2XGSA

Xcogt in complex with c-udp
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
542
structure length
542
Chain Sequence
LMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords XCOGT
publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
total genus 206
structure length 542
sequence length 542
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgsA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgsA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgsA02
4N39A 3LY9A 4J8DA 1XC7A 1L6IA 3COPA 1Y6FA 3C4QA 3DD1A 3E3OA 3T3GA 9GPBA 3MBOA 4AY5A 3ZFWA 4XI9A 2PQRA 3CEMA 1W3BA 3BD7A 1P4JA 3CUWA 4LEIA 4YI3A 3WADA 5HI7A 4WUYA 4M83A 5IKOA 3ZCVA 4N3AA 1Z8DA 4F97A 3ULQA 3QWPA 3NC4A 2X0DA 1GGNA 3QHPA 5HXAA 3QKYA 3S7BA 1FA9A 3H4IA 5CCMA 3H4TA 1Y8ZA 2GEJA 2VCEA 1FTYA 2IF4A 5DBKA 3CK7A 2XEVA 3ASFA 2VSNA 1KTIA 1HZ4A 1FU8A 4REMA 3RO3A 5JTUA 5TMBA 1Y6GA 1P2DA 4J0UA 2QN8A 3RSCA 2XMPA 3AS8A 1XOIA 2IV3A 3WXXA 3L7CA 2GT1A 3TG5A 4NC9A 8GPBA 5JJ7A 4J8EA 4GA1A 2XA2A 3R9AB 4N3BA 2QN3A 3T3DA 2V5FA 3AS4A 4RIHA 3CEQA 3CUUA 2UY1B 2QZSA 3S0JA 1V4VA 4U07A 3S7JA 2I6HA 4JHRA 2FF4A 2PZIA 3K9IA 1IXYA 4LEUA 4CTOA 4BQEA 3CEHA 3RT1A 3CKCA 4XI0A 2IEGA 3L7BA 3CUYA 3EBPA 3MT8A 4N9WA 2FFRA 3TGOA 4RIGA 4WNDA 2GW1A 3Q4AB 1GPAA 3S28A 4RG6A 1M5RA 3NCHA 3MV3B 1A17A 4X7MA 3T5TA 4GYOA 3EBOA 4UQYA 3ZHEB 4YVQC 3HBMA 1FTQA 2C0MA 3OXGA 2OFFA 5BW8C 1F6DA 1JEJA 3TOVA 3TAXA 4PQGA 2G9QA 1E4OA 5D01A 3S2UA 2BGTA 2QN1A 3RSZA 2H1FA 3RU0A 3BD8A 2HO1A 1P2GA 3D0RA 3MT9A 4HWGA 5AYWD 3L01A 3OXLA 5GPBA 3QKWA 1IHGA 1L5QA 2R5SA 4XIFA 5TVGA 2F3SA 3T3IA 3N71A 3GYZA 4G2TA 4U04A 1JIUA 4AMBA 2QLNA 1P5QA 4UI9K 2WTXA 1IIRA 3Q3IA 3ZCTA 1Z6QA 4B94A 4Y6CA 2UWJG 1ZU2A 3E4BA 4F9FA 1HH8A 2IYFA 2R68A 1YA6A 4UQZA 3FP3A 1K08A 2X6RA 3MEKA 4N3CA 2XGOA 3CV3A 2O6LA 5TMDA 1KLXA 2FEZA 2UY1A 2BFWA 2X0EA 4GYYA 2ACWA 2AV6A 3G2IA 4AMGA 4RBNA 4G26A 1BX3A 3S7DA 2C9ZA 2L6JA 3JYSA 3OTHA 4RELA 4YI5A 2VGYA 3LY8A 3MKRA 1IYGA 2IEIA 1JG7A 1L5SA 4F96A 5BT1A 3GZ2A 2X6QA 4KQ1A 2JZCA 1PNVA 2FBNA 1OUVA 3DZCA 3L7AA 2R4UA 1P29A 2Q6VA 1QKJA 4MI3A 3MRVA 3CKBA 3ZHEA 4NEQA 2ASVA 4YUAA 3OY7A 3Q5MA 1LWNA 3OTIA 5DIZA 3OKAA 3LY7A 3Q3HA 2F3UA 1QM5A 2GM9A 3FWVA 2DBAA 2YQ8A 3ESKA 2ATIA 2PRIA 1H5UA 3SF4A 5KJKA 4RIEA 4GZ3A 3CVQA 3Q3EA 3NF1A 3QWWA 5D0QD 2AW3A 2H1HA 3IEGA 2GEKA 3OKPA 1ZBPA 1FC0A 4EKEA 1WM5A 2QN2A 3S7FA 3RKVA 5M72A 2GJ4A 4QLBA 3BEEA 1KT1A 1QZ2A 3OXFA 2VG8A 3T3HA 3D0QA 3OY2A 2HY7A 4IN3B 5HQ8A 4BT8A 1FTWA 4GPKA 3T3EA 1LWOA 4L22A 1L7XA 3HYMB 4RIIA 4HORA 1XV5A 2E2EA 1KT0A 5FT9A 1WW2A 4UI9J 4HOSA 5FTPA 2QRGA 1K06A 4GA0A 2XCUA 4I2WA 4ME2A 3U4TA 4AIFA 4EL5A 4WADA 3S29A 3LKUA 2BUGA 2VSYA 4YVOA 3AMVA 4CDRA 1C3JA 3G2NA 4MHSA 2AMVA 1P4HA 1AHPA 1B89A 3ZCSA 3BCRA 3NP9A 5JTTA 5I45A 3MTBA 2NC9A 3PDNA 4I1AA 1E96B 3VTYA 1NA3A 3KD7A 4KQ2A 4I17A 3MTAA 1Z62A 2IUYA 3HBFA 5G05J 3S27A 3NB0A 2PQ6A 3CX4A 4W9RA 4BQFA 2QFCA 4UQXA 3MTDA 3ZPJA 1HLFA 1NZDA 1YGPA 2IW1A 4AY6A 2JJMA 5KJLA 2ONDA 1L5VA 4X6LA 1JIXA 4JL0A 5JJTA 3E3NA 4I9EA 2IFUA 1WAO1 1ABBA 2VYIA 3SYMA 4GA2A 4N2SA 3SYRA 3QOUA 3UUXA 1EXVA 4GPBA 4BFCA 5EX0A 1GFZA 2G9VA 4O6FA 1C8KA 4Y6WA 1YA0A 4BT9A 2QRHA 3ASGA 1SXQA 5FJYA 5CHEE 4M7PA 1WV0A 4N5CA 4FKZA 5A7DB 3O3CA 3QDNA 2G9RA 1P4GA 2P6PA 7GPBA 1EM6A 3CUTA 1UZUA 2YHCA 5G04J 2ACVA 1E1YA 3KAEA 2QNBA 3MA5A 4YNDA 2Y4TA 4MI6A 4RENA 1FU7A 2FI7A 2AZDA 4GCOA 2X0FA 3MS2A 2LSUA 2R4TA 2F9FA 3MRTA 3VUEA 1TJCA 3ASHA 5DLDA 3URZA 5JJ6A 1JIVA 2GPBA 1NZFA 1NOIA 3MRXA 2FO7A 1GZ5A 3NP7A 1NOJA 3RIBA 3UYLA 1NA0A 3SZ7A 5BNWA 3CUVA 2R66A 2PYDA 2G9UA 3VTXA 2BGUA 2XA9A 4JA7A 2XCIA 2XPIA 5KJMA 4RG9A 2QRPA 3HBJA 4EL0A 3ZGQA 2FETA 4I2ZA 1XL0A 2ZB2A 3Q49B 4EKYA 5D00A 3IA7A 3CVPA 3L79A 3OKCA 2C0LA 2ECPA 1FU4A 4AM9A 4AN4A 2KS6A 2XGSA 1NLMA 3TSAA 1UQTA 1L5WA 4UI9C 1RRVA 1C8LA 5DU2A 3EDTB 3G2HA 3MT7A 4APOA 2BISA 1B4DA 3NAZA 2YJNA 3BD6A 2QN7A 4MICA 4JA9A 2MHKA 2QRMA 3G2LA 5LCWJ 2KCLA 3QWVA 3G2KA 4WNGA 5TMEA 3WC4A 3CVLA 3Q47B 3UYKA 3FFLA 3OT5A 1Y8MA 3L7DA 4GZ6A 2VQ2A 4MHOA 2VGXB 4W6QA 3FROA 2LNIA 3BDAA 2KCKA 5G05C 2R60A 2AVPA 3Q15A 4J8FA 4X7PA 5D0OD 4CTNA 2XCBA 1PN3A 5FZRA 1WV1A 2P58C 4BTAA 1VGVA 3UQ3A 1Z6PA 1QQEA 3ZN3A 3DDSA 4U0UA 2C2LA 4Z5XA 3TG4A 1RZUA 3ZCPA 3BCSA 1ELRA 3VDNB 3PE3A 3NPAA 1RZVA 3ZCQA 3LYAA 2IV7A 4N2QA 3GUHA 5ENZA 5ARFA 1GPYA 1O6CA 4G23A 4CGVA 3BEOA 3ASDA 1HXIA 2PYIA 3CK9A 1SXPA 3CV0A 1C50A 2QRQA 5A6CA 3MS4A 2LSVA 3LCAA 3CK8A 4H7XA 3HBNA 3VDMA 3VUFA 3D1JA 2SKDA 1WUTA 2QLLA 2HYZA 3GPBA 3O48A 4G2VA 2IYAA 1XL1A 2GPAA 4FZRA 3PE4A 4LDPA 5LQDA 3MS7A 5G04C 2GPNA 3GZ1A 1L5RA 1UQUA 2QN9A 1F0KA 1NZNA 4BQIA 1WW3A 5ARGA 3CVNA 3E3LA 2XCCA 4GCNA 4HOUA 4HOQA 2VCHA 2J9QA 4MRAA 2Y4UA 1NOKA 5EKQD 3RJVA 1J39A 2QLMA 4U0SA 1P2BA 2PL2A 2F3PA 5EX3A 4EQFA 3AS5A 2C4MA 2VGXA 3IAAA 2XGMA 2C1ZA 2XA1A 1WUYA 4G25A 3ZCRA 4G1TA 4CGWA 2SKCA 3CEJA 2HR2A 4I9CA 1FS4A 4WACA 3MQFA 2F3QA 2C1XA 2KATA 5KJNA 1ELWA 1A8IA 3ZCUA 2PRJA 4WNFA 4CTMA 2OOEA 3KS2A 3OTGA 3RO2A 6GPBA 3C4VA 4G24A 4HLNA 4EJ2A 4NRHB 3DDWA 1PYGA 4MI9A 1FCHA 2FF5A 5DXFA 5C1DA 1JG6A 2KCVA 3RHZA 3BCUA 4KXKB 4WHMA 3C48A 1PSWA 2JLBA 2PQNA 5LCWC 1XNFA 1GG8A 4M60A 4RIFA 5FZSA 2Q7FA 2WQHA 4X7RA 3LPZA 4ABNA 4KBQA 1PC2A 4F3VA 4HOTA 3G2JA 3MSCA 1GPBA 3U3WA 5IKPA 4KQMA 4KYOB 3WAGA 1XKXA 3UPVA 1AXRA 5CCLA 3GW4A 4U0ZA 4WNEA 4NQ0A 4BTBA 4A1SA 1NVKA 3T7DA 4GYWA 4GZ5A 4NESA 4BWRA 2WPVA 2KC7A 4H7YA 2SKEA 5FZQA 3MV2B
chains in the Genus database with same CATH superfamily
1PBTA 3COPA 3M4ZA 2AQ8A 1NXQA 1XMSA 2CXNA 3F49S 3N07A 4H2DA 3ASZA 2QAGC 4BO2A 3TVDA 1RLTA 1R0ZA 1XU4A 2OP0A 1C0IA 2J41A 2Z8YM 1K2VN 5IF3A 3TE7A 2FN8A 4G2NA 1YH3A 2RI1A 4G11A 1R5JA 3NHSA 4UDXX 1AK1A 3PGJA 2QE7A 3H1TA 3HKDB 4IVQA 4UNSA 1FYDA 3SHFA 2J8ZA 4LXTA 4HGNA 4L7QA 4UULA 1AD2A 4QDOA 1GPAA 1ORIA 3RFXA 2NACA 1UZNA 2JD1A 2XBUA 3V2GA 4XIFA 2PA0A 2VIIA 4DNQA 2JEKA 4QPZA 4HYEA 3TM4A 4EO4A 4C29A 2JAQA 3TW6A 5C4IA 2VRCA 5J47A 4PLWA 2L6JA 1DLIA 1KDVA 4B9EA 3ICCA 4KXFB 1P2FA 2Y6UA 2VK4A 2CHWA 1E6EA 4HHEA 3EQ8A 4URHA 3NAWA 4XLLA 4AIRA 3G0DA 2YQ8A 3BQ9A 2JD2A 4LV6A 3ZHRA 1DMRA 1QNFA 4MZDA 3TGWA 3BEEA 1J2RA 3R4CA 4IY1A 5C8YA 1H93A 4YJDA 2VF5X 3GLFE 4E22A 1T15A 4BT8A 1P19A 3PHJA 1RYHA 2DGDA 4JLOA 5BN5A 3GLGE 1ZMTA 2DTDA 2H07A 3IPLA 4ME2A 2ZBFA 1RYBA 4W5HA 4CDNA 4R9SA 4ZVQA 1JTEA 1F20A 4ANXA 4OK6A 4B6FA 2XYQA 3PQ2A 4AJ1A 4KN9S 4NMHA 2EEZA 4IIJF 3B7BA 4GL4A 5HKKA 1Q91A 3EXG1 3OJEA 2R87A 3T1YB 1V6SA 5AIAA 1LEHA 1PK7A 1VSTA 1L7EA 3HXQA 4QYMA 4CL0A 3ZXUB 1C29B 2P6PA 5DXAA 4L50A 4URZR 1NFIE 2QL9A 1HO8A 4LCTA 1XE3A 2Y1EA 3VPGA 2FZ5A 5AK3A 1BYIA 3SSOA 2UYGA 2Q5FA 3URZA 4Q19A 3D3NA 5CNMA 3NP7A 4ZVNA 3ILXA 2DUWA 1F48A 3RUFA 4DCGA 2ZG6A 5DKFA 1ZJZA 2I80A 2FETA 1RHJA 3HV0A 2JNWA 2HE0A 4PPYA 2RK6A 4H3HB 5JMPA 4REOA 2ZFUA 3OOSA 3NHLA 2YWRA 2FFHA 2ZANA 4Y9TA 4L0CA 4KXUA 3IESA 4HEA1 4G1EB 1JRLA 3SEAA 2ZSUA 3ED1A 1W85B 2ZIVB 1U2TA 1EDZA 3EN0A 4JKYA 3VAZA 4NENA 1PNTA 1HDIA 5D5PA 2QTVA 1XRQA 4AZVA 3ZDBA 2FWBA 4EGJA 1XUOA 4YRGA 4DGQA 1IUKA 5ES4B 3E3LA 2HA6A 4R05A 3LVQE 3U4QA 1NOKA 3T7RA 1GARA 4MAFA 2GVDC 3EIEA 2VGXA 3NW9A 2KLHA 4FFBA 3CEJA 4AQYB 5CRVA 3Q3VA 2ERCA 3IO3A 2ZPAA 4EPZA 4NZ9A 1UAGA 3PF8A 5CJPA 1YZKA 1C1XB 2SHKA 3E53A 2P3QA 2XEXA 4B73A 3AYZB 3L7KA 2HEIA 1XDZA 1SELA 4KWEA 1PJRA 2BF0X 3X3HA 4P7BA 3LZDA 5DTMA 3AG6A 4GYWA 1JHOA 2VTBA 1E2QA 3FYTA 4DX1A 1J0XO 2HEGA 1QBKC 3E3OA 2E4XA 3X43A 5EMLA 1SVUA 1EGAA 3IXLA 2B8EA 4CM5A 2QU8A 1P9NA 1G63A 5CT9A 1F7UA 4XGKA 5FORA 1S3IA 3IAS6 1XOIA 3KU4A 4II3A 3A1SA 1CD5A 1CDOA 4B3TB 1WMDA 3AXSA 5DCLA 2QZSA 4ND6A 1SUEA 1ZC4A 3GDHA 4OLFA 1BGVA 5F5XA 2WTEA 1NN3A 3EHEA 3TGOA 2WYUA 5LBUA 4H7EA 2C29D 3ZHEB 3ASNE 1VBMA 1N5IA 5DK4A 5AK6A 1Y4DE 3FAKA 1D5WA 2GYYA 1AE1A 3B3JA 3P0RA 1SC3A 3D0RA 2DQ4A 4XEIG 2FR1A 1L1EA 2OZLB 3K4PA 4K6FA 3A1DA 2ZM5A 4BAZA 3IS3A 2EWMA 3DTVB 1NQTA 5D7BA 3IT3A 4MAAA 3A9VA 2P9HA 2OAP1 3NBZC 4UNIA 3W2GA 2YVLA 3JCKC 2I7CA 2J0UB 2AI2A 4I3FA 1VJTA 5FHQA 1G8JA 3UT7A 3HKDA 4C0XA 1FSZA 2YJGA 1U94A 5DM1A 1KARA 2OQRA 4TTSA 1I3CA 2G88A 3AU4A 2SNIE 4NEQA 3VDQA 4ZMBA 3ZYKA 2PRIA 2TMKA 2O7VA 1EFUA 4BPRA 5K8CA 4CZ2A 4GI2A 1Y81A 5KOHB 1LBTA 4NZOA 5L6MB 1A3CA 2OEVA 4ZYYA 2VJCA 2VJMB 2WXHA 1E60A 2AI1A 3RVJA 4YK7A 4MMYB 1GNVA 1UFQA 2O7QA 5KNHD 1JWFA 3WXMA 1NMZA 4GP9A 4Q4LA 3LKUA 4HKTA 5KSYA 4QWMA 4XIGS 2FQWA 3CLHA 3R4VA 1SKBA 4EWLA 1NHWA 3HBFA 2Q4TA 3FCAA 3NS7A 4PAGA 3STWA 1NBHA 2DCUA 5JDCC 3K5IA 2YDXA 2P5UA 5F5LA 4MWGA 4R2HA 4JZKA 3R2JA 4KQHA 1XRLA 2GJ8A 1HG1A 4Q69A 4W7SA 1P0CA 4F2HA 4QELA 4ND5A 3SQXA 4WWHA 2NO5A 1H3FA 4AEZC 2HBYA 4ARSA 1EG7A 4GTVA 2WXQA 2JASA 2CNWA 4I6GA 2WI8A 1FSFA 1BI7B 1NW8A 3GLHB 4IP0A 2F9FA 4PCVA 3HLKA 5F5NA 3N70A 1MO3A 2GUWA 5BQFA 4GZDA 2ONKA 3ZI7A 1CQPA 5DYNA 3VTXA 4TSKA 3GNTA 2WKSA 1A27A 2R751 1ADFA 2KS6A 3OUZA 1JIQA 2WT9A 4R8SA 3UUWA 3W5VA 1E2UA 3JQ8B 4OQEA 4LGYA 5TMEA 2VDVE 3OLZA 2B8TA 3N2EA 1Y8RB 1IEXA 3GFOA 5HK8A 1GADO 2LNIA 5KOYA 1O6GA 4FLHA 4TXLA 3EIJA 2Y0PA 2Z6QA 2JLWA 4RM3A 5BRAA 2I1JA 1XQVA 4LSWA 1CBUA 2GAOA 4TMWA 4DRXB 1L4HA 2CF6A 2YWEA 1KA9H 4PYNA 1TT5A 1C3LA 4KQFA 2C94A 2XZPA 4WJZA 3ASVA 4ND2A 2COEA 5J23A 1ZVJA 4S1OA 1UWCA 1CU1A 3CJTA 2VP4A 3GIWA 4PEVA 3HJBA 5UKDA 2R48A 4XQEA 5KB3A 4O2AF 3NUGA 3T7AA 1DCTA 3O2QB 1BYUA 4KR7A 3HXFA 2NVWA 2QJTA 1JJAA 4YA6A 1W85A 3BJIC 5C51B 1TNUA 1KS9A 1HG2A 1S89A 4M7WA 3IAS1 2QRNA 1ML3A 2AJBA 2EZ9A 5EHIA 4FYJA 1YS7A 3FH5A 1NJ6A 1HEUA 3UIEA 4YGXB 4CM4B 5FFNA 1RYZA 1YI1A 4UBOA 4O2BF 4D3DA 3UMCA 1PKXA 4IJVA 2HJ9A 3NOOA 4TYWA 1RADA 1UBGA 2K87A 2WV7A 3TQTA 1LKZA 5EOVA 1F38A 2QE7D 4RXMA 3CHOA 3KHTA 2FKAA 3A2KA 3AIIA 3SIWA 4Y7DA 2GF2A 1E3DA 3EZ9A 1Y4AE 3LC2O 4RPJA 1Z8NA 3ABQB 4RDIA 5IAGA 1O7JA 1RQXA 2NO4A 4LFCB 4FLEA 2VCEA 1C1XA 3BE4A 4PZAA 4E6EA 2Q1UA 3KEGA 3KSUA 3K1YA 4QGFA 4Q7JB 5EZ5A 2VRCD 2LR0A 2B78A 4HNQA 1Z56C 4JWTA 1PNQA 4D8VA 2GBLA 3W8NA 2IEGA 4UU0A 2XODA 4CL3A 4MWDA 3M4JA 4BZZA 3T5TA 2YZGA 4RM2A 4JYCA 3JS5A 3NKFA 2QI9F 2ES4A 3T4XA 1DAGA 2IJGX 1Y42X 2Z57A 1DPFA 2BGTA 5CB4F 1P2GA 2F64A 1W0KA 2EG9A 1XD8A 2F48A 1Z4NA 5L4NA 2BHLA 4N01A 4JBYA 1H4SA 4Q6WA 3UK7A 4J4TA 1FNNA 2AOTB 1KZ7B 3DZFA 2F9MA 3L8GA 1VL0A 3RSFA 1LPAB 1YI0A 3EASA 1SW6A 3O1HB 1W47A 5A6SB 1QH1A 2XNHA 3M4NA 1ZUWA 1ZVVA 3O0DA 3VU1A 3ZHEA 4LOAA 4AT1A 4OMUA 1AMOA 4C4TA 3RYFA 2ZIWB 1J6UA 3DEIA 2OZLA 3IDAA 1LF0A 1RHKA 1Z5ZA 1UXOA 5E4JA 2H6HA 4BTEA 5JCXA 1AHNA 2WXIA 4WE3A 3DTVA 3BFKA 3F1KA 3D0QA 2X3YA 4JP5A 5A4DA 2J0UA 5CG2A 3QTBA 2IXBA 4QFCA 4F1KA 1WE2A 2AMVA 4LWPA 4OU4A 4BUJA 3SFTA 2HPVA 3ZBUA 2V3VA 3NYQA 4DLLA 5JYCA 1TNBA 4XOUA 4OQ4A 2EIKE 2RDMA 3I45A 3L41A 5A03A 4EB3A 5FWNA 3ANSA 3PHIA 2VSXA 3L1VA 4Q7LA 1JPNA 1N2BA 4GWGA 2QW0X 1GIAA 2B5WA 5TF0A 3MWJA 1CY8A 3IVGA 4GPBA 5AQ9A 2VJMA 3WYAA 6ADHA 3MJHA 3K70D 4DCJA 3D43A 4AS2A 5E2AA 4N4AA 4FWIB 1NQ5A 3E5NA 3FKQA 4Y2YA 4FKMA 4PW0A 2AE1A 5F2OA 1ISSA 2CD9A 3RJMA 4TM8A 1IN5A 4V24A 4D4MA 1M2GA 3DFMA 1EESA 1K27A 1EDBA 1QGDA 1WJGA 2HBRA 1J8QA 3W6UA 1I9CA 4BV9A 4KXQA 1E8WA 3WRYC 1TO1E 5JUWA 5KWVA 1KYQA 2B3DA 4RXTA 1F12A 1AO0A 2BI8A 4P4TA 4E08A 1KZYC 2QRMA 4V38A 4RU1A 4DUPA 3AEQB 4OHOA 3KU1A 3U7JA 4JUBA 4HFJA 2PRZA 2HTEA 2TMYA 2PWBA 2KCKA 5HIMA 3RAJA 2XZOA 3GLHA 2HJVA 1N5MA 4U5QA 1PIWA 2PQMA 1IJBA 1AX9A 2Z30A 3G85A 3OBBA 1CP2A 1SOUA 3AR4A 3W2HA 2FCAA 2DQZA 2XEEA 4C0EA 2ZR0A 2J9GA 3VDMA 2EX4A 4CM1A 6Q21A 1QVWA 3VR6H 3EZ2A 3AERB 2X8AA 2VDUE 5EXEA 2ILTA 3JQ8A 2Y0DA 1V8BA 1N4RA 1Y1LA 1Y8RA 4EYQA 4N3GA 3UCEA 3L7OA 3T1TA 2RGDA 3GJ7A 5FUMA 1JHUA 1GLGA 3ZD7A 4KR9A 2OCGA 5C37A 1V96A 1S3GA 1EVQA 1PYGA 4DRXA 3CZ5A 3OEED 2DUMA 4QHSA 5HQJA 2QMQA 1GRNA 4HOTA 3LOUA 2HSGA 1Y1KE 4Z1MA 3ZWNA 4QICA 3B7UX 1NSFA 4F45A 3AIKA 2BONA 4HDRB 1PR1A 3LY9A 1SBHA 1JF8A 4H18A 3ZHTA 3B1JA 4K6CA 3PD1A 2A1TS 2PJRA 5CVCA 1F7VA 3QOFA 2FDRA 2WHPB 3QYJA 1OW3B 5BVHB 1JEDA 4I8DA 1O9HA 4CM4A 3NWOA 1A8SA 4HRYA 4KGZA 3FUMA 2O2DA 4UHFA 1N2IA 1OLXB 1CV2A 4OU5A 3AS4A 4MUJA 4JLNA 3BGVA 3ONDA 4FFNA 4P80A 1M2KA 2X38A 4TN5A 1R4NB 4LHZA 1PFQA 5CDGA 1KO5A 4BLVA 1V25A 2XTNA 1FW8A 2FSVA 2EJWA 1OWOA 1ISRA 2GTIA 4BE4A 3ORQA 2CSUA 2YQZA 1FNBA 4WX2B 1R6DA 4CZ2D 1A96A 3HPRA 1OX6A 3TD9A 1V9CA 4KU4A 4E30A 3EB9A 3EUEA 2BDEA 3KSAC 1JXOA 4KQ6A 3SZLA 3B51X 3MCTA 2XLBA 2ENUA 1L4KA 4CYMA 3WNCA 1IY8A 4HQ0A 4LWQA 1XF9A 4OUKX 4BYMA 2NXCA 3AFIA 4LGMA 2W58A 2EILE 3SGHA 3PHCA 1XK7A 2FN4A 3LY7A 3V1NA 4F9TA 4PYRA 3E84A 2OHGA 3G88A 1IPFA 4NAUA 4WWNA 5TJHA 2J0QA 3HKEB 4PNHA 4Q3AA 3MG9A 2Q5QA 3BRQA 1R0LA 4D96A 5I7RA 3GJSA 4DB4A 3P27A 3NAQA 1FP2A 3TQOA 2AOTA 5SY4A 3G79A 4L22A 3AEUB 1K63A 4CL8A 3T94A 5EY5B 2CNWD 1MAUA 3P0JA 1HFAA 3N0WA 4ESEA 4L5AA 3ROTA 4DR1B 1KAHA 1P4HA 3H7IA 3NRBA 2WAXA 5AD1A 3A6JA 4DLPA 2VHCA 4HCJA 5FA8A 5DLEA 1H6BA 4LDNA 3DEFA 2YRXA 2ASEA 2YCLA 4XGNA 3PLRA 5ICMA 3PF9A 3K3PA 1Q0PA 1GRRA 1W9MA 2PUVA 4YPOA 4XR4A 1JEYA 4UZSA 2DMRA 1TYDE 4KO4S 2C4VA 3OMLA 2HK7A 1KR2A 3FR8A 3QU9A 2A57A 4X6XA 4F5ZA 2DBRA 1Q57A 3QOYA 3ESZA 2JLXA 1CUIA 2W98A 1J0DA 2WAYA 1U7PA 1Q1EA 1TPYA 2CVHA 2EARA 3AEYA 3PQ5A 1A50B 3M7IA 2M9MA 4Q94A 1QE0A 4ZQBA 4M49A 4ZIRB 1MXHA 5ARDA 3TOZA 1UQTA 5LVAA 1UOPA 2IF2A 4IMPA 3GLVA 2O0LA 3V30A 3AFMA 3G7SA 2R60A 2VA8A 3U31A 4JELA 4U0UA 3ORFA 2H5EA 4C30A 5I51A 4QOJA 1UPAA 2DAPA 4KWHA 5FWAA 1O6CA 5CYOA 3HK2A 3KKKA 3CN9A 4L74A 3FMVA 4JK3A 2LUHA 2GRRB 1RXEA 4HB0A 2O2EA 3K32A 2WJ3A 4UE6A 2Y71A 3B3QA 3R8CA 3DVRX 5H4GA 2ZYUX 3AEQA 5JLAA 4RAOA 4IIJA 1NE7A 5DF1A 4KXXA 3DHNA 1CNEA 2HJSA 2Z8ZA 3V3KA 4L76A 4ZVPA 4JAVC 2OV6A 5I7SA 3TXXA 3ITNA 3ODGA 2F6RA 5E75A 1D4OA 2FI1A 3DEKA 3SF8B 1L4NA 3KJGA 2PY6A 2W5UA 2M6SA 3SX2A 3R0VA 2ZJBA 7MDHA 1V35A 3FTCA 1XTKA 1TU4A 2ZQZA 1AKEA 5JD3A 1ZCFA 4AKGA 1KMNA 3AERA 3WAGA 2AXQA 1AXRA 5ALWA 2AWOA 4WNEA 2JK1A 2GDZA 1YQDA 3F7TA 5IX8A 2ZEJA 2BMVA 2QHXA 5C7OO 5JSHA 3DZHA 3SE0A 3UJ6A 3A1NA 1XLVA 1LY1A 2P6NA 1E2EA 3M82A 3W8DA 5BORA 1BEUB 3KOYA 4LVUA 2PO5A 1TYAE 1MO4A 3BB4A 1WD5A 1MZCA 2D59A 3AY0A 2AKEA 3VNUA 2JI7A 3UW1A 1W0KD 2Q9BA 5F3DA 5CXXA 4D46A 5DNVA 3VU0A 1U8AA 4YP1A 2DLCX 2FHPA 5CK4A 1A4UA 3NFYA 2RBEA 3JPYA 5AKHA 4HN4B 1ULBA 2DJIA 2XX3A 5LMUB 1SQ5A 4QQRA 1GL7A 1LPMA 1ZH0A 4KR0A 1Z5OA 2DQSA 1LX7A 2O2JA 4JU8A 4JLMA 4Y2JA 1SKUA 4HDRA 4RJ2A 2H6EA 1SM4A 3ZYZA 2YWFA 4A0QA 5A6VA 1QXSA 2F43B 3R6LA 4M8IA 4W5QA 2JL1A 3CT6A 2EFYA 1J8YF 3TR0A 1LBEA 2WHPA 4BLWA 1E4OA 3UN1A 4TV9F 4DHEA 1AZLA 3OXLA 3W7VA 3MZ0A 2R5SA 5BVHA 2O2CA 3TQFA 3SYNA 2BE9A 3DBRB 4MVJF 3NIGB 1R15A 3QMMA 4FI3C 2HA5A 1OLXA 1TEXA 4NG5A 1P0IA 1Y7LA 2R00C 4XD7A 1SBCA 4INPA 1WPGA 4NCAA 1R4NA 3IXMA 2ILRA 3IV0A 2X1LA 3QVJA 3JZDA 1M0EA 5DHTA 4DA7A 2Q3CA 1UADA 1JHDA 4NV0A 2WMNB 3IQXA 5K3DA 4Q1CA 1NN0A 3CISA 5E38A 1DAOA 4DN6A 4EARA 3ESKA 1W48A 2ATIA 2BZSA 4F2PA 4UM8B 2VWPA 4JGIA 3WL8A 4WW0A 4ND4A 2G9NA 2XAAA 2Q5CA 4G85A 2O52A 5D51S 4MW9A 4ZVRA 5HQ8A 2H6FA 2FX3A 3FEXA 4AO6A 3HYCA 5CB4B 1N6IA 4IIDA 2W48A 3PZDA 4B47A 4ERNA 3LPLA 2P9IG 5LWHA 1J00A 4HH3C 1KFEB 1Z73A 4C87A 2FR0A 4R2WA 3O92A 1I5OA 5EKXA 3U7FB 3KLNA 4L16A 1EVLA 3IUEA 4RACA 3FRIA 5EESA 3AOEA 1B3BA 4I1OA 4RGYA 3SDZA 4UC0A 2V96A 3HKEA 3MJTA 5L7TA 3TD2A 1DWPA 4BESA 4N2SA 2ZPTX 5PNTA 3HU1A 4FGJA 4TLMB 1AQUA 4BXOB 2GF0A 1MNAA 1UWKA 3WDMA 3AEUA 3EFOA 1Z9BA 5CH8A 3CF4G 1QB7A 2NOAA 4YAJA 5D8DA 3ACDA 1NNSA 1ZR4A 1H1LA 1XCOA 1MC8A 4J7UA 4DQUA 3TLEA 1OIWA 2YVUA 4BE9A 3ZIAA 2A3RA 4F4IA 4EKDA 1U2GC 1TEHA 2AVDA 4W1PA 5EXPA 4UUNA 1PYOA 2NVOA 2VBGA 3D4IA 3EEOA 3OPMA 2GKSA 1VJRA 2FWNA 3P45A 2HFKA 5DMHA 3U4CA 4WGFA 3GRAA 3S1AB 3OIUA 3WKEA 4OI2A 1E4EB 2C2LA 4A0HA 3EIOA 5DGXA 5ARFA 5CX4A 1EK5A 1V5FA 4YCSA 4P4LA 4PNPA 3RFCA 4HWRA 1YXMA 3H42B 3RUHA 1QDLB 4UCWA 1OB5A 4ZIRA 2WEKA 4CF4A 5TQ0B 3QA9A 1EVYA 2DB3A 3ZNNA 3DGFC 1D7OA 4RHXA 3HKCB 4KK3A 3LC7O 3ML1A 4A2QA 3SBDA 1HNZB 5LJIA 2HF9A 3OZUA 4I1SA 2C4MA 4AXHA 3K53A 1II8A 3K30A 4J1QA 2L42A 1OMOA 1ODCA 5DTRA 1DCQA 1C4OA 5CRUA 1F2TB 4Q9JA 1W19A 2ZYHA 4WJLA 3LSYA 2JKZA 4NDAA 2OZPA 4U8HA 4JR0A 3M1AA 4EPXA 4BX0A 4DABA 4CIBA 3Q79A 3FDZB 3OSUA 2BMFA 3QX9A 3D59A 1L4EA 2OWEA 4B8ZA 3E5RA 1OFIA 1GDTA 1UDXA 4IM7A 3DWGA 4Q9LA 3WIUA 2G67A 3M4YA 3ZK9A 3V46A 1N7GA 1FA9A 5FTLA 1ZO8A 5AJXA 3SF8A 2FZWA 2VK1A 4WZ6A 1VKZA 3QUSA 1N2CB 1QIGA 5M2QA 1GU1A 3C8MA 3WLTA 3SEFA 5HM6A 4N3BA 1RQ7A 2RHOA 4L1BA 2B98A 2I6HA 4LMAA 1ZJJA 4BQEA 4CYMD 3HVKA 3FYSA 2R7LA 1W49A 2R25B 1RYMA 3RREA 3DMFA 1UZAA 5IC6A 3GDOA 5AKLA 1X1BA 4G0WA 5FQ8A 3GMDA 4FMCF 2XMSA 5JSFA 1PHRA 3DE4X 1I2CA 5FDFA 1WHSB 4QTTB 1S6YA 2Q1WA 1KDTA 2VAWA 2D13A 1SFRA 3V8MA 2L17A 2FYTA 2BAGA 1WTCA 1QF7A 2X7HA 4EW6A 4GR9A 1Z3CA 1SKYB 1IYGA 5CYPA 2MSKA 1J21A 2C3UA 4L75A 1DLJA 3DT6A 3EVZA 4HXIA 1VIYA 4TMTA 1CJMA 3CKBA 4PGGA 5CBOA 3AGQA 2NQ8A 2ZROA 2BMWA 1U0EA 2FRDC 3DBRA 2GOYA 3QPBA 4ID3A 4ML3A 3LQRA 4B1FA 3IV9A 1YA8A 4QPJC 4DQXA 1J9GA 1QK4A 1WXFA 3W77A 3TNFA 1M6VB 1EPUA 5P21A 3PFHA 2BZGA 2HMAA 2O3RA 1AO3A 3E8XA 1VE1A 5JCPA 2IWRA 5DX0A 1HUQA 4Y2TA 2XT9A 3GGJA 1YRHA 1TKRA 2WMNA 4MQ4A 3WYCA 5GONB 3AQIA 5FFFA 1FYWA 1NF8A 2BFBB 2Z4SA 1EX1A 3RTAA 4BLOA 2QYSA 2YZ2A 3WMEA 4FBMA 2YWHA 5JZOA 3OQBA 4AROA 4DCOA 3ND9A 3PCRB 3ICVA 3WAKA 5JZVA 4MWEA 2SICE 1YCFA 2VQDA 1D5CA 5JG7A 5CB4A 1GPMA 3MGCA 4AZSA 4XUGB 1QVZA 2R5FA 2QM8A 4P7FA 4BTVA 4FFPA 2BGRA 2MOKA 5EZSA 1ZCJA 2GM5A 5FPYA 2FPGB 3M5DA 4DPLA 3R0JA 1AQJA 3ICPA 1U8UA 4YHBA 2ZUVA 1B14A 1V43A 1VYHA 4PSKA 4F3NA 2Z5GA 2GF9A 4BLSA 5EA2A 4WIAA 3JXIA 3NAZA 1WP4A 4BXOA 3HBAA 1QH9A 3O5AA 3UYKA 3IT2A 2FA9A 5A5EA 2E89A 1PLLA 3KTOA 3TPZA 4TRRA 3ZV3A 3ZXXA 4MIEA 2FG5A 1T4CB 1Q19A 4KR3A 1HX7A 1BTOA 2PX3A 4RX1A 2DHQA 3K0BA 5CDFA 3B48A 3F6SA 5EL0A 3PTLA 4AUKA 4WFQA 4GDFA 4MVWA 4MV5A 5FAKA 3UKOA 5JBQA 3ZI0A 3T7SA 2OV2A 4Q9HA 4AULA 4KVMA 2LWIA 2R4QA 1RP7A 1K5PA 3S1AA 3EK2A 3BIWA 4XCXA 4JY7A 1ODTC 4TN1A 2FEWB 1U2ZA 1E4EA 3CMMA 3OZAA 2JIPA 1YDFA 3WYDA 3MNFA 3F98A 2XMDA 2ODTX 2GPWA 4RKQA 3RRZA 4KO3S 1WSWA 4M60A 3FU3A 1YF3A 2BM8A 3AR6A 2M1XA 3LXXA 3HKCA 4I46A 2BDUA 2H3HA 3WRWA 2DT5A 1ZIYA 3Q4GA 3SAJA 2A3NA 2AXPA 3ULYA 3ME5A 3DMGA 4J8DA 2MU1A 1Y6FA 3Q78A 3JVUA 3A6ZA 4Z8XA 4NE9A 4O5OA 2WSLA 2XPCA 4G9BA 2PQRA 2B7CA 4OLBA 4ZOLF 3F47A 1E6CA 3FMPB 4MW7A 3AP1A 5CCMA 4EFKA 2JK0A 3ITEA 1WAMA 4RLQA 1WQ3A 1M2WA 3WGMA 2FHSA 2NZVG 3HBLA 5KSWB 4YAOA 4R1LA 1OVMA 3H6HA 4XD7D 4BFRA 3S7JA 3R3SA 3UT4A 3FDZA 1P72A 4R8MA 3ZNOA 2D1RA 3BSSA 1QTIA 1R6VA 4OM8A 4K6GA 1FTGA 4D0RA 4ZICA 4KN5A 1CF9A 1T5IA 1U7UA 3CLRC 2XXBA 2EG5A 5DLYA 1J2EA 3RS7A 4C4PA 4IKOA 1YRAA 4XVHA 5IMSA 2P11A 1N2CA 4YJKA 5LIPA 4JUCA 1Y5NA 1YE5A 3K70B 1TM2A 4CLEA 3J5QB 2YJ6A 5LP6C 1I4WA 1Z6GA 2EQ5A 4ZO7A 5IJ9B 2ACWA 5AOCA 1ZVKA 3E7XA 1GN9A 1F2UB 3IVRA 4NENB 1CYEA 7MHTA 5K8LA 3GCDA 4NV1A 3RS0A 4J6IA 3LA6A 1U8FO 4PHCA 2FZCA 2XOKA 4TTJA 3KQWA 1RR6A 3I09A 3GA5A 2CJXA 4ALMA 4OM7A 4N47A 3HA5A 1GSIA 1ENPA 1CVRA 4F3YA 2WHEA 1WHSA 1IZ7A 1VL6A 5ALJA 5MGBA 2NTYC 1K8RA 3PRKE 2QU7A 3Q7AA 4AY2A 2AYXA 2GFQA 3B60A 1U0OC 1MHTA 1H2VC 5HW0A 2BIFA 2BKGA 1LPPA 2JCVA 3H9JA 3LDUA 3TRDA 3NAMA 1LDYA 2IYWA 1H6PA 1NJSA 3YASA 3UMJA 5I45A 4N6OA 1YZ3A 4LZOA 5JISA 2LKCA 4KUGA 2A0FA 1TW2A 1ZP6A 3ZPJA 1P73A 1UOQA 4BVKA 5KJLA 4KIFA 3V4ZA 3UGKA 2JHAA 1KSGA 2RK3A 2CXRA 2VTBB 3AF1A 1UPUA 3AY3A 5BR8B 4B4VA 4YO8A 3O3CA 4HK4A 2C04A 3A1VA 1M6VA 4C5BA 4INZA 1PE0A 3KAEA 1KBZA 1P91A 5IG2A 4XD2A 3UPUA 1TJCA 3JQBA 3MRXA 4YRAA 2FPSA 3AL2A 4TLDA 2BFBA 3B7RL 2WSIA 4AKTA 2VKTA 2ECKA 2H4WA 1KI9A 4U96D 4BNZA 4G1MB 1U28A 2ZYAA 4OA8A 1H2ZA 2YINC 4MK4A 3VKHA 1OAKA 4JJEA 2EGHA 3V42A 3OT5A 4RKFA 3OMXA 3QEKA 3C8DA 3ZE6A 4EHNA 1NUPA 2R5WA 2ZYDA 3ROMA 1TM1E 2DVWA 4O2LA 2VZ9A 5EUMA 4HBDA 1RJGA 1X1CA 4X54A 4U7DA 2X15A 2XZTA 1B26A 1E9VA 3QFCA 2YR0A 5FQ7A 2FPGA 3DOIA 3HR7A 4K2HA 1LFAA 1RI5A 3RJZA 1HLDA 1M34B 2J48A 3ESCA 1QZTA 4R1QA 1MJFA 4DHWA 2NP7A 2ID4A 4C3VA 3HEMA 1HDZA 1UQUA 3BZBA 1HE5A 3W05A 5LZ2A 4RK7A 4BO0A 4R8RA 4YV1A 1P1RA 1J25A 1B8VA 4GOXA 2G04A 3OCXA 1FFYA 4MYTA 1IMOA 1L8AA 1ZOPA 3S2SA 1GTSA 4MKGA 5JNTA 1T4CA 2I66A 1ONOA 3CQGB 3TOCA 4AUNA 4A63B 1FCHA 4KE7A 4O60A 4MPTA 1SURA 4I4LA 4Y67A 3SNKA 3UKRG 1Q7GA 1XG5A 3SHWA 5BXYA 1FE8A 4TWZA 2Y1DA 1I36A 4L9SA 3LRTA 1KMHA 2VPTA 3R44A 3HXCA 2YW2A 4M2LA 2B4TO 4TXNA 3K73O 2RE8A 4N1AA 4OX9B 1D1PA 5H3LA 3SJCA 5FA6A 4XYMA 1GRCA 4X3OA 2XQVA 3A36A 3B7PA 1JQ3A 3DE7X 3TUJC 3N8KA 4M99A 4RDHA 5C2YA 4GPAA 4C2AA 5JTUA 1VL8A 3EGCA 1P5ZB 4WVLA 3CPSA 3KO8A 2OYCA 1C9KA 2A9OA 2FNAA 4TVKA 3A7DA 3OZEA 1LLUA 1Z0IA 4EIWA 2ZAGA 3TQQA 1E98A 3T3OA 4YRNA 5JZMA 4B93B 3IBGA 1MXFA 2C5HA 1QZXA 3X1KA 4IH1A 1KOFA 2PBFA 1SVLA 2B6NA 1KVSA 4PZYA 1MDFA 1TMGE 3WDLA 3OQHA 1RXIA 5FRDA 5IT4A 3IUNA 3DC2A 1SCQA 3GBSA 1TVEA 1NULA 3FTXA 4BSZB 2RSLA 1DBPA 4F06A 3DW1X 1I13A 1PTKA 1MW9X 4ZYXA 2NG1A 5ED0A 3RFVA 1JNXX 3WFZA 4G5OA 1YK0A 3USZA 4JW1A 2ZUTA 1YL5A 4RCYA 1U1DA 3H2SA 4CMIB 3FTVA 1K3FA 3Q0TA 5EJEA 1QKJA 1ZRHA 4TWJA 4FONA 1TT5B 2QYJA 5B12A 4Y98A 4Z4CA 3LVRE 5B6PA 1C80A 4KO2S 1R88A 5KJKA 1PJZA 4K0KB 1I32A 1XWFA 2PQ2A 3PUVA 1D1QA 5JC1A 1AKTA 1YTUA 3ZIDA 1L9XA 4C89A 5EYPF 4LNAA 2GN8A 5IJ9A 1H4VB 4BNIA 5KKCA 1FT1A 5A9RA 1F2UA 2Q0SA 2J46A 2C92A 2HXSA 3A06A 3LUCA 3NRCA 4O1HA 1DJNA 2PH5A 3ZTYA 3WKAA 4I17A 3MJEA 4FDAA 1K6XA 2ZBUA 4UHCA 4U0KA 4L4YA 3ICQB 2O1SA 2NO7A 5YASA 3FUCA 1E2DA 1TGVA 4IYJA 3HXLA 1ZJ5A 2J6IA 3ZW7A 1T5BA 5DX1A 4FNMA 4M7PA 3DWFA 2J9ZB 3ZX4A 3QDNA 1SXJB 1HSZA 1E2KA 2O8NA 2C2XA 4TV9A 5BSEA 2DYKA 1EFAA 4PDXA 2X0FA 1YQGA 3APDA 3KZMA 3U13A 4P3KA 2B7LA 4RV9A 2FJ0A 3A6LA 1XMIA 4MXDA 2Y92A 2VJBA 5K6AA 1VQ1A 2QT1A 1YJ5A 5SYAA 2XZTG 4QJIA 1YZQA 3PZ3A 3G2LA 5THQA 3Q47B 2Y1LE 4IWNA 3D54D 1RXSA 2OBNA 5E8JA 5K3SA 4AIIA 1Q1AA 1NW4A 4C7KA 4R9NA 3OEEA 2X6IA 1TYBE 3WL4A 3ZLTA 4LFBB 3SQDA 5L4LA 2OO7A 5EIBD 4OLAA 2YZNA 5LWQA 4G97A 4HLUC 3ZDEA 3MHTA 1DFGA 4B7XA 1MW8X 1W35A 5EKQD 1QH1B 3T8YA 2AFIE 3ZWQA 3GRCA 1ULZA 1T5DX 2BELA 3L7NA 3JV7A 5KNLA 1VXRA 2XQKA 2ZYTX 4C4AA 4RY9A 2VP2A 3RYFB 1FW6A 5G3ZA 1JFFB 3OJWA 1FDIA 1D0IA 1PT7A 2JDID 1M34A 3P0EA 1XDBA 5HKLA 2XRMA 4J0IA 3AK4A 4BBAA 2VL7A 4UNNA 2I76A 4FS8A 2P9YA 1ULAA 3TL3A 5EP2A 1JHVA 3WYBA 1RVDA 1WTAA 5EMHA 2WPVA 5FBQB 4HJRA 3Q8LA 1E9RA 1UP4A 1U90A 3JQ7A 1GITA 2CDCA 4Y9SA 4YROA 1JYFA 4L4SA 3QNUA 5HXAA 3S7BA 2F59A 4L15A 1O0CA 4H6VA 3J80A 3O4GA 5ITVA 2PX2A 1QIIA 3H3JA 4FFOA 3RUAA 2YXEA 4F60A 4LJ8A 5CFNA 1XYGA 2EINE 4Q12A 4DLYA 4PZ9A 1W2HA 3E9YA 5KVCA 3QENA 1CR6A 1YE3A 3FZQA 3ZE2B 3KKZA 4LY9A 2ZCVA 1EK0A 1W581 2YXPX 2GW1A 4Y2XA 1BC5A 2XOKD 3HLYA 4EG5A 5JS2A 2G71A 2Y1WA 1J24A 4GOJA 1XEFA 2AB0A 1WR8A 1SCIA 1IHDA 5LZ8A 3HO1A 4EYOA 3I2JA 3PPWA 1KGSA 4XVQA 1DC5A 3OI7A 4F53A 4PCUA 1KRWA 3THWB 3L0ZA 2O2YA 1PDWA 3N8DA 4Q3NA 4WNYA 3ADCA 3MWGA 3OPQA 1FDRA 5C80A 1A7JA 4G26A 5EXDA 2FEOA 1C81A 3PQ7A 4V3BA 5JNRA 4QARA 3ESBA 4D8UA 1J8VA 4H0CA 3PRHA 1UDRA 4IXNA 1MAAA 2JRLA 4QEZA 2B0JA 3OKAA 3TRKA 2VQEB 1HDYA 2XXJA 4EYEA 5KTPA 4J0QA 3EMBA 1N1GA 3DMDA 4F7AA 1NNUA 4I0WB 1OH6A 2H1HA 4OCZA 1EUQA 3CC8A 1VG1A 2DWPA 2JJQA 2OZVA 3D2BA 2YHAA 1KNQA 1EZZA 3LUBA 3C45A 1KT0A 5EJIA 4JWKA 4AJ4A 2I2AA 3P0HA 4D6PA 1EXMA 4CMIA 5HRUA 3RANA 3HYLA 4RSYA 1S2OA 2W42A 4M7RA 1OXBB 1T91A 2FPXA 5EINA 4JBWA 2CXPA 2EF0A 3M0EA 2OQ2A 1ZCAA 1A4XA 3N7TA 3SYRA 4J76A 5ADUS 4RHUA 3A2MA 2QS9A 5ICCA 3HUTA 4Z54A 5CB0A 1CRWG 5BW6B 3IUBA 2XKKA 4PX2A 1G3IA 2H8GA 1KVTA 1WW8A 4KIJA 1RW4A 3FSGD 1ZXXA 2O20A 1G19A 2PYDA 1U31A 4DRZA 4YYZA 3PFBA 5CJJA 3CVJA 4X94A 3AR2A 3F9CA 2Q46A 5LZ4A 4EHBA 1TGYA 1B41A 1GT6A 4U2GA 2Y93A 3PFGA 3LFHA 1MCZA 1X92A 4MICA 1NT2A 4JA9A 3OBIA 1BJRE 4HQFA 2ZCUA 5C35A 3JYNA 4WNGA 1SXJA 1PQWA 1G8HA 2PEZA 3DP9A 3NYWA 4OK5A 5HHTA 1K68A 1LVUA 2W8ZA 3M3PA 2P1ZA 3AGPA 1CR2A 1RRCA 2F3RA 3DFFA 1Z5PA 4MUHA 4AJ2A 5C8XA 1WF6A 1KSHA 2A5JA 1E2IA 3E9MA 1S70B 3DEPA 3KQYA 1Z8FA 1CIPA 2IQCA 4PFQA 1SY7A 3ZWOA 5L8VA 3MIZA 4CIXA 1T2EA 3ZDYB 3GLKA 2R5NA 4X64B 1MT3A 3UCXA 1JLMA 4ILGA 4EQFA 5FNVF 4FB5A 4MCHA 2OEPA 3CT4A 3ZV7A 3FWHA 1QYCA 3Q10A 1A9PA 4OF4A 4IFBA 2N47A 1RM4A 1RYEA 1VYTA 1R0BA 1OXJA 3KZ1E 3AWIA 4PQFA 4JI6B 5KNCH 2JEZA 5JCOA 3W0LB 2FWPA 3Q8MA 3GW4A 1XDSA 2XV1A 1MV8A 1P1FA 1M1NB 2C42A 3I04A 4EQZA 4ZCPA 2QT0A 2O5VA 2VHTA 1F0YA 3A14A 1OCEA 1UK6A 4QTXA 2ZYRA 5HG0A 1HFEL 3WV5A 2MSDB 1JFFA 3ENVA 3QKYA 1Z28A 2Y2VA 1DG9A 5AKYA 1U2RA 4LZJA 1JPJA 4FLFA 1UXGA 1SC4A 1WZ2A 1JEYB 2OCKA 4BZQA 2HN9A 2RKWA 5AKZA 3IHVA 3LNCA 1USKA 3Q1KA 4A3SA 4UZFA 3ND7A 3JRXA 3HXTA 2FOIA 3RV3A 3VDRA 4UTOA 2PUBA 2LW7A 4IS3A 4B71A 1JDPA 1I3OA 2RIRA 2RCNA 2DULA 2C8KA 3U4GA 2WYVA 5ALDA 3BM5A 1I2AA 2OXRA 5ABPA 1E9CA 3DWIA 1T2FA 5K51A 3RSZA 3EPRA 3W3AA 4BBZA 2BKLA 4ZALA 2JGLA 2V5VA 1KQOA 2F3SA 3SP1A 4N5DA 4KRYA 4GLFA 3RFUA 2GSWA 3HCWA 1XJCA 4UQZA 5E0KB 1B93A 1N9ZA 3W78A 4H3VA 3A1FA 4FWTA 2QX8A 2IOHA 5C7IO 3KFXA 1XVTA 1SVOA 4M0KA 5CNKA 3ULKA 4KZCA 3RIXA 4EELA 4E1VA 4JXZA 3WVNA 3L16A 1KFBB 2QPOA 3KETA 4KQ1A 3QLUC 4X93A 4EKGA 4JMLA 3E27A 4LBYA 1CR0A 4I4TF 2H31A 4NK5A 3ZWWA 3R7QA 3DZDA 4GPEA 1F8UA 4JC5A 1A7UA 3BGWA 4Y6PA 1GCOA 1WWKA 1QV7A 1K97A 2NQ2C 3QVUA 5HF9A 3ELDA 4KR6A 4KMMA 4B8YA 1IMJA 5D1HA 4IIJB 1Z2NX 1YZYA 3THWA 1N0QA 4ZOLA 3FUVA 2PGNA 1FS5A 5L3QB 4OI1A 3KEMA 3ABLE 3B13B 1O95C 1ZA2A 1UM9B 5KNBA 3I30X 3V4PB 3X1MA 1JDSA 4ESVA 3D9NA 3I8XA 3MGBA 1QGUB 1AQLA 2WYOA 2Z1NA 2BYTA 5THXA 4J0CA 4YDRA 2UXBB 2AMJA 1JI0A 2VYIA 4WZBB 4P31A 3WBKA 5IH3A 2OWDA 1N8TA 1H2RS 4HTFB 4N8DA 1U7DA 1JEOA 4G5XA 1P4SA 3GUZA 1RE0A 1YR3A 2HT1A 2PQ0A 4GZLA 4FE3A 3SJAA 4P4SB 2AN9A 3GEDA 4KLCA 1P18A 1K6EA 3IUMA 1D6NA 1KRHA 1E2JA 3QYPA 3F5SA 3N3BC 2N0SA 2P6UA 2HADA 4MUMA 3DZIA 1XL0A 1Z13A 4QFDA 5M5BA 3KB6A 5E95A 2O7RA 1YB5A 3VZCA 4N82A 2EW8A 2Y66A 1MOPA 1KYZA 3T5CA 1JX6A 1QF9A 5BN4B 3RYTC 2N1MA 2R85A 4FIZA 1JH8A 3F74A 1IM8A 3TTTA 4NOMA 4ND7A 4IV5A 3UAWA 3D7NA 4ZJZA 3KTFA 3DBVO 1ZC3A 5J2TF 1VLQA 1OA1A 3RCBA 4Q7KA 2EEPA 4ALIA 2EDCA 1ZNQO 3G6WA 4FP9A 2OCXA 4WKBA 3ENWA 4AJLA 2Y4UA 4Y1GA 4HVLA 3L9TA 3UJBA 4MLPA 3N7AA 1Y5MA 2A33A 1MX5A 5FX2A 3CWQA 1KK3A 3LG2A 4AKIA 4UTVA 1BMTA 4BNUA 4XVUA 4MP6A 3GC6A 2QPTA 4D8YA 4Y0VA 1QGAA 3RR2A 1OYWA 1HA3A 2X4IA 1Q5PA 1HOTA 5EN4A 5LQJA 1SWWA 2E55A 2QPAA 3GRFA 2L0IA 2V3WA 4KQXA 4YWJA 4ARZA 1GAJA 2ZRCA 4Q4JB 4K7JA 4BZPA 1XZLA 1EAYA 1MAWA 5BWLA 5JMWA 3ZHUA 3I92A 3IJ5A 1ZITA 2X8LA 1RC1A 3MBOA 1KL7A 2Q4OA 3WADA 2Z3VA 4QBIA 4K9RA 4I1OB 3I2IA 2W6IA 1JE0A 3R40A 2YIJA 3UJNA 1GYQA 2CVFA 1WD7A 4B40A 3EFOB 4A26A 2EQXA 2ILVA 3LJ3A 3I52A 3MC1A 1BHSA 4JNKA 3OZRA 4BU0A 4UM5A 1H1LB 2HOQA 4LDJA 3L2OB 2DZDA 1CUWA 4C5CA 4BO5A 1M1NA 3I0NA 1V5IA 1U0FA 3A7EA 1PT5A 4DSTA 3WOVA 2Q2NA 2QVGA 3CA8A 5K7SA 4ZYLA 5CA1F 3M6LA 1WETA 1NN1A 2VJOA 1YL7A 5H3CA 4WKCA 4KWCA 3D1LA 4WFIA 4R7TA 4XW2A 1RHUA 1VKRA 4DEXA 4UUOA 3NZEA 3DEZA 4PR3A 1ISPA 2OO5C 1T8SA 2CL6X 1AS3A 1J2TA 4JGGA 4P82A 4PS8A 2IYSA 4IBOA 1IWPB 1MVLA 2ZRBA 4U2FA 3V8NA 1GUDA 4QDXA 4R2IA 2RH4A 3W1EA 3PEYA 1M75A 3VA7A 1JR3E 1UXIA 3CF4A 3HU5A 1I3LA 3Q3GE 4HL6A 4MA4A 3K71B 4GWKA 3UIOC 2Y27A 3SZ3A 1NAHA 4M88A 3TLJA 3CLUD 3A1EA 3V4LA 3OQVA 3KOOA 2NZWA 1Z0UA 4H7KA 4EHLA 1T25A 1DIRA 3BICA 4WGGA 4D4IA 1II8B 1EDUA 4URXR 3RW9A 1H2BA 3R5HA 4GNKA 3GUUA 3CW9A 2QVZX 2H9AA 2Q5OA 3S5UA 3V1KA 2CV0A 4EZKA 3Q40A 3U3RA 2PQ6A 3UAVA 3LQFA 2FFJA 1W36D 3HC7A 4CGYA 5KWJA 1R0CA 1VPEA 2JFQA 4KZPA 3M70A 4GRDA 3PUJA 1ODIA 3ZUPA 1WAO1 1GFZA 1CQXA 1VE6A 4CF7A 2OG2A 1WXDA 1Q1QA 3C5RA 1WOYA 3QE0A 1SXJD 4XSGA 4EMUA 3A26A 5L3QA 1TU0A 3B13A 2IP4A 1M3SA 1L8LA 1UM9A 2O2XA 1SZPA 2AJLI 1OAOA 4PINA 1GZ5A 1W4RA 1K2WA 1HNXB 4QXAA 2G9UA 1K8ZB 2DC1A 4EG0A 1QGUA 2P40A 4O08A 5EE5B 5JXHA 4IOJA 1XLTA 1T6NA 4YVFA 4ARBA 4DWVA 4ZAFA 2DVMA 2XYGA 4WZBA 2BJWA 3DMTA 1KAMA 3OT1B 3CVLA 1IHOA 4HTFA 3AKEA 4E5SA 3FU0A 4D0NA 4JX8A 3SC3A 4O2AB 1GA4A 5CX1B 5JW6A 4P4SA 4JJGA 2C5AA 3OIWA 4WZAB 2GPJA 3RUIA 2D5AA 5JRJA 2WILA 4YAFA 1GNTA 2AQIA 1PVVA 3CK9A 3MRSA 4TMXA 3AV0B 3W2EA 1I4TD 2PMCA 1FBNA 3GPBA 4CUJA 1IDOA 1Q0SA 3KQNA 2GPNA 3GZ1A 1ADYA 2A14A 5C53B 4DUIA 5JJLA 1RZ3A 2IZ7A 1L1FA 2CEAA 1UKEA 4MINA 4U0SA 2ZJ3A 4O2BB 4UJ5A 5BN4A 2BHNA 1XJWA 4A1GA 4MW0A 3JPWA 4J16C 2I6SA 1TOAA 4H4DA 4EK9A 2NO6A 3CRMA 5HCIA 3HZZA 4GLLA 3OTGA 4OMCA 1P2UA 4RZ2A 3ZDXB 1H0AA 1D2RA 3D9KA 3DAOA 2Q7FA 4FULA 4H7IA 1NPYA 3K09C 4QD3A 3ZCXA 2IEBA 1V9LA 1N25A 3P2JA 4PPNA 2FSSA 1T9ZA 2C2YA 4B8CB 5TT1A 1W3BA 2V8OA 4NQZA 1AKQA 2IO2C 4AI6A 4BQOA 3MLAA 3FYCA 3W3AD 3NC0C 2IF4A 5T4FA 5C5IA 4RTMA 2IW3A 4BDSA 4PCLA 3FH8A 3T5AA 2VF4X 4FC8A 2GAJA 1PHPA 1BXRB 2ZRNA 4EX7A 4PLCA 2RFLA 4Q4JA 3MMZA 1LSSA 3EHNA 3A31A 5AOAA 1YBMA 3TCXB 3RBVA 5CM2Z 1IY9A 2FZVA 4G5SA 3HKBB 3E30A 2OOSA 1TYZA 5FTWA 1TIBA 2I9PA 3TIFA 2LCFA 4QQFA 3WLOA 3DL7A 2C0MA 3FPGA 2ETCA 1MPTA 4HI8A 4OG2A 3VHXB 2P4QA 3IEPA 3B1XA 4U39A 3AM3A 3IEXA 2PWZA 3AUSA 1NVMB 3L46A 2Y3IA 1N6KA 2F1JA 2RHJA 4Z68A 4F84A 3WL7A 4JGBA 3AUAA 4YCBA 3OICA 4IWYA 3MELA 3SM9A 2FZGA 1R9NA 5CLJA 5KNBD 1S64A 3UHFA 1A95A 1XN4A 3IP3A 5B58T 3B95A 2XWJI 1BVYF 4FYPA 1P61B 2M1ZA 2W2KB 4NCBA 1UJBA 2HX1A 5AUQA 5ESWA 1XNHA 2ERXA 6AT1A 4O4LF 3CF0A 4X3PA 1EWYA 4GT1A 3BB3A 3Q9SA 4MWBA 1EI9A 2A30A 2NAPA 4E46A 4TQAA 4EGSA 3QJYA 1ZQ9A 4CNQA 1YK1A 2NO9A 4P0PB 5JA4D 3MUOA 1NNI1 3WWDA 4HXEB 1F6WA 1KEWA 1KEKA 1SCNE 1GA1A 2YY6A 4MO9A 1GCUA 3R3VA 1L7AA 1SBIA 3BWVA 4B2PA 3DAFA 2W6PA 5F4BA 3PUZA 1N8SA 2BKUA 2GZDA 1W6UA 1EZ1A 3IHTA 3VPHA 2HHAA 3VKGA 3A37A 1M72A 1V5GA 2GVNA 5HKPA 5FBVB 4B34A 3ZYQA 1ZKMA 2ZIZA 4D8WA 3IAM6 3ODPA 2OCDA 3HCOA 3KFLA 4QHTA 4DLRA 3JCZA 1TQ6A 2KZTB 4QFVA 3OLCX 4GM4A 2G4VA 1EBFA 1PLKA 5A23A 1ZK3A 2QNRA 1C7JA 2W37A 3AM1A 4L0MA 3VR2A 4BNMA 1JHQA 4LS3A 4H3SA 2VP0A 4GMFA 1CZKA 2QJOA 5LXTF 4ZT7A 1QRDA 2XUZA 1RP1A 4B85A 2GJAA 2WYWA 2VBCA 3MB5A 4WY2A 4WLUA 4LDZA 2RFAA 1JG4A 3G9TA 2QN7A 2ZRFA 3ROPA 5HIKA 1BNCA 3OIFA 3UMSA 4DZZA 1DJMA 1P77A 4E09A 3R7NA 1EUZA 4WL0A 1OY1A 4C22A 2BFAA 1W34A 5KWEA 3GUHA 2DOKA 3AHCA 3Q8WA 1VRWA 3GMSA 2ZI4A 3E15A 2HGZA 4AG3A 3DBHB 4DCMA 1EFVB 1DC4A 3A3YA 4DWJA 3R6WA 4BRWA 3M1YA 4QL3A 3SZUA 2K4MA 3OT1A 2V4ZA 3PNYA 4UATA 5T64A 2R6ZA 5JBIA 1TZCA 3H2HA 1FFGA 5JSUA 3DFIA 4U7TB 4O2AA 5CX1A 4D25A 4IQGA 1B73A 2IPNA 4NBLA 2W6ID 4WZAA 3L43A 3CRW1 3VNBA 4O8CA 5AVSA 4DKXA 4Y1EA 1OD6A 3U44B 4OVVA 2FVYA 4X41A 4DUYB 2P6RA 2P7IA 4E5VA 2AEEA 4ILIA 2QA5A 4O2BA 2VDWB 3P9ZA 4G0YA 1THMA 1QAQA 5K0EA 5HUQA 4XUDA 3DD1A 4X7BA 1G21B 5MN6A 3B9PA 3CH7A 3BQNB 5DYGA 4EA6A 3AV3A 3I2GA 3DSVA 3MMXA 4MRMB 3REOA 5EI5A 3B1FA 2VPPA 9ABPA 3HB5X 5JPCA 2TSYB 4JROA 2O2GA 1JCRA 2XJ4A 1JG2A 3CLSD 1Z5WA 3DDUA 3BN3A 2EFHB 4M22A 3QWBA 2WM9A 2XBLA 1NXXA 2CLCX 1EVEA 1DEHA 2XBMA 2HIGA 3NWBA 5AIJA 2H2WA 1Z2OX 4UUMA 3DMRA 3RG2A 2HNAA 3X2EA 3E9NA 1AQIA 4UUBA 2O0MA 3JVVA 3O8NA 3JQQA 1ZNZA 2ZRLA 4UU8A 3H6KA 4XX1A 1BXRA 4M1SA 4GTMA 4L8LA 2ZAYA 1TO2E 1E1LA 4LERA 1EDDA 4MQUA 4NEHB 5EPEA 4RO0A 4YI5A 3DVSX 3IP7A 3PXBA 2B8JA 3CRQA 3HKBA 3EEYA 3HE3A 4G67A 4MSUA 4JH0A 4X1IB 1C3EA 3E6AA 1JBKA 3JYQA 1HQYE 1A9QA 3MPUA 3VHXA 2C59A 2YHUA 4LBZA 1RKVA 4KRFA 1RJFA 3IAM1 3LBYA 3VHRA 1VGQA 4Y6QA 3TZEA 4B6QA 3HYMB 3AHHA 1SUPA 4Q9DA 1NXOA 4AK9A 4ZA2A 1LNZA 3RIYA 2R97A 1RYFA 2RJNA 4DSNA 2LBPA 4Q37A 3T5GA 4F7DA 2Q3MA 3ELWA 4K26A 1JLHA 1X15A 5JS6A 4GTOA 1YQ9A 2W2KA 1AKRA 2X0JA 3CO5A 4EUFA 1J23A 4M1QA 1A04A 4GSLA 1KMHB 4JLUA 2ALJA 1Y1QA 2XR1A 5F12A 1YJXA 4ONEA 3DHEA 3IKLA 4ARAA 1SQ0A 4DA9A 1CE8B 1UZUA 4DMLA 3GJYA 3UC5A 2VQFB 1P7ZA 4GXRA 4EHIA 3MAAC 4YX9A 3WMWA 4PHFA 3KUCA 4PC2A 3SXPA 5CLFA 2D7JA 1PTJA 2GQ0A 3LO5A 3K9QO 5HUJA 2ZJFA 4REQB 4OQXA 3STVA 4XAQA 2JIDA 2MYPA 2C00A 5EHQA 3FGZA 2P67A 2H9IA 2ORYA 3IFSA 1ML4A 5G1NA 1HGXA 4PONA 1IHYA 4OYSA 5BVGB 4M9CA 2FX5A 4HS4A 4HWKA 1O94C 3MWDB 5CCBA 4BL5A 4GX0A 1YRQA 2KZTA 2CUZA 4U9IS 4MP8A 2A5DA 1Q0ZA 2JDIA 1PFWA 1N5JA 5CLHA 4EAQA 1BLXB 2FSIA 2BM9A 3U81A 1L7RA 5AI6A 2H5IA 2E18A 1M5TA 4RGBA 5AUNB 2Y67A 3VPCA 3DOHA 3MS7A 1MO6A 4CM6A 3ONFA 4NFSA 3PIIA 2BCEA 4G3XA 4K9PA 3NXSA 4KLAA 3G9QA 2X4DA 1L7DA 1Z2AA 1QCYA 2F3PA 2WU0A 2OKCA 3AS5A 4FSXA 3P1UA 1C3XA 4AUEA 2ZUFA 4GF5A 2G9ZA 3O1IC 1M54A 1BE1A 4R0VA 2VTKA 4D9KA 4I5IA 5K5EA 2DE0X 2OFXA 2IQ5A 3GEHA 3PXEA 1J49A 1NR5A 3LTEA 4NYJR 2Z2IA 1WSAA 3DRAA 3HG7A 2XENA 1XMXA 5BV2P 3KQKA 1GDHA 4NU6A 4MI1A 3DBHA 2OMKA 2BF4A 1EFVA 2H57A 3SNHA 3WRXA 1QIDA 1KJQA 5J4YA 3DXFA 3CYFA 3RFTA 4NQ0A 2PCLA 4FC7A 1LVGA 5FZQA 2IYPA 4B5KA 1IPEA 3E7DA 4TSFA 3M49A 4LQ4A 4KBFA 1FNSA 3HCNA 3LIPA 4PXSA 2RAUA 1E0DA 4EZEA 3BMCB 3GGPA 1ECPA 1KDOA 3L6BA 3OG9A 1MX6A 3B5IA 3U44A 4TV9B 4RLYA 4JC4A 1VJDA 4G0ZA 3EFHA 2GBIA 5FJIA 3TAUA 2HK8A 1IXYA 3JW8A 3H13A 3U17A 3QPDA 2VDWA 2AW5A 4GRAA 3D9JA 3I6ZA 1R8SA 5J2TA 3NBQA 3FTUA 1ECBA 4L5YA 2FX2A 1G21A 1UWVA 3FTFA 3HDGA 4C07A 1F6DA 3IVCA 2AZTA 1JIKA 3CPHA 4MRMA 2HBQA 2UUAB 3OZTA 3ESRA 1E8DA 3H8WA 1NUHA 3DV0B 2BFWA 2Y9PB 1HF3A 1JILA 4AMGA 2RHBA 1I7DA 2DTXA 2QTWB 3PKIA 4ZGBA 1YVPA 3PSHA 2WWXA 2FQ1A 3EIUA 3P20A 3DVLA 3OTIA 3MOGA 2E1RA 1A2OA 2W8BB 1TF2A 2JI9A 2AF3C 4Y6OA 3GZNA 3TJRA 2BC9A 5J4LA 3DE0X 3AJEA 4RA6B 3O4FA 4LYYA 4KTVE 1Y33E 1JPUA 5AARA 1VI6A 2EZ4A 1Z75A 3BHNA 3GK3A 4GOOD 4Q1FA 2V65A 3LS8A 2JLSA 3FSGA 4Q9NA 4X1IA 3KNZA 1G5PA 3AQ4A 5JDIC 2EFDB 3GFTA 5E9QA 3KZCA 1J9ZA 4GBMA 3VR2D 4B74A 3QLTA 3RVDA 3H2YA 2B34A 3TSZA 1B6RA 4R71A 1VIAA 2EC5A 3QM1A 2OBXA 2CLIB 2J08A 3MOSA 2RBGA 3UUXA 3S2YA 4W5JA 3LUHA 2X6KA 4MQMA 3LY5A 3JQ7B 4FGUA 7GPBA 1T0IA 4HLLA 1R4AA 1K1AA 1V8DA 2RGBA 2NN3C 4KDRA 3BGSA 2C7RA 4NY1A 2PKYX 3GZ4A 1JTFA 2WXNA 3PLNA 3L0YA 5AJYA 2LPMA 3L1IA 2O8CB 1VOTA 4Y1RB 4IX9A 5EMNA 1HNNA 2IU0A 4U95D 2X58A 1QWSA 1UJMA 4Z4EA 2XSZA 3ONWA 4CFYA 2QVLA 2TMDA 4DV7B 1JMKC 4LQLA 5CEAA 1HYGA 1CE8A 5F78A 2OAQ1 2YWJA 5IJAA 3LPCA 2UYOA 2HCFA 3OFNA 1G8SA 4DLTA 2A5GA 4DCCA 2XCBA 3R5FA 1EU1A 2EW2A 3FMGA 1JUQA 3ILHA 4N5HX 3ER9A 4G84A 2NU6B 4NLLA 4HSEA 2QRQA 5FUVA 3M6IA 4K5BA 3CK8A 3D1JA 1N2GA 3TFWA 4R2JA 1RMQA 1WDTA 4REQA 2GPAA 3G5LA 3OCCA 5A9SB 1NVTA 1AP7A 2VCYA 1EEXB 2A1UB 3FUEA 2ODAA 2J09A 4YQYA 1QYIA 1G20E 2PFGA 3KRTA 3ZGVA 2G7ZA 5BVGA 3MWDA 3CVVA 1KS2A 2FE1A 4GG1A 1GY8A 5L9AA 1OLUB 4LF6B 2V8BA 3KLMX 5KJEA 4PR0A 1A8IA 2H4ZA 4UHHA 4WXPA 4G24A 1FNCA 4P1ZA 4UU7A 2WY2D 5BR4A 3UIPC 4PLPA 5IKMA 1FVHA 1SN7A 4ZV4A 2WQHA 4F4CA 4CT5A 3AL3A 1RHQA 3ILVA 4DLVA 1DL5A 3V1YA 4JI3B 2BKXA 1LFDB 4JVMA 4N5QA 2OSVA 4P8RA 2FPPB 1UKCA 4H7YA 4F5WA 1B16A 3SYKA 1LD7A 1XVVA 3C4QA 3JTEA 4UUCA 4OOFA 1WZIA 3L0IB 4IOLA 1IVSA 1QAOA 3OHMA 3WMFA 1U3TA 3ROGA 2CL5A 2O2IA 4B3SB 1JH9A 1I0IA 1P9LA 4MWTA 2A7QA 4FMCB 2O7SA 3CCFA 3DTTA 3EGIA 4HAIA 4TT3D 4LISA 4Z7OB 1P44A 4ZEWA 3VX4A 4KXLA 3OO1A 3H17A 1TKCA 5C7YA 3BRWD 5BN1A 2EOAA 4PZUA 4K9DA 5DHAA 2XUGA 5TGTA 4DSOA 2E48A 1W36B 2VJ8A 4W5WA 1TRHA 1CDZA 4TX1A 1VE3A 1HL3A 5T5QA 4HWGA 4DQVA 4ER0A 3EIQA 3BMCA 1QFXA 5DI3B 4RV4A 3EAFA 3MJCA 4AJJA 1BA2A 3UTCA 5LMCA 1V4NA 5TMDA 1OBFO 2O57A 5JZBA 4FZ5A 4MVJA 2G40A 4I4IA 1A9SA 4H0FA 1MTOA 4X65B 3IJRA 2JZCA 5FR1A 3D3WB 4TKZA 1Z2DA 3M6FA 5E1DA 5AUOB 4MUEA 3MRVA 3C72A 2BKKB 2CLLB 5EQTA 2R8PA 1JAXA 4L51A 4WESA 3Q3HA 3GB9A 5K05A 3W79A 2W9XA 1QS0B 1T9AA 3AFGA 1RCUA 3V34A 4U1RA 3DPDA 1ZBPA 2C95A 4MJLA 3CS3A 3CNNA 4I8IA 1L7PA 2XB6A 3CQCB 1AKUA 2V1UA 2DBYA 1R9GA 2GCPA 3AEXA 3DV0A 1CHNA 4R01A 5KQGA 1ICIA 3EA4A 2VDKB 1KH1A 3KYDB 3GI1A 2X6FA 3HVHA 1QFYA 4OH1A 3LF1A 3A4MA 4PAMA 2GN1A 2Q8PA 3SS7X 4W9RA 1NBAA 2WNIA 2R7NA 1TK3A 1YGPA 4W4TA 5LX8A 2RGUA 2W8BA 3E3MA 1UEXC 1GZ7A 2O05A 4GRIA 4IDQA 1LK5A 4K2AA 4N7MA 4RCZA 1YR6A 4RA6A 1T6ZA 2VI5A 3GVIA 2PZLA 3B70A 2VLBA 1NBME 5EPUA 1JV2B 3B2EA 3BU8A 4JL6A 2QQ5A 3JX9A 3E8MA 1E0SA 1KJ9A 4DQKA 5F7OA 3IRVA 2R02A 2H1CA 2EATA 4JX9A 3IOEA 1LV7A 4QDJA 5KJMA 4ZHSA 3HL0A 4GKKB 2QYTA 3D2CA 4GUAA 3L79A 1MJ5A 1ONBA 3G2HA 4APOA 4N7RA 1HMPA 1PT9A 2C9MA 5T3UA 4FGLA 3ELUA 4PZLA 3UH0A 2E85A 5JQGF 1ZDMA 1VHQA 4NI5A 4KR2A 2Z4TA 3OIYA 1A5TA 4J6EA 5ESDA 3ZY4A 3TF5A 5JAIA 1LPOA 1L3CA 4V3CA 3CLJA 1OU4A 5DSXA 4R6WA 5DVZA 2BR3A 4D8XA 1N1EA 1XLUA 2BGLA 3DP7A 2ATVA 1OXKB 2O8CA 5JZ9A 4Y1RA 2F1RA 3D8UA 4E1AA 3OEYA 3E70C 2I54A 3UGJA 3LCMA 1J97A 3NWJA 2EXXA 4JEIA 2NUTB 3KUKA 1YO6A 2VRBA 1DEAA 3A3OA 4JCOA 1XAIA 4TSFD 1YUBA 3WGOA 5A0VA 3KS2A 4LMRA 2NU6A 2GB4A 3RUCA 4HZGA 4WHMA 3BK1A 4ZOLB 2RAVA 5LOVF 2OLEA 5A9SA 2ZDGA 4IJUA 4MRNA 2A1UA 3I73A 1JTVA 1DDIA 4BX8A 1S96A 3FDXA 1R8XA 2R6CA 2PGJA 2HYIC 3RV4A 4D4GA 1HX8A 1ZUIA 4JNCA 3FBWA 1NLYA 2W4MA 3O2NA 3RQSA 1OLUA 3GH3A 4DARA 1ZGCA 5H9VA 4W9NC 3TIXB 4LCEA 3ZR4B 1CJSA 2V5UA 3TZCA 5C3UA 3IOBA 2QP3A 4O1PA 1KP9A 1LS6A 3KJHA 4GZCA 2HJWA 3GHHA 3GF4A 4KB5A 2QKYA 5IT5A 3NDBB 4JYAB 2PKXA 1VL5A 1RMYA 3L3BA 1NIJA 3JSXA 4KZ0A 4JUDX 2FEKA 3PS6A 2DPHA 1XEXB 1K4YA 4AMZA 3EVEA 2FPPA 2FN3A 1RIFA 2I78A 1LCIA 2WPDA 5AM5A 4CG2A 1JAIA 3TJMA 2HRDA 1XTIA 4K5AB 2R1ZA 4QUBA 4NYIQ 3R7BA 4WCFC 4MVJG 4OP1A 1JZQA 3L6DA 5IT0A 1H0KA 3IKVA 4DEVA 3DQPA 2W4IA 5NLLA 5FL7A 1E1QD 3ET5A 2A0KA 1XPJA 2MMCA 2CBGA 2WABA 1EXWA 1B15A 1OH8A 2CZQA 5B58C 2X6QA 4NJMB 2Z8XA 1E1MA 4M9ZA 1RIIA 3AVWA 1M1UA 4HNRA 3M1LA 4EHHA 3T1QA 1XWWA 4QXOA 2P5TB 1I94B 1DG3A 3ECCA 5DI3A 4C3ZA 3BTOA 2Z2XA 1N4SA 2X9QA 3RKVA 2OXTA 1PGJA 1L7QA 2C82A 1FRVA 3HB7A 2HYDA 4DFDA 3T3EA 2O8BB 2ADFA 2ORVA 2QM7A 5BW8A 4LW8A 4J3FA 2LIPA 3PKJA 1CZHA 2JH8A 1CUXA 1HRKA 1E79A 3UW3A 1O9BA 3DL4A 5FL3A 3WLNA 2BEWA 3D3WA 2W11A 3GO4A 3ZHZA 2QL7A 4BNGA 2Q7DA 3FHOA 4ENVA 1QS0A 4ARZB 1J5PA 2PVSA 1NBIA 1R5BA 4HJXA 5DWQA 4FHDA 4I9EA 4URUR 4HAXA 4QODA 2BW0A 4HY3A 5EX0A 2YV4A 2XSZD 2YFHA 4RD4A 1IBLB 5AENA 1L7BA 1GCAA 2GAIA 2YHCA 4UQOA 3D3JA 4EB0A 3OFND 4UBLA 4KTTE 3KYDA 4MGHA 2QR3A 3UWPA 4MQBA 1OASA 1T8PA 4RPIA 1QG4A 2VSOE 1M5UA 2Y8EA 4YMUA 3COYA 3F8TA 3HA3A 2Z83A 3PEEA 1Z8HA 3OOYA 3DL2A 4NMWA 3K72B 3ND8A 4HQNA 3ETDA 2XVZA 3TAHA 1YMPA 2VYCA 5CJ2A 1HEIA 4PG6A 1U9YA 2J5QA 2YHSA 2XTZA 1GZ4A 5HX7A 1X70A 5ANLA 4BIIA 1JKMA 3O93A 2CMGA 1CB0A 3IMCA 5C1OA 3BF8A 3IV6A 2V0GA 2AJ8A 4MYDA 1QPGA 4ZFNA 2R17C 4M9SA 4A92A 4RA9B 5DZSA 5FHRA 3E18A 2YBEA 4UE3S 3QC1A 2CHQA 3FJ1A 3VTAA 4CV1A 2YWDA 3OJLA 2IYAA 4MVJI 4DNPA 3MFQA 4PBTA 1G291 4R6XA 4YRBA 1NURA 1OJLA 3MF4A 1OIXA 3RHSA 3UFXB 1SNYA 1KY4A 4XDHA 2CXQA 5IXJA 1L8XA 1YCSB 5A1JA 1WLSA 2NLOA 4FE7A 2ZJ1A 1LD8A 1LF8A 3B53X 4GX5A 2PRJA 4HGRA 4C0LA 1M76A 4UEKA 3DNMA 1TM4E 3V8BA 3N5CA 3IGFA 2YWGA 5IVKA 2JLBA 1J56A 1W8DA 3ZWPA 4QBHA 5DEIA 4D44A 4V0LA 2NUTA 2NQTA 1FXSA 5FOQA 1FSGA 3C8ZA 3EMDA 1G4UR 5JSZA 2O3TA 3TM5A 4ES6A 1TMOA 2VA9A 3TDMA 1HE8B 4GGPA 4PCAA 4YI3A 1Y37A 4CMCA 2DU8A 1I5EA 5EFOA 4JENA 5HILA 3HHMA 4HATA 4V0ME 3WDSA 1P2DA 1E5TA 1P2SA 3CJQA 2XF2A 1RRFA 5L3SB 1B2LA 5ADWA 1ORDA 3TNYA 1TN8A 3HVUA 2OK8A 4AJOA 3UMMA 1IVYA 1N3LA 2A0XA 2NYAA 4CLXA 3CEQA 1J2UA 3PQ6A 3SKYA 1ZH4A 4MVJD 5JHGB 3QFRA 2GJ9A 3UVEA 3BORA 2Z5FA 3HNPA 3S28A 3WLMA 3K0CC 4ZANA 5K0SA 3I12A 5D66A 5EIXA 3FGNA 2OUIA 4LRTB 2GPTA 5FUXA 3ZZMA 2QVCA 3UK1A 3S2UA 1B0ZA 2R84A 4HMQA 3QKWA 1WXIA 3TB4A 1VPWA 4QM6A 4IZIA 1IIRA 4ZI3A 3VDXA 1PJ3A 2HUPA 1GZDA 2LXMA 4JBLA 3MEKA 3IQWA 3EXHC 3FOFC 5L95A 3A6PC 3H11B 4XLZA 3LHKA 1XEXA 4Q1DA 4IULA 1NQWA 3R9KA 3QMWA 1U1EA 5EYPB 1QYXA 2I2BA 4MUBA 1ES9A 2J9YB 3SIXA 3TFOA 3GCGA 2GI4A 5AHKA 2CXHA 3HJFA 3OF3A 1FDUA 2NPOA 4Q3LA 3BPSA 1P7YA 2DKOA 4R16A 4F38A 4ZCRA 3WGVA 3D9IA 1AUOA 3BWXA 2P9SG 4JYBA 8MHTA 4ZAWA 1AUPA 1KQNA 4Q9AA 5AT1A 5A05A 4BCCA 4TSRA 2WAOA 4ZHBA 4L4ZA 2XDYA 4IIYA 2QX6A 4N0DA 4DK5A 4UHKA 5T8KA 5H0IA 4NJMA 3V8VA 2CMHA 1BKYA 4IIXA 5DBHX 5A5GA 1XMPA 4M89A 4EA7A 3K94A 2BH9A 1S7CA 4AVYA 4Z2YA 2VHYA 3E61A 4C4OA 4HLEA 4EGQA 4ZQCB 4DXHA 4L78A 1MORA 4NACA 1MNQA 4LHVA 3U56A 1S2DA 1H2FA 3V7UA 4J4HA 1ORRA 1XXHE 2Z1DA 4E14A 2ZBGA 3QAQA 2JCXA 4DDHA 1CEQA 1D4ZA 1E2LA 4HT3B 4C0KA 2O8BA 2RG1A 2QXYA 3OIDA 5K0BA 3LYLA 3PL1A 5C1BA 1JI3A 3D7LA 5HZMA 1U6KA 2UYHA 3DKVA 5TF4A 3C6KA 1D3AA 3AR8A 1USGA 4IFEA 3IV7A 1PAUA 5D6OA 2ZJZA 3TSWA 3ZGLA 2B0OE 4ZZ1A 2R66A 4JA7A 4OB6A 1LDMA 3WISA 1FRQA 3FTDA 1NVDA 3LA8A 4DLWA 5K3FB 2NO0A 2CLKB 1MJGA 1QFZA 4TMFA 4HX5A 4F4UA 2MHKA 2A1IA 2ZREA 3CONA 2QRLA 1XYYA 3C8UA 3UMVA 1JG3A 2H1RA 3PTAA 3QMPA 3CXUA 1EH5A 4ARCA 5I4BA 1XN1A 4X7PA 3D2LA 1H9BA 1X1QA 1G2IA 1UFVA 4RWEA 4E5YA 1SXHA 1Z7EA 2QY7A 5IAJA 7REQB 2H16A 2GERA 4YMTA 3WQHA 3LYHA 3TRIA 4XR9A 2KLBA 2ZTUA 1RQPA 3CUEF 3B3FA 4HO1X 3QWHA 4O3MA 1YAJA 2F1KA 2QUHA 5B1YA 2E9SA 5F98A 5IZ4A 3QY9A 4N6GA 1RQNA 3WE7A 2QX7A 1FMLA 2CJFA 3HCFA 3JR3A 3V1UA 3K4QA 3L0OA 4QRIA 4RA9A 4FM9A 1FOEB 1ZESA 1KJYA 5K0GA 1BZYA 1QDEA 3GBPA 4ZAVA 4PIMA 4UNPA 3DZGA 4DJ5X 5AR1A 3CPJB 2OHFA 2QR2A 1V47A 5I5EA 3UFXA 5HRAA 3JALB 3ZWDA 1ABEA 1RQ2A 1QIEA 2WPDD 3RT9A 4GNRA 3EFBA 4LZNA 3EZYA 1TZMA 3UB2A 3G7UA 1ULHA 4DLXA 4WUYA 1Z8DA 4F97A 3M6VA 3LP6A 3T7KA 1YS9A 4FGSA 2NUPA 3NV7A 2ZI9A 1K9SA 3F6CA 1GCGA 2QLTA 5MDHA 3F3MA 5FL7D 5AHRA 3H19A 4BWGA 3S2ZA 1P0QA 1V2HE 1U4SA 1FJXA 1WO8A 4DBZA 3UHOA 1B2RA 1W96A 2NU9B 2X3FA 5LC1A 4EYKA 1OQAA 1SG6A 5IEBA 4G86A 2IY8A 2OORA 1L3BA 2I22A 5TC4A 5KMGB 1HE8A 2F4NA 3D8NA 1QRUA 1CVIA 4EY8A 4Q82A 4NAVA 3X1JA 4R0NA 3TOVA 1XA0A 1JFTA 1ZI6A 1E7UA 1NTRA 4G65A 1T6BY 4ABTA 5B3JA 5L3SA 3ZCTA 5GGYA 3LF2A 3C7AA 3MWFA 4MKXA 5BQPA 4NYIR 2IUSA 4W5TA 3UICA 1UBFA 1PR3A 1UF9A 1QGYA 3EGDB 4WXEA 1K6IA 1E79D 2RC5A 1BGXT 1IJEA 5FUWA 2ZUWA 4A1FA 3VBCA 1MX4A 2BMJA 4DPKA 3TX6A 2WVHA 2CNBA 2I6QA 2JGEA 3K6SB 1NMQA 2ZJ0A 2VDLB 2QORA 3GEIA 1BI8B 4TL6A 1JDUA 1SZAA 2GFIA 3EAGA 2H2IA 3DCJA 3HJCA 4G8KA 1G8PA 2O50A 5FADA 1MOSA 3WNDA 2PZMA 3A9TA 4FK8A