1X81A

Farnesyl transferase structure of jansen compound
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Design, synthesis, and activity of 4-quinolone and pyridone compounds as nonthiol-containing farnesyltransferase inhibitors.
pubmed doi rcsb
molecule tags Transferase
total genus 103
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1x81A00
1X81A 4YDEA 3PZ3A 1TNOA 1O5MA 1TNBA 4YDOA 4LNGA 1S64A 3PZ2A 1MZCA 2ZIRA 1TNYA 1NI1A 1O1TA 3Q75A 3E33A 3HXCA 1TNUA 3E30A 1FT1A 1JCSA 3HXEA 2H6FA 3EUVA 1LTXA 3Q7FA 2H6IA 1TN6A 1FT2A 3KSQA 4GTVA 1KZPA 3DSVA 1QBQA 3PZ4A 3DSWA 3DSXA 1NL4A 4GTTA 4GTRA 4L9PA 4MBGA 4LNBA 4GTSA 2BEDA 2R2LA 4GTOA 1TN7A 1SA4A 1TNZA 1FPPA 1LD8A 3DSTA 1N94A 1JCQA 2H6GA 1LD7A 4EHMA 3Q7AA 3DRAA 1N4QA 2IEJA 1N95A 2ZISA 3HXDA 3SFYA 1TN8A 3HXBA 1S63A 1N4PA 3KSLA 1SA5A 3PZ1A 1O1RA 4GTPA 3C72A 1D8DA 1N4SA 3E32A 1N4RA 3SFXA 4GTQA 3Q73A 3HXFA 3Q78A 1JCRA 3DSUA 2F0YA 3E34A 3E37A 1N9AA 3DPYA 2H6HA 3DSSA 3EU5A 4GTMA 1O1SA 1KZOA 1DCEA 1D8EA 3Q79A
chains in the Genus database with same CATH superfamily
1K8KG 1OCCE 2XHEA 5FZQA 3QOUA 2A5UA 3NQPA 2P9LG 2GRPB 2CFUA 4TRQA 3ABLE 3IV0A 1BLXB 3FUEA 3HVEB 4ABNA 2KBXA 5KWDA 2MOWA 3EHMA 4MS6A 3ZU7B 1FT1A 4J8DA 2J9QA 2KM4A 4G11A 3CHPA 3EHRA 4D10C 2AXZA 4U8YD 3KSQA 5FINA 4DX6D 4FHJA 3FTZA 3PH0C 1TYQG 1NL4A 3APCA 2WXJA 3P1UA 2WXGA 4FP7A 4FJYA 4CRWA 3CQGB 4ANUA 4J8SA 3L9TA 3LS8A 1N95A 3JQ1A 3C3RA 2JLBA 2WXQA 5CMYA 2Y4TA 2HO1A 2KXPC 2DWZA 4AV7A 5C1DA 3APFA 1FVHA 4B89A 4Z68A 4I9EA 4E85A 4H7XA 4MKTA 2EQXA 4KXKB 4JPSA 1KPSB 1B89A 4K03A 3TWTA 1OCZE 3CHRA 2HR2A 3UX4A 4QFVA 1O1SA 1Z5SC 4C0MA 4DX1A 3EIQC 3PUJA 1O5MA 4HFGA 3GW4A 1ELKA 3G2TA 3SZ7A 3RRUA 3FU5A 4H7YA 1TNUA 3GZ1A 3CVYA 3FUNA 5KJLA 5EX3A 4UWLA 4PS7A 3CK7A 5EKQD 3C5RA 1GW6A 1E7UA 3ZGQA 5ENRD 4GTOA 5AIJA 3L08A 5ENSD 2WQ6A 5HKPA 2IF4A 1P5QA 1N94A 1E8WA 3CHMA 4U0ZA 3FUIA 2C0LA 3ASHA 2CG3A 3ZRHA 1JWGA 4A1SA 2R59A 2FO1E 1SW6A 5ENQD 4U0UA 2V8SE 2FBNA 4UQYA 4DX7D 2QZAA 4N3BA 4PH4B 1BI7B 1E8YA 4U07A 5AQ7A 1MX6A 3IHVA 4GA0A 1BI8B 1HF8A 3Q73A 4G2VA 3B7RL 3DSUA 2XZDG 5IY5E 5A23A 2I1KA 4HRNA 3ZPJA 1PAQA 1OY3D 4JEHA 3UT7A 3F6QA 1OWLA 2WM9A 4N3AA 1X81A 4AOFA 5EIBE 5CBNA 3SQVA 3QWPA 4XIFA 3NAWA 3CVUA 1Y6IA 4AVXA 3FEYA 4GYWA 1MYOA 1Z6TA 1OCRE 1DNPA 3EIJA 4E6HA 4LNUD 3RRNB 3HXEA 3FP3A 2AXVA 4AP2A 4GB9A 3LKUA 2YNQA 3FTUA 2XS1A 3FULA 1DC2A 3R7RA 3TG5A 3RU0A 3FH8A 1INZA 4WUYA 4UWHA 3CK9A 2R05A 4F53A 4JVSA 3QDNA 1LD7A 5FTPA 5HI7A 4DI4A 3D9MA 3QWVA 2WB2A 4J0UA 5ARFA 4ILHB 2LSVA 2YHEA 2LO6A 4O60A 2L9BA 5FZSA 4GCNA 2QYUA 4IULA 3ESLA 2PL2A 4GAAA 1JCRA 1NZNA 3RJVA 4DUIA 3QC1A 4C0EA 2XEHA 2A5EA 4EQFA 2IY0C 2PZIA 3G2UA 2IO2C 2DYSE 1YMPA 3CVNA 4LNGA 4UQZA 1BD8A 4ANXA 3KEZA 4BWRA 3ZXSA 3C3OA 2IO3C 1N52A 2UWJG 2HYZA 3BU8A 1HH8A 1EYHA 4I6EA 3EUVA 3HIZA 3MCXA 3QKYA 2WXRA 2LNIA 3PRZA 3SHFA 3U64A 2CHZA 3DSVA 2DYRE 4DRXE 4YDYA 3ZUVB 4RVBA 3RKVA 2R2LA 5G05J 4PS3A 4IYPA 4MLPA 2E0IA 2QC9A 3MZLB 1JCQA 5JHBA 5AQAA 2LXMA 3AS4A 2XGSA 4G25A 5LCWJ 4KYOB 4RG6A 3BEEA 1N4PA 2UY1A 4GA1A 2VGYA 3O4ZA 2IOSA 3Q4AB 3PZ1A 1W3BA 3IXEA 5ARGA 3OXLA 1D8DA 3RRMB 1N0QA 1KT1A 3FFLA 1N4RA 3T8KA 2IONA 3EHQA 3HXFA 3Q78A 1QNFA 3CHOA 1HX8A 4N5QA 1HS6A 3S2AA 4GZ5A 3TWWA 3HHMA 2QFCA 4LRZA 3RAUA 1WM5A 4G1TA 3LY9A 3JCKC 3PZ3A 4APFA 4KBQA 1TNOA 4LSZE 3LJNA 5A7DB 4HLLA 4GMLA 4JC8A 1N11A 4ACKA 3CVPA 3RK6A 2VTBB 4EBAG 4C48B 3CIAA 5D0QD 3FUHA 4HI8A 4BSZB 1IQUA 3C98A 3LEWA 2X6FA 2XRZA 2LUHA 4Q96A 3B13A 5ITZF 2X6HA 3UIOC 3FUMA 4CEMA 2VJ8A 2XPYA 4AXHA 4A3VA 5KNHD 2H6GA 2OOEA 4I6JA 3TWRA 3HG0D 3CSFA 3R9MA 4BT9A 5FQ8A 4ATZD 4U8HA 1NA0A 1N4SA 3TWUA 2EIKE 4U63A 4GCOA 1DVPA 4PDXA 3CKCA 1KLXA 2X38A 3V2OA 4ANVA 3FDHA 3ABKE 5G55A 2R02A 4YDEA 4DJAA 5HRYA 1H6OA 3QARA 3DWLG 2UY1B 1IHBA 3CKBA 4EECA 3FTSA 4J8FA 1NP7A 1HG5A 3O48A 5CMWA 2FULA 4F1SA 3UM2A 1TJCA 5FIOA 1OWNA 2BKKB 4BERA 5EYPF 2KCKA 5FQ4A 2Y1LE 1KT0A 1UG3A 1KZPA 3U9WA 4TUUA 1QZ2A 3L16A 4FULA 3PZ4A 3IBEA 5BV1A 1D9SA 4MBGA 2AW6A 4KZ0A 3SI5A 3SNXA 1MHQA 4I1OB 4KMOA 4K5BA 1WY6A 2QY7A 4G8LA 3D9OA 3BG1B 3ZXPA 4G26A 4F7AA 2WQ7A 4FLHA 2WPVA 4HQDA 2V4HC 3UM1A 3KSLA 2RFAA 3PE4A 2IQCA 1IKND 3L17A 1ZU2A 4U7EB 4HI9A 4GTQA 1QYMA 4FJZA 2ZU6B 1G3NB 2P9NG 1FVFA 3MKQA 3QB2A 4BTAA 1N9AA 4JL0A 4JA9A 2Y4UA 2F8XK 1K3ZD 3ULQA 5JMND 2XEVA 3B7SA 2X3MA 3IHYA 2FF4A 1OXJA 5J08A 3C3QA 4YDOA 1E96B 1TJFA 4HXIA 2P9KG 4I17A 3Q75A 1RZ4A 1H6PA 4GMJA 2FO7A 4AIFA 4U96D 5KCMA 1FT2A 2NSZA 3VLDA 4BX9A 3TJPA 2QYJA 2KZTA 1UJJA 2A4ZA 4B94A 2EIJE 2NC9A 1U3CA 1ELWA 2C2LA 2IFUA 2L6BA 1TN7A 4UWFA 3B7UX 3CVQA 1FPPA 2BTDA 5FJYA 1S0PA 4LEUA 1WAO1 2WXIA 3CV0A 4WNGA 2YHCA 2B6CA 1TN8A 3FUKA 4NURA 4LCTA 4OYSA 2IOLA 1VDYA 4C9BB 2J49A 4ME2A 4FADA 3QJZA 4W9RA 1X5BA 2V5QC 3J5PA 1H0AA 2J8SD 3UMVA 3ZEFA 4KVOA 5J90A 5E75A 3JUIA 2M63A 4A55A 2V5FA 1KZOA 1YA0A 3ASNE 3LXUX 4J8YA 4BTBA 3GZ2A 2E2EA 5CCLA 1HO8A 2I6HA 2RFMA 4PUCA 2KC7A 3NB2A 1OWOA 4XZ4A 5CCMA 3CR3A 2R5SA 1HXIA 2MHKA 3AG3E 2GROB 3V31A 3T9KA 5ENOD 3ZW3A 2YINA 3RO2A 1JCSA 3MKQB 1V55E 3UT4A 2Y69E 3LPZA 1TN6A 2PNNA 4CT0A 4GTVA 4I2ZA 1E8XA 3HYMB 1SZ9A 2J4BA 3TWVA 3KAEA 4CZ2D 2VSNA 2BEDA 2CHXA 3NOGD 3PNTB 4N39A 4FLBA 4YVQC 3MJWA 2WMNA 4RG9A 5D0OD 3MX3A 3DRAA 3HRAA 2RG8A 3Q9NC 3D9NA 2KZTB 3CVVA 2VGXA 4BT8A 2Y3AA 4DI3A 3ML8A 2J07A 3MV3B 4HVBA 1O1RA 2MYOA 1ZBPA 2NXPA 3ASGA 1BU9A 3OAWA 3E32A 3PREA 3R7QA 4CCAA 2FEZA 2P9UG 3SFXA 2AXUA 4O1PA 1UN9A 4LG6A 1IXVA 3ZVVA 3EDTB 3LCAA 4X8QA 3L54A 4EZKA 2H6HA 5AQ9A 5CERB 3ZIMA 2Q7FA 1XGWA 1IHGA 4UQXA 5ENNA 2WXHA 3W9GA 2VTBA 4UUCA 5FWQA 4FU3A 4I1MA 1E90A 1TNYA 4DPRA 1O1TA 4GPMA 4XE0A 5AN8A 3KD7A 4UI9C 3ZYLA 2DCPA 3UKRG 4JHRA 2H6IA 5CBOA 4KZCA 4FHKA 3DSWA 4UI9J 4ZHBA 5FZRA 4HLEA 4XKCA 1TNZA 4I6GA 5B1AE 3SBTB 5BXOA 2WXMA 3QAQA 2KCLA 5BT1A 1EF1C 1ZB1A 3NOCD 4GYYA 4ILGA 4DK5A 1OUVA 2ZISA 5B3SE 4ILIA 3MA5A 4I2WA 4DX2A 4HB5A 3QWWA 3KEAA 5KNGA 3FTVA 2XEEA 3D9KA 1EDUA 2XZTG 4F1PA 1H2TC 2P9SG 2GRRB 3G2SA 2XENA 1Z3XA 5AYWD 4J6IA 1YCSB 2I9CA 4GTMA 5CRUA 2OCCE 4GMRA 5T8IA 4K5AB 4PS8A 1SZAA 2V4LA 4MRUA 2VGXB 1SVXA 5CEDB 1TEZA 5CEAA 4HS2A 4LUNU 2ZXWE 3L13A 4GZ6A 5BNWA 3DXKG 3LVRE 1FCHA 1Q2ZA 2GRQB 1IQRA 5FT9A 4L9PA 3U4TA 3V30A 4F6RD 4GZCA 2EINE 4N3CA 4GTSA 3IEGA 4F3VA 3ABME 5C2YA 1LD8A 3DSTA 3JQ0A 2WXNA 5FQ6A 5BXUA 4BSXA 4CT4A 3EJNA 2RD0A 1MQSA 3PNLB 1N4QA 3ZYKA 4A3TA 5A6CA 3HXDA 2ILRA 5LP0A 2L6JA 3D9LA 2RKKA 4XEIG 3UPVA 4JB8P 2DZNA 2I1JA 2BKGA 4CDNA 3C72A 2XGMA 3FH7A 3R9AB 5EIDA 2F0YA 3Q9UC 3Q5MA 1UOHA 3SBSA 2PM6A 4NIKA 1MX4A 2OVBA 4KT6B 5B1BE 5LOZA 3OXGA 3JXJA 4FA6A 5H7PA 3RIBA 4R7LA 3FU3A 1MZCA 3FHEA 4EZJA 5CECB 4RSYA 3GYZA 3D9JA 2B0OE 2VGEA 3ZHEA 4HBDA 4RLYA 3LY7A 2WXKA 1UW4B 3Q7FA 5JJ7A 3SY2A 2GW1A 3VTXA 4G8KA 1WDYA 4UI9K 5AAOA 3OXFA 4FC8A 4AY5A 4AEZC 3FEXA 1HE8A 3TL5A 2NYJA 3IKOB 3Q15A 5T3RA 4HOTA 5FQ7A 5EX0A 2VYIA 2IEJA 2XQ0A 3AU5A 2MRIA 1S63A 2WXOA 1QQEA 4ANWA 2OV8A 3D9PA 4K0RA 1OWPA 4I43A 4YNDA 5ENTD 3UIPC 2JABA 4CYMD 3TXNA 3FTXA 3SD5A 2F8YA 2AVPA 4L7TA 1ELRA 3CSTA 3NBNB 1D8EA 3Q79A 2X6IA 5EN5D 1RW2A 1OT8A 4U95D 4CDRA 5BPPA 4Y6WA 1S64A 3APDA 3I5PA 3PDNA 2KATA 2ZIRA 3PS6A 2DVWA 3B7TA 2ONDA 2AWIA 4XI0A 1AP7A 4V3IA 1LTXA 4U04A 3W9FA 2ZGGA 1AWCB 3ULYA 1JPLA 1U3DA 3ZNGA 4EZLA 4TXRA 1A17A 4GZDA 3NF1A 3P2BA 2WQHA 3FH5A 3TXMA 2R17C 3FU0A 4HNAD 1MX2A 1E7VA 3FTWA 4P29A 3Q49B 3T8MA 3UXGA 5G2NA 3Q7AA 3ZHEB 2J08A 4B0ZA 4ACLA 3S7DA 2P58C 3L22A 2XRYA 3CVWA 3NZUA 3MKRA 3FU6A 2EIME 3LVQE 3PUKA 3ONLA 4YVOA 2DIWA 4L2YA 4L2LA 3E4BA 5LFAA 2PM7A 1UJKA 1UN8A 4A63B 4LERA 3FUFA 5CHEE 3Q47B 3VTYA 1HZ4A 5JHAA 3CEQA 3SO8A 1K1AA 3PEVB 5KJKA 2X6JA 4QQIA 3UT8A 1H6KA 2XCBA 5JJ6A 3SGHA 3PZ2A 2LAHA 4URKA 4JZYA 1SQMA 3E33A 1K1BA 3HXCA 3PZDA 4N2QA 2HM8A 4EBAA 1JUQA 3AG2E 3FTYA 4J7WA 5DIZA 4BETA 3S7FA 4AY6A 3SF4A 3CHSA 4M7CA 5KJNA 3WXXA 2LSUA 2CHWA 5E76A 3FY4A 4NACA 3AS8A 3TAXA 4GTTA 4GTRA 3T5VA 2VSYA 4JHJA 4XI9A 4I9CA 2J09A 1WG0A 3RSEG 3ONKA 5BW8C 2WXLA 3G2WA 1U2VG 4AM9A 1OWMA 2JEKA 3VLFA 4UWGA 5DBKA 1PC2A 4Q69A 5JJTA 3ZKJA 3CHQA 3L6AA 3DBSA 4J8EA 3UKUG 5EILA 4BY6A 4O1OA 3EHNA 5BUZA 2ETCA 4HRLA 4HOSA 1HG2A 3JUEA 5HQ8A 4KVMA 3CLJA 3WG7E 3AU4A 3K9IA 5LX8A 3DEOA 3EU5A 4UWKA 2XGOA 5HS0A 2BF0X 5D66A 3AS5A 3LY8A 2WXPA 1H2UA 1NA3A 4K5CA 4TV3A 2WVIA 3QNKA 4CDMA 2ETAA 3UUXA 4WWOA 4N5CA 2KCVA 2ETBA 4ZFHA 4JEUA 3TWQA 3JXIA 5D2MC 3L82A 5AARA 1YYHA 4OAUC 3TWSA 4Y6CA 2P9IG 5JA4D 2ZGDA 5M72A 5ANLA 2WMOA 2OEVA 3CK8A 1NFIE 2VQ2A 3U3WA 3D9IA 4DX5D 4LNBA 3B7BA 3DXMG 2X6KA 4NQ0A 4BEPA 3MGBA 1OCOE 4ATGA 3RO3A 3PE3A 3AG4E 4TXPA 3D9HA 1H19A 2LAIA 1DCQA 2XCCA 2OEWA 1N0RA 1Y8MA 2DBAA 2YQ8A 1HFAA 4I1AA 5ANRA 3SFZA 5T4YA 3ESKA 1H2VC 3V2XA 4U0SA 1Z3YA 2BUGA 4B93B 4Q94A 4U8VD 4OVVA 3I4RB 3JYSA 4JHKA 4L1BA 3TG4A 3EU9A 2GGFA 1MJ0A 3ZYMA 4BFRA 5G05C 5G04C 2GRNB 3X2QE 3BQOA 2P2CP 3CVXA 3AJIA 3ASOE 5AJDA 5LCWC 4B8CB 3FUJA 1NI1A 2PQRA 3ZN3A 3ENEA 2XPZA 4HOQA 3E30A 3MYVA 5BV0A 5G04J 4BX8A 3AG1E 4AJWA 2LXLA 3BG0B 4DLQA 4RQIA 3PEUB 2VSOE 3DEPA 4L23A 1QBQA 3DSXA 3TGOA 3FWVA 1JWFA 2GRMA 2Y0BG 4JD2G 4GPKA 2CG2A 4JA7A 4OVUA 3NZSA 3UI2A 3ZYQA 4GYOA 3S7BA 3FUDA 1SA4A 4HORA 4EPZA 4GZ3A 2IU1A 4NRHB 5KBAA 3LJ3A 4EHMA 2FI7A 3QK0A 3LYAA 3MV2B 4WWNA 1LF8A 3SFYA 3UM0A 2F37A 3HXBA 3J5QB 5KJMA 3ASFA 2XS8A 5AJLA 3D3MA 3BUAA 2VSXE 4M3OA 3UINC 3UM3A 3S7JA 3MEKA 3UTMA 3G2VA 3HVEA 3OTNA 4WAFA 1IYGA 5ENPD 3E37A 3HDXA 3GZSA 4WNDA 3AAAC 2WXFA 5AENA 2OVFA 3DPYA 2CFZA 3DSSA 2PQNA 4CGVA 4WNFA 4GA2A 3I3NA 4IRUA 2DZOA 1L5JA 2XPIA 2L0IA 4DLOA 3U66A 1S70B 1TNBA 4OAVB 1N54A 3CVLA 5CRVA 3VLEA 3CGHA 4HRMB 2IJGX 1HU3A 3PVLA 4G23A 3TWXA 1E8ZA 2H6FA 2HE0A 4B8AA 3I4GA 5EDSA 2EILE 3V79K 4G24A 4WWPA 2C0MA 1A5EA 3LDZA 4HOUA 2V0PA 3DPDA 2P9PG 3ML9A 4GU5A 1XNFA 4IN3B 3ZFWA 2I2OA 5EYLA 2L0TB 2R03A 4CGWA 4TUMA 4O6FA 1V54E 4BESA 4JW1A 4N2SA 1EPUA 2J4DA 3T5XA 1BPOA 4TXQA 2AJAA 2GRLA 3ASDA 1SA5A 4APOA 3URZA 4GTPA 3UQ3A 3ULEG 3B95A 4JXTA 4WNEA 4XX5A 3N71A 3CQCB 3ISMC 3E34A 4A1GA 4XKBA 4YDWA 3KS2A 1PY1A 5AQBA 1DCEA 1TR4A
chains in the Genus database with same CATH topology
1X81A 4YDEA 3PZ3A 1TNOA 1O5MA 1TNBA 4YDOA 4LNGA 1S64A 3PZ2A 1MZCA 2ZIRA 1TNYA 1NI1A 1O1TA 3Q75A 3E33A 3HXCA 1TNUA 3E30A 1FT1A 1JCSA 3HXEA 2H6FA 3EUVA 1LTXA 3Q7FA 2H6IA 1TN6A 1FT2A 3KSQA 4GTVA 1KZPA 3DSVA 1QBQA 3PZ4A 3DSWA 3DSXA 1NL4A 4GTTA 4GTRA 4L9PA 4MBGA 4LNBA 4GTSA 2BEDA 2R2LA 4GTOA 1TN7A 1SA4A 1TNZA 1FPPA 1LD8A 3DSTA 1N94A 1JCQA 2H6GA 1LD7A 4EHMA 3Q7AA 3DRAA 1N4QA 2IEJA 1N95A 2ZISA 3HXDA 3SFYA 1TN8A 3HXBA 1S63A 1N4PA 3KSLA 1SA5A 3PZ1A 1O1RA 4GTPA 3C72A 1D8DA 1N4SA 3E32A 1N4RA 3SFXA 4GTQA 3Q73A 3HXFA 3Q78A 1JCRA 3DSUA 2F0YA 3E34A 3E37A 1N9AA 3DPYA 2H6HA 3DSSA 3EU5A 4GTMA 1O1SA 1KZOA 1DCEA 1D8EA 3Q79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X81 A;  4YDE A;  3PZ3 A;  1TNO A;  1O5M A;  1TNB A;  4YDO A;  4LNG A;  1S64 A;  3PZ2 A;  1MZC A;  2ZIR A;  1TNY A;  1NI1 A;  1O1T A;  3Q75 A;  3E33 A;  3HXC A;  1TNU A;  3E30 A;  1FT1 A;  1JCS A;  3HXE A;  2H6F A;  3EUV A;  1LTX A;  3Q7F A;  2H6I A;  1TN6 A;  1FT2 A;  3KSQ A;  4GTV A;  1KZP A;  3DSV A;  1QBQ A;  3PZ4 A;  3DSW A;  3DSX A;  1NL4 A;  4GTT A;  4GTR A;  4L9P A;  4MBG A;  4LNB A;  4GTS A;  2BED A;  2R2L A;  4GTO A;  1TN7 A;  1SA4 A;  1TNZ A;  1FPP A;  1LD8 A;  3DST A;  1N94 A;  1JCQ A;  2H6G A;  1LD7 A;  4EHM A;  3Q7A A;  3DRA A;  1N4Q A;  2IEJ A;  1N95 A;  2ZIS A;  3HXD A;  3SFY A;  1TN8 A;  3HXB A;  1S63 A;  1N4P A;  3KSL A;  1SA5 A;  3PZ1 A;  1O1R A;  4GTP A;  3C72 A;  1D8D A;  1N4S A;  3E32 A;  1N4R A;  3SFX A;  4GTQ A;  3Q73 A;  3HXF A;  3Q78 A;  1JCR A;  3DSU A;  2F0Y A;  3E34 A;  3E37 A;  1N9A A;  3DPY A;  2H6H A;  3DSS A;  3EU5 A;  4GTM A;  1O1S A;  1KZO A;  1DCE A;  1D8E A;  3Q79 A; 
#chains in the Genus database with same CATH topology
 1K8K G;  1OCC E;  2XHE A;  5FZQ A;  3QOU A;  2A5U A;  3NQP A;  2P9L G;  2GRP B;  2CFU A;  4TRQ A;  3ABL E;  3IV0 A;  1BLX B;  3FUE A;  3HVE B;  4ABN A;  2KBX A;  5KWD A;  2MOW A;  3EHM A;  4MS6 A;  3ZU7 B;  1FT1 A;  4J8D A;  2J9Q A;  2KM4 A;  4G11 A;  3CHP A;  3EHR A;  4D10 C;  2AXZ A;  4U8Y D;  3KSQ A;  5FIN A;  4DX6 D;  4FHJ A;  3FTZ A;  3PH0 C;  1TYQ G;  1NL4 A;  3APC A;  2WXJ A;  3P1U A;  2WXG A;  4FP7 A;  4FJY A;  4CRW A;  3CQG B;  4ANU A;  4J8S A;  3L9T A;  3LS8 A;  1N95 A;  3JQ1 A;  3C3R A;  2JLB A;  2WXQ A;  5CMY A;  2Y4T A;  2HO1 A;  2KXP C;  2DWZ A;  4AV7 A;  5C1D A;  3APF A;  1FVH A;  4B89 A;  4Z68 A;  4I9E A;  4E85 A;  4H7X A;  4MKT A;  2EQX A;  4KXK B;  4JPS A;  1KPS B;  1B89 A;  4K03 A;  3TWT A;  1OCZ E;  3CHR A;  2HR2 A;  3UX4 A;  4QFV A;  1O1S A;  1Z5S C;  4C0M A;  4DX1 A;  3EIQ C;  3PUJ A;  1O5M A;  4HFG A;  3GW4 A;  1ELK A;  3G2T A;  3SZ7 A;  3RRU A;  3FU5 A;  4H7Y A;  1TNU A;  3GZ1 A;  3CVY A;  3FUN A;  5KJL A;  5EX3 A;  4UWL A;  4PS7 A;  3CK7 A;  5EKQ D;  3C5R A;  1GW6 A;  1E7U A;  3ZGQ A;  5ENR D;  4GTO A;  5AIJ A;  3L08 A;  5ENS D;  2WQ6 A;  5HKP A;  2IF4 A;  1P5Q A;  1N94 A;  1E8W A;  3CHM A;  4U0Z A;  3FUI A;  2C0L A;  3ASH A;  2CG3 A;  3ZRH A;  1JWG A;  4A1S A;  2R59 A;  2FO1 E;  1SW6 A;  5ENQ D;  4U0U A;  2V8S E;  2FBN A;  4UQY A;  4DX7 D;  2QZA A;  4N3B A;  4PH4 B;  1BI7 B;  1E8Y A;  4U07 A;  5AQ7 A;  1MX6 A;  3IHV A;  4GA0 A;  1BI8 B;  1HF8 A;  3Q73 A;  4G2V A;  3B7R L;  3DSU A;  2XZD G;  5IY5 E;  5A23 A;  2I1K A;  4HRN A;  3ZPJ A;  1PAQ A;  1OY3 D;  4JEH A;  3UT7 A;  3F6Q A;  1OWL A;  2WM9 A;  4N3A A;  1X81 A;  4AOF A;  5EIB E;  5CBN A;  3SQV A;  3QWP A;  4XIF A;  3NAW A;  3CVU A;  1Y6I A;  4AVX A;  3FEY A;  4GYW A;  1MYO A;  1Z6T A;  1OCR E;  1DNP A;  3EIJ A;  4E6H A;  4LNU D;  3RRN B;  3HXE A;  3FP3 A;  2AXV A;  4AP2 A;  4GB9 A;  3LKU A;  2YNQ A;  3FTU A;  2XS1 A;  3FUL A;  1DC2 A;  3R7R A;  3TG5 A;  3RU0 A;  3FH8 A;  1INZ A;  4WUY A;  4UWH A;  3CK9 A;  2R05 A;  4F53 A;  4JVS A;  3QDN A;  1LD7 A;  5FTP A;  5HI7 A;  4DI4 A;  3D9M A;  3QWV A;  2WB2 A;  4J0U A;  5ARF A;  4ILH B;  2LSV A;  2YHE A;  2LO6 A;  4O60 A;  2L9B A;  5FZS A;  4GCN A;  2QYU A;  4IUL A;  3ESL A;  2PL2 A;  4GAA A;  1JCR A;  1NZN A;  3RJV A;  4DUI A;  3QC1 A;  4C0E A;  2XEH A;  2A5E A;  4EQF A;  2IY0 C;  2PZI A;  3G2U A;  2IO2 C;  2DYS E;  1YMP A;  3CVN A;  4LNG A;  4UQZ A;  1BD8 A;  4ANX A;  3KEZ A;  4BWR A;  3ZXS A;  3C3O A;  2IO3 C;  1N52 A;  2UWJ G;  2HYZ A;  3BU8 A;  1HH8 A;  1EYH A;  4I6E A;  3EUV A;  3HIZ A;  3MCX A;  3QKY A;  2WXR A;  2LNI A;  3PRZ A;  3SHF A;  3U64 A;  2CHZ A;  3DSV A;  2DYR E;  4DRX E;  4YDY A;  3ZUV B;  4RVB A;  3RKV A;  2R2L A;  5G05 J;  4PS3 A;  4IYP A;  4MLP A;  2E0I A;  2QC9 A;  3MZL B;  1JCQ A;  5JHB A;  5AQA A;  2LXM A;  3AS4 A;  2XGS A;  4G25 A;  5LCW J;  4KYO B;  4RG6 A;  3BEE A;  1N4P A;  2UY1 A;  4GA1 A;  2VGY A;  3O4Z A;  2IOS A;  3Q4A B;  3PZ1 A;  1W3B A;  3IXE A;  5ARG A;  3OXL A;  1D8D A;  3RRM B;  1N0Q A;  1KT1 A;  3FFL A;  1N4R A;  3T8K A;  2ION A;  3EHQ A;  3HXF A;  3Q78 A;  1QNF A;  3CHO A;  1HX8 A;  4N5Q A;  1HS6 A;  3S2A A;  4GZ5 A;  3TWW A;  3HHM A;  2QFC A;  4LRZ A;  3RAU A;  1WM5 A;  4G1T A;  3LY9 A;  3JCK C;  3PZ3 A;  4APF A;  4KBQ A;  1TNO A;  4LSZ E;  3LJN A;  5A7D B;  4HLL A;  4GML A;  4JC8 A;  1N11 A;  4ACK A;  3CVP A;  3RK6 A;  2VTB B;  4EBA G;  4C48 B;  3CIA A;  5D0Q D;  3FUH A;  4HI8 A;  4BSZ B;  1IQU A;  3C98 A;  3LEW A;  2X6F A;  2XRZ A;  2LUH A;  4Q96 A;  3B13 A;  5ITZ F;  2X6H A;  3UIO C;  3FUM A;  4CEM A;  2VJ8 A;  2XPY A;  4AXH A;  4A3V A;  5KNH D;  2H6G A;  2OOE A;  4I6J A;  3TWR A;  3HG0 D;  3CSF A;  3R9M A;  4BT9 A;  5FQ8 A;  4ATZ D;  4U8H A;  1NA0 A;  1N4S A;  3TWU A;  2EIK E;  4U63 A;  4GCO A;  1DVP A;  4PDX A;  3CKC A;  1KLX A;  2X38 A;  3V2O A;  4ANV A;  3FDH A;  3ABK E;  5G55 A;  2R02 A;  4YDE A;  4DJA A;  5HRY A;  1H6O A;  3QAR A;  3DWL G;  2UY1 B;  1IHB A;  3CKB A;  4EEC A;  3FTS A;  4J8F A;  1NP7 A;  1HG5 A;  3O48 A;  5CMW A;  2FUL A;  4F1S A;  3UM2 A;  1TJC A;  5FIO A;  1OWN A;  2BKK B;  4BER A;  5EYP F;  2KCK A;  5FQ4 A;  2Y1L E;  1KT0 A;  1UG3 A;  1KZP A;  3U9W A;  4TUU A;  1QZ2 A;  3L16 A;  4FUL A;  3PZ4 A;  3IBE A;  5BV1 A;  1D9S A;  4MBG A;  2AW6 A;  4KZ0 A;  3SI5 A;  3SNX A;  1MHQ A;  4I1O B;  4KMO A;  4K5B A;  1WY6 A;  2QY7 A;  4G8L A;  3D9O A;  3BG1 B;  3ZXP A;  4G26 A;  4F7A A;  2WQ7 A;  4FLH A;  2WPV A;  4HQD A;  2V4H C;  3UM1 A;  3KSL A;  2RFA A;  3PE4 A;  2IQC A;  1IKN D;  3L17 A;  1ZU2 A;  4U7E B;  4HI9 A;  4GTQ A;  1QYM A;  4FJZ A;  2ZU6 B;  1G3N B;  2P9N G;  1FVF A;  3MKQ A;  3QB2 A;  4BTA A;  1N9A A;  4JL0 A;  4JA9 A;  2Y4U A;  2F8X K;  1K3Z D;  3ULQ A;  5JMN D;  2XEV A;  3B7S A;  2X3M A;  3IHY A;  2FF4 A;  1OXJ A;  5J08 A;  3C3Q A;  4YDO A;  1E96 B;  1TJF A;  4HXI A;  2P9K G;  4I17 A;  3Q75 A;  1RZ4 A;  1H6P A;  4GMJ A;  2FO7 A;  4AIF A;  4U96 D;  5KCM A;  1FT2 A;  2NSZ A;  3VLD A;  4BX9 A;  3TJP A;  2QYJ A;  2KZT A;  1UJJ A;  2A4Z A;  4B94 A;  2EIJ E;  2NC9 A;  1U3C A;  1ELW A;  2C2L A;  2IFU A;  2L6B A;  1TN7 A;  4UWF A;  3B7U X;  3CVQ A;  1FPP A;  2BTD A;  5FJY A;  1S0P A;  4LEU A;  1WAO 1;  2WXI A;  3CV0 A;  4WNG A;  2YHC A;  2B6C A;  1TN8 A;  3FUK A;  4NUR A;  4LCT A;  4OYS A;  2IOL A;  1VDY A;  4C9B B;  2J49 A;  4ME2 A;  4FAD A;  3QJZ A;  4W9R A;  1X5B A;  2V5Q C;  3J5P A;  1H0A A;  2J8S D;  3UMV A;  3ZEF A;  4KVO A;  5J90 A;  5E75 A;  3JUI A;  2M63 A;  4A55 A;  2V5F A;  1KZO A;  1YA0 A;  3ASN E;  3LXU X;  4J8Y A;  4BTB A;  3GZ2 A;  2E2E A;  5CCL A;  1HO8 A;  2I6H A;  2RFM A;  4PUC A;  2KC7 A;  3NB2 A;  1OWO A;  4XZ4 A;  5CCM A;  3CR3 A;  2R5S A;  1HXI A;  2MHK A;  3AG3 E;  2GRO B;  3V31 A;  3T9K A;  5ENO D;  3ZW3 A;  2YIN A;  3RO2 A;  1JCS A;  3MKQ B;  1V55 E;  3UT4 A;  2Y69 E;  3LPZ A;  1TN6 A;  2PNN A;  4CT0 A;  4GTV A;  4I2Z A;  1E8X A;  3HYM B;  1SZ9 A;  2J4B A;  3TWV A;  3KAE A;  4CZ2 D;  2VSN A;  2BED A;  2CHX A;  3NOG D;  3PNT B;  4N39 A;  4FLB A;  4YVQ C;  3MJW A;  2WMN A;  4RG9 A;  5D0O D;  3MX3 A;  3DRA A;  3HRA A;  2RG8 A;  3Q9N C;  3D9N A;  2KZT B;  3CVV A;  2VGX A;  4BT8 A;  2Y3A A;  4DI3 A;  3ML8 A;  2J07 A;  3MV3 B;  4HVB A;  1O1R A;  2MYO A;  1ZBP A;  2NXP A;  3ASG A;  1BU9 A;  3OAW A;  3E32 A;  3PRE A;  3R7Q A;  4CCA A;  2FEZ A;  2P9U G;  3SFX A;  2AXU A;  4O1P A;  1UN9 A;  4LG6 A;  1IXV A;  3ZVV A;  3EDT B;  3LCA A;  4X8Q A;  3L54 A;  4EZK A;  2H6H A;  5AQ9 A;  5CER B;  3ZIM A;  2Q7F A;  1XGW A;  1IHG A;  4UQX A;  5ENN A;  2WXH A;  3W9G A;  2VTB A;  4UUC A;  5FWQ A;  4FU3 A;  4I1M A;  1E90 A;  1TNY A;  4DPR A;  1O1T A;  4GPM A;  4XE0 A;  5AN8 A;  3KD7 A;  4UI9 C;  3ZYL A;  2DCP A;  3UKR G;  4JHR A;  2H6I A;  5CBO A;  4KZC A;  4FHK A;  3DSW A;  4UI9 J;  4ZHB A;  5FZR A;  4HLE A;  4XKC A;  1TNZ A;  4I6G A;  5B1A E;  3SBT B;  5BXO A;  2WXM A;  3QAQ A;  2KCL A;  5BT1 A;  1EF1 C;  1ZB1 A;  3NOC D;  4GYY A;  4ILG A;  4DK5 A;  1OUV A;  2ZIS A;  5B3S E;  4ILI A;  3MA5 A;  4I2W A;  4DX2 A;  4HB5 A;  3QWW A;  3KEA A;  5KNG A;  3FTV A;  2XEE A;  3D9K A;  1EDU A;  2XZT G;  4F1P A;  1H2T C;  2P9S G;  2GRR B;  3G2S A;  2XEN A;  1Z3X A;  5AYW D;  4J6I A;  1YCS B;  2I9C A;  4GTM A;  5CRU A;  2OCC E;  4GMR A;  5T8I A;  4K5A B;  4PS8 A;  1SZA A;  2V4L A;  4MRU A;  2VGX B;  1SVX A;  5CED B;  1TEZ A;  5CEA A;  4HS2 A;  4LUN U;  2ZXW E;  3L13 A;  4GZ6 A;  5BNW A;  3DXK G;  3LVR E;  1FCH A;  1Q2Z A;  2GRQ B;  1IQR A;  5FT9 A;  4L9P A;  3U4T A;  3V30 A;  4F6R D;  4GZC A;  2EIN E;  4N3C A;  4GTS A;  3IEG A;  4F3V A;  3ABM E;  5C2Y A;  1LD8 A;  3DST A;  3JQ0 A;  2WXN A;  5FQ6 A;  5BXU A;  4BSX A;  4CT4 A;  3EJN A;  2RD0 A;  1MQS A;  3PNL B;  1N4Q A;  3ZYK A;  4A3T A;  5A6C A;  3HXD A;  2ILR A;  5LP0 A;  2L6J A;  3D9L A;  2RKK A;  4XEI G;  3UPV A;  4JB8 P;  2DZN A;  2I1J A;  2BKG A;  4CDN A;  3C72 A;  2XGM A;  3FH7 A;  3R9A B;  5EID A;  2F0Y A;  3Q9U C;  3Q5M A;  1UOH A;  3SBS A;  2PM6 A;  4NIK A;  1MX4 A;  2OVB A;  4KT6 B;  5B1B E;  5LOZ A;  3OXG A;  3JXJ A;  4FA6 A;  5H7P A;  3RIB A;  4R7L A;  3FU3 A;  1MZC A;  3FHE A;  4EZJ A;  5CEC B;  4RSY A;  3GYZ A;  3D9J A;  2B0O E;  2VGE A;  3ZHE A;  4HBD A;  4RLY A;  3LY7 A;  2WXK A;  1UW4 B;  3Q7F A;  5JJ7 A;  3SY2 A;  2GW1 A;  3VTX A;  4G8K A;  1WDY A;  4UI9 K;  5AAO A;  3OXF A;  4FC8 A;  4AY5 A;  4AEZ C;  3FEX A;  1HE8 A;  3TL5 A;  2NYJ A;  3IKO B;  3Q15 A;  5T3R A;  4HOT A;  5FQ7 A;  5EX0 A;  2VYI A;  2IEJ A;  2XQ0 A;  3AU5 A;  2MRI A;  1S63 A;  2WXO A;  1QQE A;  4ANW A;  2OV8 A;  3D9P A;  4K0R A;  1OWP A;  4I43 A;  4YND A;  5ENT D;  3UIP C;  2JAB A;  4CYM D;  3TXN A;  3FTX A;  3SD5 A;  2F8Y A;  2AVP A;  4L7T A;  1ELR A;  3CST A;  3NBN B;  1D8E A;  3Q79 A;  2X6I A;  5EN5 D;  1RW2 A;  1OT8 A;  4U95 D;  4CDR A;  5BPP A;  4Y6W A;  1S64 A;  3APD A;  3I5P A;  3PDN A;  2KAT A;  2ZIR A;  3PS6 A;  2DVW A;  3B7T A;  2OND A;  2AWI A;  4XI0 A;  1AP7 A;  4V3I A;  1LTX A;  4U04 A;  3W9F A;  2ZGG A;  1AWC B;  3ULY A;  1JPL A;  1U3D A;  3ZNG A;  4EZL A;  4TXR A;  1A17 A;  4GZD A;  3NF1 A;  3P2B A;  2WQH A;  3FH5 A;  3TXM A;  2R17 C;  3FU0 A;  4HNA D;  1MX2 A;  1E7V A;  3FTW A;  4P29 A;  3Q49 B;  3T8M A;  3UXG A;  5G2N A;  3Q7A A;  3ZHE B;  2J08 A;  4B0Z A;  4ACL A;  3S7D A;  2P58 C;  3L22 A;  2XRY A;  3CVW A;  3NZU A;  3MKR A;  3FU6 A;  2EIM E;  3LVQ E;  3PUK A;  3ONL A;  4YVO A;  2DIW A;  4L2Y A;  4L2L A;  3E4B A;  5LFA A;  2PM7 A;  1UJK A;  1UN8 A;  4A63 B;  4LER A;  3FUF A;  5CHE E;  3Q47 B;  3VTY A;  1HZ4 A;  5JHA A;  3CEQ A;  3SO8 A;  1K1A A;  3PEV B;  5KJK A;  2X6J A;  4QQI A;  3UT8 A;  1H6K A;  2XCB A;  5JJ6 A;  3SGH A;  3PZ2 A;  2LAH A;  4URK A;  4JZY A;  1SQM A;  3E33 A;  1K1B A;  3HXC A;  3PZD A;  4N2Q A;  2HM8 A;  4EBA A;  1JUQ A;  3AG2 E;  3FTY A;  4J7W A;  5DIZ A;  4BET A;  3S7F A;  4AY6 A;  3SF4 A;  3CHS A;  4M7C A;  5KJN A;  3WXX A;  2LSU A;  2CHW A;  5E76 A;  3FY4 A;  4NAC A;  3AS8 A;  3TAX A;  4GTT A;  4GTR A;  3T5V A;  2VSY A;  4JHJ A;  4XI9 A;  4I9C A;  2J09 A;  1WG0 A;  3RSE G;  3ONK A;  5BW8 C;  2WXL A;  3G2W A;  1U2V G;  4AM9 A;  1OWM A;  2JEK A;  3VLF A;  4UWG A;  5DBK A;  1PC2 A;  4Q69 A;  5JJT A;  3ZKJ A;  3CHQ A;  3L6A A;  3DBS A;  4J8E A;  3UKU G;  5EIL A;  4BY6 A;  4O1O A;  3EHN A;  5BUZ A;  2ETC A;  4HRL A;  4HOS A;  1HG2 A;  3JUE A;  5HQ8 A;  4KVM A;  3CLJ A;  3WG7 E;  3AU4 A;  3K9I A;  5LX8 A;  3DEO A;  3EU5 A;  4UWK A;  2XGO A;  5HS0 A;  2BF0 X;  5D66 A;  3AS5 A;  3LY8 A;  2WXP A;  1H2U A;  1NA3 A;  4K5C A;  4TV3 A;  2WVI A;  3QNK A;  4CDM A;  2ETA A;  3UUX A;  4WWO A;  4N5C A;  2KCV A;  2ETB A;  4ZFH A;  4JEU A;  3TWQ A;  3JXI A;  5D2M C;  3L82 A;  5AAR A;  1YYH A;  4OAU C;  3TWS A;  4Y6C A;  2P9I G;  5JA4 D;  2ZGD A;  5M72 A;  5ANL A;  2WMO A;  2OEV A;  3CK8 A;  1NFI E;  2VQ2 A;  3U3W A;  3D9I A;  4DX5 D;  4LNB A;  3B7B A;  3DXM G;  2X6K A;  4NQ0 A;  4BEP A;  3MGB A;  1OCO E;  4ATG A;  3RO3 A;  3PE3 A;  3AG4 E;  4TXP A;  3D9H A;  1H19 A;  2LAI A;  1DCQ A;  2XCC A;  2OEW A;  1N0R A;  1Y8M A;  2DBA A;  2YQ8 A;  1HFA A;  4I1A A;  5ANR A;  3SFZ A;  5T4Y A;  3ESK A;  1H2V C;  3V2X A;  4U0S A;  1Z3Y A;  2BUG A;  4B93 B;  4Q94 A;  4U8V D;  4OVV A;  3I4R B;  3JYS A;  4JHK A;  4L1B A;  3TG4 A;  3EU9 A;  2GGF A;  1MJ0 A;  3ZYM A;  4BFR A;  5G05 C;  5G04 C;  2GRN B;  3X2Q E;  3BQO A;  2P2C P;  3CVX A;  3AJI A;  3ASO E;  5AJD A;  5LCW C;  4B8C B;  3FUJ A;  1NI1 A;  2PQR A;  3ZN3 A;  3ENE A;  2XPZ A;  4HOQ A;  3E30 A;  3MYV A;  5BV0 A;  5G04 J;  4BX8 A;  3AG1 E;  4AJW A;  2LXL A;  3BG0 B;  4DLQ A;  4RQI A;  3PEU B;  2VSO E;  3DEP A;  4L23 A;  1QBQ A;  3DSX A;  3TGO A;  3FWV A;  1JWF A;  2GRM A;  2Y0B G;  4JD2 G;  4GPK A;  2CG2 A;  4JA7 A;  4OVU A;  3NZS A;  3UI2 A;  3ZYQ A;  4GYO A;  3S7B A;  3FUD A;  1SA4 A;  4HOR A;  4EPZ A;  4GZ3 A;  2IU1 A;  4NRH B;  5KBA A;  3LJ3 A;  4EHM A;  2FI7 A;  3QK0 A;  3LYA A;  3MV2 B;  4WWN A;  1LF8 A;  3SFY A;  3UM0 A;  2F37 A;  3HXB A;  3J5Q B;  5KJM A;  3ASF A;  2XS8 A;  5AJL A;  3D3M A;  3BUA A;  2VSX E;  4M3O A;  3UIN C;  3UM3 A;  3S7J A;  3MEK A;  3UTM A;  3G2V A;  3HVE A;  3OTN A;  4WAF A;  1IYG A;  5ENP D;  3E37 A;  3HDX A;  3GZS A;  4WND A;  3AAA C;  2WXF A;  5AEN A;  2OVF A;  3DPY A;  2CFZ A;  3DSS A;  2PQN A;  4CGV A;  4WNF A;  4GA2 A;  3I3N A;  4IRU A;  2DZO A;  1L5J A;  2XPI A;  2L0I A;  4DLO A;  3U66 A;  1S70 B;  1TNB A;  4OAV B;  1N54 A;  3CVL A;  5CRV A;  3VLE A;  3CGH A;  4HRM B;  2IJG X;  1HU3 A;  3PVL A;  4G23 A;  3TWX A;  1E8Z A;  2H6F A;  2HE0 A;  4B8A A;  3I4G A;  5EDS A;  2EIL E;  3V79 K;  4G24 A;  4WWP A;  2C0M A;  1A5E A;  3LDZ A;  4HOU A;  2V0P A;  3DPD A;  2P9P G;  3ML9 A;  4GU5 A;  1XNF A;  4IN3 B;  3ZFW A;  2I2O A;  5EYL A;  2L0T B;  2R03 A;  4CGW A;  4TUM A;  4O6F A;  1V54 E;  4BES A;  4JW1 A;  4N2S A;  1EPU A;  2J4D A;  3T5X A;  1BPO A;  4TXQ A;  2AJA A;  2GRL A;  3ASD A;  1SA5 A;  4APO A;  3URZ A;  4GTP A;  3UQ3 A;  3ULE G;  3B95 A;  4JXT A;  4WNE A;  4XX5 A;  3N71 A;  3CQC B;  3ISM C;  3E34 A;  4A1G A;  4XKB A;  4YDW A;  3KS2 A;  1PY1 A;  5AQB A;  1DCE A;  1TR4 A; 
#chains in the Genus database with same CATH homology
 1X81 A;  4YDE A;  3PZ3 A;  1TNO A;  1O5M A;  1TNB A;  4YDO A;  4LNG A;  1S64 A;  3PZ2 A;  1MZC A;  2ZIR A;  1TNY A;  1NI1 A;  1O1T A;  3Q75 A;  3E33 A;  3HXC A;  1TNU A;  3E30 A;  1FT1 A;  1JCS A;  3HXE A;  2H6F A;  3EUV A;  1LTX A;  3Q7F A;  2H6I A;  1TN6 A;  1FT2 A;  3KSQ A;  4GTV A;  1KZP A;  3DSV A;  1QBQ A;  3PZ4 A;  3DSW A;  3DSX A;  1NL4 A;  4GTT A;  4GTR A;  4L9P A;  4MBG A;  4LNB A;  4GTS A;  2BED A;  2R2L A;  4GTO A;  1TN7 A;  1SA4 A;  1TNZ A;  1FPP A;  1LD8 A;  3DST A;  1N94 A;  1JCQ A;  2H6G A;  1LD7 A;  4EHM A;  3Q7A A;  3DRA A;  1N4Q A;  2IEJ A;  1N95 A;  2ZIS A;  3HXD A;  3SFY A;  1TN8 A;  3HXB A;  1S63 A;  1N4P A;  3KSL A;  1SA5 A;  3PZ1 A;  1O1R A;  4GTP A;  3C72 A;  1D8D A;  1N4S A;  3E32 A;  1N4R A;  3SFX A;  4GTQ A;  3Q73 A;  3HXF A;  3Q78 A;  1JCR A;  3DSU A;  2F0Y A;  3E34 A;  3E37 A;  1N9A A;  3DPY A;  2H6H A;  3DSS A;  3EU5 A;  4GTM A;  1O1S A;  1KZO A;  1DCE A;  1D8E A;  3Q79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...