4I17A

Crystal structure of a tpr repeats protein (bf2334) from bacteroides fragilis nctc 9343 at 1.50 a resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
224
structure length
224
Chain Sequence
b'TTDPNQLKNEGNDALNAKNYAVAFEKYSEYLKLTNNQDSVTAYNCGVCADNIKKYKEAADYFDIAIKKNYNLANAYIGKSAAYRDMKNNQEYIATLTEGIKAVPGNATIEKLYAIYYLKEGQKFQQAGNIEKAEENYKHATDVTSKKWKTDALYSLGVLFYNNGADVLRKATPLASSNKEKYASEKAKADAAFKKAVDYLGEAVTLSPNRTEIKQMQDQVKAMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (BF2334) from Bacteroides fragilis NCTC 9343 at 1.50 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 95
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2012-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i17A00
3IEGA 5DIZA 3ZHEA 2LSVA 2R5SA 3FP3A 4YVOA 4N2SA 4U0ZA 1QQEA 4I2WA 4N3BA 3CV0A 1YA0A 3LY9A 3MA5A 4Y6WA 5EKQD 3U3WA 4G2VA 3GYZA 3ASHA 4NQ0A 1NZNA 3U4TA 3MEKA 3MV3B 1KT1A 2YQ8A 2VGXB 2FF4A 3LKUA 1QZ2A 3Q4AB 4N3AA 3RO2A 2LSUA 3S7DA 4JHRA 5LCWJ 4GZ3A 3QWVA 2FO7A 2PQNA 4WNGA 4BTBA 3Q47B 1ZBPA 4CDRA 1A17A 3AS8A 4GYOA 4KXKB 4GA1A 3KD7A 4BT8A 3RJVA 2WPVA 4ME2A 4A1SA 1WAO1 4HOQA 3N71A 4AY6A 2C0LA 3Q49B 3EDTB 4H7YA 4O6FA 4RG9A 4AIFA 4CGWA 1HXIA 3AS5A 2LNIA 5JJ6A 4N5CA 2XPIA 3LY8A 5D0OD 3KAEA 3GZ2A 3AS4A 4WNFA 1PC2A 2C0MA 3KS2A 3CEQA 1TJCA 4KBQA 4UI9C 4BT9A 2KCLA 3VTXA 4U04A 2KATA 2VGYA 5KJKA 2IF4A 3PE4A 3CK7A 3QWWA 1WM5A 4G26A 2HO1A 2NC9A 2OOEA 2QFCA 4XI0A 3ZFWA 4N2QA 4UI9J 2VGXA 2VSNA 4GYYA 2DBAA 4LEUA 3CK9A 5ARGA 4WNEA 4HOSA 2PL2A 3S7FA 5AYWD 4NRHB 3TG5A 3TGOA 4N3CA 3UQ3A 5KJLA 4UI9K 3UUXA 4HOUA 4BWRA 4JA9A 4CGVA 5KJNA 5G04J 3VTYA 2KCVA 3UPVA 4G23A 3E4BA 3TG4A 3MV2B 5LCWC 3QOUA 3CVNA 3RIBA 5CCLA 3OXFA 5JJTA 3FFLA 3ESKA 4Y6CA 2MHKA 3JYSA 2JLBA 2Y4UA 1P5QA 2C2LA 5BT1A 3HYMB 3FWVA 4HORA 4WNDA 4IN3B 5G05C 2AVPA 3PE3A 4G25A 5D0QD 4I9EA 5M72A 4UQZA 2YHCA 2ONDA 1KT0A 3ASFA 5ARFA 2HYZA 5G05J 5FZRA 3QKYA 4KYOB 4HOTA 4BTAA 2GW1A 4J0UA 4G1TA 3SF4A 4U07A 1B89A 3LPZA 1HZ4A 2XGMA 4I17A 2VSYA 4GYWA 3CKCA 3URZA 4GCNA 5CCMA 2UY1A 4GA2A 4GZ5A 2PQRA 5FZSA 4GCOA 4J8FA 2L6JA 5FTPA 2P58C 3S7BA 5G04C 2HR2A 5DBKA 3OXGA 2XGSA 3O48A 4APOA 2VYIA 3CKBA 3Q5MA 4W9RA 1ELRA 3QWPA 3LYAA 1OUVA 5FZQA 4YVQC 3OXLA 3NF1A 4RG6A 5HQ8A 4H7XA 3S7JA 4I9CA 3R9AB 2BUGA 2Y4TA 3TAXA 4AM9A 3PDNA 3CVLA 1NA3A 2UY1B 5EX0A 3ASGA 4GA0A 3Q15A 4I1AA 5FT9A 1NA0A 2I6HA 2E2EA 1W3BA 1E96B 4AY5A 2KCKA 4XIFA 4ABNA 3RO3A 4EQFA 2FEZA 3ULQA 3SZ7A 4GZ6A 2XGOA 5FJYA 4UQYA 4U0SA 1IHGA 3LCAA 1Y8MA 3LY7A 3RKVA 3ZN3A 4J8DA 5KJMA 1FCHA 4UQXA 4N39A 3ZHEB 4B94A 1KLXA 2XCBA 5C1DA 4U0UA 5EX3A 2Q7FA 1XNFA 2V5FA 1ZU2A 4F3VA 2KC7A 3WXXA 2UWJG 4WUYA 3ASDA 5JJ7A 2J9QA 5HI7A 3K9IA 3CVQA 3RU0A 1IYGA 1ELWA 2FBNA 3GZ1A 3QDNA 4JL0A 5A6CA 5A7DB 3CVPA 4JA7A 5BNWA 2XCCA 3GW4A 3MKRA 3BEEA 4G24A 2PZIA 4XI9A 3ZPJA 4I2ZA 4J8EA 5BW8C 2WQHA 3ZGQA 4YNDA 2VQ2A 2XEVA 2IFUA 2FI7A 1HH8A 5CHEE 4GPKA 3CK8A
chains in the Genus database with same CATH superfamily
3T5XA 1L5JA 3DXKG 3IEGA 4C9BB 3ZHEA 1HS6A 4LG6A 4O1PA 3FP3A 3UTMA 1OCOE 2XZDG 4C0EA 2EIME 3CV0A 1YA0A 4FLHA 4Y6WA 3U3WA 4L2YA 3ASHA 4NQ0A 3U4TA 3LEWA 3E32A 2VGXB 2FF4A 2XS8A 1QZ2A 3BG0B 3RO2A 2LSUA 3KSQA 3D9JA 2X6FA 5LCWJ 4IRUA 3CHMA 2PQNA 4HVBA 1JCSA 4CDRA 1E8ZA 4GYOA 3ZYMA 5JA4D 1RZ4A 3CSTA 2WPVA 4ME2A 3SD5A 4B89A 2P2CP 4O6FA 4H7YA 5HKPA 4AIFA 2X3MA 4CGWA 3AS5A 5AJDA 5ANLA 1SA4A 3Q7FA 3W9FA 3C5RA 4JHKA 2B0OE 5KCMA 3UT8A 5JHAA 3AS4A 2NYJA 3D9KA 2WQ6A 4WNFA 3CEQA 4PH4B 3HXCA 4AEZC 1H2UA 1N4QA 1H6KA 3NQPA 3MKQA 2KATA 2WXKA 2IF4A 3CK7A 2XPYA 4G26A 1S64A 4A55A 3HHMA 4UI9J 4GYYA 5A23A 2VTBB 3FU5A 3CK9A 3S7FA 4G8LA 1JWGA 3FY4A 1Z5SC 4U7EB 3SI5A 2OCCE 4N3CA 4DI3A 4LERA 2ETCA 5AN8A 3UUXA 1OXJA 4B93B 3WG7E 4ILIA 1QBQA 3L22A 2QYJA 5G04J 1BLXB 3VTYA 1H19A 3TG4A 4AP2A 2QZAA 3SO8A 3HXFA 3CVNA 2LO6A 3OXFA 5JJTA 2I2OA 3VLEA 1RW2A 1Z3XA 2IQCA 3QB2A 3NZUA 5AAOA 4B0ZA 3FTUA 1X81A 2VGEA 2Y69E 4MKTA 4EZJA 2XPZA 4OVVA 4APFA 5CRUA 3C3QA 4PS3A 4IN3B 3C3OA 4HQDA 3EJNA 2RFAA 2XQ0A 3LVRE 3PZ1A 4G25A 5KBAA 4A3TA 3DBSA 2YHCA 2ONDA 3FTWA 1KT0A 3ASFA 1SVXA 5BXOA 3MGBA 5ARFA 3ASNE 2NXPA 1MX6A 5FZRA 2RG8A 3QKYA 1QYMA 2RKKA 1N0RA 3DSTA 3TXMA 2LXMA 1JCQA 3FUIA 4NACA 3SF4A 1JWFA 5AQ9A 1S70B 1B89A 1MJ0A 5H7PA 3LPZA 1HZ4A 4I17A 4OAUC 3CKCA 2AXVA 5CCMA 4GA2A 1TNBA 2J08A 4GZ5A 2L0IA 4BERA 3MZLB 3L17A 4FHKA 4KVMA 3G2TA 4NIKA 4GCOA 3FTYA 2IO2C 4B8AA 3ZYQA 3S7BA 4DX2A 5G2NA 2EIJE 2H6GA 2J09A 1JUQA 5DBKA 3OXGA 5ENNA 3O48A 4J7WA 2WQ7A 5C2YA 3EHMA 3LYAA 4IULA 4FU3A 4RG6A 5HQ8A 3FDHA 2CFZA 1TR4A 3ABKE 3ZYKA 1ELKA 2BUGA 3D9MA 4M3OA 3V31A 5CBNA 3T9KA 3FH7A 3TAXA 1NA3A 1FPPA 3EIJA 5FT9A 1NA0A 3FEXA 4HNAD 1W3BA 1N95A 4HRLA 2PM6A 4HRMB 4GZCA 4ABNA 3RO3A 4EQFA 2B6CA 2NSZA 2XGOA 2ILRA 3EHRA 4R7LA 3JQ0A 3AG3E 1ZB1A 4UQYA 4U0SA 3AJIA 1KZPA 3LCAA 3B7RL 1Y8MA 3CGHA 2X6IA 3I4RB 1E8YA 3RKVA 3UT7A 3UT4A 4I1MA 4J8DA 4U8VD 1JPLA 4UQXA 4XX5A 4N39A 4B94A 5E76A 4U0UA 5EX3A 2Q7FA 1O1TA 2KM4A 1XNFA 1EPUA 2V5FA 2WM9A 1ZU2A 4F3VA 5BXUA 4RQIA 1N11A 1GW6A 3NBNB 4UWHA 4RLYA 4WUYA 4YDWA 3U64A 4N5QA 5FQ4A 4ZHBA 3FH5A 3C98A 5HI7A 1K8KG 3DPYA 3LXUX 3SBTB 2GRLA 4GMRA 4AV7A 5KWDA 1IYGA 5CEAA 3PUJA 1YYHA 4HB5A 3FH8A 5HS0A 4JL0A 5A6CA 3AU4A 1S0PA 3CVPA 4FJYA 3Q73A 3MKRA 4EPZA 3BEEA 4I6GA 3UIOC 1HF8A 2KZTB 3PUKA 3E37A 5BW8C 3FTXA 1IQUA 3EHNA 4YNDA 5G55A 1YCSB 5CHEE 4GPKA 3IBEA 2IEJA 3E30A 3CVYA 3ZW3A 1K1AA 4U96D 2RD0A 4V3IA 5AARA 2WXQA 3U66A 3CHSA 2WVIA 3PNTB 4XKBA 2DYRE 1Z6TA 3DSVA 1YMPA 4L9PA 4PUCA 5KNGA 3V79K 2J8SD 5EKQD 3ULYA 1IKND 3GYZA 3T8MA 4CT4A 3MEKA 1H6PA 1E8XA 4K5BA 4Q96A 3Q4AB 2WXOA 1NP7A 3HG0D 4WWOA 2ZGDA 3QWVA 1WG0A 3EU5A 1HG5A 4F1PA 5AJLA 2FO1E 4XKCA 1FVFA 4L23A 3TWVA 1MX4A 2XEHA 4GA1A 3KD7A 4BT8A 1HE8A 3Q75A 1NFIE 4HOQA 3Q49B 3SFYA 5LFAA 4BX9A 4LNUD 3UMVA 3ABME 5FQ7A 4LCTA 4K03A 3I4GA 5EILA 1DCQA 3LY8A 1BI8B 5E75A 3IXEA 2GRQB 1PC2A 3KS2A 1IQRA 2YNQA 1TJCA 4UI9C 2R05A 3VTXA 2QY7A 3L9TA 2VGYA 5JMND 2QYUA 4GU5A 4EZLA 3PE4A 3FTSA 5J90A 1WM5A 3LVQE 2Y1LE 2WXMA 2OOEA 2QFCA 2VSNA 4HI9A 2X6JA 3T8KA 2P9KG 4TXRA 5ITZF 4LEUA 2PM7A 2XZTG 4YDOA 2PL2A 1TNUA 4NRHB 4DK5A 5KJLA 4TUMA 4UI9K 3TWXA 4HOUA 4L2LA 5CEDB 5T3RA 4JA9A 4CGVA 1IHBA 5CERB 4ILGA 4K5CA 1OWMA 4GMJA 5KJNA 2P9SG 5LX8A 1BI7B 3HXBA 3UPVA 4G23A 4U8YD 3ZVVA 3NB2A 3QOUA 3TXNA 2J49A 1S63A 3RAUA 3FFLA 3L13A 4GTSA 4Y6CA 1AP7A 3JYSA 1KPSB 3ABLE 2CG3A 3HVEB 1P5QA 3HYMB 3IKOB 4HORA 4FJZA 1BU9A 2WXHA 4UWKA 3JCKC 3FULA 1D8EA 2HM8A 2DWZA 1HX8A 3FU3A 5BV0A 4WWNA 1WY6A 3D3MA 2J07A 5ENPD 5EN5D 4EZKA 3UM3A 3CVWA 4J6IA 3CQCB 4HOTA 2IOSA 1E90A 3Q78A 4HS2A 3UM1A 4JC8A 4G1TA 2WXNA 2ETAA 4XZ4A 5D2MC 4U07A 1UW4B 2A4ZA 5T4YA 2XGMA 4GYWA 3KEAA 3JQ1A 1TYQG 4GTRA 3UINC 2PQRA 5LP0A 1KZOA 1U3DA 4JEHA 3TL5A 2F0YA 2L6JA 2DYSE 3TWSA 2YINA 3FEYA 2AJAA 5EYLA 1N0QA 2WB2A 2VYIA 4DX6D 3Q5MA 4W9RA 1ELRA 4IYPA 3IHVA 3HXDA 5T8IA 1OUVA 3Q79A 4YVQC 2WXGA 4PS7A 3ZKJA 3NF1A 4P29A 3ML9A 2X6KA 1OT8A 4H7XA 3DXMG 3RRNB 2XRYA 4GMLA 4JHJA 2M63A 1JCRA 3HXEA 1UOHA 3B7SA 2Y4TA 4AM9A 2DIWA 2R03A 1LD8A 3CVLA 3FUKA 1DNPA 4XEIG 2UY1B 3CSFA 2VJ8A 5BUZA 2V0PA 1HFAA 4KZ0A 2AWIA 3MJWA 2X6HA 4MBGA 1SZ9A 1TNZA 3SZ7A 2OEVA 4FULA 1O1SA 1TEZA 1N52A 4HLLA 2DZNA 2P9PG 4LNGA 3ZN3A 4DUIA 5KJMA 1FCHA 4OYSA 3ZHEB 2V4HC 5C1DA 3UM0A 4A3VA 4FLBA 4K0RA 4EHMA 2Y3AA 2A5EA 3B7BA 3FU0A 3JUIA 1N4RA 3PNLB 4EBAA 1E8WA 2LUHA 2IONA 3OTNA 4E85A 4LSZE 2WXJA 2I1JA 4JZYA 1EDUA 5FWQA 3RU0A 2GRNB 3UI2A 3AG1E 1ELWA 2FBNA 3RSEG 1LTXA 2GRRB 4WAFA 4PS8A 3KSLA 5BNWA 3O4ZA 4A1GA 2P9IG 2PZIA 2MRIA 4I2ZA 1IXVA 4J8EA 3R9MA 2F8XK 1A5EA 2CG2A 3DSSA 1HH8A 4GPMA 3CK8A 2OVFA 3DSXA 4JXTA 4G11A 3SNXA 5AENA 3ZRHA 5DIZA 3PZ3A 2LSVA 2R5SA 3IV0A 1OCCE 4GTVA 4N2SA 1U2VG 3MKQB 4O1OA 1TNOA 1OY3D 3ULEG 4I2WA 4N3BA 4TXPA 1WDYA 3MYVA 5J08A 4ZFHA 4G2VA 2VSXE 3QNKA 4GTQA 3MV3B 3E33A 3LKUA 3JXIA 3X2QE 5BV1A 4JHRA 1E7UA 2GRPB 5CECB 3QARA 4GZ3A 4JW1A 2FO7A 4WNGA 4BTBA 2J4DA 1V54E 3VLFA 3Q47B 4KT6B 1ZBPA 3I5PA 3AS8A 4KXKB 5CMYA 3CVUA 4XE0A 4GZDA 3N71A 3EDTB 2F37A 4NURA 4RG9A 4U95D 4I43A 2OV8A 2XPIA 5D0OD 3KAEA 2WXRA 3RRUA 1O1RA 5EIBE 3FHEA 2C0MA 4BEPA 3V2XA 4KBQA 2ETBA 4U04A 3LDZA 3CHQA 1TN6A 3FUDA 3JUEA 2WMOA 3QWWA 3CLJA 4J8YA 3P2BA 2HO1A 2JABA 3ZFWA 4N2QA 4CYMD 4M7CA 2VGXA 4FADA 2DBAA 3MCXA 2IOLA 3SFZA 4DI4A 4HOSA 2R02A 3UKUG 2H6HA 2GGFA 5AYWD 3TG5A 3HVEA 4CDNA 4TRQA 3UQ3A 3UXGA 5HRYA 3D9NA 2WXLA 4BWRA 3L54A 4GAAA 1AWCB 4OAVB 2L6BA 3MX3A 3E4BA 4DX5D 2OVBA 2R2LA 4CZ2D 3MV2B 2V8SE 5LCWC 3U9WA 3UKRG 3RIBA 3IHYA 4RSYA 4I1OB 5ENSD 2DZOA 2I9CA 2MHKA 1PY1A 3CHPA 3D9HA 3FUJA 4OVUA 2C2LA 3B95A 3T5VA 2VSOE 3FWVA 3ZU7B 2XENA 2VTBA 3TWRA 4YDYA 1DC2A 4UWGA 2BKKB 2WXPA 4I9EA 5M72A 2PNNA 4UQZA 2Y0BG 2R59A 4Q69A 2HYZA 5G05J 1HG2A 3PH0C 4I6EA 4KYOB 4HRNA 3UM2A 4BTAA 3SGHA 2GW1A 4JB8P 5ANRA 4J0UA 3CVXA 5KNHD 1EF1C 4F6RD 3URZA 3AG2E 2UY1A 4ANVA 3GZSA 3ZYLA 4FA6A 4BFRA 1U3CA 4AOFA 3L82A 3DSWA 2HE0A 4DPRA 2WXIA 4L7TA 3APDA 1BPOA 1K3ZD 5G04C 4UWLA 4BETA 3BQOA 3J5PA 4HXIA 2HR2A 2CHWA 1MQSA 5BPPA 3TJPA 1FVHA 4KMOA 2CHZA 4ILHB 2QC9A 5FZQA 1SZAA 1OWLA 3NZSA 3BUAA 3QAQA 4I9CA 3ONKA 3CHOA 3APCA 4QQIA 4BSXA 4UUCA 3ASGA 4GA0A 3D9IA 2XS1A 2I6HA 1MHQA 2XRZA 3ASOE 3HDXA 1E96B 4AY5A 4XIFA 4PDXA 3TWUA 3R7QA 1OWNA 1TN7A 4GZ6A 2WXFA 1OCRE 1SW6A 3ISMC 2H6IA 3TWQA 1H6OA 3NOGD 1SA5A 3EU9A 3LY7A 2FULA 4ATGA 2P9UG 1TJFA 2EQXA 3D9OA 2H6FA 1N54A 1H2VC 3ENEA 2V5QC 3FUEA 5ENOD 4JVSA 3FUHA 3APFA 1FT2A 2JEKA 3W9GA 2UWJG 3VLDA 5EIDA 2J9QA 3DRAA 3G2VA 1INZA 2BEDA 4HLEA 4BX8A 3L16A 3PEUB 3GZ1A 3QDNA 5A7DB 3V30A 4JA7A 3OAWA 4ACLA 3ZXPA 2XCCA 3GW4A 2LXLA 1TN8A 1OWOA 1EYHA 4G24A 4LUNU 4XI9A 3ZIMA 4WWPA 2CHXA 4JPSA 1XGWA 3ZNGA 3DWLG 4K5AB 2WQHA 3ZGQA 4ANXA 2FI7A 5JHBA 2BKGA 1MYOA 3S2AA 3FU6A 3BG1B 1H0AA 3FTZA 2OEWA 2EINE 4YVOA 4FC8A 1OCZE 5AQ7A 2ZXWE 3RRMB 4U0ZA 1QQEA 5FIOA 3PEVB 4JEUA 4DLQA 4TV3A 3UX4A 3DEOA 1NL4A 3LY9A 3MA5A 3Q9UC 3CVVA 1N4PA 2IU1A 4LNBA 1NZNA 3ONLA 1LF8A 3ZXSA 1KT1A 2YQ8A 4ANUA 4UWFA 1HU3A 1Q2ZA 5B1AE 4N3AA 3NAWA 3S7DA 5ENTD 3TWWA 4AJWA 1A17A 3D9LA 4Q94A 4MS6A 2KZTA 1V55E 3RJVA 3LJNA 2IO3C 1UJKA 4A1SA 1WAO1 1Z3YA 2AXUA 5CBOA 4AY6A 2C0LA 5ENRD 2P9LG 3C72A 3CQGB 4GTOA 1HXIA 1HO8A 5CRVA 3V2OA 2LNIA 5JJ6A 5B3SE 3PZ4A 5AQBA 4N5CA 1MX2A 3GZ2A 3EUVA 3AAAC 1H2TC 3R7RA 3ZUVB 4I6JA 3Q7AA 4BT9A 2KCLA 5ENQD 3SBSA 5KJKA 4CEMA 3QJZA 3SQVA 4C0MA 3DSUA 4MLPA 1N4SA 2NC9A 4XI0A 4DX1A 4AVXA 4GTTA 4C48B 2GRMA 1D8DA 2ZGGA 4ACKA 2XHEA 5ARGA 3CHRA 4WNEA 3KEZA 3LJ3A 4KVOA 2IJGX 4U63A 3TGOA 1O5MA 2A5UA 4L1BA 4CCAA 5AIJA 2KBXA 1UG3A 1UJJA 3UIPC 2ZISA 4F1SA 4D10C 4DX7D 3SHFA 4F53A 5D66A 4J8SA 4E6HA 2KCVA 3G2WA 3FUFA 1NI1A 3PZDA 2EIKE 2YHEA 1N94A 2AW6A 5CCLA 3HRAA 3SFXA 3B13A 4BY6A 3ESKA 4F7AA 2JLBA 2E0IA 3FUNA 5AQAA 3AU5A 4B8CB 1D9SA 2Y4UA 3NOCD 1LD7A 5BT1A 5FINA 3L6AA 4WNDA 2XEEA 1Y6IA 3J5QB 5G05C 4EBAG 2AVPA 3PVLA 3PE3A 4O60A 1G3NB 5D0QD 2MYOA 2EILE 4RVBA 1TNYA 3P1UA 4G8KA 2LAHA 4LRZA 2BF0X 4GTPA 1MZCA 2MOWA 3CIAA 2V4LA 3QK0A 2AXZA 4Z68A 4JD2G 4BSZB 2CFUA 2VSYA 3I3NA 4GCNA 4GTMA 5EYPF 4FP7A 3FTVA 2DCPA 5B1BE 2F8YA 3ZEFA 1DCEA 5FZSA 3HIZA 4J8FA 3BU8A 2IY0C 4MRUA 5FTPA 3L08A 2P58C 4CDMA 1UN8A 2XGSA 4APOA 4BESA 3CKBA 2R17C 3AG4E 3QWPA 1QNFA 3B7UX 3OXLA 3E34A 3TWTA 3ESLA 1UN9A 3S7JA 5EDSA 3R9AB 2ZU6B 2DVWA 3PRZA 4HBDA 4ATZD 3G2SA 3PDNA 5FQ8A 5EX0A 3Q15A 4FHJA 4I1AA 3EHQA 5FQ6A 1X5BA 2E2EA 3F6QA 3JXJA 3LS8A 1K1BA 2LAIA 2KCKA 3B7TA 2FEZA 4KZCA 4ANWA 3ULQA 2P9NG 1FT1A 5FJYA 2GROB 1IHGA 2BTDA 2KXPC 3PS6A 3CR3A 2I1KA 4URKA 4AXHA 3SY2A 3DPDA 3PZ2A 2ZIRA 2RFMA 3FUMA 1KLXA 2XCBA 3Q9NC 5IY5E 3G2UA 1VDYA 4U8HA 3ML8A 3PREA 4HI8A 3QC1A 5LOZA 4DRXE 2KC7A 3WXXA 4X8QA 3ASDA 5JJ7A 3DEPA 3K9IA 4HFGA 4YDEA 4CRWA 2X38A 3CVQA 2J4BA 4DJAA 4DLOA 1N9AA 5CMWA 4EECA 3EIQC 1E7VA 1SQMA 4GB9A 1PAQA 1OWPA 2L9BA 2L0TB 3C3RA 3ZPJA 2WMNA 3D9PA 4CT0A 4QFVA 2VQ2A 2XEVA 4TXQA 2IFUA 1DVPA 4TUUA 4A63B 1BD8A 3RK6A
chains in the Genus database with same CATH topology
3IBEA 2OVFA 4JXTA 4G11A 3SNXA 3T5XA 5AENA 1L5JA 3ZRHA 3IEGA 5DIZA 4C9BB 3S2AA 3ZHEA 3CVYA 3ZW3A 1HS6A 2LSVA 3FU6A 2R5SA 3BG1B 1H0AA 3FP3A 3FTZA 3IV0A 2RD0A 4V3IA 4YVOA 2WXQA 3U66A 3CHSA 4FC8A 2WVIA 4N2SA 3RRMB 4U0ZA 3PNTB 1QQEA 4XKBA 3MKQB 4C0EA 3PEVB 1Z6TA 4JEUA 4DLQA 4TV3A 4I2WA 4N3BA 3UX4A 4PUCA 3CV0A 1YA0A 3LY9A 3MA5A 4FLHA 3MYVA 4Y6WA 5EKQD 5J08A 3U3WA 4G2VA 2VSXE 3QNKA 3GYZA 3ASHA 4L2YA 4NQ0A 3CVVA 2IU1A 1NZNA 3T8MA 3U4TA 4CT4A 3MEKA 3MV3B 3ONLA 1LF8A 1E8XA 3LEWA 3ZXSA 1KT1A 2YQ8A 4ANUA 4UWFA 1HU3A 2VGXB 2FF4A 3LKUA 1QZ2A 3BG0B 3Q4AB 2WXOA 4Q96A 4N3AA 3RO2A 1NP7A 2LSUA 3S7DA 5BV1A 4JHRA 4WWOA 1E7UA 3D9JA 2X6FA 5LCWJ 3QARA 4GZ3A 4JW1A 3QWVA 4IRUA 2FO7A 3CHMA 1HG5A 2PQNA 4WNGA 5AJLA 2J4DA 4XKCA 4BTBA 4HVBA 3VLFA 3Q47B 1FVFA 4L23A 4KT6B 1ZBPA 3I5PA 4CDRA 4AJWA 1A17A 1E8ZA 3D9LA 3AS8A 4GYOA 4KXKB 3ZYMA 4GA1A 4Q94A 3KD7A 4MS6A 4BT8A 1HE8A 2KZTA 3CSTA 3RJVA 2WPVA 4ME2A 5CMYA 3SD5A 3CVUA 1UJKA 4XE0A 1WAO1 4A1SA 1Z3YA 4GZDA 4B89A 2AXUA 4HOQA 3N71A 4AY6A 2C0LA 3Q49B 3EDTB 4H7YA 4O6FA 4NURA 4RG9A 4AIFA 5LFAA 2X3MA 4BX9A 3CQGB 4CGWA 1HXIA 1HO8A 3AS5A 5AJDA 5ANLA 3UMVA 2LNIA 5FQ7A 5JJ6A 4LCTA 4K03A 4I43A 3I4GA 4N5CA 4JHKA 2OV8A 2XPIA 5KCMA 3LY8A 5D0OD 3KAEA 3UT8A 3GZ2A 5JHAA 2WXRA 3AS4A 5E75A 1H2TC 3D9KA 3R7RA 3RRUA 2WQ6A 3FHEA 4WNFA 1PC2A 2C0MA 1IQRA 3KS2A 3CEQA 4I6JA 2YNQA 4PH4B 4AEZC 1H2UA 1TJCA 1H6KA 3NQPA 4KBQA 3MKQA 4UI9C 4BT9A 2KCLA 3VTXA 2QY7A 4U04A 3SBSA 2KATA 2VGYA 3CHQA 3LDZA 2WXKA 4CEMA 5KJKA 3QJZA 3FUDA 2IF4A 4GU5A 4EZLA 3PE4A 4C0MA 2WMOA 3CK7A 3QWWA 2XPYA 3CLJA 3FTSA 5J90A 3P2BA 1WM5A 3LVQE 4G26A 2HO1A 4MLPA 2WXMA 2NC9A 2OOEA 2QFCA 4XI0A 3ZFWA 4A55A 4N2QA 4AVXA 3HHMA 4UI9J 2VGXA 2VSNA 4GYYA 2GRMA 4FADA 2DBAA 2X6JA 2IOLA 3MCXA 4ACKA 5A23A 2VTBB 3SFZA 3FU5A 4LEUA 5EDSA 3CK9A 2XHEA 5ARGA 4DI4A 3CHRA 4WNEA 4HOSA 2PM7A 3KEZA 2PL2A 3S7FA 3LJ3A 2GGFA 5AYWD 4NRHB 1JWGA 3FY4A 3HVEA 3TG5A 4CDNA 3SI5A 4KVOA 2IJGX 4TRQA 4U63A 4DK5A 3TGOA 4N3CA 3UQ3A 2A5UA 4DI3A 4LERA 4L1BA 5KJLA 4UI9K 4CCAA 3D9NA 3UUXA 5AIJA 1UG3A 4HOUA 2WXLA 4L2LA 1UJJA 4BWRA 4ILIA 5T3RA 4F1SA 4JA9A 4D10C 3L54A 4CGVA 3SHFA 4GAAA 4F53A 3L22A 4ILGA 1OWMA 4GMJA 5KJNA 5G04J 3VTYA 4J8SA 5LX8A 1H19A 2KCVA 3MX3A 4E6HA 4G23A 3UPVA 3E4BA 3TG4A 3G2WA 2OVBA 3FUFA 3PZDA 3MV2B 4AP2A 2YHEA 2V8SE 3ZVVA 5LCWC 3QOUA 3TXNA 3U9WA 2J49A 3CVNA 2AW6A 3RIBA 5CCLA 3IHYA 2LO6A 3OXFA 5JJTA 3FFLA 3L13A 2I2OA 3B13A 4RSYA 4I1OB 3VLEA 4BY6A 3ESKA 1Z3XA 2I9CA 4Y6CA 4F7AA 2IQCA 2MHKA 3QB2A 3JYSA 1PY1A 2JLBA 3NZUA 3CHPA 2E0IA 3FUJA 3FUNA 3FTUA 4B0ZA 3AU5A 4MKTA 4OVUA 4B8CB 2Y4UA 2CG3A 3HVEB 1P5QA 2C2LA 3T5VA 5BT1A 2VSOE 4EZJA 2XPZA 3HYMB 3FWVA 3IKOB 3L6AA 4OVVA 4HORA 4APFA 4FJZA 4PS3A 4WNDA 4IN3B 1Y6IA 5G05C 4EBAG 2WXHA 4UWKA 2AVPA 3PVLA 3JCKC 3FULA 2VTBA 3PE3A 3EJNA 2XQ0A 3LVRE 4G25A 5D0QD 2HM8A 4UWGA 4A3TA 2WXPA 1HX8A 3FU3A 4I9EA 4RVBA 4UQZA 5M72A 3DBSA 5BV0A 2YHCA 2ONDA 2R59A 3FTWA 1KT0A 4WWNA 4Q69A 1WY6A 3ASFA 3P1UA 2HYZA 3MGBA 5ARFA 3D3MA 5G05J 2J07A 1HG2A 2LAHA 4EZKA 2NXPA 5FZRA 2RG8A 3PH0C 3CVWA 3QKYA 4I6EA 2BF0X 4J6IA 3CQCB 4KYOB 4LRZA 4HOTA 2IOSA 3TXMA 4BTAA 1E90A 4HS2A 3SGHA 3FUIA 4NACA 2GW1A 4JC8A 2MOWA 3CIAA 4J0UA 4G1TA 5ANRA 2V4LA 3CVXA 2WXNA 3QK0A 4XZ4A 3SF4A 1JWFA 4U07A 1UW4B 2AXZA 2A4ZA 1B89A 3LPZA 1HZ4A 2XGMA 1EF1C 4I17A 5T4YA 2CFUA 2VSYA 4GYWA 3CKCA 3URZA 3I3NA 4GCNA 2AXVA 3JQ1A 4FP7A 5CCMA 2UY1A 4GA2A 3GZSA 3ZYLA 2J08A 4ANVA 4FA6A 4BFRA 3FTVA 1U3CA 2DCPA 4GZ5A 2L0IA 3MZLB 3L17A 3ZEFA 2PQRA 4AOFA 5LP0A 4FHKA 4KVMA 1U3DA 3G2TA 4JEHA 5FZSA 4DPRA 4GCOA 3TL5A 3HIZA 4J8FA 2L6JA 3FTYA 2WXIA 4L7TA 4MRUA 3APDA 5FTPA 2YINA 3L08A 3ZYQA 4B8AA 1BPOA 2P58C 4CDMA 3FEYA 3S7BA 5G04C 4UWLA 5G2NA 1UN8A 4HXIA 2HR2A 2CHWA 2J09A 1JUQA 5DBKA 3OXGA 1MQSA 5ENNA 2XGSA 3O48A 5BPPA 2WQ7A 2WB2A 4APOA 3TJPA 1FVHA 2VYIA 3CKBA 3Q5MA 4W9RA 5C2YA 1ELRA 2R17C 4IYPA 4KMOA 3IHVA 2CHZA 3QWPA 3EHMA 3LYAA 4ILHB 5T8IA 1OUVA 1QNFA 3B7UX 4IULA 5FZQA 4FU3A 1SZAA 3OXLA 2WXGA 4PS7A 4YVQC 3NF1A 1OWLA 3ML9A 3NZSA 4P29A 2X6KA 4RG6A 3ESLA 5HQ8A 1UN9A 4H7XA 3S7JA 3QAQA 3FDHA 2CFZA 3ONKA 4I9CA 2ZU6B 3R9AB 2XRYA 3RRNB 3CHOA 1ELKA 4GMLA 4JHJA 3ZYKA 2M63A 2BUGA 3D9MA 4M3OA 3PRZA 3APCA 4BSXA 3B7SA 2Y4TA 3FH7A 3G2SA 3TAXA 4AM9A 2DIWA 3PDNA 3CVLA 1NA3A 3FUKA 1DNPA 2UY1B 5FQ8A 5EX0A 3CSFA 3ASGA 3EIJA 4GA0A 2VJ8A 3Q15A 3D9IA 4FHJA 4I1AA 1NA0A 5FQ6A 5FT9A 1X5BA 5BUZA 3FEXA 2I6HA 2V0PA 2E2EA 1MHQA 2XRZA 1HFAA 3HDXA 4KZ0A 2AWIA 3LS8A 1W3BA 1E96B 2LAIA 2KCKA 4AY5A 4XIFA 4PDXA 2PM6A 3B7TA 3MJWA 4GZCA 4ABNA 3RO3A 2X6HA 4EQFA 2FEZA 1SZ9A 3R7QA 1OWNA 4KZCA 4ANWA 3ULQA 3SZ7A 4GZ6A 2NSZA 2WXFA 4FULA 2XGOA 2ILRA 4R7LA 3JQ0A 5FJYA 4UQYA 4U0SA 1IHGA 2BTDA 3PS6A 3CR3A 3LCAA 2I1KA 3B7RL 4URKA 1TEZA 4AXHA 1Y8MA 3CGHA 3LY7A 1N52A 2X6IA 3I4RB 2FULA 1E8YA 3DPDA 3RKVA 3ZN3A 3UT7A 3UT4A 4I1MA 4J8DA 5KJMA 1FCHA 1JPLA 4OYSA 4UQXA 4N39A 4XX5A 3ZHEB 4ATGA 5E76A 4B94A 3FUMA 1KLXA 2XCBA 5C1DA 4U0UA 5EX3A 2Q7FA 2KM4A 3G2UA 4A3VA 1TJFA 1XNFA 1VDYA 2EQXA 4FLBA 4K0RA 1EPUA 2V5FA 2Y3AA 2WM9A 1ZU2A 3D9OA 4U8HA 1N54A 3ML8A 1H2VC 3FU0A 3ENEA 4F3VA 3JUIA 3FUEA 3PREA 3QC1A 1GW6A 5LOZA 4JVSA 3FUHA 3PNLB 3APFA 2JEKA 4EBAA 1E8WA 2KC7A 3WXXA 2UWJG 4UWHA 3VLDA 2IONA 3OTNA 4WUYA 3U64A 5FQ4A 4E85A 3ASDA 5JJ7A 2J9QA 2WXJA 3FH5A 3C98A 5HI7A 2I1JA 3LXUX 4JZYA 3K9IA 3G2VA 1INZA 1EDUA 4HFGA 3SBTB 5FWQA 4CRWA 2GRLA 2X38A 3CVQA 3RU0A 2J4BA 4DJAA 4DLOA 4HLEA 4AV7A 4BX8A 1IYGA 3L16A 3PUJA 3PEUB 1ELWA 2FBNA 5CMWA 3FH8A 3GZ1A 4WAFA 4PS8A 3QDNA 4JL0A 4EECA 5A6CA 3AU4A 3EIQC 5A7DB 1S0PA 1E7VA 1SQMA 3CVPA 4GB9A 3OAWA 4JA7A 1PAQA 5BNWA 4ACLA 4FJYA 2XCCA 3GW4A 3O4ZA 4A1GA 3MKRA 1OWPA 2L9BA 4EPZA 3BEEA 1OWOA 2L0TB 4I6GA 1EYHA 4G24A 2PZIA 4LUNU 4XI9A 2MRIA 2WMNA 4I2ZA 4WWPA 3ZPJA 1HF8A 3D9PA 2CHXA 2KZTB 4JPSA 1XGWA 3PUKA 4J8EA 5BW8C 3FTXA 2WQHA 1IQUA 3ZIMA 4CT0A 3ZGQA 4ANXA 3EHNA 4QFVA 4YNDA 2VQ2A 2XEVA 5G55A 2CG2A 2IFUA 1DVPA 4TUUA 2FI7A 1HH8A 5CHEE 5JHBA 4GPKA 3CK8A 3RK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEG A;  5DIZ A;  3ZHE A;  2LSV A;  2R5S A;  3FP3 A;  4YVO A;  4N2S A;  4U0Z A;  1QQE A;  4I2W A;  4N3B A;  3CV0 A;  1YA0 A;  3LY9 A;  3MA5 A;  4Y6W A;  5EKQ D;  3U3W A;  4G2V A;  3GYZ A;  3ASH A;  4NQ0 A;  1NZN A;  3U4T A;  3MEK A;  3MV3 B;  1KT1 A;  2YQ8 A;  2VGX B;  2FF4 A;  3LKU A;  1QZ2 A;  3Q4A B;  4N3A A;  3RO2 A;  2LSU A;  3S7D A;  4JHR A;  5LCW J;  4GZ3 A;  3QWV A;  2FO7 A;  2PQN A;  4WNG A;  4BTB A;  3Q47 B;  1ZBP A;  4CDR A;  1A17 A;  3AS8 A;  4GYO A;  4KXK B;  4GA1 A;  3KD7 A;  4BT8 A;  3RJV A;  2WPV A;  4ME2 A;  4A1S A;  1WAO 1;  4HOQ A;  3N71 A;  4AY6 A;  2C0L A;  3Q49 B;  3EDT B;  4H7Y A;  4O6F A;  4RG9 A;  4AIF A;  4CGW A;  1HXI A;  3AS5 A;  2LNI A;  5JJ6 A;  4N5C A;  2XPI A;  3LY8 A;  5D0O D;  3KAE A;  3GZ2 A;  3AS4 A;  4WNF A;  1PC2 A;  2C0M A;  3KS2 A;  3CEQ A;  1TJC A;  4KBQ A;  4UI9 C;  4BT9 A;  2KCL A;  3VTX A;  4U04 A;  2KAT A;  2VGY A;  5KJK A;  2IF4 A;  3PE4 A;  3CK7 A;  3QWW A;  1WM5 A;  4G26 A;  2HO1 A;  2NC9 A;  2OOE A;  2QFC A;  4XI0 A;  3ZFW A;  4N2Q A;  4UI9 J;  2VGX A;  2VSN A;  4GYY A;  2DBA A;  4LEU A;  3CK9 A;  5ARG A;  4WNE A;  4HOS A;  2PL2 A;  3S7F A;  5AYW D;  4NRH B;  3TG5 A;  3TGO A;  4N3C A;  3UQ3 A;  5KJL A;  4UI9 K;  3UUX A;  4HOU A;  4BWR A;  4JA9 A;  4CGV A;  5KJN A;  5G04 J;  3VTY A;  2KCV A;  3UPV A;  4G23 A;  3E4B A;  3TG4 A;  3MV2 B;  5LCW C;  3QOU A;  3CVN A;  3RIB A;  5CCL A;  3OXF A;  5JJT A;  3FFL A;  3ESK A;  4Y6C A;  2MHK A;  3JYS A;  2JLB A;  2Y4U A;  1P5Q A;  2C2L A;  5BT1 A;  3HYM B;  3FWV A;  4HOR A;  4WND A;  4IN3 B;  5G05 C;  2AVP A;  3PE3 A;  4G25 A;  5D0Q D;  4I9E A;  5M72 A;  4UQZ A;  2YHC A;  2OND A;  1KT0 A;  3ASF A;  5ARF A;  2HYZ A;  5G05 J;  5FZR A;  3QKY A;  4KYO B;  4HOT A;  4BTA A;  2GW1 A;  4J0U A;  4G1T A;  3SF4 A;  4U07 A;  1B89 A;  3LPZ A;  1HZ4 A;  2XGM A;  4I17 A;  2VSY A;  4GYW A;  3CKC A;  3URZ A;  4GCN A;  5CCM A;  2UY1 A;  4GA2 A;  4GZ5 A;  2PQR A;  5FZS A;  4GCO A;  4J8F A;  2L6J A;  5FTP A;  2P58 C;  3S7B A;  5G04 C;  2HR2 A;  5DBK A;  3OXG A;  2XGS A;  3O48 A;  4APO A;  2VYI A;  3CKB A;  3Q5M A;  4W9R A;  1ELR A;  3QWP A;  3LYA A;  1OUV A;  5FZQ A;  4YVQ C;  3OXL A;  3NF1 A;  4RG6 A;  5HQ8 A;  4H7X A;  3S7J A;  4I9C A;  3R9A B;  2BUG A;  2Y4T A;  3TAX A;  4AM9 A;  3PDN A;  3CVL A;  1NA3 A;  2UY1 B;  5EX0 A;  3ASG A;  4GA0 A;  3Q15 A;  4I1A A;  5FT9 A;  1NA0 A;  2I6H A;  2E2E A;  1W3B A;  1E96 B;  4AY5 A;  2KCK A;  4XIF A;  4ABN A;  3RO3 A;  4EQF A;  2FEZ A;  3ULQ A;  3SZ7 A;  4GZ6 A;  2XGO A;  5FJY A;  4UQY A;  4U0S A;  1IHG A;  3LCA A;  1Y8M A;  3LY7 A;  3RKV A;  3ZN3 A;  4J8D A;  5KJM A;  1FCH A;  4UQX A;  4N39 A;  3ZHE B;  4B94 A;  1KLX A;  2XCB A;  5C1D A;  4U0U A;  5EX3 A;  2Q7F A;  1XNF A;  2V5F A;  1ZU2 A;  4F3V A;  2KC7 A;  3WXX A;  2UWJ G;  4WUY A;  3ASD A;  5JJ7 A;  2J9Q A;  5HI7 A;  3K9I A;  3CVQ A;  3RU0 A;  1IYG A;  1ELW A;  2FBN A;  3GZ1 A;  3QDN A;  4JL0 A;  5A6C A;  5A7D B;  3CVP A;  4JA7 A;  5BNW A;  2XCC A;  3GW4 A;  3MKR A;  3BEE A;  4G24 A;  2PZI A;  4XI9 A;  3ZPJ A;  4I2Z A;  4J8E A;  5BW8 C;  2WQH A;  3ZGQ A;  4YND A;  2VQ2 A;  2XEV A;  2IFU A;  2FI7 A;  1HH8 A;  5CHE E;  4GPK A;  3CK8 A; 
#chains in the Genus database with same CATH topology
 3T5X A;  1L5J A;  3DXK G;  3IEG A;  4C9B B;  3ZHE A;  1HS6 A;  4LG6 A;  4O1P A;  3FP3 A;  3UTM A;  1OCO E;  2XZD G;  4C0E A;  2EIM E;  3CV0 A;  1YA0 A;  4FLH A;  4Y6W A;  3U3W A;  4L2Y A;  3ASH A;  4NQ0 A;  3U4T A;  3LEW A;  3E32 A;  2VGX B;  2FF4 A;  2XS8 A;  1QZ2 A;  3BG0 B;  3RO2 A;  2LSU A;  3KSQ A;  3D9J A;  2X6F A;  5LCW J;  4IRU A;  3CHM A;  2PQN A;  4HVB A;  1JCS A;  4CDR A;  1E8Z A;  4GYO A;  3ZYM A;  5JA4 D;  1RZ4 A;  3CST A;  2WPV A;  4ME2 A;  3SD5 A;  4B89 A;  2P2C P;  4O6F A;  4H7Y A;  5HKP A;  4AIF A;  2X3M A;  4CGW A;  3AS5 A;  5AJD A;  5ANL A;  1SA4 A;  3Q7F A;  3W9F A;  3C5R A;  4JHK A;  2B0O E;  5KCM A;  3UT8 A;  5JHA A;  3AS4 A;  2NYJ A;  3D9K A;  2WQ6 A;  4WNF A;  3CEQ A;  4PH4 B;  3HXC A;  4AEZ C;  1H2U A;  1N4Q A;  1H6K A;  3NQP A;  3MKQ A;  2KAT A;  2WXK A;  2IF4 A;  3CK7 A;  2XPY A;  4G26 A;  1S64 A;  4A55 A;  3HHM A;  4UI9 J;  4GYY A;  5A23 A;  2VTB B;  3FU5 A;  3CK9 A;  3S7F A;  4G8L A;  1JWG A;  3FY4 A;  1Z5S C;  4U7E B;  3SI5 A;  2OCC E;  4N3C A;  4DI3 A;  4LER A;  2ETC A;  5AN8 A;  3UUX A;  1OXJ A;  4B93 B;  3WG7 E;  4ILI A;  1QBQ A;  3L22 A;  2QYJ A;  5G04 J;  1BLX B;  3VTY A;  1H19 A;  3TG4 A;  4AP2 A;  2QZA A;  3SO8 A;  3HXF A;  3CVN A;  2LO6 A;  3OXF A;  5JJT A;  2I2O A;  3VLE A;  1RW2 A;  1Z3X A;  2IQC A;  3QB2 A;  3NZU A;  5AAO A;  4B0Z A;  3FTU A;  1X81 A;  2VGE A;  2Y69 E;  4MKT A;  4EZJ A;  2XPZ A;  4OVV A;  4APF A;  5CRU A;  3C3Q A;  4PS3 A;  4IN3 B;  3C3O A;  4HQD A;  3EJN A;  2RFA A;  2XQ0 A;  3LVR E;  3PZ1 A;  4G25 A;  5KBA A;  4A3T A;  3DBS A;  2YHC A;  2OND A;  3FTW A;  1KT0 A;  3ASF A;  1SVX A;  5BXO A;  3MGB A;  5ARF A;  3ASN E;  2NXP A;  1MX6 A;  5FZR A;  2RG8 A;  3QKY A;  1QYM A;  2RKK A;  1N0R A;  3DST A;  3TXM A;  2LXM A;  1JCQ A;  3FUI A;  4NAC A;  3SF4 A;  1JWF A;  5AQ9 A;  1S70 B;  1B89 A;  1MJ0 A;  5H7P A;  3LPZ A;  1HZ4 A;  4I17 A;  4OAU C;  3CKC A;  2AXV A;  5CCM A;  4GA2 A;  1TNB A;  2J08 A;  4GZ5 A;  2L0I A;  4BER A;  3MZL B;  3L17 A;  4FHK A;  4KVM A;  3G2T A;  4NIK A;  4GCO A;  3FTY A;  2IO2 C;  4B8A A;  3ZYQ A;  3S7B A;  4DX2 A;  5G2N A;  2EIJ E;  2H6G A;  2J09 A;  1JUQ A;  5DBK A;  3OXG A;  5ENN A;  3O48 A;  4J7W A;  2WQ7 A;  5C2Y A;  3EHM A;  3LYA A;  4IUL A;  4FU3 A;  4RG6 A;  5HQ8 A;  3FDH A;  2CFZ A;  1TR4 A;  3ABK E;  3ZYK A;  1ELK A;  2BUG A;  3D9M A;  4M3O A;  3V31 A;  5CBN A;  3T9K A;  3FH7 A;  3TAX A;  1NA3 A;  1FPP A;  3EIJ A;  5FT9 A;  1NA0 A;  3FEX A;  4HNA D;  1W3B A;  1N95 A;  4HRL A;  2PM6 A;  4HRM B;  4GZC A;  4ABN A;  3RO3 A;  4EQF A;  2B6C A;  2NSZ A;  2XGO A;  2ILR A;  3EHR A;  4R7L A;  3JQ0 A;  3AG3 E;  1ZB1 A;  4UQY A;  4U0S A;  3AJI A;  1KZP A;  3LCA A;  3B7R L;  1Y8M A;  3CGH A;  2X6I A;  3I4R B;  1E8Y A;  3RKV A;  3UT7 A;  3UT4 A;  4I1M A;  4J8D A;  4U8V D;  1JPL A;  4UQX A;  4XX5 A;  4N39 A;  4B94 A;  5E76 A;  4U0U A;  5EX3 A;  2Q7F A;  1O1T A;  2KM4 A;  1XNF A;  1EPU A;  2V5F A;  2WM9 A;  1ZU2 A;  4F3V A;  5BXU A;  4RQI A;  1N11 A;  1GW6 A;  3NBN B;  4UWH A;  4RLY A;  4WUY A;  4YDW A;  3U64 A;  4N5Q A;  5FQ4 A;  4ZHB A;  3FH5 A;  3C98 A;  5HI7 A;  1K8K G;  3DPY A;  3LXU X;  3SBT B;  2GRL A;  4GMR A;  4AV7 A;  5KWD A;  1IYG A;  5CEA A;  3PUJ A;  1YYH A;  4HB5 A;  3FH8 A;  5HS0 A;  4JL0 A;  5A6C A;  3AU4 A;  1S0P A;  3CVP A;  4FJY A;  3Q73 A;  3MKR A;  4EPZ A;  3BEE A;  4I6G A;  3UIO C;  1HF8 A;  2KZT B;  3PUK A;  3E37 A;  5BW8 C;  3FTX A;  1IQU A;  3EHN A;  4YND A;  5G55 A;  1YCS B;  5CHE E;  4GPK A;  3IBE A;  2IEJ A;  3E30 A;  3CVY A;  3ZW3 A;  1K1A A;  4U96 D;  2RD0 A;  4V3I A;  5AAR A;  2WXQ A;  3U66 A;  3CHS A;  2WVI A;  3PNT B;  4XKB A;  2DYR E;  1Z6T A;  3DSV A;  1YMP A;  4L9P A;  4PUC A;  5KNG A;  3V79 K;  2J8S D;  5EKQ D;  3ULY A;  1IKN D;  3GYZ A;  3T8M A;  4CT4 A;  3MEK A;  1H6P A;  1E8X A;  4K5B A;  4Q96 A;  3Q4A B;  2WXO A;  1NP7 A;  3HG0 D;  4WWO A;  2ZGD A;  3QWV A;  1WG0 A;  3EU5 A;  1HG5 A;  4F1P A;  5AJL A;  2FO1 E;  4XKC A;  1FVF A;  4L23 A;  3TWV A;  1MX4 A;  2XEH A;  4GA1 A;  3KD7 A;  4BT8 A;  1HE8 A;  3Q75 A;  1NFI E;  4HOQ A;  3Q49 B;  3SFY A;  5LFA A;  4BX9 A;  4LNU D;  3UMV A;  3ABM E;  5FQ7 A;  4LCT A;  4K03 A;  3I4G A;  5EIL A;  1DCQ A;  3LY8 A;  1BI8 B;  5E75 A;  3IXE A;  2GRQ B;  1PC2 A;  3KS2 A;  1IQR A;  2YNQ A;  1TJC A;  4UI9 C;  2R05 A;  3VTX A;  2QY7 A;  3L9T A;  2VGY A;  5JMN D;  2QYU A;  4GU5 A;  4EZL A;  3PE4 A;  3FTS A;  5J90 A;  1WM5 A;  3LVQ E;  2Y1L E;  2WXM A;  2OOE A;  2QFC A;  2VSN A;  4HI9 A;  2X6J A;  3T8K A;  2P9K G;  4TXR A;  5ITZ F;  4LEU A;  2PM7 A;  2XZT G;  4YDO A;  2PL2 A;  1TNU A;  4NRH B;  4DK5 A;  5KJL A;  4TUM A;  4UI9 K;  3TWX A;  4HOU A;  4L2L A;  5CED B;  5T3R A;  4JA9 A;  4CGV A;  1IHB A;  5CER B;  4ILG A;  4K5C A;  1OWM A;  4GMJ A;  5KJN A;  2P9S G;  5LX8 A;  1BI7 B;  3HXB A;  3UPV A;  4G23 A;  4U8Y D;  3ZVV A;  3NB2 A;  3QOU A;  3TXN A;  2J49 A;  1S63 A;  3RAU A;  3FFL A;  3L13 A;  4GTS A;  4Y6C A;  1AP7 A;  3JYS A;  1KPS B;  3ABL E;  2CG3 A;  3HVE B;  1P5Q A;  3HYM B;  3IKO B;  4HOR A;  4FJZ A;  1BU9 A;  2WXH A;  4UWK A;  3JCK C;  3FUL A;  1D8E A;  2HM8 A;  2DWZ A;  1HX8 A;  3FU3 A;  5BV0 A;  4WWN A;  1WY6 A;  3D3M A;  2J07 A;  5ENP D;  5EN5 D;  4EZK A;  3UM3 A;  3CVW A;  4J6I A;  3CQC B;  4HOT A;  2IOS A;  1E90 A;  3Q78 A;  4HS2 A;  3UM1 A;  4JC8 A;  4G1T A;  2WXN A;  2ETA A;  4XZ4 A;  5D2M C;  4U07 A;  1UW4 B;  2A4Z A;  5T4Y A;  2XGM A;  4GYW A;  3KEA A;  3JQ1 A;  1TYQ G;  4GTR A;  3UIN C;  2PQR A;  5LP0 A;  1KZO A;  1U3D A;  4JEH A;  3TL5 A;  2F0Y A;  2L6J A;  2DYS E;  3TWS A;  2YIN A;  3FEY A;  2AJA A;  5EYL A;  1N0Q A;  2WB2 A;  2VYI A;  4DX6 D;  3Q5M A;  4W9R A;  1ELR A;  4IYP A;  3IHV A;  3HXD A;  5T8I A;  1OUV A;  3Q79 A;  4YVQ C;  2WXG A;  4PS7 A;  3ZKJ A;  3NF1 A;  4P29 A;  3ML9 A;  2X6K A;  1OT8 A;  4H7X A;  3DXM G;  3RRN B;  2XRY A;  4GML A;  4JHJ A;  2M63 A;  1JCR A;  3HXE A;  1UOH A;  3B7S A;  2Y4T A;  4AM9 A;  2DIW A;  2R03 A;  1LD8 A;  3CVL A;  3FUK A;  1DNP A;  4XEI G;  2UY1 B;  3CSF A;  2VJ8 A;  5BUZ A;  2V0P A;  1HFA A;  4KZ0 A;  2AWI A;  3MJW A;  2X6H A;  4MBG A;  1SZ9 A;  1TNZ A;  3SZ7 A;  2OEV A;  4FUL A;  1O1S A;  1TEZ A;  1N52 A;  4HLL A;  2DZN A;  2P9P G;  4LNG A;  3ZN3 A;  4DUI A;  5KJM A;  1FCH A;  4OYS A;  3ZHE B;  2V4H C;  5C1D A;  3UM0 A;  4A3V A;  4FLB A;  4K0R A;  4EHM A;  2Y3A A;  2A5E A;  3B7B A;  3FU0 A;  3JUI A;  1N4R A;  3PNL B;  4EBA A;  1E8W A;  2LUH A;  2ION A;  3OTN A;  4E85 A;  4LSZ E;  2WXJ A;  2I1J A;  4JZY A;  1EDU A;  5FWQ A;  3RU0 A;  2GRN B;  3UI2 A;  3AG1 E;  1ELW A;  2FBN A;  3RSE G;  1LTX A;  2GRR B;  4WAF A;  4PS8 A;  3KSL A;  5BNW A;  3O4Z A;  4A1G A;  2P9I G;  2PZI A;  2MRI A;  4I2Z A;  1IXV A;  4J8E A;  3R9M A;  2F8X K;  1A5E A;  2CG2 A;  3DSS A;  1HH8 A;  4GPM A;  3CK8 A;  2OVF A;  3DSX A;  4JXT A;  4G11 A;  3SNX A;  5AEN A;  3ZRH A;  5DIZ A;  3PZ3 A;  2LSV A;  2R5S A;  3IV0 A;  1OCC E;  4GTV A;  4N2S A;  1U2V G;  3MKQ B;  4O1O A;  1TNO A;  1OY3 D;  3ULE G;  4I2W A;  4N3B A;  4TXP A;  1WDY A;  3MYV A;  5J08 A;  4ZFH A;  4G2V A;  2VSX E;  3QNK A;  4GTQ A;  3MV3 B;  3E33 A;  3LKU A;  3JXI A;  3X2Q E;  5BV1 A;  4JHR A;  1E7U A;  2GRP B;  5CEC B;  3QAR A;  4GZ3 A;  4JW1 A;  2FO7 A;  4WNG A;  4BTB A;  2J4D A;  1V54 E;  3VLF A;  3Q47 B;  4KT6 B;  1ZBP A;  3I5P A;  3AS8 A;  4KXK B;  5CMY A;  3CVU A;  4XE0 A;  4GZD A;  3N71 A;  3EDT B;  2F37 A;  4NUR A;  4RG9 A;  4U95 D;  4I43 A;  2OV8 A;  2XPI A;  5D0O D;  3KAE A;  2WXR A;  3RRU A;  1O1R A;  5EIB E;  3FHE A;  2C0M A;  4BEP A;  3V2X A;  4KBQ A;  2ETB A;  4U04 A;  3LDZ A;  3CHQ A;  1TN6 A;  3FUD A;  3JUE A;  2WMO A;  3QWW A;  3CLJ A;  4J8Y A;  3P2B A;  2HO1 A;  2JAB A;  3ZFW A;  4N2Q A;  4CYM D;  4M7C A;  2VGX A;  4FAD A;  2DBA A;  3MCX A;  2IOL A;  3SFZ A;  4DI4 A;  4HOS A;  2R02 A;  3UKU G;  2H6H A;  2GGF A;  5AYW D;  3TG5 A;  3HVE A;  4CDN A;  4TRQ A;  3UQ3 A;  3UXG A;  5HRY A;  3D9N A;  2WXL A;  4BWR A;  3L54 A;  4GAA A;  1AWC B;  4OAV B;  2L6B A;  3MX3 A;  3E4B A;  4DX5 D;  2OVB A;  2R2L A;  4CZ2 D;  3MV2 B;  2V8S E;  5LCW C;  3U9W A;  3UKR G;  3RIB A;  3IHY A;  4RSY A;  4I1O B;  5ENS D;  2DZO A;  2I9C A;  2MHK A;  1PY1 A;  3CHP A;  3D9H A;  3FUJ A;  4OVU A;  2C2L A;  3B95 A;  3T5V A;  2VSO E;  3FWV A;  3ZU7 B;  2XEN A;  2VTB A;  3TWR A;  4YDY A;  1DC2 A;  4UWG A;  2BKK B;  2WXP A;  4I9E A;  5M72 A;  2PNN A;  4UQZ A;  2Y0B G;  2R59 A;  4Q69 A;  2HYZ A;  5G05 J;  1HG2 A;  3PH0 C;  4I6E A;  4KYO B;  4HRN A;  3UM2 A;  4BTA A;  3SGH A;  2GW1 A;  4JB8 P;  5ANR A;  4J0U A;  3CVX A;  5KNH D;  1EF1 C;  4F6R D;  3URZ A;  3AG2 E;  2UY1 A;  4ANV A;  3GZS A;  3ZYL A;  4FA6 A;  4BFR A;  1U3C A;  4AOF A;  3L82 A;  3DSW A;  2HE0 A;  4DPR A;  2WXI A;  4L7T A;  3APD A;  1BPO A;  1K3Z D;  5G04 C;  4UWL A;  4BET A;  3BQO A;  3J5P A;  4HXI A;  2HR2 A;  2CHW A;  1MQS A;  5BPP A;  3TJP A;  1FVH A;  4KMO A;  2CHZ A;  4ILH B;  2QC9 A;  5FZQ A;  1SZA A;  1OWL A;  3NZS A;  3BUA A;  3QAQ A;  4I9C A;  3ONK A;  3CHO A;  3APC A;  4QQI A;  4BSX A;  4UUC A;  3ASG A;  4GA0 A;  3D9I A;  2XS1 A;  2I6H A;  1MHQ A;  2XRZ A;  3ASO E;  3HDX A;  1E96 B;  4AY5 A;  4XIF A;  4PDX A;  3TWU A;  3R7Q A;  1OWN A;  1TN7 A;  4GZ6 A;  2WXF A;  1OCR E;  1SW6 A;  3ISM C;  2H6I A;  3TWQ A;  1H6O A;  3NOG D;  1SA5 A;  3EU9 A;  3LY7 A;  2FUL A;  4ATG A;  2P9U G;  1TJF A;  2EQX A;  3D9O A;  2H6F A;  1N54 A;  1H2V C;  3ENE A;  2V5Q C;  3FUE A;  5ENO D;  4JVS A;  3FUH A;  3APF A;  1FT2 A;  2JEK A;  3W9G A;  2UWJ G;  3VLD A;  5EID A;  2J9Q A;  3DRA A;  3G2V A;  1INZ A;  2BED A;  4HLE A;  4BX8 A;  3L16 A;  3PEU B;  3GZ1 A;  3QDN A;  5A7D B;  3V30 A;  4JA7 A;  3OAW A;  4ACL A;  3ZXP A;  2XCC A;  3GW4 A;  2LXL A;  1TN8 A;  1OWO A;  1EYH A;  4G24 A;  4LUN U;  4XI9 A;  3ZIM A;  4WWP A;  2CHX A;  4JPS A;  1XGW A;  3ZNG A;  3DWL G;  4K5A B;  2WQH A;  3ZGQ A;  4ANX A;  2FI7 A;  5JHB A;  2BKG A;  1MYO A;  3S2A A;  3FU6 A;  3BG1 B;  1H0A A;  3FTZ A;  2OEW A;  2EIN E;  4YVO A;  4FC8 A;  1OCZ E;  5AQ7 A;  2ZXW E;  3RRM B;  4U0Z A;  1QQE A;  5FIO A;  3PEV B;  4JEU A;  4DLQ A;  4TV3 A;  3UX4 A;  3DEO A;  1NL4 A;  3LY9 A;  3MA5 A;  3Q9U C;  3CVV A;  1N4P A;  2IU1 A;  4LNB A;  1NZN A;  3ONL A;  1LF8 A;  3ZXS A;  1KT1 A;  2YQ8 A;  4ANU A;  4UWF A;  1HU3 A;  1Q2Z A;  5B1A E;  4N3A A;  3NAW A;  3S7D A;  5ENT D;  3TWW A;  4AJW A;  1A17 A;  3D9L A;  4Q94 A;  4MS6 A;  2KZT A;  1V55 E;  3RJV A;  3LJN A;  2IO3 C;  1UJK A;  4A1S A;  1WAO 1;  1Z3Y A;  2AXU A;  5CBO A;  4AY6 A;  2C0L A;  5ENR D;  2P9L G;  3C72 A;  3CQG B;  4GTO A;  1HXI A;  1HO8 A;  5CRV A;  3V2O A;  2LNI A;  5JJ6 A;  5B3S E;  3PZ4 A;  5AQB A;  4N5C A;  1MX2 A;  3GZ2 A;  3EUV A;  3AAA C;  1H2T C;  3R7R A;  3ZUV B;  4I6J A;  3Q7A A;  4BT9 A;  2KCL A;  5ENQ D;  3SBS A;  5KJK A;  4CEM A;  3QJZ A;  3SQV A;  4C0M A;  3DSU A;  4MLP A;  1N4S A;  2NC9 A;  4XI0 A;  4DX1 A;  4AVX A;  4GTT A;  4C48 B;  2GRM A;  1D8D A;  2ZGG A;  4ACK A;  2XHE A;  5ARG A;  3CHR A;  4WNE A;  3KEZ A;  3LJ3 A;  4KVO A;  2IJG X;  4U63 A;  3TGO A;  1O5M A;  2A5U A;  4L1B A;  4CCA A;  5AIJ A;  2KBX A;  1UG3 A;  1UJJ A;  3UIP C;  2ZIS A;  4F1S A;  4D10 C;  4DX7 D;  3SHF A;  4F53 A;  5D66 A;  4J8S A;  4E6H A;  2KCV A;  3G2W A;  3FUF A;  1NI1 A;  3PZD A;  2EIK E;  2YHE A;  1N94 A;  2AW6 A;  5CCL A;  3HRA A;  3SFX A;  3B13 A;  4BY6 A;  3ESK A;  4F7A A;  2JLB A;  2E0I A;  3FUN A;  5AQA A;  3AU5 A;  4B8C B;  1D9S A;  2Y4U A;  3NOC D;  1LD7 A;  5BT1 A;  5FIN A;  3L6A A;  4WND A;  2XEE A;  1Y6I A;  3J5Q B;  5G05 C;  4EBA G;  2AVP A;  3PVL A;  3PE3 A;  4O60 A;  1G3N B;  5D0Q D;  2MYO A;  2EIL E;  4RVB A;  1TNY A;  3P1U A;  4G8K A;  2LAH A;  4LRZ A;  2BF0 X;  4GTP A;  1MZC A;  2MOW A;  3CIA A;  2V4L A;  3QK0 A;  2AXZ A;  4Z68 A;  4JD2 G;  4BSZ B;  2CFU A;  2VSY A;  3I3N A;  4GCN A;  4GTM A;  5EYP F;  4FP7 A;  3FTV A;  2DCP A;  5B1B E;  2F8Y A;  3ZEF A;  1DCE A;  5FZS A;  3HIZ A;  4J8F A;  3BU8 A;  2IY0 C;  4MRU A;  5FTP A;  3L08 A;  2P58 C;  4CDM A;  1UN8 A;  2XGS A;  4APO A;  4BES A;  3CKB A;  2R17 C;  3AG4 E;  3QWP A;  1QNF A;  3B7U X;  3OXL A;  3E34 A;  3TWT A;  3ESL A;  1UN9 A;  3S7J A;  5EDS A;  3R9A B;  2ZU6 B;  2DVW A;  3PRZ A;  4HBD A;  4ATZ D;  3G2S A;  3PDN A;  5FQ8 A;  5EX0 A;  3Q15 A;  4FHJ A;  4I1A A;  3EHQ A;  5FQ6 A;  1X5B A;  2E2E A;  3F6Q A;  3JXJ A;  3LS8 A;  1K1B A;  2LAI A;  2KCK A;  3B7T A;  2FEZ A;  4KZC A;  4ANW A;  3ULQ A;  2P9N G;  1FT1 A;  5FJY A;  2GRO B;  1IHG A;  2BTD A;  2KXP C;  3PS6 A;  3CR3 A;  2I1K A;  4URK A;  4AXH A;  3SY2 A;  3DPD A;  3PZ2 A;  2ZIR A;  2RFM A;  3FUM A;  1KLX A;  2XCB A;  3Q9N C;  5IY5 E;  3G2U A;  1VDY A;  4U8H A;  3ML8 A;  3PRE A;  4HI8 A;  3QC1 A;  5LOZ A;  4DRX E;  2KC7 A;  3WXX A;  4X8Q A;  3ASD A;  5JJ7 A;  3DEP A;  3K9I A;  4HFG A;  4YDE A;  4CRW A;  2X38 A;  3CVQ A;  2J4B A;  4DJA A;  4DLO A;  1N9A A;  5CMW A;  4EEC A;  3EIQ C;  1E7V A;  1SQM A;  4GB9 A;  1PAQ A;  1OWP A;  2L9B A;  2L0T B;  3C3R A;  3ZPJ A;  2WMN A;  3D9P A;  4CT0 A;  4QFV A;  2VQ2 A;  2XEV A;  4TXQ A;  2IFU A;  1DVP A;  4TUU A;  4A63 B;  1BD8 A;  3RK6 A; 
#chains in the Genus database with same CATH homology
 3IBE A;  2OVF A;  4JXT A;  4G11 A;  3SNX A;  3T5X A;  5AEN A;  1L5J A;  3ZRH A;  3IEG A;  5DIZ A;  4C9B B;  3S2A A;  3ZHE A;  3CVY A;  3ZW3 A;  1HS6 A;  2LSV A;  3FU6 A;  2R5S A;  3BG1 B;  1H0A A;  3FP3 A;  3FTZ A;  3IV0 A;  2RD0 A;  4V3I A;  4YVO A;  2WXQ A;  3U66 A;  3CHS A;  4FC8 A;  2WVI A;  4N2S A;  3RRM B;  4U0Z A;  3PNT B;  1QQE A;  4XKB A;  3MKQ B;  4C0E A;  3PEV B;  1Z6T A;  4JEU A;  4DLQ A;  4TV3 A;  4I2W A;  4N3B A;  3UX4 A;  4PUC A;  3CV0 A;  1YA0 A;  3LY9 A;  3MA5 A;  4FLH A;  3MYV A;  4Y6W A;  5EKQ D;  5J08 A;  3U3W A;  4G2V A;  2VSX E;  3QNK A;  3GYZ A;  3ASH A;  4L2Y A;  4NQ0 A;  3CVV A;  2IU1 A;  1NZN A;  3T8M A;  3U4T A;  4CT4 A;  3MEK A;  3MV3 B;  3ONL A;  1LF8 A;  1E8X A;  3LEW A;  3ZXS A;  1KT1 A;  2YQ8 A;  4ANU A;  4UWF A;  1HU3 A;  2VGX B;  2FF4 A;  3LKU A;  1QZ2 A;  3BG0 B;  3Q4A B;  2WXO A;  4Q96 A;  4N3A A;  3RO2 A;  1NP7 A;  2LSU A;  3S7D A;  5BV1 A;  4JHR A;  4WWO A;  1E7U A;  3D9J A;  2X6F A;  5LCW J;  3QAR A;  4GZ3 A;  4JW1 A;  3QWV A;  4IRU A;  2FO7 A;  3CHM A;  1HG5 A;  2PQN A;  4WNG A;  5AJL A;  2J4D A;  4XKC A;  4BTB A;  4HVB A;  3VLF A;  3Q47 B;  1FVF A;  4L23 A;  4KT6 B;  1ZBP A;  3I5P A;  4CDR A;  4AJW A;  1A17 A;  1E8Z A;  3D9L A;  3AS8 A;  4GYO A;  4KXK B;  3ZYM A;  4GA1 A;  4Q94 A;  3KD7 A;  4MS6 A;  4BT8 A;  1HE8 A;  2KZT A;  3CST A;  3RJV A;  2WPV A;  4ME2 A;  5CMY A;  3SD5 A;  3CVU A;  1UJK A;  4XE0 A;  1WAO 1;  4A1S A;  1Z3Y A;  4GZD A;  4B89 A;  2AXU A;  4HOQ A;  3N71 A;  4AY6 A;  2C0L A;  3Q49 B;  3EDT B;  4H7Y A;  4O6F A;  4NUR A;  4RG9 A;  4AIF A;  5LFA A;  2X3M A;  4BX9 A;  3CQG B;  4CGW A;  1HXI A;  1HO8 A;  3AS5 A;  5AJD A;  5ANL A;  3UMV A;  2LNI A;  5FQ7 A;  5JJ6 A;  4LCT A;  4K03 A;  4I43 A;  3I4G A;  4N5C A;  4JHK A;  2OV8 A;  2XPI A;  5KCM A;  3LY8 A;  5D0O D;  3KAE A;  3UT8 A;  3GZ2 A;  5JHA A;  2WXR A;  3AS4 A;  5E75 A;  1H2T C;  3D9K A;  3R7R A;  3RRU A;  2WQ6 A;  3FHE A;  4WNF A;  1PC2 A;  2C0M A;  1IQR A;  3KS2 A;  3CEQ A;  4I6J A;  2YNQ A;  4PH4 B;  4AEZ C;  1H2U A;  1TJC A;  1H6K A;  3NQP A;  4KBQ A;  3MKQ A;  4UI9 C;  4BT9 A;  2KCL A;  3VTX A;  2QY7 A;  4U04 A;  3SBS A;  2KAT A;  2VGY A;  3CHQ A;  3LDZ A;  2WXK A;  4CEM A;  5KJK A;  3QJZ A;  3FUD A;  2IF4 A;  4GU5 A;  4EZL A;  3PE4 A;  4C0M A;  2WMO A;  3CK7 A;  3QWW A;  2XPY A;  3CLJ A;  3FTS A;  5J90 A;  3P2B A;  1WM5 A;  3LVQ E;  4G26 A;  2HO1 A;  4MLP A;  2WXM A;  2NC9 A;  2OOE A;  2QFC A;  4XI0 A;  3ZFW A;  4A55 A;  4N2Q A;  4AVX A;  3HHM A;  4UI9 J;  2VGX A;  2VSN A;  4GYY A;  2GRM A;  4FAD A;  2DBA A;  2X6J A;  2IOL A;  3MCX A;  4ACK A;  5A23 A;  2VTB B;  3SFZ A;  3FU5 A;  4LEU A;  5EDS A;  3CK9 A;  2XHE A;  5ARG A;  4DI4 A;  3CHR A;  4WNE A;  4HOS A;  2PM7 A;  3KEZ A;  2PL2 A;  3S7F A;  3LJ3 A;  2GGF A;  5AYW D;  4NRH B;  1JWG A;  3FY4 A;  3HVE A;  3TG5 A;  4CDN A;  3SI5 A;  4KVO A;  2IJG X;  4TRQ A;  4U63 A;  4DK5 A;  3TGO A;  4N3C A;  3UQ3 A;  2A5U A;  4DI3 A;  4LER A;  4L1B A;  5KJL A;  4UI9 K;  4CCA A;  3D9N A;  3UUX A;  5AIJ A;  1UG3 A;  4HOU A;  2WXL A;  4L2L A;  1UJJ A;  4BWR A;  4ILI A;  5T3R A;  4F1S A;  4JA9 A;  4D10 C;  3L54 A;  4CGV A;  3SHF A;  4GAA A;  4F53 A;  3L22 A;  4ILG A;  1OWM A;  4GMJ A;  5KJN A;  5G04 J;  3VTY A;  4J8S A;  5LX8 A;  1H19 A;  2KCV A;  3MX3 A;  4E6H A;  4G23 A;  3UPV A;  3E4B A;  3TG4 A;  3G2W A;  2OVB A;  3FUF A;  3PZD A;  3MV2 B;  4AP2 A;  2YHE A;  2V8S E;  3ZVV A;  5LCW C;  3QOU A;  3TXN A;  3U9W A;  2J49 A;  3CVN A;  2AW6 A;  3RIB A;  5CCL A;  3IHY A;  2LO6 A;  3OXF A;  5JJT A;  3FFL A;  3L13 A;  2I2O A;  3B13 A;  4RSY A;  4I1O B;  3VLE A;  4BY6 A;  3ESK A;  1Z3X A;  2I9C A;  4Y6C A;  4F7A A;  2IQC A;  2MHK A;  3QB2 A;  3JYS A;  1PY1 A;  2JLB A;  3NZU A;  3CHP A;  2E0I A;  3FUJ A;  3FUN A;  3FTU A;  4B0Z A;  3AU5 A;  4MKT A;  4OVU A;  4B8C B;  2Y4U A;  2CG3 A;  3HVE B;  1P5Q A;  2C2L A;  3T5V A;  5BT1 A;  2VSO E;  4EZJ A;  2XPZ A;  3HYM B;  3FWV A;  3IKO B;  3L6A A;  4OVV A;  4HOR A;  4APF A;  4FJZ A;  4PS3 A;  4WND A;  4IN3 B;  1Y6I A;  5G05 C;  4EBA G;  2WXH A;  4UWK A;  2AVP A;  3PVL A;  3JCK C;  3FUL A;  2VTB A;  3PE3 A;  3EJN A;  2XQ0 A;  3LVR E;  4G25 A;  5D0Q D;  2HM8 A;  4UWG A;  4A3T A;  2WXP A;  1HX8 A;  3FU3 A;  4I9E A;  4RVB A;  4UQZ A;  5M72 A;  3DBS A;  5BV0 A;  2YHC A;  2OND A;  2R59 A;  3FTW A;  1KT0 A;  4WWN A;  4Q69 A;  1WY6 A;  3ASF A;  3P1U A;  2HYZ A;  3MGB A;  5ARF A;  3D3M A;  5G05 J;  2J07 A;  1HG2 A;  2LAH A;  4EZK A;  2NXP A;  5FZR A;  2RG8 A;  3PH0 C;  3CVW A;  3QKY A;  4I6E A;  2BF0 X;  4J6I A;  3CQC B;  4KYO B;  4LRZ A;  4HOT A;  2IOS A;  3TXM A;  4BTA A;  1E90 A;  4HS2 A;  3SGH A;  3FUI A;  4NAC A;  2GW1 A;  4JC8 A;  2MOW A;  3CIA A;  4J0U A;  4G1T A;  5ANR A;  2V4L A;  3CVX A;  2WXN A;  3QK0 A;  4XZ4 A;  3SF4 A;  1JWF A;  4U07 A;  1UW4 B;  2AXZ A;  2A4Z A;  1B89 A;  3LPZ A;  1HZ4 A;  2XGM A;  1EF1 C;  4I17 A;  5T4Y A;  2CFU A;  2VSY A;  4GYW A;  3CKC A;  3URZ A;  3I3N A;  4GCN A;  2AXV A;  3JQ1 A;  4FP7 A;  5CCM A;  2UY1 A;  4GA2 A;  3GZS A;  3ZYL A;  2J08 A;  4ANV A;  4FA6 A;  4BFR A;  3FTV A;  1U3C A;  2DCP A;  4GZ5 A;  2L0I A;  3MZL B;  3L17 A;  3ZEF A;  2PQR A;  4AOF A;  5LP0 A;  4FHK A;  4KVM A;  1U3D A;  3G2T A;  4JEH A;  5FZS A;  4DPR A;  4GCO A;  3TL5 A;  3HIZ A;  4J8F A;  2L6J A;  3FTY A;  2WXI A;  4L7T A;  4MRU A;  3APD A;  5FTP A;  2YIN A;  3L08 A;  3ZYQ A;  4B8A A;  1BPO A;  2P58 C;  4CDM A;  3FEY A;  3S7B A;  5G04 C;  4UWL A;  5G2N A;  1UN8 A;  4HXI A;  2HR2 A;  2CHW A;  2J09 A;  1JUQ A;  5DBK A;  3OXG A;  1MQS A;  5ENN A;  2XGS A;  3O48 A;  5BPP A;  2WQ7 A;  2WB2 A;  4APO A;  3TJP A;  1FVH A;  2VYI A;  3CKB A;  3Q5M A;  4W9R A;  5C2Y A;  1ELR A;  2R17 C;  4IYP A;  4KMO A;  3IHV A;  2CHZ A;  3QWP A;  3EHM A;  3LYA A;  4ILH B;  5T8I A;  1OUV A;  1QNF A;  3B7U X;  4IUL A;  5FZQ A;  4FU3 A;  1SZA A;  3OXL A;  2WXG A;  4PS7 A;  4YVQ C;  3NF1 A;  1OWL A;  3ML9 A;  3NZS A;  4P29 A;  2X6K A;  4RG6 A;  3ESL A;  5HQ8 A;  1UN9 A;  4H7X A;  3S7J A;  3QAQ A;  3FDH A;  2CFZ A;  3ONK A;  4I9C A;  2ZU6 B;  3R9A B;  2XRY A;  3RRN B;  3CHO A;  1ELK A;  4GML A;  4JHJ A;  3ZYK A;  2M63 A;  2BUG A;  3D9M A;  4M3O A;  3PRZ A;  3APC A;  4BSX A;  3B7S A;  2Y4T A;  3FH7 A;  3G2S A;  3TAX A;  4AM9 A;  2DIW A;  3PDN A;  3CVL A;  1NA3 A;  3FUK A;  1DNP A;  2UY1 B;  5FQ8 A;  5EX0 A;  3CSF A;  3ASG A;  3EIJ A;  4GA0 A;  2VJ8 A;  3Q15 A;  3D9I A;  4FHJ A;  4I1A A;  1NA0 A;  5FQ6 A;  5FT9 A;  1X5B A;  5BUZ A;  3FEX A;  2I6H A;  2V0P A;  2E2E A;  1MHQ A;  2XRZ A;  1HFA A;  3HDX A;  4KZ0 A;  2AWI A;  3LS8 A;  1W3B A;  1E96 B;  2LAI A;  2KCK A;  4AY5 A;  4XIF A;  4PDX A;  2PM6 A;  3B7T A;  3MJW A;  4GZC A;  4ABN A;  3RO3 A;  2X6H A;  4EQF A;  2FEZ A;  1SZ9 A;  3R7Q A;  1OWN A;  4KZC A;  4ANW A;  3ULQ A;  3SZ7 A;  4GZ6 A;  2NSZ A;  2WXF A;  4FUL A;  2XGO A;  2ILR A;  4R7L A;  3JQ0 A;  5FJY A;  4UQY A;  4U0S A;  1IHG A;  2BTD A;  3PS6 A;  3CR3 A;  3LCA A;  2I1K A;  3B7R L;  4URK A;  1TEZ A;  4AXH A;  1Y8M A;  3CGH A;  3LY7 A;  1N52 A;  2X6I A;  3I4R B;  2FUL A;  1E8Y A;  3DPD A;  3RKV A;  3ZN3 A;  3UT7 A;  3UT4 A;  4I1M A;  4J8D A;  5KJM A;  1FCH A;  1JPL A;  4OYS A;  4UQX A;  4N39 A;  4XX5 A;  3ZHE B;  4ATG A;  5E76 A;  4B94 A;  3FUM A;  1KLX A;  2XCB A;  5C1D A;  4U0U A;  5EX3 A;  2Q7F A;  2KM4 A;  3G2U A;  4A3V A;  1TJF A;  1XNF A;  1VDY A;  2EQX A;  4FLB A;  4K0R A;  1EPU A;  2V5F A;  2Y3A A;  2WM9 A;  1ZU2 A;  3D9O A;  4U8H A;  1N54 A;  3ML8 A;  1H2V C;  3FU0 A;  3ENE A;  4F3V A;  3JUI A;  3FUE A;  3PRE A;  3QC1 A;  1GW6 A;  5LOZ A;  4JVS A;  3FUH A;  3PNL B;  3APF A;  2JEK A;  4EBA A;  1E8W A;  2KC7 A;  3WXX A;  2UWJ G;  4UWH A;  3VLD A;  2ION A;  3OTN A;  4WUY A;  3U64 A;  5FQ4 A;  4E85 A;  3ASD A;  5JJ7 A;  2J9Q A;  2WXJ A;  3FH5 A;  3C98 A;  5HI7 A;  2I1J A;  3LXU X;  4JZY A;  3K9I A;  3G2V A;  1INZ A;  1EDU A;  4HFG A;  3SBT B;  5FWQ A;  4CRW A;  2GRL A;  2X38 A;  3CVQ A;  3RU0 A;  2J4B A;  4DJA A;  4DLO A;  4HLE A;  4AV7 A;  4BX8 A;  1IYG A;  3L16 A;  3PUJ A;  3PEU B;  1ELW A;  2FBN A;  5CMW A;  3FH8 A;  3GZ1 A;  4WAF A;  4PS8 A;  3QDN A;  4JL0 A;  4EEC A;  5A6C A;  3AU4 A;  3EIQ C;  5A7D B;  1S0P A;  1E7V A;  1SQM A;  3CVP A;  4GB9 A;  3OAW A;  4JA7 A;  1PAQ A;  5BNW A;  4ACL A;  4FJY A;  2XCC A;  3GW4 A;  3O4Z A;  4A1G A;  3MKR A;  1OWP A;  2L9B A;  4EPZ A;  3BEE A;  1OWO A;  2L0T B;  4I6G A;  1EYH A;  4G24 A;  2PZI A;  4LUN U;  4XI9 A;  2MRI A;  2WMN A;  4I2Z A;  4WWP A;  3ZPJ A;  1HF8 A;  3D9P A;  2CHX A;  2KZT B;  4JPS A;  1XGW A;  3PUK A;  4J8E A;  5BW8 C;  3FTX A;  2WQH A;  1IQU A;  3ZIM A;  4CT0 A;  3ZGQ A;  4ANX A;  3EHN A;  4QFV A;  4YND A;  2VQ2 A;  2XEV A;  5G55 A;  2CG2 A;  2IFU A;  1DVP A;  4TUU A;  2FI7 A;  1HH8 A;  5CHE E;  5JHB A;  4GPK A;  3CK8 A;  3RK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...