1X81A

Farnesyl transferase structure of jansen compound
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Design, synthesis, and activity of 4-quinolone and pyridone compounds as nonthiol-containing farnesyltransferase inhibitors.
pubmed doi rcsb
total genus 103
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1x81A00
4GTPA 1SA5A 1N4PA 1NL4A 3C72A 3DSXA 1TN6A 1O1SA 2H6GA 3DSUA 3Q73A 1O1RA 1FT2A 3HXDA 4L9PA 3SFYA 3E33A 1KZPA 4GTMA 2ZISA 2H6IA 1N95A 1LTXA 4MBGA 3E37A 1JCQA 1TN8A 3PZ3A 1NI1A 1S64A 3DSWA 1TNOA 1S63A 4GTTA 3DPYA 1QBQA 4GTQA 1TN7A 3Q78A 2H6FA 1FT1A 1TNBA 1JCSA 4GTOA 1O1TA 3Q7AA 3E32A 4LNBA 3Q75A 1O5MA 1N94A 3PZ2A 1DCEA 1KZOA 2H6HA 2BEDA 3E30A 3HXBA 1X81A 1MZCA 4GTVA 3DSVA 1JCRA 3Q79A 3E34A 1LD7A 1SA4A 3HXEA 1TNYA 4YDEA 1N4SA 1FPPA 4LNGA 3HXFA 3KSQA 3Q7FA 1LD8A 2R2LA 2ZIRA 4GTSA 3DSTA 3KSLA 4YDOA 3PZ4A 4EHMA 1TNUA 3EU5A 2F0YA 1N4QA 2IEJA 3SFXA 3DSSA 1N4RA 1N9AA 4GTRA 3HXCA 1D8DA 3EUVA 3PZ1A 1D8EA 1TNZA 3DRAA
chains in the Genus database with same CATH superfamily
4ATGA 2A4ZA 4BESA 4I17A 3ASFA 2WQ7A 3T8KA 1UN8A 2CFUA 1O1SA 1U3DA 2Y69E 1FT2A 1N52A 4JPSA 1TJCA 5FQ4A 3TGOA 3D9PA 3PEVB 5FQ6A 1YYHA 5JA4D 4GTMA 4FHJA 2PM7A 4LRZA 2CHXA 3FTWA 1UJKA 2VSNA 3MA5A 3MKQA 1BPOA 3D9JA 3B7TA 2RG8A 2I1JA 3AS8A 4JB8P 5B3SE 3MX3A 4JA9A 4PS3A 2XCBA 1JUQA 3Q78A 2AXVA 5A7DB 3CHSA 2LSUA 2VSOE 3L82A 3I3NA 1N0RA 4G8LA 3BQOA 4I43A 3RU0A 5FZSA 3UKUG 4J6IA 4IULA 4HQDA 4UWKA 1A17A 4BT8A 3DSVA 2QY7A 3AG1E 4JXTA 3V2OA 3UM1A 3NF1A 4RSYA 3ABLE 4GA2A 2HYZA 2HO1A 2QYJA 1H0AA 3AG2E 5BV0A 4EHMA 2PZIA 3VLEA 1MX2A 3RO3A 2X6JA 4U0ZA 3B7BA 4KT6B 2UWJG 2WMNA 4CGVA 3APFA 2BKKB 4I1OB 3LVQE 3EIQC 5B1AE 3PH0C 2PQNA 3DSUA 1O1RA 5CERB 3FUEA 3RSEG 3FU6A 4R7LA 3VTXA 4A1SA 3QDNA 3OTNA 3RRUA 2WXIA 1TR4A 2DWZA 3BEEA 3RK6A 3IHVA 3L22A 3TWRA 1D9SA 4GA1A 3RIBA 4K5BA 3FUHA 2Y3AA 5ENRD 1FVFA 3S7FA 2VQ2A 3MYVA 3Q75A 4LERA 5EILA 3FHEA 2BTDA 1N94A 1JWFA 1MX4A 2P9IG 2VYIA 3ZXPA 1Q2ZA 2J09A 3CHOA 1AP7A 4GYWA 4GTVA 4HBDA 2X6HA 4BX9A 4LCTA 2EINE 3LXUX 3KSQA 3TL5A 3DEPA 2R2LA 2ZIRA 2VGXB 3G2UA 5BXOA 5FTPA 2XEEA 3PZ4A 5FZRA 2UY1B 1V55E 3SFXA 4G11A 2J4BA 3MCXA 1D8DA 4Q96A 1EYHA 4HOSA 4HVBA 2HM8A 3V31A 5BT1A 4YDWA 4HLLA 3APDA 4XKCA 5EX0A 1TN6A 5EIBE 2H6GA 3UIPC 2NSZA 3CVQA 1S0PA 1H6PA 4OYSA 2F8XK 3PNTB 1E8XA 4J8YA 4FLHA 5A23A 3F6QA 2EQXA 3FU5A 1UG3A 1E8YA 4G2VA 4DJAA 1ZU2A 4F6RD 2Y0BG 2KATA 3CQCB 2P9NG 4Q69A 3PZ3A 4CT0A 4HI8A 5KJMA 2V8SE 3PEUB 3BUAA 4AP2A 2DVWA 4XEIG 3FUMA 3IXEA 1HS6A 1TN7A 3BU8A 4UQZA 4BETA 3UM2A 1BLXB 2IONA 2YHEA 2Y4UA 3I5PA 3ZEFA 3Q7AA 3E32A 1OWMA 4WUYA 3IBEA 4HB5A 2Y1LE 1KZOA 2RFMA 2P58C 4TXQA 1K1AA 3ZRHA 4GYYA 4JHKA 4U8VD 2J4DA 5CRVA 1HE8A 1OXJA 4I1AA 3ASDA 1RW2A 3B13A 1NZNA 4JHJA 3DSTA 4G23A 3D9MA 2XPIA 4GPMA 3FEXA 1N4RA 3C5RA 3MZLB 5D0OD 3TG4A 2WMOA 4G8KA 4LUNU 4X8QA 3WXXA 3CHMA 3LKUA 3PUKA 4KXKB 4BERA 4ABNA 4HOUA 4U07A 4N3CA 3UT7A 5HI7A 3ASHA 3Q5MA 3LY8A 4U0SA 1KZPA 2LXLA 4O60A 3SQVA 3LPZA 3MV2B 3PS6A 1MX6A 1IHBA 3O4ZA 5AJDA 1A5EA 4WNFA 3UT4A 5KNHD 5T4YA 3ZPJA 1ELKA 3CHPA 3QKYA 5ENOD 4BY6A 1FCHA 2MYOA 3GZ1A 1TNBA 4MRUA 1WM5A 3LVRE 2WXGA 5FJYA 4U8HA 3EJNA 5FZQA 3ZKJA 4CZ2D 4DRXE 5CBNA 3GZ2A 3E4BA 4HOQA 2CHZA 3Q79A 2HR2A 3QOUA 2WVIA 4LNGA 3ASNE 2J07A 3JYSA 3HXFA 4KVOA 1AWCB 2FO7A 4C9BB 5G05J 2V4LA 1OWPA 2WXMA 2X38A 3LY9A 4ILGA 4ZHBA 1U2VG 1HZ4A 5G05C 1NA3A 1HF8A 5CMWA 3FTVA 3D9IA 1MYOA 1MQSA 4DUIA 3FTZA 2R59A 1XGWA 3FEYA 4P29A 4BT9A 3SGHA 4BFRA 4DX7D 3FULA 3SFYA 5BUZA 4XE0A 4GMRA 3G2VA 2GRMA 4HRMB 4DLQA 2IO2C 3B95A 4OVUA 4DX5D 3FP3A 5JHBA 4GZ3A 4NRHB 4ANVA 3ML8A 4EZKA 4AY6A 5FIOA 2AXZA 2XEHA 1IKND 5HS0A 2LXMA 3CK8A 4F1SA 4JC8A 1YCSB 3URZA 3L9TA 1BI7B 1X81A 1MZCA 4HRLA 3U4TA 1P5QA 3OAWA 4FJZA 2IOSA 3D9NA 4O6FA 2WXJA 3GW4A 1TJFA 1PC2A 4GCOA 4G25A 1DC2A 4YVOA 3KS2A 1OCOE 4GZDA 3B7RL 2DYRE 2IO3C 4JW1A 2XPZA 4E6HA 3C3OA 4GPKA 2ZGDA 4JHRA 3NOGD 4DLOA 4J0UA 2KBXA 2FULA 2Q7FA 2AW6A 4B0ZA 3EU9A 2FBNA 2ZISA 4WWNA 3CKBA 3D9LA 4LG6A 5KJKA 3NZSA 3LYAA 3FFLA 2CFZA 4L2LA 3U66A 2H6FA 1XNFA 3NZUA 5AQAA 4XI9A 4BSXA 5JJ7A 1O1TA 2GRQB 4ANUA 3QARA 3ZYQA 2DZOA 2PM6A 5DIZA 4UQYA 4XZ4A 2WQHA 5JMND 4EZJA 4Y6WA 2VGEA 4WNDA 4Y6CA 3UMVA 1LD7A 3FU0A 1NP7A 3HXEA 3FUJA 4U7EB 4YDEA 1N54A 2AXUA 2WXFA 4K03A 4W9RA 3AG3E 3UX4A 3C3QA 5G04J 3TG5A 4I6JA 1TNUA 3ZGQA 3L17A 1UJJA 5BW8C 4DI3A 4GTRA 2ILRA 4ANXA 5ENPD 2OOEA 2PQRA 2QYUA 4DI4A 3U3WA 4GYOA 4N3BA 2KZTB 4F7AA 2KM4A 3QK0A 2F8YA 1ZB1A 2X6IA 3D9OA 1NA0A 1E90A 3C72A 3VLDA 1ELWA 3CVWA 4FP7A 2J8SD 3HDXA 2WXLA 3UI2A 1SZAA 2J9QA 4G26A 4UWGA 1H6KA 3UM3A 3IKOB 3CHQA 1Z6TA 2RD0A 1KPSB 4EBAA 4XI0A 2L6BA 3ABME 3W9GA 2BKGA 2RKKA 3NAWA 4URKA 2WQ6A 2X6FA 4C0MA 3U64A 3JXJA 4MKTA 3CK9A 4WWOA 3S7BA 1OY3D 5KCMA 3ZU7B 4J8DA 2I2OA 1UOHA 3CVVA 4I6GA 2CG2A 3QJZA 3FUKA 2P9KG 2I1KA 3E34A 3TXMA 3FUIA 3ZXSA 3FH8A 2KCKA 2V5QC 2YINA 4GU5A 4YDOA 3FUFA 2VTBA 3TWUA 3Q47B 5D2MC 5LCWJ 4GAAA 4UWFA 1N9AA 3PZ1A 5C1DA 1D8EA 5LCWC 4JZYA 4KYOB 4PS8A 3EHRA 2L0IA 4GMLA 3AS4A 1HH8A 5KWDA 3LDZA 4MS6A 2JABA 3K9IA 2WXPA 4L2YA 2IQCA 1B89A 4F3VA 4IRUA 3DXKG 2KCVA 4HNAD 4K5CA 1IHGA 2FI7A 4DX6D 3D3MA 1N95A 1WAO1 3UM0A 3HVEA 4APFA 2BF0X 1MJ0A 3T5XA 4EBAG 1S63A 5ARGA 1QNFA 5CECB 2B0OE 2I6HA 5EX3A 3ZYMA 3RAUA 1Y6IA 3DXMG 1QZ2A 3IHYA 4D10C 2XQ0A 2XS1A 3AU4A 1V54E 4UWHA 2XZDG 4RG6A 5AAOA 3JQ0A 1KT0A 3FTXA 4DX1A 4EZLA 4IYPA 5ARFA 2GW1A 2IFUA 5HRYA 5ANLA 1H2TC 2NXPA 3B7SA 3JXIA 4B8AA 2QC9A 4JEHA 2L0TB 5KJNA 4L1BA 1KLXA 2CHWA 3AS5A 3SBTB 2NC9A 4OAVB 3L13A 5D66A 3ZHEB 1W3BA 3N71A 3D9HA 2C2LA 4TXPA 3ULYA 2JEKA 4N2SA 2WXKA 2A5EA 4U95D 3CSTA 1MHQA 5T8IA 2DCPA 3SY2A 1OWOA 1YA0A 2WPVA 1H2UA 3D9KA 4J8SA 1OT8A 4IN3B 4GZCA 1EF1C 1JPLA 3E37A 1JCQA 3O48A 4BWRA 3CR3A 4GCNA 3V30A 4A63B 4TXRA 2XRZA 3MKQB 2ONDA 2GRLA 3CIAA 5KJLA 3KEZA 2VJ8A 4YVQC 4UUCA 4RLYA 3FH7A 4FA6A 3LJ3A 4CYMD 5E76A 2L9BA 4KBQA 4PUCA 1PAQA 1IXVA 4GTSA 4N2QA 1Z5SC 3G2WA 4A1GA 3EU5A 4KZ0A 2L6JA 3ZVVA 4NURA 3SBSA 4H7XA 3UIOC 3HXCA 1PY1A 1EDUA 1H2VC 2M63A 3LS8A 3CVUA 2ETCA 2R03A 4I2WA 5CRUA 5LX8A 2WXRA 4B93B 4AJWA 1EPUA 3S2AA 4HOTA 4AY5A 3FH5A 2FF4A 4XIFA 3SZ7A 2MRIA 1LTXA 3RKVA 3ZYKA 1S64A 2WB2A 1H19A 4CRWA 1HX8A 3TWVA 4GTQA 1JWGA 1SVXA 3ABKE 1FT1A 4GA0A 3ESKA 3ML9A 5HKPA 4RG9A 1BU9A 1ZBPA 4GZ6A 4J8EA 3SD5A 3LCAA 4FHKA 4N5CA 1TEZA 5AJLA 2VGXA 2X3MA 2VTBB 3FTYA 4LNUD 2EILE 3W9FA 2XHEA 4OAUC 2UY1A 5H7PA 3HYMB 5HQ8A 3T8MA 2WXOA 5EKQD 2GROB 3LY7A 3HG0D 4ZFHA 4AOFA 5LFAA 5EYPF 3SFZA 3VLFA 4U04A 2AJAA 2WXQA 3U9WA 3EUVA 2A5UA 1DVPA 3PE3A 3UKRG 2MOWA 2XGMA 4FADA 3I4GA 2AWIA 4CEMA 3S7DA 5AN8A 2ETAA 3Q9UC 4AIFA 3CEQA 4FU3A 1X5BA 1Z3YA 1WDYA 4NIKA 5ITZF 2XPYA 3DBSA 5ENQD 3TXNA 2V4HC 3ESLA 4PH4B 4G24A 4ILHB 4AEZC 3TWTA 3UPVA 2BUGA 4I9EA 3L6AA 5CHEE 1DCQA 3QWWA 3FWVA 2XGSA 3R9AB 2XENA 3VTYA 1U3CA 4FJYA 2OEVA 1WG0A 4BX8A 1L5JA 5CCMA 1DCEA 5LP0A 4TRQA 3J5PA 1JCRA 1RZ4A 3B7UX 5D0QD 1DNPA 2YQ8A 4U8YD 4G1TA 4I6EA 3Q7FA 5M72A 3MGBA 4LEUA 2QFCA 2PL2A 2R02A 4N5QA 4N39A 3ONLA 5AENA 2EIKE 4RQIA 3R7QA 4M3OA 4I1MA 4A3TA 1IYGA 3P1UA 1Z3XA 1N4PA 2IU1A 2P9UG 3LEWA 2Y4TA 3MJWA 3TWQA 3WG7E 3GYZA 4J8FA 4NQ0A 3AJIA 3HXDA 4GB9A 4KZCA 5G04C 2ZXWE 5CCLA 3BG1B 4M7CA 4A3VA 3UUXA 2V0PA 1NI1A 4MLPA 2IOLA 1SZ9A 3T5VA 4ATZD 4Q94A 5DBKA 3QNKA 4EPZA 3JCKC 1WY6A 3BG0B 2VSYA 2ETBA 4LNBA 5J08A 4JL0A 2ZGGA 4JD2G 2OV8A 2H6HA 5EIDA 3UT8A 3ONKA 2P2CP 3HXBA 5FQ7A 1QQEA 3G2TA 2YNQA 1INZA 3OXGA 4B89A 3J5QB 2EIJE 2EIME 5ANRA 2LAHA 3KD7A 4ILIA 1ELRA 5B1BE 5LOZA 2DBAA 4E85A 3CKCA 4CGWA 2DIWA 3APCA 3PRZA 3X2QE 2F0YA 3ZUVB 3AG4E 1KT1A 3S7JA 3AAAC 3EIJA 3ENEA 4TUMA 4DK5A 4RVBA 5T3RA 1HXIA 4GTPA 1SA5A 4HORA 1HG2A 3R7RA 3CQGB 2E2EA 3PREA 2QZAA 4AXHA 2GGFA 3DSXA 3IV0A 5CBOA 2XRYA 3QWPA 4K0RA 3Q73A 2CG3A 3QB2A 3MKRA 3ZN3A 5CEDB 3LJNA 4EQFA 4U96D 4PS7A 4AV7A 4O1OA 4F53A 2HE0A 3UTMA 4L7TA 5JHAA 3TWWA 1TNOA 4LSZE 3PUJA 1E7UA 3DPYA 4GZ5A 4WNEA 2OEWA 3G2SA 4HXIA 2FO1E 3EDTB 5BXUA 3CGHA 3RJVA 4B8CB 5ENNA 1TYQG 2P9PG 2J49A 3ZIMA 3QWVA 4UWLA 3PDNA 1SA4A 4I9CA 3PE4A 4JA7A 2X6KA 4JVSA 1N11A 4WWPA 3QAQA 3V2XA 2RFAA 2YHCA 1K1BA 2LAIA 5FQ8A 2VSXE 3CVXA 3FUDA 3OXLA 1E96B 2R5SA 5EN5D 3Q4AB 1K8KG 3UQ3A 2WXHA 3FUNA 3ZNGA 3RO2A 3RRMB 3HRAA 1S70B 2OVFA 2P9SG 2J08A 4C48B 2XGOA 5BV1A 5CMYA 3HIZA 1HG5A 3CSFA 3CVPA 4WAFA 4QQIA 2PNNA 4U0UA 3ISMC 1OCCE 3ZFWA 4BEPA 4HFGA 3DPDA 4YDYA 3NBNB 3L16A 3CVNA 3GZSA 3DWLG 2H6IA 4MBGA 4YNDA 2JLBA 1IQRA 4N3AA 4NACA 4ACLA 3DEOA 2LO6A 3CV0A 3NQPA 3UINC 3SNXA 4CDNA 3ASGA 1JCSA 1SW6A 4GTOA 4V3IA 3EHNA 2KCLA 4ACKA 4KVMA 1O5MA 2XS8A 1E8ZA 1BD8A 2OCCE 5J90A 1GW6A 5AYWD 1H6OA 2LSVA 1OWLA 5FINA 3C98A 3MEKA 4HI9A 4FLBA 4J7WA 4JEUA 2GRRB 5G2NA 4FC8A 3FTSA 5JJ6A 3CVLA 4DPRA 1YMPA 3C3RA 3IEGA 2R17C 2OVBA 2VGYA 4XKBA 3FTUA 3TWSA 4EECA 5EDSA 4CCAA 2KZTA 3JUIA 3ULEG 5KBAA 3ZYLA 4GMJA 1N4QA 4AM9A 2IEJA 1LF8A 1OWNA 3TWXA 4C0EA 3L08A 1TNZA 3DRAA 2IJGX 1E7VA 3PNLB 2DYSE 4HRNA 5G55A 3SF4A 3CVYA 4KMOA 5JJTA 1VDYA 4APOA 3KEAA 5C2YA 3UXGA 4U63A 4TV3A 1OCRE 3E33A 1OCZE 2IF4A 2IY0C 3T9KA 3I4RB 1Y8MA 4A55A 3AU5A 4UI9J 1FVHA 1HU3A 2KC7A 2XCCA 4WNGA 2GRPB 4UI9C 4GTTA 1QBQA 3R9MA 3V79K 3SI5A 1K3ZD 3Q9NC 5BPPA 2GRNB 4BTBA 3PZ2A 3QC1A 2BEDA 5IY5E 4UI9K 5ENTD 1G3NB 2ZU6B 4BSZB 4H7YA 1TNYA 5CEAA 5AQ9A 3NB2A 2C0LA 2F37A 3CHRA 4PDXA 2I9CA 1LD8A 3ASOE 3KSLA 3L54A 3RRNB 4K5AB 3TAXA 3TJPA 3CK7A 5AQBA 4B94A 3Q15A 3DSSA 1NFIE 4OVVA 2NYJA 3ULQA 4TUUA 1HFAA 5FT9A 3P2BA 5KNGA 2XZTG 1HO8A 5ENSD 1NL4A 4I2ZA 2LUHA 2MHKA 3OXFA 5AIJA 4AVXA 1UN9A 2LNIA 2V5FA 5AARA 4L9PA 2C0MA 4HLEA 4UQXA 3EHQA 3KAEA 1TN8A 4F1PA 4Z68A 3NOCD 2E0IA 3DSWA 1SQMA 1UW4B 1BI8B 3HVEB 3CLJA 1E8WA 4QFVA 3PZDA 4CDMA 4DX2A 4ANWA 5FWQA 3Q49B 2DZNA 2WM9A 3PVLA 1N0QA 2R05A 2FEZA 2P9LG 5E75A 2KXPC 3E30A 3EHMA 3JQ1A 4FULA 4ME2A 4CDRA 2XEVA 1OUVA 5EYLA 3FDHA 4BTAA 5AQ7A 2B6CA 1N4SA 1FPPA 3JUEA 4L23A 3ZHEA 4CT4A 1QYMA 2AVPA 4O1PA 3FY4A 3MV3B 1IQUA 2WXNA 5BNWA 3ZW3A 3HHMA 4XX5A 3FU3A 3SO8A 5A6CA 3SHFA 4HS2A
chains in the Genus database with same CATH topology
4GTPA 1SA5A 1N4PA 1NL4A 3C72A 3DSXA 1TN6A 1O1SA 2H6GA 3DSUA 3Q73A 1O1RA 1FT2A 3HXDA 4L9PA 3SFYA 3E33A 1KZPA 4GTMA 2ZISA 2H6IA 1N95A 1LTXA 4MBGA 3E37A 1JCQA 1TN8A 3PZ3A 1NI1A 1S64A 3DSWA 1TNOA 1S63A 4GTTA 3DPYA 1QBQA 4GTQA 1TN7A 3Q78A 2H6FA 1FT1A 1TNBA 1JCSA 4GTOA 1O1TA 3Q7AA 3E32A 4LNBA 3Q75A 1O5MA 1N94A 3PZ2A 1DCEA 1KZOA 2H6HA 2BEDA 3E30A 3HXBA 1X81A 1MZCA 4GTVA 3DSVA 1JCRA 3Q79A 3E34A 1LD7A 1SA4A 3HXEA 1TNYA 4YDEA 1N4SA 1FPPA 4LNGA 3HXFA 3KSQA 3Q7FA 1LD8A 2R2LA 2ZIRA 4GTSA 3DSTA 3KSLA 4YDOA 3PZ4A 4EHMA 1TNUA 3EU5A 2F0YA 1N4QA 2IEJA 3SFXA 3DSSA 1N4RA 1N9AA 4GTRA 3HXCA 1D8DA 3EUVA 3PZ1A 1D8EA 1TNZA 3DRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTP A;  1SA5 A;  1N4P A;  1NL4 A;  3C72 A;  3DSX A;  1TN6 A;  1O1S A;  2H6G A;  3DSU A;  3Q73 A;  1O1R A;  1FT2 A;  3HXD A;  4L9P A;  3SFY A;  3E33 A;  1KZP A;  4GTM A;  2ZIS A;  2H6I A;  1N95 A;  1LTX A;  4MBG A;  3E37 A;  1JCQ A;  1TN8 A;  3PZ3 A;  1NI1 A;  1S64 A;  3DSW A;  1TNO A;  1S63 A;  4GTT A;  3DPY A;  1QBQ A;  4GTQ A;  1TN7 A;  3Q78 A;  2H6F A;  1FT1 A;  1TNB A;  1JCS A;  4GTO A;  1O1T A;  3Q7A A;  3E32 A;  4LNB A;  3Q75 A;  1O5M A;  1N94 A;  3PZ2 A;  1DCE A;  1KZO A;  2H6H A;  2BED A;  3E30 A;  3HXB A;  1X81 A;  1MZC A;  4GTV A;  3DSV A;  1JCR A;  3Q79 A;  3E34 A;  1LD7 A;  1SA4 A;  3HXE A;  1TNY A;  4YDE A;  1N4S A;  1FPP A;  4LNG A;  3HXF A;  3KSQ A;  3Q7F A;  1LD8 A;  2R2L A;  2ZIR A;  4GTS A;  3DST A;  3KSL A;  4YDO A;  3PZ4 A;  4EHM A;  1TNU A;  3EU5 A;  2F0Y A;  1N4Q A;  2IEJ A;  3SFX A;  3DSS A;  1N4R A;  1N9A A;  4GTR A;  3HXC A;  1D8D A;  3EUV A;  3PZ1 A;  1D8E A;  1TNZ A;  3DRA A; 
#chains in the Genus database with same CATH topology
 4ATG A;  2A4Z A;  4BES A;  4I17 A;  3ASF A;  2WQ7 A;  3T8K A;  1UN8 A;  2CFU A;  1O1S A;  1U3D A;  2Y69 E;  1FT2 A;  1N52 A;  4JPS A;  1TJC A;  5FQ4 A;  3TGO A;  3D9P A;  3PEV B;  5FQ6 A;  1YYH A;  5JA4 D;  4GTM A;  4FHJ A;  2PM7 A;  4LRZ A;  2CHX A;  3FTW A;  1UJK A;  2VSN A;  3MA5 A;  3MKQ A;  1BPO A;  3D9J A;  3B7T A;  2RG8 A;  2I1J A;  3AS8 A;  4JB8 P;  5B3S E;  3MX3 A;  4JA9 A;  4PS3 A;  2XCB A;  1JUQ A;  3Q78 A;  2AXV A;  5A7D B;  3CHS A;  2LSU A;  2VSO E;  3L82 A;  3I3N A;  1N0R A;  4G8L A;  3BQO A;  4I43 A;  3RU0 A;  5FZS A;  3UKU G;  4J6I A;  4IUL A;  4HQD A;  4UWK A;  1A17 A;  4BT8 A;  3DSV A;  2QY7 A;  3AG1 E;  4JXT A;  3V2O A;  3UM1 A;  3NF1 A;  4RSY A;  3ABL E;  4GA2 A;  2HYZ A;  2HO1 A;  2QYJ A;  1H0A A;  3AG2 E;  5BV0 A;  4EHM A;  2PZI A;  3VLE A;  1MX2 A;  3RO3 A;  2X6J A;  4U0Z A;  3B7B A;  4KT6 B;  2UWJ G;  2WMN A;  4CGV A;  3APF A;  2BKK B;  4I1O B;  3LVQ E;  3EIQ C;  5B1A E;  3PH0 C;  2PQN A;  3DSU A;  1O1R A;  5CER B;  3FUE A;  3RSE G;  3FU6 A;  4R7L A;  3VTX A;  4A1S A;  3QDN A;  3OTN A;  3RRU A;  2WXI A;  1TR4 A;  2DWZ A;  3BEE A;  3RK6 A;  3IHV A;  3L22 A;  3TWR A;  1D9S A;  4GA1 A;  3RIB A;  4K5B A;  3FUH A;  2Y3A A;  5ENR D;  1FVF A;  3S7F A;  2VQ2 A;  3MYV A;  3Q75 A;  4LER A;  5EIL A;  3FHE A;  2BTD A;  1N94 A;  1JWF A;  1MX4 A;  2P9I G;  2VYI A;  3ZXP A;  1Q2Z A;  2J09 A;  3CHO A;  1AP7 A;  4GYW A;  4GTV A;  4HBD A;  2X6H A;  4BX9 A;  4LCT A;  2EIN E;  3LXU X;  3KSQ A;  3TL5 A;  3DEP A;  2R2L A;  2ZIR A;  2VGX B;  3G2U A;  5BXO A;  5FTP A;  2XEE A;  3PZ4 A;  5FZR A;  2UY1 B;  1V55 E;  3SFX A;  4G11 A;  2J4B A;  3MCX A;  1D8D A;  4Q96 A;  1EYH A;  4HOS A;  4HVB A;  2HM8 A;  3V31 A;  5BT1 A;  4YDW A;  4HLL A;  3APD A;  4XKC A;  5EX0 A;  1TN6 A;  5EIB E;  2H6G A;  3UIP C;  2NSZ A;  3CVQ A;  1S0P A;  1H6P A;  4OYS A;  2F8X K;  3PNT B;  1E8X A;  4J8Y A;  4FLH A;  5A23 A;  3F6Q A;  2EQX A;  3FU5 A;  1UG3 A;  1E8Y A;  4G2V A;  4DJA A;  1ZU2 A;  4F6R D;  2Y0B G;  2KAT A;  3CQC B;  2P9N G;  4Q69 A;  3PZ3 A;  4CT0 A;  4HI8 A;  5KJM A;  2V8S E;  3PEU B;  3BUA A;  4AP2 A;  2DVW A;  4XEI G;  3FUM A;  3IXE A;  1HS6 A;  1TN7 A;  3BU8 A;  4UQZ A;  4BET A;  3UM2 A;  1BLX B;  2ION A;  2YHE A;  2Y4U A;  3I5P A;  3ZEF A;  3Q7A A;  3E32 A;  1OWM A;  4WUY A;  3IBE A;  4HB5 A;  2Y1L E;  1KZO A;  2RFM A;  2P58 C;  4TXQ A;  1K1A A;  3ZRH A;  4GYY A;  4JHK A;  4U8V D;  2J4D A;  5CRV A;  1HE8 A;  1OXJ A;  4I1A A;  3ASD A;  1RW2 A;  3B13 A;  1NZN A;  4JHJ A;  3DST A;  4G23 A;  3D9M A;  2XPI A;  4GPM A;  3FEX A;  1N4R A;  3C5R A;  3MZL B;  5D0O D;  3TG4 A;  2WMO A;  4G8K A;  4LUN U;  4X8Q A;  3WXX A;  3CHM A;  3LKU A;  3PUK A;  4KXK B;  4BER A;  4ABN A;  4HOU A;  4U07 A;  4N3C A;  3UT7 A;  5HI7 A;  3ASH A;  3Q5M A;  3LY8 A;  4U0S A;  1KZP A;  2LXL A;  4O60 A;  3SQV A;  3LPZ A;  3MV2 B;  3PS6 A;  1MX6 A;  1IHB A;  3O4Z A;  5AJD A;  1A5E A;  4WNF A;  3UT4 A;  5KNH D;  5T4Y A;  3ZPJ A;  1ELK A;  3CHP A;  3QKY A;  5ENO D;  4BY6 A;  1FCH A;  2MYO A;  3GZ1 A;  1TNB A;  4MRU A;  1WM5 A;  3LVR E;  2WXG A;  5FJY A;  4U8H A;  3EJN A;  5FZQ A;  3ZKJ A;  4CZ2 D;  4DRX E;  5CBN A;  3GZ2 A;  3E4B A;  4HOQ A;  2CHZ A;  3Q79 A;  2HR2 A;  3QOU A;  2WVI A;  4LNG A;  3ASN E;  2J07 A;  3JYS A;  3HXF A;  4KVO A;  1AWC B;  2FO7 A;  4C9B B;  5G05 J;  2V4L A;  1OWP A;  2WXM A;  2X38 A;  3LY9 A;  4ILG A;  4ZHB A;  1U2V G;  1HZ4 A;  5G05 C;  1NA3 A;  1HF8 A;  5CMW A;  3FTV A;  3D9I A;  1MYO A;  1MQS A;  4DUI A;  3FTZ A;  2R59 A;  1XGW A;  3FEY A;  4P29 A;  4BT9 A;  3SGH A;  4BFR A;  4DX7 D;  3FUL A;  3SFY A;  5BUZ A;  4XE0 A;  4GMR A;  3G2V A;  2GRM A;  4HRM B;  4DLQ A;  2IO2 C;  3B95 A;  4OVU A;  4DX5 D;  3FP3 A;  5JHB A;  4GZ3 A;  4NRH B;  4ANV A;  3ML8 A;  4EZK A;  4AY6 A;  5FIO A;  2AXZ A;  2XEH A;  1IKN D;  5HS0 A;  2LXM A;  3CK8 A;  4F1S A;  4JC8 A;  1YCS B;  3URZ A;  3L9T A;  1BI7 B;  1X81 A;  1MZC A;  4HRL A;  3U4T A;  1P5Q A;  3OAW A;  4FJZ A;  2IOS A;  3D9N A;  4O6F A;  2WXJ A;  3GW4 A;  1TJF A;  1PC2 A;  4GCO A;  4G25 A;  1DC2 A;  4YVO A;  3KS2 A;  1OCO E;  4GZD A;  3B7R L;  2DYR E;  2IO3 C;  4JW1 A;  2XPZ A;  4E6H A;  3C3O A;  4GPK A;  2ZGD A;  4JHR A;  3NOG D;  4DLO A;  4J0U A;  2KBX A;  2FUL A;  2Q7F A;  2AW6 A;  4B0Z A;  3EU9 A;  2FBN A;  2ZIS A;  4WWN A;  3CKB A;  3D9L A;  4LG6 A;  5KJK A;  3NZS A;  3LYA A;  3FFL A;  2CFZ A;  4L2L A;  3U66 A;  2H6F A;  1XNF A;  3NZU A;  5AQA A;  4XI9 A;  4BSX A;  5JJ7 A;  1O1T A;  2GRQ B;  4ANU A;  3QAR A;  3ZYQ A;  2DZO A;  2PM6 A;  5DIZ A;  4UQY A;  4XZ4 A;  2WQH A;  5JMN D;  4EZJ A;  4Y6W A;  2VGE A;  4WND A;  4Y6C A;  3UMV A;  1LD7 A;  3FU0 A;  1NP7 A;  3HXE A;  3FUJ A;  4U7E B;  4YDE A;  1N54 A;  2AXU A;  2WXF A;  4K03 A;  4W9R A;  3AG3 E;  3UX4 A;  3C3Q A;  5G04 J;  3TG5 A;  4I6J A;  1TNU A;  3ZGQ A;  3L17 A;  1UJJ A;  5BW8 C;  4DI3 A;  4GTR A;  2ILR A;  4ANX A;  5ENP D;  2OOE A;  2PQR A;  2QYU A;  4DI4 A;  3U3W A;  4GYO A;  4N3B A;  2KZT B;  4F7A A;  2KM4 A;  3QK0 A;  2F8Y A;  1ZB1 A;  2X6I A;  3D9O A;  1NA0 A;  1E90 A;  3C72 A;  3VLD A;  1ELW A;  3CVW A;  4FP7 A;  2J8S D;  3HDX A;  2WXL A;  3UI2 A;  1SZA A;  2J9Q A;  4G26 A;  4UWG A;  1H6K A;  3UM3 A;  3IKO B;  3CHQ A;  1Z6T A;  2RD0 A;  1KPS B;  4EBA A;  4XI0 A;  2L6B A;  3ABM E;  3W9G A;  2BKG A;  2RKK A;  3NAW A;  4URK A;  2WQ6 A;  2X6F A;  4C0M A;  3U64 A;  3JXJ A;  4MKT A;  3CK9 A;  4WWO A;  3S7B A;  1OY3 D;  5KCM A;  3ZU7 B;  4J8D A;  2I2O A;  1UOH A;  3CVV A;  4I6G A;  2CG2 A;  3QJZ A;  3FUK A;  2P9K G;  2I1K A;  3E34 A;  3TXM A;  3FUI A;  3ZXS A;  3FH8 A;  2KCK A;  2V5Q C;  2YIN A;  4GU5 A;  4YDO A;  3FUF A;  2VTB A;  3TWU A;  3Q47 B;  5D2M C;  5LCW J;  4GAA A;  4UWF A;  1N9A A;  3PZ1 A;  5C1D A;  1D8E A;  5LCW C;  4JZY A;  4KYO B;  4PS8 A;  3EHR A;  2L0I A;  4GML A;  3AS4 A;  1HH8 A;  5KWD A;  3LDZ A;  4MS6 A;  2JAB A;  3K9I A;  2WXP A;  4L2Y A;  2IQC A;  1B89 A;  4F3V A;  4IRU A;  3DXK G;  2KCV A;  4HNA D;  4K5C A;  1IHG A;  2FI7 A;  4DX6 D;  3D3M A;  1N95 A;  1WAO 1;  3UM0 A;  3HVE A;  4APF A;  2BF0 X;  1MJ0 A;  3T5X A;  4EBA G;  1S63 A;  5ARG A;  1QNF A;  5CEC B;  2B0O E;  2I6H A;  5EX3 A;  3ZYM A;  3RAU A;  1Y6I A;  3DXM G;  1QZ2 A;  3IHY A;  4D10 C;  2XQ0 A;  2XS1 A;  3AU4 A;  1V54 E;  4UWH A;  2XZD G;  4RG6 A;  5AAO A;  3JQ0 A;  1KT0 A;  3FTX A;  4DX1 A;  4EZL A;  4IYP A;  5ARF A;  2GW1 A;  2IFU A;  5HRY A;  5ANL A;  1H2T C;  2NXP A;  3B7S A;  3JXI A;  4B8A A;  2QC9 A;  4JEH A;  2L0T B;  5KJN A;  4L1B A;  1KLX A;  2CHW A;  3AS5 A;  3SBT B;  2NC9 A;  4OAV B;  3L13 A;  5D66 A;  3ZHE B;  1W3B A;  3N71 A;  3D9H A;  2C2L A;  4TXP A;  3ULY A;  2JEK A;  4N2S A;  2WXK A;  2A5E A;  4U95 D;  3CST A;  1MHQ A;  5T8I A;  2DCP A;  3SY2 A;  1OWO A;  1YA0 A;  2WPV A;  1H2U A;  3D9K A;  4J8S A;  1OT8 A;  4IN3 B;  4GZC A;  1EF1 C;  1JPL A;  3E37 A;  1JCQ A;  3O48 A;  4BWR A;  3CR3 A;  4GCN A;  3V30 A;  4A63 B;  4TXR A;  2XRZ A;  3MKQ B;  2OND A;  2GRL A;  3CIA A;  5KJL A;  3KEZ A;  2VJ8 A;  4YVQ C;  4UUC A;  4RLY A;  3FH7 A;  4FA6 A;  3LJ3 A;  4CYM D;  5E76 A;  2L9B A;  4KBQ A;  4PUC A;  1PAQ A;  1IXV A;  4GTS A;  4N2Q A;  1Z5S C;  3G2W A;  4A1G A;  3EU5 A;  4KZ0 A;  2L6J A;  3ZVV A;  4NUR A;  3SBS A;  4H7X A;  3UIO C;  3HXC A;  1PY1 A;  1EDU A;  1H2V C;  2M63 A;  3LS8 A;  3CVU A;  2ETC A;  2R03 A;  4I2W A;  5CRU A;  5LX8 A;  2WXR A;  4B93 B;  4AJW A;  1EPU A;  3S2A A;  4HOT A;  4AY5 A;  3FH5 A;  2FF4 A;  4XIF A;  3SZ7 A;  2MRI A;  1LTX A;  3RKV A;  3ZYK A;  1S64 A;  2WB2 A;  1H19 A;  4CRW A;  1HX8 A;  3TWV A;  4GTQ A;  1JWG A;  1SVX A;  3ABK E;  1FT1 A;  4GA0 A;  3ESK A;  3ML9 A;  5HKP A;  4RG9 A;  1BU9 A;  1ZBP A;  4GZ6 A;  4J8E A;  3SD5 A;  3LCA A;  4FHK A;  4N5C A;  1TEZ A;  5AJL A;  2VGX A;  2X3M A;  2VTB B;  3FTY A;  4LNU D;  2EIL E;  3W9F A;  2XHE A;  4OAU C;  2UY1 A;  5H7P A;  3HYM B;  5HQ8 A;  3T8M A;  2WXO A;  5EKQ D;  2GRO B;  3LY7 A;  3HG0 D;  4ZFH A;  4AOF A;  5LFA A;  5EYP F;  3SFZ A;  3VLF A;  4U04 A;  2AJA A;  2WXQ A;  3U9W A;  3EUV A;  2A5U A;  1DVP A;  3PE3 A;  3UKR G;  2MOW A;  2XGM A;  4FAD A;  3I4G A;  2AWI A;  4CEM A;  3S7D A;  5AN8 A;  2ETA A;  3Q9U C;  4AIF A;  3CEQ A;  4FU3 A;  1X5B A;  1Z3Y A;  1WDY A;  4NIK A;  5ITZ F;  2XPY A;  3DBS A;  5ENQ D;  3TXN A;  2V4H C;  3ESL A;  4PH4 B;  4G24 A;  4ILH B;  4AEZ C;  3TWT A;  3UPV A;  2BUG A;  4I9E A;  3L6A A;  5CHE E;  1DCQ A;  3QWW A;  3FWV A;  2XGS A;  3R9A B;  2XEN A;  3VTY A;  1U3C A;  4FJY A;  2OEV A;  1WG0 A;  4BX8 A;  1L5J A;  5CCM A;  1DCE A;  5LP0 A;  4TRQ A;  3J5P A;  1JCR A;  1RZ4 A;  3B7U X;  5D0Q D;  1DNP A;  2YQ8 A;  4U8Y D;  4G1T A;  4I6E A;  3Q7F A;  5M72 A;  3MGB A;  4LEU A;  2QFC A;  2PL2 A;  2R02 A;  4N5Q A;  4N39 A;  3ONL A;  5AEN A;  2EIK E;  4RQI A;  3R7Q A;  4M3O A;  4I1M A;  4A3T A;  1IYG A;  3P1U A;  1Z3X A;  1N4P A;  2IU1 A;  2P9U G;  3LEW A;  2Y4T A;  3MJW A;  3TWQ A;  3WG7 E;  3GYZ A;  4J8F A;  4NQ0 A;  3AJI A;  3HXD A;  4GB9 A;  4KZC A;  5G04 C;  2ZXW E;  5CCL A;  3BG1 B;  4M7C A;  4A3V A;  3UUX A;  2V0P A;  1NI1 A;  4MLP A;  2IOL A;  1SZ9 A;  3T5V A;  4ATZ D;  4Q94 A;  5DBK A;  3QNK A;  4EPZ A;  3JCK C;  1WY6 A;  3BG0 B;  2VSY A;  2ETB A;  4LNB A;  5J08 A;  4JL0 A;  2ZGG A;  4JD2 G;  2OV8 A;  2H6H A;  5EID A;  3UT8 A;  3ONK A;  2P2C P;  3HXB A;  5FQ7 A;  1QQE A;  3G2T A;  2YNQ A;  1INZ A;  3OXG A;  4B89 A;  3J5Q B;  2EIJ E;  2EIM E;  5ANR A;  2LAH A;  3KD7 A;  4ILI A;  1ELR A;  5B1B E;  5LOZ A;  2DBA A;  4E85 A;  3CKC A;  4CGW A;  2DIW A;  3APC A;  3PRZ A;  3X2Q E;  2F0Y A;  3ZUV B;  3AG4 E;  1KT1 A;  3S7J A;  3AAA C;  3EIJ A;  3ENE A;  4TUM A;  4DK5 A;  4RVB A;  5T3R A;  1HXI A;  4GTP A;  1SA5 A;  4HOR A;  1HG2 A;  3R7R A;  3CQG B;  2E2E A;  3PRE A;  2QZA A;  4AXH A;  2GGF A;  3DSX A;  3IV0 A;  5CBO A;  2XRY A;  3QWP A;  4K0R A;  3Q73 A;  2CG3 A;  3QB2 A;  3MKR A;  3ZN3 A;  5CED B;  3LJN A;  4EQF A;  4U96 D;  4PS7 A;  4AV7 A;  4O1O A;  4F53 A;  2HE0 A;  3UTM A;  4L7T A;  5JHA A;  3TWW A;  1TNO A;  4LSZ E;  3PUJ A;  1E7U A;  3DPY A;  4GZ5 A;  4WNE A;  2OEW A;  3G2S A;  4HXI A;  2FO1 E;  3EDT B;  5BXU A;  3CGH A;  3RJV A;  4B8C B;  5ENN A;  1TYQ G;  2P9P G;  2J49 A;  3ZIM A;  3QWV A;  4UWL A;  3PDN A;  1SA4 A;  4I9C A;  3PE4 A;  4JA7 A;  2X6K A;  4JVS A;  1N11 A;  4WWP A;  3QAQ A;  3V2X A;  2RFA A;  2YHC A;  1K1B A;  2LAI A;  5FQ8 A;  2VSX E;  3CVX A;  3FUD A;  3OXL A;  1E96 B;  2R5S A;  5EN5 D;  3Q4A B;  1K8K G;  3UQ3 A;  2WXH A;  3FUN A;  3ZNG A;  3RO2 A;  3RRM B;  3HRA A;  1S70 B;  2OVF A;  2P9S G;  2J08 A;  4C48 B;  2XGO A;  5BV1 A;  5CMY A;  3HIZ A;  1HG5 A;  3CSF A;  3CVP A;  4WAF A;  4QQI A;  2PNN A;  4U0U A;  3ISM C;  1OCC E;  3ZFW A;  4BEP A;  4HFG A;  3DPD A;  4YDY A;  3NBN B;  3L16 A;  3CVN A;  3GZS A;  3DWL G;  2H6I A;  4MBG A;  4YND A;  2JLB A;  1IQR A;  4N3A A;  4NAC A;  4ACL A;  3DEO A;  2LO6 A;  3CV0 A;  3NQP A;  3UIN C;  3SNX A;  4CDN A;  3ASG A;  1JCS A;  1SW6 A;  4GTO A;  4V3I A;  3EHN A;  2KCL A;  4ACK A;  4KVM A;  1O5M A;  2XS8 A;  1E8Z A;  1BD8 A;  2OCC E;  5J90 A;  1GW6 A;  5AYW D;  1H6O A;  2LSV A;  1OWL A;  5FIN A;  3C98 A;  3MEK A;  4HI9 A;  4FLB A;  4J7W A;  4JEU A;  2GRR B;  5G2N A;  4FC8 A;  3FTS A;  5JJ6 A;  3CVL A;  4DPR A;  1YMP A;  3C3R A;  3IEG A;  2R17 C;  2OVB A;  2VGY A;  4XKB A;  3FTU A;  3TWS A;  4EEC A;  5EDS A;  4CCA A;  2KZT A;  3JUI A;  3ULE G;  5KBA A;  3ZYL A;  4GMJ A;  1N4Q A;  4AM9 A;  2IEJ A;  1LF8 A;  1OWN A;  3TWX A;  4C0E A;  3L08 A;  1TNZ A;  3DRA A;  2IJG X;  1E7V A;  3PNL B;  2DYS E;  4HRN A;  5G55 A;  3SF4 A;  3CVY A;  4KMO A;  5JJT A;  1VDY A;  4APO A;  3KEA A;  5C2Y A;  3UXG A;  4U63 A;  4TV3 A;  1OCR E;  3E33 A;  1OCZ E;  2IF4 A;  2IY0 C;  3T9K A;  3I4R B;  1Y8M A;  4A55 A;  3AU5 A;  4UI9 J;  1FVH A;  1HU3 A;  2KC7 A;  2XCC A;  4WNG A;  2GRP B;  4UI9 C;  4GTT A;  1QBQ A;  3R9M A;  3V79 K;  3SI5 A;  1K3Z D;  3Q9N C;  5BPP A;  2GRN B;  4BTB A;  3PZ2 A;  3QC1 A;  2BED A;  5IY5 E;  4UI9 K;  5ENT D;  1G3N B;  2ZU6 B;  4BSZ B;  4H7Y A;  1TNY A;  5CEA A;  5AQ9 A;  3NB2 A;  2C0L A;  2F37 A;  3CHR A;  4PDX A;  2I9C A;  1LD8 A;  3ASO E;  3KSL A;  3L54 A;  3RRN B;  4K5A B;  3TAX A;  3TJP A;  3CK7 A;  5AQB A;  4B94 A;  3Q15 A;  3DSS A;  1NFI E;  4OVV A;  2NYJ A;  3ULQ A;  4TUU A;  1HFA A;  5FT9 A;  3P2B A;  5KNG A;  2XZT G;  1HO8 A;  5ENS D;  1NL4 A;  4I2Z A;  2LUH A;  2MHK A;  3OXF A;  5AIJ A;  4AVX A;  1UN9 A;  2LNI A;  2V5F A;  5AAR A;  4L9P A;  2C0M A;  4HLE A;  4UQX A;  3EHQ A;  3KAE A;  1TN8 A;  4F1P A;  4Z68 A;  3NOC D;  2E0I A;  3DSW A;  1SQM A;  1UW4 B;  1BI8 B;  3HVE B;  3CLJ A;  1E8W A;  4QFV A;  3PZD A;  4CDM A;  4DX2 A;  4ANW A;  5FWQ A;  3Q49 B;  2DZN A;  2WM9 A;  3PVL A;  1N0Q A;  2R05 A;  2FEZ A;  2P9L G;  5E75 A;  2KXP C;  3E30 A;  3EHM A;  3JQ1 A;  4FUL A;  4ME2 A;  4CDR A;  2XEV A;  1OUV A;  5EYL A;  3FDH A;  4BTA A;  5AQ7 A;  2B6C A;  1N4S A;  1FPP A;  3JUE A;  4L23 A;  3ZHE A;  4CT4 A;  1QYM A;  2AVP A;  4O1P A;  3FY4 A;  3MV3 B;  1IQU A;  2WXN A;  5BNW A;  3ZW3 A;  3HHM A;  4XX5 A;  3FU3 A;  3SO8 A;  5A6C A;  3SHF A;  4HS2 A; 
#chains in the Genus database with same CATH homology
 4GTP A;  1SA5 A;  1N4P A;  1NL4 A;  3C72 A;  3DSX A;  1TN6 A;  1O1S A;  2H6G A;  3DSU A;  3Q73 A;  1O1R A;  1FT2 A;  3HXD A;  4L9P A;  3SFY A;  3E33 A;  1KZP A;  4GTM A;  2ZIS A;  2H6I A;  1N95 A;  1LTX A;  4MBG A;  3E37 A;  1JCQ A;  1TN8 A;  3PZ3 A;  1NI1 A;  1S64 A;  3DSW A;  1TNO A;  1S63 A;  4GTT A;  3DPY A;  1QBQ A;  4GTQ A;  1TN7 A;  3Q78 A;  2H6F A;  1FT1 A;  1TNB A;  1JCS A;  4GTO A;  1O1T A;  3Q7A A;  3E32 A;  4LNB A;  3Q75 A;  1O5M A;  1N94 A;  3PZ2 A;  1DCE A;  1KZO A;  2H6H A;  2BED A;  3E30 A;  3HXB A;  1X81 A;  1MZC A;  4GTV A;  3DSV A;  1JCR A;  3Q79 A;  3E34 A;  1LD7 A;  1SA4 A;  3HXE A;  1TNY A;  4YDE A;  1N4S A;  1FPP A;  4LNG A;  3HXF A;  3KSQ A;  3Q7F A;  1LD8 A;  2R2L A;  2ZIR A;  4GTS A;  3DST A;  3KSL A;  4YDO A;  3PZ4 A;  4EHM A;  1TNU A;  3EU5 A;  2F0Y A;  1N4Q A;  2IEJ A;  3SFX A;  3DSS A;  1N4R A;  1N9A A;  4GTR A;  3HXC A;  1D8D A;  3EUV A;  3PZ1 A;  1D8E A;  1TNZ A;  3DRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...