2XGSA

Xcogt in complex with c-udp
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
542
structure length
542
Chain Sequence
LMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XCOGT
publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
total genus 206
structure length 542
sequence length 542
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgsA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgsA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgsA02
3IA7A 1C50A 4GA1A 1HLFA 1FU8A 3E3OA 5KJKA 3OTHA 3KAEA 3OKPA 3K9IA 1P4HA 3MKRA 2PYDA 2H1FA 3Q3HA 4NESA 4HOUA 3LY9A 5ARGA 3CVQA 4HOQA 4I9EA 3E4BA 3OXLA 2KCKA 5KJMA 2YHCA 1SXPA 2JZCA 3CUVA 3ZCPA 4KQ2A 4M60A 4N3BA 3SZ7A 4X7MA 1QZ2A 4MI3A 3WC4A 3RO3A 4HWGA 4F3VA 2VSYA 4X7RA 1P5QA 1NLMA 1XL0A 3ZCRA 1SXQA 1GGNA 1Z6QA 5FTPA 3L7CA 2AMVA 3NB0A 5DLDA 1TJCA 4G23A 4N3AA 3ESKA 1F6DA 3OT5A 4U07A 1PYGA 2F3UA 1YA0A 5TMBA 2Q7FA 4XIFA 4G1TA 1FU4A 3CKBA 3MS7A 1RZVA 3LYAA 2QN8A 4UI9J 3LY7A 2UWJG 4CGWA 5LCWC 3G2HA 3G2IA 3LPZA 3TGOA 2XCCA 2QLMA 3L79A 4F97A 3H4TA 2QRHA 2JLBA 3L01A 4U0SA 3NAZA 3CUYA 2IFUA 1OUVA 3ASDA 4AMGA 3PE3A 4WNGA 3E3NA 1E1YA 3BEOA 4RIFA 3UQ3A 2X6QA 3T7DA 9GPBA 2MHKA 1M5RA 3HBFA 3HBJA 1L5RA 2VCEA 4KYOB 4G26A 4REMA 4RENA 3R9AB 3DDSA 4J8FA 3QWVA 3MS2A 4MI6A 3T3HA 3MEKA 3DDWA 2PL2A 3FFLA 1PN3A 4NQ0A 3ULQA 3Q47B 1A17A 3GUHA 1H5UA 2DBAA 1P2DA 5BNWA 5JJ6A 2PQRA 1P2GA 5G05C 2LSVA 4AY6A 3MTDA 1KTIA 4N2QA 1WW2A 3T3IA 3BCSA 5HQ8A 4WNDA 2QRPA 4L22A 5EX0A 4GZ3A 2G9RA 1Z8DA 3KD7A 1YGPA 2QN9A 4WACA 3CK9A 3U3WA 4U04A 3GZ1A 2KC7A 2IV3A 1NVKA 3AS4A 1FTQA 1FC0A 1QQEA 1BX3A 4X6LA 5D0OD 3MRVA 1HZ4A 3CEJA 1IHGA 3Q15A 1NOIA 2OOEA 2PQNA 4AMBA 2ECPA 2LNIA 4N2SA 3C48A 3D0RA 4NRHB 1LWNA 4PQGA 3PDNA 4H7XA 3CEMA 4EKEA 1L5QA 4HOSA 3NF1A 5TMEA 5I45A 1GPBA 3CUUA 3FP3A 4FKZA 2AZDA 4EL5A 3N71A 2WPVA 3QHPA 2YQ8A 3L7DA 2SKDA 4KQ1A 4HORA 5CCMA 3AS5A 4U0UA 1JIVA 2GEJA 2XA1A 3C4VA 4GPKA 2VYIA 4FZRA 4Y6WA 4Y6CA 1JEJA 1W3BA 2FO7A 3BCUA 2KATA 3MA5A 4NC9A 1E96B 3BD8A 4Z5XA 1GPAA 3TG5A 1JG7A 3G2KA 5IKOA 4GZ5A 2O6LA 3HBMA 3ZCVA 3RO2A 2YJNA 3RHZA 1A8IA 1YA6A 3U4TA 1ELWA 2C4MA 2XCBA 3QKYA 2XGSA 3T5TA 3MQFA 2G9QA 3RSCA 2VSNA 4N9WA 2F3QA 5FZQA 3RT1A 4BQIA 1L5SA 1KT1A 2R5SA 1JIUA 3RKVA 2R68A 4UI9C 4GYOA 2C0MA 4UQYA 3SF4A 2ZB2A 2XCIA 4AN4A 1UQUA 2X0FA 2QN1A 2IV7A 3CV0A 3MV3B 4CTNA 3MT8A 2BGTA 2QLLA 4I2WA 4M83A 5D0QD 2Y4UA 3Q3IA 1WW3A 3CK8A 2XGOA 3NC4A 4BT9A 3BD6A 1K08A 4QLBA 4JL0A 1FA9A 3L7BA 3VTXA 2VG8A 3MRTA 3S29A 2XCUA 1KLXA 3CEHA 4N3CA 1PNVA 3OKAA 3BDAA 5KJNA 2AV6A 2PZIA 1FS4A 1L7XA 2GPNA 5A6CA 2R4UA 4CTMA 3C4QA 5FT9A 3WXXA 4RELA 1NA0A 3LCAA 3Q5MA 5M72A 2AW3A 4G2TA 3T3GA 1JG6A 1J39A 2BISA 1WAO1 2X0DA 4EKYA 5LCWJ 1GFZA 1WV1A 1PC2A 2FF5A 2PQ6A 3D0QA 4RG6A 3O3CA 3RU0A 3AMVA 2GEKA 3BD7A 3CUWA 3UYKA 3OTGA 4YVOA 4BT8A 2Q6VA 3BCRA 3QWPA 1XC7A 3KS2A 2IF4A 3ZHEB 1B4DA 2QN7A 2OFFA 2L6JA 5JTUA 2UY1A 2KCLA 3CX4A 3T3DA 2ATIA 4KBQA 1Z6PA 4W9RA 2FETA 5DU2A 5JJ7A 2QFCA 2PYIA 3GPBA 3FROA 4A1SA 4AIFA 4ME2A 3SYRA 5G04J 3CKCA 3Q4AB 4XI0A 2SKCA 1NZFA 2PRJA 2GW1A 2IEIA 4GPBA 1XKXA 2E2EA 1P4JA 1P4GA 3SYMA 3T3EA 5JTTA 4RIHA 1UQTA 3MRXA 5FZSA 5KJLA 5DIZA 4G24A 3ZN3A 1ZU2A 2XGMA 1RZUA 2FEZA 3ZCTA 2V5FA 5AYWD 4J8EA 3NP7A 1Y6GA 5C1DA 4NEQA 3HYMB 4BWRA 2P58C 1C8LA 4RIIA 4RG9A 3RIBA 1NOJA 2R4TA 5DBKA 4J8DA 1L5WA 3ZCUA 2FBNA 5A7DB 3VDMA 1FTYA 4N39A 5CHEE 1B89A 3ZGQA 2Y4TA 2QZSA 3ZPJA 4I17A 2C2LA 3CVNA 2G9UA 4JA7A 4YUAA 1GPYA 3AS8A 1C8KA 1UZUA 3OXFA 1AXRA 2GJ4A 3IEGA 5BT1A 3MS4A 3ASHA 3GW4A 2J9QA 3COPA 5FZRA 5GPBA 2F3SA 2R66A 2ONDA 4GYWA 4X7PA 4W6QA 3RJVA 1ZBPA 2WQHA 4LEUA 3EBOA 4BTBA 4AY5A 5TVGA 1XOIA 3NP9A 4LEIA 5HI7A 2XEVA 4MRAA 3Q49B 5BW8C 3TAXA 4F9FA 1XL1A 2H1HA 8GPBA 2VCHA 2P6PA 4HLNA 2X6RA 3S7BA 3NCHA 3LKUA 4APOA 1FCHA 2VGXB 3WADA 1WUYA 3NPAA 3CV3A 3OY7A 4YI3A 4EJ2A 1NZDA 3G2LA 1WM5A 2G9VA 4CTOA 2XA2A 4F96A 2X0EA 4YVQC 4MICA 1HH8A 2IYFA 4KXKB 3QWWA 1PSWA 2ACWA 3FWVA 3D1JA 3S0JA 4U0ZA 3EDTB 1E4OA 3S28A 3S7FA 5JJTA 1P29A 1V4VA 2HO1A 3EBPA 2HY7A 3VUFA 2ASVA 3ZFWA 3GYZA 2F9FA 2HR2A 2SKEA 1L6IA 3CVLA 1C3JA 4EQFA 1VGVA 4YI5A 3CEQA 2IYAA 3DD1A 3E3LA 3H4IA 4MHOA 3QOUA 1F0KA 3OXGA 2C1ZA 2GT1A 1Y6FA 4G2VA 3ZHEA 1FU7A 4WHMA 3MTBA 3S7DA 3GZ2A 2AVPA 3OY2A 2KCVA 3CK7A 2IUYA 1EXVA 2KS6A 2ACVA 4GCNA 3ASFA 1FTWA 1AHPA 2PRIA 3VTYA 5EX3A 4BTAA 4M7PA 1JIXA 3G2NA 4HOTA 1Y8MA 1WV0A 2R60A 3L7AA 1WUTA 3DZCA 4WNFA 3CUTA 1Z62A 1L5VA 5ARFA 1HXIA 4GCOA 2LSUA 3UPVA 2QN2A 4EL0A 1GZ5A 1XNFA 3MT9A 3ASGA 4LDPA 7GPBA 4H7YA 1GG8A 1K06A 5HXAA 3IAAA 4N5CA 4I2ZA 1KT0A 5FJYA 2XPIA 3HBNA 3S2UA 5ENZA 1QKJA 3O48A 3VUEA 3MV2B 3UYLA 1O6CA 4UI9K 1NA3A 2QLNA 4I1AA 4UQZA 4RIGA 4MI9A 5G04C 3Q3EA 5DXFA 2C0LA 4O6FA 4G25A 6GPBA 2BUGA 3QDNA 2QN3A 4BQEA 3ZCSA 2QRGA 5EKQD 4BQFA 3MSCA 4GA2A 1P2BA 2BFWA 1NOKA 3G2JA 4J0UA 4JA9A 2VQ2A 5G05J 2I6HA 1RRVA 3VDNB 4CGVA 3JYSA 5TMDA 3OTIA 2QRQA 4XI9A 1Y8ZA 1QM5A 2F3PA 2GPAA 4MHSA 5CCLA 1IXYA 4BFCA 4I9CA 4B94A 4WADA 4RBNA 2XA9A 3MBOA 2HYZA 2VGYA 3ZCQA 4GYYA 4AM9A 4ABNA 2FFRA 2FI7A 3CVPA 5IKPA 1ABBA 4GZ6A 3BEEA 2IEGA 3LY8A 2VGXA 2FF4A 2UY1B 2XMPA 3URZA 2BGUA 2NC9A 3OKCA 4IN3B 5D00A 4KQMA 2IW1A 1EM6A 2C1XA 1NZNA 4CDRA 4UQXA 2JJMA 5LQDA 3QKWA 2GPBA 4GA0A 3S7JA 4WUYA 3MT7A 2GM9A 4YNDA 4RIEA 3TOVA 1LWOA 1XV5A 4JHRA 2QRMA 3PE4A 1IIRA 5D01A 3TSAA 3WAGA 3TG4A 1IYGA 2C9ZA 2QNBA 3MTAA 2WTXA 3S27A 4WNEA 3RSZA 1ELRA 3UUXA
chains in the Genus database with same CATH superfamily
3I4CA 3T1VA 4PINA 3NC0C 3THSA 2RGNA 4FFSA 1M1YA 3H7AA 4Q3NA 3L2OB 3KKZA 2FMKA 3N87A 3WNCA 1OLUA 3H42B 1QGZA 2VSOA 1ZIPA 4NBLA 3ORSA 3A1TA 4E51A 2A6PA 3FMGA 2C58A 3VR1A 2E21A 1TM4E 5ALKA 1W5SA 3ZH2A 4UD6A 1JSCA 1CY7A 1N4RA 4BLUA 1EP1B 4GG1A 2L6BA 1M5RA 3GLKA 1U3UA 4JJEA 1R0LA 1R6DA 1VHDA 5CFMA 1C3XA 3EXFA 5I48A 3TW6A 3P5SA 4DFDA 1QRRA 1GGJA 2R48A 3T3PB 4MLZA 3HDQA 4P9NA 5DJ5A 1RI3A 2WTEA 4ZCQA 3UJ8A 1M2WA 2HKIA 4GZ3A 4MUNA 1G64A 5D2MC 5DWDA 3LCUA 2HHHB 3TIFA 3ADDA 3IUMA 2JCBA 4M7RA 3EXIB 2Z4RA 5AQ9A 3GLRA 3D9JA 3QKRB 1F5NA 3ONDA 2GHIA 2QM0A 4ZOCA 3ZNNA 4A2CA 5LU9A 4IXDA 4J8SA 3JZDA 4ZK2A 3VOSA 4LWOA 3SQLA 2ZS9A 2DUMA 1G4AE 3KOYA 1P18A 3W6ZA 4RORA 3G2TA 4P7FA 3O8QB 1A8QA 2YQ5A 4WIAA 2CXXA 3NTLA 1L7QA 1NF9A 2QJWA 4OHYA 2WJWA 3D3JA 1WULS 1GGVA 2HA0A 1QYCA 2IFTA 2XGGA 4ZAWA 3PHCA 5FEMA 2I4IA 5K6AC 5KJCA 4BNVA 3DVRX 4AUMA 4EPZA 3MRTA 2V8OA 1NMEA 4NIMA 5CFPA 1K7EB 3L82A 1CV2A 3EZ6A 1J39A 1Y63A 4AXXA 1TKAA 2CB0A 3JS5A 2AEEA 4JEIA 3ZHEB 1H3NA 1QNFA 4D80A 4PO8A 3SFYA 4M6WB 3SY8A 2JZNA 1SY7A 5DLPA 1V43A 1YJXA 4XR4A 4IDQA 3T3EA 3A4IA 2RONA 1IWPB 3IVAA 5GV8A 4BZWA 1J8YF 4J0IA 1QZUA 2NTNA 3RS4A 3JQ8A 1SC4A 4YFVA 1SUBA 3PXEA 3U64A 2HX1A 2XHEA 3ZVKA 4PE5B 5LCXA 3W79A 1TZCA 2GZAA 2BFBA 5ARBA 1M8PA 3JVEA 3QY0A 3JXEA 4X7PA 1G6HA 3UWDA 1K27A 3V9PA 4PCUA 1ZLXA 3AEQB 4BESA 5FWNA 3DULA 4F9FA 3BJRA 2MR5A 2W93A 3K7EA 3MJFA 2V65A 4MVWA 2NXCA 1ZWKA 2UUBB 2ZVQX 1WM5A 3ICWA 2J5BA 5ALUA 2WAOA 3CLJA 2OFPA 1R4NB 3PUWA 5TQJA 1UKBA 5L8VA 1FLAA 3OIVA 1YDFA 1AUVA 3CNEA 1UJ4A 2GSWA 5A5FA 4Q1CA 4AZTA 3H0KA 4RHYA 2P9QA 4LUCA 3I42A 3DZCA 3AF4A 4IYPA 3FUCA 3U5ZB 2Q4RA 5D66A 4C7BA 3DR5A 1GPMA 2OAEA 1ORIA 1QHHA 1KT0A 1UBHS 3VNUA 3RRNA 5H70A 1DJNA 4XLLA 2FUNB 4QA9A 2Q46A 2A5DA 1GTZA 1II9A 3P9RA 4C3ZA 3KTFA 3A8TA 2IPAB 3HDXA 4BP3A 3E7FA 3MINA 1YJCA 1PEKE 2V9CA 4I1OB 3VDNB 2AJAA 1VJ0A 5AQ1A 2PKRA 2GTHA 5FNVF 2GFHA 2Y4NA 3P2MA 1L8QA 1JHRA 3Q7SA 3GZNB 4NJOA 3RIGA 4D9KA 3IV7A 3BH6A 3FG9A 4JUBA 2YYYA 2JJMA 4BWVA 3MT7A 5KWJA 2H07A 2P5TB 1FBNA 2GCIA 3IRUA 1G7SA 5K8JB 1DBWA 7YASA 4MUAA 1JLSA 3GLGE 2ATXA 1IEWA 3UT5A 3ROFA 5K2MA 1DKPA 1PTJC 2P2NA 4YASA 4BVJA 3WDSA 3FCUB 2BMWA 5AW3A 5L3RA 3PC2A 4LGCA 4D9GA 4HJRA 3GC6A 3VZCA 3BGOS 1PT5A 4B48A 1JPLA 2P11A 5E7IA 5AKXA 2EBUA 3IJEB 4JDPA 1T6YA 1VJGA 1QZXA 1RJ9A 4IDBA 1IHUA 4RK1A 1RVV1 3MG9A 3W8NA 4GAAA 3I6YA 2ZZMA 2XNKA 1A7JA 3KALA 4FWIB 4J0GA 1XHFA 1JNXX 3JZFA 5DM60 4Q66C 4HGNA 5LMUB 4HQ6A 1DAIA 2B2XA 5AW7A 4OMDA 4OM8A 3B13B 1VOTA 2CLMB 2QV0A 3EQZA 3OF3A 3VX3A 2CFTA 4YLYA 1TUBA 1LPPA 1ADJA 2FX2A 2OOKA 3K9BA 3QVUA 3E9DA 1YCHA 3U1BA 1X80A 4EF4A 1DXYA 1PL6A 3PFBA 4YEDA 2UUCB 2JASA 4KJZA 3OCXA 4R40A 3VSEA 3AUUA 4TX1A 3UK2A 3TL2A 2DTXA 1SFRA 1SXHA 4V0OA 4XWAA 5G3ZA 4G5YA 4AJNA 1SVIA 1BI8B 3U7FB 5JDCA 1M8FA 4IVNA 5KDLA 1Z0ZA 4DJJA 2FVYA 3TQCA 3ETNA 4BZZA 4IGFA 4GD3Q 5FBRB 1FMCA 4C0BA 3MLBA 3C3KA 2JHCA 3R3SA 1NAHA 3L7BA 4G1CA 4OUKX 3OECA 4O2RA 3NXKA 4MPPA 5U4QA 3WXXA 3FWZA 3IUEA 3C5EA 3AVWA 4K87A 3NTXA 5FB3A 1X9IA 3F6YA 1QP8A 1FTGA 2UV8A 5BQFA 2GEKA 5C7OO 2QRUA 3KPVA 1I51A 2CBGA 4U0KA 4R2JA 4ZT3A 2ID7A 2WAMA 1B4DA 3HJTA 3EEOA 4X8QA 4C7VA 2QZPA 4AF8A 4G89A 4BE4A 3E32A 1UOPA 4RYLA 3DS8A 5ESWA 1EE9A 4OQXA 3KHTA 2CL6X 4WPGA 2PTHA 1U0NA 2EHJA 1I3CA 1QGED 3U17A 1KOGA 2CV0A 3ISTA 5JO9A 2GS9A 4QHSA 1D4ZA 4H6PA 4WJZA 3G1UA 2HXSA 3KQHA 2FSUA 5FUVA 4HFMA 2IU0A 1ATZA 2HCJB 3NIFB 1JALA 3RG2A 4GL2A 2B8TA 4BPRA 2XB2A 4YJDA 1AN9A 5T4YA 3RVSA 1A5ZA 3EJ6A 4OXIA 1JTEA 1Y5NA 4A1OA 1XTZA 1V3TA 3S7BA 2J46A 1ZINA 2DBQA 4I81A 3QA9A 2JJQA 1DIGA 5AJXA 1T1EA 1FJ2A 4TSKA 1D8EA 4GUAA 3UGJA 3W8EA 3E9EA 2CJWA 1NT4A 2ZVDA 4YQZA 3PNPA 1Z18A 3VUFA 2Y3IA 3WP1B 1N0QA 4BXOA 2QHXA 4MHOA 2X3FA 1JSZA 2GT1A 4HZUB 2YOFA 3I28A 3FYSA 4R01A 3FNBA 2ZJZA 4AZWA 2GZDA 2GPTA 4R31A 1QO9A 2LV8A 4NENB 2IL1A 1NG1A 2IY8A 1JCQA 1G55A 4D45A 1Y5IA 1I2ZA 2FV8A 2EL7A 2R25B 1QV6A 3PI7A 4HDMB 4RVOA 4AMZA 5CBOA 4EJ6A 2BFWA 1QVZA 2PKEA 3MJTA 1UMKA 2PN1A 5FKJA 3LMKA 3ROTA 1U7WA 3VLEA 2Q7XA 3M2PA 2ECKA 4NARA 4L2IB 4DC0A 2QX7A 4OFZA 3Q3CA 4KQMA 4ALNA 3UC9A 3AW8A 5L3QB 3BILA 4ER7A 2UUPA 3N2KA 3C1TA 2C5SA 3HACA 3TSAA 4ZVQA 3H0EA 4RFSA 4AQ7A 3HSKA 3P2OA 1KJZA 2ILRA 4TVSA 2X9QA 2XKBA 3O83A 2Z8YM 3ZNGA 3W2EA 5LDHA 3RFTA 3TD6A 1ZUNA 4FIDA 3DAHA 1M6YA 3SHQA 4IIJF 3F0TA 2I78A 4RKRA 5LB4A 3ZVRA 3WISA 2QY6A 3QY9A 4F2PA 2C83A 1P0FA 2X6QA 3MOSA 1GSIA 2BCEA 3GLGA 3OUTA 1J8VA 3G82C 3M9XA 5DXJA 4PPYA 3TX6A 3WIVA 1JV2B 4RSRA 4HB3A 4F7DA 2JVJA 3EZLA 3VFDA 1PAUA 1L8AA 4XTCS 5IFKA 4F93B 3PT9A 1F1JA 5LX8A 4GE3A 4TV3A 3NJ4A 3PWTA 4E1VA 3P26A 1T9CA 4Q0MA 3Q9LA 4KI0A 1JHPA 4B7XA 3ODPA 1N25A 4IJUA 3EF1A 4ZQGA 1E89A 2E6KA 2WJ6A 3TBHA 4HNAD 4HFNA 1HE5A 1YIOA 4MVJP 4PIVA 3FB4A 3QW2A 3W9UA 3IESA 1T5LA 5CTAA 1NBME 4URWR 1PUJA 1JZTA 1B43A 4FYMA 5AR1A 3D02A 3R44A 5KTTA 3U7HB 5LLDA 1VPTA 3H2KA 1S2LA 2B8EA 4W9NC 2ROQA 3AU8A 1OBCA 2PV7A 1TQ2A 3UXHA 2XCIA 3FZNA 5ANRA 3KT0A 1GYPA 4HFJA 4BVGA 3VU1A 1ZAKA 4IQ8A 4MTLA 2CSUA 5K6AA 1VE9A 3OEYA 3HGMA 1FRZA 1L4EA 5HDBB 2AD1A 1T5IA 2DBYA 4K3UA 3O1LA 1ZC3A 1TLFA 3RUDA 2MRIA 1R1DA 3U6KA 1PFQA 3CVYA 1QYIA 3QWPA 3PLNA 2TS1A 1PZNA 4AG6A 5FWYB 3QKRA 2HHJA 2DGDA 3FTNA 2A67A 2P35A 3ZCTA 4IRMA 3LUBA 3EW9A 3OOJA 3GP5A 3EZXA 2FBNA 3FGZA 3K35A 3QPVA 4DHEA 4XM0A 4TROA 2IHJA 2VHWA 1JJBA 1OB5A 3ZHRA 2OZLB 2H4FA 1K68A 3B9QA 5HF5A 4G8LA 2EF1A 1H0RA 4GM1A 5C1BA 1YL6A 1Q6ZA 4P54A 2C1EA 4LMBA 4ASUA 4N7MA 4EJ2A 2E6UX 5FH9A 4UUAA 3I2JA 2PKYX 3MOIA 1Q3HA 4NYIQ 5AVOA 2CCJA 4IV0A 3PXDA 3SR0A 2PMEA 3ZNPA 4KZ0A 2UXCB 4DIDA 3K1TA 2EZ8A 4LY0A 1FP7A 3ZLBA 1JL3A 3OXGA 3ZHEA 3OZTA 4M6WA 1ZD4A 4C22A 3VRHA 4BVKA 1JIXA 3LQFA 4MQFB 3V55A 3GFTA 2HDHA 1W25A 4HOYA 3PH0C 4KVOA 1YRYE 5REQA 5AKZA 4GI7A 4E07A 4R3UC 2HA7A 4CF3A 2DT8A 4OK5A 4D9MA 4ITUA 2RGUA 3EQ7A 1TIBA 5C80A 4WKOA 2WJ3A 4G5RA 3N2YA 1BN6A 1SOWA 1W30A 4CR7A 1O6GA 4GX1A 4RTPA 3RRBA 3AEQA 2FZ4A 4A1FA 2LBPA 3AQIA 1WY5A 4MLPA 4MKXA 3I9OA 3OKCA 2YWCA 2HRBA 4AKEA 4YMVA 4PZ9A 4HPXB 1L5LA 3B7RL 4V0QA 5A5DA 3C3PA 4OVVA 4ND6A 3UCEA 3KR1A 3F67A 4G8JA 1P0PA 1NHGA 3N75A 3ZW9A 4QUAA 1U0HC 2RGEA 1BWQA 3PNQA 4TWJA 1SXPA 4LQCA 3ZLUA 4URYR 2D4HA 2OORC 4RAQA 1A8PA 3VU8A 2WIKA 3L0SA 2PL3A 1RWXA 3VC2A 4B7CA 1JJFA 2CHEA 5G0WA 3U48A 4ZVSA 4OREX 4S2UA 3CVJA 3WO1A 4GMXA 4B9AA 3DSRA 3KSMA 4U9HS 1EYZA 3ZQ6A 1XNHA 4KX3A 2FMHA 1N2OA 1KXZA 1E1QD 1GHTA 1M2FA 1TCAA 4G1VA 4ZVUA 1X6VA 3MGGA 3S1AA 5FI0B 3QITA 4N82A 4ZU3A 3T12A 4EYGA 2YIDA 4KMSA 4L73A 5AQAA 1BGVA 4C0SA 2GCOA 1JJ7A 1JPJA 3DF9A 4AY6A 4H59A 4BFYA 1W6RA 2P1RA 3OPXA 2IV2X 5M04A 3R4VA 3KT8A 5CBPA 1WHSB 3G7NA 2CDRA 5CB4A 1CUBA 3VKFA 1DQNA 4YAFA 2AMLA 2W6IA 4GRAA 3T7JA 3NF1A 2YH2A 2KMLA 3S5JA 5C3MA 3LXUX 5FR1A 2JB9A 3HXMA 1I2DA 2SKDA 4IXNA 1EIZA 4IRUA 5F5LA 4HQ0A 1NRXA 2HSZA 2IC5A 2CUTA 4I5FA 4JL6A 2B3DA 4TTRA 5LYJF 1L8OA 5E7JA 2Q6TA 3IBSA 4DSOA 4OSPA 1ZNXA 3RTBA 3NVMB 5JCXA 4O8ZA 1SR8A 4OOEA 5H5JA 4RH1A 1FQJA 4LF9B 3JQEA 1DS6A 3IHYA 2A3RA 1NBMA 2YV5A 1E62A 1FA9A 1DC2A 4B3CA 3F1LA 4PLHA 4JVSB 5U1PA 4JI1B 1KDZA 5AK5A 3IE1A 3B13A 3O3CA 1ZD5A 4JD2G 1E66A 1T6ZA 4BT8A 2JPDA 1UN8A 3KIPA 5A6VA 1NKTA 1E64A 4CM9A 4KBYA 2DBZA 3VI4B 1KAEA 4J03A 1ULTA 4MKTA 3DWGA 4YREA 2CVFA 1PBTA 1SIUA 2F1RA 3FWYA 1RAGA 4D10C 2VZEA 3CHSA 4GOMD 3B2EA 4MQLA 5F7JA 1AT1A 3AO0B 3AZQA 5BR4A 1SVXA 2V7VA 5HCIA 2HHCA 3LSTA 3DZFA 3Q49B 3GJSA 2G36A 8GPBA 2JLUA 2VCHA 9LDTA 1OFUX 1YZ3A 2AOWA 3QG1A 1NR1A 2EVWX 3P9NA 4BDTA 2R2LA 2HNKA 2OCBA 1QG4A 1BH6A 4NE2A 3GWZA 1T9GR 4EGJA 3GYZA 1FNNA 3EQ9A 2BP7B 5LIRA 3QUAA 3ZDAA 2UYGA 3G2SA 3RS9A 4HB2A 4B79A 2QVGA 3TWRA 1MJGM 3ZQKA 1WF3A 4BWFB 4G2NA 1XRRA 4MVJF 2NTVA 3D6VA 2JC3A 3OZBA 2ZT5A 4ZQEA 1AKVA 2J4DA 3D31A 2QUAA 3KDSE 4K05A 5LUAA 5H68A 5GY7A 3Q4GA 4OAVB 4Q3OA 3O2QB 2BEKA 4OQMA 4KBFA 2VL7A 4X95A 4I1IA 2RARA 3B2QA 2CFUA 5A0VA 2GN4A 4W82A 4V0RA 3E6AA 2B2CA 5K0CA 3HTXA 3LYHA 1K6XA 4P93A 1RPAA 3PQCA 3SBEA 3AB7A 1PJ2A 1M2NA 2IEGA 2WM2A 3QXCA 4ZT5A 3AVVA 2ES4A 1SOMA 5C51B 1WDTA 3OPNA 1FRQA 1ZCJA 4LOIA 4FHKA 2ON6A 4M36A 3RU2A 5JNLA 5JUWA 2BGLA 2G8NA 4ETIA 3OT1A 3KQVA 3RWOA 2AI2A 1F60A 3HB1A 5KJKA 3PKJA 4HZUA 4AG3A 4A3SA 3O95A 5FHRA 1CDZA 2G0NA 1EFDN 5A6SB 4NATA 3ZCRA 2WZQA 3GN1A 4NENA 1BQ3A 3T7EA 5CMWA 4RK0A 2XBMA 4R9UC 5K8VA 3EH2A 4NYJR 2DY1A 2Z2ZA 3IPRA 2BFDB 1KDYA 5AYVA 2BKUA 3UB4A 2PNJA 4HDMA 2G25A 3S2SA 1YE8A 3UOWA 2R6CA 3L13A 2WQ7A 3QU4A 5SYAA 2BHSA 3FMVA 4ERXA 521PA 3ZDQA 4L2IA 2CHUA 5EPOA 5EJ2A 5HF9A 1Z0AA 4EQZA 2XAUA 4ISCA 3P4YA 1KTIA 1WW2A 1EVQA 3ENKA 3H2YA 2VPYA 3QENA 3KTAA 4MGHA 4W7SA 1L5YA 3BDVA 1CB7A 1J7KA 1Y3BE 4H1VA 1Y7TA 2FPGB 5L3QA 3D7SA 1CERA 4QUBA 3FTWA 1FC0A 2N0SA 4M1KA 4LSZA 3A2LA 1KE1A 4X71A 1IYZA 4EBBA 4B76A 4KUEA 4D8UA 4WLNA 1JXAA 5NULA 4BLTA 3IEXA 4FC6A 5SYNA 2A5GA 1XTUA 4XFKA 1U81A 3QF4B 5IKMA 3BIXA 4LCJA 3SMQA 2OMKA 2PFKA 5DX0A 3LVFO 4OHVA 1C7RA 2I7DA 3OUUA 3BWCA 4KRGA 3R3YA 4DMRA 2R7AA 1N0RA 4GLBA 4W9NA 1RFLA 2CUZA 1D8AA 2FZEA 4XVHA 3QEJA 4BV9A 2Y67A 4AZ3A 5CG2A 3QH4A 4CM3A 2XODA 2R79A 3BM5A 1NFQA 3PWZA 2CBXA 1FBTA 2QJRA 2VJCA 3AFIA 3LCCA 3WNBA 3SYTA 4OL9A 4YONB 5GVSA 3JW8A 5LQKA 3K70B 4L4YA 4O25A 2B4QA 2C96A 5CVJA 2PEYA 3A31A 1YB1A 2HADA 2XNDD 3KZ1E 5E2IA 2EW8A 2OGSA 2RSLA 3U0BA 3OBBA 2O3RA 4G5HA 2ZRAA 2CKMA 3VC3A 4K9PA 2BAGA 4INZA 4L5AA 1EM8B 5YASA 3KCQA 3UAZA 1HNXB 4BFSA 1XZLA 2ZUFA 9LDBA 4KN5A 1JQKA 2NVUA 3L1IA 1R4AA 1ISFA 2RK3A 4GKBA 1EP3B 5J63A 4AF7A 3WYCA 5JT1A 3QC1A 3K8OE 4ETNA 1NP6A 4D8WA 2Z8ZA 3FUVA 2I2XB 1FT1A 5KI6A 1AP7A 5TSDA 2Z58A 2VTKA 3OLZA 1LV8A 4X94A 3VKUA 4ZEWA 1RHKA 5BXUA 3WGKA 2V59A 4GBED 3IIEA 2KM1A 4UFNA 4GWLA 3AVYA 2Q5CA 1OSNA 1QH9A 4WZZA 4X85A 5KYNA 4Q96A 1Z0FA 2RHHA 3K70C 2V5UA 2J4BA 2ASVA 3U7RA 2TMKA 5TRTA 4ARCA 2UVPB 3OVMA 1DOAA 2J3JA 3K0FA 5F3RA 2VQSA 3CN7A 3MTBA 4B3TB 5ITVA 2VWGA 2VYNA 1K0FA 5FWYA 2WYIA 5EHXA 1A8SA 4LGMA 4C6TA 4TRQA 3JR7A 4RMGA 1LNSA 1E5LA 1KAMA 3WK5A 2G82A 3UC5A 4X3OA 2HV9A 1XK7A 3LX8A 3F4KA 2H2GA 4RA6A 3LWDA 3VAZA 4DR1B 3RRUA 4C0XA 2P4QA 2OZLA 2I2BA 2I67A 1STOA 1YCSB 1JI0A 2HC9A 1OI7A 4D8XA 3ROQA 2G6BA 1BNCA 3PEYA 3BK7A 4C5AA 2BGUA 4EKIA 4ZOLF 1KYIA 4CDRA 2B2NA 4U9UA 4CIBA 5CRIA 4RTOA 2EOAA 3ADKA 2PSSA 3LT2A 4DQLA 2ZIVB 1PY1A 3OOEA 3KZMA 4PC6A 1VL0A 3UMVA 2BHNA 1VSTA 4D8VA 4LV5B 1DIHA 5GINE 4EHFA 3UUGA 4NYJQ 3IAUA 4MQFA 3ZEAA 2B0CA 2I2AA 3O93A 2P0EA 4KR6A 1B76A 2OORA 5FBQB 5EZ6B 2VHJA 3HFSA 3WGVA 1LJUA 2XOKA 3ZY5A 3DLPX 2WU0A 3EDQA 3IDOA 2FFQA 1SA0A 1PJTA 4ZI5A 4A8PA 1C81A 2CVHA 2P9BA 3F9IA 2GPJA 1EUQA 1U1DA 5EN5D 2I1WA 1J2JA 5HM6A 4IDGA 7ABPA 4EY5A 2M32A 3TSWA 4YACA 5H83A 1PJRA 3NAQA 2E4UA 2FW1A 2QRPA 1LUAA 3KUKA 3H1TA 1P1CA 2IZ1A 4ZREA 3HI4A 3ESZA 1QHHB 3ZGNA 2JKZA 2EJCA 1I1NA 3JR3A 2VRCA 1YHNA 4AX4A 3RRNB 4M0MA 2OOEA 1BDBA 3SDSA 2ECPA 4INJA 3ABRB 2WJIA 4K9OA 3VR6A 5AUQA 4GOJA 5EVCA 3G89A 3W2TA 4WWHA 3PR3A 4D0GA 1U2GC 3MINB 1JFVA 2BOVA 4BYMA 4UDOA 1GG9A 4DLVA 5JAZA 3OWOA 1XXLA 3QLVC 2FWRA 2ZRDA 4LJLA 3LY5A 2FVXA 1KSJA 2I9PA 3IO5A 5CTJA 1RWMA 4ENUA 3I5MA 5MFZA 2P6MA 5HZMA 4H7FA 5AM5A 4UUPA 4G5FA 1G8AA 4MTCA 4QU9A 4BAGA 4O3FA 4J0FA 1ZEJA 4L15A 1D1SA 5ADWA 4ENPA 2UZ0A 3UCXA 1ZHOA 2QLLA 1F06A 3V79K 4RHFA 4CI0B 1SBIA 3VR4A 3JZAA 3JQ6A 4QPDA 1E2HA 1RQPA 3DZKA 4FFLA 1I0LA 3LI2A 4GVPA 5FT9A 1TUGA 3K2BA 3RANA 2PQ6A 5DTQA 1T5OA 4RS4A 1HU3A 5CFNA 3CS3A 3WHPA 1E2PA 2D1TA 1TL7C 3HP4A 5BMOA 1JFSA 4DK5A 2AE1A 1L8XA 1ENPA 3CKCA 5JAPA 2IDKA 3L8EA 3C4JA 2XRYA 5HKLA 5G0VA 1RJ9B 4RPCA 3WLOA 1Q77A 1PJ4A 5IT4A 4JLDA 3NRCA 4RIIA 1H2EA 1ZH2A 5CYFA 3IC5A 2RHGB 4YCCA 1XJ0A 4B31A 5EPUA 4OJQA 5DHSA 3ASYA 2CJPA 2VSOE 5E7MA 2R5FA 4XWGA 4N47A 1EFHA 4J16C 1KEWA 4GGPA 1GZ6A 5K51A 1NWCA 1BOOA 3MWLA 4KYTA 2KYRA 4JB2A 2QDXA 1TUBB 3C7DB 4CBVA 2VGXB 5GM2A 3LVRE 3ZJ5A 2ORED 3NZSA 1A69A 3GD5A 4JVSA 4R1QA 4YVQC 1E18A 2QGZA 2IYFA 1VCOA 4MV5A 5MN4A 5CT6A 821PA 2YZ2A 2FB9A 2R6AA 2NXNA 3STUA 2P7IA 2Y6UA 2JEZA 4K2AA 3BXEA 4RSMA 1RRKA 3GZ2A 1TI7A 5JFTA 2B9EA 3LPLA 3TIXB 2Q5IA 1W2WB 2ZT8A 4IDEA 3TNLA 2IP4A 3UAYA 4DV7B 2VH2A 1PJSA 2E0IA 2ZK7A 5KTPA 3KP1A 1IATA 4M21A 3VNAA 4CIWA 2LVBA 4ZAYA 2WBLC 3I9V1 1M2JA 2LKDA 4FMBB 3WLEA 3P45A 2ODAA 4D56A 3GWGA 3NYIA 5JS8A 4EJSB 4EKNB 3MBOA 3GFPA 1APBA 2EKBA 2FLVA 3KYJB 4GT1A 2J7PA 3F9CA 4NAUA 2DSTA 1HTTA 2QP3A 3PIRA 3LF2A 4N7RA 1K6JA 3RVBA 1UOOA 1TE2A 1E58A 5HZHA 4FFPA 1VB5A 3GGPA 4RY2A 4XE5A 2BP7A 3CVQA 1G7CA 1GVNB 4M9RA 1I3OA 3Q79A 2GM5A 1N4DA 2L42A 3C2QA 2X6KA 4DADA 4Y2YA 4A15A 1P8AA 4Q7JB 4CYMD 2EARA 5LWHA 3HADA 4GRDA 1T3HA 5LBTA 1GG2A 2C0CA 3FOEC 3VV2A 4MO9A 4ID3A 4U7WA 3EMDA 3KD3A 1DAFA 3DDWA 3FDXA 4NQ0A 3ETDA 2VDQB 1CYDA 2ZE7A 2CJFA 4FYHA 1P9LA 1LEHA 1XHEA 3IHLA 1DXHA 3PHJA 2GEFA 1P0MA 4WLEA 4CT0A 3N2LA 4YRFA 4KQXA 3LOPA 1VDYA 4IL5A 2FEOA 3KHSA 3RS2A 1DWPA 3HCWA 2D7DA 2W6JA 3AUKA 1SU7A 1HSZA 3DVLA 3GJ8A 3O1JC 2UVQA 4O2AF 5A6SA 2XQGA 1RYDA 4IZHA 4UMEA 1CC1S 3G6KA 3ADPA 3A1EA 2QDKA 1VPLA 1OWMA 1SG9A 4JHLA 4TMTA 4FGJA 4PIPA 4JR2A 3ZOZA 1OFVA 2DJ5A 3N2KB 5K4GA 1PHRA 4RFSB 3NC4A 4B71A 1LDYA 1ZOOA 2PMKA 3MJSA 2ZRKA 2OKCA 1MIHA 2NU8B 1AS3A 5BWCA 1E8ZA 4DOMA 4KBGA 3R0XA 3OLYA 4QXRA 2J3IA 2FPGA 1WBBA 3PD7A 4C3VA 4G5SA 1CLEA 3LU1A 3ETHA 3VISA 4UHCA 3EGVA 2IF4A 1YS2X 2O5EA 1MHQA 3HP7A 2PX0A 3E82A 5D84A 4ZZ0A 2DE0X 3I0ZA 4JU9A 1UT8A 2ZUTA 1OI2A 5CCBA 3QK0A 3CLKA 2PS1A 1OZHA 2PZ8A 4BO2A 3MSXA 1VPDA 4J07A 3QF4A 1I6MA 3PFGA 4AB1A 5DBKA 4G0QA 2FPOA 4JUIA 4UEOA 3RREA 1NIJA 4HVBA 2WMDA 5BMVF 5IRCD 2AQ8A 3GW4A 3ET5A 3FSEA 4YRJA 2HLPA 2VK4A 1Z6GA 1R88A 5KHOC 5HGJA 5L6MB 1VE7A 3DT8A 4DXDA 3PQEA 4EY3A 1HH8A 1BMFA 2HJWA 4LQDA 3OIDA 5EMHA 4FK8A 4UVDA 1KAQA 1XDUA 5HIJA 4LYGA 3D0OA 2EBFX 2EKPA 2O1XA 3E3LA 4IJKA 3HVJA 2QYUA 4FP7A 4L6CA 2GVNA 1MQAA 4NV0A 4UVHA 3H3JA 5JAMA 1IXRC 1NBEA 4RM2A 2IHUA 3ZDXB 1AKNA 3VPHA 1OF1A 1HTWA 2X3UA 1VIYA 3ASGA 1EM8A 4BO3A 1DB3A 1MOZA 4ZJUA 5DKFA 5ENZA 5A62A 3VUEA 5ANRB 5CXUA 4MW4A 5EJAA 4WK2B 4PLWA 1XVUA 3VPSA 1KP2A 3ZHOA 5K45A 4J1NA 4KW7A 1Y89A 4U2FA 3UM3A 4DANA 1POWA 3KQUA 1P2VA 1EDEA 1Q83A 1XRPA 2FFRA 1PSZA 2GSDA 1TO6A 1AK9A 4ZYLA 3BIFA 2V54A 1AUOA 4ARAA 2ICAA 4Q3BA 1QYMA 2F8SA 3AETA 2C7GA 1F8FA 4P53A 1JQJC 1GPJA 1EK0A 4UHBA 5CM8B 2IY9A 2UVPA 2AC7A 4ZYWA 2LTAA 4Y9UA 1EH5A 3UHAA 4J9VA 5H3CA 4JB0A 4FOLA 3A11A 2I3BA 1P1KA 2BMDA 3CGHA 3PZDA 1VRVA 2HEGA 3HK2A 3ROGA 5FTPA 3K16A 4TYQA 1EMDA 2H1RA 1QO0A 4N0PA 4G0PA 2YRXA 2YN0A 2WXKA 5EZ5A 1J5XA 3H17A 4RZXA 4O2BF 3CNLA 4MCJA 1USIA 4QJIA 4CF5A 3B6EA 3HYSA 1NAIA 2R65A 4JJAA 1TJNA 4BX0A 3B1JA 1BKSB 1MO6A 3CW8X 4QYMA 3T3HA 5HRAA 1E69A 1KNXA 4P7BA 4NSNA 2I5PO 3FUEA 1U7UA 4IWNA 4KACA 2C57A 5EX0A 2AUNA 5PNTA 5C8VA 1Z8DA 3OZ7A 3VGJA 4PYLA 3H1BA 4OAQA 1EFPA 1L0BA 3FH7A 2XNCA 1C1XB 1ID1A 3GP8A 3DW1X 5REQB 4IO0A 4NICA 4WOJA 2O8DB 4GMHA 3OJOA 4YLEA 2GOYA 3VTKA 3VKHA 4MP6A 1TC2A 1E4EA 3FNFA 4L5BA 4K88A 2UUAB 3CH6A 5DI3A 4M3NA 3KWJA 3BFKA 3WAJA 4UNRA 4N65A 1U2GA 2BD0A 4OHUA 4KGXA 3WBKA 4RC9A 3AESB 4MUXA 4Q9HA 3CQGB 3QLVA 3AIOA 3Q7RA 1ZR4A 1Q0QA 4CMHA 2H6EA 3IEPA 4CIXA 2FPXA 4NFLA 2CHFA 3GJYA 4PXSA 4HPWA 1KHTA 2GAOA 3DDUA 2OBNA 4Y0NA 2J3QA 3PQ2A 3VR3A 5FO0A 4RVHA 3F98A 2X0FA 3K5PA 3F8SA 4WLFA 3DZHA 1PJZA 4B2IA 5DBHX 3L77A 1GRCA 1Y6IA 2QNIA 5KNCA 1GKUB 1YUMA 3WTCA 4XD7A 2PD4A 3FR8A 1DBRA 4GF5A 3QVXA 3LP5A 3RFUA 4YUZA 3BD7A 2Q7DA 4PONA 3QBEA 3B6MA 4HH1A 3IA2A 2ZSDA 1Q7BA 2QTMA 5DTEA 3JPWA 3EVBA 3EK2A 3TJZA 4UHHA 1QFXA 3DH0A 3H05A 3A6EA 3ZD6A 1ZVMA 2DY0A 5JPCA 1AWCB 5BSMA 4ENQA 3ZU5A 4TSFA 3S1AB 2DUJA 3UBMA 1DXOA 5ALMA 3D5TA 3E7PA 3MJHA 2GCOB 3E8SA 1LBIA 1FJXA 1T5HX 4BTEA 2D2XA 1PLJA 5I9BA 2PX6A 1DBSA 5GJVC 4J16A 3FBWA 3G9TA 4I1PA 2FZKA 1L6RA 1X81A 3LUCA 2Z2IA 5CBPB 1Q74A 3R09A 4KV9A 2F48A 3A3YA 2ZP1A 1U3VA 2O1WA 4P08A 5CB4B 1I7SB 3PVLA 2OZVA 3USES 3D1JA 1ECLA 1NRWA 1QH1B 3UJ6A 2I1KA 1NQOA 2O20A 4IRUB 4DNFA 3TI9A 4LWQA 1T36B 5D1HA 1AHPA 1NVBA 4EH1A 1L1RA 4BU0A 1YR6A 3N2GB 4NG5A 5EYPA 2B37A 3I6IA 3WR5A 3QPDA 1BRMA 4C04A 4MI9A 5E8RA 5DBOA 4RQAA 4A8JB 3FETA 5CVUA 3AT1A 2LR0A 4JBHA 2XDWA 4TV9A 1HEYA 3UWMA 2H5EA 3JARA 2Y0CA 4IUCS 1TIKA 4CGVA 1G60A 3OZIA 4WDQA 1ATIA 1X3SA 2EHDA 4MVYA 3RFCA 4JGBA 5IAKA 4QELA 1E9CA 2IT1A 5BOSA 1U0TA 2VGXA 5TQVA 3T0GA 3UMBA 5AW4A 2X6TA 1Z38A 5LQUA 1O5OA 2WM9B 5F2EA 2R8BA 3TMYA 3JZIA 2DH6A 3SD7A 1BROA 4QVKA 5HTOA 5GTDA 3TG4A 5KUTA 4W5WA 1EJ2A 4Z4IA 3LOUA 2E82A 2DBRA 2NNLD 2L0XA 1QE3A 3HN6A 1YOBA 3G5AA 1NW7A 3VZBA 3HR7A 3KKOA 4I1UA 4NR0A 3WC4A 4M9SA 5E6RB 4E5VA 1E92A 3CLSC 3G9XA 4X7BA 2VAXA 2VA9A 3AUAA 4FYJA 3P9XA 2J87A 4CJXA 4XIFA 4Y6PA 5EWMB 3ND8A 2TRSB 1V3QE 1HYGA 3DMGA 3HDYA 3NBKA 3EASA 1T3TA 5J5AA 3NPMA 2D13A 1EGVB 4A8JC 1VRCA 3CUKA 2VHUA 4B09A 4ESOA 5BOVA 1QHIA 4NK5A 4GMLA 3KVYA 4CMBA 1KRHA 3I34X 1VKZA 4EJSA 1L7RA 2P67A 2X4LA 1A04A 1GILA 3H8JA 4FKMA 2QL6A 2FW8A 2A1TR 4NV1A 3PF8A 4GSLA 1M66A 2O2IA 1U0RA 3DAFA 3LWBA 1DO2A 4MAMA 1MENA 5DCUA 2WKWA 1GKLA 3IXLA 4YCJA 4EHDA 5B3AA 3VGPA 2A9OA 2EJTA 3CQ9A 3SC3A 1BJRE 5CDSA 2QE7D 1TUIA 3LXXA 2BJVA 1T2AA 2X86A 1F8XA 4XJVA 3A1UA 4Q7KA 3ISMC 4QDXA 1QQTA 2HYDA 1HF3A 4Z3KA 4RXTA 3HU3A 4FYXA 4IXMA 1C7ZA 4GI5A 3M6FA 4QBTA 2CLLB 5LKRA 2PZBA 5JEEA 4DG5A 1FFXA 1EFAA 3B3FA 3SGHA 3ASVA 1EJ0A 5JLAA 2R5WA 3CSDA 1E8XA 5TARA 3OT1B 4O4HF 1TPYA 5GAJA 4F1KA 4EG7A 2ZTLA 3TW8B 4L7QA 1Z34A 2VRNA 2YTZA 3M6UA 4OGFA 1TCUA 4JY7A 4HG2A 1OH7A 1QB7A 2PZMA 3W6PA 3BQMB 2F4VB 4GZDA 2XB9A 4ZVTA 5J1TB 4XQGA 3EGEA 1QYVA 3A1FA 4LA4A 4RIHA 1JECA 1RZUA 1TKCA 4HLDA 2PFGA 1N6OA 1HDYA 2C4UA 3RVLA 3E1GA 4N6OA 2GRNB 3VDMA 4PO1A 3I6BA 4Q01A 4HHEA 2EZTA 4TT8A 1R3DA 2C2LA 3BIJA 4Y2GA 4CTKA 5GIOE 3OXFA 2GJ4A 4I36A 2GCGA 4REOA 2EINE 3KTAB 1HDZA 3HCDA 5CGZA 3OZSA 3RFFA 5EMJA 2QJOA 4R98A 2O7QA 2O1EA 2YMPA 3GAZA 3TAXA 3DFZA 3GLFB 5CJ2A 1PZGA 3K73O 3M81A 2WMYA 2NU8A 2JRLA 1JB1A 1HDXA 1HOXA 2ZCJA 2XYQA 4WGGA 3QLUC 2UUOA 1L5JA 4PZAA 1DQPA 2ZWIA 4LJYA 4A55A 4OH7A 5LSAA 4PRZA 4Z9YA 3O82A 1J2YA 3E35A 1T10A 1VYUA 1Q2XA 3QV1A 3L7KA 5KVAA 2GGFA 1FMFA 1WM1A 3BBPA 1H0HA 1RJFA 3FUDA 5DM2A 2XSZA 3CPEA 2IHTA 4AZ3B 1KZPA 1ID8A 4DLZA 2C20A 5EE3A 4WFKA 3L0CA 1WUHS 4NH0A 1THMA 3FPLA 3UINC 5HS0A 1QQBA 2D1FA 3CHPA 2ZJ6A 1XEFA 4Z7JA 3T7AA 5E3IA 3HHPA 1M2KA 1J0XO 4OLBA 1PT7A 5B1YA 1TM3E 3AF2A 1Z0SA 3TDMA 3CCBA 4I55B 4JBNA 4RJLA 2EJUA 3UWPA 5FCDA 2GPBA 3RKRA 4Q34A 4A0SA 4I9NA 2R62A 1MW8X 4DMHA 1A2QA 2IH4A 1V2HE 4GPMA 4GS5A 4RV9A 1ONBA 3DT9A 1YRHA 2EATA 2NVUB 2AF4C 4XOIA 5GZ1A 3OXLA 2FWBA 4HNGA 3W9YA 3U9WA 5EUCA 2IITA 3RO3A 1O0SA 2V0GA 2QPTA 2J9GA 2O2ZA 1PV2A 2X5JO 3PUVA 5EIBD 1FP4A 5JXHA 4G01B 2ZI3A 3H5WA 2P9NG 3EWIA 4LC9A 2O50A 2AJLI 1Y3AA 3IOCA 4F71A 1X8XA 1DOHA 3FBTA 3EHRA 2B35A 2J6BA 1U7ZA 2XJ9A 3TVTA 3DZJA 3ZZ0A 3E3NA 3KEMA 3BFJA 2BFOA 5EN4A 1PZMA 2ZRBA 3R9KA 5AW6A 4ER5A 2HNBA 3IEVA 1X70A 5EXPA 3K0FB 2R00C 1KI8A 2BELA 3CKKA 1QK3A 4COOA 2NG1A 4DRXA 4HNUA 4DV3B 2IBTA 3PYMA 2MYNA 3USZA 5L3SB 2R6ZA 4C6TB 2ZRHA 2B1GA 4J0DA 3SR3A 1XYVA 2QR3A 4AKHA 1DC8A 1VQ1A 4Q9DA 1NW5A 1U0BB 2QRNA 2NTYC 4CMKA 5K0GA 3PDNA 2R8YA 4JOQA 2ADMA 5BQ3A 1UJCA 4RA6B 3ZYZA 1R5NA 1U4SA 1SIOA 4EB8A 2F0YA 3HB7A 2OHJA 4O6VA 2BR5A 3THWB 1W5BA 4YR7A 3M2TA 2CZQA 3R7QA 3FOCA 4DEVA 3IT0A 1XTJA 4JL8A 2QM8A 3CM0A 2C4MA 1GTVA 4R51A 2XYRA 3QHQA 3ZJ4A 1TFRA 2E37A 3TIIA 2ZISA 1P4SA 1PJLA 2H9IA 3DYIA 4EY8A 1RHMA 3GIWA 4RU1A 4EGFA 4C4PA 5FUYA 1H66A 2R6FA 4F5YA 4H6XA 2GPWA 4PR0A 4RKQA 2FE1A 1H2XA 1OGJA 1KJYA 1C1XA 2C8JA 2P3SA 4BB0A 3PNTB 3KS9A 3BCRA 2N75A 3C3MA 5KTRA 1L7MA 2O8DA 3BE8A 2X0NA 4RX1A 3O2SB 5IJAA 3UY4A 5AK4A 4RFLA 4UTOA 2GW1A 4K0RA 4QXPA 1SA0B 4KKXB 2FPWA 3FXAA 2GETA 3MGAA 3RVPA 4GC5A 3WKDA 3HU5A 1DNPA 3UJDA 1XZBA 2PL5A 1OXJA 5H7PA 3UB2A 3WGHA 4Y67A 3AESA 3ZX4A 1ILEA 2FK8A 5KWVA 2YZNA 3IEGA 3MS4A 5SICE 4DJ5X 3UG7A 4DQKA 4ATNA 3EU9A 4G0NA 3SK0A 1DAPA 4YP6A 3H5AA 4YXWD 1NI4A 1AS0A 5EJEA 5CA1B 4C0KA 2WWFA 4HBGA 3BT7A 1LF0A 3S55A 3CF4A 5E1BA 1MX2A 1DZ3A 3AHEA 5CT4A 1MYOA 4EFLA 4DJTA 1LY1A 3EPJA 1PTJA 1L4KA 5J2UF 2P8JA 1G20B 2PWPA 1XMVA 3GROA 4BYGA 1SBNE 1VA4A 2ZI6A 4CM6A 2H4YA 3NO4A 2Q4TA 3II6X 2VP2A 1Q0UA 2PRYA 4LF6B 3ML1A 1DAGA 4OLFA 3GLFE 4LSZE 3L4KA 1QSGA 3ISJA 4YJGA 5A02A 1JP7A 1V71A 2E4YA 1TO2E 3RIYA 4NP6A 3B6IA 5I4BA 1JQ3A 1RYZA 1P8JA 1Y37A 1E9VA 4A9AA 1QVWA 3NV9A 4HGZA 2FSIA 4ON9A 3T4XA 2H5JA 3FWKA 1VL5A 3ZPXA 3C45A 3VAYA 3PCXA 1L5GB 2RE8A 1R8YA 5EJ6A 2HK8A 3W8FA 5J4LA 2V74B 4UCXA 1EDOA 4B45A 3IO3A 4IIHA 5DBEX 4FMCB 3WBJA 3M83A 4H18A 4QPCA 2XQKA 2PGIA 3MJVA 5JQGF 4YNDA 4RVUA 2I4MA 1YL7A 1QH1A 4IFTA 1JR3E 3COSA 3OOSA 2YWFA 2H1FA 2R7KA 1T36A 4LCEA 4MR7B 1J49A 4BMVA 3R2JA 2DWOA 2IYEA 1YTUA 1WB5A 5KBYA 1QMPA 1BEEA 3N2GA 4D4KA 5IZCC 2FMFA 5CURA 1QLHA 4BO7A 2B20A 2UYHA 1N3LA 4LKRA 3H1EA 4D9EA 4BTVA 2PEZA 4A8JA 5BXOA 3F49S 3SS9X 4EZEA 9GPBA 4R8LA 5E38A 2WWRA 2IYWA 1D0IA 2PWYA 4YY3B 1RWOA 3QVWA 1CJBA 3Q98A 4A23A 1RIIA 2B25A 5A4AA 1N2JA 3LFHA 2PU7A 4MQEB 1H8HD 4F2GA 3PQ8A 3FZQA 3MBIA 4CMIB 3BE5A 1WQ3A 1FXSA 3B36A 3TEFA 5AENA 4FEAA 4I3HA 4BGVA 3VZRA 2RHLA 1N57A 1UIRA 2WM9A 3NBUA 3OMLA 2C00A 1FNCA 3SP1A 2CNNA 4LXYA 4QTYA 4KIUA 1B2RA 1NNUA 3OH8A 5CEJA 3KPUA 3EPHA 3DBHB 3FCXA 4KFTA 3HZRA 2IOSA 5E6RA 1COWD 1S2NA 3PRZA 1E96B 2O7VA 4BQPA 4BLQA 4Z2YA 1GPAA 5EWMA 3N6XA 3H8VA 3A6HA 2DCPA 2JIBA 2OR3A 4OBWA 2OXIA 4F9GA 2VTDA 4XIJA 1ZXXA 3D43A 4Y6GB 3CF0A 2VYVD 1UDCA 3JQGB 4ZHQA 5TQ2B 4FJ2A 1TAGA 1OCEA 3OZVA 1JDSA 5T3YA 3NHPA 3NXSA 4FI3C 4WINA 4A5OA 3VBCA 3U39A 5BNIA 4YMHA 3MIIA 3MC1A 4URUR 4KXWA 2WWGA 5B4UA 2NSYA 2JJ1D 4Y2UA 1PZEA 3A10A 3WB1A 1N9GA 3KUUA 1SM4A 4B40A 3WWZA 2ZWPA 3WGQA 2JI7A 3JYOA 4RK6A 2QR2A 2PUEA 4EFNA 2PLAA 4EEZA 3DL7A 2GF2A 2Q27A 4W9RA 1TQ8A 1HE3A 1U8FO 3VZDA 4X60A 4OX9B 3OP4A 3OT4A 3SYMA 2BBTA 1B7GO 4INPA 3HNPA 3EUAA 2PPVA 1U7OA 1Z7YA 3MCVA 1ZS9A 3PVSA 3RJMA 2ZG6A 4EX7A 4FJ1A 3K05A 4L4RA 3NAMA 3B48A 4DA9A 1TTQB 3INRA 4FINA 3AZOA 1LBSA 3PFHA 1W87A 5HKKD 4KAJA 4ZYYA 3E9MA 4DR2B 4J2TA 1SHTX 1NN0A 4RDHA 1RXEA 5CDYA 3KVRA 2CE7A 4EG0A 1CEYA 1EVLA 1A50B 3TW8A 4R54A 1Z33A 4HS4A 1MDBA 2VPQA 4OI2A 4DMCA 2MSKA 4HS9A 2YS7A 2JI9A 2DH5A 2AKAB 4INOA 3QLUA 2ZI5A 1K1EA 4TV8B 3WA7A 5TJHA 3WLRA 2Z08A 3QE4A 5DSZA 1B93A 2H9AA 2EWMA 1DBVO 3TR6A 3S8EA 4F9TA 5JD5A 4C9BB 4XKBA 3L1HA 4L4ZA 2XVXA 3ZZNA 1B1CA 5G04C 3LLSA 4E5PA 3OFJA 4R0VA 2O3JA 4PGAA 5EJ9A 3NHSA 4XM2A 4RQIA 2QVBA 1G20E 3KDPA 2QYOA 4Y1EA 3EOBI 2IXBA 3LKZA 3UW1A 5KVVA 1BWRA 2JFYA 2XI4A 1MX5A 4K0KB 3LZDA 3GLFA 5FOXA 4LS3A 4DQUA 3DHEA 4FB4A 1VJCA 2GRAA 4YT5A 2MWMA 5DF1A 2QTLA 4GM4A 4BGIA 4KN8A 3X1ZA 3QE3A 4XXHA 2QNBA 1JCSA 1N2GA 3V46A 3LPDA 2HPZA 4JB8P 2W2PA 4LRXA 2OXCA 3C7CB 3WQQA 2Z6QA 2GZSA 1KSGA 1YZVA 5BNZA 4D4LA 4OX9Y 1YK1A 4DY4A 1YBMA 1WY7A 5TMBA 1OYVA 1PJQA 5JBNA 3RF7A 5BPFA 3LY7A 1G4UR 3BKXA 1LTHR 1ULSA 5I7HA 2PCLA 2EKDA 1JR3A 4X91A 2E5WA 4DZZA 2D2EA 2V5VA 2IOHA 1JT2A 3RSSA 3RARA 1PLLA 1MC8A 3KFXA 2NN3C 3G5LA 3DPDA 3LSYA 1FNDA 2WG1A 1WUKS 1I10A 3RJ9A 5LN1A 1XVVA 4HNQA 2Z1MA 1N11A 1XR3A 3PTAA 3D6TB 2R00A 3IMCA 5J58A 1G9TA 3RHFA 4I55A 2O14A 5DN6A 4BUJA 1TK2A 2J6CA 2XE6A 1O95C 4WNYA 1FXWA 3DMHA 4AKSA 3AS4A 3EW7A 3PNYA 2R96A 2ACKA 3Q9NC 3OQPA 1O1TA 1TJ5A 2O8VA 4G65A 3P5BA 3ZBUA 3KJXA 3OI7A 4MYCA 1JQAA 4C4ZA 1QANA 3HU1A 3NVKI 5E75A 3OLWA 1JEJA 3LRXA 5JRZA 1RAEA 3AR3A 3OURA 1RWPA 8ADHA 4GX0A 4ZZ2A 2BF4A 3B9BA 4E2ZA 1GCOA 5CFZA 2QT9A 3WJAA 4R9NA 4BZPA 3PGMA 4P7JA 3AETB 1BH2A 4RUKA 2IYOA 1IAQA 4L07A 3CV0A 4B8YA 4MJLA 5JARA 3BFVA 4HAXA 4U2GA 4TKVB 4DM7A 1VMAA 1FS4A 4PX3A 2LUOA 3OAAD 2WD9A 4YAOA 3CX8A 1PT8A 4CQJA 5L3SA 3GVXA 1SXIA 3PZ4A 3H3FA 2X0JA 4EKGA 1BC5A 4M1EA 3UKUG 4D7AA 4PY2A 2B69A 2RG1A 2JFNA 2EJVA 4C7OA 1QONA 2H6HA 3THWA 1NUHA 4L76A 5DZSA 3TBKA 4QICA 4FX2A 1PL8A 1EHYA 1GGEA 4M87A 1XN4A 4OMFG 2Y66A 1E79A 4MLCA 4N18A 3HGTA 3CXUA 1YAJA 4NJMA 2BC9A 1SCQA 1EFPB 2WJZB 4CG0A 3LEWA 2X2PA 4QM7A 5FTKA 4NZ9A 4L74A 1FCHA 3NPAA 3OY7A 4OFXA 4PRYA 3ZV6A 1KQOA 1E4EB 3IAHA 3ED5A 3C74A 1UODA 2GN9A 3OJLA 4UHKA 5DI3B 1B0AA 5A5VA 3E18A 4C4SA 3BH0A 2FI1A 5JCOC 3PR2B 4A1GA 4J49A 5CA0B 2VO1A 4HSEA 2ZJ0A 4OUDB 2YBDA 4CE6A 2P41A 4DYVA 2HR1A 1FYDA 1WUTA 1VIDA 1Y1SA 3IALA 3KT6A 2HXYA 2P0YA 1Z5GA 3O8OA 5DNWA 2ID9A 1QWOA 4EGAA 2WNSA 4BTLA 1A82A 3LWNA 3QLTA 1SUSA 1PSDA 1EFLA 2YJTD 2KBFA 1ESZA 3OZGA 2BM1A 5SZHB 1EQ2A 4CDGA 1SVSA 3BWVA 2M9MA 2WT9A 4P5EA 5JH7F 5LIPA 2K7ZA 4DG9A 4ESVA 3WG7E 4K03A 1NF8A 3EXG2 3CZ9A 3SKYA 5CA1A 1J97A 5K3EA 3COYA 2HM8A 1Y33E 4DSUA 5FPSA 1G20A 3AG4E 3KJHA 2GRPB 4NKRA 2DAPA 1SW6A 3U37A 4C78A 3AP1A 2I66A 1JWGA 3U3XA 4MZXA 1X19A 1M5TA 2I22A 4YK7A 3LRTA 3G0OA 3HXPA 2GK6A 5LQNA 3O75A 4XA8A 3MJEA 2ZR0A 2O7RA 3KV1A 3M1IA 5C52B 1H1DA 3AP2A 4W63A 2YS6A 5IZCA 3R3UA 4IS3A 2G06A 3KEOA 1OWNA 4LV6A 3M6WA 3CBGA 4TXNA 1V1MB 4TXQA 2XLBA 5DIFA 4F85A 3QFSA 5INTA 3DDSA 1L7EA 1JBKA 2AEJA 1KFKB 1N2XA 4N0EA 3MM4A 4B3RB 2FEPA 2XQ0A 4XKCA 4CL8A 2O8EB 2I6TA 3ZDDA 2KBXA 4IVQA 4ANVA 4DIOA 3CF4G 4KFRA 4DVGA 5ALIA 4QASA 3OHPA 4YJFB 1IY8A 2QEQA 5EYPB 4TXHA 5DYTA 1LDMA 1KA9H 2C2OA 4FFNA 2FA9A 5AKEA 4F21A 3K1AB 3V7YA 3QJ5A 4MR7A 5FI3A 2PL9A 3KE8A 4JYMA 3FP3A 1O9BA 4TV9B 4Q3CA 3DEYX 3JARB 5L51A 1P17A 1TYCA 2WKPA 3CTPA 4QOFA 4ZDWA 3KPWA 3F6BX 5FOQA 2NIPA 5DSXA 5CLLA 5BOSB 4CKBB 3KBOA 1UN9A 4EUNA 1FS6A 2PMWB 4D0LB 2VHVA 2JS7A 1EAYA 3ZXYA 3LBAA 2CF5A 2DFNA 1BD3A 4CN8A 3K92A 2D1SA 4Z9AA 1PNTA 2WD8A 2JRCA 2AS0A 3EVCA 4MQEA 1K98A 3DEPA 4CMIA 1M1UA 4UTXA 4PX9A 1HM5A 4MWOA 2CMDA 1HMPA 4FVTA 1OD6A 3C5CA 1P6QA 3I9MA 3TNFA 1TD9A 4O29A 1E20A 1TR4A 1JE1A 3OM8A 4FNAA 4BV3A 1XCPA 2FUG1 1K2VN 1ZCZA 3TR5A 4QBHA 1RXUA 2UY1A 2JLXA 1XX6A 3N39C 2E89A 3SU8A 3F7NA 2AQKA 2C4HA 3DBHA 1J90A 2A3NA 3RRXA 2G77B 4LG6A 1Z4KA 1DO8A 3GG9A 2BCJQ 4FHEA 3BYZA 4XWWA 2C9BA 3DQZA 1LRKA 2AEFA 2ZJ8A 4DQDA 2ZRQA 1E96A 5EZQA 1T4BA 5FP0A 3NRJA 1ECJA 4JQCA 2A0UA 4LECA 10MHA 3VYWA 1D4AA 3A9VA 4FYYA 3TPFA 5GPBA 4TMZA 3D9KA 4E46A 3CKYA 3JQGA 3OSZA 5TQ2A 3EBOA 1LQ2A 3QU7A 1G6Q1 2PUHA 2BL4A 2JA1A 4L02A 4LZPA 3EGWA 3TWXA 3JQQA 3KR0A 3UWKA 1OZFA 4A36A 1A72A 5E9AA 4WUVA 2D7JA 4BC0A 4XUEA 1LNQA 2I7XA 2GHQA 3KB8A 1UIMA 4ZALA 1IPFA 4IXWA 3FW1A 4ZQCB 3H4IA 5H16A 1LD7A 2VPPA 1B8PA 4R2LA 4L0MA 4NFSA 4K5AB 4OG2A 4R1UA 3VO2A 5C32A 3U4AA 4ENWA 1OC2A 1HXIA 4KXMA 4FTWA 2JI8A 1YACA 2VYFA 1FFXB 1I6WA 4BKUA 5B3LA 1GG8A 2GLUA 2JAXA 4AW9A 3KXPA 5JDIC 1NMYA 2Y4OA 1WB9A 1ZRNA 3BSWA 1U3DA 1EK5A 1P39A 1JQ5A 4RPLA 3U3ZA 3ND7A 1ZNYA 1LJ8A 4C30A 5EMMA 2P8SA 4IM7A 1UBUS 1W4LA 1N0WA 4JUFA 2D62A 4ZEMA 1YB4A 3RC8A 1E5TA 2FN3A 1OPRA 5LU8A 1GO2A 4MKGA 1BDMA 4QU8A 1XDSA 2OB2A 2ZYSA 1T8PA 5BSFA 1EB8A 3H2GA 4U02A 1H8EA 5CYGA 3EZFA 2A5EA 3HR8A 4TV8A 4GPIB 4WT7A 4PS1A 5HTKA 2AI3A 5JS6A 3N8NA 1AKWA 1RYNA 2GXAA 5HG0A 3NI2A 5DM0A 2IEDA 2ODPA 5F78A 4F5EA 4B0OA 3UTDA 1UBRS 3BKWA 1JEYA 3GFOA 1S2DA 1GZDA 1XZEA 3ESKA 2H18A 4OLAA 5K8TA 1NX9A 4UQPA 3RTAA 3HABA 3MW8A 2NO1A 3BG1B 4C9BA 2AR0A 3GELA 1P5JA 3AJ9A 2ONCA 5TPZD 2ZT7A 1AKTA 1UM9A 2FPKA 4D81A 3OO1A 4R9RA 2CG2A 1I30A 1G5PA 2PKWA 1R00A 3WBFA 1EHIA 4QRIA 1RR6A 1A5AB 2PL2A 4KDFA 4O4IA 5H1YA 1R16A 3ASNE 1NSYA 1O58A 2PM8A 1X94A 4WACA 3CK9A 1B73A 1O95A 2DEUA 3HYLA 5ALGA 3CU5A 2HA3A 3AM5A 3VJLA 5CVEA 1F9EA 3ZIDA 4AYTA 3Q9NA 4ARUA 5TF4A 4N2SA 3D0RA 1L4UA 4EKEA 3U44B 3BQNB 4UHEA 3S1SA 3L7DA 3VR4H 1DUVG 4U00A 1N2CB 3V8QA 1CUYA 1QBGA 3CWCA 1QK4A 3SSMA 5IKOA 5K0FA 3CQCB 3R3WA 2DF8A 1GQQA 4UBKA 4X5OA 3KKMA 3D8HA 1RM0A 4F0JA 4PHFA 5F9FA 3PC6A 1T4CB 2YIJA 2AW6A 3DUWA 3LIPA 4M1QA 3ICEA 4YCBA 3QGMA 4IINA 4YWJA 2WSMA 1SCUB 2W6QA 2VZ0A 1X7ZA 2FF5A 4LOLA 2V3WA 2PGDA 1JXMA 2CVPA 2OCPA 1FP4B 4L9SA 3VR5A 3UWSA 2WUEA 4QNNA 2YWBA 1O03A 4DBZA 2X0IA 1SG6A 3ZCXA 4FMPA 4YAUA 1EGMB 4B0ZA 3EHQA 2IHYA 4LOHA 4CQLB 1HE8A 4X54A 2JANA 1LI7A 4I50F 2HFJA 3DDOA 3HB9A 1EP9A 3Q7EA 4I17A 2QIPA 5B4VA 1E99A 1H6DA 2PV0A 1VGRA 4P4NA 1EDDA 4DRXB 1OV6A 4Y7CA 1RNLA 2IUEA 3KQKA 4P29A 1GQSA 1CQWA 2NZYA 4U63A 2Z1NA 2Z1DA 4P3YA 3DXFA 2PNNA 1XQXA 5GONB 3LKUA 4TKVA 4ZV7A 3ZWMA 4WY5A 3WMWA 3TXNA 1W46A 1QHNA 1K4YA 1EVIA 3D2CA 1ACJA 1DT5A 3S7FA 4YV2A 3BA6A 3MEQA 5DB4A 4C6SA 4D74A 3LC0A 1PG5A 4QJ3A 3ILHA 5JCOA 3EOZA 4LHXA 4JP8A 3BGSA 2YXEA 3V4PB 3B51X 3GZSA 1ADFA 3L0BA 2QTBA 4HADA 3ENZA 2WB4A 3ELWA 1ULAA 2I2FA 2JHGA 3PHBE 1O6CA 1TNDA 2PJZA 5KNDH 4DJAA 2ZIUB 3KWFA 4EQ6B 4O6FA 3EGCA 3VH3A 5L9AA 2C8LA 1EWRA 1X1BA 5EUQB 2OBYA 3AG5A 2A1UB 3DE5X 4Q1FA 3AKZA 4QARA 5DYNA 2CFZA 2FLWA 2GNPA 5BT8A 4IMPA 3MJDA 3LA8A 2WWWA 4EB0A 2Z56A 3TLZA 3GJRA 1E63A 5EIHA 4GA0A 4YNBA 2C2BA 2PUWA 1KZ7B 1V95A 3V31A 4D5GA 4O1PA 2FUG6 4FGLA 1I4EB 2OP1A 1XZKA 4HRXA 3FNIA 5CA0A 3DOJA 4N0QA 1T1JA 3I9V6 3I3SR 4OUDA 2YZ7A 1AA6A 3QEMB 4YTEA 5I7SA 1AGNA 1TAQA 3ZU7B 2HPHA 2IIVA 4EG8A 1SGWA 3WRWA 3KSRA 1EWVA 4DTIA 5LDGA 3VA7A 3WK7A 3WL6A 1KU0A 3L4JA 5FF9A 3Q73A 1NI4B 2H11A 3Q6MA 2V6JA 1G2QA 3ZGZA 5JVDF 1SU4A 3GLUA 4E3WA 3CNHA 2YC4C 2NVBA 5I51A 2VA8A 2WKQA 2CWWA 1K86A 2P78A 1W0KD 3GJ3A 5IY5E 3JU3A 4QVGA 4IG9A 4IMIB 1AHNA 3MXOA 5SZKB 3I05A 4AKTA 1XLUA 2HF7A 1ZK0A 3OOHA 2IPLA 3QE2A 1LBHA 4Z1MD 3LT1A 1WVMA 3EVTA 5T4EA 2HZ7A 2GKSA 5AHRA 4X6LA 3Q2KA 4NONA 3ES9A 3L7IA 5B1DA 4YJGB 5K09A 5FI5A 4M86A 3IQHX 2GWRA 2OBXA 1FFSA 2NO6A 4Y3UA 1KO8A 4OXKA 2WPVA 2JLSA 1D2RA 5ECGC 4U0UA 2EQBA 4O08A 3MFQA 2AOVA 4FC7A 4L0CA 1SZPA 3L16A 4TKMA 4RV5A 1YA6A 3ZKAA 4W7IA 3HXQA 3JQCA 3OOYA 4MZDA 2ZDQA 1V1MA 4B82A 2VUSA 3M4JA 2QUJA 3RAEC 2H51A 4L78A 4K9SA 4RTLA 3WL5A 2O8EA 1DWQA 4GTQA 1NA0A 1N2CE 1Y6JA 1EKXA 2C4WA 3NBNB 1C2TA 4FQ7A 2LO6A 4J91A 2FHSA 4EMSA 4RA9A 4QC2A 2ZQZA 1ZGJA 2GZ1A 2PGXA 3DJFA 1WW8A 3I62A 3GA0A 2NW6A 4EHLA 4XWTA 4YJFA 5E4YA 1ZSNA 5KTNA 4Q93A 1U2EA 2HJGA 4EVIA 4NAHA 3DC7A 3K1AA 1FMJA 4H27A 3GFFA 5DHFA 4F4HA 1G19A 2A8YA 2JAWA 1N2ZA 4HNHA 4RG9A 3KU4A 4FGSA 2BKEA 3ZWPA 3GR6A 2XCOA 3EVAA 3ZHBA 5JJIA 4OGGA 1JFLA 3EX7C 4DCMA 1AS2A 1KEPA 4XFJA 4FFRA 4CKBA 4UM9D 4BX9A 1W2HA 3WIEA 3AEZA 4FFDA 4LW8A 3CNOA 3OTQA 2Z8YA 4E85A 4X3PA 3ANMA 1KE2A 3H84A 2AXZA 3BK1A 4RNDB 5HP4A 3RU9A 4YJ3A 3GFBA 2R03A 3HUTA 4W9MC 4UBJA 5B7PA 2ONYA 4N41A 3TLBA 3X1DA 2BFNA 4UUNA 2XUGA 4E03A 3G8AA 2X0EA 4KOEC 4O4LA 4Y2HA 4U0ZA 3G5UA 5JHGB 2HO1A 5TS2A 1YBFA 2XZTA 2GJSA 4JJGA 4E14A 1EDUA 1Q1ZA 3R7LA 5KVCA 4DPMA 3I4RB 1IXKA 4DRXE 1SHJA 5KTYA 3FMOB 3CG4A 4H31A 3TTYA 4POOA 4KH0A 2A0KA 1KDVA 4ALIA 3PJEA 4YBRA 1WPRA 2EXXA 1Q92A 4IDCA 3HKCA 2WJVA 4ZHQB 3TPCA 4IIVA 3ZI7A 4AYWA 4KG7A 2RGAA 1M54A 4BS9A 1OLOA 5J9FA 3RYTC 1D9ZA 5JDIA 1ES9A 2AF3C 2ZAMA 1A96A 4ZK6A 2OD2A 3OTWA 2J8SD 4FHDA 5D87A 3VVMA 1N9GB 2ZBUA 5K3OA 3MWEA 3NWBA 4XI9A 1E2KA 1H2BA 2GB4A 3P0JA 4KQKA 1JTVA 4LYHA 2NUAB 1TYEB 4GQAA 3NGXA 2QRZA 4IHJF 4ZQIA 2A4KA 3ROPA 1PNOA 2GBCA 3PHIA 1IYGA 3CLRC 1O1YA 2ANCA 1IPEA 2IPNA 1OU0A 2WUGA 2FN9A 3RNLA 3GX1A 4R6WA 2G8LA 1P4HA 4QWMA 5EG5A 2ZRGA 1A9ZA 3KQNA 1UK8A 5T4FA 3NEPX 1SXQA 2V4HC 5EFOA 3I09A 4OU4A 3T3MB 4Z7QB 2VPXA 1CIJA 3SFZA 1KJNA 2VAWA 3G2IA 4HH3C 1GNQA 1N6PA 5JHAA 4YAIA 3FUMA 2X0KA 4GFDA 4BFZA 3U81A 1YQUA 4GOND 2C5GA 3JWEA 3H1AA 1WZNA 1ZIDA 2B5OA 2JFPA 1J7JA 4DV4B 1JT9A 4OI0A 2HGSA 4KP7A 5GOTA 2Q8PA 3N28A 2QPAA 4ETWA 4FS8A 3IURA 2FNAA 2C5BA 1XCMA 1QRUA 2XEEA 1NBOA 3QOXA 2WVHA 2RHCA 5JU6A 4Q18A 1HL3A 2I76A 1JLMA 3MB5A 2R84A 2C7VA 1D6MA 3KR2A 4FADA 3KQWA 3STTA 5HIAA 3WFJA 2BSXA 5HKAA 2LPMA 1SQSA 5DYWA 3L7MA 4TUYB 4M9XA 8AT1A 4E70A 4FFVA 2D2FA 4UE6A 4HLEA 4KLAA 1XCJA 4PZLA 4FLBA 1MJNA 3E37A 3HJNA 2WXRA 5AJLA 3B9RA 3QBDA 1WXDA 5FJIA 1X15A 1K3UB 5EIOA 1YA4A 4CNBA 1AM4D 3CE9A 3UXGA 1MX9A 4BT9A 2DQ4A 1W47A 2W6ZA 3V1NA 1BHJA 2R5NA 3DBLB 3E5MA 1Q15A 1R6AA 1L7XA 2R4UA 1X7DA 1YL5A 1XWFA 3PJFA 5M72A 4OP1A 2HIAA 1G9SA 5LCWJ 2VUIB 1GFZA 2HWWA 3LPCA 1TJYA 5ED4A 3FPFA 2REBA 1N1EA 3CUWA 1HK7A 4NY1A 1GDDA 1QHEA 4M4SA 1T6NA 2J7KA 5ALVA 2R1VA 4TYPA 5ITWA 1E7MA 1Z3YA 3AR2A 3U44A 1PVOA 3V34A 4B2YA 3IR6A 4MW1A 3DEAA 2W6NA 4GLJA 3UV3A 1N2CA 4XJTA 3ERCA 3BEDA 4DV2B 2JFZA 1U6KA 3JAWB 1ZIXA 3SZLA 3T1YB 2QZSA 2CNBA 5AM1A 2ACEA 4JU8A 3F96A 3ZI0A 2G1PA 2DWUA 1XDZA 4N49A 1A1SA 3EWNA 4Q7MB 1T8UA 1L4BA 3HVEA 3H83A 3KAKA 3TO5A 1T4CA 4B8CB 1OXUA 3ACBA 3NCHA 3CV3A 1MTOA 4XSHA 4O4JA 4HXYA 2VTEA 1JAXA 4QYSA 1P1FA 3AG3E 1SCUA 5AKLA 4L6AA 2BMJA 1ZUD1 4EGSA 1LDEA 1JHDA 3TB6A 3SEAA 2IYAA 2R1UA 4B87A 2Q4BA 1YS6A 1CPYA 3B82A 4ONEA 2IUYA 2OCIA 1CP3A 1X8JA 2OMEA 4CIVA 4BTAA 2AZMA 2DG2A 2ZRNA 3SKVA 4XYMA 1E7VA 3LGSA 3WIOA 1J9GA 4ZI3A 3B1FA 2CGEA 4BLRA 3W5DA 1MTZA 2QLFA 4Q4JA 4RIGA 4RF4A 3SD5A 4CQLA 3HZZA 1HF8A 1DAEA 4Z2AA 3B89A 3DMFA 4PGGA 4DDWA 2W2KB 2C9DA 4CR8A 4ZKEA 1TNBA 1R0XA 4QUJA 3NHBA 4UFOA 4QNRA 2B6NA 1EVZA 1CUCA 1KMQA 5GONA 3TXYA 1FDRA 3MELA 3ZNOA 4TKZA 4LHSA 5I6DA 3FNQA 2H9YA 4K5QA 2IY0C 4MRUA 1VI6A 3SJZA 2B82A 4G0OA 1R6XA 1RTKA 1E8NA 3H1GA 4DM3A 1QHSA 2Z2KA 1YMQA 1JVBA 5DEIA 4C7OB 2WPDA 1SHUX 2HDNB 4IILA 5JIBA 4AJPA 1Z74A 5HRCA 1GCUA 2A7XA 1FRNA 1IH8A 2Z3WA 1N78A 1ZJZA 1TYZA 2KCKA 2J5RA 2JFFA 4DNPA 1AN0A 2H4WA 2WZDA 1E5DA 4ZAFA 2HV8A 3TE6A 4X7RA 4NBUA 1Z6QA 1UBFA 4NJMB 2FF7A 3OM0A 4WY8A 3A3PA 4FONA 1LK5A 3LPZA 4EQ6A 4YRKA 1KYXA 3EAFA 5K01A 2W2TA 4JSTA 5HUJA 4UOQA 4I6EA 4UHFA 4DA6A 3T9AA 1M5UA 3H7IA 1ABFA 5M7EA 1ZAYA 2A1UA 3VKGA 3IQXA 3W06A 3I9NA 3M7IA 4PLZA 1H5UA 2BH9A 4QQIA 2UYOA 4GMDA 1TYAE 3O8OB 4KVGA 1IBRA 4RTSA 2BGKA 3A32A 4IIYA 1DELA 1OW3B 3CIOA 1IHGA 2XNDA 1ZJYA 1XHLA 3QE0A 4C0WA 4NCAA 1LQTA 3QEMA 3LG2A 1R0RE 4RSYA 3IIIA 3BL8A 4B89A 3SZMA 2FKNA 1ZOLA 1ZJJA 4JD5A 3KTDA 3DKKA 2H52A 2J0UB 2EQXA 2OUIA 1OT8A 2BIFA 5JJ5A 4IDOA 1MJGA 1QX4A 1EVJA 1F1BA 2XQJA 1US8A 3S4YA 2Z4TA 2IV7A 3P0HA 1AUQA 2WDZA 2ZJBA 2Q0XA 2WVGA 1J42A 1XRSB 6ABPA 4CTMA 2GAJA 2H7XA 1CRWG 4EJFA 3IQDB 4OCZA 1ZD1A 2G70A 3BHIA 4EG3A 3RU0A 3LCMA 4H60A 2WHEA 2BGWA 4EO4A 2FRVA 3SIRA 3BPSA 3IHTA 1PFGA 2V45A 1QQAA 1OBOA 5GGXA 2FCAA 1GFWA 1W0JD 3OTOB 1B41A 1JHYA 5CVDA 1L7NA 2HA5A 3AX6A 1UJJA 2W7TA 3U4IA 5LZ7A 3S7ZA 1SD1A 3C3CA 1KAHA 3IPLA 3EFOB 4HZGA 3G2WA 1R6TA 2WXQA 3JUIA 3DMPA 2RK6A 1NY5A 1USKA 3FI0A 5TVGA 3RODA 4S1PA 3GJ5A 3VR2D 1IQUA 2Z6VA 5JCZA 3RVQA 1EFVA 1IY2A 4C0AC 4RM3A 2C4VA 2YV3A 5A4KA 7ADHA 3UJ9A 1QZZA 4QU5A 4JJ7A 3WDLA 3EDTB 3DSUA 3QJYA 2VKQA 1G3MA 4ZRDA 5E8JA 4PSUA 4QOSA 1WAMA 2B5VA 1IJFA 1MR3F 1FTWA 4KO4S 4DX7D 3L7AA 3BIWA 3PC4A 3TTVA 2WIFA 3TFWA 4MPDA 4C21A 2QL7A 3WLQA 4J94A 5HQTA 3K4QA 1AUXA 4JC5A 3EYAA 1KR2A 1T5TA 3SJ7A 2F1IA 1SZCA 5CRVA 3ZHCA 4ACLA 1YDEA 3D4IA 3NUQA 4AICA 3KYBA 1K7CA 3IVCA 3K15A 5TMDA 2DTEA 3I9JA 1XTTA 3SX2A 4EO9A 4GMGA 2WTUA 1JMVA 3IQFA 2GCNA 1ZJWA 2UY1B 5TDHA 4HDQB 4AURA 4YRZA 1BYUA 4UQXA 4B4UA 3L6DA 5FUBA 4PPNA 1U0SY 1YR7A 3QYFA 3C85A 4L95C 2DBVO 3NQPA 5F7XA 4GZLA 2HWYA 4F7WA 2OV2A 5DGHA 3LQ4A 3EXHC 2DULA 1GWNA 2ZIAA 4JIGA 2PUBA 3TQSA 2ZBRA 1B3BA 4CEIA 2PZEA 1JX6A 1ZI6A 1UPFA 1PYGA 4BQSA 3NTRA 4WVFA 1NNLA 2QLMA 1N94A 4HAZA 3DRAA 5EEGA 5DWVA 1YQGA 3AF6A 4KYIB 3IOYA 4KN9S 2I8LA 1ISJA 1CDDA 3IMFA 3ADBA 3I1IA 5CRUA 4BWYA 3RHSA 5GWXA 4IIXA 2C2GA 3FH8A 2AXPA 2NUAA 1LZLA 1WLYA 1GL6A 3R76A 2YYAA 4MK4A 4M0FA 4L23A 2DKOA 1ZISA 2M98A 2XZTG 2FSPA 3DMRA 1CUJA 1V9CA 5IJWA 3RAGA 3KYIB 1YI0A 4G56A 5DHAA 3WNZA 4KC0A 5CBNA 1B0PA 2POCA 3AC0A 2ZITA 3PGLA 4P31A 4QJ5A 1GPBA 2GTPA 1WEKA 5L7WA 4Z1OA 1PNRA 1SCJA 1G8PA 1J5EB 3G68A 2KATA 1USVA 1NJ8A 3LL7A 1E2IA 1L4NA 3N0VA 4NPCA 3GFRA 1XAGA 4DX1A 5KOYA 4MUBA 4TQGA 1V8FA 4H17A 4CLEA 3K8ZA 3D0KA 4NCNA 5FQ7A 4S2EA 3ZJVA 3ZIAD 3TLMA 3AH8A 1JJIA 3T3GA 1PI3A 4Z68A 4UCWA 3ISVA 4XEUA 1JEYB 2VQ3A 1C9JA 4HBDA 1C9DB 3DEOA 2PVCA 5C8YF 1DIRA 1I33A 2XV1A 2KCLA 3BXZA 3GZ4A 5TJ9A 2IJGX 2G71A 4TUYA 2PHZA 2GCPA 3KJGA 2QJFA 1R0WA 4OVKA 1L5ZA 5LC1A 1M6HA 2DYSE 1UM9B 1AE1A 5C7YA 4YP5A 5I7WA 2WMNB 1PZXA 4O4IB 1KQNA 4LUNU 3CVNA 3R3VA 3JD0A 3N7TA 1PK7A 3ZU6A 3NVAA 4JKYA 4RVFA 4FSDA 3DHVA 5F5NA 5SZIA 3EEIA 1V48A 4I5GA 4N03A 1SKQA 3T9KA 4LZNA 1TCVA 2OT3B 1XL1A 2O4UX 1E98A 3JUEA 2V4LA 1FL9A