4I17A

Crystal structure of a tpr repeats protein (bf2334) from bacteroides fragilis nctc 9343 at 1.50 a resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
224
structure length
224
Chain Sequence
TTDPNQLKNEGNDALNAKNYAVAFEKYSEYLKLTNNQDSVTAYNCGVCADNIKKYKEAADYFDIAIKKNYNLANAYIGKSAAYRDMKNNQEYIATLTEGIKAVPGNATIEKLYAIYYLKEGQKFQQAGNIEKAEENYKHATDVTSKKWKTDALYSLGVLFYNNGADVLRKATPLASSNKEKYASEKAKADAAFKKAVDYLGEAVTLSPNRTEIKQMQDQVKAMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (BF2334) from Bacteroides fragilis NCTC 9343 at 1.50 A resolution
rcsb
source organism Bacteroides fragilis
total genus 95
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2012-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i17A00
3MV2B 3SZ7A 4UI9J 4GYWA 5LCWJ 4BWRA 4H7YA 3JYSA 4BT9A 1KT1A 3Q47B 1WM5A 5FZSA 1TJCA 4GZ3A 3ZGQA 4I2ZA 3RO3A 4RG6A 4G1TA 2FF4A 3R9AB 3CVNA 4KBQA 1HZ4A 4AM9A 2KCLA 1P5QA 1QZ2A 4J8EA 1ELWA 2HO1A 3LPZA 3PDNA 5G04C 4G26A 4H7XA 3KAEA 1FCHA 5D0OD 3MA5A 4GA2A 3GW4A 4U0UA 5ARFA 5CCLA 2PZIA 4HORA 2J9QA 3RKVA 5FZRA 3CVLA 4RG9A 4GZ6A 2XEVA 3S7JA 3LYAA 3IEGA 3UUXA 1W3BA 3KD7A 4GZ5A 3TG5A 2PL2A 4A1SA 2XGOA 2P58C 3KS2A 2FI7A 3QOUA 5FT9A 3ZFWA 4W9RA 5D0QD 5EX0A 3RIBA 4O6FA 2YQ8A 1HH8A 4NQ0A 3QKYA 3ASHA 4AY6A 1XNFA 4BT8A 4N39A 4N3AA 2Q7FA 3RU0A 5KJMA 1ELRA 5EKQD 4B94A 3WXXA 2YHCA 5HI7A 2LNIA 4JL0A 3O48A 4ABNA 5FJYA 4I9CA 5KJLA 5DBKA 3MEKA 4XI0A 2C0LA 3CKCA 2KCVA 5G05C 2MHKA 3E4BA 2I6HA 4XI9A 3GZ1A 5ARGA 2FO7A 3QWVA 3S7BA 3LY8A 3PE4A 2Y4UA 5JJTA 3LY7A 2Y4TA 2VGXB 2VSNA 4CGWA 3CK7A 5M72A 4IN3B 4HOTA 2BUGA 5BW8C 3HYMB 2VQ2A 4YNDA 3RJVA 1ZU2A 1PC2A 3TGOA 4KYOB 1KLXA 2IFUA 3OXFA 3CV0A 2VSYA 3ZHEA 2FBNA 4U04A 5G04J 3ZN3A 3BEEA 4HOQA 2KATA 5A6CA 2VYIA 4I2WA 2DBAA 3ASFA 4WUYA 2C0MA 3Q5MA 5JJ6A 4BTAA 4KXKB 2GW1A 4CDRA 4G25A 4LEUA 2V5FA 4Y6WA 3ASGA 3ZHEB 3NF1A 4GA1A 4GA0A 3Q4AB 4N3CA 3AS4A 4GCNA 3QWWA 4JHRA 3UQ3A 3FFLA 2E2EA 2PQNA 3QWPA 4JA7A 1E96B 1WAO1 4HOSA 3ZPJA 3CKBA 4GPKA 2JLBA 3UPVA 3U4TA 2XGSA 3LKUA 3PE3A 2XGMA 4UQYA 3ULQA 2ONDA 5DIZA 4G23A 1KT0A 3URZA 4CGVA 4J8FA 3TAXA 1QQEA 3TG4A 4F3VA 3CVPA 3K9IA 1Y8MA 3LCAA 4U07A 5EX3A 1NZNA 3CVQA 2VGXA 2NC9A 5BNWA 3S7FA 3QDNA 4UI9C 5LCWC 1NA0A 5A7DB 2WQHA 5G05J 4XIFA 2OOEA 5FTPA 4U0SA 2UY1B 3SF4A 3OXLA 5KJNA 2C2LA 1NA3A 3FWVA 4UI9K 4N5CA 4UQXA 1OUVA 3GYZA 3CK8A 1A17A 3GZ2A 3N71A 1YA0A 4WNFA 4N2SA 4I1AA 2UWJG 1HXIA 3CK9A 4JA9A 3AS5A 2AVPA 2HR2A 4AIFA 4EQFA 4WNDA 4ME2A 5KJKA 1IYGA 5JJ7A 2HYZA 3LY9A 4GCOA 1ZBPA 2R5SA 4WNGA 3EDTB 2FEZA 5CCMA 2XCBA 3OXGA 2XCCA 5AYWD 4U0ZA 2LSVA 2WPVA 2XPIA 4APOA 5BT1A 3ASDA 4G2VA 2QFCA 3S7DA 4I9EA 5C1DA 2KC7A 4GYYA 4WNEA 5CHEE 4YVQC 2IF4A 3RO2A 4G24A 4UQZA 4YVOA 3U3WA 3ESKA 3MV3B 3VTYA 3AS8A 4AY5A 4J8DA 3Q49B 4HOUA 4GYOA 4N2QA 5HQ8A 4BTBA 4NRHB 2KCKA 3FP3A 1B89A 3VTXA 4I17A 2L6JA 3MKRA 4N3BA 4Y6CA 5FZQA 2LSUA 2PQRA 2UY1A 3Q15A 2VGYA 3CEQA 4J0UA 1IHGA
chains in the Genus database with same CATH superfamily
3D9IA 5LCWJ 4CEMA 4BWRA 3PRZA 5JHBA 1HFAA 1DC2A 4BT9A 1TNUA 3I3NA 2VTBA 1IHBA 3MGBA 2BF0X 3ZGQA 3BG1B 3JQ1A 2PM7A 3FEXA 2FF4A 2PM6A 4KBQA 1D8DA 2DZNA 1P5QA 2P9IG 1ELWA 2HO1A 4GTSA 3JXJA 3V2XA 2I1KA 3T9KA 4H7XA 3C5RA 4JHJA 1FCHA 5D0OD 3T8MA 4GA2A 1MZCA 3ULYA 4HNAD 2ZXWE 3CVXA 3RAUA 2J9QA 3FU5A 1S70B 3RKVA 3CVLA 2XEVA 2AXZA 3NB2A 3LYAA 1FT2A 2OVFA 3G2UA 2WVIA 2XZDG 3G2WA 3TWQA 3ONLA 4A1SA 3KS2A 3KEZA 5FT9A 1MHQA 4K5BA 4HLEA 3QAQA 4YDWA 4FJZA 3ASHA 3MCXA 3D9HA 4MLPA 4BT8A 5EYPF 4N3AA 2Q7FA 1SVXA 5KJMA 1ELRA 3FU6A 5EKQD 3PZ2A 2YHCA 5HI7A 2F37A 5KCMA 2EINE 3T5VA 4I9CA 4AP2A 1H2TC 3DRAA 4C0MA 4YDYA 3FTXA 4CCAA 5ITZF 3MKQA 4WAFA 2KCVA 5G05C 4ANUA 5HRYA 3ZYMA 2J07A 5FQ8A 2L0IA 3NZSA 3QWVA 4L2YA 4Z68A 1LD7A 2ETBA 3PE4A 3DPDA 2WXOA 4EZLA 4U8VD 2FULA 3PUJA 3P2BA 1IXVA 2AXUA 3SI5A 4L23A 5BW8C 2GRQB 1O5MA 3RJVA 2XS1A 4PUCA 5BV0A 3DSWA 4J8SA 3FDHA 3TGOA 3UMVA 5CBNA 2R03A 3D9OA 4DJAA 3LS8A 3ZHEA 2B6CA 3CR3A 3ULEG 3ZN3A 5CBOA 3ABLE 4PH4B 1OCCE 1TYQG 5EDSA 2DBAA 3ASFA 2C0MA 1JCRA 2J8SD 3TWWA 3E34A 2GW1A 4LEUA 4F53A 4EPZA 5E76A 2QY7A 4I6JA 2QYJA 3T5XA 3D9MA 3NF1A 4J7WA 1INZA 3AS4A 3OTNA 3G2VA 3QWWA 4JHRA 3ZYLA 4HRMB 5FQ4A 3ASNE 3FFLA 3DSSA 4JA7A 3MJWA 2I1JA 2L9BA 3CKBA 3CHQA 3LKUA 3V79K 5EIDA 1BI8B 3CQCB 1D8EA 1N52A 3CVYA 5DIZA 2WXPA 3BU8A 3UX4A 1QQEA 3EHRA 3FH5A 3TG4A 3ABKE 2NXPA 2J4DA 4ANXA 4HVBA 3K9IA 4RQIA 4MBGA 3TWVA 3V30A 1WY6A 4U07A 5BV1A 1JUQA 3CVQA 3B7BA 2VSXE 3I4GA 3ZVVA 1HG5A 1KPSB 4GMLA 4BETA 2MYOA 4ILHB 2UY1B 2R2LA 4O60A 2WMOA 3UKRG 5KJNA 3DBSA 2P2CP 1NFIE 4BSZB 4UI9K 1E7UA 2ILRA 5T4YA 2WQ6A 4WNFA 2AJAA 4BX8A 4KZ0A 2Y3AA 1H6OA 4ZHBA 2VGEA 4XX5A 1DVPA 4C0EA 2JEKA 1NP7A 5T3RA 3PEUB 3FH7A 3EHNA 2V4LA 4WNGA 4DI3A 4GZCA 2LO6A 3CIAA 2FEZA 3B7RL 5CCMA 2WXRA 2XCCA 1S63A 5AYWD 2BEDA 2WPVA 4U63A 2XPIA 5C2YA 4F1PA 1OXJA 1H6KA 2QFCA 3PEVB 4FLBA 2L0TB 5C1DA 4NACA 5ENQD 4KMOA 1FPPA 3MX3A 4YVOA 2CHZA 3ESKA 1HO8A 3MV3B 4B89A 4J8DA 3Q49B 2PNNA 4HQDA 1EDUA 3ONKA 5AQ9A 4OAVB 3MKRA 2RFMA 4N3BA 3QK0A 3HXBA 1VDYA 4CZ2D 4TXQA 1H19A 1S64A 3G2SA 2UY1A 3PS6A 5AQAA 4GB9A 3PNTB 2VGYA 3U64A 1EYHA 3MV2B 4UI9J 4GTVA 4H7YA 2X38A 3JYSA 3DSVA 4DK5A 2Y0BG 4U95D 3TWUA 4L7TA 3PZDA 3EHMA 4I2ZA 3RO3A 3FUEA 3R9AB 3HIZA 4TXRA 4AM9A 1OT8A 3IKOB 2DZOA 1K1BA 2R05A 4XE0A 4FU3A 3NAWA 2IO2C 2XHEA 2GRMA 3MA5A 5CCLA 4F7AA 2QYUA 3DSTA 4JXTA 5ENRD 4A1GA 2PZIA 1UG3A 3ZKJA 3ZRHA 4PS3A 5LP0A 4BEPA 2GRLA 2XS8A 4FULA 2XEHA 1Q2ZA 3C98A 4Q94A 5CMWA 3UUXA 2X6HA 5ENOD 2IONA 5D66A 3S2AA 2V0PA 1OWLA 1EF1C 2P58C 3QOUA 3ZUVB 3AJIA 2H6GA 5EX0A 1S0PA 4O6FA 3L9TA 2P9UG 2YQ8A 2GRNB 1HH8A 3Q9UC 4NQ0A 2H6HA 3LEWA 3QKYA 4ZFHA 3IXEA 3P1UA 2Y69E 3QB2A 4U8YD 3AG2E 1Z5SC 4AY6A 4OVVA 2NYJA 4JEUA 3RU0A 4GTRA 2MRIA 2CHWA 3TWRA 4ILIA 3MYVA 4B94A 3WXXA 3FUNA 2LAIA 2XQ0A 5FJYA 3FUDA 2XZTG 3HG0D 1EPUA 2C0LA 2XENA 2FO1E 4BESA 3UI2A 3V2OA 3E4BA 2CHXA 1N4SA 4MRUA 3F6QA 3GZ1A 4UWFA 5ENTD 2J49A 1A5EA 1JCQA 2WXQA 3HRAA 3MKQB 3AU4A 3L16A 3LY8A 5JJTA 2ETAA 3KEAA 3LY7A 4FJYA 3Q78A 4I1MA 1AWCB 4CGWA 4HOTA 3UXGA 1BD8A 5B1AE 2VQ2A 2RKKA 5JHAA 3CGHA 3APCA 1PC2A 2B0OE 1OCRE 4KYOB 2IFUA 2ETCA 3OXFA 1OWMA 3CV0A 2VSYA 3HXDA 2X6FA 2FBNA 3JQ0A 2CG2A 3V31A 4HOQA 2KATA 4JD2G 2VYIA 2OVBA 4WUYA 5JJ6A 3EU9A 4WWNA 4Y6WA 3ZHEB 4GTQA 3O4ZA 4GA1A 3Q4AB 4N3CA 4DLQA 3ZU7B 1E90A 2F8XK 1MX2A 4ACKA 2E2EA 5EN5D 4MS6A 1WAO1 5KNGA 2IEJA 1NL4A 2DWZA 4WWPA 2JLBA 5CRVA 3FEYA 1SZ9A 2XGSA 2F0YA 3PE3A 4G11A 3RSEG 2HE0A 3FTZA 1KZOA 2WXHA 4JPSA 2ONDA 3CVUA 4G23A 5FQ6A 3FUMA 3QARA 5BPPA 4UWHA 4CGVA 4J8FA 4UWKA 3TAXA 4CT4A 1SW6A 3NQPA 3PVLA 1N4RA 1OCOE 5FQ7A 4FHJA 5ENPD 3W9GA 4BFRA 3CVPA 3ABME 4ATGA 3FHEA 1Y8MA 4K5AB 2OEVA 3UIPC 2WQ7A 4GMJA 1YCSB 1SA4A 1FVHA 5EX3A 4APFA 1NZNA 2R02A 4AXHA 3ZNGA 4K03A 4F6RD 4Q96A 2NC9A 3S7FA 3UINC 1AP7A 3LDZA 1OWOA 5G05J 2V5QC 5B3SE 3D3MA 3CHPA 2OOEA 5CEAA 1JWFA 2WMNA 4KT6B 3ENEA 2ZISA 3RRNB 3FTVA 4TUMA 3FWVA 4N5CA 2P9LG 3DPYA 3D9LA 4UQXA 2H6FA 1OUVA 5CERB 3R7QA 3C72A 4LG6A 5LFAA 4NIKA 3FU3A 3N71A 1YA0A 2P9SG 3DXKG 5CEDB 3HXEA 4JW1A 5HS0A 4JA9A 1KZPA 4K0RA 3AS5A 2AVPA 4AIFA 4ME2A 3TL5A 1IYGA 4A55A 3JUEA 3UKUG 5D2MC 2J09A 3LY9A 1ZBPA 2XRYA 3EDTB 4OVUA 3Q79A 4AV7A 5ENSD 4B8CB 3ZXPA 3FUIA 4UWGA 4CYMD 4DRXE 5BT1A 1N0QA 1L5JA 3APDA 4YDOA 3AU5A 2KXPC 4CT0A 4EZKA 3LXUX 2KC7A 4GYYA 4WNEA 3QJZA 4YVQC 2IF4A 2BTDA 4J8YA 1QYMA 4MKTA 2GROB 4B93B 4FHKA 5ANRA 4BSXA 3AS8A 4AY5A 5HQ8A 1ZB1A 4NRHB 1LD8A 1MX4A 4GU5A 5G55A 1BU9A 1E8WA 1JPLA 4C48B 2L6JA 2Y1LE 4HS2A 3EJNA 3G2TA 3OAWA 2LSUA 4A3VA 4IYPA 5AJLA 3CEQA 4ILGA 1TN7A 4J0UA 1N95A 1H2VC 3SD5A 4J6IA 5T8IA 3SZ7A 3ASOE 1PAQA 2P9NG 4P29A 3UM1A 3IV0A 4DX1A 3Q47B 3CLJA 1WM5A 5FZSA 1TJCA 3AG3E 3UM2A 3HHMA 3I4RB 3SHFA 2XEEA 5AJDA 2LXLA 3FULA 1TEZA 4DPRA 3E30A 1QZ2A 4J8EA 3TXNA 4KZCA 3IHYA 2OEWA 1QBQA 3R7RA 5G04C 1LTXA 5ENNA 3JCKC 4DX5D 2WXLA 2DVWA 1HE8A 3NZUA 1U3CA 2YNQA 5FZRA 3S7JA 3NOCD 1H0AA 3CSTA 1YYHA 3LJNA 5BUZA 2XPZA 4GTOA 2H6IA 2J08A 1O1TA 3Q9NC 4ANVA 3KD7A 2X3MA 4QFVA 3TJPA 2XGOA 5AAOA 1BPOA 4LERA 3SO8A 4JHKA 1SZAA 4AVXA 1Y6IA 1IQRA 2I9CA 4DX6D 5EIBE 4HB5A 5G2NA 3LJ3A 1G3NB 3FUKA 4JL0A 3O48A 1FVFA 4HRLA 5KJLA 3PZ4A 5DBKA 4ANWA 3PH0C 1N94A 3MEKA 4XI0A 3L54A 3CKCA 4JZYA 3HXFA 4EBAA 5ARGA 3FTSA 2FO7A 3TWSA 2A5UA 2CFUA 4URKA 4LRZA 5AIJA 1MQSA 3AG1E 2VGXB 2NSZA 5AARA 3CK7A 5M72A 2BUGA 3SBTB 4M3OA 3HYMB 4IULA 4YNDA 1U2VG 1JWGA 1N54A 3E37A 2AXVA 3DXMG 3UM3A 3BEEA 4HLLA 3R9MA 4CDMA 1H6PA 5A6CA 2WXMA 3Q5MA 4BTAA 3FUJA 4KXKB 1N4PA 3D9JA 1SQMA 1OY3D 4CDRA 2VSOE 2RD0A 4F1SA 3E33A 2V5FA 4DUIA 3ASGA 5J08A 2IOSA 4GAAA 2GRRB 1HX8A 4EHMA 1TNOA 1O1RA 1UJJA 3UQ3A 4HI8A 3HDXA 3PZ1A 2WXJA 2PQNA 3FY4A 3QC1A 4HOSA 1LF8A 3ZPJA 1QNFA 4KVOA 2WB2A 3UPVA 1HF8A 1Z6TA 3L13A 3B13A 4UWLA 4C9BB 4EZJA 2KM4A 3URZA 3CVVA 2QC9A 4V3IA 4XZ4A 5ANLA 1MX6A 4GTPA 4F3VA 3Q7FA 1UOHA 3VLEA 4GTTA 2BKKB 3L82A 1Z3YA 1PY1A 4GMRA 5A23A 3L08A 4HRNA 4LNBA 1TNBA 2ZIRA 3SGHA 2P9KG 2VGXA 3U66A 5BNWA 3J5QB 3C3QA 5LCWC 4DX7D 5HKPA 3ML9A 2WQHA 4RLYA 1N9AA 3HXCA 3X2QE 2EIJE 4XIFA 5EILA 3I5PA 4JB8P 3LVRE 3SF4A 1X5BA 3B7UX 1NA3A 3WG7E 4I6EA 1K1AA 3E32A 3PNLB 2KZTA 4TXPA 2KBXA 4I1AA 1RW2A 3B7SA 2UWJG 4PDXA 1DCQA 2MOWA 3CK9A 5J90A 4HBDA 2HR2A 2RG8A 2J4BA 3SQVA 3Q73A 4B8AA 5JJ7A 2DYSE 4GCOA 5CECB 3C3OA 2IOLA 3EU5A 1TNYA 2XCBA 3HVEB 3CHRA 3IBEA 4TV3A 4E85A 4JVSA 1E8YA 3SBSA 4APOA 3JUIA 3CVWA 4Q69A 4DX2A 4G2VA 3S7DA 4RSYA 1TR4A 3ESLA 1TNZA 1UN8A 3RO2A 4G24A 3U3WA 2YHEA 4FLHA 4N5QA 4DLOA 3GZSA 2E0IA 3D9NA 4I43A 4GYOA 4O1PA 4N2QA 1K8KG 4CRWA 2ZGDA 2KCKA 3EIJA 3EUVA 2BKGA 4U8HA 1UN9A 4O1OA 4EECA 3DEPA 4BY6A 4Y6CA 2ZU6B 2JABA 4LUNU 2PQRA 2R17C 3Q15A 3EIQC 3ZYQA 1GW6A 3D9PA 1E8ZA 2HM8A 2IO3C 3ZYKA 4DI4A 1DCEA 1Z3XA 1IHGA 4GYWA 1UW4B 5AQ7A 4KVMA 3BQOA 4FP7A 3FUFA 4QQIA 3CHOA 2P9PG 3L22A 3J5PA 1KT1A 4GZ3A 4LCTA 1X81A 4RG6A 1HG2A 4G1TA 3L17A 3CVNA 3Q7AA 3B7TA 1HZ4A 1WG0A 2IY0C 2I2OA 2KCLA 4HFGA 2WXNA 3CSFA 3LPZA 3PDNA 5IY5E 4G26A 4BX9A 3HVEA 1HS6A 3KAEA 2F8YA 4LNGA 4OYSA 2DYRE 3GW4A 4U0UA 5ARFA 2ZGGA 4GZDA 4XKCA 4HORA 4A3TA 1JCSA 2EQXA 4RG9A 4GZ6A 4B0ZA 3SNXA 4HXIA 3IEGA 2A5EA 3IHVA 1W3BA 1H2UA 4I1OB 4IRUA 4GZ5A 3TG5A 2PL2A 5FINA 3PREA 5E75A 3UT4A 2FI7A 1FT1A 2V8SE 5CRUA 3VLDA 3W9FA 3ZFWA 4AJWA 4W9RA 5D0QD 3NOGD 2RFAA 3RIBA 3FU0A 2WXKA 3KSQA 2IQCA 4I6GA 4U96D 1XNFA 3MZLB 4N39A 4YDEA 4WWOA 1N4QA 5FIOA 2L6BA 2CG3A 4EBAG 4FADA 2LNIA 5B1BE 2WXFA 5H7PA 4ABNA 1TJFA 2OCCE 2GGFA 4NURA 4L9PA 4AOFA 3CHSA 2WXGA 2X6KA 2MHKA 4AEZC 2I6HA 4XI9A 3LVQE 3Q75A 1MJ0A 3TWXA 3PUKA 4A63B 3APFA 2IU1A 4G8LA 3DEOA 3S7BA 2X6JA 2Y4UA 2Y4TA 2VSNA 1XGWA 3AG4E 4IN3B 4G8KA 1E8XA 3U9WA 5LOZA 1TN8A 1BI7B 2WM9A 4FC8A 5BXUA 1YMPA 1ZU2A 4E6HA 1V54E 1KLXA 1ELKA 1UJKA 3KSLA 4PS8A 3ZEFA 4U04A 5G04J 2LAHA 1SA5A 4ATZD 1E7VA 4I2WA 3SFZA 3BUAA 4GTMA 1D9SA 4G25A 1N11A 2A4ZA 2WXIA 4GA0A 2DCPA 4U7EB 4GCNA 1IQUA 3D9KA 2QZAA 4L1BA 2V4HC 3QWPA 3B95A 1E96B 3RRMB 2YINA 5AN8A 4UUCA 4GPKA 3U4TA 2XGMA 4UQYA 4FA6A 2AWIA 2R59A 3ULQA 3BG0B 3ZXSA 5AQBA 1KT0A 3T8KA 3NBNB 3EHQA 2GRPB 1WDYA 4M7CA 5KNHD 5LX8A 5CMYA 2XPYA 3RK6A 4XEIG 4OAUC 3LCAA 2XRZA 4L2LA 4X8QA 4R7LA 3UM0A 4JC8A 3FUHA 4K5CA 1RZ4A 4ACLA 2LXMA 1OWNA 4XKBA 3QDNA 4UI9C 3FH8A 3JXIA 1NA0A 5A7DB 4PS7A 3UT8A 1IKND 1O1SA 2VJ8A 5AENA 5FTPA 3QNKA 4U0SA 4BERA 3DSUA 3OXLA 4D10C 3L6AA 2C2LA 2DIWA 3ZIMA 2AW6A 3RRUA 3GYZA 4TUUA 3CK8A 1A17A 2M63A 3GZ2A 2EIME 4N2SA 3DWLG 4HI9A 3UTMA 2VTBB 1HXIA 4RVBA 1HU3A 3FTWA 1OWPA 4EQFA 3SFXA 4WNDA 2KZTB 5KJKA 3SFYA 5EYLA 3UIOC 2HYZA 3ISMC 2R5SA 5BXOA 1OCZE 3FTYA 3OXGA 3FTUA 4U0ZA 1U3DA 1TN6A 2LSVA 5KWDA 5FWQA 4TRQA 5JMND 3PZ3A 1V55E 3ASDA 3ZW3A 3DSXA 5JA4D 5KBAA 3AAAC 4I9EA 3CQGB 4CDNA 1MYOA 5CHEE 1NI1A 3SY2A 3C3RA 4UQZA 3VTYA 4HOUA 4BTBA 2IJGX 3TXMA 3FP3A 2LUHA 1BLXB 1B89A 2X6IA 2OV8A 3VTXA 4I17A 4GPMA 4LSZE 3TWTA 3CHMA 3VLFA 5FZQA 3ML8A 3UT7A 1DNPA 2CFZA 4LNUD 2EILE 4JEHA 1K3ZD 2EIKE 1N0RA
chains in the Genus database with same CATH topology
3MV2B 3D9IA 4UI9J 3SZ7A 4GYWA 5LCWJ 1UW4B 4CEMA 1PAQA 4KVMA 4BWRA 3PRZA 4H7YA 4FP7A 4P29A 2X38A 5JHBA 3FUFA 3JYSA 4DK5A 3IV0A 1HFAA 3CHOA 4BT9A 3L22A 3I3NA 1KT1A 3CLJA 1WM5A 3Q47B 5FZSA 2VTBA 1TJCA 4GZ3A 4L7TA 3MGBA 2BF0X 3EHMA 3PZDA 3HHMA 3I4RB 4LCTA 4I2ZA 3ZGQA 3RO3A 3FUEA 3SHFA 3BG1B 3JQ1A 2PM7A 4RG6A 3FEXA 1HG2A 5AJDA 4G1TA 2FF4A 3R9AB 3L17A 3CVNA 3HIZA 3FULA 2PM6A 3B7TA 4KBQA 1TEZA 4DPRA 1HZ4A 4AM9A 2I2OA 2KCLA 1P5QA 3IKOB 4HFGA 2WXNA 1QZ2A 3CSFA 4J8EA 3TXNA 1ELWA 4KZCA 4XE0A 2HO1A 3IHYA 4FU3A 3LPZA 3PDNA 3R7RA 5G04C 4G26A 2I1KA 4BX9A 3HVEA 4H7XA 4JHJA 1HS6A 3KAEA 1FCHA 5ENNA 5D0OD 2XHEA 2GRMA 4OYSA 3MA5A 3JCKC 3T8MA 4GA2A 3GW4A 4U0UA 5ARFA 2WXLA 5CCLA 4F7AA 1HE8A 4JXTA 3NZUA 4A1GA 1U3CA 4GZDA 3CVXA 2PZIA 4XKCA 1UG3A 4HORA 2J9QA 3FU5A 4A3TA 3RKVA 2YNQA 5FZRA 2EQXA 3CVLA 4RG9A 4GZ6A 2XEVA 3S7JA 4PS3A 3ZRHA 4B0ZA 5LP0A 3SNXA 1H0AA 2GRLA 2AXZA 3CSTA 3LYAA 4HXIA 3IEGA 5BUZA 2OVFA 2XPZA 4FULA 3IHVA 3G2UA 3C98A 4Q94A 5CMWA 5T8IA 3UUXA 2WVIA 1W3BA 2J08A 2X6HA 1H2UA 2IONA 3G2WA 4ANVA 3S2AA 3KD7A 4I1OB 2V0PA 1OWLA 4IRUA 4GZ5A 3TG5A 2PL2A 3ONLA 3PREA 2X3MA 4A1SA 4QFVA 3TJPA 5E75A 1EF1C 2XGOA 3UT4A 2P58C 3KS2A 3KEZA 1BPOA 2FI7A 4LERA 3QOUA 2V8SE 5FT9A 3VLDA 3ZFWA 1MHQA 4AJWA 4W9RA 5D0QD 4JHKA 5EX0A 1S0PA 1SZAA 3RIBA 4O6FA 4HLEA 2YQ8A 2WXKA 3FU0A 1HH8A 4NQ0A 3LEWA 3QKYA 3QAQA 4FJZA 2IQCA 3ASHA 3P1UA 4AVXA 4I6GA 4AY6A 3QB2A 1XNFA 1Y6IA 3MCXA 4MLPA 1IQRA 2I9CA 4OVVA 3MZLB 4BT8A 4N39A 4N3AA 2Q7FA 4JEUA 4WWOA 3RU0A 2MRIA 2CHWA 5G2NA 5KJMA 1ELRA 3FU6A 5EKQD 3LJ3A 2CG3A 3MYVA 4ILIA 4EBAG 4B94A 3WXXA 2YHCA 3FUNA 4FADA 5HI7A 2LNIA 3FUKA 5KCMA 2LAIA 3T5VA 4JL0A 2XQ0A 2WXFA 3O48A 4ABNA 1TJFA 5FJYA 1FVFA 4I9CA 4AP2A 1H2TC 3FUDA 2GGFA 4NURA 5KJLA 4C0MA 5DBKA 3FTXA 4ANWA 3PH0C 4CCAA 3MEKA 1EPUA 4XI0A 3MKQA 2C0LA 3CHSA 4AOFA 3L54A 3CKCA 2KCVA 4WAFA 5G05C 2WXGA 2X6KA 2MHKA 4ANUA 4JZYA 3E4BA 2I6HA 4XI9A 3ZYMA 2CHXA 4MRUA 4AEZC 2J07A 4EBAA 3GZ1A 5ARGA 3LVQE 2L0IA 3NZSA 5FQ8A 3FTSA 2FO7A 3QWVA 4L2YA 4UWFA 2A5UA 3PUKA 2CFUA 2J49A 4URKA 3APFA 2IU1A 4LRZA 2WXQA 3S7BA 3MKQB 3AU4A 3L16A 2X6JA 3LY8A 3DPDA 3PE4A 2Y4UA 5AIJA 5JJTA 1MQSA 2Y4TA 3LY7A 2WXOA 4EZLA 2VGXB 4FJYA 2VSNA 2NSZA 4I1MA 2FULA 1XGWA 3PUJA 3P2BA 2AXUA 3SI5A 4CGWA 3CK7A 5M72A 4IN3B 4L23A 4HOTA 2BUGA 3SBTB 1E8XA 3U9WA 5LOZA 4M3OA 5BW8C 2WM9A 3HYMB 4FC8A 4IULA 2VQ2A 4YNDA 3RJVA 3CGHA 4PUCA 5BV0A 5JHAA 1ZU2A 1JWGA 1N54A 4J8SA 3APCA 4E6HA 1PC2A 3FDHA 3TGOA 4KYOB 2AXVA 1KLXA 3UMVA 2IFUA 4DJAA 3D9OA 3OXFA 1ELKA 3LS8A 1UJKA 1OWMA 3CV0A 2VSYA 4PS8A 3ZEFA 2X6FA 2FBNA 3ZHEA 4U04A 3JQ0A 2CG2A 2LAHA 3CR3A 5G04J 3ZN3A 3BEEA 4PH4B 4CDMA 1E7VA 4HOQA 2KATA 5A6CA 2VYIA 4I2WA 2OVBA 2DBAA 2WXMA 3ASFA 4WUYA 3SFZA 5EDSA 2C0MA 3Q5MA 5JJ6A 4BTAA 3FUJA 4KXKB 3D9JA 4WWNA 1SQMA 2GW1A 4CDRA 2VSOE 2RD0A 4F1SA 4G25A 4LEUA 4F53A 4EPZA 5E76A 2QY7A 4I6JA 3T5XA 2V5FA 4Y6WA 3ASGA 3D9MA 3ZHEB 3NF1A 5J08A 2A4ZA 2IOSA 4GAAA 2WXIA 3O4ZA 4GA1A 4GA0A 1INZA 3Q4AB 4N3CA 2DCPA 1HX8A 3AS4A 4DLQA 3OTNA 4GCNA 3G2VA 3QWWA 4JHRA 1UJJA 1IQUA 3ZYLA 1E90A 3D9KA 3UQ3A 5FQ4A 3FFLA 3HDXA 2WXJA 2E2EA 2PQNA 4ACKA 4L1BA 3QWPA 4JA7A 3FY4A 3MJWA 4MS6A 3QC1A 1E96B 1WAO1 3RRMB 1LF8A 2YINA 4HOSA 2I1JA 1QNFA 3ZPJA 2L9BA 3CKBA 4KVOA 4WWPA 2JLBA 4GPKA 2WB2A 3UPVA 3U4TA 3FEYA 1SZ9A 3CHQA 2XGSA 1HF8A 3LKUA 1Z6TA 3PE3A 4G11A 2XGMA 4UQYA 3L13A 3FTZA 2WXHA 4FA6A 3CQCB 4JPSA 2AWIA 2R59A 3ULQA 1N52A 3B13A 4UWLA 3BG0B 4C9BB 3CVYA 2ONDA 5DIZA 4EZJA 2KM4A 4G23A 5FQ6A 3ZXSA 3CVUA 3FUMA 2WXPA 1KT0A 3URZA 3QARA 3CVVA 5BPPA 4UWHA 4CGVA 4V3IA 4J8FA 4UWKA 4XZ4A 5ANLA 3TAXA 3UX4A 4CT4A 1QQEA 3NQPA 3PVLA 5LX8A 5CMYA 5FQ7A 3FH5A 4FHJA 2XPYA 3TG4A 4F3VA 2NXPA 4BFRA 3CVPA 2J4DA 3RK6A 4ATGA 4ANXA 4HVBA 3VLEA 3K9IA 3FHEA 1Y8MA 1Z3YA 3LCAA 2WQ7A 1PY1A 4GMJA 5A23A 3L08A 2XRZA 1WY6A 4U07A 1FVHA 5EX3A 4L2LA 4APFA 1NZNA 4R7LA 4JC8A 3FUHA 5BV1A 1JUQA 3SGHA 3CVQA 4AXHA 2VSXE 4ACLA 4K03A 2VGXA 3I4GA 4Q96A 3ZVVA 1HG5A 1OWNA 2NC9A 3U66A 4XKBA 5BNWA 3S7FA 3QDNA 4UI9C 5LCWC 4GMLA 3LDZA 3ML9A 3FH8A 1NA0A 5A7DB 2WQHA 1OWOA 5G05J 4PS7A 3UT8A 2VJ8A 3D3MA 3CHPA 5AENA 4XIFA 2OOEA 5FTPA 3QNKA 3I5PA 4U0SA 3LVRE 4ILHB 1JWFA 2UY1B 3SF4A 2WMNA 4KT6B 3ENEA 3OXLA 1X5BA 2WMOA 5KJNA 3RRNB 3DBSA 4D10C 3FTVA 3L6AA 2C2LA 3B7UX 1NA3A 2DIWA 3FWVA 4UI9K 3ZIMA 2AW6A 1E7UA 4N5CA 2ILRA 3D9LA 4UQXA 4I6EA 3RRUA 1OUVA 3GYZA 3R7QA 3PNLB 4TUUA 5LFAA 3CK8A 1A17A 2KZTA 2M63A 3GZ2A 3FU3A 5T4YA 3N71A 1YA0A 2WQ6A 4WNFA 4N2SA 4I1AA 4BX8A 4KZ0A 2Y3AA 3B7SA 2UWJG 4JW1A 4PDXA 2VTBB 2MOWA 1HXIA 3CK9A 4JA9A 4RVBA 5J90A 1HU3A 3FTWA 4K0RA 4XX5A 3AS5A 1DVPA 1OWPA 2AVPA 2HR2A 2RG8A 2J4BA 4AIFA 4C0EA 4WNDA 4EQFA 2KZTB 4ME2A 2JEKA 5KJKA 1NP7A 5T3RA 3TL5A 1IYGA 4A55A 4B8AA 5JJ7A 2HYZA 2J09A 3LY9A 3PEUB 4GCOA 1ZBPA 3FH7A 3EHNA 2V4LA 2XRYA 2R5SA 4WNGA 3EDTB 4DI3A 4OVUA 4GZCA 2LO6A 3CIAA 2IOLA 4AV7A 2FEZA 3B7RL 5CCMA 4B8CB 2WXRA 2XCBA 3FTYA 3HVEB 3CHRA 3FUIA 3IBEA 3OXGA 2XCCA 3FTUA 4TV3A 4U0ZA 1U3DA 4UWGA 5AYWD 4E85A 2LSVA 2WPVA 4JVSA 4U63A 2XPIA 1E8YA 3SBSA 5C2YA 4APOA 5FWQA 4TRQA 3JUIA 3CVWA 5BT1A 4Q69A 1L5JA 3APDA 3AU5A 1H6KA 3ASDA 3ZW3A 4G2VA 2QFCA 3S7DA 4I9EA 4RSYA 3PEVB 4FLBA 2L0TB 4CT0A 4EZKA 3CQGB 5C1DA 4NACA 3LXUX 2KC7A 3ESLA 4GYYA 4WNEA 4CDNA 5CHEE 4KMOA 3QJZA 4YVQC 2IF4A 1UN8A 3RO2A 4G24A 2BTDA 4UQZA 3MX3A 4YVOA 4MKTA 3U3WA 2YHEA 2CHZA 4FLHA 3ESKA 4DLOA 1HO8A 3GZSA 2E0IA 3MV3B 4FHKA 5ANRA 3VTYA 4BSXA 3AS8A 3D9NA 4J8DA 4B89A 3Q49B 4AY5A 4HOUA 4I43A 4GYOA 4N2QA 4CRWA 5HQ8A 4BTBA 4NRHB 2KCKA 3EIJA 1EDUA 2IJGX 3ONKA 3TXMA 3FP3A 4GU5A 5G55A 1B89A 2X6IA 1E8WA 1UN9A 4U8HA 1JPLA 2OV8A 3VTXA 4I17A 2L6JA 4EECA 3MKRA 4N3BA 3QK0A 4BY6A 1VDYA 4HS2A 3CHMA 3VLFA 4Y6CA 3EJNA 3G2TA 3OAWA 5FZQA 2ZU6B 1H19A 3ML8A 2LSUA 3G2SA 3UT7A 1DNPA 2PQRA 2R17C 4LUNU 2UY1A 2CFZA 3PS6A 4A3VA 4IYPA 3Q15A 5AJLA 3EIQC 3ZYQA 4GB9A 1GW6A 3D9PA 1E8ZA 2HM8A 3PNTB 2VGYA 3ZYKA 4DI4A 3CEQA 4JEHA 4ILGA 4J0UA 3U64A 1Z3XA 1H2VC 3SD5A 4J6IA 1EYHA 1IHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MV2 B;  3SZ7 A;  4UI9 J;  4GYW A;  5LCW J;  4BWR A;  4H7Y A;  3JYS A;  4BT9 A;  1KT1 A;  3Q47 B;  1WM5 A;  5FZS A;  1TJC A;  4GZ3 A;  3ZGQ A;  4I2Z A;  3RO3 A;  4RG6 A;  4G1T A;  2FF4 A;  3R9A B;  3CVN A;  4KBQ A;  1HZ4 A;  4AM9 A;  2KCL A;  1P5Q A;  1QZ2 A;  4J8E A;  1ELW A;  2HO1 A;  3LPZ A;  3PDN A;  5G04 C;  4G26 A;  4H7X A;  3KAE A;  1FCH A;  5D0O D;  3MA5 A;  4GA2 A;  3GW4 A;  4U0U A;  5ARF A;  5CCL A;  2PZI A;  4HOR A;  2J9Q A;  3RKV A;  5FZR A;  3CVL A;  4RG9 A;  4GZ6 A;  2XEV A;  3S7J A;  3LYA A;  3IEG A;  3UUX A;  1W3B A;  3KD7 A;  4GZ5 A;  3TG5 A;  2PL2 A;  4A1S A;  2XGO A;  2P58 C;  3KS2 A;  2FI7 A;  3QOU A;  5FT9 A;  3ZFW A;  4W9R A;  5D0Q D;  5EX0 A;  3RIB A;  4O6F A;  2YQ8 A;  1HH8 A;  4NQ0 A;  3QKY A;  3ASH A;  4AY6 A;  1XNF A;  4BT8 A;  4N39 A;  4N3A A;  2Q7F A;  3RU0 A;  5KJM A;  1ELR A;  5EKQ D;  4B94 A;  3WXX A;  2YHC A;  5HI7 A;  2LNI A;  4JL0 A;  3O48 A;  4ABN A;  5FJY A;  4I9C A;  5KJL A;  5DBK A;  3MEK A;  4XI0 A;  2C0L A;  3CKC A;  2KCV A;  5G05 C;  2MHK A;  3E4B A;  2I6H A;  4XI9 A;  3GZ1 A;  5ARG A;  2FO7 A;  3QWV A;  3S7B A;  3LY8 A;  3PE4 A;  2Y4U A;  5JJT A;  3LY7 A;  2Y4T A;  2VGX B;  2VSN A;  4CGW A;  3CK7 A;  5M72 A;  4IN3 B;  4HOT A;  2BUG A;  5BW8 C;  3HYM B;  2VQ2 A;  4YND A;  3RJV A;  1ZU2 A;  1PC2 A;  3TGO A;  4KYO B;  1KLX A;  2IFU A;  3OXF A;  3CV0 A;  2VSY A;  3ZHE A;  2FBN A;  4U04 A;  5G04 J;  3ZN3 A;  3BEE A;  4HOQ A;  2KAT A;  5A6C A;  2VYI A;  4I2W A;  2DBA A;  3ASF A;  4WUY A;  2C0M A;  3Q5M A;  5JJ6 A;  4BTA A;  4KXK B;  2GW1 A;  4CDR A;  4G25 A;  4LEU A;  2V5F A;  4Y6W A;  3ASG A;  3ZHE B;  3NF1 A;  4GA1 A;  4GA0 A;  3Q4A B;  4N3C A;  3AS4 A;  4GCN A;  3QWW A;  4JHR A;  3UQ3 A;  3FFL A;  2E2E A;  2PQN A;  3QWP A;  4JA7 A;  1E96 B;  1WAO 1;  4HOS A;  3ZPJ A;  3CKB A;  4GPK A;  2JLB A;  3UPV A;  3U4T A;  2XGS A;  3LKU A;  3PE3 A;  2XGM A;  4UQY A;  3ULQ A;  2OND A;  5DIZ A;  4G23 A;  1KT0 A;  3URZ A;  4CGV A;  4J8F A;  3TAX A;  1QQE A;  3TG4 A;  4F3V A;  3CVP A;  3K9I A;  1Y8M A;  3LCA A;  4U07 A;  5EX3 A;  1NZN A;  3CVQ A;  2VGX A;  2NC9 A;  5BNW A;  3S7F A;  3QDN A;  4UI9 C;  5LCW C;  1NA0 A;  5A7D B;  2WQH A;  5G05 J;  4XIF A;  2OOE A;  5FTP A;  4U0S A;  2UY1 B;  3SF4 A;  3OXL A;  5KJN A;  2C2L A;  1NA3 A;  3FWV A;  4UI9 K;  4N5C A;  4UQX A;  1OUV A;  3GYZ A;  3CK8 A;  1A17 A;  3GZ2 A;  3N71 A;  1YA0 A;  4WNF A;  4N2S A;  4I1A A;  2UWJ G;  1HXI A;  3CK9 A;  4JA9 A;  3AS5 A;  2AVP A;  2HR2 A;  4AIF A;  4EQF A;  4WND A;  4ME2 A;  5KJK A;  1IYG A;  5JJ7 A;  2HYZ A;  3LY9 A;  4GCO A;  1ZBP A;  2R5S A;  4WNG A;  3EDT B;  2FEZ A;  5CCM A;  2XCB A;  3OXG A;  2XCC A;  5AYW D;  4U0Z A;  2LSV A;  2WPV A;  2XPI A;  4APO A;  5BT1 A;  3ASD A;  4G2V A;  2QFC A;  3S7D A;  4I9E A;  5C1D A;  2KC7 A;  4GYY A;  4WNE A;  5CHE E;  4YVQ C;  2IF4 A;  3RO2 A;  4G24 A;  4UQZ A;  4YVO A;  3U3W A;  3ESK A;  3MV3 B;  3VTY A;  3AS8 A;  4AY5 A;  4J8D A;  3Q49 B;  4HOU A;  4GYO A;  4N2Q A;  5HQ8 A;  4BTB A;  4NRH B;  2KCK A;  3FP3 A;  1B89 A;  3VTX A;  4I17 A;  2L6J A;  3MKR A;  4N3B A;  4Y6C A;  5FZQ A;  2LSU A;  2PQR A;  2UY1 A;  3Q15 A;  2VGY A;  3CEQ A;  4J0U A;  1IHG A; 
#chains in the Genus database with same CATH topology
 3D9I A;  5LCW J;  4CEM A;  4BWR A;  3PRZ A;  5JHB A;  1HFA A;  1DC2 A;  4BT9 A;  1TNU A;  3I3N A;  2VTB A;  1IHB A;  3MGB A;  2BF0 X;  3ZGQ A;  3BG1 B;  3JQ1 A;  2PM7 A;  3FEX A;  2FF4 A;  2PM6 A;  4KBQ A;  1D8D A;  2DZN A;  1P5Q A;  2P9I G;  1ELW A;  2HO1 A;  4GTS A;  3JXJ A;  3V2X A;  2I1K A;  3T9K A;  4H7X A;  3C5R A;  4JHJ A;  1FCH A;  5D0O D;  3T8M A;  4GA2 A;  1MZC A;  3ULY A;  4HNA D;  2ZXW E;  3CVX A;  3RAU A;  2J9Q A;  3FU5 A;  1S70 B;  3RKV A;  3CVL A;  2XEV A;  2AXZ A;  3NB2 A;  3LYA A;  1FT2 A;  2OVF A;  3G2U A;  2WVI A;  2XZD G;  3G2W A;  3TWQ A;  3ONL A;  4A1S A;  3KS2 A;  3KEZ A;  5FT9 A;  1MHQ A;  4K5B A;  4HLE A;  3QAQ A;  4YDW A;  4FJZ A;  3ASH A;  3MCX A;  3D9H A;  4MLP A;  4BT8 A;  5EYP F;  4N3A A;  2Q7F A;  1SVX A;  5KJM A;  1ELR A;  3FU6 A;  5EKQ D;  3PZ2 A;  2YHC A;  5HI7 A;  2F37 A;  5KCM A;  2EIN E;  3T5V A;  4I9C A;  4AP2 A;  1H2T C;  3DRA A;  4C0M A;  4YDY A;  3FTX A;  4CCA A;  5ITZ F;  3MKQ A;  4WAF A;  2KCV A;  5G05 C;  4ANU A;  5HRY A;  3ZYM A;  2J07 A;  5FQ8 A;  2L0I A;  3NZS A;  3QWV A;  4L2Y A;  4Z68 A;  1LD7 A;  2ETB A;  3PE4 A;  3DPD A;  2WXO A;  4EZL A;  4U8V D;  2FUL A;  3PUJ A;  3P2B A;  1IXV A;  2AXU A;  3SI5 A;  4L23 A;  5BW8 C;  2GRQ B;  1O5M A;  3RJV A;  2XS1 A;  4PUC A;  5BV0 A;  3DSW A;  4J8S A;  3FDH A;  3TGO A;  3UMV A;  5CBN A;  2R03 A;  3D9O A;  4DJA A;  3LS8 A;  3ZHE A;  2B6C A;  3CR3 A;  3ULE G;  3ZN3 A;  5CBO A;  3ABL E;  4PH4 B;  1OCC E;  1TYQ G;  5EDS A;  2DBA A;  3ASF A;  2C0M A;  1JCR A;  2J8S D;  3TWW A;  3E34 A;  2GW1 A;  4LEU A;  4F53 A;  4EPZ A;  5E76 A;  2QY7 A;  4I6J A;  2QYJ A;  3T5X A;  3D9M A;  3NF1 A;  4J7W A;  1INZ A;  3AS4 A;  3OTN A;  3G2V A;  3QWW A;  4JHR A;  3ZYL A;  4HRM B;  5FQ4 A;  3ASN E;  3FFL A;  3DSS A;  4JA7 A;  3MJW A;  2I1J A;  2L9B A;  3CKB A;  3CHQ A;  3LKU A;  3V79 K;  5EID A;  1BI8 B;  3CQC B;  1D8E A;  1N52 A;  3CVY A;  5DIZ A;  2WXP A;  3BU8 A;  3UX4 A;  1QQE A;  3EHR A;  3FH5 A;  3TG4 A;  3ABK E;  2NXP A;  2J4D A;  4ANX A;  4HVB A;  3K9I A;  4RQI A;  4MBG A;  3TWV A;  3V30 A;  1WY6 A;  4U07 A;  5BV1 A;  1JUQ A;  3CVQ A;  3B7B A;  2VSX E;  3I4G A;  3ZVV A;  1HG5 A;  1KPS B;  4GML A;  4BET A;  2MYO A;  4ILH B;  2UY1 B;  2R2L A;  4O60 A;  2WMO A;  3UKR G;  5KJN A;  3DBS A;  2P2C P;  1NFI E;  4BSZ B;  4UI9 K;  1E7U A;  2ILR A;  5T4Y A;  2WQ6 A;  4WNF A;  2AJA A;  4BX8 A;  4KZ0 A;  2Y3A A;  1H6O A;  4ZHB A;  2VGE A;  4XX5 A;  1DVP A;  4C0E A;  2JEK A;  1NP7 A;  5T3R A;  3PEU B;  3FH7 A;  3EHN A;  2V4L A;  4WNG A;  4DI3 A;  4GZC A;  2LO6 A;  3CIA A;  2FEZ A;  3B7R L;  5CCM A;  2WXR A;  2XCC A;  1S63 A;  5AYW D;  2BED A;  2WPV A;  4U63 A;  2XPI A;  5C2Y A;  4F1P A;  1OXJ A;  1H6K A;  2QFC A;  3PEV B;  4FLB A;  2L0T B;  5C1D A;  4NAC A;  5ENQ D;  4KMO A;  1FPP A;  3MX3 A;  4YVO A;  2CHZ A;  3ESK A;  1HO8 A;  3MV3 B;  4B89 A;  4J8D A;  3Q49 B;  2PNN A;  4HQD A;  1EDU A;  3ONK A;  5AQ9 A;  4OAV B;  3MKR A;  2RFM A;  4N3B A;  3QK0 A;  3HXB A;  1VDY A;  4CZ2 D;  4TXQ A;  1H19 A;  1S64 A;  3G2S A;  2UY1 A;  3PS6 A;  5AQA A;  4GB9 A;  3PNT B;  2VGY A;  3U64 A;  1EYH A;  3MV2 B;  4UI9 J;  4GTV A;  4H7Y A;  2X38 A;  3JYS A;  3DSV A;  4DK5 A;  2Y0B G;  4U95 D;  3TWU A;  4L7T A;  3PZD A;  3EHM A;  4I2Z A;  3RO3 A;  3FUE A;  3R9A B;  3HIZ A;  4TXR A;  4AM9 A;  1OT8 A;  3IKO B;  2DZO A;  1K1B A;  2R05 A;  4XE0 A;  4FU3 A;  3NAW A;  2IO2 C;  2XHE A;  2GRM A;  3MA5 A;  5CCL A;  4F7A A;  2QYU A;  3DST A;  4JXT A;  5ENR D;  4A1G A;  2PZI A;  1UG3 A;  3ZKJ A;  3ZRH A;  4PS3 A;  5LP0 A;  4BEP A;  2GRL A;  2XS8 A;  4FUL A;  2XEH A;  1Q2Z A;  3C98 A;  4Q94 A;  5CMW A;  3UUX A;  2X6H A;  5ENO D;  2ION A;  5D66 A;  3S2A A;  2V0P A;  1OWL A;  1EF1 C;  2P58 C;  3QOU A;  3ZUV B;  3AJI A;  2H6G A;  5EX0 A;  1S0P A;  4O6F A;  3L9T A;  2P9U G;  2YQ8 A;  2GRN B;  1HH8 A;  3Q9U C;  4NQ0 A;  2H6H A;  3LEW A;  3QKY A;  4ZFH A;  3IXE A;  3P1U A;  2Y69 E;  3QB2 A;  4U8Y D;  3AG2 E;  1Z5S C;  4AY6 A;  4OVV A;  2NYJ A;  4JEU A;  3RU0 A;  4GTR A;  2MRI A;  2CHW A;  3TWR A;  4ILI A;  3MYV A;  4B94 A;  3WXX A;  3FUN A;  2LAI A;  2XQ0 A;  5FJY A;  3FUD A;  2XZT G;  3HG0 D;  1EPU A;  2C0L A;  2XEN A;  2FO1 E;  4BES A;  3UI2 A;  3V2O A;  3E4B A;  2CHX A;  1N4S A;  4MRU A;  3F6Q A;  3GZ1 A;  4UWF A;  5ENT D;  2J49 A;  1A5E A;  1JCQ A;  2WXQ A;  3HRA A;  3MKQ B;  3AU4 A;  3L16 A;  3LY8 A;  5JJT A;  2ETA A;  3KEA A;  3LY7 A;  4FJY A;  3Q78 A;  4I1M A;  1AWC B;  4CGW A;  4HOT A;  3UXG A;  1BD8 A;  5B1A E;  2VQ2 A;  2RKK A;  5JHA A;  3CGH A;  3APC A;  1PC2 A;  2B0O E;  1OCR E;  4KYO B;  2IFU A;  2ETC A;  3OXF A;  1OWM A;  3CV0 A;  2VSY A;  3HXD A;  2X6F A;  2FBN A;  3JQ0 A;  2CG2 A;  3V31 A;  4HOQ A;  2KAT A;  4JD2 G;  2VYI A;  2OVB A;  4WUY A;  5JJ6 A;  3EU9 A;  4WWN A;  4Y6W A;  3ZHE B;  4GTQ A;  3O4Z A;  4GA1 A;  3Q4A B;  4N3C A;  4DLQ A;  3ZU7 B;  1E90 A;  2F8X K;  1MX2 A;  4ACK A;  2E2E A;  5EN5 D;  4MS6 A;  1WAO 1;  5KNG A;  2IEJ A;  1NL4 A;  2DWZ A;  4WWP A;  2JLB A;  5CRV A;  3FEY A;  1SZ9 A;  2XGS A;  2F0Y A;  3PE3 A;  4G11 A;  3RSE G;  2HE0 A;  3FTZ A;  1KZO A;  2WXH A;  4JPS A;  2OND A;  3CVU A;  4G23 A;  5FQ6 A;  3FUM A;  3QAR A;  5BPP A;  4UWH A;  4CGV A;  4J8F A;  4UWK A;  3TAX A;  4CT4 A;  1SW6 A;  3NQP A;  3PVL A;  1N4R A;  1OCO E;  5FQ7 A;  4FHJ A;  5ENP D;  3W9G A;  4BFR A;  3CVP A;  3ABM E;  4ATG A;  3FHE A;  1Y8M A;  4K5A B;  2OEV A;  3UIP C;  2WQ7 A;  4GMJ A;  1YCS B;  1SA4 A;  1FVH A;  5EX3 A;  4APF A;  1NZN A;  2R02 A;  4AXH A;  3ZNG A;  4K03 A;  4F6R D;  4Q96 A;  2NC9 A;  3S7F A;  3UIN C;  1AP7 A;  3LDZ A;  1OWO A;  5G05 J;  2V5Q C;  5B3S E;  3D3M A;  3CHP A;  2OOE A;  5CEA A;  1JWF A;  2WMN A;  4KT6 B;  3ENE A;  2ZIS A;  3RRN B;  3FTV A;  4TUM A;  3FWV A;  4N5C A;  2P9L G;  3DPY A;  3D9L A;  4UQX A;  2H6F A;  1OUV A;  5CER B;  3R7Q A;  3C72 A;  4LG6 A;  5LFA A;  4NIK A;  3FU3 A;  3N71 A;  1YA0 A;  2P9S G;  3DXK G;  5CED B;  3HXE A;  4JW1 A;  5HS0 A;  4JA9 A;  1KZP A;  4K0R A;  3AS5 A;  2AVP A;  4AIF A;  4ME2 A;  3TL5 A;  1IYG A;  4A55 A;  3JUE A;  3UKU G;  5D2M C;  2J09 A;  3LY9 A;  1ZBP A;  2XRY A;  3EDT B;  4OVU A;  3Q79 A;  4AV7 A;  5ENS D;  4B8C B;  3ZXP A;  3FUI A;  4UWG A;  4CYM D;  4DRX E;  5BT1 A;  1N0Q A;  1L5J A;  3APD A;  4YDO A;  3AU5 A;  2KXP C;  4CT0 A;  4EZK A;  3LXU X;  2KC7 A;  4GYY A;  4WNE A;  3QJZ A;  4YVQ C;  2IF4 A;  2BTD A;  4J8Y A;  1QYM A;  4MKT A;  2GRO B;  4B93 B;  4FHK A;  5ANR A;  4BSX A;  3AS8 A;  4AY5 A;  5HQ8 A;  1ZB1 A;  4NRH B;  1LD8 A;  1MX4 A;  4GU5 A;  5G55 A;  1BU9 A;  1E8W A;  1JPL A;  4C48 B;  2L6J A;  2Y1L E;  4HS2 A;  3EJN A;  3G2T A;  3OAW A;  2LSU A;  4A3V A;  4IYP A;  5AJL A;  3CEQ A;  4ILG A;  1TN7 A;  4J0U A;  1N95 A;  1H2V C;  3SD5 A;  4J6I A;  5T8I A;  3SZ7 A;  3ASO E;  1PAQ A;  2P9N G;  4P29 A;  3UM1 A;  3IV0 A;  4DX1 A;  3Q47 B;  3CLJ A;  1WM5 A;  5FZS A;  1TJC A;  3AG3 E;  3UM2 A;  3HHM A;  3I4R B;  3SHF A;  2XEE A;  5AJD A;  2LXL A;  3FUL A;  1TEZ A;  4DPR A;  3E30 A;  1QZ2 A;  4J8E A;  3TXN A;  4KZC A;  3IHY A;  2OEW A;  1QBQ A;  3R7R A;  5G04 C;  1LTX A;  5ENN A;  3JCK C;  4DX5 D;  2WXL A;  2DVW A;  1HE8 A;  3NZU A;  1U3C A;  2YNQ A;  5FZR A;  3S7J A;  3NOC D;  1H0A A;  3CST A;  1YYH A;  3LJN A;  5BUZ A;  2XPZ A;  4GTO A;  2H6I A;  2J08 A;  1O1T A;  3Q9N C;  4ANV A;  3KD7 A;  2X3M A;  4QFV A;  3TJP A;  2XGO A;  5AAO A;  1BPO A;  4LER A;  3SO8 A;  4JHK A;  1SZA A;  4AVX A;  1Y6I A;  1IQR A;  2I9C A;  4DX6 D;  5EIB E;  4HB5 A;  5G2N A;  3LJ3 A;  1G3N B;  3FUK A;  4JL0 A;  3O48 A;  1FVF A;  4HRL A;  5KJL A;  3PZ4 A;  5DBK A;  4ANW A;  3PH0 C;  1N94 A;  3MEK A;  4XI0 A;  3L54 A;  3CKC A;  4JZY A;  3HXF A;  4EBA A;  5ARG A;  3FTS A;  2FO7 A;  3TWS A;  2A5U A;  2CFU A;  4URK A;  4LRZ A;  5AIJ A;  1MQS A;  3AG1 E;  2VGX B;  2NSZ A;  5AAR A;  3CK7 A;  5M72 A;  2BUG A;  3SBT B;  4M3O A;  3HYM B;  4IUL A;  4YND A;  1U2V G;  1JWG A;  1N54 A;  3E37 A;  2AXV A;  3DXM G;  3UM3 A;  3BEE A;  4HLL A;  3R9M A;  4CDM A;  1H6P A;  5A6C A;  2WXM A;  3Q5M A;  4BTA A;  3FUJ A;  4KXK B;  1N4P A;  3D9J A;  1SQM A;  1OY3 D;  4CDR A;  2VSO E;  2RD0 A;  4F1S A;  3E33 A;  2V5F A;  4DUI A;  3ASG A;  5J08 A;  2IOS A;  4GAA A;  2GRR B;  1HX8 A;  4EHM A;  1TNO A;  1O1R A;  1UJJ A;  3UQ3 A;  4HI8 A;  3HDX A;  3PZ1 A;  2WXJ A;  2PQN A;  3FY4 A;  3QC1 A;  4HOS A;  1LF8 A;  3ZPJ A;  1QNF A;  4KVO A;  2WB2 A;  3UPV A;  1HF8 A;  1Z6T A;  3L13 A;  3B13 A;  4UWL A;  4C9B B;  4EZJ A;  2KM4 A;  3URZ A;  3CVV A;  2QC9 A;  4V3I A;  4XZ4 A;  5ANL A;  1MX6 A;  4GTP A;  4F3V A;  3Q7F A;  1UOH A;  3VLE A;  4GTT A;  2BKK B;  3L82 A;  1Z3Y A;  1PY1 A;  4GMR A;  5A23 A;  3L08 A;  4HRN A;  4LNB A;  1TNB A;  2ZIR A;  3SGH A;  2P9K G;  2VGX A;  3U66 A;  5BNW A;  3J5Q B;  3C3Q A;  5LCW C;  4DX7 D;  5HKP A;  3ML9 A;  2WQH A;  4RLY A;  1N9A A;  3HXC A;  3X2Q E;  2EIJ E;  4XIF A;  5EIL A;  3I5P A;  4JB8 P;  3LVR E;  3SF4 A;  1X5B A;  3B7U X;  1NA3 A;  3WG7 E;  4I6E A;  1K1A A;  3E32 A;  3PNL B;  2KZT A;  4TXP A;  2KBX A;  4I1A A;  1RW2 A;  3B7S A;  2UWJ G;  4PDX A;  1DCQ A;  2MOW A;  3CK9 A;  5J90 A;  4HBD A;  2HR2 A;  2RG8 A;  2J4B A;  3SQV A;  3Q73 A;  4B8A A;  5JJ7 A;  2DYS E;  4GCO A;  5CEC B;  3C3O A;  2IOL A;  3EU5 A;  1TNY A;  2XCB A;  3HVE B;  3CHR A;  3IBE A;  4TV3 A;  4E85 A;  4JVS A;  1E8Y A;  3SBS A;  4APO A;  3JUI A;  3CVW A;  4Q69 A;  4DX2 A;  4G2V A;  3S7D A;  4RSY A;  1TR4 A;  3ESL A;  1TNZ A;  1UN8 A;  3RO2 A;  4G24 A;  3U3W A;  2YHE A;  4FLH A;  4N5Q A;  4DLO A;  3GZS A;  2E0I A;  3D9N A;  4I43 A;  4GYO A;  4O1P A;  4N2Q A;  1K8K G;  4CRW A;  2ZGD A;  2KCK A;  3EIJ A;  3EUV A;  2BKG A;  4U8H A;  1UN9 A;  4O1O A;  4EEC A;  3DEP A;  4BY6 A;  4Y6C A;  2ZU6 B;  2JAB A;  4LUN U;  2PQR A;  2R17 C;  3Q15 A;  3EIQ C;  3ZYQ A;  1GW6 A;  3D9P A;  1E8Z A;  2HM8 A;  2IO3 C;  3ZYK A;  4DI4 A;  1DCE A;  1Z3X A;  1IHG A;  4GYW A;  1UW4 B;  5AQ7 A;  4KVM A;  3BQO A;  4FP7 A;  3FUF A;  4QQI A;  3CHO A;  2P9P G;  3L22 A;  3J5P A;  1KT1 A;  4GZ3 A;  4LCT A;  1X81 A;  4RG6 A;  1HG2 A;  4G1T A;  3L17 A;  3CVN A;  3Q7A A;  3B7T A;  1HZ4 A;  1WG0 A;  2IY0 C;  2I2O A;  2KCL A;  4HFG A;  2WXN A;  3CSF A;  3LPZ A;  3PDN A;  5IY5 E;  4G26 A;  4BX9 A;  3HVE A;  1HS6 A;  3KAE A;  2F8Y A;  4LNG A;  4OYS A;  2DYR E;  3GW4 A;  4U0U A;  5ARF A;  2ZGG A;  4GZD A;  4XKC A;  4HOR A;  4A3T A;  1JCS A;  2EQX A;  4RG9 A;  4GZ6 A;  4B0Z A;  3SNX A;  4HXI A;  3IEG A;  2A5E A;  3IHV A;  1W3B A;  1H2U A;  4I1O B;  4IRU A;  4GZ5 A;  3TG5 A;  2PL2 A;  5FIN A;  3PRE A;  5E75 A;  3UT4 A;  2FI7 A;  1FT1 A;  2V8S E;  5CRU A;  3VLD A;  3W9F A;  3ZFW A;  4AJW A;  4W9R A;  5D0Q D;  3NOG D;  2RFA A;  3RIB A;  3FU0 A;  2WXK A;  3KSQ A;  2IQC A;  4I6G A;  4U96 D;  1XNF A;  3MZL B;  4N39 A;  4YDE A;  4WWO A;  1N4Q A;  5FIO A;  2L6B A;  2CG3 A;  4EBA G;  4FAD A;  2LNI A;  5B1B E;  2WXF A;  5H7P A;  4ABN A;  1TJF A;  2OCC E;  2GGF A;  4NUR A;  4L9P A;  4AOF A;  3CHS A;  2WXG A;  2X6K A;  2MHK A;  4AEZ C;  2I6H A;  4XI9 A;  3LVQ E;  3Q75 A;  1MJ0 A;  3TWX A;  3PUK A;  4A63 B;  3APF A;  2IU1 A;  4G8L A;  3DEO A;  3S7B A;  2X6J A;  2Y4U A;  2Y4T A;  2VSN A;  1XGW A;  3AG4 E;  4IN3 B;  4G8K A;  1E8X A;  3U9W A;  5LOZ A;  1TN8 A;  1BI7 B;  2WM9 A;  4FC8 A;  5BXU A;  1YMP A;  1ZU2 A;  4E6H A;  1V54 E;  1KLX A;  1ELK A;  1UJK A;  3KSL A;  4PS8 A;  3ZEF A;  4U04 A;  5G04 J;  2LAH A;  1SA5 A;  4ATZ D;  1E7V A;  4I2W A;  3SFZ A;  3BUA A;  4GTM A;  1D9S A;  4G25 A;  1N11 A;  2A4Z A;  2WXI A;  4GA0 A;  2DCP A;  4U7E B;  4GCN A;  1IQU A;  3D9K A;  2QZA A;  4L1B A;  2V4H C;  3QWP A;  3B95 A;  1E96 B;  3RRM B;  2YIN A;  5AN8 A;  4UUC A;  4GPK A;  3U4T A;  2XGM A;  4UQY A;  4FA6 A;  2AWI A;  2R59 A;  3ULQ A;  3BG0 B;  3ZXS A;  5AQB A;  1KT0 A;  3T8K A;  3NBN B;  3EHQ A;  2GRP B;  1WDY A;  4M7C A;  5KNH D;  5LX8 A;  5CMY A;  2XPY A;  3RK6 A;  4XEI G;  4OAU C;  3LCA A;  2XRZ A;  4L2L A;  4X8Q A;  4R7L A;  3UM0 A;  4JC8 A;  3FUH A;  4K5C A;  1RZ4 A;  4ACL A;  2LXM A;  1OWN A;  4XKB A;  3QDN A;  4UI9 C;  3FH8 A;  3JXI A;  1NA0 A;  5A7D B;  4PS7 A;  3UT8 A;  1IKN D;  1O1S A;  2VJ8 A;  5AEN A;  5FTP A;  3QNK A;  4U0S A;  4BER A;  3DSU A;  3OXL A;  4D10 C;  3L6A A;  2C2L A;  2DIW A;  3ZIM A;  2AW6 A;  3RRU A;  3GYZ A;  4TUU A;  3CK8 A;  1A17 A;  2M63 A;  3GZ2 A;  2EIM E;  4N2S A;  3DWL G;  4HI9 A;  3UTM A;  2VTB B;  1HXI A;  4RVB A;  1HU3 A;  3FTW A;  1OWP A;  4EQF A;  3SFX A;  4WND A;  2KZT B;  5KJK A;  3SFY A;  5EYL A;  3UIO C;  2HYZ A;  3ISM C;  2R5S A;  5BXO A;  1OCZ E;  3FTY A;  3OXG A;  3FTU A;  4U0Z A;  1U3D A;  1TN6 A;  2LSV A;  5KWD A;  5FWQ A;  4TRQ A;  5JMN D;  3PZ3 A;  1V55 E;  3ASD A;  3ZW3 A;  3DSX A;  5JA4 D;  5KBA A;  3AAA C;  4I9E A;  3CQG B;  4CDN A;  1MYO A;  5CHE E;  1NI1 A;  3SY2 A;  3C3R A;  4UQZ A;  3VTY A;  4HOU A;  4BTB A;  2IJG X;  3TXM A;  3FP3 A;  2LUH A;  1BLX B;  1B89 A;  2X6I A;  2OV8 A;  3VTX A;  4I17 A;  4GPM A;  4LSZ E;  3TWT A;  3CHM A;  3VLF A;  5FZQ A;  3ML8 A;  3UT7 A;  1DNP A;  2CFZ A;  4LNU D;  2EIL E;  4JEH A;  1K3Z D;  2EIK E;  1N0R A; 
#chains in the Genus database with same CATH homology
 3MV2 B;  3D9I A;  4UI9 J;  3SZ7 A;  4GYW A;  5LCW J;  1UW4 B;  4CEM A;  1PAQ A;  4KVM A;  4BWR A;  3PRZ A;  4H7Y A;  4FP7 A;  4P29 A;  2X38 A;  5JHB A;  3FUF A;  3JYS A;  4DK5 A;  3IV0 A;  1HFA A;  3CHO A;  4BT9 A;  3L22 A;  3I3N A;  1KT1 A;  3CLJ A;  1WM5 A;  3Q47 B;  5FZS A;  2VTB A;  1TJC A;  4GZ3 A;  4L7T A;  3MGB A;  2BF0 X;  3EHM A;  3PZD A;  3HHM A;  3I4R B;  4LCT A;  4I2Z A;  3ZGQ A;  3RO3 A;  3FUE A;  3SHF A;  3BG1 B;  3JQ1 A;  2PM7 A;  4RG6 A;  3FEX A;  1HG2 A;  5AJD A;  4G1T A;  2FF4 A;  3R9A B;  3L17 A;  3CVN A;  3HIZ A;  3FUL A;  2PM6 A;  3B7T A;  4KBQ A;  1TEZ A;  4DPR A;  1HZ4 A;  4AM9 A;  2I2O A;  2KCL A;  1P5Q A;  3IKO B;  4HFG A;  2WXN A;  1QZ2 A;  3CSF A;  4J8E A;  3TXN A;  1ELW A;  4KZC A;  4XE0 A;  2HO1 A;  3IHY A;  4FU3 A;  3LPZ A;  3PDN A;  3R7R A;  5G04 C;  4G26 A;  2I1K A;  4BX9 A;  3HVE A;  4H7X A;  4JHJ A;  1HS6 A;  3KAE A;  1FCH A;  5ENN A;  5D0O D;  2XHE A;  2GRM A;  4OYS A;  3MA5 A;  3JCK C;  3T8M A;  4GA2 A;  3GW4 A;  4U0U A;  5ARF A;  2WXL A;  5CCL A;  4F7A A;  1HE8 A;  4JXT A;  3NZU A;  4A1G A;  1U3C A;  4GZD A;  3CVX A;  2PZI A;  4XKC A;  1UG3 A;  4HOR A;  2J9Q A;  3FU5 A;  4A3T A;  3RKV A;  2YNQ A;  5FZR A;  2EQX A;  3CVL A;  4RG9 A;  4GZ6 A;  2XEV A;  3S7J A;  4PS3 A;  3ZRH A;  4B0Z A;  5LP0 A;  3SNX A;  1H0A A;  2GRL A;  2AXZ A;  3CST A;  3LYA A;  4HXI A;  3IEG A;  5BUZ A;  2OVF A;  2XPZ A;  4FUL A;  3IHV A;  3G2U A;  3C98 A;  4Q94 A;  5CMW A;  5T8I A;  3UUX A;  2WVI A;  1W3B A;  2J08 A;  2X6H A;  1H2U A;  2ION A;  3G2W A;  4ANV A;  3S2A A;  3KD7 A;  4I1O B;  2V0P A;  1OWL A;  4IRU A;  4GZ5 A;  3TG5 A;  2PL2 A;  3ONL A;  3PRE A;  2X3M A;  4A1S A;  4QFV A;  3TJP A;  5E75 A;  1EF1 C;  2XGO A;  3UT4 A;  2P58 C;  3KS2 A;  3KEZ A;  1BPO A;  2FI7 A;  4LER A;  3QOU A;  2V8S E;  5FT9 A;  3VLD A;  3ZFW A;  1MHQ A;  4AJW A;  4W9R A;  5D0Q D;  4JHK A;  5EX0 A;  1S0P A;  1SZA A;  3RIB A;  4O6F A;  4HLE A;  2YQ8 A;  2WXK A;  3FU0 A;  1HH8 A;  4NQ0 A;  3LEW A;  3QKY A;  3QAQ A;  4FJZ A;  2IQC A;  3ASH A;  3P1U A;  4AVX A;  4I6G A;  4AY6 A;  3QB2 A;  1XNF A;  1Y6I A;  3MCX A;  4MLP A;  1IQR A;  2I9C A;  4OVV A;  3MZL B;  4BT8 A;  4N39 A;  4N3A A;  2Q7F A;  4JEU A;  4WWO A;  3RU0 A;  2MRI A;  2CHW A;  5G2N A;  5KJM A;  1ELR A;  3FU6 A;  5EKQ D;  3LJ3 A;  2CG3 A;  3MYV A;  4ILI A;  4EBA G;  4B94 A;  3WXX A;  2YHC A;  3FUN A;  4FAD A;  5HI7 A;  2LNI A;  3FUK A;  5KCM A;  2LAI A;  3T5V A;  4JL0 A;  2XQ0 A;  2WXF A;  3O48 A;  4ABN A;  1TJF A;  5FJY A;  1FVF A;  4I9C A;  4AP2 A;  1H2T C;  3FUD A;  2GGF A;  4NUR A;  5KJL A;  4C0M A;  5DBK A;  3FTX A;  4ANW A;  3PH0 C;  4CCA A;  3MEK A;  1EPU A;  4XI0 A;  3MKQ A;  2C0L A;  3CHS A;  4AOF A;  3L54 A;  3CKC A;  2KCV A;  4WAF A;  5G05 C;  2WXG A;  2X6K A;  2MHK A;  4ANU A;  4JZY A;  3E4B A;  2I6H A;  4XI9 A;  3ZYM A;  2CHX A;  4MRU A;  4AEZ C;  2J07 A;  4EBA A;  3GZ1 A;  5ARG A;  3LVQ E;  2L0I A;  3NZS A;  5FQ8 A;  3FTS A;  2FO7 A;  3QWV A;  4L2Y A;  4UWF A;  2A5U A;  3PUK A;  2CFU A;  2J49 A;  4URK A;  3APF A;  2IU1 A;  4LRZ A;  2WXQ A;  3S7B A;  3MKQ B;  3AU4 A;  3L16 A;  2X6J A;  3LY8 A;  3DPD A;  3PE4 A;  2Y4U A;  5AIJ A;  5JJT A;  1MQS A;  2Y4T A;  3LY7 A;  2WXO A;  4EZL A;  2VGX B;  4FJY A;  2VSN A;  2NSZ A;  4I1M A;  2FUL A;  1XGW A;  3PUJ A;  3P2B A;  2AXU A;  3SI5 A;  4CGW A;  3CK7 A;  5M72 A;  4IN3 B;  4L23 A;  4HOT A;  2BUG A;  3SBT B;  1E8X A;  3U9W A;  5LOZ A;  4M3O A;  5BW8 C;  2WM9 A;  3HYM B;  4FC8 A;  4IUL A;  2VQ2 A;  4YND A;  3RJV A;  3CGH A;  4PUC A;  5BV0 A;  5JHA A;  1ZU2 A;  1JWG A;  1N54 A;  4J8S A;  3APC A;  4E6H A;  1PC2 A;  3FDH A;  3TGO A;  4KYO B;  2AXV A;  1KLX A;  3UMV A;  2IFU A;  4DJA A;  3D9O A;  3OXF A;  1ELK A;  3LS8 A;  1UJK A;  1OWM A;  3CV0 A;  2VSY A;  4PS8 A;  3ZEF A;  2X6F A;  2FBN A;  3ZHE A;  4U04 A;  3JQ0 A;  2CG2 A;  2LAH A;  3CR3 A;  5G04 J;  3ZN3 A;  3BEE A;  4PH4 B;  4CDM A;  1E7V A;  4HOQ A;  2KAT A;  5A6C A;  2VYI A;  4I2W A;  2OVB A;  2DBA A;  2WXM A;  3ASF A;  4WUY A;  3SFZ A;  5EDS A;  2C0M A;  3Q5M A;  5JJ6 A;  4BTA A;  3FUJ A;  4KXK B;  3D9J A;  4WWN A;  1SQM A;  2GW1 A;  4CDR A;  2VSO E;  2RD0 A;  4F1S A;  4G25 A;  4LEU A;  4F53 A;  4EPZ A;  5E76 A;  2QY7 A;  4I6J A;  3T5X A;  2V5F A;  4Y6W A;  3ASG A;  3D9M A;  3ZHE B;  3NF1 A;  5J08 A;  2A4Z A;  2IOS A;  4GAA A;  2WXI A;  3O4Z A;  4GA1 A;  4GA0 A;  1INZ A;  3Q4A B;  4N3C A;  2DCP A;  1HX8 A;  3AS4 A;  4DLQ A;  3OTN A;  4GCN A;  3G2V A;  3QWW A;  4JHR A;  1UJJ A;  1IQU A;  3ZYL A;  1E90 A;  3D9K A;  3UQ3 A;  5FQ4 A;  3FFL A;  3HDX A;  2WXJ A;  2E2E A;  2PQN A;  4ACK A;  4L1B A;  3QWP A;  4JA7 A;  3FY4 A;  3MJW A;  4MS6 A;  3QC1 A;  1E96 B;  1WAO 1;  3RRM B;  1LF8 A;  2YIN A;  4HOS A;  2I1J A;  1QNF A;  3ZPJ A;  2L9B A;  3CKB A;  4KVO A;  4WWP A;  2JLB A;  4GPK A;  2WB2 A;  3UPV A;  3U4T A;  3FEY A;  1SZ9 A;  3CHQ A;  2XGS A;  1HF8 A;  3LKU A;  1Z6T A;  3PE3 A;  4G11 A;  2XGM A;  4UQY A;  3L13 A;  3FTZ A;  2WXH A;  4FA6 A;  3CQC B;  4JPS A;  2AWI A;  2R59 A;  3ULQ A;  1N52 A;  3B13 A;  4UWL A;  3BG0 B;  4C9B B;  3CVY A;  2OND A;  5DIZ A;  4EZJ A;  2KM4 A;  4G23 A;  5FQ6 A;  3ZXS A;  3CVU A;  3FUM A;  2WXP A;  1KT0 A;  3URZ A;  3QAR A;  3CVV A;  5BPP A;  4UWH A;  4CGV A;  4V3I A;  4J8F A;  4UWK A;  4XZ4 A;  5ANL A;  3TAX A;  3UX4 A;  4CT4 A;  1QQE A;  3NQP A;  3PVL A;  5LX8 A;  5CMY A;  5FQ7 A;  3FH5 A;  4FHJ A;  2XPY A;  3TG4 A;  4F3V A;  2NXP A;  4BFR A;  3CVP A;  2J4D A;  3RK6 A;  4ATG A;  4ANX A;  4HVB A;  3VLE A;  3K9I A;  3FHE A;  1Y8M A;  1Z3Y A;  3LCA A;  2WQ7 A;  1PY1 A;  4GMJ A;  5A23 A;  3L08 A;  2XRZ A;  1WY6 A;  4U07 A;  1FVH A;  5EX3 A;  4L2L A;  4APF A;  1NZN A;  4R7L A;  4JC8 A;  3FUH A;  5BV1 A;  1JUQ A;  3SGH A;  3CVQ A;  4AXH A;  2VSX E;  4ACL A;  4K03 A;  2VGX A;  3I4G A;  4Q96 A;  3ZVV A;  1HG5 A;  1OWN A;  2NC9 A;  3U66 A;  4XKB A;  5BNW A;  3S7F A;  3QDN A;  4UI9 C;  5LCW C;  4GML A;  3LDZ A;  3ML9 A;  3FH8 A;  1NA0 A;  5A7D B;  2WQH A;  1OWO A;  5G05 J;  4PS7 A;  3UT8 A;  2VJ8 A;  3D3M A;  3CHP A;  5AEN A;  4XIF A;  2OOE A;  5FTP A;  3QNK A;  3I5P A;  4U0S A;  3LVR E;  4ILH B;  1JWF A;  2UY1 B;  3SF4 A;  2WMN A;  4KT6 B;  3ENE A;  3OXL A;  1X5B A;  2WMO A;  5KJN A;  3RRN B;  3DBS A;  4D10 C;  3FTV A;  3L6A A;  2C2L A;  3B7U X;  1NA3 A;  2DIW A;  3FWV A;  4UI9 K;  3ZIM A;  2AW6 A;  1E7U A;  4N5C A;  2ILR A;  3D9L A;  4UQX A;  4I6E A;  3RRU A;  1OUV A;  3GYZ A;  3R7Q A;  3PNL B;  4TUU A;  5LFA A;  3CK8 A;  1A17 A;  2KZT A;  2M63 A;  3GZ2 A;  3FU3 A;  5T4Y A;  3N71 A;  1YA0 A;  2WQ6 A;  4WNF A;  4N2S A;  4I1A A;  4BX8 A;  4KZ0 A;  2Y3A A;  3B7S A;  2UWJ G;  4JW1 A;  4PDX A;  2VTB B;  2MOW A;  1HXI A;  3CK9 A;  4JA9 A;  4RVB A;  5J90 A;  1HU3 A;  3FTW A;  4K0R A;  4XX5 A;  3AS5 A;  1DVP A;  1OWP A;  2AVP A;  2HR2 A;  2RG8 A;  2J4B A;  4AIF A;  4C0E A;  4WND A;  4EQF A;  2KZT B;  4ME2 A;  2JEK A;  5KJK A;  1NP7 A;  5T3R A;  3TL5 A;  1IYG A;  4A55 A;  4B8A A;  5JJ7 A;  2HYZ A;  2J09 A;  3LY9 A;  3PEU B;  4GCO A;  1ZBP A;  3FH7 A;  3EHN A;  2V4L A;  2XRY A;  2R5S A;  4WNG A;  3EDT B;  4DI3 A;  4OVU A;  4GZC A;  2LO6 A;  3CIA A;  2IOL A;  4AV7 A;  2FEZ A;  3B7R L;  5CCM A;  4B8C B;  2WXR A;  2XCB A;  3FTY A;  3HVE B;  3CHR A;  3FUI A;  3IBE A;  3OXG A;  2XCC A;  3FTU A;  4TV3 A;  4U0Z A;  1U3D A;  4UWG A;  5AYW D;  4E85 A;  2LSV A;  2WPV A;  4JVS A;  4U63 A;  2XPI A;  1E8Y A;  3SBS A;  5C2Y A;  4APO A;  5FWQ A;  4TRQ A;  3JUI A;  3CVW A;  5BT1 A;  4Q69 A;  1L5J A;  3APD A;  3AU5 A;  1H6K A;  3ASD A;  3ZW3 A;  4G2V A;  2QFC A;  3S7D A;  4I9E A;  4RSY A;  3PEV B;  4FLB A;  2L0T B;  4CT0 A;  4EZK A;  3CQG B;  5C1D A;  4NAC A;  3LXU X;  2KC7 A;  3ESL A;  4GYY A;  4WNE A;  4CDN A;  5CHE E;  4KMO A;  3QJZ A;  4YVQ C;  2IF4 A;  1UN8 A;  3RO2 A;  4G24 A;  2BTD A;  4UQZ A;  3MX3 A;  4YVO A;  4MKT A;  3U3W A;  2YHE A;  2CHZ A;  4FLH A;  3ESK A;  4DLO A;  1HO8 A;  3GZS A;  2E0I A;  3MV3 B;  4FHK A;  5ANR A;  3VTY A;  4BSX A;  3AS8 A;  3D9N A;  4J8D A;  4B89 A;  3Q49 B;  4AY5 A;  4HOU A;  4I43 A;  4GYO A;  4N2Q A;  4CRW A;  5HQ8 A;  4BTB A;  4NRH B;  2KCK A;  3EIJ A;  1EDU A;  2IJG X;  3ONK A;  3TXM A;  3FP3 A;  4GU5 A;  5G55 A;  1B89 A;  2X6I A;  1E8W A;  1UN9 A;  4U8H A;  1JPL A;  2OV8 A;  3VTX A;  4I17 A;  2L6J A;  4EEC A;  3MKR A;  4N3B A;  3QK0 A;  4BY6 A;  1VDY A;  4HS2 A;  3CHM A;  3VLF A;  4Y6C A;  3EJN A;  3G2T A;  3OAW A;  5FZQ A;  2ZU6 B;  1H19 A;  3ML8 A;  2LSU A;  3G2S A;  3UT7 A;  1DNP A;  2PQR A;  2R17 C;  4LUN U;  2UY1 A;  2CFZ A;  3PS6 A;  4A3V A;  4IYP A;  3Q15 A;  5AJL A;  3EIQ C;  3ZYQ A;  4GB9 A;  1GW6 A;  3D9P A;  1E8Z A;  2HM8 A;  3PNT B;  2VGY A;  3ZYK A;  4DI4 A;  3CEQ A;  4JEH A;  4ILG A;  4J0U A;  3U64 A;  1Z3X A;  1H2V C;  3SD5 A;  4J6I A;  1EYH A;  1IHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...