2XGSA

Xcogt in complex with c-udp
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
542
structure length
542
Chain Sequence
LMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
molecule keywords XCOGT
total genus 206
structure length 542
sequence length 542
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgsA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgsA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgsA02
2YQ8A 4HOQA 3MV3B 2AW3A 1NA0A 4O6FA 1ZBPA 3NC4A 3D0QA 2HO1A 1L5SA 2C0LA 2SKCA 2IV3A 5CCMA 3MTBA 3C4VA 3CUWA 3G2KA 2XCCA 3WC4A 1AXRA 1NVKA 2GW1A 2QN1A 3O3CA 4L22A 3AS8A 4XI0A 4WACA 4KQ2A 3QWPA 3ZGQA 5DXFA 1B4DA 1FCHA 1NZNA 4U0SA 5KJNA 2GPBA 3DDSA 4IN3B 3RO2A 1EXVA 1NZFA 1XL1A 2ACWA 3Q3EA 2ZB2A 1FTWA 2HR2A 3IA7A 3MBOA 3SZ7A 5IKPA 3BEEA 4HLNA 3T3EA 3RT1A 2R60A 4N9WA 3Q5MA 4HWGA 3OTIA 3QDNA 1QM5A 3N71A 3T3HA 4KQMA 1LWNA 4JA9A 4KQ1A 3LPZA 4PQGA 3ULQA 1P4JA 3OXLA 2R66A 4Z5XA 3E4BA 4UI9C 4GPBA 2SKEA 3CX4A 1ELRA 2F3PA 4I2WA 2FF4A 1IXYA 2XCBA 2LSUA 3TOVA 5KJMA 5TVGA 3SF4A 2QNBA 4Y6CA 2QN7A 2R4TA 4RIIA 4MICA 2ASVA 2Q6VA 1FA9A 1GGNA 4H7XA 4WUYA 3CKCA 4RELA 4RIFA 3MS2A 4CTOA 3CEQA 1A17A 4QLBA 1SXQA 1XOIA 3UUXA 1JG6A 2GEKA 4BWRA 4H7YA 2XA2A 5ENZA 4N3AA 5EKQD 4NESA 1Y8ZA 2LSVA 2YJNA 2X0DA 3CK9A 3CV3A 1HH8A 4I9EA 2C4MA 3ZCQA 1QZ2A 2VG8A 3L7DA 3Q3IA 4F9FA 4AY6A 5LCWC 2QN2A 2JLBA 1PC2A 1JIXA 1GPYA 3ZCUA 1Y6GA 3ZHEA 1JIVA 2F3SA 5BT1A 5D00A 2VGYA 2KS6A 2QRGA 1NOKA 1V4VA 3C48A 3RHZA 3T3IA 1Z6PA 2P6PA 2OOEA 4EJ2A 5G04J 4J8EA 5FZRA 4BT9A 1NZDA 2PRIA 4YNDA 9GPBA 1JIUA 4LEUA 3S7BA 1L5WA 3E3NA 5D0OD 4F97A 3ZHEB 2SKDA 4RIEA 3RSZA 1GPAA 3FFLA 4XIFA 2IF4A 2KATA 5FZSA 4AMBA 3GW4A 5G05C 1P2BA 4BQIA 5TMDA 3CV0A 1NOJA 2XMPA 3ZCPA 2IEIA 3G2HA 4J0UA 1P2DA 4HOSA 3L01A 4CTNA 3ESKA 5EX0A 2GT1A 3HBMA 4X7RA 5IKOA 3D0RA 2Y4TA 3G2NA 3ZFWA 3S0JA 3FWVA 1Z8DA 3GYZA 4JA7A 1L5QA 4W6QA 2XGOA 4BFCA 2PL2A 2PQNA 1J39A 4I1AA 1FC0A 3EBPA 2VGXA 2AVPA 2G9VA 4ABNA 4GZ3A 2V5FA 5G05J 4RIHA 5HI7A 3ZCRA 3GPBA 2JJMA 2BISA 5FTPA 3QWWA 5D01A 5ARFA 2R68A 3ASFA 1GFZA 3T3GA 1HZ4A 3PE4A 1KTIA 2KCKA 4CTMA 1GPBA 4N3BA 3KAEA 2XA1A 3MS7A 2F3UA 1RZVA 3MV2B 2ACVA 4LEIA 2PYIA 1YGPA 4G26A 5EX3A 1Y8MA 5AYWD 3Q15A 3ZPJA 4GA0A 4GZ5A 1P2GA 3H4TA 3SYRA 3MRVA 2FI7A 4MI6A 3VUEA 1L7XA 1NOIA 3MS4A 4CGWA 3MRXA 3FP3A 2AMVA 4FKZA 2LNIA 2VQ2A 3K9IA 2L6JA 4WNGA 1IHGA 2JZCA 2QLNA 2QLLA 2VSYA 3VUFA 4YI5A 2QFCA 1LWOA 2R5SA 8GPBA 2ONDA 1K06A 3LCAA 1OUVA 3BEOA 2GPNA 4AIFA 5KJLA 3E3LA 4U07A 1P4GA 2J9QA 3G2IA 5JTUA 2Y4UA 3AS5A 4KYOB 3HBNA 3S29A 3UYKA 4NRHB 2G9RA 3QKYA 3BDAA 4MI3A 1C50A 3L7AA 4UI9J 3ASGA 2HYZA 3GUHA 2R4UA 4NC9A 2F9FA 1FU8A 2FF5A 1JEJA 2FBNA 1WW2A 2UY1A 4I9CA 2IV7A 2IUYA 2PZIA 4G1TA 3MT7A 4B94A 2BGUA 2ECPA 1IIRA 4LDPA 2C2LA 4KXKB 4GPKA 1WV1A 4AN4A 2WPVA 2XCUA 1UQTA 5GPBA 4GYYA 2YHCA 3CUYA 3DDWA 2BGTA 1Y6FA 1KLXA 1Z6QA 4MRAA 3BD6A 1C8KA 3MTAA 4JHRA 4YI3A 5LCWJ 3MEKA 4YVQC 4WHMA 1UZUA 1XV5A 2IEGA 3LYAA 4HORA 1L5VA 3BCRA 4BQEA 3KS2A 2PQRA 2WQHA 3AS4A 3G2LA 3RO3A 4KBQA 2QN3A 1FU7A 3CVPA 3WAGA 4U0ZA 4GCNA 2X0FA 1WM5A 1YA6A 5DBKA 4EL0A 4J8FA 3T3DA 5FT9A 3LY9A 3OTHA 2ATIA 3BD8A 4GYWA 4F3VA 4GZ6A 1NA3A 5LQDA 2GPAA 3CK8A 4NQ0A 3CK7A 3QHPA 2C0MA 1E96B 2C1XA 2QN9A 1WUTA 2G9UA 4XI9A 6GPBA 2IFUA 1ZU2A 1Z62A 3MSCA 3E3OA 4AY5A 3DZCA 3TSAA 4GA1A 4AM9A 2XCIA 2Q7FA 3CVLA 2DBAA 3LY7A 3S28A 2E2EA 3SYMA 2IYFA 2XPIA 3IEGA 2KCLA 2UY1B 3AMVA 3CEJA 3T5TA 3C4QA 3NB0A 3MRTA 5M72A 5A6CA 3PDNA 1KT0A 4UQZA 3BCSA 5JTTA 3L7BA 1FS4A 3NAZA 4BT8A 4RENA 2VGXB 2P58C 2XEVA 3VDNB 3S7DA 4M83A 5I45A 3OTGA 1UQUA 2VCHA 1M5RA 5A7DB 1WUYA 4GCOA 4RG6A 3OXGA 4NEQA 4CGVA 3MA5A 2QRMA 5CHEE 4FZRA 4I2ZA 1WAO1 4YUAA 5HQ8A 1PNVA 1PYGA 1O6CA 2H1FA 3RIBA 1XNFA 4J8DA 1WW3A 4UQYA 3OKAA 3TAXA 3Q47B 2VCEA 3PE3A 4RIGA 5JJTA 3CVQA 1PN3A 3UQ3A 4RBNA 7GPBA 1GZ5A 1L5RA 2GEJA 4X7PA 3OY7A 1KT1A 3JYSA 1L6IA 3LKUA 3O48A 1XL0A 1NLMA 4M7PA 2BUGA 3EDTB 1GG8A 1YA0A 3VDMA 4BQFA 1A8IA 3OT5A 3S7JA 4Y6WA 5BW8C 3NF1A 1ELWA 3CUTA 1P29A 3MT9A 2QRPA 1PSWA 3T7DA 1FTYA 3TGOA 1IYGA 2QLMA 3QOUA 4EKEA 3QKWA 3EBOA 3NCHA 3ZCVA 5JJ6A 3UPVA 2FETA 3RSCA 3RKVA 3NP9A 3Q4AB 2QN8A 4N2QA 2X6RA 3H4IA 1RZUA 4WNDA 3ZCTA 2BFWA 2HY7A 2C1ZA 2X0EA 2QZSA 5TMBA 3ASDA 1FTQA 4EKYA 1B89A 2PYDA 2XGMA 4X6LA 1W3BA 4N2SA 2AV6A 5DU2A 4APOA 2IYAA 4AMGA 1VGVA 3NP7A 1C3JA 2IW1A 5ARGA 3S7FA 3CVNA 4G24A 3FROA 3U4TA 1XC7A 3IAAA 4X7MA 5DLDA 1HLFA 2GM9A 2I6HA 4MI9A 3G2JA 4WNFA 5TMEA 2OFFA 2AZDA 4MHOA 3GZ1A 3OKCA 2FO7A 4RG9A 3BCUA 1TJCA 2C9ZA 3TG5A 4U04A 1F0KA 3CEHA 3GZ2A 3HYMB 4G2VA 3RJVA 2KC7A 2FFRA 1HXIA 3VTXA 5CCLA 3OKPA 1EM6A 1E4OA 5C1DA 4M60A 1RRVA 3NPAA 4G23A 4YVOA 5JJ7A 3L79A 3QWVA 3WADA 5DIZA 2GJ4A 4GA2A 3TG4A 5FJYA 2WTXA 4U0UA 4N5CA 3BD7A 1E1YA 3S27A 2MHKA 1FU4A 4EQFA 2QRQA 3MT8A 1QQEA 1XKXA 3CEMA 3CKBA 1BX3A 4WADA 5HXAA 1AHPA 4UQXA 4REMA 5BNWA 3ASHA 5KJKA 3CUVA 5D0QD 4F96A 4HOUA 1QKJA 1P5QA 2X6QA 4CDRA 2H1HA 4W9RA 2QRHA 1H5UA 3OY2A 4ME2A 2VYIA 3Q3HA 1C8LA 3D1JA 4WNEA 3UYLA 2FEZA 2PQ6A 4MHSA 3MTDA 3ZCSA 3MKRA 1K08A 2G9QA 3WXXA 3DD1A 2VSNA 3U3WA 4BTBA 3MQFA 3VTYA 3CUUA 3KD7A 2PRJA 3RU0A 4HOTA 3S2UA 1SXPA 2F3QA 4EL5A 3HBJA 4JL0A 1P4HA 4A1SA 5G04C 4N3CA 1ABBA 4N39A 3L7CA 1WV0A 3HBFA 3OXFA 4UI9K 2XA9A 2KCVA 5FZQA 3LY8A 3ZN3A 2UWJG 4G2TA 3COPA 4G25A 2O6LA 3URZA 4I17A 1F6DA 2NC9A 3R9AB 4GYOA 4BTAA 1JG7A 2XGSA 3Q49B
chains in the Genus database with same CATH superfamily
4LC1A 1EVQA 1VFNA 1X9IA 1F06A 5FWYA 2Z08A 2JLVA 1FRVA 1NA0A 3WGZA 3JQBA 4QASA 1J7KA 1DKNA 4LNGA 4J90A 4Q3EA 5G0VA 4AIRA 5H3CA 4J76A 2Z5VA 4GPTA 2C92A 3TWRA 1V96A 2RH4A 3MTBA 5CNKA 5EUBA 3VR5H 2XCCA 4QL3A 4CZ2D 4C29A 2M2IA 2WAAA 4A27A 3A70A 4MIYA 5KDLA 3AP3A 4V0ME 3PGVA 3PT5A 2LIVA 3ZGQA 2B3TA 2ZI9A 1Y3CE 2F8TA 1S3SA 1E9BA 2E6UX 2Q6OA 4BBZA 3RO2A 3N87A 4H7DA 1TYQG 1K7CA 1EXVA 4HPJB 3QKRA 4HUJA 3X2QE 3R74A 5LQAA 3T9BA 2GYUA 4W5HA 2MR5A 2PZAA 3VOBA 3BMQB 3SKVA 3W3AD 5EYLA 2EZ9A 5LQRA 4OQQA 3I9KA 2GLXA 4ZGBA 4JU9A 2XQVA 3H84A 2EX0A 2QG4A 4WGGA 4GQAA 4BQQA 4RFVA 4Z9BA 1H19A 4KQMA 5DHQA 3ILYA 2ZU6A 1FFCA 5A0TA 4JELA 4NBTA 3VHRA 3V4SA 1T4GA 4X1IB 5AI5A 3OMLA 2YRFA 5F1KA 4NAVA 2GRAA 3K0KA 1H94A 1SXHA 5DGTA 5FBHA 1T2VA 4BX2A 3HFJA 4IJVA 4LECA 1JPVA 1NI1A 1LPAB 3A37A 3I6MA 3LA8A 1H1LB 2BFCB 3N3AC 3IEMA 4U7JA 1U0GA 2HIMA 1VCIA 1N25A 4KTVE 1JE0A 2BHSA 4AN1A 3U7GA 4KR2A 1DRJA 1D7AA 2B1GA 2QYOA 1JUDA 5AVZA 3IOMA 3SXPA 5E1BA 4KIGA 3RSEG 4MWZA 5I9MA 1X7YB 3HCWA 1TL7C 2WVJA 3DCIA 4HGYA 5HQTA 4TKUA 2BGLA 3ET4A 3FW1A 3O21A 1RM0A 2OECA 1CLUA 2IPOA 3VHLB 1TM1E 3WHIA 4QLBA 2ORED 2XOEA 3GRPA 4BAZA 3DBHA 3C24A 1OXXK 1CPYA 2PLFA 1S8NA 3GR6A 4L51A 4M36A 5A71A 4Q4AA 1Y8RA 3UHJA 4B17A 2X8JB 3DKRA 2EQ5A 3GT4A 4B5LA 2CVOA 4NFSA 5JS2A 1BDIA 2A35A 4QUDA 4ZJYA 2BWJA 3HVUA 5E6RB 5FO1A 1OVMA 1WZCA 5TVKA 4B3MB 2HAEA 5IW8A 1PFWA 4DG9A 1GV1A 5JO9A 3RU3A 2BM8A 3C0KA 3NI2A 1TAQA 1A5EA 3EULA 5FV7A 1L7OA 3RRZA 1B8VA 5E6UB 4RVFA 4DQDA 3IIMA 4KNWA 3T3IA 4MROA 1U5BA 3JZMA 2P6PA 2OOEA 4RE5A 1AUOA 3G2WA 5FTJA 5BP7A 4YRBA 5L51A 3RRJA 1NUQA 1Q2UA 1UMKA 3CNNA 1A5TA 4B4KA 1H9AA 3OT1A 4M86A 3WWPA 3AVXA 2BP7B 1IRXA 1W1IA 1WNTA 4EGAA 5IFLA 2J3LA 1WKBA 3C3XA 2Z9BA 4AJ2A 1L5JA 2B4AA 4RL4A 2YFHA 3IUMA 4H9GA 4QJ4A 2P2ZA 4IUDS 4DWOA 1ZLYA 2GK3A 4H6PA 4PLFA 4X00A 3SDSA 2B5WA 2GI4A 2XMPA 1EUCA 2H1CA 1XDZA 3DMHA 3ZW9A 4EHIA 1PR3A 4AZ0A 1H0KA 3JQ6A 4CTNA 4EELA 2OZEA 2XDQB 3QLUA 1OLOA 3VH4A 2YS6A 2PS9A 3N0WA 1FJGB 3SC3A 2XTMA 3AO0B 3T38A 1JHYA 1VKOA 2CEAA 1PJ8A 3M5PA 1YZYA 3OE7D 4NONA 2B82A 2H5IA 2C61A 2FRDA 3CX8A 4BX0A 4KREA 1T36B 2YICA 4GP7A 1L5KA 1ZOLA 1K9VF 1A8QA 5IY5E 4B75A 1UJ2A 1JXAA 5KIAA 4PINA 1ISHA 1BKDR 1WPXA 2YFYA 4MOWA 2QQGA 5K8JB 1KZ4A 1TYCA 5TF0A 2FQWA 4FEYA 3PTZA 2F55A 3H04A 5REQA 1XRRA 3JAWA 1YTUA 1KDOA 1P1JA 2ZYUX 3HYTA 4K05A 4M88A 4MJ3A 3RS7A 4BL5A 5M34A 3OG9A 5CEFA 2AX3A 2ODTX 3R2JA 1GPBA 2QVBA 1WSWA 1ZWKA 3WKDA 1VCHA 4RO0A 3ZDZB 2BKAA 2MU1A 5A03A 4D44A 4UARA 1V9LA 5LJLA 3PHIA 3Q98A 4F2HA 2R62A 4CKBB 4JNCA 4WK0B 4P4NA 1MPXA 2JCGA 2OC9A 3AXSA 3BYZA 4OGFA 3H4TA 2H54A 1HE3A 3UF0A 1VSTA 4JJ8A 4F6RD 5JBNA 3Q9NA 2V45A 1BJKA 4EFNA 5KYYB 4FKZA 1EXWA 3GMDA 1FNCA 2FZWA 1IZYA 1VE5A 2QRZA 1X7WB 4HGNA 3UJNA 2O59A 4N03A 3ER8A 4CNQA 2HADA 4RH1A 7AT1A 1ZVQA 2CC2A 2B4YA 1ZY2A 3VR4D 3GJ7A 1HNNA 3BAFA 4F7AA 3VU1A 3R4CA 1LW6E 4OBXA 3I61A 3LCAA 2Q2OA 1JR3E 1V1RB 4MMXB 4M3NA 3CISA 5HS0A 3W7BA 5AJHA 5K8UA 2FEKA 3DONA 5ISMA 3E7FA 4GI1A 1TJFA 1TJYA 3PU6A 4PQRA 1RE0A 4FNGA 4E3WA 3BL5A 2IXEA 2JG3A 4Z3OA 4OG2A 1MH1A 1DFIA 1IJBA 1RRFA 1GAEO 1VLZA 4ARVA 2OCLA 1F60A 1NJSA 2NPOA 4ZICA 3DBSA 2GFQA 2R3SA 5IMSA 1SVSA 4HYTA 2QDKA 1EIZA 1HNWB 4PCVA 5FNVB 4HTFB 4NNJA 4WFKA 5EHNA 4C21A 4NULA 3PR3A 3GHHA 1SXPA 1KXJA 2IF0A 1SC4A 4R84A 2WHPA 3TD6A 2SCUA 3JZAA 4YJFB 2P4EA 1VZ2A 4AC9A 4D46A 2CHXA 3U66A 3AY7A 2FN4A 4JBYA 3WBFA 5JMOA 4X66B 1UPTA 3L6UA 1QTIA 4PUCA 3MT7A 4RY9A 3TTSA 5ITSA 2OBBA 4RV9A 3LU1A 4IOMA 1I9CA 3EMBA 4HZIA 2IZ7A 2WYVA 3OEWA 4O8ZA 1P81A 2PT9A 4LJLA 5TQ0A 3ETCA 1JR4A 4E1BA 4XJTA 2KI5A 1BZYA 5IKEA 1C14A 3WYFA 4X8HA 1X9HA 3E84A 2FEMA 3VZCA 4N47A 5FBZA 2JPDA 3SGLA 3B6IA 2PZGA 1SU6A 2X9LA 4JYMA 4DSAA 3I53A 1KBQA 1NDUA 3E9CA 4UMEA 5FI0B 3F9IA 2IO3C 2MSEB 4GE0A 2ZRPA 1ZM2A 1XV5A 1LKZA 2GS9A 1CJUC 3L1VA 1VPDA 4G86A 4JT8A 5I4CA 4JI8B 1DC3A 3S2GA 1MC4A 1RE1A 3EZXA 2EFYA 1YFJA 4MUEA 2M98A 4HDKA 5HFAA 3FTYA 1Y7LA 2JABA 2H6IA 2NXPA 4YT8A 2YWFA 1VHDA 2IP4A 3PUHA 1Q21A 4QSHA 2FEXA 3K6SB 1E69A 2PUDA 2QX4A 3K35A 4XR4A 4QXAA 4L5YA 3NAWA 3WRVA 1WHTB 2ST1A 1MV5A 3KJNA 4MRRA 1KEKA 1C9NA 2DQSA 3FWZA 4PGGA 4EHBA 3O8CA 5JS1A 5FOQA 2J41A 5AI9A 5IP5A 1T0IA 3K72B 3PKZA 1RR6A 1E2NA 4WBSA 3UGQA 3ZU4A 4BVAA 2A9KA 2VHUA 5IF9A 3CZQA 4X20A 5BXUA 2CXTA 3N7AA 1G5IA 2G9UA 3OD5A 3OIFA 4LOJA 5AUPB 3UMYA 1TUBA 3RHSA 1IHUA 3O1IC 2NZUG 4TV9F 3UMRA 1ZU2A 3BJZA 4LV5B 1IQPA 3ZD7A 3D1VA 3HDQA 1G5HA 1MORA 3S28A 3SYMA 4TV8B 4F5ZA 3VR2D 5I4KA 2XXBA 5IG2A 3C1TA 3HKEA 3ZV5A 5KJFA 1U1FA 4JXZA 2UY1B 1QRDA 3CEJA 2BM9A 2EL7A 3IB3A 3IPCA 1P1IA 1QYIA 4BNLA 3LVBA 5BWLA 4WEQA 1Z2NX 4DG8A 4OFBA 4AYWA 2VS1A 1MRZA 2RAFA 2FZVA 4L7VA 5BVGB 1E1NA 4GH5A 2VGXB 3QIAA 4L2YA 4YWHA 4JT4A 1MKYA 2ZSBA 3S7DA 3MINA 3MUNA 1XLTA 4FS3A 4FYIA 4ZVRA 1SXGA 2C4UA 4POAA 4QICA 2JKVA 1LU9A 1SZJG 3LTEA 1MAUA 3WP0A 1A9XA 5JNLA 2W2QA 3I45A 1OAOC 1ZX1A 3EGXA 3R75A 1EUYA 1X8KA 3DC2A 1YNSA 4F5DA 2KBEA 1BG6A 4TMZA 4WBNA 4PF1A 4R9SA 4Z9XA 3WLQA 3D43A 5F2OA 1ZWLA 3ZYQA 2POCA 3U0BA 3V4OA 1I7SB 1PQ4A 1XELA 2RFLA 3DV2A 4QREA 4S04A 1ZD2P 4MVJP 5FUVA 1A95A 5HOQA 2PUVA 3KOXA 4YCAA 3DH0A 3DUFB 3UM2A 2A9FA 3U3MA 1GTZA 2H4JA 2A1TR 5EZYB 1RPZA 2K87A 2W6JD 2V7UA 3O8OB 1ZUHA 4EY7A 5BPPA 1ZH2A 1UN9A 5CW1A 1P45A 3EQ2A 7GPBA 3RRXA 5JNSA 2HF9A 4ANWA 1VL5A 1B3BA 1BU5A 3VDQA 3PIDA 5F2KA 2XDWA 1KT1A 3QVMA 2MRIA 4E7OA 1NQTA 5I4BA 1KA9H 3HVKA 4X6YA 2D1YA 3L2OB 3NM4A 3WIUA 4HK4A 1QKIA 2O3JA 2FPMA 4BE9A 1PAQA 4HS9A 1WW8A 5JQGA 3EZFA 4WXMA 1OFUA 3A4LA 4B9EA 2P78A 1E3DA 1NYLA 3A1EA 1D9XA 4W8HA 4ER3A 4FYYA 2GO7A 2Q3FA 3FI9A 4ER5A 1IBCA 5GGXA 4DC1A 5TS3A 1I51A 1RT9A 4BFLA 3QLJA 2WINI 1M0TA 1NBHA 4QBKA 2HREA 5A7HA 3V2UA 5REQB 2P65A 2R1UA 3FZNA 5CVUA 4HB3A 3QWIA 4PNZA 3WGYA 3K0SA 4US1R 4XGNA 2RFAA 3IYLW 3L0ZA 5DYWA 1R6UA 3EYAA 5A4KA 2FTKE 4K9QA 4A3TA 1N5IA 2GN1A 2HBYA 1MN6A 1N2SA 2FWIA 3QEKA 3KV3O 4GFDA 4HX5A 1E89A 1ZD1A 2GRUA 5TT0A 2EZTA 2JGJA 2ADOA 4HDRB 4QOSA 2UU9B 1V16B 2GARA 2GSWA 5FA8A 4ZO6A 4C88A 1CR2A 3FI0A 5TARA 5JS6A 1FTQA 2QD2A 1OSNA 2PUAA 3OM8A 1JHVA 3S2FA 3FUVA 4ALIA 2JKYA 2QAGB 2JJ1D 2RGXA 1XJQA 1Q91A 5F73A 3WLFA 3ZI4A 1QV9A 4ETWA 3QOXA 2QQEA 2GJKA 1VGVA 4QQRA 3GGCA 3H4VA 3AK4A 2BDUA 1P18A 1T9DA 5AJLA 1NNI1 1QDEA 1O77A 3TZKA 3LXRA 2PLNA 3FHLA 1J2JA 4FA6A 3H9EO 3DRAA 1JQJC 1NVEA 2IHYA 3HXDA 4JJAA 3CVNA 4N0DA 1AUXA 5D3QA 3ROGA 5FDFA 3H11A 5T3YA 2WF6A 3SJAA 3BHJA 4MTCA 4X7MA 2FN3A 4INOA 3LF2A 1AGRA 4GMLA 3T4XA 3GG2A 4Z3DA 5KBYA 2GAIA 2G28A 2A5FA 2HMWA 4FR2A 1XDSA 4DIMA 4EHJA 3H5IA 2C0QA 2H92A 4LZZA 1R5OA 3SFXA 2VNJA 2BJVA 4B7UA 5LZ2A 2HA5A 4J6EA 5AW3A 1PJRA 3KALA 3UWOA 1GUAA 3H4MA 4FYWA 3OLZA 4FMDF 4ZWNA 4JR0A 1TJPB 4LBYA 3TG5A 1XALA 2IXTA 3M2PA 1SUBA 5E8JA 1V1JA 2IZ6A 4G4GA 2DKNA 3HXFA 3EWSA 4S1TA 3E3AA 3FLAA 2WOJA 1FSSA 3NYWA 5C8VA 2AZ4A 4HNSA 5IF3A 2A2ZA 3QVVA 3GC6A 4DJFC 2RH9B 3HLTA 5B57C 1MABA 1NUAA 1LVGA 1JQKA 1IUNA 1TCBA 3EGIA 4P7KA 1SUPA 5JJ7A 1JQAA 2BUAA 3OJ0A 3GCWA 3PZRA 4QTUB 4CQMB 3WDSA 2AUNA 5FI5A 1JHQA 4HQ0A 3ON5A 4GOOD 4KXUA 4F3RA 4UNIA 2X1VA 3VOSA 4UU7A 2WUGA 4U0UA 1UIMA 1KP9A 2XPZA 4D0RA 4OQXA 4EW1A 3QFHA 2VWGA 2REXB 2ZJ5A 3CNLA 3VZPA 1ZAKA 9ATCA 1TDJA 3L1IA 1UDAA 3Q7TA 5GVSA 1RLUA 2QLBA 3AI1A 2EERA 3F3SA 1RHMA 4V3BA 3TCXB 2BJHA 3DEJA 3GZNA 4WADA 1BXRA 5B3AA 1DIRA 1LPSA 4PZ0A 1BA2A 3ASHA 2G06A 3FF4A 5G4KB 4O1OA 4Z9AA 4JD2G 3V3KA 4AJHA 1JG3A 4XR9A 2B0JA 2YJZA 3SX4A 2J7PD 4BDTA 5FI1B 2P0YA 3PLNA 5HTOA 4TLLB 4RA9B 4WOPA 1RPNA 3C3PA 2G1JA 2QTLA 3KB6A 3U7IA 1KFEB 1TNYA 4N40A 1GXSB 4D9EA 4LXUA 3LC0A 4MUIA 1AWCB 1LF5A 1N2BA 1US8A 1E7WA 1Q57A 1ZSVA 2CE2X 2JFOA 3DXMG 3AW8A 3F71A 4YAIA 4G0VA 2Y05A 3D5TA 3GLHA 2IQCA 2JD2A 1EEXB 2VSNA 1H2HA 2QJOA 3DXYA 4TMWA 4CHGA 1UDXA 2A4KA 4HLEA 4CM7A 1X2EA 3CF6R 4OLFA 3F46A 4NXMB 2H00A 4BO6A 2XDYA 5JQGF 1EX7A 5AI4A 1KPHA 2Q8NA 3QX7A 4JOCA 2VJAA 4EZLA 4N39A 3F5MA 1K75A 1SQ5A 3ANTA 3GRAA 2GZSA 3B3GA 4IZIA 4Z4EA 3GA7A 3B48A 1T2DA 1NVFA 1W52X 4DDTA 5DLYA 1HX8A 1NUTA 1T9GS 5DN6A 3UWKA 2QPTA 2OYRA 1S2GA 1T3HA 3CX3A 1NUHA 3BG5A 4FQ5A 2NC9A 4R5MA 2QTVA 2PM7A 2YVQA 3TOSA 1IHDA 4E51A 4QAJA 4QQKA 4TYMA 5EJ2A 3P2KA 1KWGA 4RE6A 5B7QA 1RYNA 3BSSA 2OEPA 4D8YA 3OPMA 1P39A 3RPEA 3QZUA 3PQ7A 5ENNA 2ZT8A 4PX5A 5BW6B 1IKND 1S64A 2P90A 2R4QA 3L7MA 4YJ2F 4Z1MA 1JA0A 2ETVA 4L1KA 1RLTA 1A5AB 4J1NA 4Z51A 1XUOA 3B53X 3AVOA 4DMKA 2FPUA 3VOTA 5E1DA 3NBMA 2DZNA 1DOAA 4DPMA 3PGMA 1CD5A 5DXFA 1RZ3A 2B4RO 5BPFA 3T3NA 1EESA 1DELA 3E5HA 1XYGA 3ZXYA 1E58A 2ZT7A 4ALKA 4N7MA 5ES4B 3PPIA 8MHTA 1IBRA 1SVMA 4OTZA 3QY0A 3CNHA 3QPWA 1UJBA 1UXGA 2ZB2A 2ZYTX 3IA7A 3FYHA 2A86A 1CE8B 3TQHA 1XMVA 3WQQA 1ULTA 1UBNA 1U9ZA 4BLSA 1BH6A 3E30A 1YCGA 3PHBE 5AI6A 2YJ3A 2R00A 1FNDA 1HF3A 2WIAA 1JCSA 1TA4A 2BTEA 3E05A 3I5AA 5CTAA 3BT7A 1YQDA 5FUQA 5K0TA 2VCYA 2VPYA 1ENOA 3ULQA 3TNDA 2RGDA 1W5BA 2YHAA 2AWNA 1JEEA 2QJTA 3MVEA 5CK5A 4A26A 5HKAA 5JS7A 4GPAA 1D2MA 4Z7QB 2J9FB 2NUTB 4B32A 4BVGA 2BKXA 3TQTA 2CBGA 1M2NA 1FMLA 4P0QB 4ZMSA 3O84A 3ZY6A 1Z4KA 3KKQA 2W6QA 4IAOA 3UTMA 3T54A 3ZGZA 1ONOA 3TL3A 2CFSA 4IW3B 3L4JA 3NKFA 5I9BA 3WMRA 4G0WA 1MZPA 4B9AA 4EO9A 4KO4S 5COQA 5JFOA 2IQ5A 3CSSA 3WKAA 1SHLA 1UPXA 3A9UA 4IHAA 2EIHA 4YGYA 3E5NA 3FFBA 1VKHA 4PSCA 4WZ6A 1KQOA 3ZHCA 2JLYA 1K8QA 1EXDA 2Q99A 1NFRA 4L0QA 1SKYB 4JOBA 3PL5A 1JG6A 4H7YA 4BJHB 4HWRA 2PL5A 4N3AA 1J20A 1GVNB 2P35A 3DPSA 2X8BA 3A4MA 4JQZA 4YJHB 4LHXA 2X0DA 4C2UA 1P60A 1XHLA 1XTKA 2YYZA 2VUTA 3KUDA 4MQEB 1B0ZA 4EQZA 4NAUA 3FH5A 4R2MA 3FHCB 4GLJA 4I1MA 1CY8A 2C83A 3D2CA 1GPYA 2J4BA 1MB4A 2EFHB 4BXOA 1H8HA 1IN7A 3NTXA 5KDOA 1JIVA 3FMPB 5BT1A 2N1BA 2AXVA 5G2OA 3TVDA 4PZEA 1MJGA 1L5ZA 4Y6QA 2JIZA 5LYYA 3TCNA 1ICEA 1XKLA 1V43A 4XB1A 2VYVD 3C3BA 1E6KA 1NZDA 4BECA 3ORQA 3C1AA 4YNDA 3KQVA 1BJRE 1V26A 1Q44A 1XN4A 1L5WA 2JAQA 3GV0A 1LDGA 2FZEA 3D9JA 4EA8A 4XWOA 1YA8A 3UG7A 2OFWA 5EUQB 4KXVA 1A8SA 1EZ4A 3RRMB 1ULHA 1YVEI 1S8FA 4NYMR 3PQFA 4BRUA 3SVZA 4Q96A 1UKZA 5AKHA 1ZJZA 2R02A 3QJZA 1DJOA 1GZ3A 3QWBA 4P08A 5CNMA 1S1MA 5E8RA 3VU0A 4EFDA 1RI3A 3WLSA 3MMXA 3T9FA 3CXUA 2H2DA 1K3UB 3L01A 1AV6A 5EIBC 1F6WA 2JH3A 3GRZA 1LSOA 1NX6A 2P62A 4PPQA 4UBKA 3D0RA 4HWKA 4X7RA 1WZNA 2MDTA 3A0UA 3GBVA 2RCNA 3LBHA 4JI3B 1XNHA 1DLIA 7ABPA 2CHFA 2P8JA 1QTQA 3FWVA 4P7JA 4JU8A 4LZAA 3DE4X 4JEIA 4EHHA 5T5QA 3WHPA 2XY4A 3T4EA 3LO8A 1FBTA 2R6FA 3USZA 3CTMA 3EBPA 3RTDA 2R6AA 3R3WA 5J4HA 4JXXA 2AVPA 2XW6A 2IWRA 4B09A 1OIVA 2DTXA 1FXWF 1Z37A 3EN0A 1Z4OA 5G05J 3T1NA 3FTPA 3PFNA 2QD5A 4DZZA 4HHEA 2OXEA 4IDFA 3OZGA 1GTL1 1Z9BA 1AXGA 2FXVA 1XYVA 3HDVA 1ZGBA 1N5OX 1TT5B 2J5BA 3HJTA 3MWYW 4N0EA 5KPDA 3PENA 3UFXB 2UZ0A 3PJFA 1OR8A 1C1DA 2OBNA 2F8SA 4S12A 1MABB 3A1TA 2CHZA 1O97D 1PW7A 2IZ1A 4FJ0A 4YDOA 2Z9CA 5DNDA 2Q5QA 2C95A 1J00A 3S1LA 4I6GA 5J2TA 4H35A 2BFPA 3VSEA 5I7OA 2OK7A 5IDQA 2NSYA 1B76A 2ZIXA 4WESA 5FF9A 1IHOA 5IEJA 3HG0D 3QEAZ 3QLVC 2PKQO 4PS0A 3AKDA 4XUCA 2BTDA 2FDXA 4RS4A 1N11A 2C29D 2F43A 3BG0B 1M6VA 1TYEB 1E5LA 1X39A 2VF2A 2WIKA 4JLKA 2Q5LA 3ZKWB 3LKDA 2YHEA 4N5NA 3VUEA 5AVVA 4CGWA 4APFA 2LNIA 4Q82A 2NN3C 4RJKA 2O1SA 4KWHA 3EVBA 3ZNGA 4LNUD 2RKOA 3HHEA 2J6BA 4RQAA 4DIKA 4ND8B 4YCMA 1MJFA 2B3DA 3B2NA 2JEKA 4CL2A 3DBVO 1WY5A 2B8NA 1L4MA 1EUCB 2EKZA 2J59A 2OCBA 2UKDA 2X15A 3BJIC 3NH9A 3N8GA 5EPEA 3V4FA 4EJSA 2E55A 3COJA 4LRYA 5J63A 3TZCA 5JBIA 1GDTA 2X2FA 4YP7A 3I0MA 3M1LA 2JIQA 3CIAA 1D6JA 1SCDA 4BDSA 4HQRA 3C3KA 1C9EA 4S1NA 1RAHA 2ZBPA 2NUAB 5JTUA 2I4IA 4G9GA 3QTLA 2W5UA 1W2HA 2NO4A 3A26A 4BO0A 4KR3A 3B95A 3IHKA 4JUAA 5EKXA 2GCGA 2Z5LA 4L6AA 1E1RD 1PS8A 3QMVA 3R3YA 2B8TA 1JJIA 2F67A 1RP7A 2HWKA 2QLJA 4RHEA 1SCUB 5FLYA 2NXJA 1XD9A 2G9ZA 1VOTA 3HO6A 3T8MA 4F7WA 3GUHA 1CQPA 3KJGA 3VX3A 2FF5A 1NXWA 1YRHA 2BN4A 3R5JA 1QPBA 2X9GA 4OJQA 4LWOA 1Z2EA 1ZN9A 2B2NA 2H4ZA 2NLOA 3UV7A 3AG5A 1VBMA 2H9AA 4QLAA 4ZT3A 3VPGA 5ELXA 4ZV9A 1PEKE 3OWOA 4LJAA 4PWZA 4YLYA 4GPKA 3H5LA 3PGJA 1CQZA 1ZM4A 1JR2A 4UPEA 3RBXA 1UZMA 3B38A 4IMRA 3DL7A 2XCLA 4AMVA 3O2SB 1ZH8A 3DWEX 3WMXA 4AXBA 4DIBA 5LQCA 4DI4A 2LKCA 3F5DA 4NBSA 1N1DA 5B1BE 2GJ8A 2R96A 2YJ6A 1ZVKA 2NO0A 1DCTA 4JHRA 3PEVA 3AAAC 1ZBQA 2R59A 4WV3A 4IDHA 4PLWA 1Z2DA 3TVYA 3BQ9A 3H2BA 1RDFA 4M7RA 2WWIA 3G89A 1L5VA 5KC9A 5K3FB 5C34B 3KS2A 1U1GA 3K6JA 4L75A 4O4JF 5BWMA 1W0JD 4CKWB 5AJDA 2YTZA 3WNBA 1DAHA 4QO7A 5BT9A 1IM5A 2FHPA 3SLGA 4YAFA 2NMVA 1PFVA 4N5MA 3U7EB 2XB9A 4LJYA 4UULA 4X64B 5C0OE 4ENPA 1MAAA 4ESOA 1DJLA 2VJKA 3R7RA 1J09A 3M6AA 2HC9A 2Z4TA 4ZVVA 3T3DA 1DQYA 2G1PA 3SF0A 2X41A 3A8TA 4YNBA 2GRJA 3V31A 3L4BC 3TDMA 5LQDA 1GA4A 5ARDA 5KKAA 1EZZA 3JCZA 4QJ5A 2QN9A 3EOBI 5EP1A 2VHTA 2X4IA 4ZO8A 4BU0A 1M6EX 3U5ZB 3OA0A 3SIXA 3ZNOA 4PONA 3TCKA 1Z62A 4XPIB 3LL7A 4AKEA 5JSYA 1XT6A 2F90A 2P2NA 3JQAA 1GJRA 4MQUA 3TOXA 3VHQA 1QGYA 2G77B 3SR3A 2JRCA 2VXOA 1WE2A 4OH1A 1SCKA 1XVUA 2E48A 3EY9A 5H83A 2PV7A 2AK3A 3D6HA 2ZE7A 3M83A 3AFOA 2R8RA 2BI7A 4AZ3A 4PX2A 3PDNA 3HU5A 1PWXA 2ZQZA 1JPUA 1T6YA 3PUZA 1HKHA 2EQAA 4YVFA 1J2UA 2WF8A 1IBKB 4TMTA 4LXYA 4FDTA 3HKDB 4YRIA 4Z4QA 4NBWA 4R1OA 2HPZA 3R3JA 2XEVA 4BXOB 1G3MA 3FVRA 2UVPA 1RBQA 1ZGJA 3GGGA 3ZIAD 2QL6A 3H16A 4CYMA 1EFRA 5DV9A 1JHPA 4OI1A 1UZLA 1YSCA 3MK31 4QFMA 5J1SB 5JAUA 3L4KA 2XTNA 3MOSA 4Y7CA 5I7UA 1W4BA 2AW5A 4COKA 1WUYA 4GCOA 2O8EA 2PH3A 1MG5A 2Q2NA 4A16A 3QVWA 2J4FA 2FZKA 5EMJA 4Z49A 4FZRA 5F76A 5I3CA 2MSWA 2O3TA 4ZZ3A 3VDRA 2QRJA 2X6HA 3DE0X 3BB3A 3KUCA 4BMSA 4JQOA 4F1SA 1AC5A 3DAHA 3Q47B 4G8CA 4ZVMA 1OWNA 5FEMA 1CUFA 4TUYB 4AWBA 5IHPA 1PN3A 3CB2A 1QZ3A 2ZFUA 1ZK1A 3AJEA 2X40A 1VJ0A 4ZAYA 1A9PA 3UQYS 5KWVA 1AB5A 2YCBA 1RBZA 3FG9A 4X61A 4ZAZA 4YFYA 3ZDXB 4BMYA 5LWHA 4ABTA 3JYSA 1L6IA 4JC0A 2CLHB 3L0SA 1NVTA 3LT2A 4CMBA 4ZT5A 1P0FA 3C5RA 2R8PA 1ZISA 2ZJOA 4Z86A 1ONSA 4L5BA 2GH1A 2R6JA 1MXHA 3I76A 4PZPA 1XTSA 1Z39A 4A8JB 2QENA 3WGOA 3HE3A 1SQGA 5TSDA 5TQ2B 3PFIA 2ZITA 4HJXA 4X95A 2N46A 3I64A 3ZWQA 3FOEC 3TXMA 2WXRA 3MT9A 1W49A 3NRCA 1RBMA 3ETHA 2W2MA 2X5OA 3G0CA 4CW7A 1M5TA 1YB7A 1HE8B 4L6CA 5BNZA 2H1WA 1CG6A 1H42A 3MCAA 4PZUA 4U7TB 3CN7A 1T0BA 1Z0JA 2G0NA 5AXBA 3RNOA 4ER0A 3M6IA 3BILA 2PKRA 3NUGA 3UKOA 4ZYLA 5KNBA 5KOHB 1EP9A 2F8LA 3FCSB 1XN1A 3ZV3A 3FKSD 2UXCB 2AOWA 3EHNA 2GPJA 1RZUA 3E61A 3RYTC 3GUUA 3NHZA 3QBDA 4P54A 2A9VA 2WIFA 4ANVA 2C1ZA 4X54A 1B6RA 4F60A 3NEPX 3ZZTA 2Y0DA 4Q1VA 3H1FA 3NETA 4U5XA 2NTEA 4I1VA 1N4RA 1W3BA 4DPRA 4N2SA 3KXPA 3CHOA 4ZCPA 1G64A 2FMFA 2QTMA 3VYUB 3UCXA 1R7RA 1ZK4A 2M6SA 2WJAA 4B8WA 2OPBA 1JH8A 1Q1NA 2HPHA 3G7SA 5JHAA 3HU3A 2I1JA 3PQ3A 4LWZA 6REQA 3SWWA 5DTQA 3O8DA 1FMCA 4KWIA 1G4HA 2GCNA 4KRGA 5K3EA 4ABYA 3RIGA 3Q6IA 3NHAA 1HG2A 3CBGA 3IAS1 3IAAA 1H6BA 4RVNA 4XQGA 2WG1A 3B13B 5AVOA 3TJMA 4J0CA 4OOEA 4FJ1A 4ENWA 4PW0A 1Z2AA 4IGFA 1VE1A 3FCYA 4LYFA 3B20A 2LE0A 1XPUA 3AHEA 4RNCA 3TLYA 2FEWB 2A9RA 4AJOA 4GSKA 4O4IB 1G291 4C4SA 1I5RA 4B3IA 3GZ1A 2D2FA 2PQ0A 1CUJA 1B6SA 1G0OA 1K5PA 3P1JA 3P9CA 3OZSA 5FL3A 1OFHA 1TJCA 2C9ZA 3W34A 5CA1A 1CS4C 5D5PA 3PFFA 1F0KA 1HQYE 2RK4A 4ZXFA 4UQOA 2ZTUA 4DDKA 4OYHA 3RJVA 1UBLS 3ELDA 5A3SA 4W5TA 2PGLA 2QA5A 3GLHB 5DCUA 4LPKA 5DK4A 5IH3A 2P2CA 3BK1A 3IAHA 1E4VA 1XZ8A 2FB9A 4YP5A 5UKDA 5HZHA 4YVOA 4P6VF 2DAPA 5CPFA 5DBIA 5KHAA 7REQA 1B8UA 2NSZA 4FFPA 1XQXA 2R85A 3SX0A 4N5CA 5G55A 2WXOA 1XBTA 2A92A 3HXLA 3CKYA 4Z68A 1MEEA 1FOEB 4WXPA 3UMJA 4BEVA 1EWYA 1YIOA 1QQEA 4L57A 1N2IA 5C80A 2AKYA 3L1KA 5C5IA 4ND1A 4AKGA 2R8OA 3OLXA 4JA0A 3HXQA 2OY0A 3DZKA 2W6IA 3GA5A 4GLFA 4FHCA 4XA8A 1GNQA 2Q5CA 3UJPA 2OORA 3TRKA 4U6QA 3V42A 3X1YA 1EWRA 2V9ZA 3TJZA 2ILVA 4IRXA 1CU1A 1HDGO 1KOJA 4MVJM 4CU2A 2WTEA 8ATCA 5EZQA 4WVFA 4ME2A 2HMSA 3SM9A 4CIBA 2JASA 1MFPA 2CKDA 2FWNA 3CINA 3GJ8A 3I04M 1PR1A 2H1VA 3DOEA 4TWIA 3KYCB 2I33A 3I05A 3QARA 1JQBA 2PQ6A 4Z0PA 4F04A 1EIWA 3A06A 3ZWWA 2I4RA 1PS9A 2HDOA 4BEJA 2E37A 1UBGA 2GN0A 4U2FA 4AROA 1K08A 1Z7YA 4U00A 1BMFD 1NMQA 3WXXA 1AKTA 1R6TA 1T34A 1ZI9A 2FX3A 2IL1A 2Q8PA 2C8KA 3DO8A 3K8OE 4UCFA 4AI6A 2DTDA 4W5RA 3RU0A 5E3JA 1UWCA 4TMVA 5C1IA 1NT4A 3BS4A 3BIWA 2C82A 3A32A 1IG3A 1QZUA 4QRIA 3RIYA 4LNBA 2Y93A 3Q7EA 1XJWA 4INZA 1WPRA 4XSGA 2Y92A 1ZJ6A 1PAUA 3ZIDA 4G56A 3JVDA 3L8GA 4HLUA 4MWBA 4DJAA 1P6XA 3UOWA 1RC0A 3WGMA 3CYFA 3G88A 3ZK7A 3ZE6A 1AMNA 3THRA 2JHPA 3COPA 4FX2A 1QK4A 4KPEC 3LUKA 1SNYA 3I30X 3G0HA 4NOJA 1QGDA 3AETA 4LF8B 4URFA 2VQDA 1ZCZA 2YMPA 4OBBA 3TVTA 3E3OA 4RLSA 4YRMA 4ZYYA 3HHMA 4LAFA 3AZPA 4MIOA 4ZVPA 2WFMA 2O7SA 2PO5A 1L7BA 3HJNA 4UE6A 4YJ3F 5DWQA 5B1DA 3S70A 3K0FB 2DVWA 2IZOA 5AD1A 5AOCA 5JCXA 3X43A 4P31A 1RYBA 1KR2A 4I4TA 4O33A 1PSDA 3QPDA 3OE1A 3RAUA 3ZGOA 1Y6IA 2IJGX 1AXRA 2I66A 2B6NA 3CX6A 1WBBA 4L22A 2IP1A 1KXZA 1T25A 5F9HA 1SBIA 3CCFA 3TWXA 1FEZA 1PDOA 2P75A 4UWFA 1VL1A 1LPBB 3AM4A 1FXSA 5G2NA 1IN8A 1JG4A 1X8JA 3LFTA 1GU1A 3P94A 1EP3B 3DEAA 1IK4A 3GAMA 4FGJA 2UZIR 4XCQA 6ADHA 2JJYA 1CUYA 3DWFA 5CBKA 5HYVA 2X58A 3A1WA 3CNBA 3J7TA 1C7JA 5AJTA 4CIAA 3L6DA 3T4PA 3HJHA 3SZ7A 4HH4A 3RSSA 4I55B 1PF7E 1HL7A 1VJ1A 2H7XA 3RAEC 1W30A 4I5FA 4LC9A 3A7EA 1DG1G 4IIJF 2C97A 1J06A 1U98A 1Z15A 1E94E 5LB4A 4B4OA 2ZWIA 1QM5A 5DTIA 3BKWA 2HA0A 1PGOA 3K9BA 2XHZA 3ZH2A 4DVJA 3ANLA 4O8CA 5HILA 4RJIA 3BFVA 5AJZA 1ZXLA 3PD0A 2XUZA 3FYUB 3GN1A 2XVMA 3CJQA 4HEA1 3OAAD 3RS0A 4KBGA 4E2XA 3N75A 2PJUA 3U6BA 2EW2A 1NVVR 5HK9A 1K8ZB 4OXXA 1LC0A 4UFOA 5AR1A 1X80B 3L4EA 5ELLA 5IFKA 7MHTA 3DOUA 4P34A 1FP2A 1H8EA 1KZ6A 2CL6X 1FCJA 1K9SA 1NBOA 2IHKA 2ZRFA 3I4CA 4OQLA 4S2UA 2QNBA 4ZI7B 1ZOSA 3FFTA 1Z73A 4L5IA 1Q1QA 3N6RA 3SQVA 4ZTZB 1ZO8A 2ASVA 2EKBA 4MQEA 5CVJA 4DLRA 2EOAA 3W9GA 2OKGA 3CVWA 1JSLA 3IIEA 2ZCUA 5ANRA 3WZLA 1QP7A 1P9LA 1EX1A 2XUIA 1UPUA 1RYMA 2F0YA 1QH8A 5E76A 1Q5PA 3MS2A 4PG6A 3PPYA 3ILVA 4DF3A 3T7RA 3ZEFA 2DT8A 2P5YA 3PDWA 2GN8A 2AFRA 1RXUA 4H27A 1CERA 3GJYA 2YFQA 4KFUA 4J94A 2G71A 5EN4A 2WC1A 5ENZA 3CLKA 1NL3A 5J3JA 5LM3A 3IVMA 1UFQA 3Q9SA 1DT3A 1G63A 1HH8A 1QH1B 4DT1B 3HB5X 2O50A 5JI2E 3JQDA 3A6GA 1N8KA 2JFPA 4XX0A 3GRFA 1X8XA 2QN2A 3DLTA 3QYPA 3ZCUA 4HATA 4CVNA 5HRUA 5LZ9A 3G23A 5M5BA 2NZ8A 4WKGA 3D7LA 4R7ZA 3MPUA 4LXQA 3V8QA 3I5MA 4C7MA 4LTDA 3C48A 3CSFA 1USUA 4LYHA 1W36D 2BDEA 3LAWA 3FUJA 3VNAA 2ZPAA 5HDBB 5LBIA 3B3JA 1L8AA 4MJ7A 2LR0A 4BZQA 3LX8A 1RXVA 4XJVA 3ZWYA 4AP6A 1N5LA 4X1YB 1V45E 3GFGA 4HGQA 1K8KG 3B82A 5ALZA 4DILA 3MUEA 1QNLA 3KEGA 4QTTB 3TLCA 2C2GA 3USES 1GM5A 2C58A 1ETHA 5ULLA 2UZ4A 1B1CA 4DV2B 2WB4A 1SMKA 2AQ8A 4KJZA 3C8UA 2H06A 5BMVA 4JX8A 4S1WA 2ZRKA 3WJ2A 3WXBA 4EMTA 5CITA 1Z16A 3H3FA 4LF6B 3MGCA 5L4SA 5I8ZA 1LDEA 3A9SA 1C7FA 1GRVA 3W8RA 4DLUA 1COZA 3SOPA 2NXWA 4W99A 2XUPA 4Y2TA 5A7GA 1HSZA 3VLDA 4C0JA 3QV1A 3CO0S 4PRKA 1GQSA 4EG7A 5KDDA 2JVJA 3FLEA 4XVQA 3R7BA 3VH2A 3APFA 4N18A 3MN1A 4GC9A 4S05A 1I2DA 3GVCA 4J7XA 1JMYA 4LJ7A 3EWIA 3MWDA 3LO5A 4W6QA 1XPOA 4IIJB 4QQFA 1AJEA 3NT2A 4M0DA 4UD6A 1P77A 4UEOA 1H2TC 4X8MA 1PJZA 5KNDD 4X1KA 5IKXA 1QUFA 4NURA 1V0JA 3HV0A 3AVWA 1L5MA 4KN6A 2KBXA 4Z4GA 3WV4A 2VIIA 1QFXA 4ND4A 3KEAA 2V4MA 4DXDA 1T3GA 1QKKA 4RKWA 2L69A 1EFPB 1V7CA 5AW7A 1YRWA 1TW2A 3NOVA 3EIWA 3N5CA 3MS7A 4YC7A 5ER6A 5G3ZA 2VTBB 2VKQA 2EKDA 1GSHA 3EDOA 1BSVA 3FUXA 1JR3D 1JWBB 3WL4A 4C08A 1BVHA 3DSUA 3RBVA 3D02A 3FBTA 2UVPB 4K87A 1V3TA 5JASA 2PH5A 4GXNA 3SBDA 2Q7XA 1U3FA 2SCUB 3DFZA 3U40A 1SRRA 3IEUA 1X81A 1ISGA 3AQ4A 4LVOA 1XMQB 2OGUA 4AZ3B 1R6BX 3ETLA 2VHVA 1SPXA 3MRXA 5AYVA 5CG2A 1U63A 1Z3YA 2NZVG 5DASA 2HO4A 5DNCA 1LPPA 3UMFA 4IMPA 2G07A 3MJWA 3A3PA 3ETDA 1OV6A 5JISA 3KSQA 2AI3A 2RC6A 3H6GA 2QMUA 2JD0A 4DX1A 2QFCA 2FMIA 3IDSA 1AXEA 2R1TA 1K06A 3UH1A 4C0XA 1OB5A 1JU3A 1KK2A 4IHQA 4WWNA 4BLPA 3LQKA 1LDBA 2CUTA 3ROKA 2OYSA 1GN8A 4RS3A 3DAFA 4IJQA 2XWSA 3PQ8A 2J9QA 4X1OA 5J5CA 3UMSA 3U3RA 3P4YA 1AG9A 1E6LA 2Y4UA 1XCOA 3F2IA 2JDID 5KSYA 1L7MA 1ZVJA 1TB4A 4TTQA 1JB1A 2FPRA 5KNHD 4XGIA 5LZ5A 5C4MA 3T6KA 4GBMA 3K5HA 1CY7A 2OOKA 4BJ3A 3EG9A 1GSOA 1DCQA 2OEWA 2ZT6A 1O94A 1C50A 3WTBA 3J81k 5KYKA 1LTXA 3PGLA 5FJJA 3FMOB 4QXQA 1J8DA 2CL0X 2WPDA 3EXFA 1SCIA 2G67A 3LQRA 1MLDA 3TJPA 4LMPA 4O6VA 1UK7A 4P7FA 1FU8A 2ZTLA 1BKYA 4F38A 2ESRA 2IYRA 4R9NA 4E13A 4I9CA 1R10A 2EDCA 5CA0A 4O2BF 3A7DA 5KWJA 1PT7A 3FUMA 4Q94A 1M2HA 4ME6A 4MR9A 2A0YA 3FWNA 4B94A 3M6MD 4P93A 4WEOA 5G02A 3I09A 4B8AA 5FAXA 5B12A 1VHJA 1YCSB 4U0JA 3PRZA 2PUGA 2JGLA 5JDCC 5JCOA 1T2FA 4M1OA 5T67A 5LQUA 2V0GA 4KRXA 1DDOA 2YRXA 2ZJAA 4YP1A 2ZYIA 2QE7D 2WTUA 1JTEA 1PGPA 3CR3C 5C4GB 1I8TA 4CFZA 3VC7A 2ZGVA 4WW0A 3MEKA 4OQMA 4PSKA 4UNRA 1P9RA 2VDJA 3GFTA 4PV7A 3IEIA 3LYAA 5FUWA 3BCRA 4M37A 2KX7A 3EW7A 2XT9A 1E3JA 1P3JA 3RT9A 3ZE0B 4C5BA 4E5PA 2BYTA 2WQHA 3H83A 2WSYB 2QMEA 2I8CA 1FU7A 4QUJA 1FVXA 4M7WA 3CLVA 2QVLA 3D3EA 2VJYA 3MB8A 4Q9JA 5AK3A 1FP6A 3JQBC 3UXGA 4MLPA 1PG5A 5COAA 1JLSA 1GITA 4CQMD 2WQ7A 3VI3B 4ZCRA 4K1LA 3BERA 3OQBA 3RF7A 3H9UA 1YZUA 3PRKE 4J7AA 3SQDA 2FGJA 3WGVA 4F3VA 4D8TA 1NA3A 1SG9A 4G5OA 1N95A 5J59A 4CDNA 1JKFA 4AUEA 4QUAA 4BX8A 5EUCA 3E2MA 4IJUA 1Q6YA 1JAIA 3ZDAA 3ORRA 4AYTA 3NWPA 4NYMQ 4J3NA 1WRBA 1E1DA 1KZYC 3BRWD 1NI4A 1JHMA 1Q12A 3CS3A 5ENPD 5FINA 1JFRA 3AM3A 3TLXA 4DZTA 3N0TA 4MW7A 5CGZA 1DUVG 4B6JA 1QFSA 4YDWA 1JP7A 5H1YA 1ILEA 1MG0A 4N7BA 2FQYA 1QHSA 2JGAA 1CSEE 5ALLA 2JAUA 3AZOA 3KXLA 2QPAA 4J1QA 1UOOA 2FUG1 5IJAA 1GA1A 1KZ1A 3OCWA 4NZPA 1OWMA 1LJ8A 4YBRA 1FS4A 1M7BA 3OBIA 4K2HA 4RENA 4DYVA 3C6MA 2X0IA 2BI4A 4R7TA 5EWLA 1TRKA 4UAVA 1JJFA 4BIIA 5JZMA 4NZ9A 5IBCA 1MA3A 4AX8A 4HNAB 4FFSA 5PNTA 4GVXA 2WIBA 4MWOA 4TUYA 5NLLA 4B5KA 1IUOA 1M5RA 3IR6A 2PGDA 4BMPB 1VRVA 1DX9A 2VTEA 3EXHB 2NOAA 1RBYA 2P9BA 3GLQA 3F4BA 1OC2A 4NCJA 5FTLA 2EAUA 2XKJE 2IOQA 1A72A 4GBJA 4I8XA 4RA6A 2B94A 3OX1A 2QY7A 1BD3A 2WU3A 4PO9A 1LFDB 4TUUA 1DQNA 1WZEA 1XSEA 2BTQB 5AQAA 2GPYA 2VLBA 2YWHA 3KOUA 3OIUA 4TKUB 4E21A 1XNFA 4MYTA 3CPHA 3JYLA 1U4SA 2BL4A 3LHSA 4G0PA 3KQKA 1TTQB 3LX6A 4JHKA 5TMPA 3K5IA 4YR9A 5BXQC 1K1AA 1UZAA 1ZK3A 1QONA 3KTFA 5AUNB 3MGBA 4J1TA 1A4UA 4B43A 5BSVA 2JJ2D 1Y7TA 2GZMA 3W79A 1TJ4A 2BEWA 1GTG1 4U7WA 2XKBA 2P1RA 4X60A 4AEZC 3V7WA 4DNOA 5EJ8A 4C3OB 2P9YA 1P7VA 2AG1A 5ALIA 5GM2A 1K6EA 1M2KA 3WLHA 4ZJZA 1HR0B 1H2XA 2UYOA 4O0LA 4OM8A 1L5FA 3F6RA 4YHBA 2G8LA 4BFWA 1G7RA 2XOKA 2EYUA 2VT2A 3RARA 4LHZA 4DX5D 2AR9A 2GTIA 2A14A 3ZNQA 3PWZA 4TLDA 3WL8A 1UWLA 3M3DA 4YUYA 3I6BA 2A33A 1ZUWA 2J8ZA 1I4LD 2QZJA 2QLMA 1F3LA 3HLYA 3D4IA 4NMHA 4EGQA 1PZFA 2G7MC 2O0HA 2YJTD 3EVEA 3EXAA 2RSLA 3EBOA 4TYQA 3TL5A 4JR1A 3IXMA 3TBFA 1PWYE 2P4HX 3TPFA 1JHUA 4YUXA 1NBWB 5CNJA 4CEIB 5IABA 2VP2A 3RKVA 2V97A 4Y9UA 5K51A 1QQ6A 2QN8A 4BP9A 4R0VA 2V7EA 4P4GA 4GM0A 5FBWB 1T1RA 4WLEA 3VJMA 1Z0FA 5DVZA 2WJYA 3ZLUA 3ZYZA 1FZTA 3OJLA 4IKPA 2F8YA 3CHMA 1XWFA 1LLUA 1IN4A 3HKEB 2CUKA 2ZIGA 3FNRA 4L50A 3FYTA 3AEUA 3ZS9A 3NAMA 4FXPA 4G1UC 1BROA 3ZG6A 3HKBA 4P58A 1P5JA 4FZJA 1Q0HA 5IZCA 4F56A 3F7MA 3PP8A 4APOA 1W5TA 2ET6A 3FSEA 2HI0A 4JLVA 4PYIA 4Q5IA 4LFBB 1JI3A 4ZCSA 1BEEA 3ONLA 2Y2UA 1ZICA 1EFPA 1EXNA 1ORVA 4EF5A 4X20B 3U4IA 1IFXA 1VE3A 1U02A 2IW1A 4C9BA 3CPSA 3QXJA 1YUBA 3LPCA 2CBXA 4ZQFA 3QC1A 1T8TA 4FMPA 2JI9A 3EXHA 3EGWA 1G7TA 4NCHA 1JFSA 2C2OA 1AUPA 4PRYA 1YHNA 3CG4A 2RFMA 4OAPA 3LUHA 4BO5A 5JFTA 4TSFA 1KIMA 2QAGC 3EEBA 4M4SA 3TSCA 4O08A 4Q4LA 4PCLA 1RTKA 2JCBA 3B78A 4AVXA 2EL9A 3A05A 2IDMA 4MHOA 4UUBA 1GD1O 1PUJA 1ZUNA 3PQ6A 4LXXA 3PUKA 4QYIB 2IS1A 2XB6A 1M6YA 3QF7A 5DX1A 4NYIR 3SC2B 3PVZA 4IMIB 4GX0A 4CRWA 2PMEA 4E33A 3THXA 3KSMA 1IB6A 1KI1A 4RF5A 4ISBA 3AESA 3ET5A 4IFEA 2VTDA 2ZZNA 3DTNA 4D0GA 1EM6A 4BB0A 4RJTA 1NVUQ 1TPZA 5DCWA 3LLUA 3PJGA 3U3OA 1TJNA 2J0SA 1HWYA 5JCJA 3FRJA 5A1JA 1VDMA 1IC6A 1PT8A 1ZGZA 3NRBA 4QFBA 1GDHA 2C00A 2H0AA 3MTGA 1WSDA 4R4JA 4I5GA 3DT9A 4F1JA 1NDQA 4HMPA 4MARA 5F5NA 3SJ7A 2OCPA 3C3QA 4E31A 1E4EB 5A6SB 4NU6A 2DJ5A 1TLLA 3LXXA 4RNDB 3R7AA 3MUFA 4HWSA 4U6NA 1T26A 2FE4A 4M6WA 2BUBA 3WGUA 1VBFA 3CEMA 2PZEA 4YX9A 2OBLA 4NE2A 4W5NA 1M6HA 4MEAA 1KYIA 1AHPA 1BOOA 4KXNA 1L7EA 2IYVA 4LBVA 3QKSA 4CFSA 4Z4FA 3D8TA 2QN6A 3TNFA 5LXTA 1P5QA 1M1YE 3OX4A 5A9SB 1IWPB 1ZJ5A 3DZBA 3V1KA 3ABLE 1RM5A 1LI4A 3KAPA 3RUIA 3S99A 1BMQA 3ZY4A 3A4IA 3NV7A 5C51B 3HWWA 5CEEA 4Q3LA 3I4LA 1IXVA 1P1CA 3CVXA 3MKRA 1AKQA 1E2FA 5BWCA 3MM4A 3SE7A 3V1LA 1GPLA 2ZGGA 4P0PB 4QATA 3Q9UA 4A1SA 3BM5A 4Q1DA 3KSBC 1W88A 2OO7A 3VH3A 3FWHA 2IPXA 4AKHA 4LMAA 5IK2D 3W7VA 1TMOA 4PRLA 3QFRA 3CUKA 3G68A 3TMAA 1ODSA 4HUQA 5DM1A 2NWQA 3ED1A 4BU1A 1UJNA 1DWPA 2PNNA 1Y0BA 4XLLA 3C14C 3ZXSA 5BOSA 3JCKC 2WJ6A 4TX1A 3HHPA 1TQHA 1XDBA 2ZDGA 1L4FA 4OI2A 2A0XA 4CMIB 2PAAA 1UXJA 1EWVA 1ETUA 5CXQA 3T1YB 1PWHA 3U7RA 4HS2A 2QU7A 2G6BA 3Q88A 3AB7A 3RJ5A 3U9TA 2DE0X 2QSUA 3HDHA 2QD4A 2X3UA 2GETA 4GF5A 3V8VA 5CVDA 4CMHA 2C0LA 1II0A 2SKCA 4J7UA 3HI6A 4YDEA 2G76A 2I2BA 4QXMA 2HF7A 1HE2A 3NVAA 5J2UB 1KK0A 1NMYA 2P77A 5AJWA 3G2UA 2WSSD 1L7PA 2E21A 3KD2A 2NTNA 3LJKA 1DJQA 4MEJA 4Q9DA 2GW1A 5DBOA 1E9EA 2ZUFA 4WACA 4X5OA 1Z13A 4DCVA 5EIXA 3QWPA 2V0PA 1NVMB 3UAGA 1OCZE 4FDLA 4OHZA 3V4VB 4C6HA 1VA5A 3A2LA 4LTMA 2IEDA 1LD8A 1T5BA 4JKYA 4CU5A 2REQB 1TW3A 3QW4B 1JHXA 2LDXA 5TPZA 2VHZA 2H6FA 1PTJA 4ZYTA 2PX2A 2JFFA 2LVBA 3E0QA 1LZLA 4NBUA 4URVR 1PJ4A 1OROA 3C70A 3TI7A 3I0NA 4C01A 4PHFA 1FF9A 1RM4A 3R9KA 1KPIA 3FPSA 3IVRA 2PJDA 3K1YA 4D3FA 1ZCAA 3K92A 4EGJA 1P31A 4ZI3A 5LP1A 2VTBA 1BA3A 1PUIA 4IEFB 4XYLA 2FZCA 3H19A 4ZCIA 1FVHA 1L1EA 4FCWA 4MVYA 4LJ4A 4X0EA 2B5OA 3TS1A 5B36A 2BBWA 2VJDA 5HKKA 2W71A 2VAPA 3W9FA 2Q9AA 3CT6A 1JU9A 3IP6A 4RVDA 1D1PA 2HRQA 1IIBA 3E4BA 1Y9ZA 2IOSA 1HLGA 1PFQA 2PWBA 1EPUA 1UKBA 4LG1A 2C03A 3GB9A 4PVDA 2P0EA 3F3YA 4EWLA 3TB6A 3PDHA 2DBVO 3IHLA 4R1LA 1OIXA 1T9ZA 4QQNA 1XTTA 4QOJA 3HU1A 4WVLA 3FWKA 1CZNA 1FA9A 4E30A 4DM7A 2ZRJA 5AIJA 2JEOA 3R1IA 1SZCA 1T24A 1RHRA 2VDWA 4HLQB 4K26A 1E79A 1X1SA 2BHLA 2HEGA 1SVKA 4PPGA 2R1VB 1NQ5A 1O5OA 1GAWA 4JLUA 4HQDA 2ZWMA 4OHBA 3GEEA 5KTYA 1R0CA 2YXNA 2W43A 3C5CA 2NQ8A 4FJYA 4I9UA 2WWTA 4UXHA 2Q27A 3I8SA 1L5OA 1O9BA 3G0BA 4OREX 2IY0C 5BYJA 2NW6A 1IK6A 5CA0B 1A2KC 1KZ7B 5IBRA 1RWPA 1T4MA 1YZVA 5DKFA 4DMFA 4DWJA 2Q5JA 3OIWA 2BMAA 1LD3A 1NIPA 2KS6A 1LB1B 1WEKA 1IZ9A 3RTGA 4FM9A 2O5VA 4JT2A 4PC6A 2FX2A 2HA4A 4LSMA 1O58A 1ABFA 2DBYA 2EKPA 4AJIA 4EG5A 3IBTA 2OM6A 4LY0A 3ZW7A 5IMBA 1WPGA 3DL0A 1CRQA 3E5RA 1KORA 4Q3CA 1O95D 1ZRMA 5JS8A 3QVKA 1MO3A 4K6OA 2WXLA 4BWGA 4D56A 1DX4A 1R4NB 3AF1A 4NX2A 1AQNA 3LE8A 1GARA 1N5JA 2FUKA 1OXKB 4D9IA 4U8VD 5TMDA 1XI2A 3CV0A 3GL9A 2FQXA 3B7TA 3QKUA 1J1IA 2Y66A 3ODPA 1E0KA 4OXIA 4XWGA 2FEPA 1MT3A 1KBOA 1K1BA 1RMTA 1ZRSA 2DR0A 3ZX4A 3IMKA 3P27A 4NFLA 4AY4A 5FOXA 1IH8A 1AURA 1Z3CA 3RM3A 1VDZA 3BGIA 1K7EB 1L5GB 3DDUA 1C9KA 1HL3A 1ZA2A 5ALDA 1FYEA 4HVAA 2O54A 1PU2A 2P3SA 4CG1A 3FPJA 4O4IA 3JYPA 3S8EA 4JZYA 3CR8A 4DARA 3B51X 4BFCA 2LCIA 4I1AA 3GJRA 2P3OA 5SYMA 1N4SA 1O5MA 3C3AA 3TTVA 4UUAA 2SNIE 3ZU2A 3KSLA 4GTMA 5CHEA 1NQWA 3FMGA 3S2IA 2XD9A 4PLYA 1H1TA 4BTLA 2XZOA 3NEYA 4ANUA 1PR9A 3H2IA 2KMLA 1CY4A 1GZHB 1MB9A 2BF7A 2IIPA 3MJEA 3OWHA 4RKQA 5B1SA 3STWA 1OYOA 2Y77A 2HJGA 1MX9A 4L9SA 5F3DA 3ZBQA 1UP7A 4UZFA 1ULAA 2REBA 2KYRA 3FE2A 2NM0A 3OQ6A 4V0MA 3DFMA 4TZKA 5JMWA 3ZDCA 3NHUA 2AHRA 2ARKA 3D3JA 1G21E 1JHRA 1LA2A 2OCAA 2ID7A 2WM8A 2IFTA 5CUQA 4DWVA 3JRXA 4YYEA 4YMUA 1FNNA 2XBUA 1Y8MA 5ALWA 5FJIA 3UHAA 2RHJA 4W5WA 3A6KA 4MRMB 2HHAA 1FIUA 4CLOA 4UOEA 2CMGA 1U0HC 4EG3A 4QOFA 1SA5A 3NEAA 2QX6A 1S3FA 3WFJA 1I1OA 4AOFA 3FIJA 3EHRA 1P0PA 3TLZA 3ZTYA 4PYJA 1YFZA 5JAHA 2CYAA 5G4KA 1QJ4A 2PWPA 4QXOA 4WNIA 4UUCA 3K8ZA 4Q3KA 1X38A 5B7NA 3UT5B 2ZI4A 4BFVA 1MU0A 4TV8A 3VUFA 4AY2A 1D3AA 4DV3B 5LL6P 2IIQA 5GIPE 2OEVA 2EJWA 3UI2A 2PUFA 1FDIA 3LUDA 2GPNA 4QU8A 5KJLA 1F6BA 2HNKA 3QQ5A 5BMVB 3GEPA 1PSZA 3R8XA 1DQZA 2GBGA 2X4GA 4XOIA 5IN4A 2BFDA 1GRRA 3AG1E 1VPLA 4K40A 2GZ3A 4KYOB 4FLEA 5T4YA 1I4EB 4WKCA 2NV0A 1L8QA 4H3VA 1C1XA 1FJHA 1EQUA 1NHGA 3VH1A 4C1BA 1XTZA 4EAQA 3BDAA 1IAQA 2EFJA 3IHYA 3IQDB 4RJLA 1EDZA 3B2EA 5HUHA 2UVQA 1KAGA 3EQ8A 5K3BA 1H1DA 5BV0A 1EWKA 1UM9B 4B93B 1XZMA 2RCYA 2NXNA 2OR3A 1ZEJA 2OV3A 2IKQA 3IO5A 4NLLA 1YC2A 3SQOA 1HRKA 1OH5A 1F9AA 2V7QD 2Z8YM 5K7SA 2X1HA 3F6CA 2IV7A 3PXUA 1EAMA 2V9CA 4OLHA 2ZLBA 4I3HA 2OO3A 4JKOA 5T3UA 2ORYA 3JASA 1SQFA 5BQ5A 2FVXA 4Q4HA 4F8JA 1R0WA 2QM8A 1OLXA 2OWDA 1Z38A 3WI7A 4RZ3A 1YB5A 1TF2A 1E7QA 1E5TA 4I19A 3SVTA 1DTEA 1YACA 1DKQA 3QX9A 1H6OA 4EO4A 3TTYA 1JUQA 4A8TA 3R9IA 2XZTG 1R5JA 4Q66C 2IEGA 4HORA 1KIFA 2FXIA 3KU4A 1RMQA 3HNOA 4L4UA 2A9OA 2R1ZA 4WCDA 3UXMA 4YTEA 3LECA 2CFUA 4EW2A 4UTNA 2QRLA 5KQRA 2VP4A 4E5YA 1O6ZA 4B40A 1FSFA 2I7DA 4DLYA 1RFGE 1Z45A 4KQ6A 2X7XA 2FUCA 4L76A 2X0FA 3OJCA 4N0PA 5BOSB 5DBKA 3SO8A 5BV1A 2Q5FA 1T6XA 3H17A 1NW5A 4ZXPA 2D13A 4Z9FA 1R0LA 2JFYA 1S3IA 1NXVA 4LF9B 2I3ZA 4L0CA 3GOQA 2I8AA 4BO7A 4PNPA 3EEFA 5K0EA 4G1BA 4W5JA 4GWLA 4XDGA 1E9VA 1PP4A 2WSMA 4B6SA 5EJ9A 2HJRA 1TYAE 1WUTA 2HGSA 3K96A 1ECGA 4FI3F 1VLJA 4RLHA 4M49A 4CTKA 1GSAA 1M2WA 1EG7A 1TKCA 3N2GA 3R0VA 4RM3A 2Q45A 3KVVA 1ZRNA 4IS3A 4OAOA 1NP7A 2O06A 3CVLA 3EVAA 4RKRA 5DWDA 1LTHR 4HNUA 2VUUA 2XPIA 2BCGY 2EP5A 3L8ZA 1E2JA 3ANNA 4IWYA 3DPUA 5I7SA 2XZPA 4DUZB 3A3NA 3D54D 1LGYA 4B1FA 5A6CA 2W00A 3W0LB 3EVZA 1NXQA 3WAKA 3F5SA 2QLTA 2J31A 3L7BA 1Y34E 2GNOA 2F17A 4WNYA 4A1FA 3TLKA 2CXOA 3E1GA 2QYJA 3NYIA 1XB2A 4D45A 2TYSB 2VXYA 3A31A 3E9ZA 4D5GA 4ZMRA 4PLGA 5FQ7A 1V8ZA 1VB3A 2Y1WA 3J5QB 2R2GA 2A59A 4B0PA 2RD2A 5LD2C 1A8HA 1WOMA 3HDJA 3QITA 4KBYA 3D3NA 2VHCA 1ESEA 1QG2A 3KEFA 2A0WA 3GF4A 3PFHA 1AO3A 3L17A 2JI7A 2WWWA 2AG6A 2J45A 3FHJA 3FYCA 3H05A 1G18A 2FPIA 1H4QA 2Q1TA 5CHEE 4D9GA 2BUCA 4ATZD 1CLEA 4TWJA 4KFSA 2VZ8A 4YDYA 1ST2A 4C6SA 1WW3A 3U7FB 3T1VA 4LY6A 4MVJF 3V32A 2VCEA 1U3TA 4K28A 4K86A 4ASUA 3DAGA 3ENNA 3CVQA 2IONA 1EJBA 1Q0SA 2ODWA 2VYND 4JB2A 3GPCA 4Q4JB 4YRFA 3T34A 3DT6A 1T9HA 3KOMA 4NPHA 4X84A 5IDXA 4J7CA 4RVCA 4EHNA 4EPRA 4CM3A 1BWSA 3T5CA 1DQSA 2FQQA 1LW7A 4I46A 4K6CA 2X3YA 1W85B 3FMVA 4OHKA 3S2AA 1MFZA 1TZJA 1WQ1R 2ZTVA 3ZDYB 2I34A 2DCUA 2EJCA 3NASA 4GL4A 1GT6A 1SK9A 2KJQA 3A2MA 3BA1A 4BQFA 2HK8A 3F6BX 2PUEA 3NF1A 1C0PA 2C5FA 2WRZA 1LY1A 2H8GA 4W7HA 3R3HA 3UK2A 5JEEA 4Y8VA 1CNMA 2WT9A 2OGSA 4YT5A 3TQCA 1A69A 5JJIA 2FN9A 2B5VA 3DZGA 4EH1A 2WXGA 1Q14A 3D4NA 2C2WA 3ZI0A 5JY6A 5EIBD 3L0BA 2IX3A 3O95A 3I9V1 1UMCB 2WJHA 4GRDA 4GLLA 4ZANA 3ZU5A 5A2QA 2HRRA 3NGXA 2ZT5A 3UKDA 2IS4A 1KFJB 3DBRA 4OSEA 2ZIRA 5LOZA 1ZHFA 2GMWA 1QZXA 2PCLA 1EFUA 2Q3DA 3EISA 3G1TA 4R2KA 4WCFC 5E6UA 3ZUVB 1ZC4A 4HAXA 3HK2A 5DDIP 4WNDA 2HIHA 1VJRA 1QE0A 4GX2A 2BVNA 4DIUA 5JDCA 2IT1A 1M0WA 2LD4A 2Q3JA 3O8NA 1EBFA 1M73E 2P2DA 2YHIA 3PRJA 4GSLA 4JASB 4K46A 3ILHA 3DOJA 2D00A 1HFEL 2B98A 3Q40A 3TE6A 5CEJA 2DKFA 2CEKA 1Z5GA 2QW8A 5IAJA 1MA0A 1JSCA 2W4QA 1UFOA 3RUFA 4DDVA 3MEQA 4RMHA 3VRHA 1G5RA 4UNQA 1C1DB 2GQ0A 3IMEA 1AU9A 4RTRA 4IIUA 4QAQA 1THGA 2WJ3A 4H16A 2WFZA 2HR1A 3S7FA 3F74A 4CV3A 1C3XA 1ODFA 2PFSA 4BMXA 4Q3OA 1J9GA 3UFBA 1CF2O 4OV6B 5EPOA 2Y76A 4UUPA 3VPAA 1SBHA 3F96A 4HUQB 4TKVB 3WK7A 5A9TA 3VSBA 3G2JA 3STTA 1C7ZA 1Y1SA 3JARB 3ZC3A 1RRCA 1X7XA 2L82A 3FUKA 4HAIA 3TQIA 1CKEA 4C2BA 3JV7A 1V95A 4QDUA 1XJ0A 3W9BA 2W8BA 3SYTA 1PYOA 1GRCA 1OX4B 5KVCA 1AT1A 2QP9X 2QMZA 3DUFA 4UJ3A 1Z63A 3D8BA 3IRUA 1TMGE 2Z95A 4CEMA 1GLVA 1P6QA 4WJZA 1U99A 3K0AA 2X86A 2PLRA 3BEDA 1PKXA 2V7TA 4NU0A 3K3PA 4XWKA 1T8YA 3VTKA 2YY5A 2A9PA 3EBLA 4KDFA 4G5SA 1QE5A 1FMTA 1W6RA 3P4XA 3QKTA 7ADHA 3AHCA 4JYPA 2DYKA 3HP7A 1H5NA 3U31A 4F2PA 3G6WA 1F1BA 3IAXA 4TWZA 3S27A 4YV0A 2P69A 2Q0SA 3F6EX 4YGXB 2OA0A 3MD9A 3KJEA 4M89A 4Q3DA 5DE3A 3UJ9A 2ZRNA 3WLIA 3LT5A 3H2HA 2AEMA 3BJMA 4YK7A 3ADKA 2J33A 2FSPA 2DR2A 3JVVA 1UK9A 4PS1A 2C2YA 2E4AA 1TVKB 3HJUA 5AUQA 3IUNA 5A3RA 1ZMXA 4TXQA 5A6SA 4CDRA 4R1SA 1H5UA 2W2LA 5SZJA 3UXEA 1KP2A 3DQPA 2Y8EA 1YE5A 2GZ1A 5DCLA 3ITNA 3QBTA 3RUPA 4QYMA 3RHTA 4M9ZA 3QX3A 1SAYA 1QGAA 5JPCA 3DMGA 1D2NA 1YO6A 2BBOA 1C9JA 1Q7TA 4V39A 4KPFC 4XQEA 3IR5A 1IHPA 2NNWB 2YRWA 3BE4A 3DDCA 4NTZA 4PYMA 3R5XA 1D2HA 5FA5A 3WAJA 3GEHA 1QG0A 3MAAC 5AMXA 4CL3A 4MO9A 2A0FA 5E1MA 5FR2A 1QR6A 2YV3A 1WBJB 3KE8A 4G0XA 3VVCA 5ADUS 3KO8A 2PU7A 2XV1A 2DECA 4EFLA 4MR7A 4Q4CA 4OIFA 3QI7A 4O4LF 4C6TB 3Q8KA 4LRXA 3DSXA 3ZVMA 4MB0A 3RFFA 2FN8A 3I5PA 3B9BA 1C3VA 1CUWA 1B6GA 3INNA 4CTJA 1U5AA 2J9FA 5K2OA 1S6YA 4IO1A 2UAGA 3VYVA 3D5EA 3O92A 3VV3A 3TZQA 2J3HA 3MJVA 3Q7QA 2ATEA 2DPXA 1D6NA 2IDZA 3C15C 4OP3A 3HFGA 3JVEA 1AE1A 1H2RS 2GD1O 3KKEA 3QA9A 2P1ZA 3LZDA 3P52A 3RS8A 3SE0A 3TE7A 4E2ZA 2O05A 5D87A 2L18A 3LDFA 2VSXE 2OZPA 5U9CA 2B2XA 1P3Y1 1XE3A 3WBBA 5L3VA 2IHNA 4J49A 5KNLA 2HMUA 1AKNA 2I4OA 4P5EA 2ZR8A 1BS1A 3SJZA 3EXG1 3WBKA 1HYBA 2ZDQA 1MVLA 1XZJA 4Q6BA 3R6GA 2I1VB 2WTMA 4FLFA 4HMOA 2F8XK 1WLYA 3H8WA 3WWYA 2YIJA 4IXMA 3X2FA 4BNYA 2OV4A 3HXEA 4ENSA 1NNEA 4NJMA 2CXUA 2W6CX 2CK3A 2QVZX 3M4ZA 2PX6A 3RU7A 3AM1A 3Q9LA 4PLHA 1QUEA 2XSZD 2ZB7A 3U1BA 1EGHA 1Y8CA 2REOA 4OL9A 1Y80A 3ODGA 1SO8A 3DP7A 5AK5A 3AUKA 4QXRA 3DDSA 5A4IS 4IN3B 5JHGB 3UC5A 2I03A 1KU6A 2DTEA 1UC4B 2YJ4A 4XGRA 4TOIA 5CT4A 4HH0A 4L73A 4MR8A 5I01A 5ESRA 4YRTA 3C7CB 2F43B 3EODA 1OXUA 1QV7A 5CYOA 1PTJC 4B82A 4O1IA 2AK2A 4CM9A 2ZWAA 3T3EA 4YMTA 2XCQA 3OJWA 1XTVA 4OHCA 3E9EA 3HUUA 4QO8A 1H9CA 2FPKA 4N54A 2CXPA 4WK6A 2OO5A 2PX8A 3VBCA 1F8GA 1YMPA 3UT4A 2FPIB 4IDOA 3QELA 4BN5A 5I7WA 2ENUA 3GFRA 4NBKA 1SOUA 2RGBA 4PQGA 2HT6A 3RW9A 3OXLA 3DLAA 2QMYA 4FCTA 3ANYB 4YO8A 2FULA 4GPBA 2NYAA 2DG2A 1QIHA 4MAMA 2G36A 1E8MA 5D7BA 1P1KA 3LYLA 3QK7A 2RHGB 3GRVA 2OHOA 3HWSA 1I5OA 4MWEA 1OUMA 2VRBA 3SF4A 1PY1A 2ZJ0A 4GX5A 5TVGA 5A5FA 1T5HX 5MN6A 4TPKA 2QB5A 5EINA 4C4OA 2A5DA 3RC8A 3FOBA 4GYKA 4CUKA 3TG8A 2BR3A 5B4UA 1G66A 5HHTA 2YDXA 4WUYA 1JHAA 2ZANA 1Z36A 3CEQA 5HUQA 2FPGA 2AEFA 4A4DA 3GT7A 2GX6A 3DR5A 4JVLA 5HQ3B 4NXNB 2Z2XA 2JAOA 5BNTA 2GM5A 2SBTA 3Q0EA 5EXTA 4UPVA 5CFOA 3MTJA 1PNTA 4S1OA 1GPKA 3GDFA 4RK1A 5A3VA 4B84A 1QHGA 1N3IA 3Q9UC 3BTVA 3WQSB 2Z6QA 4M7CA 3N2NA 3WOHA 2HM7A 3SZRA 2AXPA 2W2PA 2ZSJA 3T7IA 3WB2A 3U5TA 1E5DA 1XTRA 2QRGA 2DBZA 1NOKA 3EIOA 1HF8A 1G1AA 2FW7A 2HJSA 1GYPA 3K5WA 3C6XA 3KFVA 4L2IA 2OYCA 4EHLA 1VC2A 2AXNA 1GZ7A 2GCPA 5C8YB 2MSDB 1KC3A 5TF4A 4IR7A 4O1HA 3IEVA 2J5KA 4OUDA 5DYTA 4URXR 2LGJA 1GL6A 4EB6B 1ZC3A 3IV6A 1HFJA 1U28C 1NI4B 4RIEA 1IN5A 4HWPA 4ZI2A 2OE2A 5KVVA 5AHRA 3KEZA 2WJWA 4DIFA 4BRSA 1K2VN 3JTMA 4ENRA 3PC2A 1SUSA 2WJ4A 4FP7A 2XRFA 3DE2X 4HQLA 3Q79A 1V47A 3GUCA 1SR8A 1NONA 1J0BA 3UGJA 1M6NA 4W9MC 3NC0C 4KLRA 1N3YA 1OLSB 4L0MA 1RJEA 4L8FA 2GT1A 4M0CA 4Q3BA 4PZZA 4S0XA 4ZOLF 2CJWA 5F77A 5CFPA 4RADA 4IUBS 2ZYHA 1XZKA 2LW7A 1LJLA 3ECAA 2A0KA 3QPBA 3NWOA 2RHOA 4FC6A 4IILA 3ZKWA 4N0MA 2IOFA 1SH7A 1I3CA 5A6VA 1ZBDA 1DRUA 3AF3A 2WW8A 4RESA 3AGQA 3W6NA 2RGCA 3BXPA 4TT3A 3VI4B 3WA6A 4WPGA 3R3VA 4BVJA 5J43A 5KOYA 2B78A 4MXDA 2WNIA 3S2SA 4WESB 4KNYA 2Q5HA 5CJ2A 4DB4A 4D8UA 1J9ZA 3P0HA 5AJYA 5DSTA 3DVSX 4GDMA 2WTBA 3LZ6A 5FYQA 4TYPA 2C7QA 2JI4A 3L16A 2GO1A 2H85A 1V7QA 3OUUA 2OXFA 2IBSA 5BN4A 2P6RA 3PE4A 3C3EA 3D7MA 1NQOA 5JFGA 3SFYA 3IBEA 1DC2A 3K4PA 5FWXA 3ITDA 3EZ6A 2WFLB 3JYHA 3AVTA 3W90A 4LEIA 2KW5A 4P53A 1JDNA 4YUZA 5IBPA 1JX6A 2XBLA 4KH1A 3UJ3X 5MN5A 5J5AA 3V00A 5IDVA 5JD6A 1O89A 1XQWA 2LWIA 4CLDA 5F7XA 4PYQA 2DOKA 4X91A 2ZM6B 2AIRA 4JP3A 3P19A 4UHKA 3AG3E 5FWDA 4FYMA 3SG0A 2MCFA 1NSFA 3FP3A 2J7KA 3V1NA 4XM2A 1CP3A 5DNWA 1Q92A 2Y0CA 1E3IA 2XB4A 3ONWA 4DM3A 2QRVA 3LT4A 1W93A 5HDQA 2CSXA 4UU0A 3G85A 1CJTC 4E08A 3FLBA 1RI4A 1MVOA 3L8YA 1TUIA 3E3LA 1YASA 2E1RA 4IDEA 4D4MA 1CDZA 3CBQA 5C4IA 1Q7CA 2NZJA 1H5QA 3G2IA 1QH1A 4DT1A 1URPA 3AF5A 2OUKA 1JMKC 1XJ5A 3GRCA 2PGAA 2ZRMA 3KAQA 4F4JA 4QWMA 2X2OA 2HQ1A 1ULUA 1UMDB 3AILA 5GGYA 5U4QA 3EZ9A 1KYWA 1T3SA 4CCAA 5AW5A 3SNKA 3TN7A 4EG0A 1QH8B 3RO7A 4AP5A 1A7UA 2VAWA 3W4JA 2X13A 521PA 3E23A 3KL4A 3SZUA 1A27A 1I10A 4RD0A 1B26A 1GTJ1 5JW6A 4F9TA 5EMLA 2ZR0A 3SAJA 3MGAA 1SBYA 3HR7A 2WYUA 4O4HF 4FHKA 1JEJA