2XGSA

Xcogt in complex with c-udp
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
542
structure length
542
Chain Sequence
LMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XCOGT
publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
total genus 206
structure length 542
sequence length 542
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgsA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgsA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgsA02
3ZGQA 4EKEA 5KJMA 3CKCA 1JG6A 2QRHA 5LCWJ 2X0FA 3T3IA 3AS4A 3BEEA 4N2SA 2XCUA 3TAXA 3HYMB 1XL0A 1B89A 4GA0A 4KYOB 1L5RA 1FCHA 2QN8A 2ONDA 4L22A 3SZ7A 3OTGA 1P4JA 3MV2B 2L6JA 4H7XA 2LSUA 3Q4AB 3UPVA 3URZA 3BDAA 4JHRA 3TG5A 4KQ1A 1SXPA 2GM9A 1UZUA 3CUUA 2X6RA 4O6FA 5D00A 1E96B 1GPAA 3AS5A 3VTXA 4NC9A 2GW1A 2QFCA 1WUYA 4Z5XA 4A1SA 1PN3A 2BUGA 2VSNA 2SKCA 3NAZA 1XL1A 3D0QA 4N5CA 2Q6VA 1GPBA 3MRXA 3NCHA 4F3VA 3CVQA 2BGTA 4Y6WA 5FZQA 1IIRA 4APOA 2QN9A 3Q3EA 2R66A 1FU4A 3PE4A 3G2LA 3RSZA 3MTBA 2IV3A 3R9AB 3BD8A 2KCKA 2QZSA 1GFZA 2AMVA 2LNIA 1L5WA 3MBOA 9GPBA 1C50A 3SF4A 2FF5A 2KCVA 3EBPA 4MHOA 4UI9J 3E3OA 2FBNA 2UWJG 3PDNA 3BD6A 3LCAA 1RZVA 4XI0A 1WM5A 2F3UA 1E1YA 2C4MA 3QHPA 3GYZA 3LYAA 4U0SA 3G2KA 3MKRA 1PNVA 2GT1A 3RO3A 3ZCUA 1XNFA 2VGXB 2UY1B 3QKYA 3MS7A 3D0RA 1NZNA 1L5SA 3E3NA 1K08A 1FS4A 3L7BA 1FU7A 4HOQA 4GZ3A 3L7DA 2VG8A 1E4OA 4GZ5A 1UQTA 4XI9A 4GA1A 3CV0A 1B4DA 1GPYA 1IHGA 5G04C 2XCBA 3EDTB 4W9RA 4Y6CA 3CEMA 3G2NA 4WNDA 4LDPA 1F0KA 2ACVA 3S7FA 2FEZA 3TG4A 4G24A 3RJVA 3CUVA 3FWVA 1QZ2A 4RIIA 3FFLA 2C1ZA 4I17A 4WNFA 4UI9K 3DDSA 8GPBA 3MT7A 4GPKA 2Q7FA 3KD7A 2AV6A 4GCOA 1Z6PA 2G9UA 2G9RA 2IEIA 4BWRA 3LY9A 3COPA 3NP7A 4AN4A 1L5QA 3ZCTA 4BT8A 4I2WA 1KTIA 3MS2A 1A17A 4RG6A 3L7AA 4BQIA 3Q3HA 3ZFWA 1P4HA 4M7PA 3CVLA 3DDWA 5IKPA 2G9VA 4PQGA 2WPVA 4CGVA 1PSWA 1PC2A 4HLNA 2PRIA 2KC7A 1C8LA 4NQ0A 4WUYA 5EX0A 2OFFA 1C3JA 3S7JA 4AMGA 2O6LA 5TMDA 3HBFA 4YVOA 1WV1A 1C8KA 5BW8C 4I1AA 2VCHA 1NOJA 1NLMA 3G2IA 3MRTA 2YHCA 3OY7A 1JIUA 4JA7A 4MI9A 2XA2A 4XIFA 5KJLA 2MHKA 2FETA 2G9QA 3Q3IA 4RIEA 3CK8A 5HXAA 1AHPA 3CVNA 1FTQA 1IXYA 2SKEA 1OUVA 3OT5A 2IF4A 1V4VA 5G05C 2V5FA 3IA7A 3Q5MA 2FFRA 2QRQA 3NP9A 3ZCSA 5D0QD 3OXGA 4IN3B 5JTUA 3BEOA 3MRVA 1FTYA 2HYZA 2I6HA 1TJCA 3RU0A 2Y4TA 3LKUA 4EKYA 2P58C 1J39A 1O6CA 2P6PA 5A6CA 3OTHA 5CCMA 2QN7A 3MV3B 2JZCA 2ACWA 4RG9A 2ATIA 4RIGA 5G04J 2PYDA 3T3EA 1GGNA 1NVKA 4JL0A 4HWGA 2VCEA 3ZHEA 2QLNA 2F9FA 5A7DB 5KJNA 3EBOA 2X0EA 3NB0A 4GYWA 4QLBA 1YA0A 2QN2A 2QLLA 3CEHA 4LEIA 4W6QA 2X0DA 1WV0A 1SXQA 4UQYA 2R68A 1HZ4A 3C4VA 3LY8A 1L6IA 3OY2A 2IUYA 2PQNA 4F9FA 2BISA 1WAO1 4G2VA 4YVQC 5EKQD 5FJYA 4YI5A 2HY7A 3RO2A 1NZFA 5KJKA 2F3QA 3DZCA 2WTXA 1HLFA 3CK7A 3S29A 1WUTA 5DBKA 3IEGA 3SYMA 4HORA 2C0LA 2YJNA 4B94A 1NA3A 1NOKA 4H7YA 3WC4A 4YUAA 1FC0A 4CTMA 2PQ6A 5ENZA 7GPBA 4EL0A 3VDNB 4N3CA 5LQDA 1Y6GA 1A8IA 4AIFA 2VQ2A 5JJ7A 1QKJA 2SKDA 4M83A 3MTDA 1Y8MA 1ZU2A 4EQFA 4MI6A 1ABBA 1XV5A 2QRMA 3CV3A 5HQ8A 4J8EA 3WXXA 4GA2A 2GJ4A 1RRVA 4N9WA 5LCWC 5TMBA 1FA9A 3RKVA 4RBNA 3BCSA 5D0OD 3OXFA 3CUWA 1FTWA 4REMA 3G2HA 4UQZA 2QRPA 2C0MA 2HR2A 4BQEA 1EXVA 4CTNA 3QWPA 4KXKB 3OTIA 4EL5A 3T7DA 1P5QA 1KT1A 3OKAA 2IYFA 1Z62A 2XGOA 4NESA 4RENA 1AXRA 4U0ZA 4KQMA 2C2LA 5D01A 3S0JA 4ME2A 1P2BA 5FZSA 2DBAA 5TMEA 3MS4A 3O48A 5ARFA 2R4UA 3QDNA 4F96A 3ASDA 2PZIA 3ASGA 2E2EA 3D1JA 4AM9A 4U07A 4G2TA 1XOIA 3TGOA 5AYWD 3TSAA 3E3LA 3ZCRA 2AZDA 2Y4UA 4MRAA 5TVGA 2HO1A 1F6DA 3S7BA 2AW3A 3MT8A 2VGYA 3MEKA 3QWWA 1H5UA 4GZ6A 3ASHA 2XA1A 3GPBA 3L79A 2XPIA 4RELA 1UQUA 3E4BA 5C1DA 1GZ5A 4X7PA 1ELRA 3GZ2A 4UI9C 2XGSA 3S2UA 5DXFA 3S27A 2WQHA 4WHMA 5BNWA 4X7MA 3T5TA 2AVPA 2QN1A 3U3WA 3MQFA 3T3DA 2R5SA 4FKZA 3LY7A 3QWVA 3KS2A 4UQXA 3HBNA 1M5RA 2KATA 4EJ2A 3VUEA 4YNDA 2IW1A 3UYKA 4G23A 4HOUA 3QKWA 2QRGA 4YI3A 4HOSA 2FI7A 2VSYA 3CK9A 2JJMA 3OXLA 2IEGA 1IYGA 1GG8A 4RIFA 3H4TA 3NPAA 4X7RA 2YQ8A 5CCLA 1JG7A 3OKCA 5DLDA 2PYIA 3L01A 2IV7A 2XEVA 3BCUA 3G2JA 1P2GA 5M72A 3WAGA 1XC7A 3Q47B 5IKOA 3NF1A 1HH8A 2KCLA 4F97A 2H1FA 1ELWA 4NEQA 3VTYA 3CUTA 5I45A 3CX4A 3ZHEB 1YGPA 4GYYA 2VYIA 4GCNA 3ULQA 3AMVA 2JLBA 5DU2A 2R60A 2OOEA 2NC9A 4AY5A 2F3PA 3WADA 4LEUA 4G26A 1NZDA 3RSCA 1W3BA 3IAAA 4J8DA 5JJTA 3VUFA 3U4TA 3UYLA 2GEKA 4WADA 2C1XA 1P4GA 1JEJA 3NC4A 2ECPA 3T3HA 1QQEA 1YA6A 4JA9A 1ZBPA 2FF4A 3MT9A 5FTPA 3TOVA 3C4QA 1Y8ZA 2XMPA 2X6QA 5JTTA 4I2ZA 4J8FA 1VGVA 4AMBA 2QLMA 4BFCA 2KS6A 4MICA 3O3CA 4MHSA 2XCCA 2VGXA 2BGUA 2ZB2A 4KQ2A 2UY1A 1WW3A 4GPBA 4MI3A 3BD7A 4CGWA 3FROA 3K9IA 3RT1A 4RIHA 3ZCQA 4N3BA 1FU8A 4BTAA 3ZCPA 1JIVA 1Z6QA 5CHEE 3ASFA 5G05J 5HI7A 1LWOA 1NA0A 4G1TA 3S7DA 4ABNA 3DD1A 4FZRA 3QOUA 1PYGA 1XKXA 3LPZA 3RHZA 3T3GA 2PRJA 3BCRA 4HOTA 4WACA 2FO7A 1NOIA 2PQRA 1JIXA 2GPAA 3HBJA 4CTOA 4WNEA 3GW4A 4CDRA 1K06A 5JJ6A 3CVPA 4GYOA 3VDMA 2XGMA 3S28A 2PL2A 1RZUA 2R4TA 2GEJA 4I9EA 3Q49B 4WNGA 3ZCVA 5FZRA 2GPBA 3FP3A 1HXIA 1P29A 4J0UA 3ESKA 4N3AA 2ASVA 5EX3A 1L5VA 3ZPJA 5GPBA 5DIZA 2F3SA 4BTBA 3MA5A 1KT0A 3CKBA 5ARGA 3N71A 2C9ZA 4AY6A 3MSCA 1L7XA 3H4IA 2IYAA 2LSVA 2QNBA 2XCIA 4X6LA 4NRHB 2QN3A 3RIBA 2IFUA 3AS8A 4M60A 4U0UA 3L7CA 1BX3A 3CUYA 2J9QA 3MTAA 4N39A 3UUXA 4G25A 3UQ3A 3GUHA 3KAEA 3OKPA 3GZ1A 3CEQA 2XA9A 4I9CA 4N2QA 1LWNA 1WW2A 3SYRA 1Y6FA 1KLXA 2H1HA 4BT9A 4BQFA 6GPBA 3PE3A 1EM6A 3JYSA 4U04A 2BFWA 1P2DA 3CEJA 3ZN3A 4KBQA 3C48A 1Z8DA 5FT9A 2GPNA 5BT1A 1QM5A 3HBMA 3Q15A
chains in the Genus database with same CATH superfamily
3CKCA 4ZRNA 4QUEA 5DHSA 1XMQB 3G1UA 4LERA 1X7HA 3IUJA 1YI8A 4X65B 4KYOB 4C07A 4MKTA 3HXPA 2R1TA 1Y8CA 5EE0A 4KDEA 4L9WA 2YINA 1T2CA 2WWYA 3WDKA 2XCTB 4BJHB 3C7KA 1TC1A 5CRVA 1G60A 1G0OA 4K6OA 3ZIMA 4MWSA 1XGWA 4IZOA 1GV1A 2A5JA 2OHIA 5ALNA 3INNA 4DLSA 3INTA 3LCAA 3T1TA 3MQ2A 5CDFE 5SYNA 4NK4A 1E9SA 2JPDA 3W6NA 3ZGOA 2QKYA 1C0EA 3UXGA 3GDGA 4N49A 4Y6CA 2R6CA 4HJRA 5BW8A 5H68A 1XQYA 3TR6A 2C1ZA 4DPKA 2ZLBA 3TF5A 3BGVA 5ED4A 3GG9A 3VLDA 5B1SA 3KVYA 1EUDA 1KTIA 1J2UA 3GVHA 4UEOA 3RRZA 5G4LA 4U02A 5FH9A 2FEOA 4N5HX 3REFA 1K6XA 2FZKA 3PQ4A 1AHNA 2DXIA 4BWGA 3PSAA 1PKEA 2FK8A 3ZIAA 5AKXA 2BTQB 3SR4A 1N2JA 1BZYA 3VPGA 4BNVA 2VSQA 4HFRA 1NNI1 3O2JA 1G9SA 5D0QD 2Q8PA 2GVNA 1X19A 2BONA 4K9KA 2ILVA 4DMCA 3HN2A 5ALWA 1EP1B 4BVKA 3MUFA 4FQ8A 3I4CA 4WWNA 1SHZA 2WV9A 3H1EA 2VDQB 4JBHA 3W9SA 3D6AA 4E21A 3RS4A 3IEPA 5L4NA 4YVQC 1A27A 4PFJA 1M33A 1RM4A 2XIJA 4R81A 3C85A 1VKHA 3UWKA 5C4GB 2QTRA 4DC9A 2PGAA 1SU6A 3VSBA 1WCYA 2NP7A 2OWDA 3I8OA 3UM0A 3PC4A 1D9XA 3KSBC 3ONVA 3AV3A 4YRFA 3RS3A 3OXFA 3FDFA 3IH5A 1KIFA 2E4YA 3QWPA 2ZRFA 3JQRA 1ND6A 1QG4A 1YASA 1YMVA 2C84A 4C6HA 4MUAA 1PEKE 1VTKA 4KO1S 3RRJA 1MVOA 4DJ5X 1XZLA 1T9ZA 3WRYA 4ASUA 3SM3A 3N7UA 4II7A 1SU8A 3W8FA 3ZY4A 4DCMA 1NN3A 3RCBA 4WASA 1YFLA 4JSYA 3PWTA 4L15A 1O0BA 1X7YA 1WD7A 1XQ9A 2CJFA 2OQ2A 2BDTA 4H7JA 3JQ0A 1R5NA 3HLTA 2I7VA 1L7QA 4B89A 5IKMA 2HADA 3BCUA 2C96A 1SXJE 2AG8A 3DZGA 2IEBA 2PL3A 1ELWA 2QYSA 2OCBA 4FC8A 4FUQA 4RF5A 4HEQA 3DMTA 4CLRA 1WKBA 4Q4AA 5K03A 1JIKA 1FFGA 1AGPA 1RWNA 4I4NA 4KACA 2ZUFA 1DJPA 1U1EA 2AX3A 3DSSA 3G2MA 3FLEA 1UBCA 2AYZA 5KKNB 2EX0A 1W76A 2OZEA 1TW3A 1EHYA 1XEAA 2JD2A 1XQWA 3VZRA 1G18A 4K03A 5GGYA 4P29A 4V38A 3PJRA 1I1QB 3H11A 1AGXA 1H9BA 4CM8A 3L8EA 1G21A 2E5WA 2CHFA 1FP2A 1QFMA 3IX7A 3H4IA 2HHAA 3S4YA 1CF2O 1ZMTA 4I55A 2I4MA 3CNNA 2LTAA 4IW3B 1A2QA 5K1ZA 3D6TB 2YNMC 1Z82A 2WM2A 2PQ0A 5DNEA 1JG4A 1PJTA 5FT9A 2HWYA 3VR6A 5C1IA 1BEUB 1Q19A 3PENA 4TYNA 3PG5A 1Q1QA 2CYBA 3FUTA 3OIDA 4N47A 5EFZA 4QJIA 3ICOA 1E9EA 1XLTC 3T4UA 3G89A 3N2ZB 3ZD8A 4X93A 3QKTA 5AJVB 3BHIA 3MD9A 3ZUPA 3FVRA 3KD3A 4R8RA 5GONB 2FMKA 3OCYA 3P0HA 1R9MA 5IK2A 5LBTA 1PFYA 4KXMA 3MTGA 4YAFA 1DBSA 4FW9A 3HKBB 2FWBA 1RW4A 4RTSA 1V3VA 2D06A 4X3CA 3EY9A 2Q4TA 2AOTB 5K3FB 1VHDA 5TY0A 2WJAA 5EHGA 2XD9A 1TUEA 1RAAA 4FDMA 3S2IA 2P77A 3WYGA 1T24A 1D1SA 1H2AS 5TT0A 1IHGA 4C21A 1PJQA 1BS9A 1FYVA 5HBRA 3WR5A 5C7IO 2VBGA 4YIKA 2RFAA 2JD1A 4BT8A 1Z3IX 1Q0LA 4DBLE 1ILEA 1N8SA 4DG9A 4DEYA 1NL4A 1KY3A 2QT9A 1KTVA 3QX8A 3DPYA 4JBLA 3NM5A 3MCXA 5DTRA 4QPDA 1VL8A 3J81k 2RMKA 2VKTA 3MJFA 4PONA 3RKUA 2OHXA 1VJ5A 3E58A 1OCCE 1FXUA 4B3HA 4EQ6B 3UAZA 4HGYA 1K8YB 5DLQC 1KNQA 4F92B 2NO9A 5ALHA 4LJAA 5J58A 3ASVA 2HA7A 2AI2A 3VC1A 3UT8A 4GOXA 3SXUB 1PS8A 2ZITA 4FP9A 3C5WP 4L8WB 2AVDA 5DNVA 4F71A 5C7LO 5E1DA 1OUMA 3ZW8A 1MJHA 1VYVA 1E1RD 2A9FA 4JLPA 2CD9A 1I0LA 2PQ6A 1KZ7B 4QYXA 4EL0A 2Y27A 2W2KB 4YUXA 3LDHA 5KVCA 2XV1A 4J0IA 1SQSA 1QMGA 2H8KA 5CT9A 3T7AA 1X9IA 3PDJA 4QFVA 1BWSA 2DUMA 3DONA 1KT1A 5EJ5A 3SYNA 1DG1G 1KJNA 1Q3KA 1E66A 3C16C 1U8FO 4ZREA 1U1GA 5D3MA 1CUEA 2CGEA 5F4BA 1PJ8A 1XN4A 1WMEA 4RV9A 2QR3A 1OBVA 1IOWA 3VOTA 4K9QA 1G5QA 5BOSB 3EXAA 4OHRA 4L4XA 2PRKA 2VSOE 3UEOA 2JI9A 1HYQA 1ODKA 1KI2A 2HV9A 3BKWA 4P4SB 3UXYA 4Q7LA 1T2EA 1Y1KE 3GAMA 1H19A 1RPTA 3VYVA 1ZRNA 1FTNA 4QAQA 1IYGA 2GYUA 4WGFA 1CUWA 2JRLA 1FP7A 1OJLA 2BEWB 2Z3ZA 8MHTA 3WK8A 2C9YA 3IIMA 4D43A 3ZYMA 3CW2A 5DT9A 1AKNA 4C0XA 5DU2A 3OOEA 1KH2A 4ETIA 3DAYA 4JV5B 3HRKA 3C1AA 5EIXA 1T3ZA 4O2BB 2YMLA 2BFEB 2XWJI 1FTSA 4HVLA 4INOA 2WJGA 4MI3A 3ROGA 3BD7A 1KHTA 3FTCA 4PWZA 1G6OA 2NXJA 4EUSA 5EYPF 3NAQA 4TV8B 1NR7A 1XRJA 1D2CA 4CYMD 3UFBA 4A7PA 4CL0A 3TZCA 3GW4A 5KWIA 1M6VB 3MUOA 3QKRA 3U5TA 1H23A 5LDGA 3ZNGA 2PL2A 3ZJTA 3BG1B 1CP2A 4D81A 2ZBEA 5IXYA 3BG0B 3R6DA 1SOMA 1JLMA 2F1OA 4BVFA 5HIAA 4PTZA 4FZVA 2O2IA 2FTKE 3P94A 1QWOA 3CG0A 1Q1AA 2H0QA 1SUWA 2Z5GA 3BILA 3IP7A 4A0QA 1V35A 1KJ9A 4I3HA 4B6OA 2X0KA 3ZKJA 3ME5A 3ND7A 3TXXA 1DXOA 1RYMA 4HNAA 3CUUA 2GZRA 3TTSA 3ZHRA 4EPTA 1UMDB 3SZGA 1XJQA 2WF8A 3TIGA 5LXTA 2XVYA 3MGAA 5I3ZA 4BX2A 1FJHA 2OQVA 1NW8A 4DEVA 1IN4A 4EKIA 3HDTA 3MXOA 4A0SA 3SSNA 1O94A 4NDAA 4ND2A 3F46A 3LL7A 5IJAA 2WSBA 3UOAB 1DIHA 2FXVA 1RWBA 1ZH2A 3MMZA 2AEEA 3FKSD 4RDCA 4RG6A 3PV0A 4KR2A 4Q24A 3I2JA 3FNIA 3ZGLA 3QF4B 1D03A 5BYJA 3NBYC 4MWDA 5K3DA 2YHCA 1EB8A 3L46A 5CH3A 5DYNA 3L4JA 3DBIA 4AMVA 3DMHA 2IF4A 5EZYA 1XTVA 2CK3A 2GK6A 3G5AA 3R7NA 4BU1A 4C14A 1MOZA 1LDEA 4NCBA 5AI6A 4RIGA 2YVKA 3TEJA 4QQNA 3OEHA 1U2GC 3PVLA 3OO0A 2VJOA 3BQ9A 4JJKA 1L6IA 1NX9A 1XEWX 4RWZA 1QYXA 4Q6WA 3D9JA 3ED5A 4MULA 2D4HA 5C8YA 4H7PA 2XTZA 3DBHA 1D2MA 1RABA 2X86A 1U0HC 5T4EA 4PQFA 4QBFA 2G36A 2JEYA 1GUFA 2P67A 3B9RA 4WVLA 4J8EA 3EZ7A 2WWVD 1L7VC 2GJ4A 3NKLA 5JXIA 4OJMX 1FFHA 1G8MA 3QK0A 2VWGA 4RSRA 3W5CA 2QAGA 4RA6B 3AERA 3H6HA 1ZZEA 1BROA 3QG5A 3HHMA 2IYVA 3O8NA 1E1KA 2PUJA 4YPFA 5JAPA 3GHHA 2Y1OA 2Y8EA 1FX1A 4TYWA 1YL5A 3K96A 1U7PA 1HI9A 1O54A 4BKMA 4TWRA 4KW7A 2HLDD 2H92A 5BN4A 1KVSA 3NS7A 4D9BA 1EFPB 4I6GA 4YNDA 2A5UA 3L6BA 4DARA 2VQDA 3WGHA 4CCAA 2D13A 4FHCA 4LHSA 3IPRA 1K7YA 3H5IA 2VJMB 1DTEA 3K0AB 3OQMA 2P11A 5BV7A 3A4YA 2FB9A 3ILXA 2P6NA 4GXQA 4GMXA 2O8EB 1P8JA 3HXFA 5ENVA 2VKQA 4K9LA 4L2IA 3H3JA 5FUYA 1AZTA 1G64A 1NE2A 4QRIA 5T67A 1C1DA 3WO0A 4KQ9A 4FLBA 1L4LA 2IQ5A 2CCKA 1E77A 3R8XA 2WUDA 4JLSA 5ERYA 3IOCA 3PL5A 2OYRA 2CNNA 2I22A 3GGDA 2NP6A 4FHZA 5FQ4A 4GRDA 3FRIA 4QTTB 2E0IA 3UJAA 1CUHA 1RAFA 3I9FA 2VRBA 4ERNA 3E2MA 2CLKB 2C8JA 3D9MA 2QYUA 5DBIA 2ODWA 1F0PA 4NSNA 3GQVA 4GYOA 3AVYA 4JLUA 5FPYA 5CUQA 4ZQGA 5A9TA 3VU8A 2J4DA 5LLSA 4GC9A 1XNHA 5B3AA 4WI1A 3QVMA 3GL9A 5FDFA 1WTCA 3AS8A 4G1CA 2WUEA 4EGJA 4GS5A 3F8WA 4RTMA 4ZP1A 1D1PA 1PLJA 1NC1A 4ESOA 2NXNA 4Y2HA 4D9CA 3QW4B 2B21A 3UHJA 5AIJA 3KYCB 3AUJB 1J8VA 1TCBA 4H9GA 3TNJA 1I2MA 2D3TA 4HMPA 4CT4B 4HUQA 2DSNA 1G7CA 2LD4A 3T9AA 3EPKA 4DLPA 2WSYB 2XCSB 1ORHA 3L1UA 4GMLA 3GEBA 1T8YA 1H94A 1Q92A 5FR1A 4MNTA 5I8ZA 4Y6WA 2MRIA 2JLWA 4P3OA 3B20A 1W1UA 4A03A 2XTNA 2BEVB 4HXYA 1W0JA 1UJBA 2PYZA 4PYQA 2WFAA 3G2KA 3L6UA 3SHQA 4LOKA 2CFZA 1DAHA 1BN7A 4LY6A 2O05A 1QH1B 3A14A 1CCWA 4OHVA 3RYIA 1A9TA 1QDEA 3KT6A 1NG1A 3FAZA 2V7PA 4DTCA 3OWOA 3LHKA 3KVVA 3SGLA 4WNDA 5EN4A 4O2RA 1VRWA 2ETCA 4YLGA 4YRRA 1XR3A 2J32A 1K9VF 1SC6A 2V7TA 1P4HA 2G6BA 2ZWVA 1ZIYA 3ZWWA 1CZLA 2Q1SA 4FHJA 3KXLA 4XWKA 4BRWA 4ZV4A 3AKYA 4BQNA 3RRUA 1QH0A 1JFFA 3KT8A 2FQQA 4WXHA 2Q9UA 2FW8A 1YO6A 4RIEA 1P5FA 4NBRA 5FBWB 1YDHA 3P9NA 2F1KA 1JDNA 1JDSA 5LQMA 2GETA 5HFJA 1M67A 1PX0A 5HRYA 3KT3A 4EKYA 1N2CB 2QN7A 4GNRA 5IF3A 1DZIA 3H84A 3CUSA 4REOA 1JU3A 2QZ4A 3LBYA 4FFDA 3UNXA 3LUJA 4MR8B 2OR3A 2O8FB 3G8AA 2VYNA 5FI1B 1VG1A 3BZUA 5JSUA 1AE1A 3TI7A 5DTEA 2BW0A 3RSOA 3JSXA 2VATA 4IQ4A 4AYTA 1VSQA 3VMFA 4RA9A 1OGYA 4LZOA 2X77A 2VRNA 2B83A 3NHMA 4P22A 5B58T 1UJCA 4C7XA 4FFPA 4RESA 3IP3A 3ZZNA 1ETUA 5LQNA 1R66A 3O91A 2XUHA 3GCWA 4LF9B 2JA2A 4HDSA 3IMEA 4Z4EA 4CLOA 3QBEA 4EHMA 2PHZA 5KC9A 1ZOOA 1Q17A 3A37A 5HBGA 2AQ8A 3PDWA 3E82A 5ESXA 3KKPA 3KB2A 2G28A 2LKCA 3KYDA 1YULA 2N3ZA 2QTFA 1N92A 2HRZA 1Z83A 3DV0B 3HCBA 2IJGX 1T5SA 2QRGA 1W2HA 1DX4A 5TGZA 2HWWA 4CMIA 3FYUC 3QX9A 3BVPA 2PK3A 2V7QD 3I0MA 1N1MA 3SBSA 1RCFA 3W3AH 3TQIA 4LDNA 4MS3B 4B9AA 1TNBA 1Z36A 1TGVA 3L0OA 3FTUA 3FRHA 3RBXA 2ETVA 5DW0A 3A7DA 3NC4A 2PVPA 3ONNA 4JA9A 1X7DA 2QNIA 4L0CA 3MERA 3PHGA 3QPAA 3Q7FA 1Z22A 4UJ3A 5GONF 1EHCA 3K9IA 1WHTA 3ZI4A 1S2DA 2FQ1A 1ZGHA 3IV0A 4M99A 2GZ2A 1E3IA 1P1RA 1T8PA 5TNXA 2AE1A 1DQSA 3MBKA 2IITA 3WTCA 4OQ4A 3FNBA 1YB5A 4IF4A 2IP4A 5JBIA 4FCCA 1XA0A 2WUVA 4MRRA 4FSHA 4IV8A 4YJHA 5AK6A 3RBVA 1DFIA 1TO6A 3HCCA 4HRLA 3NEPX 4TSFD 1V96A 2XXAB 4NZNA 2OHOA 2Z3VA 4DPMA 4NH0A 2QR2A 3O9VA 3DKKA 1A69A 1GFIA 2SNIE 4EG0A 1U99A 2NO6A 3ZWAA 2H2WA 4ODIA 4DLZA 2PKQP 3DHNA 4W1SA 4RY9A 4B4UA 4F2WA 4AZWA 4XARA 1VP3A 4XOIA 3BWBA 4ARCA 1UDCA 3SD7A 4OLAA 3ZC3A 3O7WA 3PQ2A 1J2JA 3MFYA 2B99A 4GP9A 4FDTA 2REXB 4NR0A 1T2AA 2YN4A 3OFJA 4A1SA 1G8HA 1KFBB 4GIBA 1VKNA 3HB5X 1F4PA 2ZI7A 4DYVA 1GM5A 5AKHA 3KJZA 4I2VA 3E5RA 2G7MC 5LL6P 1QUEA 3HO6A 2X13A 3RSQA 4EF6A 1GA4A 3GLHE 5WRFA 4OM7A 1KJQA 2QLBA 2X7HA 3LKDA 4LRZA 5BSFA 3GVCA 1QR2A 5DP1A 4WBNB 4MR7B 1SCJA 4HOQA 4KMOA 1EZ1A 2ZJFA 4OHBA 4YJDA 1V9SA 3ETCA 3Q5GA 4AJ4A 1KXZA 3AU8A 4K5CA 1VJCA 4ZVKA 1HL3A 3LA6A 2PZLA 1PVDA 3RTBA 2C5GA 3U4QB 2KM1A 1WAMA 2YIJA 4PG7A 4L8GA 4JYZA 4P84A 3MB5A 1USUA 3JWHA 2VPPA 2VCHA 4GD3Q 4Q1AA 3W5VA 3OOWA 3CTPA 2HRBA 2IIVA 2HCBA 5KUTA 2EL7A 1MB3A 3CZ9A 3QSYA 1IQPA 4OKIA 1VPVA 3OLVA 3VKWA 1U9IA 3JD2A 4WZBB 1U8ZA 3PC6A 3DLBA 3T3NA 5K3CA 1G5IA 1X74A 2EW2A 3DAOA 3S7ZA 1IWPB 1Q0RA 1YNOA 3HA3A 4MVJE 5DXJA 1LTKA 4C0HA 2ZUTA 2GO1A 3A6ZA 2XVMA 1Z47A 4IIJA 5EKQD 4M0CA 3TEMA 2EBFX 3ZQUA 3WKBA 5K3BA 3K5IA 4P9NA 1Q7CA 4MAAA 3N70A 2E82A 4GOOD 4WZAE 1YZNA 1QKJA 3TLEA 1RHJA 2NZ2A 1ABBA 3OETA 1VYTA 2F67A 4WWOA 1MFZA 3FY4A 1GN9A 1E94E 5I3CA 2J5BA 1QH8B 4JXZA 1QQAA 4O2BF 4BOYA 1U0RA 1JQ5A 5JXGA 1KJ8A 3DBLB 4MYRA 2X0IA 3A1WA 2WTMA 4DIOA 3GEEA 2NN3C 1VLVA 1HG5A 4PBRA 1Y4UA 1SZJG 1NJ1A 4TV8F 5HKKD 4PINA 1VM6A 4O3MA 5JSQA 3TINA 3GO4A 3W5JA 4MRPA 3WTBA 4V0KA 4CM4B 3UMSA 2JATA 3B5JA 3E48A 4JROA 4UTZA 4N41A 4XVRA 2YXDA 4KAAA 2AG1A 4M36A 1X7ZB 1NU8A 3SQXA 1N6OA 4ZYYA 1PZMA 3PU6A 2YVLA 5ALKA 3CUTA 5CAEA 1I7SB 3L0DA 2AZXA 5KWSA 5HA5A 1QONA 4P0QB 1WXDA 1WUHS 3C97A 4QYMA 1HEUA 3O95A 2FPIB 2X42A 3QC1A 5A9SB 1BDBA 5EXTA 5AJUA 4QBTA 1SVUA 3YASA 3H6GA 1FFSA 4NBKA 4EJFA 5L9AA 4L9AA 3LX4A 5F76A 3UGTA 1N78A 3S55A 2ONKA 4WZAA 1M72A 4LZAA 4CTOA 1DKLA 3ZNNA 1YJQA 4ENPA 1LK7A 4FE7A 3UV3A 4E94A 1PY1A 3TQOA 2JHPA 3ZWXA 5FWXA 2ZB8A 4PPFA 5A3VA 1G4UR 2CE7A 4HVTA 3G68A 5KTSA 2O57A 4NQRA 1KF0A 2B82A 5AOCA 3FTVA 2CFCA 4AP6A 1OREA 3ZKWB 4OQEA 3IUNA 2IODA 4MGZR 1YHYA 3DLPX 3VXKA 4HP8A 5CBOA 1ST3A 5G0WA 4D8TA 3WQQA 1IZZA 4WLNA 3RYFA 3T61A 3CLUC 2ZJ0A 3AHJA 4IFTA 1G7TA 2OD9A 1RS0A 3NTRA 2GN9A 2VJPA 3HKBA 5CB6A 2NVUA 3JWPA 1KE1A 3AJ8A 2CE2X 3KR9A 4FT2A 1FFXB 4Z3KA 1IXKA 1IYZA 1JILA 2AOTA 3AJRA 1DCKA 1T26A 1JSZA 3OX4A 4ICIA 1GADO 2HFJA 1HTBA 4LJRA 1ZU5A 1YRAA 1I36A 5GZ1A 1WHSA 1JCSA 3IHVA 3I23A 3PNVA 3RJVA 3FUFA 1V4BA 2EU8A 5AICA 1SK9A 4JT8A 1BPOA 1VG9B 3F6YA 2HR1A 4EI8A 1I0IA 1SVSA 2B4TO 4ZHSA 1YVPA 1A82A 3ENKA 1DWQA 2IPOA 2G5GX 4MUKA 3VPFA 4R68A 3I5YA 3EWIA 1WDWB 1CEYA 4ISBA 3UVEA 2O0KA 4IO1A 4DCVA 2J9GA 2QVCA 1H2TC 1XHEA 3RK6A 4G0MA 3PQCA 5DX0A 3WG9A 4G1VA 3WL8A 4QXOA 2NZWA 4OM8A 4W9NC 5T8KA 5CCMA 1P7ZA 3SXUA 3H3XA 2FDRA 3DC2A 3L49A 1KZYC 4IRUB 3ABKE 1YA0A 4U95D 4J2TA 4DIKA 2FOLA 3OSUA 3COVA 1FQWA 1X1DA 2HPAA 3SE7A 2IOLA 1FFDA 2XT6A 2C5LA 4FHGA 3BSYA 4PPNA 1FXWF 2YYSA 5L3VA 1VYHA 1CD5A 2PT5A 1AKVA 1D0IA 3G49A 4YY3B 3GPCA 4RE6A 1IULA 2IHUA 4DOMA 4Q3NA 4LXIA 3HVEB 1DXQA 2D8AA 1Y81A 1EXVA 3OKAA 1U3VA 4PSUA 2ZTLA 1P4RA 1OZ0A 2A9OA 1Z6XA 4M76B 3B6IA 4TXRA 1KU0A 3I6ZA 4IF6A 3G0OA 5I4CA 1XOIA 2C94A 4KR0A 2YC4C 1S5PA 3RVQA 2VGYA 3U4GA 3BBLA 4AICA 1V5FA 2F8YA 1HNZB 2C0PA 4FKZA 3LY7A 1GRNA 3A06A 1QYCA 3VUEA 3G5UA 4EA7A 2OEVA 1ISIA 1TQ8A 1VCHA 4TVOA 1MVLA 1U1FA 2WT9A 1UKBA 3E5MA 2QC9A 1P5JA 3O2SB 4BN0A 1ZX1A 4BV9A 1P2GA 4ZYXA 4BPBA 2ZQZA 1T3GA 2QRLA 1E6UA 1FX0A 5FQ7A 3L16A 3WLFA 4KE8A 4MRNA 2HU7A 5CVUA 3KP1A 2UYGA 2HUPA 1O57A 1L7BA 2EZTA 2EW1A 4IEFB 4Z7OB 2B36A 3O0TA 4UNNA 3NB2A 4LNGA 5HCUA 1YBVA 3N8IA 4TV8A 3CWCA 1PI3A 1LV7A 1KL7A 1E5TA 4KYUA 4RLYA 1I7LA 1ADCA 3WLIA 4BC0A 1PYGA 4ER7A 3TW4A 3DFMA 4YWJA 5JRZA 1JAYA 3NXSA 1I1OA 3ANSA 3IL2A 3HZHA 1D0VA 4LGYA 1RZRD 4HLUA 4RLFA 4BL5A 4JHLA 5M29A 2D7CA 4DCOA 4EMSA 2WXRA 1WO8A 4M60A 1E9FA 1IRXA 4RTLA 3IAS1 2R00A 5DX8A 2NYUA 3AEZA 3AP2A 4RNDB 3ZV6A 3EIEA 5CT4A 1YRWA 1PJZA 3ICPA 4I81A 3JYPA 2ZTMA 2I1LA 4K6KA 2QEQA 4HNSA 2FCAA 2E1RA 3IBTA 4JFRA 2V9PA 2IV2X 3Q41A 4BNMA 4L22A 2P7IA 1UMDA 3WMRA 3VR2D 2EJUA 5FQNA 5JCJD 3VSDA 2R6ZA 1GVHA 4QARA 2ZM6B 4MVJG 2ZUVA 4R54A 4WJZA 3B6ZA 2HDWA 2XB6A 2WVHA 3O4VA 3LYUA 4BEPA 1USWA 2Y0PA 4ATZD 3AF1A 3IBFA 1PNQA 2VHYA 3U3OA 2D1FA 2F3UA 2QGZA 3H5NA 4RPJA 2PXAA 1ZUIA 2Z2YA 2UY1B 1AUVA 2QPAA 3WLTA 4NAUA 4J7CA 1XTJA 3O31A 3I0ZA 2PR7A 5IC5A 3GLFE 2A57A 3TG4A 4CLHA 3ER9A 3H1TA 5F5LA 1GSHA 1J8DA 1TK9A 4HQFA 2QYTA 3QH4A 2WB2A 2J0QA 1NQXA 2ENUA 3AQ4A 3ESXA 3EC7A 2ZSFA 5AN8A 1ZJWA 4JN6B 1OC2A 3F5DA 3L40A 4B5LA 1U8CB 4YCLA 3FDZA 1RTKA 5CVVA 5H82A 3RWOA 1JT9A 5BSTA 1KKUA 1TO2E 2EGHA 3RC3A 1MU0A 1VKRA 1KQNA 1GARA 1U28C 1YDGA 1X8LA 5A4IS 4Q7MB 1KP3A 5AENA 3E27A 4M9CA 1UFOA 4F7WA 3D2AA 5E1OA 5LJIA 3Q9LA 4GG1A 3BRSA 4CM6A 2X0DA 1RI5A 4UQYA 4AK9A 3RYTC 2P6RA 1DXHA 3T35A 3BJEA 2B7LA 4QYIA 5K4AA 1BCRA 2HK6A 2GHRA 1X8JA 5GM2A 4QT0A 4C4YA 2Z4SA 3HUTA 4CTMA 4QDZA 4E4RA 4OHWA 4M0FA 5BV0A 3WGJA 4ZAXA 3U1BA 4DBVO 2JLYA 4OMFG 1UFKA 3GN2A 5T4HA 3W6UA 4YC7A 3LCMA 1M8GA 4N8DA 4OFXA 1ESZA 1N5JA 1SY7A 4MINA 4IZ6A 1P33A 4PYLA 2YFKA 3IXQA 3LPAA 1ZW6A 2YMQA 2R8ZA 2ZWMA 2W2NA 4RXUA 1H5UA 4W1PA 4L1KA 1JG1A 3OZUA 5A1JA 2J49A 1DI0A 2O8CA 3I6BA 4MUXA 2DPXA 1E8XA 1EFPA 1JPLA 4NH4A 2I91A 3EXHA 4PC7A 2WUGA 2FN8A 4QO7A 2VZ0A 5E3IA 4EG5A 3OJLA 2L2QA 3ANLA 4N5MA 2VJMA 2OV3A 1Y8AA 2JJMA 3ZU2A 5DM2A 5AW9A 2OORC 4KLCA 3QBJA 4FMDB 2VXOA 3VO8A 4BRZA 4TRJA 2D1TA 1VECA 4LUNU 4HXFB 2J45A 1U2QA 2BSQA 4FEGA 4EDFA 1QRSA 4UD6A 3RROA 5C2JB 4OMDA 3QNMA 2MHCA 4UHCA 3JD1A 4RKWA 3GDHA 4DA9A 3AOGA 3JR7A 5H9VA 3W1VA 3T4XA 4WK0B 3TTUA 1PJCA 1UMKA 1WABA 3OZDA 5BRAA 1C3OB 1X80B 3KPJA 3KSUA 1VCNA 4ZYZA 2E37A 1MYOA 8OHMA 3V55A 2JBAA 3AC0A 1RSZA 1IJKA 1YFZA 1WM1A 2PT6A 4WNEA 2D2VA 1KETA 4RUKA 1W4LA 1DAEA 5D86A 5JBNA 1OFVA 4AFNA 4OGGA 3I61A 3WIOA 2F3SA 4WBNF 3W7BA 2C61A 5DN6D 3SFXA 3OQNA 3N8HA 1QE3A 5I5GA 4F38A 2GCNA 4N0QA 3W34A 3ZJ4A 1EVKA 4AZ0B 1UKAA 2G4VA 3N0TA 4XCXA 1GTSA 5FLXA 2H1HA 4J94A 4E1AA 2IPNA 1ULSA 5IWAB 4FZ3A 3ECSA 3V4ZA 4CT4A 5EQJB 2ZRQA 1Y8QA 3U17A 2NYJA 1CQJA 4IGEA 3QX3A 1LW7A 1S3SA 1Z0ZA 4PC2A 1C9NA 1NN1A 2G63A 3E37A 2PWZA 3A9WA 2IDMA 4LF5B 3HR7A 4DX6D 2BIFA 3EF1A 3QUTA 2SKCA 1T5IA 4EPXA 5FV4A 2CMGA 2GBLC 2JH9A 3VNVA 3OE7D 3PA6A 4LFBB 4Y1FA 1XVUA 4I7EA 3RRNA 4HYTA 3JQCA 4NJOA 3QEMB 3DDHA 2LCIA 3W2TA 4D8XA 1Z63A 4HGPA 3ES9A 3D5EA 1N2XA 3W3AA 1KORA 1PQUA 4IV0A 1G21E 3RVDA 2R03A 1MQ8B 4O02B 5AUQA 3QTLA 2IY0C 2HJVA 4V3CA 3ADKA 5F5NA 2OG2A 4AF6A 1L4FA 2JIZD 1P9LA 2OBMA 1Y4ZA 4DYHA 2GGFA 5LJLA 4ABYA 3G79A 1I5OA 2ORED 2VTKA 4IG9A 2MHKA 1WNFA 4URYR 2UZ4A 1YBMA 4QULA 3OT5A 4F4FA 1N2CA 5IULC 2YZMA 2JFPA 1CDDA 4DA0A 3TMAA 1MZCA 2W70A 2Z30A 5HK9A 4MR8A 4FPXA 3L1HA 2XE6A 2P5TB 5A62A 1EE9A 4UZEA 1JBKA 5KX5A 3WGUA 4Y6QA 1HZ4A 2R6JA 3HJRA 5IEBA 3Q8XB 1FQJA 1EG2A 1DFGA 3IQZA 3LDFA 4BLRA 2B5VA 3ADDA 2ZYVX 3SYMA 3L8ZA 3VR4A 2I2BA 3HKDB 5IH7A 4UNQA 1MIOB 2A94A 4C3ZA 4QNMA 4O6VA 2FUEA 3LHDA 3RFXA 1F9AA 3JPWA 1VIDA 1TYQG 3LLSA 3SS7X 1TM2A 1XJ5A 1OXUA 3U39A 3K6SA 3NIBA 4LVUA 1T4GA 4EJMA 3A6JA 3BTUA 3WKAA 2QTGA 2XDAA 3HYTA 2HC9A 2YWJA 3CHSA 3B3FA 2JGAA 1ELOA 1F1BA 1TO1E 5JQWA 4LOJA 4PS3A 2WT4A 1R3DA 5DNUA 4O1IA 2BAGA 2Y6VA 1Z4QA 4IMRA 3OJWA 2VNHA 4X7PA 3ISVA 1J24A 4GVXA 2L0XA 3DUFB 2Q29A 3TXMA 1A4XA 2G09A 2HBYA 1R15A 1XQVA 1QZZA 2PXXA 2GBIA 1SCBA 3IESA 5K51A 4OLFA 2W2TA 2H59A 3T8KA 4H1TA 2RGYA 4HR7A 4HOSA 2HN9A 3JASA 3G88A 5JU6A 1HDZA 4O1HA 2YV2A 2VF5X 3FLBA 2VYVD 4TMKA 2ZUBA 3ZWNA 5CIQA 4KOAA 3L8HA 2H1FA 1JAZA 1MO2A 4NF2A 3OFSA 4B31A 1Y37A 2J0UB 4P4TA 4XEIG 3C72A 4ZU1X 5LQUA 3Q79A 1EMDA 1REQA 3AUKA 5JJTA 3CW8X 4GLBA 3Q7QA 4GP6A 5IX8A 3VR5A 3E7FA 2PUWA 3NZSA 3ENZA 2ZYWX 1T9DA 4XSHA 1PBTA 3GP5A 1B74A 4AUKA 3RS9A 3PQ7A 3HI6A 3QY9A 1V3UA 5CX1B 1XA3A 2BF4A 1RZ4A 4OAQA 2X6JA 1XCMA 1O95A 4QOHA 5JI3E 3I9JA 3EWAA 2GESA 3ONDA 4OX9Y 5HQ3A 3I32A 1SJ9A 4J1TC 5DSXA 3K1AB 5BW4A 1H4SA 3E61A 3P32A 4GGPA 3SC2A 1WWKA 1M6HA 2V0NA 3ELWA 4OXXA 4KPGA 2A1UA 3L4SO 4G8JA 2F8TA 1DARA 3I2GA 4EKEA 2QRHA 2XCUA 4TMYA 3OPXA 3M5PA 2CFRA 1KGSA 2RGWA 4K6CA 2V4MA 1KQOA 1ZXBA 4R9UC 2O20A 3BQMB 3HFSA 3KE8A 3JQ1A 4AX4A 2NSJA 5IM5A 1U94A 3CTMA 2VSNA 2WF9A 3RAJA 3L41A 2B37A 2H5EA 1QOZA 3ICEA 2E89A 2IUTA 5FF9A 1OTXA 1FU4A 4G5HA 2B8TA 4RKFA 2X3UA 1VL6A 4G8LA 4MHOA 3NGLA 4JOQA 2G9NA 2EZUA 5JFOA 1WP4A 2OMEA 4WBNA 3C5HA 2R9VA 3MKRA 4GMKA 4P08A 3D0RA 5ESRA 3NDJA 2VH5R 5FYDA 4M3OA 3RKSA 5AVQA 5HS4A 3QZUA 3L7OA 2QOEA 3AG5A 1AUQA 4K5QA 2DZNA 4EF4A 2H9YA 4W7HA 3HCAA 1VZ3A 1HDCA 2ZBPA 2BR3A 3IKLA 2WKSA 3TEFA 4I2WA 4YV2A 1PLLA 3WB2A 2NPOA 4HQ6A 1SU4A 2P30A 1M0WA 3FGZA 3G6WA 2ZQ5A 5ER6A 4I3FA 2H4XA 1ETHA 4TQ9A 4TQUS 4DCPA 1GKIA 4J8SA 4QPZA 3D7RA 1KHHA 1PEDA 4ZVQA 5BOVA 1H0HA 4DJEC 1WJGA 2Q7OE 3QV2A 3VH2A 4ZCPA 3RDPA 1E63A 4U00A 1AGNA 4IYRA 4RG9A 3T3EA 1FY2A 1AKYA 4I4IA 3E4CA 1SO8A 5KMGA 1NPYA 2VXBA 3M81A 3G8BA 3DE0X 2IUYA 5A7HA 3KUDA 4CU2A 4DA4A 1W2GA 1JDBC 4D4IA 1SCUB 3DFFA 1LFDB 4A8TA 1F3LA 4EG7A 1DVPA 1OOEA 1QH8A 3NBUA 4MW5A 4YNBA 3CISA 5AKYA 3DBLA 1L4NA 2ETBA 2XEHA 4DQ0A 3SQDA 1Y5NA 2GNPA 2OCLA 3ID6C 2ST1A 1O89A 2D3WA 5EZ5A 3ESLA 3CLTC 1CX9B 2VH1A 4DE5A 5H0IA 4P3XA 1KEPA 3KQMA 3MNFA 5IRCD 3S7BA 3RYCB 1YZQA 5JMWA 1L8XA 6REQA 1KI7A 1MABB 3KWMA 2OZLA 4QUKA 1LSUA 1TJYA 3F5MA 4YUZA 2JNWA 3WXBA 2I2AA 4BATA 1E3SA 1W4AA 4M4SA 1A5AB 3G0DA 4RW0A 3ENEA 2BTEA 1NVBA 3SQMA 4NU0A 3TQTA 5H7XA 3LUHA 3T7JA 2WKQA 2XNJA 3WAGA 3DEAA 4BNGA 3DE4X 4ZCTA 1W29A 4WA7A 4P53A 1GUDA 3PNBA 4KQ6A 4BMSA 1BW9B 4JYCA 5A9SA 3SJ7A 4Y6GB 3BH7A 3LQQA 4YT4A 3PEVB 4HQOA 3TLBA 1C14A 2R8BA 1RJFA 2H17A 1SXGA 2H1IA 1JAXA 5IXSA 3QW2A 1ISFA 3AEQB 1VPLA 3SC6A 3KS9A 4EO7A 2QLMA 4R69A 5J9FA 4MYUA 4AL4A 1VI2A 2AXUA 2OD2A 3WLHA 4Y2RA 5LP1A 3RF6A 1ZC3A 4OYHA 3E2IA 2XH8A 4GECA 4U1RA 3QYJA 1QPBA 4ZVLA 5KHOC 2RAFA 1LUAA 4UVHA 4DSTA 3FD8A 4TS3A 4P98A 3C3BA 1QYVA 1OXVA 4MUFA 1C7JA 2FSFA 3ROPA 4ZEMA 1IWOA 1QF7A 5LQCA 4JCOA 3L8CA 5AVVA 3IMFA 4X6LA 2J1LA 1VQ1A 1LS1A 2O3TA 3TI9A 7ADHA 3FOEC 4XVCA 3DOFA 2NAPA 5L7YA 2AFIB 4P4GA 2V1XA 3P9XA 4HRXA 3WSWA 2CB9A 2XQJA 3V6MA 3A2LA 1RC1A 3JYQA 5HZMA 4FHKA 3OX2A 1VSUA 1PZNA 3HO1A 2BSXA 2V7BA 4D82A 5JNSA 4J75A 2DJ5A 1FDWA 2EINE 4FR0A 1IN7A 5TEVA 1ZUD1 4L7QA 4L51A 2HJGA 1ZHHA 2OV4A 2B2CA 2ZJ3A 2P9GA 1Q12A 1Q84A 3BK2A 1NA5A 2HBRA 3CLRD 2XSZD 3EXIB 5FWYB 2G1JA 3TSWA 1H0KA 4D4HA 2FSHA 4M1KA 1E1YA 3L8YA 3GYZA 1I3CA 2WHPB 3Q0TA 2KXPC 2A59A 4TTAA 3V33A 4HSEA 4FYWA 3B1JA 1G8PA 5FA5A 2J7KA 4F85A 1VXRA 2A9KA 3ZYCA 3JZDA 4CBVA 4Q93A 2H07A 3T7CA 1NXWA 1TCUA 1PG0A 2XY4A 4X60A 2P6UA 3EZ2A 5DYTA 4WCFC 2EFJA 1JVSA 5ALYA 4F3KA 4NQ0A 4KXWA 3I30X 3FPAA 1V5EA 2VSFA 4OXQA 2M6SA 1JFRA 4HEA1 4JA7A 4EUFA 3M5DA 4LC0A 2OXFA 2WP0A 1CTQA 1B26A 2FE4A 4XFDA 4QXPA 4PS1A 4D6YA 3E18A 4OSEA 1SQMA 1KVTA 1O6BA 2PMDA 2QE6A 1X8KA 4ZZ0A 4YTEA 4QELA 2WMNA 5BNIA 2DX7A 4TWAA 4R9RA 4UBKA 3B3GA 3LQRA 1KAEA 3QWBA 2XQFA 2QN2A 2P3SA 3F6EX 5H3HA 4EYOA 2E6UX 1QGAA 5JWOA 3RSEG 2VAMA 2ZT8A 4FMDF 1W85B 5L3SB 4JEMA 3F5FA 1QIKA 4QODA 2VNJA 3WLOA 2UDPA 2O2SA 3HO8A 2B34A 3K0HA 4NBUA 3P1UA 3MTDA 5F23A 3I1JA 1FNSA 3MQ4A 2X0NA 2AX4A 1VJTA 5B1EA 4HKTA 2PNFA 4PX5A 2P90A 1QK5A 1QJ4A 1T2FA 3AKZA 2WF6A 3X1JA 2AOUA 1P3JA 2NO4A 1GNRA 4WESB 5D01A 3WLQA 1M5TA 5DFAA 1PGPA 2NVOA 3P4YA 3O93A 1JCRA 2OXEA 1W88A 3DHVA 1CQPA 1UFVA 1HQDA 4K0RA 4K6MA 4Y30A 4OGFA 1E4YA 3T9KA 3LCJA 4F56A 5EIAA 2O2CA 5KYTA 1ACMA 2VPTA 3UG7A 2BELA 3DV2A 2WQHA 2HQRA 3EOZA 4MI1A 5F1YA 1JUDA 1EJ0A 3HK2A 3VYUB 3C8UA 4GX2A 5E4TA 2EEZA 2PZKA 2C9BA 3DTTA 2FKNA 2EATA 2P3QA 4KLZA 5J40A 3H5AA 4HPXB 2RHCA 1EZ4A 1BYUA 4L5BA 5E7JA 2PYIA 2FSSA 3EIQC 3EIXA 1OCZE 1TJ3A 2A7XA 2DFPA 2FAXA 5EYPA 2IHNA 3DXMG 2GEKA 2NACA 3I9MA 4X91A 1AK9A 2IXGA 4OJTA 1NIJA 5BSRA 4V1CB 1F1JA 3VMMA 3HYNA 4RYDA 4CF4A 3LFTA 3NDIA 5DCWA 3DNFA 1JMVA 5ADVA 4QWWA 3IOEA 3NRBA 4AZ3A 1N2ZA 3QVXA 1E1RA 2GEUA 3ISMC 1QP8A 5EPEA 2IH4A 4TKLA 3QE0A 1NYRA 1Z13A 2CFOA 3M5WA 3RLFA 1QBQA 1MQSA 2WF5A 4FDVA 4FJ0A 2NGRA 4HDRB 1TU4A 1AZLA 4XKCA 1UPBA 1Y4AE 2ODBA 3SF8B 2O0MA 2CXPA 1HFJA 4NZ9A 4JLVA 4UD2A 1FQKA 1MB2A 5EESA 4UPVA 2DETA 4UAJA 2GUWA 4OI0A 4Q82A 3R5SA 2WG2A 4EF5A 3AVVA 3EIOA 2N47A 3ITEA 5FB3A 3V1MA 3TO5A 3D3MA 3OJCA 1ZBDA 1O96A 4HADA 3WV4A 5DBGA 3IT0A 3O4GA 4PEVA 3K72B 1JWGA 4YRNA 2GW1A 3IAUA 4N48A 3TNFA 3TVTA 5JMTA 1EEHA 2DBZA 1DPGA 2B1IA 821PA 2NYRA 1PR3A 1YRQA 4H6XA 4N54A 3F6SA 2HMWA 1QQ7A 3A1DA 2X19A 3GJ4A 4E14A 1DUSA 1Z18A 3DVSX 3OLXA 2Q0XA 2H54A 1CJUC 3QJYA 3QFRA 4JJFA 3QKYA 4M1YA 3VDXA 4PGMA 1FB5A 2D1RA 2JGJA 3KB1A 3PWKA 4NOJA 3BXXA 5AVSA 3LCRA 1BVHA 1HOXA 3OQIB 2Q5HA 1U81A 3BXEA 2MYNA 3RAUA 4Q3EA 2Y1CA 1H65A 4RIIA 1CT9A 2ZI9A 2WIFA 3DDSA 3W2FA 4D1YA 4CYMA 3THYA 2XXJA 1G63A 3IUMA 4C01A 4GTQA 3E1KA 4V1CI 1QO9A 1YMPA 1ZONA 5L4SA 4I3GA 1GG5A 4L08A 4E5KA 1HO8A 1MC5A 1G2IA 4QIHA 4J3FA 4EKNB 3TR0A 1BMTA 1V7ZA 3K8QA 3AUFA 5K8UA 4YRTA 3WA7A 3WGTA 3Q0EA 4GWGA 1M76A 4JKIA 4XXHA 4I1VA 4E5NA 1PNRA 4I8IA 2V59A 1ZHFA 3ROZA 3IUSA 5JSZA 3EZXA 3BERA 1C30A 2XS1A 3OU7A 3MMNA 3IHYA 5HVNA 1C7IA 1ARZA 3M4NA 3D6MA 1FNCA 1WV0A 2DBRA 5IT0A 3ZJUA 3SK0A 3AR4A 4B09A 2DU8A 4F5WA 2Z8ZA 4URXR 1B43A 3ZUGA 1S63A 1L5HB 1BFUA 2JFVA 1Z4IA 2Q3FA 4P0PB 5FNVB 2V3VA 3ACCA 3CIFA 3D6JA 2OFOA 4EFNA 1D2AA 1RYFA 4QHYA 4NPHA 1M7GA 3BCSA 3DXZA 3U1VA 1LF8A 5FOQA 4C9BA 1B0ZA 1XRPA 1FVHA 1AM4D 2X0RA 3UJDA 2GEFA 2DJIA 2WA2A 2EC5A 4ILGA 1GGFA 2QTTA 2ZRBA 3JQ6A 4ZC8A 2DVMA 1NV9A 2J6CA 3QELB 1TJNA 4GZ6A 1G5PA 4ZXPA 2JAQA 4I5FA 1IM5A 4GSYA 3H0KA 3JPYA 3LCVB 4PO3X 3H5TA 3P0RA 3U3KA 2NUAA 1BMFA 1JALA 4HOUA 4B82A 4Q66C 3KCNA 1XZFA 2BRUA 1XAJA 1O4WA 3H8VA 1LI4A 3U7HB 4Y2TA 1Y98A 5D2CA 3F3KA 1NMSA 3TJPA 3HCPA 3B36A 2QM0A 2ZWOA 1E0DA 2W90A 1BQ4A 4OXIA 3PC7A 1FCJA 1DCQA 1NPTO 3DBRB 2XRYA 4PZ9A 5JS8A 5AQEA 1UDXA 3RSCA 1MJGM 5IG2A 3EFHA 3C3DA 3A1TA 1X80A 2GAAA 3TLZA 1F5NA 5AHRA 2B4QA 3HB7A 5HWSA 3ZU4A 1FFCA 1KWGA 1F9EA 3LWNA 1NXOA 1YYHA 4J49A 1S7GA 3OUUA 2XS8A 1UXJA 1XF9A 2IEZA 2X4LA 4RD6A 4GEKA 4GLJA 3KSZO 3WP1B 2QD3A 2LE0A 2YHSA 3MELA 1HRKA 1Z2DA 5FZRA 5FJIA 1K8RA 1VL2A 1BNCA 1R0WA 2O48X 4RYLA 2JA1A 1KH1A 2Y0BA 1NF8A 4PICA 3VO2A 2BTQA 4KUHA 4NP6A 3RT7A 2VIIA 4WY2A 1YBAA 3L5KA 3DGFC 1KYZA 2O7NA 3TSYA 3AR9A 4KXNA 2HLDA 2VRCD 1BVUA 3NIDB 3UJPA 1JWBB 4LK2A 3KZMA 5EVJA 4EFMA 1H4VB 1USKA 3MV2B 4RPHA 5HP4A 2W6JD 2CLLB 1YQTA 5EHQA 2Y05A 1MNQA 3ZYZA 4N5CA 1ZN8A 2H4WA 4UWLA 2A3RA 1LNSA 3S2YA 4ALJA 2LNIA 2HWKA 1RRFA 2VUHB 3FUHA 3KAJA 3LM8A 4G5SA 4KFTA 3ZHTA 2QT0A 5HKAA 4J4HA 4Q0MA 3ZEAA 4MW2A 4DCSA 2FP4B 4IKEA 5BY2A 3H97A 3ZCUA 3I76A 2FZGA 3VJRA 4AO6A 1ULZA 1UMBB 1JHYA 3GD5A 1Z88A 4JGGA 3LH5A 4MO9A 4CHGA 2BLNA 2P2ZA 4IXTA 5G04C 4E2FA 3L7JA 5LR6A 4MCIA 3OJXA 2V6IA 3Q2OA 4QEKA 1FUYB 1VGRA 1H9AA 4CF7A 5DPMA 3V2GA 3V3KA 2IEIA 1OVGA 4JB2A 3C74A 4FNGA 4M9XA 3STYA 4I46A 2RSLA 1P0FA 2GTIA 5TQ2B 1XZMA 4AS1A 4D9FA 1FYFA 2YUIA 1UT5A 3DZ8A 1EX1A 4PXSA 3RHTA 5IYZB 2GZ3A 1UEJA 2V45A 4K7JA 4J03A 3QIVA 4UOZA 3E23A 4UM8B 1U3DA 5H4GA 3R23A 2BEDA 5FAKA 4Z9YA 1N25A 4ESEA 5IHPA 3O4FA 3K70C 2W2OA 3G8CA 2IU6A 3FNRA 3BIWA 5LCXA 4JWKA 4L5AA 5ENTD 2RG8A 2C4UA 4TL9A 2DE0X 2SHKA 4BNZA 5AUNB 5IUKC 5LZ5A 4EAAA 1XQXA 4WNAB 4IQ8A 4HQNA 4D56A 1KI8A 3E0XA 1DEOA 1S2MA 3V2XA 4L4UA 1BH2A 1JA0A 4KTVE 5A0FA 5CFMA 1A96A 5NLLA 2KWIA 4ACKA 5ARCA 4DR5B 1CLEA 1HY3A 1X8XA 4JSRA 3O48A 3ASDA 5C18A 3W4JA 1JNYA 5LZ8A 2O54A 5B53A 3W05A 2NUPB 3A9RA 3ORRA 4UHHA 3NVAA 2OA0A 1P5HA 1W36B 4UXIA 3FZGA 5EIBC 3MJRA 2OQRA 4IAOA 2W48A 2JKZA 4UQXA 1M5RA 1BDMA 2OYSA 5DNWA 3GWGA 4AEZC 1YS6A 3QM1A 1S4MA 5TR9A 4MQLA 3N2LA 3CA8A 2XCOA 5AJTA 1NVUQ 5EMNA 3CR3A 1NJ2A 1BDHA 3NANA 1LTXA 5HGXA 1TA0A 5JXWA 2QVZX 1I3KA 5GONA 3VR3D 1KK2A 2NVWA 4WK6A 3R0VA 3WADA 3ICCA 2C59A 1W3BA 1O0SA 1B8NA 1F60A 5CNIA 4UEWA 3FVVA 2ZSHA 1RWVA 3PPIA 2O06A 5FTPA 3MCUA 3P2KA 2VAWA 5K3FA 4NV0A 4MHSA 4ZDKA 3SMVA 3ABME 4B4WA 1E8ZA 1W75A 4O5AA 1A8SA 1SPXA 4QC2A 5CX1A 3TE7A 3RE1A 3O9MA 3E9CA 1EINA 3BWXA 5FWDA 3PGLA 1T0PA 3DA8A 4GLFA 2P40A 1XWWA 1CZHA 4BO2A 1J1IA 5BPPA 1OV6A 3C6ZA 4RTPA 1P29A 3QLEA 3JQ9A 3FDIA 4YQYA 5AOVA 3K1AA 3BFPA 2HLHA 3B95A 3Q7TA 2C2BA 1YHNA 3BE8A 4HBZA 4G25A 1XD2B 1P1HA 3ITDA 1IJEA 1S2LA 4X1IB 2Y2VA 3LC2O 2F7SA 4NV1A 4V0NA 1HTTA 4G0XA 2P9BA 5ELLA 3OQJA 3RTDA 4EQ6A 5BQ5A 5I7WA 4YP7A 4XTRA 4C2UA 5G4KB 4MGHA 3CLSC 3FETA 2V97A 4Y6LA 1TRHA 1E6EA 4ND1A 4DM7A 4QYSA 4GB9A 4MKGA 1BX0A 5EJ7A 3LUBA 3VNQA 3C3MA 4Q1CA 3R7QA 3USCS 4TMXA 4US2R 2ZTSA 3AWIA 2A0YA 4LAFA 3RVJA 3P19A 2C7QA 4XUEA 1MEJA 2H6IA 5JC8A 4OOFA 1ZAKA 3ESDA 4XFJA 1YNSA 4FC7A 4P32A 4DDMA 2W2KA 2DHRA 2RGUA 4LWQA 1ZMOA 5C8XA 4AS2A 5HOQA 2WYWA 4B35A 5MFZA 1QTQA 4I66A 1ZD4A 4C7JA 2P0AA 4DQDA 4KPEC 4QOGA 1L5JA 1BOOA 3S7FA 1ONPA 4Q3BA 2ODAA 4OXKA 1YR2A 2V8OA 3T15A 4BWRA 2BBWA 2WY2D 1ONSA 4Q9LA 3SR3A 5BOSA 5DX1A 4B3MB 3EC2A 1DAPA 1I4DD 4GM0A 4MUNA 4I1MA 3FH8A 1NLMA 1E5VA 4DBZA 4P4SA 1PUIA 3H2SA 2WVGA 2CLOB 3PDUA 2X41A 1F06A 4ENUA 4EEXA 1VMAA 3R4CA 3NIGB 4DMGA 2HCFA 2QRZA 1YE5A 4FLHA 2QYOA 2QL7A 2BEWA 4IOKA 1SA0B 1M1ZA 4XCVA 3WI7A 3R2JA 2OZPA 1ONBA 1OFIA 5K05A 3WLLA 2QTVB 3AP3A 1PS0A 1SCUA 5CFRA 1Z2CA 3I0NA 1Z6TA 5FA6A 2Z8YA 3ANTA 1N2BA 1VE1A 4O2BA 2BFEA 1ZM3A 3TZHA 3DT9A 3IEGA 3UJ6A 3MHTA 5JNUA 3B38A 4J0KA 5JD6A 3KSRA 3V8MA 2IUUA 3CS3A 1Y6GA 1X14A 2YNQA 3PZ2A 4P34A 1NBME 2KW5A 4OMUA 1FK8A 1K1BA 1Q22A 1YR8A 2OGTA 3WGKA 1N5OX 3INYA 1M6VA 3AL0C 3RFFA 2FR0A 1IEQA 1KDRA 3CGGA 2VPIA 3LKVA 2BP7B 1Q7RA 1E2IA 2R1UA 3IBYA 3PS9A 1MABA 1V0JA 1F2UB 3MILA 1ACLA 4BMPB 4BXOB 1QWSA 5K4GA 1A4UA 1PYDA 2WWTA 5EA2A 2HHLA 1Q6ZA 4ZAWA 1GQFA 4IFEA 2D5BA 4ABTA 2DR0A 1NX6A 2O7RA 5TB5A 3UUFA 4FSDA 1L5NA 3CRW1 1U7HA 5IPFA 2LBPA 1DC5A 3IQXA 2DFNA 3RAGA 1JEYB 4V0OA 3SBDA 4DNPA 5TS2A 2QUBA 1QO0A 3QHAA 1OWMA 3O73A 4G63A 3VVMA 2QMEA 4GZLA 2NWQA 5DGHA 2YR0A 3PEVA 4DQVA 4EGAA 3BOSA 3LU1A 3RFCA 2ZULA 1DZ3A 4FFWA 3AEQA 4ZPXA 4D8YA 3UATA 4CCSA 5AUOB 5U1PA 2ECPA 4TMTA 1X7WB 2OMKA 3C39A 4Y7CA 4YRBA 2BOVA 1GSAA 4DT1B 4Q15A 5TS3A 4M0LA 3CSDA 4AIIA 3OZFA 5ERXA 1CUCA 3FFTA 3DDUA 1QIHA 1MAVA 1GPNA 1EFKA 5EN5D 3RB8A 3FDHA 1Z5SC 2COUA 1NBMA 4CGYA 4X3OA 1ZR2A 1C7FA 3VZCA 3QF4A 3W8EA 3H0EA 4BGDA 4KMRA 4UBOA 3AF6A 1KFKB 4KAFA 3X0DA 4F4JA 1RYYA 5F2KA 4AN0A 2JIDA 3MWLA 4URZR 4AUEA 4M7CA 4MJXA 2FPSA 2DKOA 5HKKA 4AKSA 2R79A 3W8DA 4BWFB 4AMUA 3ZGXA 3V48A 5AJDA 4TTPA 3A6DA 4A8JC 1ZHOA 2GNAA 4DIEA 2GR9A 2WTAA 2RGAA 3PCTA 2CVPA 1XAHA 4M1TA 3TW8B 3DP9A 1WMFA 1RWXA 2ISSD 4Q00A 1RD4A 3NWJA 1GPBA 3MRXA 1UJ5A 3U9WA 3W06A 1E1LA 5FWYA 4R2WA 4CM3A 5CBKA 3DEZA 4LTDA 2J3QA 4Z0TA 3FTPA 1GU7A 4MGKR 1K6IA 4AS3A 4BAZA 2C42A 4XGRA 2R96A 1Q83A 4WXYB 3NRJA 2NOAA 3RC9A 4ARBA 4V3IA 2V55B 1IXZA 4KV7A 8AT1A 3AR2A 4GZ5A 3LT5A 1EX7A 4TMFA 1GU0A 3PC3A 3QMPA 4JBGA 4RA6A 3A1SA 4DR6B 5FNVF 1JQLB 2YVQA 3LY9A 2AK3A 4RFLA 2AD5A 4C0WA 1NJ6A 1ZLXA 4CDMA 1I8TA 5A5GA 3B9PA 4HLNA 3B13B 2FRDA 4OQPA 5EX0A 4LKOA 3HSSA 1QVAA 4R3WA 1KFJB 4NVRA 2Q50A 2H3EA 4KI0A 2PGOA 1ATZA 3G2OA 3GLTA 4JP1A 1VPTA 5LZ7A 1EK5A 4HAYA 1TAHA 4UHKA 2ATEA 4QTUB 2E55A 5J90A 3A1EA 4BDSA 1MXFA 1EQUA 3CF4A 5JSHA 5JH7B 1K1EA 3ZV3A 2W8BB 1N4SA 4BLSA 1YB2A 1FXWA 3R6TA 4KX5A 3LHSA 5KYUB 4OEHA 2BCGY 3K0AA 4QUDA 1H8EA 4D79A 4F2HA 2JJYA 1VB5A 3VHXB 4LXXA 2O8EA 2XDQB 4LJ5A 1X7GA 1NXQA 5ICMA 3E1SA 3R7FA 5E6UB 3NNNA 4J29A 4GRIA 1HLFA 1T8WA 2CY0A 1HO3A 1K0FA 1N5KA 2YY7A 4AG6A 5C32A 4N3CA 1A8IA 1ABFA 4UKDA 1VE5A 2SKDA 3R20A 2F64A 4F1JA 2OILA 3G7SA 2J7PD 1L7EA 3MMPA 3PB3A 5IWCA 3UOGA 3SEAA 2O7VA 3ACBA 1B0AA 2I62A 1EYZA 3DOEA 4S1TA 3GVPA 4NYIR 5E2IA 5TMEA 1ORIA 2UUBB 4B47A 2MSDB 2HB6A 1GTRA 4MYCA 4B3RB 2IA5A 4IP0A 2ZJAA 4D9MA 2QTBA 1C4XA 2IHYA 1N2CE 2CJYA 3CRZA 3GZ2A 2P9QA 621PA 2I29A 3T54A 3QVTA 5HRUA 3KYCA 4ENQA 1KSHA 4UMVA 1KQ3A 4C0KA 3ZHZA 3DEOA 4W5NA 4N6NA 1R16A 2XWSA 1HT2E 4EA6A 5AI5A 4MMYB 2FHSA 4ISCA 4YUYA 3K92A 1NF9A 3WVNA 4EITA 2EKZA 3JTMA 1V1RB 4B8WA 1JYSA 3GLRA 2OO3A 1Q3TA 2CNWD 2XYQA 4Q7JB 4V1CA 3MX3A 2C8KA 1UJMA 4BX9A 2BEVA 3K4PA 2IY9A 2H2IA 3X1DA 4DMRA 1T5TA 4OKNA 2EP8A 4GFDA 1RHUA 1GZSA 3SKYA 5ALIA 2WE7A 3WGGA 2Z2KA 3M83A 1JIVA 1QH1A 3I9OA 3QYFA 4XVUA 2SECE 4AJ1A 5EMMA 1FSSA 1Z2EA 2W2MA 5H59A 1M9NA 3FUXA 1ATIA 4ENVA 3OF3A 4DN6A 1GZVA 1N4DA 1RZUA 3E9NA 4DWJA 4QXQA 1T2NA 1YB1A 1W36D 5E3HA 4UVEA 1D04A 4FQ7A 2OL4A 3O1JC 3QLUA 5DLYA 3OJOA 2P9YA 3I2KA 3IVCA 5FPSA 4RMHA 2HJSA 2E49A 2VK4A 3UMVA 3IVRA 3GUHA 3R40A 4YJGB 4DLBA 1IOZA 4AJIA 5C81A 2VUUA 4XYLA 5IP5A 1ESEA 3CO0S 3UK7A 4QSHA 2CXHA 3K9BA 3LVFO 3UF0A 2ZU6B 4D10C 4MUEA 2ZJ7A 1P4JA 2A1TR 1LI5A 5IYZF 1T1SA 1OT5A 2I2XB 4Q94A 3SO8A 3BDAA 1R0LA 2VHWA 2YIMA 2XITA 1E96B 2Z98A 2WHXA 3VYWA 2Q5CA 5HRAA 4OJQA 2O8FA 1ZK4A 2RG1A 5LMNB 3DFIA 3JUEA 3TDKA 5CFLA 1A76A 4OYRA 4DYDA 1SWWA 4ME6A 1AS0A 3KLMX 4FOLA 3A9VA 4WKPA 4TLLB 5CK4A 2OESA 1TAQA 2QJRA 1HZJA 1BS1A 2HT6A 1P9WA 1MDFA 2JD0A 1FU7A 4Y1GA 1B7GO 1R12A 2AN9A 3KJNA 2J9YB 1WETA 1FUUA 2XTJA 2EOAA 3TCXB 3EY4A 4IH1A 4B8CB 3BULA 2YV3A 4XUDA 3ZLTA 4JR2A 1AKUA 1BD8A 5M7EA 1UR5A 4JT4A 1Z4OA 2Y1LE 1PC2A 1DBQA 3DM9B 3PLRA 1H9CA 4KXUA 5TMDA 1RZRA 5KJ6A 5F73A 2X9NA 3BFKA 3ZYLA 2F43B 4BB0A 5CU7A 1BX1A 1PF7E 4Q3OA 4JCCA 4BC1A 3PX7A 1RVV1 3R74A 1XZCA 4AJPA 3DV0A 3FCSB 3B82A 2VUIB 1Z15A 3EXFB 3NP9A 1KK3A 1CUJA 2FEPA 4JEIA 2CV0A 2C5FA 2LKDA 5LPNA 4UFOA 3ST7A 2REQB 5EE3A 4IDNA 4TZKA 4MS3A 4KOEC 4M0EA 3KZKA 4JH0A 2OHVA 4MRVA 3PRJA 1YS1X 3ABRB 3E7DA 4UNSA 2I1KA 3LY8A 4KDRA 3B78A 5FJYA 5BR4A 4DF3A 1M2WA 3C5EA 3VR2A 3NBXX 5JCJA 3F8SA 1BE1A 5FNVA 2FPPB 1HMPA 3HJTA 4C4OA 1UIMA 2X1HA 4WY8A 3DSUA 2QDXA 3JQPA 5A3RA 4OXYA 2R5WA 3OEYA 1CJKC 1QFXA 3Q75A 4A0HA 1NLZA 1V8BA 3U6KA 1C3LA 3PNOA 5A2GA 2FR8C 1MX2A 2OCCE 4NZOA 4I9UA 1V3TA 2P9NG 2FDXA 2JZNA 4J07A 1ZN7A 1U90A 1IY9A 2XMQA 3LLVA 4UEJA 4WSOA 4WX2B 3K0BA 1C3EA 4OY3A 4XAQA 3ASHA 2NT3A 1JSLA 2G3YA 4WZBE 5SICE 2XXAA 1RPZA 3S2UA 4MCHA 4NU5A 1N0QA 4BFSA 4JOCA 4E31A 4YV7A 1RYHA 3EJWA 4TRMA 4D26A 3IR6A 2DY0A 1RXWA 1TEXA 3HBNA 3MOGA 4PYMA 1U8UA 5JECA 2Y1LA 4IIXA 3E30A 4KGDA 1GGKA 4QM7A 3GRYA 2JGIA 4G89A 4JMPA 3LW8A 2QE7D 4JENA 1XG5A 1Y6RA 2IYQA 3CRQA 1JEEA 5KWVA 5ENPD 3DBRA 3PXAA 3IMGA 1LPSA 1D2GA 2Z57A 3ROEA 1EE2A 4ZT4A 2DT8A 4OQLA 1QXSA 4GYYA 1XMJA 4IHJB 3AMVA 4MWZA 2HCJB 3UO8B 5JCOA 1UK9A 3TLMA 1NVVR 2YZ2A 4DGQA 2IS6A 2O5VA 4UNPA 4BTLA 5CH5A 2HQSA 4TLAA 1A7AA 3OF5A 5HS6A 3G2WA 1P7YA 5ECGC 4MR7A 5FBVB 2Q9BA 3R0IA 1YB7A 2GEBA 3KM0A 2COEA 2FO7A 4LN1A 1IN1A 1KO5A 3KD2A 1NSFA 3W78A 1DQNA 1P74A 1R0YA 1WDLA 2WM8A 3IIKA 5DASA 1DXYA 1VIMA 1N52A 3U4QA 3ZGVA 4DUYB 2MSKA 4BNTA 4XJXA 1CJSA 4NFLA 3IEUA 1DWPA 1R6XA 2PLFA 1GKKA 4PWYA 2V0GA 2AJCA 4MPTA 4CCYB 3MCZA 3FUUA 2FFHA 3IYLW 2CZQA 3RV3A 2H6GA 1SZAA 2YIDA 1I14A 2PL5A 4WXPA 2WEKA 1A0OA 3EGWA 4PN7A 1NKTA 5KJ1A 1Z0JA 3T3IA 1E20A 2AOXA 3LPLA 4WZBA 3K0KA 1KJZA 3QEAZ 3LUDA 3BE6A 3DEIA 4EFDA 3NOGD 3CM0A 1ZLYA 2NYAA 2RHOA 2VQSA 3VFDA 3F9CA 5F64A 3C15C 3C4JA 4BLVA 2IHBA 2YOGA 2IV3A 2R8XA 4EWLA 5FP0A 3CEPB 2WIBA 3LHFA 5B64A 1UMBA 2O2YA 1GNPA 4IJVA 4B0PA 3ZEIA 3V4RA 4E07A 4FYJA 3KK0A 2VUTA 3HDHA 5J08A 2VP4A 4P0TA 4PBTA 4EA9A 1J6UA 4NBSA 1UWCA 5G1OA 1NYTA 4DG8A 1MJFA 4OQDA 3BDIA 9LDTA 1PR0A 2VLIA 1QUFA 2AG6A 1TN8A 2DZOA 2AKAB 4F84A 4ZJZA 3ZBQA 1HQCA 1YQGA 2O8DB 1VSBA 2PXHA 1ZK2A 1TQ6A 3QFHA 4CM4A 3PR3A 3HU2A 1QPGA 4RZIA 2W4IA 1LSSA 1FVOA 1SD2A 3LZCA 2DBYA 4CKZA 2MINB 4C76A 5ED0A 3UMRA 3I2YX 4A2QA 3L93A 2GA9A 2VTBB 2WJIA 5AXCA 3V31A 2BKUA 1KFEB 1X7ZA 3UMBA 5CHYA 1QBGA 1NE7A 2XUAA 1TFUA 4RJJA 3I6MA 2GRMA 3PPYA 2BD0A 4MWCA 3HVHA 2X3MA 4Q1FA 3GYBA 5LBIA 3VZSA 4QUHA 4RPGA 4TXNA 2DY1A 3E33A 1TX4B 2FX2A 4WNAA 4K9NA 2FPIA 3FYDA 2WSMA 3BH6A 5I7SA 3QVLA 2A86A 3EVCA 4YRZA 3LFHA 4HORA 3L8GA 4UBJA 4V0QA 5G1NA 3IFSA 2WAYA 4JOSA 3X2EA 3PQ6A 3CJRA 2WJPA 4J43A 4EBFA 1IK6A 3U9LA 4G1BA 4G0YA 1XZGA 4X92A 5BPHA 1JAHA 5IHXA 4CEJB 3BU8A 4HRAA 1YDEA 1JTEA 1KC3A 3D4IA 3I2FA 3USES 1E69A 2EJCA 2NUPA 4ZQCB 2QRVB 4IGIA 2PH7A 5LOZA 2XCQA 4PHHA 4QOSA 2PUDA 1EAMA 3ZK9A 1O03A 2P9HA 2B8EA 3ABZA 1KAOA 1Q77A 3ZKWA 2JIZA 3GC6A 4RVBA 4HN9A 1FZQA 5BNWA 4QGSA 5HKPA 1E7MA 2I03A 3DEHA 3L82B 3IHTA 1FPQA 4TPKA 3BTOA 2XMCA 4ITUA 1KMNA 1X94A 5E9AA 4H0CA 1E7WA 3FFWA 5F77A 5FEUA 2R05A 2DYKA 2Z2XA 4YRQA 3NAGA 5CLJA 4DFDA 3AM5A 3LJ3A 4JJGA 3I4GA 2OSVA 3K9WA 1ZW1A 3ZD9A 1FFXA 4GW3A 4YRAA 3U3MA 4PZ0A 5FO1A 4NBWA 1FVFA 2ZJBA 1YVUA 4YO7A 4Y6PA 4H60A 1MA0A 2BI4A 1IDOA 1OI7A 3TX6A 1FJ2A 3ULYA 4RIHA 3D7MA 2AW6A 1XTZA 1XROA 2YVUA 3Q9UA 4CF3A 1XU4A 1TB4A 1TE2A 2BLLA 1YJCA 4U8GA 5L3QB 2O5CA 1AQ6A 2TS1A 4UWKA 2PT9A 2Z6QA 3S7TA 2BTDA 5JJ6A 2C20A 3SSAA 2YHEA 3EDYA 2VXCA 1OVMA 1F20A 4BVLA 4C0JA 3RIEA 4YJ3B 3JQQA 2YCLA 4Q21A 1P2TA 3D3JA 3KOZA 2WJ4A 1J00A 4KRXA 3EQ8A 1R2QA 4IOJA 2Q3BA 3PGKA 4E09A 2WDZA 2ZW9A 4HGOA 2DH5A 3KG2A 3KEAA 5CM9C 1X13A 4WXEA 3DPSA 4DLAA 2QW8A 1EFUA 5JISA 1ULAA 1A9XB 2CYAA 2O8VA 1OSNA 4IRUA 3AR6A 4KQ1A 1SQGA 3B6KA 5JH7F 5D5HA 4ZZ3A 2C4NA 4WW0A 1DKMA 1SBNE 2VYVA 1AF7A 3WAKA 3P5SA 5J5CA 1P6QA 1PL6A 1KPGA 4MRUA 5CNMA 2E4WA 4B79A 5HSGA 1EE1A 4HMOA 4HAIA 5DLEA 4NEHB 1U6JA 2D8MA 3WBJA 3BQOA 1SIUA 2BGRA 2NV2B 3HVEA 1Q1EA 3QUBA 3E3NA 3G5MA 4I8DA 5DGXA 3JQAD 3L7BA 3FZEA 1ODIA 3PIIA 2CZGA 3B5EA 1PT7A 3IDAA 4UCFA 5CTAA 1QCDA 3IR5A 1L4EA 2PCLA 3L02A 5JWHA 1UH5A 1WXXA 4R2KA 1V1JA 2Y9PB 4ZCRA 4J16A 3IAXA 5B2ZA 3MS2A 2F4NA 2P0YA 1A17A 3BWEA 2P79A 1SN7A 1QHEA 2I2OA 2NG1A 4DIUA 1WEHA 1GGEA 3AB3A 2M63A 2PMWB 3ZXXA 4INAA 2LAIA 4X97A 3O2NA 1Q95A 3REGA 1YFKA 2HFKA 3B3AA 4FDLA 2RHTA 1SA0A 3S5UA 4ZZ2A 3SKXA 4P7FA 1PK9A 2RGNA 5ADWA 4JQZA 3BB1A 2QSJA 2QTVA 1WVGA 1MB4A 3ZZUA 3PTAA 4HWGA 1LGYA 2Y6UA 1JB9A 3KTFA 4FFSA 4MV4A 3U3RA 4QUBA 1PWYE 4F6CA 4M0KA 1F12A 1WZCA 4PC1A 2P9TA 2H1LA 1NBAA 3AVWA 1RQGA 1XRLA 3BRCA 1TLFA 2Q1YA 3WLAA 4GZCA 3PNPA 1S2GA 2Z1MA 3GWZA 1RNLA 3D8TA 5JALA 2R87A 5LCWC 3JYLA 1UJ4A 5F4ZA 3RJZA 4KXKB 1DC6A 3FNFA 1RWOA 4LSMA 1MENA 3LDAA 2R8PA 4P5DA 3PC8A 4CG3A 2X15A 2NM0A 4IMPA 2FEMA 1K8ZB 4WCDA 1U7XA 1T0UA 1GQSA 3UMYA 2GHQA 1K98A 1FFEA 3FNQA 4KJXA 4JGBA 3I45A 4N40A 1ID1A 2QXYA 4DW8A 3UT5B 2XUOA 1BE6A 2ZE5A 4P3KA 5KJFA 1E0AA 4Q7QA 1TMKA 4XDHA 3IPAA 2PQ2A 2JEKA 4C6RA 1ZOIA 1RIIA 3T7KA 2FSVC 4F8YA 3OIFA 4FR5A 5C0OE 1R37A 1L5LA 5FI5A 3HIZA 3C41J 5ECDA 3HJUA 3IUPA 1SCKA 2PKYX 3ZWPA 4HAOA 1XSEA 3Q7SA 1OHHD 4JLKA 5DNYB 4JITA 1BO6A 1XYVA 2AGVA 1J25A 1T9AA 2UY1A 1FU8A 3GGJA 1OGJA 4F12A 3PXUA 1M2NA 3Q8MA 3FVTA 2ZBUA 3LO8A 4QJ3A 3K1TA 2GPAA 3N1UA 3SE0A 3FMVA 2RKOA 3HDVA 2NNLD 5AW3A 3PICA 2EW8A 4TXLA 1F8FA 3KKMA 2DQZA 5GV8A 2ANBA 2Q6LA 2VTVA 5K0TA 4L6AA 1JAIA 2X8WA 4YROA 1FTGA 5AQ7A 1AO0A 2VBIA 4KVMA 3I05A 4AWAA 2QYHA 2PR2A 2Z56A 1KMHB 3K0SA 4EHKA 3C43A 1OH5A 4EYQA 4CF5A 1YKGA 4UM9D 4KVAA 2IPLA 3CX7A 1I4EB 4W5HA 4D4MA 5M3BA 2NZJA 5FYQA 2LV8A 3Q15A 1J0BA 3OPMA 3NTXA 4S12A 3OZ7A 5EIFA 1TMGE 3FPEA 1NQTA 3HYMB 3JY6A 3A25A 4OIMA 2YJ3A 4KX3A 2ZSDA 3Q3GE 2XTMA 2ROQA 4EY6A 1RJ9B 1QG0A 1N7JA 1WOYA 3W9GA 2LP4Y 4V02A 1MAAA 2GRRB 3K6JA 1DT5A 1S1CA 2X5XA 3O9ZA 121PA 4F72A 4RQUA 2O2GA 1CF9A 4CV2A 4JHXA 1WCXA 3DCIA 3FH0A 1M1XB 4LPKA 3KSDO 2IXEA 1XLWA 5CERB 4NXNB 5EQDA 5JD4A 1K3UB 4C0QC 3I1IA 1ZFNA 1RXCA 4U0JA 2X8BA 2DZDA 4IG4A 2VT7A 4MV1A 2BV3A 1D8AA 3FR8A 1SC4A 1XFAA 3F47A 1YK1A 2C3YA 4AN4A 2ZSKA 1B1CA 1RI2A 4CKWB 1GZUA 2VF7A 2HRDA 4B2LA 2NU9B 2HHCA 1INLA 2YRWA 5IKPA 4XQ9A 4WFJA 4QG3A 3GJYA 1EVJA 3GRRA 5GADl 1GL7A 2FG7C 4BRSA 2YQ4A 2IYXA 3A04A 2GERA 3Q85A 1U4SA 1WP9A 1XZPA 3GIDA 3ANYB 3FKSA 5CX4A 1VLJA 3NKFA 4FNMA 4ZU6X 3LK7A 1SUPA 2AQIA 3E1GA 3EIFA 4FU0A 4PVCA 5KYUA 2JGMA 4AWBA 4Q02A 5CEAA 4O4JB 2XDQA 5EPOA 4ZTUB 3GG2A 5E9WA 2QLNA 1Q50A 5E6UA 4JX8A 4LJLA 5KOHB 3KOUA 2GYWA 3LZ6A 3THOA 1V41E 4OSOA 1R4NB 3BGSA 3GFVA 3RODA 4YDEA 2QTCA 4CL3A 1MF7A 3G7UA 4LX0A 2HEGA 1HNXB 3PTZA 3U7EB 1C3OA 4C7BA 4NOKA 2GB4A 3SBOA 3AG1E 1K6MA 2PPVA 4IHJF 1JHRA 2FQYA 1PYOA 1TT5B 4OG2A 1Z25A 2XSZA 1WPQA 4UU0A 3EEOA 1AQUA 2YXNA 4O4LB 1Q15A 1YCHA 1YZFA 1D6SA 1P17A 3W6ZA 5FPKA