2XGSA

Xcogt in complex with c-udp
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
542
structure length
542
Chain Sequence
b'LMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XCOGT
publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
total genus 206
structure length 542
sequence length 542
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgsA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgsA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgsA02
1GPBA 2F3SA 2OFFA 2PQRA 2QRPA 1YA6A 4KQ2A 4REMA 1E4OA 4MRAA 3T3GA 2JZCA 1YA0A 3TG5A 2XA2A 3E3OA 1NZFA 3CKCA 1QZ2A 5D01A 2JLBA 1L7XA 3IEGA 4H7XA 2PRIA 1HXIA 3RT1A 1FCHA 3JYSA 2I6HA 3ASHA 2PZIA 5LQDA 2VGXA 1HLFA 4EL0A 2IV7A 4GCNA 3SZ7A 2H1HA 2X6RA 3FROA 3L7CA 5HXAA 4MHSA 3BCSA 3O48A 5KJMA 2PYIA 4I9CA 2YJNA 2YQ8A 1Y6FA 1IIRA 1UZUA 2FF5A 3UPVA 3DZCA 3O3CA 1KLXA 3S2UA 4I2WA 3NF1A 2XA1A 2VSNA 2E2EA 3RIBA 3VUEA 3ZCRA 1WUTA 4AMGA 5C1DA 3MS4A 2L6JA 4HOUA 1XL1A 3CV3A 3MS2A 3ZGQA 2C0LA 1PN3A 1RRVA 3WADA 3E4BA 3BEEA 4J8EA 1JIVA 4APOA 4W6QA 4GZ5A 1W3BA 4NC9A 4WADA 5M72A 4G2VA 3WC4A 2BFWA 4JA7A 2UWJG 4FKZA 2WTXA 1SXQA 3NAZA 3CUUA 3COPA 1WW3A 4HOSA 1FS4A 3MV3B 4XI0A 3S27A 1WM5A 1P2GA 3QWWA 3FP3A 4I2ZA 2QN2A 2XCUA 1P5QA 1JG6A 3S7FA 2G9RA 4U07A 3AS8A 2KS6A 3AS5A 4AM9A 2AMVA 2IEIA 4N5CA 1P2DA 2IYAA 2NC9A 4MHOA 2KCVA 9GPBA 3OKPA 5JTUA 4WNDA 2QRHA 2C1XA 2V5FA 3S0JA 3TOVA 1GPYA 3BD8A 4M60A 2ECPA 3VDNB 2WQHA 5BT1A 2IW1A 1L5SA 1PSWA 4HWGA 2VG8A 1F6DA 4YUAA 2G9QA 1L5QA 4CDRA 2C4MA 2O6LA 3H4TA 4JHRA 4GYYA 2XCIA 3ZCQA 4GA1A 3SYRA 3ULQA 1FC0A 1NOJA 2C1ZA 2X6QA 4BQIA 4BT9A 3NPAA 2XA9A 5GPBA 2XCBA 2XPIA 3S29A 2F3PA 4G23A 4I1AA 1RZVA 4GYOA 5A7DB 4NQ0A 5ARFA 2DBAA 1XC7A 4GPBA 1ZBPA 1FTWA 3VUFA 4N9WA 3HBJA 3RO3A 3G2IA 2XEVA 3G2KA 4LEIA 3T3DA 3WXXA 4HLNA 4G26A 3CVPA 4NRHB 1E1YA 1PC2A 4J8DA 4X7RA 3MRVA 2X0EA 2QN7A 3WAGA 2IFUA 2SKEA 2PQNA 4GZ3A 1Z8DA 1FU8A 4YI3A 2AW3A 4BWRA 3K9IA 4ME2A 5ARGA 3UUXA 4YVOA 2XGMA 3IAAA 3MV2B 3MT8A 3FWVA 3SF4A 3OTIA 3VDMA 4JA9A 4F96A 2ONDA 1IXYA 3LYAA 5IKPA 4N3BA 3Q5MA 5DXFA 2Y4TA 4AY6A 4HOTA 3MTBA 1AHPA 1J39A 4KQMA 3CUYA 4GPKA 1GFZA 4WUYA 3L79A 3LY7A 2GEJA 2AVPA 2C9ZA 4J0UA 4QLBA 1WV0A 2P6PA 3RHZA 6GPBA 3HBNA 3BCUA 3ESKA 4RG6A 1O6CA 1XKXA 1UQTA 3RO2A 2PQ6A 2KCLA 3LY9A 2GPAA 4RIIA 3NP7A 3GPBA 3Q47B 3MSCA 3RSCA 4GA2A 4WNEA 2ZB2A 3CX4A 5FZQA 3C4VA 5D0QD 3QDNA 5A6CA 5ENZA 2QRGA 2PYDA 4RELA 3CV0A 4L22A 3CK8A 1NA3A 4KBQA 3RU0A 4CTNA 5G05J 5AYWD 4BTBA 3D0QA 1JG7A 2VGXB 3U4TA 3CUTA 3NC4A 1LWNA 1FU4A 3Q3HA 4NESA 5EX0A 3UQ3A 3OKAA 2QN8A 2X0FA 1NZDA 2R68A 5TMDA 1P4HA 4RIGA 4HORA 1GZ5A 2GJ4A 3OXFA 1FU7A 4I9EA 2BUGA 1SXPA 4EQFA 1YGPA 2G9VA 1XNFA 4KYOB 4Z5XA 3L01A 5TMBA 1EXVA 3Q3IA 1NZNA 5CHEE 3D1JA 2UY1A 3L7BA 3KD7A 4JL0A 1Y8MA 3CEMA 3RSZA 1M5RA 2QLNA 4G24A 3T3EA 4BQFA 1KTIA 1P2BA 2QRQA 1K06A 3S7BA 4CTOA 4O6FA 5DBKA 4RG9A 4U0ZA 1Z6QA 3C48A 3ZCPA 5DIZA 3KAEA 5JJ7A 4I17A 3MT9A 4UI9K 3HBFA 1ELRA 2VYIA 3BEOA 3TAXA 7GPBA 1HZ4A 2R4UA 5DU2A 3BCRA 3CVQA 3EBOA 2HO1A 2FEZA 3CKBA 3VTYA 2IV3A 3ASFA 1E96B 3VTXA 4F97A 1A17A 2R4TA 5G05C 4EKYA 2FBNA 4UQYA 2GPBA 2QN1A 5LCWJ 1NA0A 2XGSA 2R5SA 4ABNA 3MTAA 4BQEA 3R9AB 3MQFA 4CTMA 2GEKA 2BGTA 2IEGA 2F3UA 3FFLA 3KS2A 3RJVA 4LEUA 3PDNA 1EM6A 4YVQC 5FT9A 3AS4A 2H1FA 2QZSA 1QM5A 2IF4A 2VGYA 3Q3EA 1NLMA 5CCMA 5JJ6A 1C3JA 4RIEA 1GG8A 1PNVA 4UQXA 1K08A 4N3CA 1NOKA 4UI9J 5KJLA 3L7DA 3E3NA 4IN3B 3OY7A 4WHMA 1UQUA 2ATIA 4H7YA 2C2LA 3EDTB 4CGWA 4N2QA 1P29A 4N2SA 3S28A 3ZHEA 4U0UA 5FZRA 3BD7A 4KXKB 1NVKA 1RZUA 1JEJA 2GT1A 4WNGA 3LY8A 3E3LA 3MT7A 4X7PA 4FZRA 1PYGA 3OXLA 4Y6WA 2R66A 1XL0A 5D0OD 3DD1A 3LKUA 1BX3A 4AMBA 3Q15A 1VGVA 1P4GA 2FFRA 2MHKA 3ZCTA 2WPVA 2R60A 4WNFA 2QRMA 2QFCA 4HOQA 3CEQA 4NEQA 2VSYA 4F9FA 1FTYA 5G04J 1V4VA 2LSVA 5LCWC 3ZFWA 5BW8C 5JJTA 3CK7A 3IA7A 4MICA 2ACWA 2LSUA 1QQEA 3GZ1A 3OKCA 3PE3A 3T7DA 3TSAA 5HI7A 4AY5A 4RBNA 3OTHA 3MA5A 2BISA 1LWOA 2GPNA 2Q7FA 3OXGA 3ZCVA 3BDAA 4UI9C 5FZSA 3ZPJA 1L5RA 3C4QA 3H4IA 2IYFA 2YHCA 3NB0A 1HH8A 1JIXA 3G2JA 2KCKA 2PL2A 3G2LA 3EBPA 2XMPA 3AMVA 3T3HA 4LDPA 4B94A 1FA9A 4WACA 3NCHA 1ELWA 3CEJA 2HYZA 3RKVA 1OUVA 2OOEA 2QLLA 2GM9A 4GZ6A 4EJ2A 4CGVA 3T5TA 2F3QA 2GW1A 1Z62A 1C50A 1XOIA 5D00A 1L5WA 4YNDA 2JJMA 2VCHA 1F0KA 5BNWA 2AZDA 3L7AA 3MTDA 4G2TA 3GUHA 4M83A 1GPAA 3MEKA 2XCCA 2ASVA 3ZCUA 5CCLA 2Y4UA 5G04C 2KC7A 3G2HA 1WV1A 3CK9A 3LCAA 3T3IA 4RIFA 3Q4AB 3UYKA 2AV6A 3ASGA 1Z6PA 3MKRA 5FTPA 4XIFA 2QLMA 2FI7A 1JIUA 3GW4A 1B89A 3PE4A 1KT1A 3DDSA 4F3VA 5FJYA 2LNIA 1AXRA 3QKYA 4MI6A 5TMEA 5I45A 1C8KA 4J8FA 1GGNA 8GPBA 1WAO1 3QHPA 5EKQD 4YI5A 4RENA 3Q49B 3QWVA 3CUVA 3UYLA 2FETA 3ZN3A 2VQ2A 2X0DA 1P4JA 2UY1B 2KATA 3N71A 4U0SA 3HYMB 5KJKA 4AIFA 5TVGA 1Y6GA 4M7PA 3MRXA 3MS7A 4GCOA 4BFCA 2HY7A 2F9FA 1WW2A 3GZ2A 4BT8A 1C8LA 2P58C 3LPZA 5IKOA 1B4DA 2SKCA 3CVLA 3DDWA 3D0RA 1QKJA 2G9UA 2BGUA 5HQ8A 1XV5A 4UQZA 2HR2A 4G25A 3GYZA 1ZU2A 3CVNA 3OY2A 3CUWA 4XI9A 3MBOA 1KT0A 3URZA 3ZCSA 1Y8ZA 3CEHA 1ABBA 3ASDA 2XGOA 5JTTA 4MI9A 2SKDA 3QKWA 4EKEA 2QN3A 2QNBA 3U3WA 1WUYA 3BD6A 4MI3A 4RIHA 4PQGA 4W9RA 3OTGA 1TJCA 2FF4A 1IYGA 4KQ1A 4G1TA 4GA0A 4U04A 4GYWA 3MRTA 2VCEA 2C0MA 2PRJA 2FO7A 4BTAA 2IUYA 1IHGA 4N39A 3TGOA 1L6IA 4AN4A 2J9QA 2Q6VA 2ACVA 3OT5A 1A8IA 5KJNA 4Y6CA 4A1SA 3SYMA 3NP9A 1L5VA 1FTQA 5DLDA 3ZHEB 3HBMA 4EL5A 3TG4A 1NOIA 5EX3A 4X7MA 4X6LA 3S7JA 4N3AA 1H5UA 3G2NA 3QWPA 3QOUA 3S7DA 2QN9A
chains in the Genus database with same CATH superfamily
4ARIA 1ZN7A 3EVFA 3R5HA 1QGED 1WDLA 4XJTA 3ADDA 1CV2A 5FEMA 2AR0A 1WJGA 1YIDA 2QJWA 1IPFA 2EP5A 3GLGE 3TIVA 3R77A 3L8EA 2WP8J 4FKMA 4QEZA 2HBZA 4HXEB 1CZLA 4YLEA 4N54A 2FSHA 1EP1B 2IP2A 1LI4A 1UMCA 3MS4A 3ZNQA 1Q2UA 3VTFA 2Y3IA 2C9OA 1ANKA 1NWCA 3EGWA 2J6HA 2Q5JA 5K3FA 1IBCA 1AKTA 1QIKA 3OZAA 3H2ZA 3MJDA 1HPLA 2GPSA 1N5JA 2GZAA 4RYLA 5JQGF 3PIRA 3PQ8A 2AMFA 1Y3IA 4QOFA 4D74A 2GROB 2W6IA 2IEIA 2OHVA 4II3A 5SYNA 3WZMA 2HMVA 4UPEA 5CDUA 5CK4A 2ECPA 4OI2A 3VDNB 1XRNA 4OYSA 1TYBE 4HNUA 3HKEA 4WJKB 2B4AA 2VF4X 4P7JA 3ABME 4P58A 3MWGA 5A0FA 2OB2A 3T1QA 2VYNA 2O7RA 1ACJA 1DPGA 3B1FA 4RTSA 3CHMA 2ERXA 2IWRA 3CLKA 4WK4B 4DQDA 1HTTA 4OSOA 5HF5A 1Z06A 3PZRA 1PJTA 1HFEL 5JD3A 2YW9A 4RNCA 2YBEA 2PKXA 2JG3A 1GYRA 4WK6A 2WWRA 1JS1X 4LXTA 1QHYA 1SIBE 5FPQA 2B36A 4UFNA 2HBYA 2IQ5A 2CY0A 2VDVE 4C9BB 2AFRA 1ZVKA 5HZMA 3CV0A 5PGMA 2FLWA 3DFZA 4IF6A 3C3OA 1CP3A 5F7JA 4UULA 1G1MA 3MMNA 3ORHA 1AM4D 3RCBA 4PLWA 5F64A 5DYIA 3PRJA 3WO1A 3AIOA 3Q3IA 3LTEA 1S7GA 5JNRA 1E2BA 4I1YA 4DIOA 3SZGA 1Q0RA 2OMEA 1NNEA 3I0ZA 1DJMA 1AMNA 2YXNA 1UJ4A 4O8ZA 5DU2A 4KR6A 3DOHA 4PINA 1M2VA 4OHBA 4RJIA 1SBNE 1KO7A 5HCNA 1ZBQA 5CA1B 5CH5A 4O2BF 4PHTA 4EI7A 4MUAA 3M70A 4X8OA 5D2CA 2JCSA 1QIEA 2ZULA 4MPJA 3S8EA 4P3XA 2RAPA 1CQPA 3OP1A 3GC6A 4IZHA 5LU8A 5D6NA 4QL3A 4BDTA 1XL0A 4N0EA 4TVOA 1A5AB 2G72A 4CEHA 3DL4A 2PAFA 4KQXA 1NQVA 5IVDA 1JA1A 1KHTA 2Q1UA 4DM7A 4B5LA 2GRMA 1F4VA 1YFKA 1UJ6A 3VZCA 4P92A 5IHXA 5CHEA 5FF9A 1UBRS 1OLOA 3TTUA 3C4QA 4BNMA 4Z4HA 1YH3A 2H4YA 5HDBB 5KHLB 3RVDA 2IYYA 1O6GA 4YMGA 2Q5IA 4RS3A 3PJEA 3DOIA 3AJRA 5E7IA 3ZHZA 2JK1A 2X9VA 4J0IA 3B2EA 2PIDA 1M67A 3AR8A 2EF1A 1Z28A 3NBNB 3OHMA 2C84A 2WSIA 4RHEA 4Y7CA 1IY9A 2QLTA 5EWMA 4V0SA 4JFAA 5CBPA 4OLFA 1RBMA 1Q7EA 2WXMA 1BHO1 1TTQB 2VXOA 5B1BE 1QC5A 3JRNA 1JEYB 3UYLA 3ZJTA 4MULA 3RYTC 5BOSA 4BN0A 3DDNA 3KVNA 4C6SA 2GASA 3H0KA 2VQEB 3UMBA 2DKOA 4RFVA 4P54A 4XPIA 2LVBA 1QIDA 4UDOA 2VHJA 4RQIA 1EFPB 3R0ZA 4YAIA 2H52A 4COKA 4PZLA 3U56A 5JCOC 3CX6A 5ECDA 1YRYE 5CGZA 4LKOA 3KAJA 4KP7A 4B4VA 1CK4A 1SVUA 3PFCA 3BD9A 2JVIA 1KC3A 1NVDA 2BRUC 4DIFA 4PU0A 3B7TA 2XCQA 3CLSC 2VUUA 4MGHA 1FMLA 2CUTA 3NUGA 5H3CA 1GCUA 1TFRA 2C2YA 4HDMA 1YRBA 3K92A 2B69A 5BYKA 4X1IB 3W3ZB 2ZUTA 4G65A 4YWJA 3ZY2A 2FFAA 3EIWA 3FCSB 3VTKA 4XDGA 3M1YA 4KE7A 5JD6A 4LF7B 2BI4A 2VSXA 3A4IA 3BEEA 3U3RA 2AXQA 3FKSA 1MAUA 5IH7A 4PXSA 1XMPA 3CNQS 2TYSB 4M8KA 2PUWA 4Y98A 1JDBC 3JXEA 1J2JA 1P39A 3V1YA 2W6ZA 5AQ9A 2RAUA 1BKYA 4C76A 3A58B 2BBOA 2GRUA 3BREA 3V97A 3V3TA 5GY7A 3TTXA 2XEDA 3S29A 2AD1A 4KAAA 1LVUA 2CL0X 2RHWA 2ZSDA 2YMMA 3HN6A 1NPTO 1RJFA 3E3MA 4D3ZA 2Z58A 2DE0X 2EJTA 2DBYA 1O03A 4JS0A 2DCUA 1QAMA 3CZ5A 3LHKA 1KDVA 4ME2A 2Z8YA 4RZQA 3ACBA 1T1GA 4ECAA 4NBLA 3KSAC 1NVGA 1OPRA 3CUYA 2PMCA 1YJXA 2NZXA 3DMTA 2UVPA 2BGWA 5FOUA 3OE5A 4TV3A 1O08A 3Q47B 2BZSA 3C5RA 4FE4A 4N01A 3E9EA 1LQUA 2ATXA 3CPJB 4GOMD 4LA4A 3DHYA 1CW2B 2IZ6A 2XMQA 1OZ0A 2X5JO 2ICAA 1A7KA 1YGPA 3OM1A 3R5XA 2OT3B 4L6IA 3VZRA 1UDXA 4W5NA 5HS4A 4LUNU 1NRXA 4OEHA 3WP1B 4MPTA 2FPPB 5HZGA 4DMGA 4IG9A 3BA1A 2CG2A 5EEHA 1YQUA 3P4UA 1BVUA 1QSGA 1KJNA 1E32A 3DSRA 4KE8A 2NZVG 3B7UX 1NFIE 1VI5A 4F4UA 4US2R 3KS2A 2B82A 4MQFA 4UFPA 3TWRA 1C3JA 3L2OB 3PDIB 1U8EA 1N1EA 3FPGA 4CFYA 5E0OA 3H2YA 3LHSA 4LF6B 4O4IF 4F91B 4YDRA 4A3TA 4J03A 5GZ1A 3EYAA 4DG8A 1I7PA 2HL6A 4AZTA 3G0GA 2C1EA 2ZDHA 3KL2A 1NBOA 4KN5A 4Y1RB 2B7LA 3SNXA 4GVPA 1QQEA 1DAPA 3OTHA 4PW0A 5ICSA 1GKIA 1M73E 3ROMA 4E12A 1IUNA 4IQ4A 3PNYA 4R1NA 4ND5A 2L82A 1O89A 1USGA 1P8JA 1RFGE 1ZH6A 5CFRA 2NTVA 2QQ0A 5K6RA 3A1DA 5DTIA 3GDFA 1DKUA 4JD5A 5EKDA 3ZYKA 1NDUA 1YUMA 4JPSA 1AP7A 1GFIA 5FJYA 1YQDA 3EDRA 3NV9A 1GAJA 4RD4A 5C7IO 1IM8A 1ZUIA 1N33B 3PP8A 1MMFB 4MR7A 1XK7A 3R7DA 5IUNC 1YIOA 5D1NA 3DE5X 3THYB 4JU8A 1TPYA 3KQPA 5B6PA 1I8TA 3IVMA 3GO4A 1F5SA 3WGJA 3P8ZA 4C0SA 3ZEIA 1SFRA 2WHRA 3UB4A 3HJRA 4WCVA 4F04A 3K35A 4Y18A 1L5JA 1EFTA 3ZDRA 3CGGA 5A3RA 4M9XA 2IXFA 2VDWA 3ZBUA 1FP1D 3A05A 2Q6VA 3TW6A 1RQPA 3P32A 2HIHA 5H82A 3TG4A 1NOIA 4W9NC 5HPYB 1K7CA 2K7FA 1SO8A 2HTEA 3PXDA 5CT4A 1N4SA 3UFXA 5BN1A 1TCUA 4G0YA 2PCJA 4ZANA 2WUEA 4Y2PA 4FZ3A 4ILEA 1HLDA 5EILA 1LI7A 3I09A 5BO5A 4Z1OA 5JMTA 4X94A 4GE0A 3KKQA 2OHGA 5KYYB 1OI2A 1CY8A 2FWRA 2OO5A 3RPEA 5HF8A 4M88A 2MSWA 1PGOA 1JTEA 2CJWA 1EHIA 2AQHA 3QV2A 3LGSA 3ORRA 1W75A 4QYSA 4ZICA 2BFWA 2FJUA 4KODA 1ZG3A 2XYGA 4AJNA 3PX2A 3WL6A 2P9NG 3UG7A 2G9RA 1F8XA 3O9MA 4BO1A 1XRMA 5ALTA 3U7RA 2WBLC 3ZKJA 2FR0A 2IELA 4R8RA 3KKPA 4K6FA 5IN4A 2E4XA 2ZRKA 4DCTA 4CLDA 4OUDA 4EAQA 4BMNA 2ZM5A 2ZG6A 5CIWA 1RW4A 1JZSA 1GL6A 4EB8A 2BR3A 4LBZA 1ZUWA 3P20A 4M0UA 4CKEA 3WXXA 4RTOA 4NRHB 4J8DA 1MJFA 2YNMA 1SVIA 4ZQEA 2VYVA 1E7UA 3BGWA 1PUJA 4HNAA 1ZD3A 3KALA 2XGMA 4PUCA 1DIGA 1I3KA 4N3BA 2MMGA 4UXJA 2CDNA 3AF6A 3GNQA 1HEYA 2NSDA 2XQIA 2ZLBA 3UWSA 3SM9A 1R5NA 4G37A 2R7MA 3M82A 4C0XA 1UOHA 2F0YA 3MAJA 1YAJA 4H7KA 2HDWA 4ZDJA 3IMKA 2FWBA 4NAUA 4D8WA 1JU3A 2Y0BG 2Q5LA 3OJEA 4Z8YA 3KVOA 4JXTA 4A4DA 2DCMA 1OHHD 3W9YA 1VL2A 4G5XA 1OX4B 4FEYA 3WZLA 2G25A 3A1CA 1U1EA 4PFSA 4HDSB 3S68A 1EXVA 5ARBA 1B2RA 4ZJZA 4PLZA 1G8MA 1Z7YA 2GLUA 3RM3A 1JBEA 3D3EA 5CFNA 4P83A 3FAKA 5DIZA 4KVZA 3LX8A 4MDYA 3ESZA 1ZVVA 4D8VA 5T4HA 1XJQA 4F97A 4F3NA 1V7PC 4MA5A 1ECFA 1OREA 4N6GA 3FFLA 3G5LA 3RJ9A 2IZ7A 1AV6A 5J5VA 3UATA 1S2GA 4MS1B 1PNVA 4OAPA 1EHYA 2ZCJA 1U02A 3PC6A 4U0UA 1ECLA 1NKVA 5JWOA 1GPJA 1VP3A 1R9GA 3LY8A 1XZJA 2QP9X 2GI4A 3OTQA 3VR6A 2Y71A 2L69A 3AG1E 1X70A 1M7BA 4KR9A 1R5BA 3WK7A 2J08A 5FLEX 3CPSA 4WA7A 3TI9A 4QOEA 2GJ9A 2O48X 3VMMA 1A4XA 3Q7AA 1J7JA 4L51A 3FCOA 2ZAOA 2REXB 3NB0A 1ISFA 5LZ4A 5I9SA 4HJRA 4OMCA 4WACA 1WTAA 3U6KA 2I9KA 5F9FA 1A76A 4EHIA 4MIYA 2RG8A 3H1FA 4LZZA 2QX9A 4QT4A 2JVKA 3ORYA 5GGYA 3K70C 2CE2X 1KKUA 3ORQA 4WWPA 5DCWA 5B1HA 1YBFA 3KQTA 5AHWA 1S8AA 3BN3A 3C45A 2P9FA 3FOBA 2R8XA 1O95A 3ON5A 4X97A 4KWTA 4J3FA 2P9BA 1H2TC 3W8DA 1I1OA 1WSWA 2OTCA 3CLTD 2AE2A 2AGVA 1Y42X 4RDHA 1UDRA 1YR3A 3KQLA 4NABA 4ADSG 3G88A 5G0VA 2WWVD 1Q7CA 2SHKA 2D0OB 4JI0B 5JALA 1RKXA 1YMPA 1SHLA 4DA9A 4LQLA 4YGXB 3IAM1 3HCDA 4MUIA 2XQGA 2FW1A 4N3AA 2I9PA 4GMJA 3NBXX 3E53A 4N0MA 5LZ9A 3ZVLA 1NHGA 5LVAA 3I12A 3N8IA 2D59A 3NHPA 2BTOA 1QZ2A 2H6FA 1YQEA 3L46A 1W87A 4L4UA 3GJ0A 5BR8B 4NZPA 4GC5A 2D0IA 2GF9A 4JB0A 5IF9A 1ZH2A 5K3OA 2WQ7A 4B5KA 4KDEA 1ODCA 1GFWA 5DTQA 1LD3A 2AFHE 3MYYA 3L6BA 1XDZA 5B1YA 5BSTA 5ALZA 4G2NA 2GEBA 4EO9A 2A7QA 1E1LA 1A8PA 1DFHA 2ENUA 1XQXA 4IWXA 4PPYA 3T9EA 3VKUA 1CJMA 2V5FA 2W4IA 4QUDA 1JR6A 2XSZA 1U3TA 2AEMA 2GF2A 5TJHA 3WB2A 3L05A 3CWZA 2C8KA 3U1BA 1Y8QA 3QLVA 1MIOA 5ALPA 4W8GA 3N2ZB 2ZU6A 3RFCA 3QEJA 4EYEA 5A7FA 5IAJA 2V0PA 2YRWA 4HDKA 3KSLA 1CT9A 2EJUA 1C9EA 3E2IA 2P79A 2WIDA 3GJ5A 2G9NA 3WRWA 2DQ4A 1HETA 1VXOA 4DDTA 2PBRA 3HVEA 2EP8A 3N8NA 5LQNA 2CXQA 4D0SA 1JT2A 3JQAD 2IS4A 1LBSA 4LOIA 1KXJA 1DBSA 2EP7A 4PRKA 2O2DA 5F1YA 5B53A 2QRLA 4HPJB 3V7YA 4DZRA 1SQ5A 5IASA 4NV3A 1CWUA 2W0SA 4Z0PA 4QUHA 3IPYA 1AG9A 4Y6QA 2VYFA 1FU4A 2BGIA 1Y63A 3M6IA 3DXYA 1US8B 3ILSA 2WXIA 1LH0A 3L18A 3R75A 3L6DA 1WZ2A 1WX1A 3C3WA 5JLJA 3M33A 5CFQA 4KZCA 2NT3A 1S3FA 2YWJA 2Z5FA 5ALKA 4Z4QA 1KO1A 3GXOA 4OXYA 3VJRA 4MVXA 2X3MA 3FUMA 4LNGA 4R81A 3CVVA 2FOXA 2Q21A 1JDNA 2VK8A 5C8DA 3WWPA 4W7SA 4LQ4A 3LT4A 4N3CA 3LOQA 2FUKA 1CDZA 5H9VA 5L9AA 3OC6A 1F8GA 4K9LA 1EG7A 3HXDA 2GCOA 5FL3A 1RWMA 3I72A 1W96A 1OT3A 3KJFA 1VGVA 3OHPA 4OQLA 1K3ZD 4LE2A 4BVAA 4ZT2A 4AKIA 3DEOA 3OF2A 3BM5A 2VUIB 2WE8A 3MVEA 4N5HX 1T3TA 3NOCD 3M6FA 1LPBB 2ZPTX 3HKDB 1RCFA 4X1KA 3JQFC 3LMKA 1T2UA 4J16A 2HA3A 3H6GA 3BTOA 5FULA 1Q21A 3OPVA 1T8WA 1I5EA 4BX8A 4MCHA 3BSSA 5A0TA 1WOMA 4M83A 2CLMB 3S2YA 1RKUA 2Z4TA 1R4MB 1L3CA 4MCJA 1ETHA 5BQFA 3GCDA 4UWGA 2EZ4A 1V5IA 4JY7A 1CDOA 4HGZA 3OMXA 4OHZA 1Y9JA 4G36A 3NHBA 3HYLA 1ACMA 3IEKA 2I2XB 4WXMA 1YHNA 5K0EA 1YE5A 1SUWA 1Q19A 4Q4DA 2JEOA 3LPDA 1M6NA 1KT0A 3R6LA 1ID8A 1S2NA 2NO9A 2RK4A 3CLRC 4ARBA 4AS2A 4BWFB 1UBJS 4HX2A 3CF2A 3G7NA 4ZYVA 4JVNA 4F4DA 1J25A 2XXAA 1GLGA 4OMFG 2C8VA 1SCKA 3VSDA 2ZXFA 3ISJA 4PSUA 4UTVA 3ZHEB 2D1SA 4FC7A 3LBYA 3D81A 4L3OA 3DYIA 3VSCA 3B6JA 3J81A 2V7PA 1H66A 5AHKA 4RO0A 3ZTWA 2WAYA 2Y2VA 5FWYB 4RJJA 2MSDB 4KH1A 4RHCA 4INPA 1EZZA 4EBAG 4BEVA 3IJPA 2QPOA 4ZVMA 1DTWB 4FFLA 5DTMA 4JNKA 3DOFA 1Z4KA 3PQEA 3IBSA 1KAHA 2X40A 4DY6A 2R03A 4UNQA 3GROA 2LE0A 4IGAA 1UXGA 1DCTA 4OX9Y 1FZTA 3WLEA 1V8BA 4TS3A 4EA8A 3ZI7A 4DTCA 3H16A 3AS5A 3KP1A 2DLDA 2OR3A 4K6MA 4LCEA 4EBFA 4LHZA 3PR1A 1GDHA 2NO5A 4NPHA 1RJEA 1F7UA 2IOFK 3TYXA 3LC2O 4EHLA 4YJ2B 2C1ZA 4EYKA 2EHDA 1OXBB 1TA9A 1WXWA 4EP1A 2DYKA 3IOMA 5FNVA 5CTJA 3ENKA 4WBNB 5L4LA 1KO5A 4TUYB 3AVVA 4I1OB 1VIAA 2O8BB 4EM6A 1BKSB 1I7NA 2R44A 3I2HA 3R9XB 1N2IA 2HDOA 1TVKB 4S1VA 1IXSB 1GUFA 4Q3KA 1DU4A 3RANA 5FQ6A 1RZ4A 5IYZA 2NUPB 1SOUA 4LC9A 3BGIA 4J0UA 2VEDA 4EMTA 3NM4A 3ZWAA 3AI7A 3I28A 3IKOB 4WNEA 1YGYA 3U13A 1UBOS 2HNKA 3F0TA 2JA1A 3RU0A 1OLSA 2Q5QA 3OQNA 3CZMA 1X39A 4YRNA 1G8FA 3OXFA 3AKEA 1RE0A 3WIEA 3LA6A 2CT8A 3KSMA 4B17A 4B8WA 5COAA 3L0IB 2SCUA 1E9RA 3EW9A 2CFRA 1CYDA 3B12A 4DSUA 2C5FA 4TRJA 4EARA 3ELWA 3PFNA 4O60A 6CHYA 1IN5A 3OWHA 3CWCA 3KEFA 1QJCA 1S96A 1I4LD 4JHXA 3O74A 1W5BA 3O91A 2B4RO 1C1DB 3IV9A 3O1LA 1NLMA 3ILVA 3T9BA 2C9YA 1KJWA 3UGQA 2OZLB 5KJLA 1TJYA 3HG0D 1BRMA 4CQMD 1HDZA 4M1SA 5CLGA 3AF0A 1A95A 3E3LA 2EX4A 2FMXA 4F1JA 4Q66C 2F1HA 3DYBA 2XITA 4P3YA 1WCV1 5FOSA 3IA7A 1NTRA 1GKUB 4DUGA 4NAHA 3ZW7A 4HUTA 1SU8A 3P2IA 3MC1A 5BVGB 3CF4G 1L1QA 2YINA 1KS2A 3V1NA 4WMLA 1OGJA 1T24A 1QKIA 1ZA1A 3OJWA 2C2OA 1QX4A 4X1YB 4RLFA 2FEWB 4BMPB 4QTUB 4F1PA 2B3DA 3TZ6A 2PVSA 3DRAA 3OJOA 5L51A 3DQZA 1RQXA 2LRHA 1B89A 4GPAA 3LLUA 4TM7A 4JOBA 3B6KA 4DR4B 3DMHA 3QKYA 1FT2A 4ROSA 2EJCA 3NZSA 4AVXA 4TKUA 1RC0A 4G1VA 2C0QA 3COSA 4KQ6A 1QIFA 4IINA 5DNVA 2CVPA 4O59O 1PJLA 2KI5A 2HY7A 3HGQA 3GYBA 3DH0A 5KNLA 1NBMA 1ORIA 1OR8A 4JKOA 1NATA 4Y1GA 2A9QA 4JI8B 9ABPA 2OCAA 4OGLA 3QKWA 5JXJA 1H42A 2GWHA 2J7PD 1WXHA 3AU4A 5DSXA 4JLMA 2KW5A 1K7YA 2IUYA 2VTEA 3CUSA 1WZEA 3FYHA 4U8GA 2AA3A 3AP1A 1MKYA 5FL7D 4TXHA 3OF3A 1KDRA 2ZIFA 3P9PA 5JIBA 4ZN6A 1KOLA 3U4HA 1VBFA 4ZAGA 1E0JA 1EUYA 3FLEA 4UKDA 5EHXA 1OVMA 4NBRA 1KI2A 1Q84A 1QFSA 2UYOA 1PWYE 1ENOA 4HB3A 4FFVA 4OPMA 4ONEA 4WUTA 4HAXA 3O1JC 1H9CA 1ZAYA 1WL8A 3NEPX 3H3JA 5M72A 2XEXA 3ZW8A 2OFOA 3S2AA 5F3WB 2HKIA 4OFXA 3LFTA 1JN0A 3AI3A 2Y1XA 2ZBRA 2O1XA 3IA2A 2QX6A 4BKMA 2D5AA 4WFKA 4MV0A 2AW5A 1GARA 2XB4A 3KLPX 4F1KA 4QGBA 5EHGA 3RT7A 5AKYA 3H6KA 2HFJA 2RHLA 4W7HA 1L5MA 2ATCA 4Y0NA 4GIBA 1EIZA 1XKTA 2X8BA 5ENTD 2R00A 4BY9E 3V00A 2AKEA 3PPXA 2ZRQA 2Q2WA 2W6NA 3INNA 1ORVA 3P9QA 1XDSA 5KBYA 3AJ8A 5JS7A 1EBBA 3EQ8A 2ZJ0A 4BWRA 4KYIB 1OXMA 4XX5A 4M21A 1MJNA 5DBGA 2B35A 1PK8A 5HWSA 3X2SA 1AA9A 2BHNA 1V7ZA 4Q5IA 4P0TA 4XTCS 3ZLVA 2C9ZA 5ED0A 3GB9A 4O1IA 1HT1E 1KVUA 4Z86A 4AY4A 2X4LA 4TXJA 1GUZA 3HSYA 5DDIP 2YC4C 1X9GA 1T2EA 3CFYA 1ZOSA 3H8WA 2DHCA 1XQVA 4EQFA 1J8DA 4OXIA 3NKLA 1KJ8A 1Q20A 2OGWA 4M9CA 2QLNA 3UAXA 4FNAA 2FY8A 1JYFA 4GXTA 1T1JA 1L4EA 1UM9A 1XLTA 4PC7A 2WRZA 2PKYX 1KBOA 2M1XA 4KFRA 1E96B 3TW0A 5BV7A 5G05C 2YYZA 3BG5A 2QSJA 4YJFA 4UEKA 1C3EA 3TVDA 4CCYB 2RGGA 3ADKA 4UUQA 2F43A 1AB6A 5JT1A 2BKUA 3COVA 1SK8A 4AF8A 1AQIA 4IOLA 3LJ3A 1NJ5A 2X9QA 4XUDA 3WYGA 2H54A 3FOWA 1E8XA 3IT2A 1N3IA 3AW8A 4UUPA 1FLVA 1YOBA 3UICA 3D6UA 3K6SA 4OVVA 3PK0A 4HOQA 3W9SA 2GEDA 3VO2A 2IX3A 1VFPA 3U3ZA 4A0HA 2NVOA 2FMKA 3TDNA 1BRTA 4CLRB 4BCBA 2CBXA 4GGOA 1KEPA 5FZSA 3SQVA 5DIFA 3BMQB 2D1TA 3GMDA 3ND9A 4R2MA 3FVQA 4MYHA 3HCWA 2EC5A 3HKCA 3KVRA 1DINA 1H1LB 4FR0A 3HWSA 1ZPDA 4B3HA 1AWCB 3HA5A 1LLDA 3EY9A 4AMVA 3ZZTA 1FF9A 4F9EA 4RLYA 2O2ZA 4FFSA 4S1WA 2VWGA 4KHZA 3VDRA 2GBPA 4L8WB 2ADOA 3OJ0A 1ATIA 1PU2A 2UY1B 4MR8A 3ILYA 5JI2E 2PX8A 1CKEA 5GTDA 4Z9XA 4EY3A 1C1HA 4JC4A 4U3JB 2H4WA 1TM2A 3OURA 2UUAB 4KIGA 3WOHA 2HM8A 2JAOA 5HQTA 1ST3A 821PA 2CJYA 2QAGB 3TRFA 2AUNA 3OIWA 1RYZA 1XB2A 4LAFA 2XUHA 3PXAA 4M7OA 5K0LA 4ZI5A 3EG5A 2DU8A 2P2CA 3VR2A 4TWIA 2CSXA 3D6VA 2PUFA 3SF0A 1YFJA 2JS7A 3A14A 2NYAA 2Z5GA 3BBLA 4DXAA 2AOTB 3CGWA 4WEOA 2P6OA 1P0QA 2ETAA 2J41A 4NCJA 4C0KA 2E89A 3AEQB 2YXEA 4LG6A 3H5AA 1YS2X 1CEQA 1AZSC 1VSUA 1SVSA 2L6JA 4GUDA 2FSPA 4HADA 2C04A 1KZYC 4D9GA 2QTTA 2O5EA 1ZL0A 5BXQC 3P9XA 1S2OA 3F90A 3H75A 5C8YA 3VPFA 3HC7A 4ZT5A 1SXJA 3S27A 1JLHA 2DF8A 4RF3A 4O5AA 3R8CA 3ZE2B 1KSJA 2HO5A 1DKRA 3O6VA 3U7GA 1GN9A 5DI3A 4R9SA 3OE7D 3I01M 3SCZA 2VBGA 4B2LA 1H0HA 2V9ZA 5I8ZA 1B23P 2WQHA 1UT8A 3KBBA 5HRUA 4E2FA 5E38A 1OCZE 4US1R 1C7ZA 1EWRA 1P0PA 1DZIA 1LV8A 4FEEA 3NBYC 2IONA 1IVSA 1ONSA 5FQ8A 4DX5D 3Q78A 2PKWA 4GPTA 1NR1A 4WNAB 3RH0A 3KEAA 1X7XA 3CNLA 3HV0A 4QDXA 3HJBA 3FDIA 3EEQA 1DC8A 3LYAA 1G4AE 2DFPA 2JH9A 1E69A 2OXCA 4LNUD 2X4IA 4MQ4A 1P73A 3O3NB 2P2CP 5FAKA 5JUWA 2QI9F 3IC5A 2EYUA 1I2ZA 3KC2A 4MWTA 4P93A 3VR3D 3HCOA 1ZJYA 3MW8A 4M0FA 1Q0HA 3RADC 3I73A 4MPRA 3C4VA 4WTOA 4QU5A 3DTVD 3K9BA 3TFOA 2ES4A 4CTNA 5FR2A 1U11A 4X20B 2X86A 3HR7A 3FX2A 5K09A 2JBAB 2WR8A 3URMA 4O3MA 3IUQA 1EU1A 3Q7QA 1GNLA 5DHQA 3UGKA 2W2VA 4FADA 4BEBA 1TR4A 1RHRA 3QOYA 1VKRA 4UBIA 1XXHE 1FDRA 1WB6A 1RAIA 4U9IS 4H6WA 4QPDA 4Q48A 3IBTA 4WZBA 1ZMBA 1MZCA 1TJ5A 2BDEA 2GYVA 2OBBA 2BCGY 1PTJC 4IDHA 4QBFA 4OKSA 1T9BA 4KFCA 5HVNA 4L74A 2ZWMA 4IYRA 1RQLA 2Q49A 4KQFA 1MXFA 3CIAA 4YDEA 1TC2A 4ZREA 2EILE 1C9MA 3KHSA 4JZKA 4C3VA 1KEEB 1QH9A 4FHEA 5J47A 1UP7A 1FP4A 1TECE 3TPFA 3GG9A 3SQMA 4PYQA 1WHSB 4XAQA 2YHEA 2CHGA 5KQGA 1FPMA 2JJ1D 4BVBA 5JSFA 4ANWA 2QIPA 3VR4A 4PN7A 2I9CA 3H7IA 3IOYA 3A3YA 1B7GO 1GTVA 3AMVA 5C9ZA 4JB8A 5FR1A 4ARUA 4HWKA 4PGGA 2I2CA 2YYAA 2E4UA 1V9CA 4AX8A 2JLYA 1AA6A 1N0RA 3WGOA 3GOQA 2AZDA 2XKAA 2Z2XA 5K99A 3D54D 3EGVA 2QYSA 4NP6A 3OEWA 4PCAA 1F06A 1VL5A 3WHKA 3GNLA 4C4YA 4RENA 3QWVA 3I01A 2GARA 5DYGA 4PLCA 1QAOA 1NW9B 5F98A 1M2OB 5BT9A 2XDWA 4D0GA 2D5IA 2AX3A 1LKZA 2O0JA 1N4DA 1FLAA 4XI9A 3CRZA 4LZOA 3D9QX 4BETA 3EN0A 2H6IA 1V8ZA 6NULA 3GLIE 1JFVA 2VTVA 2E4ZA 4C0WA 4BX0A 4RPHA 1FCJA 3LC0A 1G8JA 2G07A 4TLLB 2WW8A 5KQRA 4A8JA 4HLEA 4A1SA 1KDYA 5ALUA 1ZOIA 2RHCA 1NRWA 2WF7A 3LCUA 4A8HA 2IIVA 2Z9CA 1E0SA 5KUTA 1MDBA 2BH2A 3TTWA 4GTQA 3KSQA 5KX5A 4FWTA 4EPYA 5ESDA 4O4LF 1T5IA 2HK8A 3ZE0B 2H2FA 1N77A 2X6HA 3VNQA 1RYEA 4E5PA 4GNRA 2GXUA 4JB8P 3GRUA 4TN1A 4MOWA 3GWGA 3HZZA 4MA0A 1BD4A 1IC6A 2QG9A 1RRVA 4NBSA 1BI7B 1EXWA 1NJFA 2GZDA 4NENA 7YASA 3T1YB 1QB7A 3K0CC 3CUUA 2R59A 4P82A 1OCCE 1XHLA 1SA0A 2BFFA 4DC1A 1I4DD 5F7ZA 3PITA 3ML8A 3Q0EA 5CDTA 2F1KA 2OBXA 4BMSA 5CR9A 3PFWO 4DW8A 1K9SA 1PFYA 2K2QB 1DBIA 1UMBA 2VG8A 4ZI3A 4ZYYA 5JYEA 3TEMA 4G0VA 5B3SE 5EDSA 2DUUA 3O8QA 2F3PA 4NQ0A 1VMIA 2W6JD 1AGPA 5FP0A 1W88B 3CVPA 1C3VA 3WWYA 3ABLE 5CG2A 1W0JD 1Z15A 5IAAA 3SFYA 1R0BA 4CF7A 4QPZA 5DX0A 5LP0A 3KQNA 5DTEA 3HEAA 2WJAA 4ND2A 1UBEA 3E0QA 4QVKA 3NT2A 2V65A 4I2NA 1VJ1A 4L8YA 4QQIA 1L4FA 2XRYA 3RHZA 1N5LA 1JLLB 3FUIA 3C8UA 2RHRA 3K9NA 4LRTB 5IXYA 2CV0A 3MHPA 2I3GA 3ZY4A 1Z0ZA 4IV8A 4GD3Q 2P9EA 2YN0A 4IDBA 4MVJM 1HR0B 3AX6A 3SIPA 3JQ7A 1QCZA 2C5EA 2E5LB 1R6AA 3BZBA 1XROA 2PQMA 3Q3HA 4U9HS 4LTNA 1VCHA 1E5TA 3H1GA 4V38A 5HUQA 1NI4A 1Q17A 1KC1A 1MJHA 3L01A 5I7FA 4DUZB 4EDFA 5DGHA 1APBA 2NTYC 4DIDA 1KZHA 4BJ5A 1EPUA 1S3SA 1RWOA 4EI9A 1V4NA 1R3DA 4R7TA 4E03A 2VN8A 3Q7IA 2IFTA 3QLEA 3VVBA 1PCXA 1YDWA 1XPJA 4TKLA 1BXRB 1DX6A 5FAXA 1QGUA 1YAHA 5FLXA 3W6OA 5DOZA 2OE2A 4LMBA 4Q3BA 1JQAA 5AQ7A 4E08A 3D8TA 4YP5A 4AV7A 3OFNA 4YMTA 4K05A 1T9GS 1Y8RB 2V8SE 2AFIB 4OK5A 2J5BA 3S1AA 4CM4A 1P18A 3AUKA 3HDGA 1GZ4A 5D0OD 4N0QA 5IVPA 4QBKA 1XA0A 5DULA 1HQKA 1AQLA 4FHFA 2RC5A 1IULA 4WLFA 4MBGA 1EGQA 3AVQA 1GQFA 3HO1A 2HQOA 3U26A 2XB8A 4PTLA 1XVVA 3EBPA 1JUDA 3SZMA 1L7BA 4NTZA 2IWHA 3OSZA 4EJ2A 2P5YA 5I3CA 3MCUA 5ARCA 3QYPA 3FUCA 1CHNA 3ONNA 4EVQA 5JROA 1P4RA 1ZQ9A 5K8TA 1M8KA 1AKYA 5I6DA 5SZKB 3KELA 2P40A 4K5QA 3UJ3X 1XPOA 3V34A 2CXNA 4ZC1A 2ZUBA 1G6KA 5EKQD 1AS0A 3L7NA 5AVXA 2VQ2A 3A3NA 2KB0A 3QLJA 3ILXA 1J21A 1Y5RA 4DFDA 5K0BA 4XIIA 4GZLA 3WGMA 4DJDC 2BFDA 3PEUA 1FLNA 4BMYA 5DCLA 1IWOA 3TNDA 3TTVA 5HX7A 3E2PA 2GJKA 2PV0A 3EHEA 4WPGA 1YB2A 1IYGA 1W5TA 1R4NB 2Y67A 3AL2A 2LPMA 3CSFA 1RLTA 4CIWA 2Z43A 1KNXA 2JLXA 3Q5DA 2V6MA 5L7YA 2KYRA 1XZDA 1D0SA 4YUXA 1Z5ZA 3ZWWA 3H4MA 2AI2A 2IYEA 2XENA 1QP4A 1U6IA 1EUDA 2ZT7A 5JBNA 3U31A 4DC9A 1PV1A 1OFHA 3BCSA 3DZCA 1HOXA 3PUVA 4MS3B 3SGHA 1JEEA 3LF1A 1XL1A 4GF5A 2FPIB 2OL4A 3PEYA 5L8VA 1BLXB 3W90A 4DM3A 1MYOA 5AO9A 2P9ZA 1Y3BE 1PWZA 2G40A 2WLTA 1CY1A 1PIWA 4EK9A 4XE5A 4LYGA 4ZARA 1NSFA 5D87A 5A3QA 2VVTA 2QGFA 3D9MA 4LVCA 2FRDA 1XWIA 2ZR8A 3T5PA 3CLHA 2PN1A 1WR8A 2JIMA 2V6IA 4H1HA 3BWDD 4FBGA 2VPIA 3EXHC 2RHHA 4B0OA 4YUAA 1HO3A 4J9UE 2Z1DA 4F86A 5DGTA 3PKIA 3Q8WA 1UN8A 3RBVA 1V1RA 5DWQA 4JXXA 1TYQG 4YCLA 1IHXA 1G7RA 1ZH0A 3WK8A 2PH3A 4HLNA 3EFOB 3QW2A 1U7TA 1QDEA 1F14A 4HN9A 4TUMA 5K0CA 3WYBA 1DIBA 1QVZA 4XLLA 3GW8A 2PU5A 2EQ5A 2IHVA 3E5HA 3QPCA 1ZMTA 1KMHB 1QPGA 1DAKA 2HHCA 2G1KA 3ROFA 2UVQA 4CEMA 3OQ1A 1Z7GA 1TM5E 2IZZA 4K9PA 4AS1A 4M8NE 3HS3A 4GOOD 2CLLB 1N4PA 4FFPA 2ZBVA 2O59A 4I4CA 9LDTA 3NZUA 4HNSA 3E27A 4BDSA 3K0FB 1V11B 1Q0UA 3OPYI 2JGLA 5LP1A 4L4SA 3I45A 3RG2A 1N7IA 4AZ0B 5ANLA 1THMA 3V1MA 5LZ2A 3TUZC 2NV2B 3AR5A 3L82B 3DEZA 5ERXA 4D10C 2FR8A 2I78A 1Z6ZA 1XQ1A 1GQQA 1KGDA 3WFIA 5B5SA 4O1PA 2ZANA 2PPLA 1C1XB 3WWOA 2OCKA 4TTJA 3VTYA 4FEGA 2CBGA 1IBLB 2P30A 5LD2B 3D8NA 4IHJF 2EBHX 2NU6B 2JEKA 1ID1A 1O6FA 3ZHCA 5TQ0A 2E48A 4R40A 4M46A 3QEMA 3LDZA 5JSYA 2XPCA 2XZDA 4QYWA 5T6MA 2D2XA 5K3AA 2NTEA 3IEUA 4E33A 3L4BA 4FFBA 2WNIA 1OJ7A 3LXMA 2ZUVA 1QYIA 3T8YA 2C8LA 3UK0A 1KP2A 4FOPA 1Z73A 5EE1A 3N2NA 1T6XA 2ID4A 4M9RA 3DONA 1SVXA 1XUOA 3NHJA 2GUGA 4ZHSA 2IPNA 4XW2A 5AOVA 3WA7A 5BW8C 3O5AA 4G0MA 4OJTA 5C31A 4CHGA 3FMOB 2VP3A 5H68A 5CT5A 2E9SA 3WQRA 1OBFO 3BHIA 3ZPJA 1JCRA 5JZBA 2VAPA 1DQYA 4GZ6A 4OV6B 1S64A 3ITNA 3UH0A 1QUEA 2ZE7A 2OZEA 3C1OA 3WV4A 5ENOD 1O57A 4NULA 2Y4UA 2HF2A 1U5CA 1N2OA 3E23A 2PXXA 1E89A 3SFXA 2ZE6A 3TLZA 4L16A 3UKRG 4QFMA 5AI8A 4EZLA 4RPKA 4B89A 3HXQA 2YNQA 5K1ZA 2B0CA 4FGJA 5F5XA 3L0SA 2HPVA 1ISGA 4GICA 4UQZA 3FYTA 3ZVKA 1PG0A 3RTDA 2OGUA 4CKBA 4KC0A 4CMIB 3BQOA 4TSFA 4ARVA 2O2JA 3T9AA 5IAOA 4D97A 1KJQA 4MVYA 4ATGA 4FSXA 3EPLA 3GZSA 3AYXB 4P08A 4WZAE 2WNSA 1LRLA 3KJXA 4CIXA 4JVOA 1E8YA 4IPTA 3CQGB 4G5YA 3SZLA 2VO1A 4HHEA 3G5AA 4TZ0A 3L16A 4A91A 1TU4A 5E3HA 8MHTA 2FRXA 5BSEA 1DS6A 1N5IA 4H7XA 2P1RA 1GOTA 1IJFA 4I4LA 3FMIA 5AXDA 4FOOA 3EGCA 1JHZA 3D4BA 2REQA 1R3UA 2BTEA 1G20B 2QD5A 1KKMA 3VKHA 3Q9NA 2FN7A 2KBFA 1KYQA 1JXMA 2EJWA 3AINA 5LLDA 3S81A 3IEVA 1W1WA 3VVCA 1R27A 4YHHB 2ZIGA 2BUCA 4WWHA 3NAZA 3VNVA 1ZCBA 1XXLA 5JAPA 3IQHX 3C98A 2BHSA 4P32A 5B3JC 1VJ0A 3TZEA 1ND6A 5G0SA 5BT1A 5F2NA 2VSOE 4D1YA 4FHJA 3GD7A 3H1BA 3SSAA 2ZITA 4LYJA 4AG3A 1GZUA 4QREA 4B9EA 4CFZA 1XN1A 4LXQA 5AUOB 3RO3A 4ZYZA 3RAEC 2O5VA 4GAEA 3WFJA 3X1XA 4OB8A 3DOUA 1WNFA 2BFEB 1JUQA 5DRYA 1H2WA 3E7FA 2BKKB 3MV2B 4JYCA 1IXYA 3R3VA 2P9TA 1XD8A 3GGOA 2F8LA 1TI7A 3EUVA 1J49A 2BLNA 3T61A 1SUIA 2A86A 4NONA 2XNJA 1TUBB 4K8OA 4S1OA 4G0ZA 1DG1G 4BGVA 2XOEA 2NVBA 3T95A 3REQA 1GY8A 1LD7A 1RAAA 1T1EA 5JEDA 3BXPA 1EMDA 4YCNA 3R9KA 1TEZA 1O4WA 2Y68A 4HORA 1NW5A 2AW6A 4UAUA 5TRTA 3RLIA 3V31A 2ZJ8A 1XTZA 2V1UA 3DAYA 4P53A 3P0RA 1I2CA 4LI0A 4ZJYA 1U7DA 9MHTA 5AM1A 2YHIB 4EFNA 2IV3A 4LC1A 1SBQA 4X5OA 3K9CA 1N3YA 3EXFA 3T7SA 1EDZA 4ND8B 1SU6A 5HEKA 4HFMA 3WRXC 4LEUA 3M6XA 3SS8A 4Q15A 1RYFA 1Y34E 4YROA 4NYJR 1XMQB 4GI1A 1KZ7B 1D6SA 1EWQA 4AKHA 4BRWA 2Z2YA 1DFGA 1EUZA 2QW8A 1JP7A 2BKEA 3L7YA 1DEAA 2GUWA 4JHJA 1QCYA 5B57C 4R2XA 5MFPA 5AKJA 1YWGO 1YQ9A 4YY3B 1FRQA 4ZOBA 5E4FA 4M53A 1M1UA 2PA3A 2FMHA 2GYWA 4HWTA 5E4TA 4M1KA 3D7LA 2YV5A 2DIWA 1HH8A 1DRKA 2QMOA 5C7YA 3K15A 4WW0A 7REQB 4R2KA 1HQCA 4MARA 4QDKA 2MSEB 3EDYA 4G1BA 3SEFA 4M87A 4ZMBA 1EBFA 3PZ2A 4ACKA 3NM5A 3HA2A 3N2IA 4OXRA 3WQSB 3DDSA 1CUEA 4BRUA 4F8YA 2V7QA 5I7WA 3HPRA 4DLKA 3I61A 4J0GA 3FPFA 2HQSA 2B4TO 1XZIA 4WZ6A 2XCLA 1T0PA 3BRWA 2HTFA 1TGYA 4D79A 2B8EA 2JLAA 4WAUA 2QG4A 4IEFB 1RYNA 3REFA 3EU5A 2P41A 4N47A 3M5CA 2WWGA 4MI3A 5EUMA 1BMTA 5GVRA 1DKQA 4IIGA 1NVTA 4O8CA 1RC1A 4I1RA 5E6UB 2X2FA 3FBTA 1UWKA 4HZGA 2IY7A 3F5DA 3RU7A 5LYJB 1E2IA 4DV7B 3C3RA 2ODWA 2EQAA 1KPGA 2WLSA 4LDNA 1SRRA 2Z2ZA 1CY7A 4C9BA 5JDIC 2H1SA 2WDZA 3JWPA 2FZLA 3ZV3A 3AR6A 3ASHA 1IUPA 4R2WA 4NBVA 5ITZB 4OREX 5IAKA 3F9CA 4G0NA 3E8XA 4UHFA 4YJ3B 5EPEA 4PYRA 1L8AA 3TL5A 1D2HA 2VSNA 4CRWB 3NMUF 4ID9A 3WJ2A 2ZJ1A 5I5EA 4BS9A 1K2VN 4HOUA 3MS2A 2RMKA 2FMIA 4TGLA 4HTFB 4PGHA 3L1IA 2OAP1 3PPYA 1HX7A 4QGSA 5I7HA 3DC7A 3MV3B 3GA7A 3FDFA 2JAUA 1OOEA 2PL5A 3SPXA 1LSOA 3GD5A 4DLPA 4U2FA 2OBYA 3GPDG 4UWLA 5CA1A 1GCOA 3VR4H 2CLKB 2AHRA 3GGGA 3ZDBA 1SOAA 1DMSA 2UVDA 4N6OA 2NTNA 4GYYA 2NNWB 5JAOA 2QVBA 1D5CA 1C9JA 5A62A 1PT5A 5JJ5A 1RZVA 5C5EA 4PS1A 5ECGC 1P74A 4EHBA 3VLFA 3LXXA 2CKDA 5LP6F 3MNFA 4MNTA 1IEVA 4C7VA 2GN2A 4JI5B 4G26A 3OCWA 4MDFA 3MGKA 1BDIA 3QA3E 1ZGHA 1ZOLA 3FRIA 4U7EB 3WIBA 4CM8B 4MJXA 1XTTA 4HDNB 4JEIA 3RSFA 1RNLA 3IPLA 3LY9A 3AJEA 4JLOA 4PSCA 1SHUX 3U6BA 4MP3A 4UMVA 3PI6A 2D5LA 4LPKA 1CY2A 1N4RA 4J7XA 4E31A 5HQ3B 3C4JA 4MLCA 5KVAA 1OXSC 1FNMA 4NCBA 4AWXA 3VM6A 4EO7A 5C1BA 2VA8A 1UT5A 2IHJA 3WYCA 1JEYA 5EZYB 1D1QA 3DA8A 1XJ0A 2D2EA 4AL4A 2XUPA 1NJ8A 1WHTB 4BOYA 3K0SA 4GR5A 2D2FA 2JGKA 4IDNA 5LQSA 4A16A 1TJPB 4F9TA 2HT6A 1J0BA 1EFPA 3VTXA 1JR4A 3UUFA 4HUJA 3HB4X 2YN2A 1LQTA 1QIMA 4HJXA 2HV8A 1WVIA 2B8TA 4WBXC 4IUYA 3OM9A 1GDDA 3I2JA 1JEQB 3C3XA 3WMRA 1G5PA 4R98A 3R41A 2X23A 4NG5A 3OZTA 1QFXA 2NG1A 2PWYA 2DFTA 1PYGA 3FVWA 5EKSA 1PZHA 1S2IA 1UOQA 2ID9A 2Z3ZA 1JFRA 3LQFA 2Z98A 2CHQA 3BH7A 3NUZA 3IV0A 5FPHA 3DL7A 5CJ2A 4ENQA 4FNMA 5HBGA 3KQUA 1K0UA 4X1IA 2RHOA 4BP8A 2WJHA 5C1PA 4INOA 6ADHA 3IESA 1B8VA 2Q1WA 5J5AA 2BKGA 3D2CA 1R8XA 1CULC 3ZGYA 3HY3A 2QRUA 3BHJA 5K2MA 3UA4A 2GYUA 4L9PA 3RF6A 4ZEMA 3C6BA 4H27A 3X1MA 4XIFA 2VYQA 3PENA 2O8EB 1L7AA 2FPSA 4B0PA 2LNIA 2YVUA 4GLOA 1X15A 1IRXA 2KSQA 2ZRFA 3E9NA 5FUQA 4REQB 3UWOA 1JWFA 3O73A 2F9FA 1QFYA 1Q11A 5CFLA 4DABA 3EU9A 3KJHA 3L0YA 2GZ1A 3AU8A 5LUBA 3OCCA 5TQ2B 3SJZA 4B7AA 3GI1A 5AJHA 4JA2A 4Q3LA 2EYQA 4JBXA 3PUKA 4BFWA 1WCIB 1I2MA 2CNDA 1QRRA 4BNJA 2JEZA 5FORA 4YMHA 1E9EA 5U4XA 2C2MA 1IHPA 2XHEA 5IBCA 3MBKA 4FT2A 3TRIA 3NP9A 1DDOA 3K6RA 1L4YA 2JJYA 5JNWA 3KQMA 3NH6A 1BJKA 1KR2A 4B73A 2F3TA 2PMFA 1BFDA 1GO2A 1OFUX 1IK4A 2H1HA 1SZ9A 2YQ8A 3TKAA 4KO8A 1ZC3A 1E8MA 2IHBA 3O3CA 1ODSA 3CLSD 3C3AA 2C5HA 3M5DA 2Q45A 2ETCA 2Z8XA 1PV4A 4B44A 4NZ9A 4ZVSA 2XXBA 3L43A 2FPPA 4BZWA 2Z9DA 5H70A 4M6WB 1BH2A 4DC0A 3UANA 1TN8A 3BB1A 2WILA 3HR8A 5FPKA 3TZHA 2IU3A 3EVTA 4LWZA 2P6UA 1JLMA 4RZIA 4DQXA 2HHLA 3PDIA 3ZUGA 3H9UA 5IRCD 5JBQA 2M9MA 1BE6A 4LC0A 5JOQA 4G23A 4JL5A 1UPAA 3K5WA 1BPOA 2E5WA 2O8VA 4RNDB 2PGOA 4MJLA 3M7IA 3NHAA 4Y1RA 4D56A 1PJSA 1TW2A 1U2DC 1KA9H 2J46A 2DT5A 5LBUA 3VTAA 1KFBB 3I8SA 3U09A 3E9CA 5ALJA 3LH5A 4INJA 5KNBA 5ALEA 2W93A 4OHXA 1FS5A 3QH4A 4QARA 1TTHA 1N0QA 5FUYA 1IZ8A 3QWIA 2FDRA 4LSZE 3F2IA 2KXPC 2QIOA 4ENVA 3U0BA 3UUWA 2VH2A 3ZWDA 2QVLA 1ZITA 4EX7A 3NO4A 3E5NA 3BUAA 3KDSE 3THYA 4XTRA 4O6FA 4BV9A 2IOSA 1AO0A 1I33A 1L7RA 1KJ9A 3AEXA 4B3DA 4E1VA 5HS6A 3ESYA 2GCGA 5AICA 1JIJA 3S4YA 3NNDA 5JJLA 5CEFA 2E4YA 3KEMA 2IF4A 3AEYA 5HQJA 4NFSA 4LZLA 2JFXA 2CMKA 2E49A 2FPOA 4BQOA 3SQNA 4MDEA 3TNLA 1T2FA 3QENA 5HRAA 1XZPA 3B9BA 5B7NA 4OA8A 2DECA 2ZRDA 2QD1A 2ZB3A 2K7ZA 1HBJA 2ZAMA 3NDPA 2IUTA 3Q7RA 4HLUA 5A4MS 4OIFA 4CN8A 5GONF 1JQ3A 1N52A 5HI7A 1Z6GA 1YK1A 4WV3A 2XW6A 2PR7A 2W2PA 1D1SA 5KYYA 2H8GA 4E2YA 4C6TB 2FNAA 3JASB 4EEXA 1AX9A 1VDYA 3AUUA 4OBEA 3DBVO 4B3FX 4ERNA 3I6QA 1U2ZA 3D3WB 4PHCA 1T5BA 1X38A 1EK5A 1RZ3A 1Q6YA 3TX2A 1TAGA 5JXGA 3KJIA 3AHGA 1GPWB 3RC3A 4A0RA 4NK5A 1HGXA 3G0OA 3HYMB 1WW8A 3PNSA 2AQIA 5BURA 3T99A 4BKQA 3KB6A 5ENNA 1ZCAA 1X1DA 3LIPA 1ZU2A 4G81A 2AC4A 4FLFA 3QTTA 3HXTA 1KFKB 3MWFA 2QLJA 1XZEA 1E2KA 3WVNA 3RU9A 4BO2A 1AY0A 3ZYQA 2VHXA 1TJCA 4CV3A 1E6MA 2VS1A 1LJUA 1NMXA 4WFQA 3KTAB 4HEJA 3RJ5A 4WJZA 4R4JA 1GSOA 4MPDA 3MT0A 2Z56A 4DV1B 1OF1A 3W9UA 2BFCB 5EOVA 1VL1A 2QZPA 2Q6KA 1Z2PX 3DWEX 5F12A 3NDBB 2XNDD 5FOXA 3G9XA 1RXIA 4FWBA 1IZ9A 3KKEA 1I6LA 3GJ4A 3AC0A 3EY4A 2KM4A 4BVKA 1OX4A 1A69A 4OK6A 4OHKA 4HDSA 4MROA 1SMKA 5A5VA 4DV3B 4L5YA 3GUUA 5EMJA 1K92A 3NQPA 4DCMA 4Y2JA 4J8EA 4WVLA 5EJ6A 4ZTBA 4JA7A 4E7OA 2I34A 1L9XA 4UBJA 1FS4A 3U3KA 4PS0A 4BFZA 2WM2A 3LIIA 4AM9A 3DKKA 4PO1A 2AS0A 3HK2A 4GLBA 1T4MA 4BNVA 1B15A 3EMBA 4MS1A 4I4TB 5KBAA 1Z5GA 5DJ5A 3C3DA 4PG8A 1RZRD 4NE2A 1OV4A 3PL5A 4JVMA 4GA1A 3DGEC 5G55A 4CLOB 2Q2NA 4DIUA 1LF5A 3AWIA 4I1AA 1UP6A 1G4UR 1EUCB 4LJ9A 1J09A 3FJOA 1M76A 5D3MB 3WL7A 4I50B 1NL4A 2E5FA 2V54A 4YO8A 1WULS 4C7XA 2PLFA 5E76A 1B1AA 1PVVA 4YRTA 4IDEA 3VAZA 1GZVA 3FTFA 3GFVA 1NDHA 4XM2A 1U7XA 1Q1ZA 3HRHA 3IP9A 3EA0A 3H87A 1JFLA 1M1YE 1WV0A 2NP7A 2W48A 3JVVA 4OJQA 1W36B 3GFSA 4JVSB 3H13A 4CNBA 1E3LA 2A94A 1KI1A 4XD2A 1KYVA 2PZAA 1MX2A 2Q3HA 2WJYA 3AG3E 4H15A 3K0KA 1TJFA 3KV3O 3U81A 2OCDA 1H3EA 1ZJJA 1SIWA 3SZUA 3GRFA 2W6PA 3FM9A 4OHCA 4YC7A 1M6EX 2Y0PA 4GTTA 3PYXA 4BKOA 4G67A 1D8TA 1ISSA 2R4UA 5IT9A 4O29A 3AH8A 1Z47A 1YMQA 4CMHA 2F90A 5JG7A 3L1HA 2DPLA 4LMPA 4QAJA 1NXTA 2JAPA 3I2KA 1GCAA 4UQXA 1CR0A 5DN9A 4F53A 1P29A 1T1SA 4JK3A 2DHRA 1M1XB 3RRFA 3TWUA 3CLVA 4BMXA 1QKKA 2R0QC 2BHTA 4FC8A 3UHPA 3FULA 2DQZA 2NSJA 5JVDF 3GZTB 2ACWA 3AY0A 3M9LA 4BU1A 2F8XK 2FCAA 1SHZA 1QVWA 4KMMA 3F1KA 1FYEA 4I5IA 1Z4MA 2Z09A 1DTSA 3YASA 3BK1A 1NYLA 2DR2A 5JAIA 4FIZA 1TLFA 2H1LA 3DEAA 1ZGGA 3LJKA 5DT2A 3WLHA 3OU7A 4IW3B 4ZZ3A 2IPMA 2OQRA 1QDLB 3IMGA 4BE7B 5CA0F 5AVRA 3NEAA 1GPUA 3C41J 2Z83A 3MRSA 1UK8A 1H2AS 2CLHB 1X7WB 3WFZA 4TYPA 4B84A 1RHUA 1W93A 3QU5A 4KQGA 1OWMA 2XT6A 2XZLA 3VR6H 2H5IA 3GF4A 4BNWA 1U7ZA 5I45A 3AZOA 1L7MA 2C42A 3K70D 3CKKA 1Z5WA 1JNYA 3E22B 2V3WA 3N71A 4YDOA 1AS2A 1CXZA 1V48A 4URWR 1AB5A 4ABTA 4XEIG 4U7GA 3VJLA 4HBGA 3OY2A 3BFXA 5IXJA 2EBFX 3MG9A 1AUVA 5DOVA 3OFJA 1P9OA 4NYMR 5FI3A 1L7DA 5JA4D 5ULLA 2FO7A 4BTAA 1A04A 5EZ6B 1JW9B 4P35A 3SHFA 3ZC3A 1X7DA 1EE1A 2OAEA 4EJ0A 5EX3A 4N12A 4E46A 2HWWA 3T3OA 4FGKA 3C24A 5BWBA 3Q40A 2W9XA 2LCFA 4DXDA 4EELA 5D8DA 3WSTA 1FXWF 5BY2A 3LRPA 2ZI3A 1OI7A 1TKRA 3CZ4A 2J0UB 3BGSA 3FTEA 1QWOA 1K1AA 2IV7A 5CX1B 3D9NA 1KPIA 3ZXPA 3IP5A 1GQYA 1IJEA 1US8A 3NWOA 4O1HA 4WL0A 2DFLA 3RIXA 2XVYA 4IDFA 3ECAA 4L9WA 2BJWA 3C5VA 3LI2A 1WCWA 3HDXA 4KHPB 1QGZA 5GZ3A 1IM2A 4S0XA 2QN2A 3LOUA 1MV8A 1SU7A 1PJQA 4J0FA 4GI5A 2IEYA 3TOVA 1ZM7A 3LOPA 3QVLA 2I4LA 1LLUA 5AUPB 3LECA 1L4NA 1T9ZA 3WGKA 3ZH9B 5WRFA 5DZSA 3GT0A 2PG3A 2CLEB 1DSSG 5H4HA 4ALKA 4NMXB 2VSQA 1FP7A 2JGDB 3BXXA 1XC7A 4MGYR 4WXPA 3NIWA 4TSKA 2J3MA 2HO4A 3ND8A 2WPNA 2EGGA 2XB2A 4ND7A 4II2A 4CG2A 1U2EA 2GVZC 3HKDA 2PEYA 3ETGA 3ASVA 5ADUS 1XHEA 4LG1A 4NARA 4G4GA 2P69A 2J9FB 1B8PA 1XEWX 3JQGB 5IARA 4TTRA 1UXKA 5LMUB 3IUSA 4F4FA 2X14A 2GN4A 3WO0A 1WDWB 5EJMA 5B3KA 3QVUA 2BAGA 4HYQA 1AXGA 1GAQA 1RQNA 3VU3A 3GJ3A 2XTMA 1R4MA 1BHQ1 5JYCA 2QJTA 4K81B 4C7KA 4DV0B 1C14A 3ANNA 2DULA 4C0AC 4RMNA 5CT6A 2X0FA 1P4HA 1B00A 5EJ7A 4BPRA 3H0EA 4IRMA 5JPIA 1TMKA 4NPCA 1GAXA 3WJ7A 1G55A 1ENZA 1O94C 1G5TA 2QRQA 3IPCA 1JQKA 3UKUG 5EFOA 4DEYA 2MHCA 3GGDA 3KAPA 4RSGA 1E4EB 2CXRA 1UEJA 1TLLA 2PTHA 5I47A 1HMYA 1XD2B 4Z8XA 4EKYA 2HLPA 2AMYA 3K1AB 1N34B 4AKEA 2IF0A 621PA 2QZSA 3X44A 1GZ3A 3B89A 2A4ZA 1VLLA 2IIQA 1UM8A 1U9CA 4R9NA 4UI9J 4KQJA 1KI9A 3L7DA 4DHEA 3FUWA 2BKXA 4X8HA 1QORA 3ZHEA 1VMDA 5CLJA 2ZVPX 3ZLBA 5BWCA 2V7UA 1Z6YA 5AARA 1AQ6A 5KDDA 2PSJA 5KYWB 3GL9A 4WGFA 5FWYA 2X19A 1X87A 3ST7A 4JT9A 4F9FA 4ZP1A 5EKTA 4HT3B 2FHPA 4FDMA 5CLHA 4Q3EA 3AETB 3LKDA 3MUNA 3FYUC 3E15A 1DTWA 3RBZA 3GLVA 1DAMA 4M49A 4ZO7A 3IUYA 1KZ6A 2G82A 5C4MA 1RQGA 2JIBA 4FGSA 4LSGA 2QLLA 4RVDA 1CDDA 2COEA 1DJLA 1KRHA 3DV2A 1ZK1A 4DMLA 1AQJA 3KQQA 1QOPB 3IALA 3L8ZA 3L7AA 4UBKA 4BYMA 1Z33A 5J2UF 2XCCA 3VA7A 3VVLA 1E9BA 4FZ5A 3WKBA 3T3IA 5CW1A 1WY7A 4UMEA 2NO0A 3IAS6 1J97A 3UK6A 1NXXA 1I0IA 5AM4A 2VP0A 3LO8A 2OK7A 4R05A 1N1DA 2LW7A 3DL0A 3G2QA 4YLGA 1I0ZA 2B2CA 2X7JA 3PB3A 3W1EA 5LWQA 3B1YA 2XXJA 5I7SA 4YJ2A 3S5UA 4IGEA 4EUFA 4YJKA 1TEXA 4HGRA 3V7UA 3ADPA 5HKKD 1QO7A 4KE6A 4WBNA 3E30A 3B6ZA 2FP3A 4TUYA 4I1OA 4P84A 4Q7EA 2O8BA 3NYRA 1B0UA 3R9XA 1ZZGA 3QLTA 1TVKA 4KQ9A 4GA0A 4LJSA 2DZNA 3OQ6A 2NUPA 5AD1A 3SYMA 1SUAA 2RGCA 3CLRD 3RO7A 2GSWA 2RAFA 1RQRA 3PNVA 5IK2A 1PS8A 3LGXA 4BNUA 2QP4A 4LJYA 3G7SA 3W4JA 3QM1A 1P77A 2DLCX 3CHRA 1E8ZA 3L02A 3AL0C 4XFDA 4BHTA 3AF4A 1DCKA 2ZRNA 4B6RA 1GQRA 3EULA 4LYDA 1N9GB 3MUEA 2CF5A 4JLDA 2RGYA 5EAIA 1DXYA 2GPJA 1EXDA 5KTNA 2F8SA 3FW1A 1FUYB 3KPWA 1GLNA 3OZFA 3LHIA 3GHYA 4U2KA 4J8YA 2QYOA 4EJSC 5TNXA 4KQEA 2GS9A 4Y9DA 4A8TA 3G3EA 3A27A 4C0JA 3O8DA 1JKMA 1C1DA 3FGPA 1HDEA 1WXFA 4XB2A 3FYCA 3NVAA 2OZLA 2JW5A 3NU1A 4RJTA 1XMXA 3HZOA 2WI8A 3TCXB 4KNWA 1BKDR 4YT2A 3S70A 2K4MA 1TZBA 4DT1B 1ZNZA 5ERGB 2GN1A 1ZBPA 5B6JA 4Z1MA 3ZHTA 2B0OE 4RK7A 4N41A 4ISCA 5JFTA 1CUWA 4UTRA 4ZYTA 1LRJA 1O9GA 4GI7A 2Z30A 3A1VA 5LU9A 4YV1A 5BVGA 2QU7A 3OZBA 2Z6UA 3ACCA 1VE6A 3MTBA 2JBWA 3I8XA 3L0DA 4XIJA 1DRJA 3GP8A 2Z4RA 4OYYA 1L8OA 1IOZA 2KHZA 3IOCA 2PJDA 2ZGVA 3GH1A 4X1YA 3WJAA 1MJ5A 3B7SA 5FZQA 1TNDA 1JE0A 2R8ZA 1MO2A 4I9NA 2AZXA 3BULA 5FLYA 1RLIA 1J8FA 4B6EA 2R6DA 3EZ2A 4NESA 3BZWA 3J7TA 2QENA 3SR4A 1QUFA 1U7UA 4F85A 3OFSA 3WNCA 3L22A 2FWAA 5AK4A 2HF8A 1QGOA 5GADl 4M0CA 3W2EA 4DGQA 2WQZA 1QV9A 3RS7A 4R8MA 3QU4A 3ABSB 1MVLA 3TM5A 2HW8A 3B1XA 2AE1A 2NUBA 2FEZA 3ZHQA 4CKWB 5E6SB 3R9AB 3CEAA 2F3UA 1FNBA 2NU8B 2V8OA 1U0BB 3VLDA 2BCJQ 4P4UA 1JRLA 1RAFA 4IJ6A 4IN3B 3P0FA 2Z8ZA 4IM7A 2OKCA 2J67A 1LD8A 2PGIA 3NBMA 1GTSA 3RJMA 1N6PA 4C1BA 3OXLA 1SH7A 5HTOA 4JQOA 2IVFA 3EVDA 3X1WA 5E2BA 4Q7QA 1G42A 2V4LA 1UKYA 5CVTA 3HH8A 3BE8A 1TT7A 2J32A 3PGKA 3N39C 2VJDA 1RWBA 1VCNA 2AXZA 1BVYF 2VJYA 4A23A 3NNSA 1OC2A 3WKEA 4ZYXA 2OOEA 3U3MA 1UXIA 2PVPA 4PZPA 4MVJA 2P9KG 4CN9A 2ESRA 2MRIA 5EMHA 1QJ4A 3L0OA 2RGDA 2WJWA 4QFBA 1NE2A 5A4FS 5L3QB 4BKPA 2VHEA 2KC7A 2C31A 1V3UA 2CD9A 4R84A 1QU2A 1S0PA 1EA5A 3ONEA 1U8UA 4JB2A 1P91A 1E9FA 1WBJB 3K4PA 3C7TA 3K9QO 4Q02A 1C4OA 3ND7A 1RKVA 5FX2A 4LTMA 1JIIA 3GBPA 3VOTA 3DOEA 4ZFNA 4WN3A 1B93A 4IJKA 3D0RA 4MV3A 4OQDA 2DJIA 3PXCX 1QH0A 5CYGA 2YOFA 4CMEA 4RTLA 2CHWA 2WZQA 4L5CA 4QXMA 1WD7A 1SKAA 1NT2A 2PZ8A 4LX0A 1CEXA 2JFPA 1YRLA 4TL7A 3I3NA 5C46F 4ZVTA 2J59A 4I3FA 4M8LA 1DJOA 3E0XA 3TMKA 4GI2A 5IVKA 1F2VA 1YZLA 2RGNC 3HBMA 3LUDA 2ZIEA 5I9TA 2C59A 2F4NA 1I13A 4URUR 2MJLA 4N8EA 3EARA 4LDZA 4G1MB 1HK7A 1DADA 3CRMA 4DLQA 3IH5A 2WWFA 4CQNA 4BERA 1AE1A 3U9SA 2I1KA 1OX6A 5EE9A 4K0RA 1UMDB 2ZWVA 4MVJP 4MQEB 4ESOA 4FI3C 4RDIA 2M63A 1I4EB 1T9GR 2FKAA 3KAKA 5AVKA 3F96A 3INRA 1Z2NX 4YDSA 3V1KA 1UADA 1W2WB 2F67A 3PR2B 4ETMA 1E96A 2ZI4A 3ZWKA 2ERCA 4CCYA 9GPBA 3EXG2 2FSSA 3ABIA 5SZJA 5JO0A 4O4HF 3RROA 5CRVA 1ZCZA 4KUEA 3UMMA 4M7CA 1C7EA 1ZMOA 4E4YA 4C6HA 3BJMA 2B92A 4MUMA 5A4JA 1ZD9A 3UV7A 4FQ7A 1QMPA 3A9CA 3E70C 4BZPA 2DWCA 2J6BA 1QOZA 1SKBA 2QTLA 1L5HB 4CLRA 1UBNA 2C58A 3NDJA 1GLVA 2EG5A 5F73A 2GZ2A 3BXGA 3A3OA 5TPWB 3BMQA 1GT6A 2QUKA 3CZCA 4MVCA 4GOLD 5BVHB 3BQMB 5EMMA 3HXEA 4WOKA 2QNRA 4Y2SA 3MUOA 1O6CA 4FYYA 3NDRA 5FWAA 1JAXA 4ZVLA 3SXJA 1H1LA 3DMGA 5A23A 3AVYA 3KDPA 3LUKA 3OCYA 1MTOA 3TE7A 4MGIR 5FIOA 5KCMA 2FW0A 3VOBA 3CO0S 4RCYA 4D4GA 1D2EA 2ZYVX 2OV6A 4UOQA 1HE2A 1AHIA 4Q9AA 3ZXXA 4BAZA 4P3OA 1MU0A 2IYOA 3TZLA 2JCBA 1PR4A 2UY1A 1Q57A 4ZGBA 4Q7KA 2ERYA 5AVJA 4KT6B 3TB6A 2YS7A 4AW9A 5E8RA 1CS0B 5JHHB 1TIKA 5EJEA 3EEIA 3WDKA 3TAXA 4U3JA 3C72A 4ND3A 2CYCA 3TBHA 3PCXA 5F4ZA 1GGFA 1UQRA 1P5HA 3TN7A 4LTDA 3EEOA 1QP0A 1T3HA 4DVGA 4NIKA 4GAAA 2O06A 1ATZA 4R1MA 1FEZA 3EFEA 4GTSA 5FUBA 4YV2A 2QAGA 3WKAA 1YCDA 1E1QD 4X95A 2GT1A 4A63B 3ICEA 1I7LA 1E7RA 5FWNA 5A06A 4HB5A 1AKQA 3F8TA 2QRMA 3HUTA 2AOTA 4G1UC 4KGVA 3EXG1 2XQFA 2XBUA 4YV0A 2XE6A 1MFZA 1U3DA 5REQB 3AEQA 1FDUA 3OXGA 1FYDA 4KKXB 3EDCA 3P45A 3I5UA 5H59A 3M34A 2P0YA 4P2BA 1WOYA 4GPMA 2B83A 4R1QA 3PREA 5J63A 3AU9A 4NIMA 2NXWA 3QYJA 5JDCC 3EA4A 1NWHA 3KOYA 4L27A 2HA0A 4OYLA 5K5EA 3S40A 4G09A 3WGQA 2ZSKA 4KR3A 3DLAA 2F00A 1W0KA 5ENPD 5FUVA 3TDKA 3HBLA 3QHPA 2HWKA 5K0ZA 3FB1A 3A6EA 1VBKA 3RVMA 1DTEA 2EG9A 2QE6A 4M7PA 1GL9B 2VYCA 1I3CA 5T4YA 1JMVA 2IYSA 1JU4A 3OFVA 3IVRA 1OAOC 1YI0A 4YIHA 4KVOA 3N8HA 1GG2A 4EPWA 4WNAA 3ANYB 4GXNA 1QK4A 1QS0B 2XGOA 1IUOA 4MI9A 3MBIA 3PCRB 2OWEA 2DR0A 3D5EA 3OCXA 1FNNA 1QVVA 1G8GA 1LBTA 3UK2A 2ACVA 2HRZA 2WXFA 3GN2A 2NZJA 2AJCA 1PL8A 1HG5A 5DBIA 1DRWA 2OFFA 1A9XB 5EXPA 4MRAA 1EK2A 2VZ8A 4KTVE 4YCSA 4P31A 4KXYA 1ZZEA 3LVRE 1Z36A 3A1NA 4ZMSA 1UKEA 3K09A 4JBWA 2R8YA 4X20A 2HA7A 1Y6ZA 1YUBA 1CVIA 2JBAA 2PD6A 1N94A 4CV1A 1BOOA 4GVXA 1RE1A 1U2GC 2JAWA 2GM3A 2ZU0C 1KK1A 4PXYA 3V4OA 3O95A 1Q6ZA 1GPKA 2A9VA 4EHNA 2G5CA 4R2HA 5HBRA 3QG5A 4GBGA 3VNSA 5EWLB 3RFTA 1I9GA 3B5IA 2ONZA 4AJ9A 1DV2A 2QXTA 3GPLA 3PHLA 2V6JA 3FTNA 4ZVPA 2FEKA 3BHNA 4C4PA 5HIMA 4NI5A 5K8UA 5JSKA 4KE9A 1F1JA 1RACA 2G7ZA 4KU4A 2C94A 4H59A 1EE2A 3A3KA 3HM9A 5ARFA 1BGVA 1TE2A 4MXDA 2IS2A 1OGYA 2OILA 1KEEA 4RF2A 5DT9A 5L6LB 1S02A 1V7CA 1L8QA 2Y05A 4QTTB 1JDZA 3QK7A 3WLNA 1UIRA 1N2CE 1P17A 3TR0A 4A03A 4YI3A 2AW3A 3PZ3A 1WHSA 2BEDA 2Y4OA 1TF5A 3F74A 3SF4A 2X9NA 1PEYA 1U7WA 3O47A 4CM3A 1HM5A 1UPTA 2AVPA 2DR3A 5HUHA 2X8JB 2XVMA 5KAPA 4ANXA 1A9YA 1V16B 1HG0A 1VE1A 4AO8A 3DLTA 1H1DA 2VP9A 3HL4A 4PX3A 4B2YA 1EK1A 1FFSA 4CLXA 1H4QA 3U4TA 4LXXA 2L2QA 5JS8A 1SQSA 3UQ3A 3LYUA 3R9MA 1DBRA 2QE7A 2XQKA 1Z22A 5ISMA 1BMFA 1X1CA 1JZTA 3AR9A 3H0CA 3S3TA 2QYTA 1C30B 3L07A 4JJZA 2GWRA 4XCVA 4MAAA 1M2EA 4BQFA 1M2OA 4CQLB 1GEGA 4HVAA 1E6WA 3AIMA 3EFHA 4EKIA 1TRKA 1KHHA 1PI3A 5BN3B 4ENSA 3RQIA 2AFVA 2DG2A 5IBPA 2BGTA 3BB3A 3D2LA 3GOHA 4ZCMA 3IDFA 1O5MA 2VP4A 4HWSA 4N7JA 1ICIA 2BGMA 1ZHOA 2BY4A 2ZKIA 1XU4A 3NWPA 4ZV4A 4CGWA 3AUXA 1OYWA 1JB1A 2RHDA 1ZAKA 5M2QA 5LJLA 1SAYA 3FZQA 2PDAA 4K6OA 1RYHA 3QE3A 2G1JA 2Y1DA 5L4SA 2LTAA 4NS4A 4YVFA 3MF4A 4EMBA 1SOWA 3CEQA 3RTCA 5LCWC 1E3MA 1IN1A 3PHHA 2W2QA 3IDSA 3FWHA 1UPFA 1X1TA 1YB6A 3E2MA 2Q4RA 4N5MA 3ZU7B 3LFUA 3QUSA 4KPEC 2H07A 3TIGA 3EGXB 2J8ZA 3LPNA 8ADHA 4RMHA 1P6QA 3TB4A 4RXUA 4EFLA 3DXXA 3I9NA 4KSYA 4BIMA 3H5OA 3FTPA 2CXHA 3CB4A 4BBZA 3HTXA 4LIPD 1PYDA 3WB0A 5ANRB 5FHRA 4WI1A 1YS7A 3NBAA 4G0UA 4R5HA 4MTCA 1XX6A 5EMNA 1PUXA 4XWKA 4GCOA 4MSUA 4NMHA 4KKVA 4NCIA 1WB5A 4P7BA 1YFLA 5GM2A 1HF3A 2OLJA 1W88A 2H7CA 3W5HA 3ED1A 4AO6A 2CF6A 1YA8A 3TOXA 2QNBA 3HSSA 3BD6A 3F6CA 1CUFA 2GHIA 2FR1A 1RLMA 4BEPA 4EQZA 3ECCA 4YT8A 5KC9A 2X2OA 2X42A 1SEVA 2Y1FA 3NS7A 4URXR 4IDPA 2NM0A 5IUKC 4ZI7F 3EIEA 1JLLA 4JJEA 3LBAA 3V8VA 1RPTA 1J56A 3SFTA 4OQ4A 2Y0EA 3VZPA 1K0FA 3W6NA 3W5DA 4M1EA 2DT8A 1QBQA 1WBBA 2PHZA 1THTA 4KRFA 1UC4B 2X6FA 4ZCSA 4KB5A 1Z82A 4PZZA 3K1JA 4A6EA 4BO8A 4HXFB 4A3VA 3VNAA 1TJNA 4MYTA 4Q7MB 4MO2A 2VIIA 4OMDA 1KERA 3JR3A 4KIFA 1R0ZA 3L5KA 4FU3A 1DBPA 2PL1A 1DAEA 1BHSA 2QHXA 4R68A 1Z2CA 1BXRA 2XCUA 2FULA 1P9WA 1R0WA 4OO3A 3LQ2A 4TN5A 1AT1A 5MGNA 1N57A 4AJHA 4Z3OA 5CD1A 3HWX1 2UYQA 5TR9A 4JUCA 4BLVA 2UZ3A 5KTTA 3VYVA 1Y8RA 2AFIA 4FW9A 1I10A 2I2OA 4C1NA 4IVNA 3SC4A 3CA8A 4W1QA 2PWPA 5KINB 1YYHA 5P8WA 3AR4A 3JR7A 1OFTA 1BX0A 3H1PA 3SI5A 5EE5B 1LEHA 2OOSA 4O1OA 4KN8A 1FUUA 3ROZA 4Y2VA 5F2OA 4F2PA 3VAYA 3NVMB 1JI3A 3SJUA 1KE2A 2L6BA 3UH1A 3E9ZA 3OIYA 2FMFA 4LF4B 4UATA 5EXEA 1J0XO 2V6FA 3S44A 2FZGA 4L22A 4D02A 4RHFA 3QF4B 3WNDA 1FTNA 4RGQA 2D6FA 4UJ3A 4X8LA 5DCUA 1R9JA 3AXSA 1G21B 4NOLA 2ZWPA 3VYTB 1GZ5A 4AJEA 1QE3A 1QX3A 3UQZA 2W6OA 2UV8A 4WDQA 5AOCA 3PJGA 2D2IA 1CUBA 5BPFA 1UBLS 3CNBA 2G4CA 4MS4B 3DSXA 1JDUA 3KZVA 4ZJUA 2DB3A 1VKJA 4GKJB 4ASUD 1XAJA 2VPPA 3SQOA 4PIPA 4YRSA 3OX2A 1FDSA 3RS8A 5GIPE 1HNZB 4JWKA 4UZSA 4EA6A 1R4NA 4DI4A