2XGSA

Xcogt in complex with c-udp
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
542
structure length
542
Chain Sequence
LMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
molecule keywords XCOGT
total genus 206
structure length 542
sequence length 542
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgsA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgsA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgsA02
2XA9A 3L7BA 5A6CA 1QKJA 3CK8A 4UQYA 2FETA 4CTNA 3VTXA 3BD7A 3S7JA 4W9RA 3UUXA 3ZCUA 1ABBA 4GYWA 1XNFA 1K08A 2IYAA 1LWNA 3MBOA 4WHMA 3NP9A 4I2ZA 2R4UA 3CKCA 2QN7A 2VCHA 4H7YA 4WNGA 1SXQA 3L7DA 3OXLA 2MHKA 3ASFA 3E3NA 8GPBA 4N3CA 1IIRA 3BD6A 3NCHA 3S7DA 3GYZA 3T5TA 4CTOA 5FZRA 3LKUA 1Z6QA 2AW3A 3TOVA 3G2LA 2QLNA 3ASDA 1AXRA 3G2NA 2QN2A 2HYZA 5HQ8A 3G2KA 3Q3HA 1WM5A 4CDRA 3E4BA 3RT1A 2XGSA 3MT9A 3UPVA 1WAO1 2C0LA 3OY7A 2R4TA 5IKOA 2GPBA 1NA3A 4UI9K 3URZA 1NLMA 4BT9A 2VSYA 4GYYA 6GPBA 3MS4A 4KQ1A 2X0DA 3QKYA 4MHSA 2QZSA 4UI9J 5CCLA 3KAEA 4EL0A 4N3BA 1RRVA 2PZIA 1YA6A 3GPBA 3L7AA 2FF5A 2ASVA 4XI0A 4HOSA 1PSWA 3VTYA 2UWJG 2PYIA 5JTTA 1VGVA 2P58C 1L7XA 5ARFA 1UZUA 3Q5MA 5A7DB 2QFCA 2QRHA 5TVGA 3RU0A 2IUYA 3BCRA 3L7CA 3EDTB 4ABNA 4NC9A 5CCMA 3CV3A 3ZGQA 1NZFA 2C2LA 2KC7A 4J8DA 3SZ7A 4ME2A 4GZ6A 2VG8A 4GA1A 2GW1A 3H4IA 2IYFA 2BUGA 5EX0A 1UQUA 3UYKA 4WNEA 3AS4A 2V5FA 1QQEA 3GZ1A 2UY1B 3AS5A 2QLMA 3HBMA 3T7DA 1L5WA 2F3SA 4KBQA 3QHPA 4G2TA 4X7MA 4AY5A 2C9ZA 1WV1A 2VGXA 2G9UA 2H1HA 4FKZA 2PQNA 2QRGA 2XPIA 1KLXA 3S27A 2X6QA 2QNBA 4M60A 3C4QA 2XA2A 2YJNA 3S0JA 3NC4A 4EL5A 5DLDA 4A1SA 1Y8MA 4AM9A 5EX3A 3BEOA 5TMEA 2F9FA 3FROA 3BD8A 9GPBA 3NB0A 2VSNA 3QDNA 2PQRA 3RHZA 4RG9A 1IYGA 1B4DA 5EKQD 2UY1A 5HXAA 1IXYA 2JJMA 2WPVA 3ASGA 4WACA 4RIIA 4G24A 1E1YA 2O6LA 4GZ5A 2J9QA 3LY8A 4GA0A 3OKAA 3T3EA 4XI9A 4GCOA 5G05C 4AMGA 2R66A 4I17A 5ARGA 5LQDA 1XL1A 4RENA 3R9AB 1KTIA 1EM6A 3U3WA 1NA0A 4EQFA 3WAGA 3Q3IA 1V4VA 4JHRA 4N2QA 1LWOA 1P4HA 4F96A 1JIUA 3CVQA 1L5SA 3CEMA 4O6FA 4I9EA 2XCCA 2ATIA 3ZCRA 3CUVA 3RJVA 3SYMA 3UQ3A 3AS8A 5KJNA 3ZCPA 4X6LA 4F3VA 3PE3A 4AY6A 4GPBA 4RIEA 7GPBA 1GPYA 1FTWA 4AIFA 3PE4A 4HWGA 3CVLA 4WNFA 3MSCA 3ZPJA 4GA2A 4YUAA 4HOQA 4J0UA 5HI7A 4BWRA 3EBOA 3VDNB 4BFCA 4J8EA 2HR2A 3Q47B 4BQFA 2KATA 5IKPA 2GEKA 2LSUA 4PQGA 4HOTA 4RIFA 1FCHA 1TJCA 1NOJA 2G9RA 3RO3A 2LNIA 3O48A 3VUFA 4U0ZA 1JG6A 1OUVA 3S28A 1A17A 1GG8A 3G2HA 2FEZA 1Z8DA 2ACWA 3QOUA 2SKDA 3RSZA 3G2JA 2AMVA 3DDSA 1ELRA 3BDAA 3MT8A 4I9CA 4GZ3A 3S7BA 3HBNA 5DXFA 5TMBA 4NESA 1Y6FA 5KJMA 3ZN3A 5CHEE 5JTUA 2XCIA 4RELA 5G05J 4IN3B 2IV7A 4GYOA 1NVKA 1HZ4A 2X0EA 1F0KA 4NRHB 3SYRA 1KT1A 3IA7A 4JA7A 4X7PA 4LEUA 3TG4A 2GM9A 5G04J 4YVQC 3OT5A 3FFLA 3FP3A 4U0UA 4LEIA 3CX4A 3OY2A 2AZDA 3LYAA 4UQXA 4JL0A 5DIZA 3T3DA 1L5RA 2ACVA 2I6HA 2VGXB 1K06A 1RZUA 3MQFA 3MTDA 3MS7A 4EKEA 1XL0A 3CUTA 5JJTA 2YHCA 3S7FA 4XIFA 3O3CA 2AVPA 4MI9A 2E2EA 3OXFA 1P2BA 4F97A 3NAZA 1C3JA 2PQ6A 3Q49B 4NEQA 3L79A 5FZSA 4EJ2A 2KCVA 2AV6A 1ELWA 2VQ2A 1Z62A 5BT1A 3CEQA 4G1TA 1QM5A 3MV3B 1GGNA 5KJKA 3OTHA 3CVNA 2QRPA 4LDPA 2HY7A 4REMA 2QRMA 4H7XA 2P6PA 4BTBA 4BT8A 1GPBA 2JLBA 1SXPA 1YGPA 4NQ0A 2YQ8A 1Y8ZA 1BX3A 3RO2A 3NPAA 2BGUA 4W6QA 3CEJA 1YA0A 1FTYA 2R68A 3CK7A 4X7RA 4N5CA 3LPZA 3CUYA 1WW3A 5TMDA 3BEEA 3KD7A 4Y6WA 1PNVA 1QZ2A 3WC4A 2XGOA 1F6DA 4F9FA 1H5UA 1P2GA 3CUUA 2XGMA 4BQEA 4U07A 1XKXA 3AMVA 2PRIA 3E3OA 2ECPA 1PC2A 1FU7A 3QWPA 2BISA 2G9VA 5JJ6A 1JEJA 3LY9A 4APOA 3COPA 2XEVA 4CGWA 1P4JA 2QRQA 5GPBA 1WUTA 2SKCA 2C1ZA 1EXVA 3LY7A 4KQ2A 3FWVA 3NF1A 1RZVA 2X6RA 4UI9C 2Q7FA 5FJYA 3HBJA 1C50A 4AMBA 3TAXA 5LCWJ 2FO7A 4JA9A 2GT1A 1UQTA 4N39A 2FI7A 4CTMA 5BNWA 1W3BA 2LSVA 2Y4TA 3Q3EA 3ESKA 1HLFA 2NC9A 2OFFA 2F3PA 1ZBPA 4YI3A 2L6JA 1FA9A 3QWVA 5D01A 5ENZA 3KS2A 2KCKA 4GPKA 3BCSA 2IEIA 2GEJA 2IEGA 3RSCA 5FTPA 3TGOA 2R60A 3CK9A 4Y6CA 3LCAA 3MV2B 5D0OD 3DD1A 3U4TA 4MRAA 4KYOB 1P29A 3VUEA 5BW8C 3ZHEA 2Q6VA 2QN8A 4M83A 2VYIA 4U0SA 3CEHA 3WADA 4YI5A 3DZCA 3N71A 2WQHA 3CVPA 2FBNA 3D0RA 4KXKB 1XC7A 3ZCSA 3MTAA 2PL2A 3CUWA 3MS2A 2G9QA 3L01A 2Y4UA 3QWWA 3MRTA 3MA5A 2XCBA 2F3UA 2GPNA 2PRJA 4HOUA 1O6CA 2XA1A 3DDWA 3UYLA 4UQZA 3TSAA 2IV3A 3OTIA 3RKVA 2QN3A 3MT7A 3G2IA 4MHOA 4U04A 4EKYA 4B94A 2XMPA 3MRVA 3CKBA 3T3IA 5AYWD 3OKCA 1IHGA 2VCEA 3ZCQA 3Q15A 3Q4AB 1L5VA 4N9WA 3MTBA 2H1FA 4WNDA 2JZCA 1PYGA 3S2UA 1P5QA 3IEGA 3OTGA 2BGTA 3RIBA 4MI3A 3MRXA 1AHPA 1XV5A 1NOIA 2QN9A 1Y6GA 4I2WA 3ZCTA 4WUYA 2F3QA 1HXIA 3S29A 2KS6A 4G23A 1XOIA 1E96B 1HH8A 2XCUA 3EBPA 2C0MA 1P2DA 3OKPA 4RIHA 2GPAA 3GW4A 3JYSA 4FZRA 5D00A 2DBAA 4G26A 4BQIA 4L22A 2R5SA 2FFRA 1NZNA 1WW2A 1FS4A 1FU8A 4RIGA 4AN4A 1M5RA 4KQMA 1GFZA 2X0FA 1FC0A 4Z5XA 3ZCVA 3HYMB 2IW1A 4RBNA 1E4OA 4G2VA 3MKRA 5FT9A 3ASHA 3NP7A 2ONDA 1PN3A 3SF4A 5LCWC 4HORA 1GZ5A 3C48A 5D0QD 3CV0A 3K9IA 2WTXA 3ZFWA 1KT0A 2FF4A 5DBKA 5JJ7A 5C1DA 2ZB2A 4HLNA 2BFWA 3E3LA 1JIVA 4M7PA 2IFUA 3T3GA 1NOKA 2GJ4A 1P4GA 5DU2A 1JIXA 2VGYA 2PYDA 4WADA 4G25A 4GCNA 5FZQA 4N3AA 1GPAA 3TG5A 2HO1A 4YNDA 4BTAA 3C4VA 1J39A 4MICA 3GUHA 1ZU2A 2C1XA 1C8KA 3PDNA 3D1JA 1JG7A 3BCUA 1L6IA 5G04C 3WXXA 3D0QA 2SKEA 3T3HA 3VDMA 2QN1A 1WV0A 4CGVA 4QLBA 3ZHEB 4MI6A 1Z6PA 1L5QA 3OXGA 4J8FA 3QKWA 5I45A 4N2SA 3MEKA 2QLLA 1C8LA 5M72A 5KJLA 2KCLA 1A8IA 4YVOA 4I1AA 1WUYA 3IAAA 3ULQA 2C4MA 1FU4A 1NZDA 3GZ2A 1B89A 2OOEA 2IF4A 1FTQA 3H4TA 3HBFA 4RG6A
chains in the Genus database with same CATH superfamily
2ZRDA 2O54A 2FWIA 2QPAA 1OY3D 3IIMA 3CK8A 1UBFA 2ZAGA 2IHUA 3IBYA 4C20A 1Q91A 4IEEA 4DGQA 3BD7A 3D2LA 4C7VA 1UAGA 1A9OA 4PS8A 1GLVA 4F5DA 1XNFA 2P6NA 3F1KA 2GYUA 4Y1RB 3DRAA 4IDNA 5EXEA 1I0ZA 4EYKA 3JAKB 1DRVA 1T1JA 1IHXA 3F78A 4Q3OA 2R1ZA 3DE1X 4YUWA 1SHJA 1S3SA 3HFRA 4DMHA 3EZ9A 2WJ3A 2R87A 4QWWA 1YD7A 3S7DA 4Z53A 1PR4A 3OWXA 3QXJA 1C7RA 1FMJA 1P75A 3ABRB 5F64A 1PUJA 2ZJBA 3AFHA 3NYIA 5T67A 4V02A 2BM9A 2PZFA 2VSXA 1R9JA 5EWLB 4BN5A 3UY4A 3AHHA 5BQ3A 2QLNA 3D6UA 1NDQA 3JQFA 1FMCA 4LHVA 2B8WA 4TTVA 5B3JC 4EGFA 3BZWA 3FYUA 4HUQB 2Z6UA 2OM2A 8AT1A 4PFJA 1NWHA 4TVKA 4Z0HO 1RS0A 2ETAA 1HZZA 3HI4A 4YP5A 3WX0A 1X70A 4QICA 5FA8A 5CGQB 3SYTA 1XPRA 3D6JA 1J1ZA 3LHDA 2WOOA 3FGPA 4FOOA 3KR9A 1HRKA 3E32A 3MKQB 2A92A 1N7HA 1RI5A 2RHOA 3PI7A 4LVOA 3UHOA 4JVOA 4KITB 1FQWA 2GPBA 2ZWIA 3OPQA 2W42A 1WETA 1UUFA 2WM9B 5ELMA 1KIAA 1MEJA 1Q7GA 1YQ9A 2QR3A 2Z9DA 1NVVR 3ES9A 1KYIA 2PX4A 2ODWA 3M5WA 1PJRA 3EFHA 4EL0A 1KJIA 3G8CA 2PGXA 4YREA 3V7UA 3LW8A 2ZB4A 3CXRA 4S35A 4BWYA 2ZAMA 2YZGA 3TJMA 1PJ8A 3O8LA 3VHRA 3KOUA 3LT5A 4FNGA 2P4HX 3ZH2A 1HNWB 1A69A 1I3CA 4PZ9A 1OB2A 2QQ0A 2P3OA 2DUNA 5EZYA 3BRWD 5L6MB 4C87A 1R8SA 4A0FA 1N52A 3L7YA 3LBYA 3DCIA 1JWLA 3GH1A 1ZS9A 4EIWA 4XFDA 5JD6A 3D3MA 1HK7A 4R2IA 3FVWA 4F2GA 3BT7A 4UD2A 5LJIA 5KTTA 1BC5A 1J2JA 2RGWA 2X7XA 3MHPA 3RDPA 3H4IA 2KW5A 2EX1A 2Q1UA 3HA7A 4RVNA 1ORWA 1KNXA 1FFXB 3ZKAA 5JALA 2RH4A 1E6LA 2O2EA 1C0IA 1P7CA 2P9BA 2TMGA 4IO1A 4O4HA 1JDNA 1C0KA 1VJTA 2X3FA 2DCMA 3GGJA 3IUPA 3PHCA 4MS3B 1YQGA 2C9ZA 1P60A 3P71T 4LDQA 4R31A 3SKYA 1BG6A 1FSPA 2IHTA 2MCFA 3V5NA 1TJ3A 1OILA 2DAPA 3VHXB 4LMRA 4DIDA 4KKXB 2VDNB 5BNTA 2WXOA 3KKNA 1JWBB 5AVZA 1FVHA 1TU0A 4M60A 3ZWNA 3C4QA 3D8BA 2XJ4A 3JWGA 4BY6A 3KR0A 2C96A 4L4ZA 4YNBA 5I4KA 4P58A 2D8AA 4FJ2A 1IWPB 4PYIA 1SVLA 4RZHA 4LXHA 1Z7YA 4PYNA 3A1FA 3DMNA 3DUFA 1VP9A 4R2KA 1JKJB 4M9CA 2X42A 2AJCA 4BJ5A 1M1YA 1LNQA 1WZEA 4IIJB 1QRUA 5JJKA 2HK7A 1NQVA 3ETEA 4RPKA 2PMBA 3ZDAA 4MUHA 1FYEA 5HZGA 4YRFA 1GGJA 3CCBA 5D6OA 4WKOA 9GPBA 4AX4A 4NEHB 1WZ2A 4J4HA 4DQXA 1U3DA 3E7WA 3EGEA 5G1PA 3TNFA 3P19A 5F78A 3AI1A 1LLQA 2A5GA 5KOIA 3FCSB 1UBCA 3PEYA 1GAWA 4MGEA 1CF9A 5HE9A 2JARA 4C0QC 3AW8A 4IQGA 4FWTA 1IXYA 1QU2A 4UOZA 2B7CA 1OVMA 4IM7A 2VP9A 4LVUA 5B3AA 3IIJA 4MPTA 3V2IA 2P0AA 4ZVSA 4ZJYA 1Y4DE 4O8CA 3W5AA 1HFEL 5CYFA 3KSLA 1VLQA 1ZOIA 1E7UA 2A1TS 2H1SA 3CZRA 4UHHA 4BB9A 3CRRA 3KQNA 4LF9B 1ISMA 4Q4HB 3VOAA 2CNWD 3RVQA 5CFLA 2H1VA 1UDWA 2PKCA 2ZROA 1LVHA 3GJYA 2JLSA 1MA3A 3QOYA 4AU1A 4BGUA 3HO6A 2C2XA 4WKCA 1UM8A 3FMFA 3SQXA 3BL8A 1PYOA 3GNLA 2H1CA 5ENOD 5ALKA 3RC2A 1KO1A 3F6RA 3SKVA 2BN4A 3KT0A 4MRSA 3WGYA 1XA4A 4LJ9A 3G0IA 3D8SA 1YU9A 3PEVA 4JIGA 3SNHA 5FAKA 1ZPDA 2EFGA 5I9NA 3BDVA 3PBKA 4L4RA 2HQ1A 3UWSA 2OCCE 1SOWA 3AT1A 4P92A 1L7DA 4ZJZA 3BRWA 1I5OA 3D8HA 4PZZA 1XHFA 1IULA 4RSRA 2QLFA 4ENWA 4ZCTA 1N8TA 1JR2A 4JI6B 1Y8RA 4CKXA 4F3VA 2Z2JA 3K6SA 2X1MA 1OXXK 1Z74A 3ISJA 3OO1A 3T9DA 4RTKA 3HP7A 4HWGA 1HYBA 1Z6XA 2P5TB 3UPDA 1CPYA 2HR1A 4OMDA 1KL7A 1VI2A 5AW0A 4WLFA 4MAMA 3VDNB 1Y3FE 3L8GA 3X2FA 3ZDXB 1U2EA 2Y1GA 2OO5C 3ZE8A 3COSA 4PC2A 3AU9A 1E5XA 3OBIA 3HLTA 1VYTA 2PEZA 3W3AA 3KWJA 2FJPA 5H81A 2A94A 5IHPA 4CMIA 1WXHA 1WP9A 4ENPA 1JFSA 1XQ9A 2XOEA 1C1XB 1DBPA 1ES9A 4IGAA 4J7CA 3TL6A 3UCFA 1CE8A 5H16A 1GTSA 1T6YA 1O6BA 3BB4A 3M0EA 5DBFA 1EQAA 4FYJA 4YHBA 1DIGA 2CZCA 3I2YX 2FEZA 2A9QA 3ACDA 3EHEA 3QWIA 1K66A 3JPYA 4DI4A 3AIKA 1VG1A 3U4DA 1RIIA 4WWNA 1GSIA 1HDCA 2EKBA 5CTJA 2WMYA 1BZYA 2V9ZA 1UP4A 4GR4A 3VBEA 1NRXA 1JTEA 1XXHB 3AB7A 4MYUA 4YGYA 1UPCA 1UBHS 1XJQA 2DTXA 3S7BA 3KUKA 3P9CA 3LK7A 2PRKA 3R0XA 2DR3A 4M8NE 1SBTA 4GB9A 3GVIA 1GW6A 5B58T 4PYJA 2UXCB 2BONA 2V6MA 3MYYA 4HB2A 3VOSA 4E13A 4N8EA 4AP2A 1QBKC 4IN3B 2N75A 3I12A 4IIJA 4WBSA 5L3RA 3HM2A 4N5IX 2FFBA 1OYYA 1U94A 4CQJA 2IXEA 4YAKA 1XPJA 4G0XA 5H4HA 3COYA 1NXVA 4NVRA 5DGCA 1YJQA 4TZ0A 3NAGA 2W6JA 1CR1A 3W5VA 1E0AA 4JP3A 4KVGA 1CP2A 3U66A 1YJ5A 2PUHA 3R3HA 3M6FA 4M6WA 1A04A 3OQIA 5DEIA 3OIYA 4A63B 2IYYA 3P9IA 1GNRA 1J8VA 1O54A 3FFLA 2D3WA 2FR1A 2X6TA 4OP2A 5FUYA 2JFZA 3GPCA 3LLCA 3HB5X 3HSYA 4KC0A 2PG3A 3AUKA 5T3YA 4MR7B 5F76A 4FSXA 1O1YA 1OH7A 1IHYA 3PGXA 3DR3A 1M72A 2PK3A 4RK0A 3JZDA 4KIGA 1N6NA 1ISIA 2BBTA 1RLJA 2ZRNA 1EA7A 2AKAB 2OD2A 4BE9A 2D5LA 5CDFA 1YE3A 3WMEA 3JW8A 1LLCA 1O94D 2HLDD 2NQ2C 5EHGA 4AXXA 1F20A 2O5EA 1IHOA 4M76B 5FI1B 1EZ4A 1G5FA 3NFYA 4RESA 1LI4A 4C4PA 1NI3A 3PX7A 3R3VA 4R41A 4BFXA 1KAHA 4H35A 3T99A 3IA2A 2V3VA 3WKDA 3VZCA 1SBIA 3UN1A 3ZD7A 2DZOA 1SHTX 1TGYA 5LP6F 1XVIA 2GR9A 4L57A 2C4WA 2DPYA 3M5PA 4FDUA 5HRCA 3ZQJA 1ZJ5A 1XEWX 2QPTA 3IOCA 4MW7A 4CMCA 4DKJA 5HIMA 2HY7A 5FTLA 2GUGA 1HM5A 1TNUA 3ZGXA 4BTBA 2GEDA 3I9JA 4BT8A 3FWYA 4II3A 4IP0A 2VNIA 1BEZA 1JEAA 1RJFA 4ZOAA 5FEMA 1FL9A 1NVVQ 3D4NA 2O1EA 3C8DA 5AK5A 1MBZA 3F7OA 5MFPA 1W0CA 3N6XA 4TV9B 4DVGA 3AG5A 3NTVA 2ONJA 3FUDA 1YA0A 2XZTG 3FVTA 4DDUA 3EWIA 3FYHA 5B58C 2GRPB 3INRA 4Z8YA 3DNFA 1P5FA 3UTMA 4GMFA 3U44A 3OD5A 3KUCA 2JGDA 1G4UR 3APDA 3N9IA 3IXMA 5KHAA 3KNZA 1GWNA 1RWVA 3ED1A 5DHRA 5LU9A 1Q0QA 3PPVA 5ECWA 4B44A 5J4KA 3O2SB 4I2NA 2D2IA 2V96A 2ADOA 3C7KA 5I7UA 4BE7B 3I61A 4YJHB 1D2MA 1EXVA 4RE6A 1QGYA 4C6SA 3FWPA 3WBJA 1FVXA 2KBFA 4WFKA 4R1PA 1IC6A 4D96A 1GKUB 3DWGA 4BUZA 3DSUA 3TAXA 4ZA2A 4DYVA 3V4FA 5HGXA 1DG3A 3LTEA 4UU7A 3I39X 1TN8A 1JWFA 1SD5A 1Z5WA 3LX8A 3NYWA 3VBCA 3ETCA 5JBQA 5MGBA 4M3NA 3SXJA 2OZPA 1LPBB 3OCUA 2F43A 4HPWA 3CR3A 2HU8A 2FPWA 3ED5A 4GLOA 4MINA 4CODB 2Q2QA 1JFLA 3EQ9A 4KGDA 5LQJA 1Z4OA 4GKAA 2KZTB 1EE2A 1QKKA 2X0IA 4YB8A 4UXIA 2HO4A 3GUUA 2FP3A 1PIWA 1ZBQA 2O5VA 4NBKA 4EHMA 2R60A 2FWBA 3C16C 4DLBA 3ZJVA 2C9YA 2PA0A 3BGSA 3AJAA 4MW9A 3PCXA 2XI4A 2OK7A 1V5EA 2YWRA 4GWGA 3KB2A 4YJFA 4ZZ3A 3BXXA 2V4HC 1P1HA 3U4TA 1FDIA 1ZMRA 2FFJA 4W82A 1TF2A 1S8AA 4QFVA 1M7GA 1DQSA 2VHYA 4EB8A 4LRSB 4MVYA 4CQLB 1ZM2A 4JL6A 1J8QA 2OGTA 2II6A 4M83A 4F4IA 3CZCA 1V7ZA 2IS1A 1TDJA 2FWRA 3TWRA 3AIMA 2PCLA 3ND6A 3CVPA 3A6DA 3G1WA 4BEPA 5LUAA 1O9HA 4BO4A 1R6BX 2ETBA 3G0BA 3B1VA 2R7LA 1R3DA 2WU1A 2Y0BG 3ESXA 5EIAA 3TIVA 2O2CA 3UT5B 1CY0A 3NEJA 1PG0A 3PJGA 5AVUA 1QHHB 4UBIA 5FNVB 1W8IA 4XD7A 1VJRA 2VK4A 4JC4A 4W1PA 1KQNA 1TQHA 1TD1A 1M6HA 4FYKA 3RUAA 3WDSA 2AJBA 2PJDA 1QTNA 5EIFA 4OH1A 4EYOA 1KYQA 5I6DA 4UEJA 1K7CA 8OHMA 1EVKA 3I1YA 3KAPA 1C14A 1COWD 2FG5A 2YZNA 3FHOA 2G67A 3AV0B 3HJAA 1XT6A 3QPWA 4HC4A 4BFRA 4LPKA 5CURA 4O02B 5H59A 3ZI7A 3VKHA 1NXOA 4L3VA 5C81A 1HMYA 3OSUA 2DE0X 3PDCA 4TTJA 2WNHA 1WMSA 4W5HA 5JQGB 5AW1A 3X1WA 1G1MA 4URVR 3B70A 4G56A 3PR2B 1H8HD 2VYQA 3QF4B 4KZ0A 1J21A 2VHCA 3SVLA 3ETHA 4S1WA 1IUKA 5JEDA 2ETCA 1BVHA 1MU0A 2OA0A 2BHTA 1C7IA 1NKTA 3LFTA 3ZV4A 5DTQA 4D92A 2VJNA 2O1XA 3UJDA 3ESQA 5AW8A 5KYVA 2DR2A 3WTBA 1A4UA 1DZIA 1MN6A 3GG9A 3KVRA 2CDBA 2XCUA 4DMKA 1DKLA 3C8UA 3WAJA 5AW2A 4Y6SA 4TXHA 2PX2A 4MARA 2Q62A 3HLKA 2XTMA 2PZBA 4WLOA 5CRVA 4L22A 1AGYA 3VVCA 5FQ4A 1SD1A 2FFRA 1WW2A 3A9RA 3F6CA 1E1RA 2DHDA 1AUVA 2XR1A 5JFGA 4ZZ1A 4G8BA 1K5HA 2G3YA 3BBPA 3NPMA 4G1FA 4TPKA 1FP4A 5ALUA 1DG9A 2FLVA 1KEVA 2X0FA 3OHSX 5HDQA 1QLJA 4QEDA 1X9IA 4GTSA 3BE6A 1P1RA 4MV0A 4BNUA 3V79K 4DCJA 1B2RA 4OVVA 3KBOA 4KQFA 2IODA 4ZDJA 4Q4AA 1XYGA 1TA0A 2JVKA 3EFBA 1F6WA 4EARA 1TZCA 3LWDA 2DFNA 4N0MA 2GKSA 3DEFA 4D0SA 1L1QA 3T38A 4E88A 1SC3A 5AQBA 1O6ZA 1KBZA 2AL7A 1NC1A 1G98A 2EBWA 2M1ZA 2SNIE 3CW9A 5DBKA 1QB8A 2BGIA 3O1JC 1KVUA 3BIWA 5A7GA 2OXCA 4OIFA 4IJVA 1I4WA 2VYVD 1RPZA 1K63A 2J9FA 2ZIUB 1S89A 1Y63A 2IYRA 2NZVG 2QI9C 1MV8A 3NHRA 1VCNA 2PYDA 4PGAA 5K9ZA 5KBYA 4ZYTA 4UUNA 1ZM4A 4G41A 2XPCA 1HNZB 1RVDA 2C8VA 1YQWA 4JBHA 4JLVA 3LQKA 1KI1A 1Y1LA 5G0TA 4ZVVA 4DR7B 1UOQA 1AKNA 4P4SA 3AYXB 1L6IA 2I3AA 4G07A 4IIUA 1KJWA 5L53A 1UG3A 3UXEA 3L4KA 4E5NA 2RE8A 2CV1A 1D09A 4C21A 2EHDA 5SZIA 1WV0A 2ZE7A 4HGOA 4EZKA 1QYMA 1Z2CA 2PR2A 3QMPA 4MSUA 3WR5A 1GT91 4RS3A 2NYUA 2AI1A 4LWZA 5GV7A 5LIPA 4PNHA 4HWSA 3FG9A 4J8FA 3BXOA 3FCAA 3QF7A 1GD1O 4YDHB 2HT6A 2R7AA 3KAJA 1YFJA 3VNUA 1H6AA 3UINC 3IAM1 1MAVA 4MEBA 1NPTO 2IO3C 1VE6A 5IHXA 1I36A 3VNVA 1FYFA 4LE1A 4I4NA 4DHWA 1UWLA 3GFQA 4LHXA 1K8XB 5DNCA 1C5KA 2GDZA 2O20A 3WB0A 2H2WA 4OA5A 4UULA 3DKKA 3Q7AA 2J6HA 1KQPA 2DVMA 5LDGA 3P0FA 4FYIA 3BN3A 4L9SA 3HBFA 1CEXA 1EEXB 4MP3A 4UXJA 3TUIC 4B32A 2VT2A 5CB6A 1QYWA 3NU1A 4YP6A 1J25A 2AFVA 2RC6A 4N0QA 3V9PA 1GL3A 5BORA 3VTXA 5EP3A 4LC1A 4RTOA 2O8DB 4IGEA 1XIVA 3BFJA 3FMVA 3PNLB 3B20A 3PR3A 4ND1A 5GAJA 1P9LA 3QLVC 4OK5A 1FYXA 5AVVA 3HVEB 4MCAA 4NPHA 4UM9D 3U17A 2DLDA 4IWNA 4OX9B 3FSGA 2V8OA 4RGBA 5B1EA 4B8ZA 5F9MA 4F4JA 3BE4A 3F71A 3OQ6A 4B6GA 1IIRA 3RC3A 1CJTC 4XWKA 4PRLA 3LM8A 1FY2A 4E7OA 1ZI9A 5KVVA 2IU3A 4CTOA 2YY6A 2YCLA 5B3LA 2FSSA 1Z56C 4Q4JB 4A92A 4R6XA 5KYKA 1P31A 1X7XB 4N5DA 3EJWA 2XRZA 4L9PA 5LC1A 4KOAA 3CEPB 2Z2XA 2IYEA 3CRQA 1IHUA 4P98A 4EQ6B 4JT8A 5ICSA 3TIIA 4ATNA 4HF7A 1OLSA 5TX7A 1ZFNA 2VF4X 3ITKA 1TYQG 3EHRA 3HXDA 1T9ZA 2BLNA 2XGSA 3F6PA 1I2CA 2AD5A 2QP4A 2CFZA 4QDJA 1SHKA 4O4IB 3W5IA 4TX1A 4ZAXA 4AMYA 3L43A 4ALLA 4DC1A 5C2JB 3QX3A 2P91A 4YECA 3H17A 5IUKC 2OV4A 2Q07A 3R0VA 5DM4A 2WT9A 1Q16A 2HJVA 3LBNA 5CMWA 2WWVD 1AUPA 4MHSA 4D4KA 2ZBGA 3BA6A 4JUIA 4TMVA 2ZTMA 4EELA 3SBXA 1YA6A 4D8XA 1BH6A 3P2KA 3W7AA 1HFAA 2X4DA 3CGHA 4PGMA 5CNMA 1ONPA 2GYYA 4ER5A 4RMHA 4KE7A 2ZI7A 5A3SA 4DQVA 5JTTA 3IAHA 3PEEA 4YR7A 3L1UA 1H69A 2QFCA 1NFFA 1U28C 3BTSA 3QBVA 5KTKA 3AUFA 3A4MA 2O2HA 4EECA 5F3DA 3UKRG 4EYQA 5DP1A 1A9TA 1V8OA 4HVLA 1XMQB 3H1TA 4N6GA 1GL7A 4NQRA 3T15A 2P78A 1MJFA 3CU5A 2YNQA 5FBZA 2HL6A 5MGNA 3EFOB 3RVPA 3B1XA 5TMPA 3R7FA 3VX4A 4BO2A 4CEHA 5K3FB 2EZ8A 4C6TB 5EESA 1DFHA 5H9WA 5TVKA 1WU7A 5DZSA 5K05A 5SY9A 4M1YA 1GXSB 3E5HA 2VDUE 1UF9A 4B8AA 3QA9A 3MBKA 4TKZA 3LHSA 3T7DA 4LY9A 2FWJA 4WFIA 4YJ3B 3V8EA 2X3MA 1E9BA 3CNQS 1VA4A 1F0YA 3PFGA 4O4LA 3WGHA 3ZE2B 5LVAA 5IKXA 1Q1NA 4N5LA 3LPLA 1OFTA 4R1LA 4ZU6X 5EIXA 3K1YA 3SIPA 3ND9A 4W5TA 3U7HB 2VQ6A 5KYUA 4O4JB 2HZBA 3QIAA 1KLXA 5TF0A 3SS7X 1IKND 3FN4A 3KXLA 1LV8A 3QV2A 1SBZA 4EQ6A 3NZUA 2FR8C 2O3SA 1W25A 5HFAA 4TWAA 1HUQA 4P08A 1I3NA 1U8UA 4GDMA 3UG6A 3NC4A 1N6IA 1S2MA 1YZKA 3FGZA 3ANYB 4G63A 4QYTA 1E8MA 2HWWA 4HGYA 3VYWA 4PHHA 3CONA 2RHCA 3AHIA 1BMQA 1Y9ZA 1RYNA 2RI6A 2GEVA 3HXPA 2AG0A 3EOBI 3WTCA 4LNAA 5H82A 1L5YA 2O1SA 2PIAA 3NALA 4DWVA 2IEDA 1SOAA 4MUFA 4PX3A 4TVSA 3BE8A 3TE6A 5DE3A 1FRFS 5BN4B 3KJEA 2CHFA 2W48A 3E9RA 3DD5A 4K9DA 5EJGA 2D62A 3OFSA 1YBHA 2NTJA 3M5CA 1N5MA 4KDCA 1ND5A 4MV3A 1JWAB 2XOXA 4HNAA 3EC1A 3PNLA 4QOIA 1EVJA 1Z22A 2UV8A 3DONA 4BNFA 5CB0A 1KAEA 2XWSA 4KRYA 3B9BA 2VKTA 1AUOA 3S5JA 4QWMA 2B25A 4UC0A 5DASA 3FEYA 4ZD6A 4QVIA 1JSZA 3PXCX 4FBMA 3CVWA 4TS4A 4QGSA 1FXWA 4X85A 5DULA 2R4QA 5ARGA 3ZVVA 2XQJA 3CB2A 3OQHA 5BWBA 2XF2A 1GEGA 4URFA 2TSYB 3LDHA 4A36A 2B0CA 1AQYA 3BSFA 3LG2A 2YZKA 1A9RA 4NBRA 3TZQA 1QH0A 4ANFA 1E2KA 1T3GA 2H4YA 2VQFB 5AKLA 4RNCA 1BS1A 1D7OA 4N2QA 2G5GX 2WG2A 2ZJ1A 4YY3B 4RSYA 1P4HA 4KQCA 2DPGA 4B93B 4TSKA 3K6JA 4H4DA 3TQCA 3CR8A 1SXIA 3FFXA 3DKRA 1VFNA 1OLXA 3O2NA 4PPQA 4P1ZA 1EXDA 1LU9A 2ATIA 2B2XA 3C6QA 3CKMA 2P9YA 4KNWA 4AS1A 4KQWA 2NO6A 1U1CA 2ZSUA 1QZUA 3L7JA 4PRKA 3SYMA 4C4ZA 5JZBA 5LR6A 3KWFA 5K1ZA 4OL9A 2PY6A 3ZD8A 1SKQA 3CHQA 4NICA 1NE7A 3HCOA 5CJJA 4U6QA 1L0BA 4RJJA 1IK4A 1AQ6A 2QYOA 1UDBA 3ET5A 2GCPA 2AWOA 3OQIB 4R3WA 3VA7A 1RXIA 2Q5EA 3MTIA 3G8AA 1LD8A 2QQ5A 3O93A 4WINA 5AHOA 2V0CA 3P9SA 2HRQA 1DP4A 2ZDQA 5FV7A 2YL2A 2I2WA 4PFKA 5BURA 3L02A 4XYGA 1TTPB 4UTOA 1WHSB 1Y37A 3NHBA 1QE3A 5K3DA 3PR1A 5EZ5A 4E33A 5DW0A 4AY2A 3Q79A 3OBBA 3CNHA 4MQ4A 4FOLA 4L4XA 1D2GA 3K7EA 4JW1A 3X1YA 1DIAA 2WXMA 1VGRA 3K2IA 1SD2A 3KJIA 3TXXA 1LBSA 2WYOA 3IKMB 3QNWA 3RTAA 2C2GA 1YJBA 2HBYA 3MD9A 1PK8A 4C4TA 3EUEA 4LRUA 5A5EA 2QV0A 4GPIB 1WLSA 4K9LA 5KNCA 1DBWA 1E5QA 1I7PA 5LOVF 1Y7LA 1OIXA 5ALEA 1BQ4A 1Z8HA 5BV8A 5AUQA 4OLBA 2QM0A 2QMYA 2Z58A 3DT9A 1XD2B 2O6HA 1B6GA 3RYIB 4EO4A 3T5PA 1PV2A 3MD0A 3HYLA 4JUAA 1E2LA 3B9QA 2QAJA 1V1MA 1CE8B 4IFEA 5TPWB 3AVPA 3AL3A 4TXJA 5HKKD 3PE6A 1FIUA 4RA9B 1E1DA 3DDOA 3PPYA 4ZVKA 1YI1A 2ZRCA 2ZRLA 3FTUA 2EZTA 2NVUA 5FV4A 3DSTA 3AVQA 1KVSA 5ALJA 1BDMA 2XUIA 1X1TA 4IXTA 4NJOA 3CNNA 3VZDA 4F9EA 3QX8A 1UMBB 5CVDA 5CLFA 3V34A 3IUJA 3SYRA 3PT9A 2JFGA 4LEUA 4ZYYA 2HLPA 3KVYA 2BKKB 2OT3B 3UAGA 1C2TA 1XKLA 3JQGB 2DSTA 4U0JA 1QQ5A 1KA9H 2BKUA 1YZQA 3L1IA 3QITA 5BOSA 4LBZA 1VLVA 5AI0A 1H6CA 1FTGA 3QLEA 2YHCA 5KKAA 1CVLA 5LPNA 2EBUA 3MK31 1QMPA 1UPXA 3NWPA 1U4SA 2EYUA 1UXHA 3EVFA 3GYBA 5EJ9A 1NR1A 1N9KA 1VLLA 3OE7A 5EPUA 2FRDA 4HAXA 5EJ7A 5LOZA 3GXBA 4QU8A 5EKSA 2EWWA 5BVHB 2VAXA 1KS9A 2ZS9A 4A91A 4A3SA 4UASA 1WCXA 3WY9A 4CG0A 4OTZA 3Q49B 4JLKA 4ZI5A 5HFNA 5GM1A 1ZU5A 3VV3A 4AKHA 3JQAB 1XZQA 3PUZA 5DO9A 5IK2D 1C7FA 2B4TO 3DEHA 3G9TA 2DWOA 1UKVY 3KYCB 2A2ZA 4UUAA 4X20B 1UINA 2XVZA 4WXHA 1NVMB 3GROA 4CIYA 3TW6A 1ZH0A 4HMPA 4DX1A 2RK3A 4J0JA 4V0MA 4G1TA 3C3YA 1ZNWA 1Z75A 4XDYA 1JJVA 4YAWA 3UANA 5LQNA 2O5CA 3KS9A 3PA8A 2X14A 1UZAA 2WKSA 1C0EA 2ON6A 1JU3A 1WCIB 2H18A 3DJFA 1SELA 5FADA 4XD7D 2XB9A 4BVGA 2ZM5A 2ISSD 2VCYA 3M2TA 3VZPA 4MVJI 4EENA 1YGPA 1CUYA 3SMVA 2FZEA 2LZ0A 3FYTA 2ZS7A 2VJYA 3I9NA 4CF4A 1CIJA 4G65A 1QO9A 4IXMA 4U7WA 3I0NA 5JANA 1VKJA 2WAXA 2LXMA 2GX6A 3E3MA 3NM6B 4M86A 2FJUA 4OQYA 1QIFA 4RQUA 1KDRA 1A9XA 3D3EA 2NXWA 3ENNA 2GN2A 3FWHA 3KWLA 3RWBA 3OIGA 3CXUA 4Q7EA 2TMDA 4OUDB 1FSSA 3WGGA 5KDDA 1J2RA 3LV8A 3FCUB 3FIJA 4MVJH 4YV2A 1YNOA 5F7JA 4QZVA 5KOHB 3OZWA 3I23A 4J3FA 4HZUA 3C3CA 3M1YA 3E3OA 5SYAA 5T5QA 1DGQA 3FHEA 1CYDA 1YDGA 1N0RA 1MPTA 3LY9A 1XNRB 5AHKA 3DZFA 3FWZA 2G9NA 2BUCA 2HDWA 1TEXA 4R69A 3FJ1A 1F6BA 1ZGZA 4LHZA 5J4LA 3JXIA 3WHKA 2WB2A 3RHSA 1DG1G 3BRCA 4IDHA 3HVJA 4L28A 3RFUA 1KSJA 2VT6A 5AUOB 2CXUA 2P9ZA 4QEKA 2GT1A 4BVBA 1GA1A 2IZ0A 4N39A 3B1KA 1A4IA 2AQIA 1X7YA 3KFVA 3EISA 3OX3A 3ZEFA 1ZK0A 3JQ7B 5BR4A 3DBLB 1JI0A 5AW9A 2A9OA 1XCJA 1JIKA 1Z36A 4BNMA 1DWOA 1DHTA 1XWIA 4KIWA 1ORRA 5EE3A 2ZIXA 1N0IA 2ZGVA 5HF9A 2JF0A 1D8EA 4C43A 1DL5A 1BS9A 4MX8A 5CDGA 5CVTA 3WK4A 3UK2A 1JAHA 4JVNA 3RSCA 1US8A 4Z0TA 1WF6A 4RTQA 3P9RA 5CEEA 3ENKA 3MIIA 3ACCA 3N3AC 3OT1B 3EIQA 1XK7A 5TT0A 2Q5IA 3TZBA 5KCZA 2QEQA 1XLTA 3GDOA 4PLWA 1BDBA 1BGVA 4OQQA 4PFQA 1T9GR 5HKBA 2W2XA 4RCVA 5ES3A 4LUNU 1BNCA 1U8TA 4N9QA 1X14A 2ZJ4A 2JL1A 1ZJ4A 2QN8A 3VPXA 3SCZA 4M8LA 1DB3A 3T7KA 2VYIA 2P62A 3D0OA 3CEHA 3P97A 3WADA 5FYDA 3BEDA 2XNJA 1SKAA 4KX3A 3ZGLA 4EWLA 4AM8A 3ZHTA 5A4IS 1C1YA 4G3XA 2QE7D 2SHKA 2BH2A 1BXRA 3KTDA 4P4NA 1Y6QA 3WK9A 1DLJA 3D4OA 1T4DA 4C04A 3DB1A 1QH9A 3WL4A 5AW4A 4OAUC 1YGYA 1C3LA 2XCBA 1QOZA 5F98A 2HADA 2XA1A 1O6CA 1YCDA 1GRNA 2D13A 2DTDA 1NYRA 1Y7IA 2G8NA 2H8GA 2JIPA 5BNZA 1GQRA 1CX9B 4HQDA 2ZG6A 4LE2A 1U0BB 4HDRB 4MWTA 2V6FA 2YN2A 4MHOA 1YZNA 1BXZA 3NEAA 2PS9A 3RT9A 5JZOA 1EB9A 1G5TA 3B52X 3UUFA 3VZSA 4BO3A 2B78A 1E6MA 3FZEA 1P9OA 3DYBA 3C15C 1DJOA 1QFSA 2G08A 4OFBA 1HX7A 4II2A 1GU0A 4M1WA 4UE2A 2GRJA 1ITZA 1JSCA 3B3FA 3A1EA 4DSZA 1D6NA 5J4HA 3IDQA 1DT3A 4IMIB 4H1VA 1Q7TA 1GITA 1Z73A 4P53A 4GYJA 4PG8A 1GPWB 3OCWA 1YR8A 1P5QA 4Y6PA 5CMLA 4BNWA 5I7OA 4HWTA 2AJ8A 2L0XA 5A02A 3M4YA 3D9OA 4LNBA 4GX2A 3CQCB 1XV5A 4IHKA 4LOLA 2MU1A 4ZYUA 1CDEA 1KVQA 4EJFA 3QPDA 2HA2A 1N8KA 2FW8A 1K6EA 5IJ0B 2ZPUA 4HDKA 4HNTA 4ZK2A 3PLAE 4F2WA 4UM9B 1AKRA 1UWCA 5IT4A 4DHEA 1L7OA 3EGVA 2BEDA 1GT6A 1UODA 3H5IA 4Q9DA 4RZQA 4X8HA 2Z6QA 1MMFB 2CYBA 1EUQA 1DAPA 2R44A 1KBQA 2IWRA 4W7HA 1E3TA 4TRNA 2B5OA 3UJNA 3N28A 3KV1A 1T1GA 1VP3A 1VIAA 2FOLA 3ANLA 3BH6A 3HWWA 5ADWA 3WNDA 4LTMA 1ADCA 5F9FA 4WD3A 1KKLA 3OEHA 3NH9A 3OU7A 4F8YA 1QYVA 2ZWAA 1YRQA 3A1DA 1QFJA 4E2YA 1BYUA 5JSYA 5C3MA 1IOLA 3R9MA 4LX0A 3AG4E 3CRVA 4D9EA 1JE0A 3MWEA 1F14A 1IZ7A 3GNQA 1KI8A 1N2CA 3ASZA 2D7JA 4YUVA 4DLZA 3R7AA 5AQ1A 4BIIA 3CCCA 2CMKA 2RAUA 3OPMA 5LCXA 3PU6A 5B37A 2HHJA 3L9WA 2GGFA 3E3LA 1U7DA 2FQYA 2ZPTX 3G2QA 4UUOA 5CUQA 4CM6A 3CVXA 2GJ4A 2QNRA 3P4XA 1R18A 3M33A 3GEMA 4HGQA 3WS7A 1Y6IA 5A4JA 10MHA 1KMIY 2AWNA 1T6ZA 5DGHA 4AOFA 1J39A 2PV7A 2WDZA 2QNIA 3H05A 4KCGA 4MR8A 3D59A 4RY9A 3D9JA 5BR1A 5FNZA 3EDQA 3PQ2A 3UKJA 4WQMA 4ZDIA 3UO8B 3JQ8A 5IS2A 3NW9A 5TV2A 3L18A 3L8MA 3T3HA 4B2YA 3EOZA 4C48B 5GONB 3ICOA 3MYRA 4BPRA 2W2KB 2CSXA 3SI5A 4Q7LA 4DE5A 5E7JA 5JCJA 4L4SA 2JIDA 1Z6PA 5FWAA 2DB3A 2QI9F 2M6RA 4GIBA 1YB1A 3BTVA 1HURA 2O52A 2W98A 1QAMA 1XLTC 1CZNA 4B7AA 3KX2A 2WEKA 2NQTA 1SA4A 3A2KA 2PT5A 4R01A 3LBAA 1DNPA 1PGPA 3KAKA 1ULBA 5KOJB 4EB6A 5ICMA 1DXHA 4YRJA 1DQRA 2VP3A 4AN0A 3DMYA 3MCVA 3PHHA 1ZB1A 1XWFA 1VL6A 3IHLA 4H6WA 4WUVA 3ZHUA 4LWPA 3PDUA 5IXSA 4BNVA 4IYJA 4TN5A 2BGNA 1NXWA 2XA9A 4PZLA 2NWQA 2RARA 4RAOA 4FLEA 4D4HA 1B14A 5CIYA 2ZSEA 4Q03A 2DPMA 5BPPA 5LZ8A 5FP0A 2IPXA 2A9RA 3DPIA 3VSDA 3U61B 4RHXA 2A0UA 3E1KA 3PPWA 3ITDA 3WE7A 5FWYB 1LWNA 4WHMA 5DFAA 3CKCA 1AKVA 1Y1KE 1IJBA 4XYEA 3S8MA 2DEUA 1T4BA 2ZI4A 4ZALA 2C3UA 2Z98A 4D56A 4U2CA 2ENWA 1D03A 3DBVO 5K0GA 1JYSA 1UQRA 4RPCA 4A0RA 5KSZA 3ZKJA 1AS2A 1FPPA 1PLJA 2W8BB 3D3JA 5BSKA 3ABLE 3HRAA 1VXOA 4F5WA 2L82A 1ZM9A 3BXPA 1LTQA 4LF6B 4NQZA 3FU3A 5J5VA 3QKTA 1XHEA 1P0IA 1DWQA 1GTMA 1AXRA 4KVOA 4HAUA 5ALNA 2F55A 2YN4A 3P5BA 4OB7A 5HQ8A 1LF5A 1QCZA 2AMLA 5AR1A 3G2KA 5IN4A 1D9XA 4TSFD 4UHJA 1PZHA 3A3KA 2MYOA 1U0NA 3ADOA 3G7NA 4KTTE 3PH0C 3X2QE 2REOA 4KWEA 3RVKA 2YXBA 4P7KA 3D9QX 2CK3D 5DNEA 4DXAA 5JC1A 5FTKA 5AXDA 4MS3A 4BNIA 2VFAA 5IZ4A 2PGIA 3OWOA 1YZTA 3GRYA 4PGGA 5EXSA 2GSWA 2GCIA 4Q7JB 5KI6A 4GSLA 4DEYA 1CNMA 1DADA 3B6MA 4R9UC 4F4UA 1IN8A 1FFXA 1FX0A 4FFVA 1Y3BE 4F6RA 3IEUA 3SC6A 3OPXA 2O7SA 1OTYA 5TQJA 3SPXA 3BHJA 3LA8A 2B8NA 4DUYB 2AJTA 3AAAC 3A9UA 2YC4C 5U1PA 4CFZA 3LCRA 3RU0A 2LIPA 2VH2A 1BVRA 1QVRA 2GN1A 3SZUA 5CVCA 3AVWA 3UMJA 3ABQB 3B2NA 3I8SA 1ZMXA 1ISHA 1G7CA 4QXOA 3B5EA 3OP1A 4JSRA 1GNSA 2PD6A 4CYMA 2I7TA 1XTVA 1XDSA 2AG6A 3JWJA 5FWNA 3IHYA 4FMPA 3QYAA 1ZVKA 2R8RA 3HO1A 2JJ8A 1A0OA 3OZFA 4QOHA 1EIZA 1PFGA 1P2SA 5EX0A 1JQKA 4B0ZA 2FDXA 1PDVA 1KY3A 3GFPA 2FZ4A 4I36A 1KDYA 4BP9A 3LECA 3VNQA 2Q3BA 5T8KC 4QQKA 1UOOA 3AS5A 5JUWA 2HYIC 3IESA 1QWOA 4CJXA 3VVBA 4D9BA 5DGIA 1CDZA 1P2VA 2X2PA 4WJZA 4DWWA 4GNKA 2C00A 3V8VA 1LPPA 3F7TA 3OZGA 2LGJA 4QC2A 3RIEA 5HCNA 1W4LA 4CEMA 2H1WA 5DCYA 4RGYA 3T8MA 3DV0A 4ALIA 2QRGA 2R6R1 3UGJA 1G3NB 1QIMA 2H4HA 4IZHA 1J20A 2CNOA 5EHQA 4N7MA 3ELUA 3NLLA 3K35A 3WLAA 4QG3A 3G17A 2WTEA 1YONA 3C6BA 1BWQA 4K0RA 2C88A 3THXB 3PWTA 1Y3DE 1H42A 1SOVA 2F1HA 5CDFE 5U9CA 3L54A 3ZLUA 1Z82A 4IJMA 4JB3A 4H6XA 1G21E 2OVBA 4P7BA 4WRRA 5K3SA 1RTKA 3DFFA 3HZRA 3DHNA 4IG4A 2ZVPX 2F9FA 5CX1A 3TS1A 4BMYA 4CIDA 5L51A 4B3MB 2VHVA 4GH5A 5JSZB 3IQHX 1SVXA 3CX7A 3BE5A 3NM4A 4YXWD 4TQAA 2BKLA 2C94A 4OQPA 5JY6A 4W9NA 1J8YF 3FDXA 2HDHA 3H9JA 4WXMA 2X8WA 1U1GA 4G1EB 5EKQD 3A37A 1USWA 4XX5A 1EESA 5BN3B 2QPOA 4CWAA 5D85A 2GZDA 1ZXLA 4RIIA 1WXQA 3UJ3X 3T9AA 4O1PA 4KU4A 4WTOA 3AU5A 1TW2A 1YI8A 2HLHA 3PEFA 3TX2A 2WXRA 1OD6A 3VAAA 1O94A 5KIAA 2ADFA 5A4FS 1XPOA 3W1VA 3E2MA 1ZUIA 1HDIA 1AN0A 1PYDA 2FHPA 3AR8A 1A5SB 2R66A 2XAAA 4I17A 2W0SA 2YV5A 3ORYA 3J5QB 4LHEA 1L7MA 4PLTA 5LQKA 3ETJA 3EU9A 4AAYA 4KWIA 5JCOC 1PD1A 2WXJA 1E66A 3V30A 1UJ6A 3THSA 4CI9A 1Z5VA 3RK6A 1Q3KA 1XXLA 4Y2GA 2ET6A 3OE4A 5L3QA 1V4VA 3FFBA 1LWOA 3IOYA 2WWIA 4O2BF 1G41A 1GZ6A 1WY5A 2LCQA 1A3CA 2XSZD 1ZGJA 3PXAA 1I6WA 2J5KA 3UGTA 2HJ9A 3FMGA 3D6AA 4Y2RA 3U26A 2CMGA 3RJVA 2QMZA 2RKWA 2ZUEA 2XRYA 1POXA 1VIMA 4N01A 5EJIA 5JADA 4GBMA 4LJAA 3VO9A 2I4LA 4AD8A 4J7WA 3RUHA 4ROTA 3Q8LA 3ASNE 3EF1A 1TUEA 2WSBA 3AUJB 3PDJA 3GL9A 4GA2A 5C31A 3IT3A 4DARA 1ILEA 3MWYW 2P3SA 1QNFA 3MGGA 1IN6A 4UUQA 3LUDA 4EG7A 4XUEA 4LZZA 4D3SA 4ZTUB 1OOEA 4D10C 2CFUA 4G8JA 3KPYA 2AS0A 4TXLA 3OLYA 3GT4A 3PGJA 2QW8A 3OJEA 2O3UA 1XCLA 2HSEA 3I6MA 2FW1A 2YX1A 4YT4A 4OHYA 2NU7A 5FIUA 1MC1A 2NO4A 3L6RA 2IELA 4LSGA 1FCHA 4BAGA 3VNAA 3GPIA 1F7UA 1GKKA 4HFGA 1P5HA 3O48A 2QTZA 3C8HA 5B3SE 1JG6A 1YZGA 2P6RA 3S28A 3HHMA 3DTVB 3PX3A 2RIRA 4LSZE 2B94A 3ABOB 1SBYA 1UM9A 3LUKA 4NG4A 3I9V6 4UAGA 1P9NA 5H7PA 3SC4A 3F3MA 4ZIRA 3WYBA 1AM4D 4OFWA 1UPAA 2SKDA 2X4LA 4WK6A 1Z39A 4R4JA 3OM1A 2PKEA 4Q4CA 4OGFA 1UL1X 4E0BA 4IMPA 3EXG2 4CCSA 3WGJA 1HDGO 2FPIB 2HO5A 3GLSA 5GV8A 2R03A 5ERXA 1MZCA 2HQBA 3P9QA 4TM7A 3IDOA 3ZTYA 1N4PA 3BQMB 2XCIA 3D54D 1V5IA 4HVAA 1VTKA 2RMKA 4C08A 5KQRA 3FDHA 1TU3A 3G0CA 3Q3JB 3K9QO 3RJ9A 2XKKA 3KCNA 2YZ7A 5AVJA 2D74A 2X0EA 1E3SA 4TTAA 2FI1A 2WFLB 3L77A 1Q6ZA 4KMMA 1R5JA 4L0DA 5EN4A 3T4UA 4J2OA 1GG9A 2R8YA 4D0NA 3MWGA 1G42A 1FT2A 5DN9A 1TZJA 3FKSA 4W8OA 4AW9A 1W5EA 2WC1A 2FDCA 4X7PA 2B37A 3TG4A 5I7SA 1OLUB 1UDAA 2YMQA 3O1HB 2GXSA 2J3HA 1VJ0A 1NXPA 3EPHA 4TMFA 5HCIA 3CVYA 4NCKA 2W70A 4EKEA 4E1AA 2HMTA 3IVMA 4UTXA 3T9BA 3X44A 4EATA 3CKLA 2CNWA 4X3OA 3DEPA 1HFWA 4D4IA 5KC9A 4WJKB 2H9IA 1KJJA 3OPYB 4R7TA 5CDHA 5DYTA 1E4EA 2HN9A 1LXCA 3A6KA 3MJHA 1EJBA 1U1EA 2BFFB 5BW8A 3S2FA 3QFRA 1E3MA 2VBCA 4HKTA 4X60A 1B0PA 5K8VA 3DA8A 3QVXA 2GARA 3PEUB 3RI3A 3JQFC 2NU9B 4FX2A 2QE7A 3VJLA 1JIIA 1R15A 2WIFA 3O4GA 4Z4FA 3UATA 5DHAA 3B95A 2J9FB 1BI8B 3DAYA 5FZSA 1LSOA 2L2QA 4D82A 1JAZA 3L4BA 3JQ1A 4I1PA 4A3TA 2YS7A 5BT1A 1N36B 1WZIA 3RO7A 3CEQA 1D2CA 1HL3A 1I6MA 2Z1DA 4OGGA 3H8VA 2MRIA 1ZD4A 4PE5B 4AJ9A 5HK8A 4EG0A 1JQ3A 1ENOA 1TUGA 4GLBA 3ICCA 4F06A 2D54A 3TGPA 4JBGA 1PZMA 5H7XA 3GG2A 4DNPA 2UUBB 2AFIB 1FP7A 1NATA 2QR2A 2RJ3A 5CHYA 3PZ2A 1FP4B 2QTTA 3NTXA 4UJ5A 4XUCA 5BYBA 3W4IA 4RDXA 3GJQA 2BGGA 3N8KA 1U7OA 5JFOA 1K5GA 5B1AE 1S3GA 2YDYA 3B13B 4MWGA 5EZQA 5HJ2A 1FUYB 4N8DA 3L1VA 4NHEA 4PBSA 1GR1A 1ICEA 3A9WA 1IZ0A 3DEYX 4M4SA 2JGRA 2QQGA 3AX6A 3ZZ1A 5DK6A 1GCAA 3I5AA 3NATA 1HPLA 3WG7E 1YUBA 5I9BA 1BU5A 2RIPA 3OZDA 3UXMA 3AUAA 1AGRA 1DKPA 4P7GA 3SSOA 5K2OA 3TTVA 2Z8XA 3N07A 3K32A 5JJ6A 1FXSA 4ILGA 1KJZA 4YRMA 3NETA 1G6Q1 5KVCA 4NXMB 5JS1A 2F17A 2GZ3A 1SB8A 1VSTA 4G5FA 4N0PA 3B1FA 1QVVA 2SKCA 3D1LA 3TXMA 3O26A 3C3KA 1T8WA 1CQIA 4MKZA 1E1NA 3QF4A 4F92B 3RWOA 4QBTA 1MAHA 1ECGA 2GILA 3HZOA 2Z4TA 3RHTA 3B7BA 3GBPA 3MWDA 4JS0A 1OWMA 4HG2A 4CYMD 5LYJA 2FI7A 3C3XA 3ZV6A 2PZ8A 5K3EA 1OX4A 1QIIA 1CQIB 1HT1E 3N8HA 4ZTBA 1E1CA 3HJBA 1MB4A 4DJ5X 2WZQA 4KO4S 3SFXA 4KLNA 1GG2A 4LNHA 4JC0A 5JQWA 3IB6A 3ESKA 3JQ0A 1HLFA 2N1BA 3JALA 4FNOA 5AKKA 3S99A 4HWPA 3RYTC 4BKQA 2ZGDA 1R10A 4Y2JA 3HHEA 3QH4A 1BMTA 2GRMA 1A95A 5GGYA 1JEYA 5ENZA 2JIBA 4YASA 3WKEA 3IUBA 3KS2A 2KCKA 4YDYA 1YCHA 4XIGS 5DCWA 4BLOA 5J4VA 2PUEA 1WZUA 4GZCA 1MT3A 4DCMA 1U2SA 2F48A 5IKMA 4LIPD 5HJEA 5DW3A 4ZJPA 3MQ2A 2YQ5A 4LFAB 5C2YA 2VUIB 2QY9A 3DDHA 3HKDA 3T7AA 4DRXA 5GOTA 1GAXA 2XNKA 1Z18A 3FLAA 3GGOA 4X5OA 4L3OA 2H4JA 2CMHA 1B6TA 3WYCA 4BNDB 2JW5A 1ORIA 3ZU7B 2GEFA 5KNDD 3F7MA 1Q0LA 5BRAA 2VJQA 3UW1A 1KU0A 4XTCS 1VDYA 3I9FA 2F64A 2ONCA 3ECCA 4TSFA 4EPRA 4JJKA 4R84A 3Q73A 4MUKA 4F3YA 4CL3A 2I33A 3RIXA 2D6FA 4IDDA 4FOSA 1JHRA 3D3WB 2JEKA 3H11A 4KR9A 1FBTA 1E9DA 6NULA 4B74A 5I5GA 3EEOA 1GEEA 3CVUA 3A6LA 3DDWA 2E0IA 3MRTA 3OC6A 2QBYB 2XQFA 4MVJD 3WL5A 2J07A 2B1JA 2CXRA 1SUSA 2OZVA 1TIKA 2C9BA 2Q5LA 2X6IA 1L8XA 3G5TA 3IUYA 3LQ4A 1DEOA 4FQ8A 3KSRA 1U7XA 1NFRA 4ESHA 4QELA 4TXQA 2BT4A 4EKYA 4BKMA 2KLHA 3VR2D 4JXJA 4PWZA 5I3ZA 1SUDA 3FTWA 4Z9AA 1CUGA 3MRVA 5KEIA 1KMHB 4PIVA 5BSRA 2ORED 3CPHA 3D4LA 4EI8A 3RSHA 4B4UA 4YDEA 2IYVA 4I6GA 4P38A 2D06A 4CF3A 3GLVA 2XMBA 4B3DA 1XJWA 2CVOA 1E2BA 3O90A 3INNA 4YRNA 2H1FA 3T95A 1ONBA 4E07A 3JS5A 4GKKB 4YIKA 5CT6A 1OX5A 3KK0A 4LXQA 3OEED 2C3OA 3Q15C 1F4PA 4P93A 4RLSA 5D8DA 1CLEA 3TPCA 5FRDA 4EX7A 2IOHA 1UBUS 4YJHA 1DUIA 3OUTA 4HNQA 3QOFA 4P36A 3UMFA 1KIMA 4P5PA 4TMTA 4INAA 4P4LA 3WZLA 4DLXA 2VNSA 4BNGA 4WUYA 1RM0A 1Z7BA 4Z9YA 3GN1A 4BX8A 1HH8A 2ZR0A 4ZVQA 4MKGA 1P2DA 2GN8A 4I1MA 2J85A 4QPPA 1QIHA 1CQXA 2RKBA 1IQ0A 1N9GB 3I2JA 4GLJA 1P1FA 2A9JA 2OCGA 1NZJA 1AS3A 1VJ5A 2PLNA 3KSMA 3LL7A 4QUBA 4PNEA 5IXJA 1FU8A 5IVHA 2Q7XA 4GQBA 3EU5A 2ECKA 3ONWA 5EA2A 4M0MA 1AB5A 3SF8B 1LKZA 2XUGA 3VISA 3OFNA 3RAGA 3PFBA 4TV9A 3BB3A 5DWQA 1M8PA 3UT6A 4MRRA 4P83A 2DPHA 4JC5A 3CFYA 3MMXA 2NIPA 3S4YA 1E4OA 3SHOA 3WK6A 1XJCA 4OHPA 4URKA 1B0UA 2E87A 5FT9A 1IWBB 2PDAA 2WD9A 4IJ6A 2J4BA 1JQ5A 1ODLA 2C7GA 2PVSA 3LAWA 5D0QD 4ND8A 1L8QA 3L6DA 1ONSA 1ZN2A 2QY7A 1KT0A 4P2GA 3K2QA 5ALHA 1RJ9B 4M7PA 1VE9A 2QAGA 2NACA 2V5UA 4FD3A 4A6XA 2O2IA 1WS6A 1UC9A 2XXJA 3K16A 2NXPA 5BT9A 4BQQA 4FDMA 1JN0A 3JQPA 2FZCA 4M1KA 5EGNA 1Q6YA 1HMPA 2YMMA 2ZBUA 4G4IA 3VR6A 3BMOA 5DXAA 3F6BX 4URZR 3B7PA 4ED9A 4JYZA 1WMDA 2JI8A 2NO1A 1BGXT 2LDBA 2HD4A 1TYDE 4HYTA 1GZSA 2QN1A 1LBIA 1OT5A 1JHXA 2RH8A 5JJLA 1PW5A 2FK7A 2R7KA 3QUAA 4JKOA 3OC0A 1R0BA 4MI6A 5EMNA 4WAFA 3EZLA 3GWZA 4RSGA 4XSVA 1XJ5A 5D66A 3L8ZA 3L9XA 4IF6A 4ZU3A 5I7VA 3ANMA 5KYWB 3MEKA 2VHUA 1IM2A 1XE3A 3EWSA 3RD5A 1LFDB 5KJLA 1UEXC 1UZMA 2PU5A 4M6WB 5L3QB 2P5YA 4XSGA 4YVOA 4OHMA 3BB1A 5D51S 2OYRA 4DL9A 4S1NA 3L84A 1U2ZA 3NC0C 4ZQCB 3W77A 3RVJA 4YTEA 4GPMA 1A8UA 4DCNA 4KQGA 4ZWNA 4B1FA 3B1WA 3UI2A 4INJA 5AJTA 4D81A 1II8B 3F3YA 4D3ZA 1BE8A 1XKQA 5FO1A 1EGQA 5A0VA 1KSHA 1HG2A 1EFCA 1NF2A 4M99A 4DGSA 3R7NA 1PJLA 3ENVA 4Q7QA 2PUWA 1XZLA 3CYFA 5CFMA 4M1MA 3QLUC 4AJ1A 4AWXA 4UKDA 5NULA 2GAJA 1FJXA 1Z6GA 4XJTA 3LWNA 3EHNA 2B8EA 4NV1A 3MBOA 5BUQA 1M2WA 3ENZA 4MUBA 3UMCA 2IYTA 2QN7A 3A4VA 4MO9A 1NIPA 4Y98A 4OOEA 1A2QA 4WNGA 1PR3A 2RDMA 4K9MA 3ROXA 2QZPA 4U96D 3H99A 1GSHA 1IEXA 1J4AA 3LPMA 1Q2UA 2FWPA 1EAMA 2IHKA 4EX6A 1B23P 1Z3YA 2H0QA 4KODA 4TLBA 4UCWA 3ZGYA 4NTZA 3PQCA 3DM9B 1W36B 1AF7A 3NOVA 5BYJA 2UUAB 2QLTA 4LDZA 2HMSA 3TOVA 1B1AA 1ZK1A 3LGAA 4LZAA 4RF5A 3Q7TA 3AR2A 3O2JA 4Y7CA 1PFKA 2HCJB 2WF5A 3EDMA 3FTCA 3NR2A 4L5YA 2BI4A 3WYNA 3FTNA 5CK5A 1DEAA 1D8AA 1EDZA 3LT1A 3NAQA 4MVJE 4BBJA 5B2FA 4JWTA 1P0FA 2N9UA 3E4BA 4LNUB 3EIFA 3KYJB 1SZPA 3N2LA 2X5JO 1RW2A 3UPVA 3TDMA 3KE9A 3ZJ5A 5JSHA 2ZUSA 2WKQA 4LS3A 2I3DA 2OB1A 3T4PA 3COVA 4LSMA 1OC4A 2WINI 4KLAA 4UI9K 3L8DA 5DSXA 4NAVA 4Y9SA 2JAHA 2X6KA 2N3ZA 2QZSA 2DWZA 1VJCA 3STTA 5DBOA 3N2KB 4XVHA 1AV7A 4XJXA 2CXTA 1RRVA 2EGHA 5L3SA 5BSFA 3W6PA 4BN0A 4MKRA 4UDXX 2P4EA 5DX8A 2LRHA 4A10A 1FBNA 2JLRA 3EMKA 3HQ4O 3PKIA 3WJ7A 4E14A 4FNAA 3AF6A 2CLSA 4KWHA 3O0DA 2EWMA 2RG1A 2ZJYA 2IUYA 2C61A 5GZ6A 2VNAA 3C0KA 1PJ4A 1FPQA 2WD7B 3MTJA 4EFMA 5J23A 1ONNA 5JCPA 2W71A 1YACA 3OVMA 3TQFA 3WLEA 5KJ6A 4JLWA 2W2TA 1ODSA 3PK0A 2DVWA 2GRAA 2XUFA 3VI4B 4QHTA 3LH5A 3OZAA 3KKLA 4CLRB 4GA1A 4B79A 3RS3A 5IABA 2WUDA 3SZGA 1ZJJA 2Y9MB 2NM0A 4DDMA 1Z47A 5KREA 1UQUA 2EZUA 5EKXA 4E2FA 4ILHB 1IZ9A 4NMWA 4ZVNA 5BXUA 2M98A 4JI1B 4ZHSA 3HBMA 4WWOA 2D2XA 2QTCA 3KVVA 4PPYA 2PM7A 2OE2A 3DOFA 4IIXA 1G17A 4RJ2A 4WFJA 2PH7A 3TLMA 3BOSA 2D2VA 3W2IA 4M89A 5B12A 5G3ZA 2O8CA 2DLCX 4C4OA 1EA5A 4Q24A 3K9FC 4RZ2A 4OQXA 4MV1A 3CE6A 5H9VA 2XPIA 2VZ0A 3GD5A 4D5GA 3LVQE 4RJTA 4N76A 2H6IA 4Z7QB 3EGDA 2WF6A 3KZ1E 2Q0HA 3QBDA 4AQYB 3EW7A 3UM0A 3NHFA 5JO9A 3UXYA 1FB5A 3BK7A 3ITEA 2PX5A 3ZN2A 1A7KA 1ECBA 5FI0B 4BEBA 4K9SA 2HA3A 3DEIA 5ALLA 1H0AA 1Y4SA 4UNRA 1O0BA 3WLTA 1U2VG 1UIRA 5AJLA 3EZYA 5EIBD 1VE3A 3DAGA 5B4TA 4EH1A 3QY0A 4ZN6A 2LNDA 1DC6A 1RM4A 3O8NA 4RVFA 4EPTA 4OB6A 3GT3A 1MQ9A 4QUDA 2DH6A 3FEXA 1ZC4A 5B1HA 5KWIA 4L5BA 3KQLA 4CIBA 4LY0A 5ENSD 2XTZA 5E9AA 4FR0A 3U13A 1SA0B 3HS3A 3LLMA 3G89A 3IVGA 4O2BA 4V0ME 5DSTA 4Z2YA 5SY6A 4UOEA 2Z2ZA 1ZWKA 3Q87B 2IIVA 4GKBA 1H2WA 5FPQA 3U3OA 2Y0PA 3D9NA 1NW9B 1USVA 2VDLB 3EH1A 3EYWA 4NCNA 4OFZA 4EY6A 5JA4D 2MSLA 1E62A 4I3GA 3FPLA 4EPZA 4GCOA 3V31A 3P0HA 3ROTA 4OJKA 1HSOA 3DO5A 3K4PA 3ZVMA 1BD4A 3A1UA 4ZGBA 2V7BA 1DJLA 4KDRA 1KIFA 1W1UA 4OSPA 4GUDA 1IOZA 4BWVA 3UJ7A 3KJXA 5I9IA 2HV9A 1SRQA 1GDDA 2EFEB 1XZKA 2B4QA 4Q82A 2J08A 4EQFA 1U65A 4CLHA 2JK1A 2HUNA 4DM4A 2QTRA 1MQ8B 1N2ZA 4U2KA 4KO8A 1RMTA 1C3EA 3KSZO 1RZRD 4AUMA 2ONYA 1E60A 1Z4LA 3CPJB 4H7KA 4JKYA 3GFFA 1XNGA 2FFHA 3TNLA 2WJYA 5DBEX 4QAQA 2JGFA 1F5SA 3O4IA 4HVTA 4V03A 3RUFA 4AJEA 4F7WA 4YLYA 3ZHXA 5CXQA 3H2HA 2IYXA 4BJ6A 5AM5A 3QA3E 4YYZA 3HXEA 1LLUA 2VTBB 1ZIDA 2YS6A 4MQ6A 4AIFA 4MKTA 1AK9A 3F1LA 3H9GA 5ES4B 3VZRA 2JLYA 3MHTA 4N18A 3CHSA 4UARA 1V3UA 1H1LA 1UMCA 3L6EA 1L5KA 3Q75A 4A82A 5AW7A 3N39C 4NJMB 5DGDA 5IDXA 4UBMA 1OSNA 3CSUA 4QU5A 4DJFC 3IEPA 3A1WA 3DMTA 1KMMA 1TT5A 1XAJA 3TKYA 1L5ZA 2BOVA 4COOA 2WILA 2QRUA 1IWOA 3VKWA 4PY2A 3AJ8A 5JAIA 2FTKE 1EUCB 3QLTA 1R4AA 3V46A 2VP2A 2G9RA 4ETMA 4KR6A 4U39A 4UNNA 5ARDA 1OI3A 2EKZA 1X7DA 3RU7A 3UJPA 2IPMA 3VTAA 4BVJA 4NFSA 4G4SO 4QOGA 4GF5A 4JEMA 5EWJB 4JX9A 3MMSA 3W3AD 3FUVA 2BFCA 2ACWA 3FPGA 1RHRA 1YULA 1L4MA 3A28A 4N0EA 5B2ZA 5BOVA 1T5SA 4C7JA 1IBMB 4YRCA 1L9XA 3D6MA 2FK8A 3DDSA 1PZFA 1YZHA 4MKHA 4YP9A 3V8QA 1NX9A 3NZSA 1NBOA 3NUGA 3SAJA 2PGOA 3THWB 3HBNA 1XRSB 3O3NB 5KX5F 1XVUA 3LF1A 4RHFA 1JT2A 2EJTA 3PRJA 1DJQA 4HB3A 5DLEA 3WIUA 3ZY5A 3ACBA 4LMPA 5BWNA 2CYCA 1FF9A 4RACA 4RCZA 3AFMA 4A8JA 2ADMA 2GPJA 5TY0A 3RS8A 4COKA 2ODTX 2HZ7A 3IMEA 2Y69E 2ZLBA 4KZKA 1HZ4A 4FP7A 4FMCF 5CNJA 4YUAA 3RRBA 2VT7A 3ABSB 3UJCA 1XDGA 2BEJA 2YWGA 4NRHB 4LZPA 3AR7A 3K1AA 3PNMA 4G89A 4NYJQ 1NI5A 3OJXA 3MYVA 1P6XA 4IFBA 3QMMA 4YONB 2B5WA 3T7EA 1SCKA 5HTKA 3W34A 2QDXA 3MINA 4R5MA 4E2ZA 5GJBA 3BJMA 3W2FA 1T2NA 1NBWB 2WICA 4FBGA 4FGLA 4WH0A 5IT5A 1YA8A 2XMSA 2ZTVA 3EEQA 4L74A 3ZEIA 2D00A 4MDYA 1RFGE 2AK3A 2C4UA 3AU8A 3GLTA 1EFRD 1W46A 4AWAA 5ALTA 1GAQA 5HR5A 2QJRA 1T5BA 9LDBA 2EAUA 4W1QA 5FR2A 1R9GA 2CBXA 4GUAA 3TVDA 3HU5A 4BP8A 4GNRA 2DZDA 4A0QA 1G21A 4I50B 3LDFA 4ENSA 1VM6A 1RI2A 1N5IA 2VTKA 3I32A 3TRKA 1GA4A 2CN1A 5EMLA 4F4HA 4RH0A 3UAVA 5JH7B 3RH0A 1KYZA 1RVV1 1DIBA 1C4WA 1P1BA 1Z4MA 3A10A 1RJ9A 2KCVA 3MN1A 3TJZA 5A4MS 3RU2A 1CQJA 1Q20A 4ZCRA 1M66A 4V2UA 4YJ2F 2LO6A 3GO4A 4I6JA 2G77B 1HORA 1VCMA 3GLGA 3NHWA 3OTHA 2QRPA 5KJFA 3D7SA 3GPLA 4RD4A 4DT1B 1QGOA 3WLLA 1JTVA 2ZJ7A 1Y9EA 1AXGA 3OOYA 1N2EA 2V7TA 5IMBA 1RWNA 3SM3A 1NJSA 5B7PA 1JT9A 2I4NA 2ZXFA 2L6BA 3MJWA 3OF5A 4LVCA 4HGNA 4P3PA 1KXZA 3RYCA 1S64A 1TR4A 2JI9A 1PKXA 2WHPB 2Z5FA 3IUSA 4HZIA 1KNQA 2JD2A 4ITVA 4HHEA 1RQPA 4C4SA 5AENA 1IL0A 1FTYA 4X71A 3U2QA 3USZA 1KP9A 4KH0A 4BESA 1N1GA 2LAIA 5FOSA 1T0HB 3FAKA 3QKSB 4H6VA 3RRNB 2VDOB 2LDXA 2ZGGA 2GYVA 5C0OE 1JE1A 1KAMA 3AEKA 1F6DA 5TQ0A 3D1VA 1L4LA 3MVEA 1BDHA 1CUUA 2FG7C 4I5FA 3VX3A 2OHXA 1RQ2A 5DBHX 2HJSA 4QYSA 4HQRA 3L7IA 3R0QA 2QMUA 2XEVA 1KI6A 3TWSA 4EA8A 2Z57A 4BFWA 3BQ9A 5DMHA 2P9TA 3KZCA 4ARSA 4PCUA 2H2IA 4RPHA 1T9HA 5AJXA 1Y7TA 2BSAA 1O89A 3DNMA 4RK1A 3RGWS 5KX5B 3GUYA 4DANA 4JBYA 3I4GA 3CF6R 2DKNA 5CH5A 5BNWA 1ZAKA 2MSWA 4M98A 2ZUDA 3AHGA 3ZYLA 4DAEA 1T4CB 2IGBA 4CETA 2VDVE 2VP0A 3KSDO 2F3PA 4PZDA 1U1FA 4E15A 3PFFA 1J5PA 1R0ZA 2C4TA 2EKPA 2Q5CA 5F7ZA 1U0FA 1Z7EA 3OZVA 1ZCJA 2SICE 1LVGA 2PKRA 1RKVA 2QQFA 2IKQA 4RYDA 5FTPA 5DISB 1QH1A 4Y3UA 4RFSA 3RADC 2QM8A 4B47A 4YAEA 3BFPA 4J8PA 3LCAA 1Y8CA 5HNKA 5JMTA 1P9RA 3ICQB 4OQEA 3ZEAA 3H11B 3WLMA 2JFXA 2ZQYA 3NIBA 4C07A 1OWPA 1E3WA 4X8OA 1MB0A 3TO5A 1NQTA 3VPSA 2O8CB 4PONA 1F0NA 5H3LA 5C1BA 3ZHEA 3U62A 2PGLA 1NL4A 2X40A 1Z12A 1U8YA 3IPCA 3LLVA 3N71A 1KK1A 5B30A 2RGUA 4BOYA 4E31A 1NSFA 1WZCA 4TTTS 3RYHA 3RKUA 4KXKB 1UIMA 3P1UA 2PZMA 2XB6A 2Q2VA 1V8PA 3B3AA 3I92A 4OHZA 3GRAA 2IK8A 3O8QA 4PC1A 4YAUA 4DI3A 4HX9A 3E37A 3CJTA 2B2NA 4LA4A 3T12A 2YMPA 4LRWA 3MA5A 2F3UA 3RBXA 4X20A 4IHQA 4XYLA 2H7XA 1HX8A 1HE8A 1JDUA 1DINA 1NG1A 1YBVA 2VA9A 4JR2A 1IBSA 1ULHA 2ZAOA 2C9DA 3C3BA 2XE4A 1C3OB 4GOOD 3FPSA 5HKOA 2NUPA 4E4YA 1M2NA 3FUJA 3L40A 1WRBA 4V1CB 1U3UA 3KD3A 4RLQA 2ATCA 2CCJA 2P69A 3H3XA 4BO5A 5BV7A 4MW2A 2UZ1B 1FQJA 1F1BA 3TUZC 5LX8A 4Q05A 2R05A 4ZOCA 4HTFA 2OB2A 3O84A 3CLHA 3VSAA 5JLJA 2H4FA 1K2WA 1Z0DA 1BS2A 2VAMA 2XYQA 4ID3A 3UJ6A 4F6LA 2HT1A 2VCEA 2ROQA 2XT0A 2W6JD 2M32A 1X80A 4LBWA 4PGHA 4IIDA 3IVRA 1BPOA 4QBKA 4A15A 3T94A 3AJDA 2GOYA 2Z30A 1H1DA 1NKVA 1EB8A 2WWWA 4XASA 3RRYA 1AHPA 3IBCA 4EO7A 1GKLA 3GLFE 4QUGA 3ANNA 1HOXA 1LRJA 2XQVA 4A23A 2XXAB 1LX6A 2YHIB 3IAM6 2WM8A 2CVFA 1UBEA 5JG7A 5IDWA 2C0MA 1UP7A 3LVRE 4GXQA 4DKXA 5AKIA 2B8JA 4OM7A 5J40A 3T1YB 4G26A 2ATXA 3BCHA 4RA9A 4MJ7A 4FW8A 4MWEA 2BE7A 4KWTA 4YCBA 5KNDA 2V7XA 1MFZA 1IUOA 1Z4JA 2EF1A 2QWXA 3BGWA 3HEMA 3OEYA 4P0TA 2W9XA 3WQQA 1J1UA 2Q1SA 2XEDA 5K2MA 2IS2A 4H7IA 1H65A 1PR0A 1TOAA 3GDFA 1RAIA 4E4TA 3HKEB 5BXOA 4WKPA 1E1MA 4X97A 4F9GA 1YOVA 3FNQA 5FPKA 2G04A 2HJWA 3EJ6A 1P7VA 1FYDA 1THTA 3B6KA 5JDCC 3T8YA 2O0HA 3ZHOA 4UPDA 4XCXA 5LMNB 5IW8A 4JVSB 4OREX 4ZOBA 3EGXA 3CT6A 1ZMBA 3ZKWA 5A2GA 2WMOB 3CHOA 1UXGA 1YCGA 2DKOA 3EVNA 5ED0A 3VU1A 1O1RA 3Q7PA 2EFDB 4K6KA 1PN3A 4UEKA 5J9FA 2XB2A 4I4CA 4QGBA 1IN5A 3QKIA 3K9IA 2WTXA 4C06A 4BU0A 4URUR 1M0TA 2XIJA 4LNGA 2VO1A 3BF8A 4LXTA 4QDTA 5GIOE 1P72A 2XUQA 3W2EA 3ZHCA 1V45E 3O4RA 1OGIA 2IFUA 1SVOA 1B26A 3HDYA 1TF7A 3AI3A 4WZZA 5CB4B 3IE1A 5HQ3A 2AFHB 5HMMA 1XEXA 1ODFA 1KK3A 2VDKB 1K6JA 1X94A 3TG5A 3AEYA 4JGIA 4S24A 3C4VA 3PGA1 2F9MA 5T4YA 3GLHB 3QW4B 3SLRA 1WO8A 1I80A 4D3DA 1L3BA 1Q44A 3I2IA 1JA0A 3BJEA 3LCVB 1W6RA 3DMPA 1RAFA 3T5MA 4L2LA 3EK2A 4K9NA 3T1NA 4MUNA 4N7RA 2WIAA 4IQ8A 3SOPA 3OFJA 4Q1EA 1GV0A 2O7NA 3C8MA 1JQLB 1QTQA 3GPDG 3G68A 3G85A 1OLXB 1JEDA 2ZKIA 5ADHA 1VL2A 2LWIA 3RUDA 4UBOA 3F5MA 3OEEA 1QRRA 2IT1A 2EXXA 4URWR 4MV5A 4EGQA 1U2PA 4N03A 3RK0A 1Y42X 7REQA 4D44A 3MUOA 4P5DA 5J2UA 3AVTA 5HUQA 2PWBA 4UUPA 3DVSX 3L16A 5K3BA 4NU8X 1QXSA 3LTNC 1EIWA 3F6EX 4W7SA 3I01A 4NOMA 1WXWA 3KTAA 1RKQA 1C9JA 1XZFA 4KN9S 1XI2A 1WXEA 2R8BA 4U5XA 3WLKX 4KYVA 1M67A 2J49A 2VRBA 3RT7A 4FT2A 2VH1A 1KPIA 1T36A 3PC3A 1GPKA 3QFFA 4Y6OA 1MGOA 3WK5A 2K6GA 4DLNA 4UQYA 2FETA 4ZRNA 4DN6A 3RSFA 5JJIA 4JL5A 4ZAYA 4PX2A 5T4HA 4W9RA 2FSFA 3T1QA 1JHPA 4CKCA 1F8YA 3DDUA 4D4LA 1CR2A 2HIMA 1KAOA 4NX2A 2ZCVA 4ZMBA 4ZPJA 4IGKA 2RBGA 2O2JA 3JQRA 3LFUA 4TT8A 1U1IA 4MV6A 1CEEA 4BGIA 2MHKA 3E3NA 1JIQA 5AKZA 3SFVA 3R0JA 1O1SA 2YYAA 3FPAA 3C5CA 4LZNA 1DO0A 3HUTA 3K5WA 4RZSA 3IV7A 1UKYA 4A8TA 2D0PB 3AO0B 4DUPA 3K0CC 2LBPA 1SQGA 3WBKA 4KIJA 4B4VA 2HU2A 4OV6B 5F52A 1JLHA 1QCDA 3KTAB 3ZDBA 3V7FA 4TRJA 1OB5A 3ASDA 2GNPA 1GVNB 3UJBA 1VSQA 1GPJA 1XX6A 4S12A 1ULSA 2WIDA 3ZW3A 3DOHA 3O83A 4JAVC 4ZREA 4C03A 2HCTA 4C4YA 3IDSA 5KJCA 3LGXA 5IANA 1Y8QB 3I2FA 4NU5A 4MLCA 3UGQA 4EJSA 1WVGA 2R4TA 2DIWA 3GA5A 5T8KA 1Y3HA 1FXWF 3DLPX 3VR1A 3WDLA 1W75A 5DXJA 4C7OA 5AKHA 3FLBA 6GPBA 4JT9A 5JD4A 6PFKA 2XRFA 2FMHA 4GZDA 4WLEA 3R41A 5LWHA 1YVEI 4FYYA 4BSZB 3DP7A 3H8SA 3KYDB 4LRQA 4ANVA 1G6OA 1NM5C 1XD9A 2I2DA 4MV9A 3AP2A 1ELKA 1NW7A 3P2EA 2VJOA 5CVEA 2ASVA 2HKIA 4JZYA 1ZU4A 1P73A 3UBMA 1VG0B 2PYIA 4RL4A 5B7QA 1XEXB 3CMCO 1L7XA 3R44A 4OLHA 3SICE 4CT4B 4Q47A 1M8FA 3E8XA 3JRXA 3VGJA 3N8DA 1QMGA 2EL9A 2W6ZA 3GMSA 4MWCA 3GDHA 2IDMA 3GFVA 3T7IA 2B6NA 3JXEA 1XQYA 3O92A 1VMIA 3GD7A 4NAHA 4MV4A 4B09A 2RJOA 2P2GA 4EUSA 3L6BA 2IL1A 3RAPR 4DV7B 2OOKA 4U6SA 1H3NA 5CG2A 2PU7A 1G8SA 1TADA 3DC2A 4PC6A 4WN9A 3SSMA 3NGMA 1U7WA 3UC5A 2J0UB 4EUFA 5JXHA 2GCOA 1SC1A 4H2DA 4XWTA 1CHDA 1A5BB 2BFEB 3AZPA 4R98A 3VU9B 1FDUA 3EMBA 4KXNA 3O95A 2IU1A 2IYPA 3J5PA 1N7JA 4EMBA 3TMYA 1OXVA 3PRYA 3TOXA 2Q0SA 4RFVA 3T7JA 4L78A 2OV3A 4X1YB 3LE8A 1X5BA 2QD5A 3M6IA 4FKZA 5JSZA 1ODKA 2OHGA 3EVAA 3M9WA 3AEQB 4XIJA 2AYYA 3AVVA 2ILRA 3B36A 1GUBA 3S27A 2YXNA 3LSTA 3CH5A 5B4VA 2XOKD 3DP9A 3QOXA 1OXSC 3N0TA 2QXTA 3CRMA 3QEJA 2CKMA 3ANXA 3GCDA 4RVSA 4BZQA 1KEEB 1AS0A 3N74A 2C5SA 4DQKA 1R0RE 2YYZA 1AKYA 5G4KA 2YHIA 1EUDB 3U3JA 2N0SA 3FMOB 3B60A 4BX0A 3CHYA 2UXBB 2ZI6A 2V9CA 3HN2A 1DIOB 2CMDA 1XZ8A 4NURA 1ZGBA 3NDPA 2LVBA 4M55A 2YNMC 1NNLA 1V11B 1OLOA 3G7SA 3MF4A 5AD1A 5C52B 1PLKA 2F9LA 3CBQA 4Z99A 4CRWB 2ZRQA 3JZFA 3CLTD 3EB9A 3AQ4A 3R7WB 1LGYA 2FUG1 1XBTA 1DCFA 4LFBB 4ZO6A 2AF4C 5IJXA 5SICE 1QJ4A 1OTHA 1XMVA 2XZDG 1QC5B 2JJMA 2X1HA 4NENA 3ZPXA 4A2PA 4WACA 5K0BA 1E1YA 2IUTA 1M2OB 4ATZD 4PRZA 4CM5A 1P9WA 3TFWA 4BKOA 4M37A 5IC5A 2P7IA 5K0FA 3OF2A 4ZV4A 1E5DA 1XSEA 2NSYA 5I7FA 5AICA 3OCZA 2VPYA 3A1NA 3ORQA 1Z0JA