A;  4PUC A;  2CG3 A;  1MJ0 A;  3PRE A;  5AQ9 A;  1ZBP A;  2YHE A;  3TWS A;  3HVE A;  4YVO A;  3UMV A;  5EX0 A;  5FIO A;  3FU5 A;  4BX8 A;  1KZP A;  3D9J A;  4AJW A;  4A3T A;  4XX5 A;  1NI1 A;  2EIK E;  3DPD A;  3QNK A;  3CHO A;  1K8K G;  2GW1 A;  2XRZ A;  2P2C P;  4CDR A;  4GML A;  4EHM A;  4GTM A;  1A17 A;  4XI9 A;  4GPM A;  1PAQ A;  4ANV A;  1N4P A;  1D8E A;  5CRU A;  3FU6 A;  5DBK A;  4UQZ A;  3HRA A;  4FU3 A;  5JA4 D;  2L6B A;  4J6I A;  3CHS A;  1DC2 A;  4TXR A;  4IRU A;  1NP7 A;  3TXM A;  4Q94 A;  2MHK A;  2EIM E;  3MX3 A;  4HB5 A;  4HLE A;  3ESL A;  4FHJ A;  1MHQ A;  4PS8 A;  2A5U A;  2P9U G;  5D66 A;  1LD7 A;  1FT2 A;  5BUZ A;  3L9T A;  3JXJ A;  3KEA A;  3LYA A;  2DYS E;  3ULE G;  4F1S A;  3FUK A;  3Q78 A;  2IFU A;  3ASO E;  3MJW A;  2IO3 C;  4ANW A;  4GTS A;  4LCT A;  3AG3 E;  5KNG A;  5BT1 A;  2FI7 A;  4Y6W A;  2AXZ A;  4F7A A;  3ZEF A;  3UPV A;  1N4Q A;  1NFI E;  3HYM B;  1Q2Z A;  2V5F A;  3E32 A;  2XZT G;  3B13 A;  3RU0 A;  5AQ7 A;  2J08 A;  1UN9 A;  2WQH A;  2XGS A;  3GW4 A;  3B7T A;  3APC A;  2QFC A;  3HXC A;  3RRU A;  4GZ6 A;  5AQB A;  1DCQ A;  1WM5 A;  2HO1 A;  2GRP B;  3ABM E;  3LY7 A;  3LXU X;  4U0Z A;  4BET A;  3ZYK A;  4K03 A;  4I1A A;  4O6F A;  3SQV A;  3QC1 A;  4YND A;  2VSN A;  2GRN B;  4A1G A;  4DUI A;  3FEX A;  1E8W A;  2V5Q C;  3ML8 A;  3S7D A;  4RVB A;  3D9H A;  3FTV A;  2DWZ A;  4RQI A;  2HR2 A;  5FQ6 A;  2OVF A;  1B89 A;  4U63 A;  5AJD A;  3QK0 A;  3DBS A;  5IY5 E;  3AS4 A;  3RO3 A;  3U9W A;  3VLD A;  4AV7 A;  1E96 B;  4DI4 A;  5G05 J;  5BV0 A;  2DYR E;  4KZC A;  2ETA A;  3MGB A;  2HYZ A;  4ILH B;  3TG5 A;  3OTN A;  4E85 A;  1TEZ A;  2YHC A;  4N3C A;  4U0U A;  4L9P A;  1ZB1 A;  2VJ8 A;  2MYO A;  1OCO E;  1XGW A;  1Y8M A;  5BXU A;  4GB9 A;  3S7F A;  3RAU A;  5HKP A;  4LNB A;  4YVQ C;  3E30 A;  2GRM A;  4APO A;  2R59 A;  3DSX A;  4CYM D;  2J07 A;  4LNU D;  3T8M A;  1UJJ A;  3I4R B;  4UWL A;  2ETC A;  1E7V A;  3FFL A;  3OXG A;  4GA2 A;  5J90 A;  4NQ0 A;  3URZ A;  4HI8 A;  5ANL A;  4GU5 A;  2KC7 A;  3LCA A;  4CEM A;  4LEU A;  5EKQ D;  5D2M C;  1IXV A;  3FTX A;  3IHY A;  4I2Z A;  4KT6 B;  4NAC A;  4H7Y A;  3LJN A;  2VGX B;  5T8I A;  2Q7F A;  4WNG A;  2H6I A; 
#chains in the Genus database with same CATH homology
 2AXV A;  3GZS A;  3SBS A;  2VSY A;  3MCX A;  3PUJ A;  3I4G A;  5CMW A;  3FUI A;  3QWV A;  1HZ4 A;  3PUK A;  3CQC B;  3ENE A;  4I1O B;  4V3I A;  3L22 A;  4HOT A;  1HS6 A;  1TJC A;  4C0E A;  3CEQ A;  4XZ4 A;  4EPZ A;  3CR3 A;  4N5C A;  4I6G A;  5EDS A;  4GA0 A;  3CHQ A;  4KVO A;  4B89 A;  3FUH A;  3GYZ A;  2L6J A;  3FWV A;  4LRZ A;  1W3B A;  3QAQ A;  1VDY A;  3LKU A;  2X6K A;  2WM9 A;  5FWQ A;  3ZHE A;  5AEN A;  4L1B A;  2V0P A;  1FVH A;  2X3M A;  3PDN A;  1IQR A;  1X5B A;  4F3V A;  3L54 A;  2CHX A;  3FUL A;  4J0U A;  5HQ8 A;  1UJK A;  2WQ7 A;  1JPL A;  4FLB A;  1BPO A;  1DNP A;  3U4T A;  1FVF A;  2J9Q A;  2C2L A;  3KAE A;  4ILG A;  1NA3 A;  3K9I A;  2Y3A A;  4I1M A;  2A4Z A;  1Z6T A;  2VTB A;  5FQ7 A;  4EQF A;  2L9B A;  4M3O A;  3CVN A;  4EBA A;  3CLJ A;  4I6J A;  3JYS A;  4IUL A;  4UWF A;  4BT9 A;  3GZ1 A;  3VLF A;  1ELR A;  3FTU A;  4JC8 A;  4KXK B;  3D9P A;  2LAH A;  4AP2 A;  3SZ7 A;  2UY1 B;  2VSX E;  4DLQ A;  1H2U A;  2IOL A;  5EX3 A;  3CVL A;  2JEK A;  2AW6 A;  1EYH A;  3FY4 A;  3ZFW A;  5BW8 C;  4WAF A;  5FT9 A;  3RRN B;  3CK7 A;  5A23 A;  3E4B A;  3G2U A;  1HH8 A;  2M63 A;  2WMO A;  3JQ1 A;  4JHJ A;  3FH8 A;  4A55 A;  5CCM A;  2AVP A;  3AU4 A;  2FUL A;  3BG1 B;  5ARG A;  3N71 A;  1GW6 A;  2GGF A;  3RJV A;  1DVP A;  4CT4 A;  2I1K A;  2XCC A;  3TAX A;  1HXI A;  5G04 J;  4HOS A;  3RRM B;  2DCP A;  4IYP A;  3FH7 A;  5JHB A;  2I2O A;  3FUF A;  4CGW A;  1FCH A;  5BPP A;  4J8E A;  4G25 A;  4JA9 A;  1S0P A;  3D9M A;  3ONL A;  4N2S A;  3S7B A;  4H7X A;  3HDX A;  1EF1 C;  2I1J A;  4FJY A;  4J8D A;  2FF4 A;  4XE0 A;  4QFV A;  5FZS A;  4AY5 A;  4N3A A;  2C0M A;  3LPZ A;  1HO8 A;  2VYI A;  1UN8 A;  1H2V C;  1ZU2 A;  1E8Y A;  2VTB B;  4ACK A;  4HOQ A;  3VLE A;  2L0T B;  4ABN A;  3LVQ E;  4BTB A;  3FU0 A;  5KJN A;  3L16 A;  4CRW A;  3I3N A;  4JVS A;  1UW4 B;  3CVW A;  4UI9 J;  4ME2 A;  3AS5 A;  5LOZ A;  4KYO B;  3ZHE B;  4DK5 A;  4JA7 A;  4NRH B;  4N39 A;  4BTA A;  3Q4A B;  4GZD A;  4Q69 A;  3Q49 B;  5LCW J;  3JUI A;  3UT7 A;  4KMO A;  2IQC A;  3QWP A;  3R9A B;  3P1U A;  1Y6I A;  2LNI A;  4C0M A;  3PEU B;  4I9C A;  2J4B A;  3PE4 A;  3Q5M A;  4TV3 A;  2LAI A;  3FUM A;  5T3R A;  1HX8 A;  3CK9 A;  3MEK A;  5DIZ A;  5KCM A;  2XRY A;  4LUN U;  3ZYM A;  4FP7 A;  2R17 C;  4MRU A;  5LX8 A;  4F53 A;  3SGH A;  3TGO A;  1KT0 A;  3ASD A;  3B7R L;  3CVQ A;  4JW1 A;  1WY6 A;  1WAO 1;  1H0A A;  2IJG X;  3R7R A;  2WXK A;  3EJN A;  3ZGQ A;  2VGX A;  4B94 A;  4EZK A;  3B7U X;  3FH5 A;  4B0Z A;  5LP0 A;  3ZVV A;  2R5S A;  3IHV A;  4L23 A;  4JL0 A;  4WWO A;  1OWL A;  5KJM A;  3G2V A;  4I6E A;  1IYG A;  4FC8 A;  4PUC A;  3CVP A;  4UQX A;  3D9N A;  2CG3 A;  3PRE A;  1N52 A;  1ZBP A;  2YHE A;  3HVE B;  5CHE E;  4HFG A;  3BG0 B;  2IF4 A;  2RG8 A;  3HVE A;  4U0S A;  3FUN A;  4YVO A;  2PQR A;  3PZD A;  3UMV A;  2KCV A;  3ZIM A;  2LSU A;  5EX0 A;  2Y4U A;  3SI5 A;  4JHR A;  3MYV A;  3G2T A;  3FU5 A;  5G05 C;  4BX8 A;  5FQ4 A;  3CVX A;  1E8X A;  4AEZ C;  4APF A;  3D9J A;  1QNF A;  4AJW A;  4XKB A;  4A3T A;  4ILI A;  2CFU A;  4XX5 A;  3DPD A;  2WXJ A;  1JWF A;  2VSO E;  3QNK A;  2WB2 A;  3CHO A;  4U07 A;  4OYS A;  4TUU A;  2GW1 A;  4DI3 A;  4UWK A;  4KVM A;  5ENN A;  4CCA A;  5AJL A;  2XRZ A;  2KZT A;  2NSZ A;  4BT8 A;  3ESK A;  4GYY A;  2AWI A;  2WXL A;  4G11 A;  4PS7 A;  5A7D B;  3MZL B;  3WXX A;  4CDN A;  5J08 A;  2X6J A;  4CDR A;  2KM4 A;  4GML A;  2LO6 A;  4HOR A;  1A17 A;  3ASH A;  4BFR A;  1YA0 A;  3MKQ A;  2XPZ A;  4XI9 A;  1XNF A;  2WXP A;  1HG2 A;  4AY6 A;  3ONK A;  3PH0 C;  4HOU A;  4L2Y A;  1PAQ A;  3NZU A;  4J8F A;  4DLO A;  4ANV A;  3G2W A;  3ZYL A;  2X38 A;  3P2B A;  4JEU A;  3CQG B;  4WWP A;  2JLB A;  2WXN A;  3FU6 A;  4FLH A;  4P29 A;  4RG9 A;  5DBK A;  4UQZ A;  2HM8 A;  4FU3 A;  5JJ7 A;  3QAR A;  4ANU A;  4J6I A;  2OND A;  4BSX A;  4DJA A;  1N54 A;  1H2T C;  3CSF A;  3D9K A;  1HFA A;  2GRL A;  3CHS A;  3HHM A;  4XI0 A;  2WXM A;  3BEE A;  3OXF A;  4IRU A;  4AIF A;  1NP7 A;  3SHF A;  2I6H A;  3TXM A;  5C1D A;  2RD0 A;  5C2Y A;  1LF8 A;  3LS8 A;  2L0I A;  5D0O D;  2CG2 A;  2NXP A;  3MKR A;  4Q94 A;  4GZ5 A;  1NZN A;  1OWM A;  2MHK A;  2XPI A;  4Q96 A;  4B8A A;  2FO7 A;  4JEH A;  1OUV A;  3MX3 A;  4XKC A;  4HLE A;  2DIW A;  2KZT B;  3ESL A;  4FHJ A;  3EIQ C;  2PL2 A;  4WWN A;  1MHQ A;  4PS8 A;  3D9I A;  2A5U A;  2XQ0 A;  3GZ2 A;  4FA6 A;  4KZ0 A;  5JHA A;  5BUZ A;  4CDM A;  4N3B A;  3SF4 A;  1UG3 A;  3FP3 A;  3LYA A;  2Y4T A;  4I43 A;  3FUD A;  5FZR A;  4F1S A;  3OAW A;  3PS6 A;  2J49 A;  4GAA A;  4B8C B;  2FEZ A;  3FHE A;  3FUK A;  4Y6C A;  2XEV A;  1HU3 A;  2ION A;  5T4Y A;  3RK6 A;  4AOF A;  1OWN A;  2IFU A;  3NF1 A;  4WNF A;  4UI9 K;  2WQ6 A;  4MLP A;  3U64 A;  2XHE A;  3MJW A;  4AXH A;  3KD7 A;  3CST A;  3IEG A;  4D10 C;  3U3W A;  1MQS A;  3SBT B;  2VGY A;  4ANW A;  2P58 C;  2C0L A;  3QJZ A;  4LCT A;  1QQE A;  4RG6 A;  2WXO A;  5BT1 A;  3QDN A;  4FUL A;  3ZXS A;  3CKC A;  4W9R A;  2FI7 A;  4Y6W A;  2KCL A;  3U66 A;  2VQ2 A;  4RSY A;  2AXZ A;  4MS6 A;  4F7A A;  4OVV A;  2YQ8 A;  3ZEF A;  3UPV A;  3R7Q A;  3Q15 A;  3HYM B;  2MOW A;  4FHK A;  3CGH A;  3JQ0 A;  2V5F A;  4GA1 A;  4JPS A;  3TXN A;  3B13 A;  3B7S A;  3RU0 A;  2I9C A;  2J09 A;  4EZL A;  4G24 A;  4G1T A;  2J08 A;  3O4Z A;  1UN9 A;  4BWR A;  3EHM A;  3CHM A;  2V4L A;  2WQH A;  3I5P A;  2XGS A;  3GW4 A;  3PE3 A;  3SFZ A;  3B7T A;  3CHR A;  3APC A;  2QFC A;  4U04 A;  3ZPJ A;  1E90 A;  3FTW A;  3APD A;  3SNX A;  3RRU A;  2CHZ A;  4GZ6 A;  3UT8 A;  4UWH A;  2XPY A;  2X6F A;  4GYO A;  2DBA A;  3D9L A;  1WM5 A;  2HO1 A;  5G55 A;  3EHN A;  5JJ6 A;  2WXQ A;  1ELW A;  4FJZ A;  4JZY A;  4PDX A;  1P5Q A;  3AS8 A;  1OWO A;  1NA0 A;  3CKB A;  4WNE A;  3RIB A;  4L7T A;  2OVB A;  5FTP A;  3L13 A;  2CFZ A;  3LY7 A;  3LXU X;  4U0Z A;  3PNT B;  1IQU A;  2E0I A;  5G04 C;  4K03 A;  2PM6 A;  4I1A A;  4O6F A;  4UQY A;  3ZYK A;  3LEW A;  2WXI A;  3LVR E;  3QC1 A;  4YND A;  4KBQ A;  2BUG A;  4I2W A;  1EPU A;  4PS3 A;  4K0R A;  4LER A;  4GZC A;  1TJF A;  2VSN A;  3T5X A;  1SZ9 A;  4EZJ A;  3APF A;  4A1G A;  2WVI A;  3EDT B;  4MKT A;  3FEX A;  1E8W A;  3L08 A;  4N2Q A;  4AVX A;  5G2N A;  2WXF A;  1ELK A;  3ASG A;  4FAD A;  5E75 A;  3RO2 A;  3ML8 A;  3C98 A;  3S7D A;  2BTD A;  3CVU A;  4RVB A;  3FTS A;  4I9E A;  5FZQ A;  1PY1 A;  2LSV A;  4R7L A;  4CT0 A;  4EBA G;  4WND A;  3FTV A;  3TJP A;  1SZA A;  1U3C A;  3FUE A;  3NQP A;  3JCK C;  2HR2 A;  2WMN A;  2XGM A;  3ZW3 A;  3ZRH A;  4ANX A;  4UI9 C;  3UUX A;  2XCB A;  2WXH A;  3Q47 B;  5FQ6 A;  2OVF A;  3QKY A;  3D9O A;  3O48 A;  4HS2 A;  1H6K A;  2YNQ A;  1B89 A;  4U63 A;  4GCO A;  5LFA A;  3IKO B;  5AJD A;  3FTY A;  5E76 A;  2UY1 A;  4I17 A;  2FBN A;  3UQ3 A;  3QK0 A;  5BNW A;  2WPV A;  3TL5 A;  3CIA A;  3DBS A;  3RKV A;  2X6H A;  3AS4 A;  3IBE A;  3TG4 A;  3RO3 A;  2PZI A;  3U9W A;  3VLD A;  2NC9 A;  4AV7 A;  3ZN3 A;  4ATG A;  1E96 B;  3FDH A;  4DI4 A;  5HI7 A;  1HE8 A;  5G05 J;  3PNL B;  2AXU A;  2IOS A;  4CGV A;  3IV0 A;  5BV0 A;  2EQX A;  4KZC A;  4OVU A;  4TRQ A;  2YIN A;  3ML9 A;  4HXI A;  3T5V A;  3MGB A;  4IN3 B;  2HYZ A;  4ILH B;  2ILR A;  2OV8 A;  1HF8 A;  3MV3 B;  4URK A;  3FU3 A;  4GCN A;  3TG5 A;  3LJ3 A;  3OTN A;  2PM7 A;  4E85 A;  2MRI A;  3QB2 A;  3KS2 A;  1KLX A;  1E7U A;  4ACL A;  2QY7 A;  1TEZ A;  5BV1 A;  3PVL A;  2X6I A;  2YHC A;  4WUY A;  4A1S A;  4N3C A;  4U0U A;  3MKQ B;  3L17 A;  5KJL A;  2VJ8 A;  4GPK A;  4L2L A;  2KAT A;  1XGW A;  1Y8M A;  3UX4 A;  3LDZ A;  2XGO A;  3PRZ A;  4GB9 A;  2IU1 A;  3S7F A;  1Z3X A;  2UWJ G;  4E6H A;  4YVQ C;  4NUR A;  1IHG A;  5LCW C;  1L5J A;  2GRM A;  3MV2 B;  1EDU A;  2BF0 X;  2V8S E;  2R59 A;  3KEZ A;  1U3D A;  5FJY A;  4APO A;  3SD5 A;  3L6A A;  3VTY A;  1KT1 A;  3S2A A;  4G2V A;  5M72 A;  5CMY A;  2E2E A;  3ASF A;  3CV0 A;  2J07 A;  5JJT A;  5A6C A;  3T8M A;  1UJJ A;  2KCK A;  3I4R B;  4JXT A;  4EEC A;  4UWL A;  1JUQ A;  3PEV B;  1E7V A;  3CVV A;  3CK8 A;  4A3V A;  1INZ A;  3FUJ A;  4GZ3 A;  4GYW A;  5FQ8 A;  3D3M A;  4AM9 A;  3HIZ A;  5KJK A;  3FFL A;  4PH4 B;  2CHW A;  2PQN A;  4BY6 A;  5ANR A;  3VTX A;  3ZYQ A;  3QWW A;  3OXG A;  4GA2 A;  5J90 A;  4NQ0 A;  4GMJ A;  3URZ A;  5ANL A;  3UT4 A;  4JHK A;  4GU5 A;  2KC7 A;  4U8H A;  3FEY A;  3LCA A;  5AYW D;  1H19 A;  4CEM A;  3OXL A;  1OWP A;  1PC2 A;  4LEU A;  3CHP A;  1HG5 A;  5EKQ D;  4XIF A;  5CCL A;  4G26 A;  3FTX A;  3NZS A;  3IHY A;  3AU5 A;  3FTZ A;  4I2Z A;  4C9B B;  3ULQ A;  3EIJ A;  5AIJ A;  5D0Q D;  4KT6 B;  3CVY A;  4NAC A;  3LY9 A;  4G23 A;  4HVB A;  4H7Y A;  3S7J A;  2WXG A;  4BX9 A;  3MA5 A;  1JWG A;  2VGX B;  1Z3Y A;  2WXR A;  4DPR A;  5T8I A;  2ZU6 B;  2J4D A;  3LY8 A;  2OOE A;  1E8Z A;  3G2S A;  5ARF A;  1QZ2 A;  1SQM A;  2Q7F A;  4UWG A;  4WNG A;  3QOU A;  4J8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...