1X81A

Farnesyl transferase structure of jansen compound
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, synthesis, and activity of 4-quinolone and pyridone compounds as nonthiol-containing farnesyltransferase inhibitors.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
total genus 103
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1x81A00
1TNZA 1N4PA 3Q7FA 3HXBA 1JCQA 3E37A 3PZ1A 3PZ3A 4YDOA 3PZ4A 1O1SA 3E34A 1LD7A 3KSQA 4GTRA 4GTTA 3E32A 1D8EA 3HXDA 1TN8A 4YDEA 4GTOA 1SA5A 1S64A 2BEDA 1TN6A 3KSLA 1FT1A 2H6IA 3DSWA 4GTVA 2H6FA 4L9PA 1S63A 3Q75A 3EU5A 2ZISA 2ZIRA 1QBQA 1DCEA 3Q78A 1FPPA 1NL4A 1TNBA 3HXFA 4LNBA 2IEJA 4GTQA 4GTPA 1TNOA 1D8DA 4EHMA 1O1TA 2R2LA 3Q73A 3E33A 3DSUA 4GTSA 3Q79A 1N4QA 1N4RA 1NI1A 3DRAA 3EUVA 2H6HA 3DSXA 1TNUA 3Q7AA 1JCRA 3C72A 3E30A 1LTXA 3SFYA 4LNGA 2F0YA 4MBGA 1N94A 1KZOA 1TN7A 1N4SA 2H6GA 1FT2A 1O1RA 1SA4A 1LD8A 1KZPA 1MZCA 3DPYA 3HXEA 1N9AA 1O5MA 3DSVA 4GTMA 3DSTA 1X81A 3HXCA 3SFXA 3DSSA 1N95A 1JCSA 3PZ2A 1TNYA
chains in the Genus database with same CATH superfamily
1RZ4A 3Q7FA 4PH4B 3CK9A 2E0IA 5BPPA 3LVRE 5FQ4A 5B1BE 5DBKA 3SD5A 1E7UA 3C3QA 4QFVA 4XKBA 4DRXE 2XS1A 1D8EA 2EILE 3BU8A 2F37A 5ARGA 4DK5A 3KAEA 1P5QA 4PUCA 4B8AA 3FUFA 3QJZA 2XEEA 3ZUVB 5ANLA 1FPPA 3FUIA 4BY6A 4HOUA 1H2VC 2MOWA 1TNOA 4NRHB 3CHMA 3NAWA 3FUNA 3FU3A 3CVVA 3PS6A 4HLLA 5T3RA 5EN5D 5J08A 2X6HA 4GA2A 3FUJA 2LSUA 3L17A 4MBGA 3AG4E 4JPSA 2WVIA 4Q96A 3D9LA 3ZXPA 5A23A 4BERA 2QYUA 3PDNA 4XEIG 3ASHA 5JHAA 2J4BA 1U3CA 4L2LA 4K0RA 2BUGA 3ESKA 4JHJA 2FEZA 1TNZA 4HOQA 2CG3A 1TR4A 2IQCA 5JMND 3TJPA 2Y4TA 2CG2A 2WXFA 1OUVA 4GCNA 2PM6A 3E34A 3FUDA 3KEAA 2UY1A 2GRRB 4U8HA 4CDRA 2WMNA 4U04A 5CERB 4GPKA 1UN9A 1NL4A 2BF0X 2L6BA 3K9IA 1SZAA 4QQIA 4RSYA 5CBNA 4EHMA 3P2BA 3APDA 4GTSA 4LRZA 4HRMB 1NI1A 2RD0A 4J7WA 1IXVA 2J8SD 3IHVA 2P9KG 3U4TA 3RK6A 3LKUA 1HX8A 2IJGX 1TN7A 5CBOA 3GZ2A 4GU5A 2KCKA 2DIWA 2HYZA 4RG6A 3SI5A 2LO6A 1H2TC 4FLHA 1AWCB 5DIZA 5ENTD 2RG8A 2Y3AA 1E90A 2GRQB 3FH8A 4J8EA 1E8YA 3URZA 2X38A 3JXJA 1BU9A 4J6IA 1TNYA 4TV3A 3ZW3A 1OCZE 2HO1A 5AJDA 5AQBA 3D9HA 3E37A 4TXPA 3MV2B 5CCMA 3U66A 2WXRA 4CYMD 3HDXA 4CEMA 2VTBA 5FZRA 2AJAA 3D9JA 4ANVA 1Q2ZA 3AG3E 1NFIE 4GTVA 4L9PA 3G2UA 3FP3A 4HXIA 2EIKE 3UT7A 3PUKA 3UKRG 3CHSA 3FTUA 4DX5D 4I2ZA 3ZXSA 5LFAA 3ONKA 2IOLA 1OXJA 3U3WA 1MQSA 4A1GA 1UN8A 1H6KA 3CLJA 4RQIA 4C9BB 3UIPC 3JUEA 2XHEA 2KCVA 4JA9A 3SZ7A 1Z3XA 2QYJA 2WXIA 4XI0A 1D9SA 3FDHA 1DC2A 5FIOA 4FJYA 3FH7A 3ULEG 3EHRA 5CHEE 4B89A 3L16A 4DX6D 1MHQA 5FWQA 2OOEA 3RRNB 2ILRA 4BSZB 4KVMA 2GRLA 3DSVA 3LS8A 4JXTA 3T8MA 1VDYA 3FTWA 3QB2A 5AQAA 4Q69A 4UWFA 5C2YA 1Z5SC 5T4YA 2WM9A 1EF1C 3JQ1A 1SZ9A 4ANXA 3BG1B 3EIJA 1OWOA 4ACKA 2ZXWE 3TXNA 5KJMA 4GTOA 2X6JA 1S64A 3V2XA 2DYSE 3TWTA 1B89A 1BPOA 3QWVA 4HRLA 4G23A 4KYOB 5FTPA 3PE3A 4BT9A 4GYWA 3NF1A 4EZLA 4B94A 4L1BA 4DJAA 4J0UA 4K03A 2VJ8A 5LP0A 1WDYA 3EJNA 3CSTA 2VQ2A 2IY0C 2H6HA 4ATZD 4UWLA 1IHBA 3LXUX 3ZVVA 5CEDB 3L9TA 2I1JA 1BLXB 2ZU6B 1TJFA 4F3VA 1HXIA 2E2EA 3UINC 5EIBE 4UWGA 2L9BA 4IYPA 1HS6A 3RSEG 1ZB1A 4CGWA 1HE8A 3ZFWA 4LCTA 5EDSA 1KPSB 3VLEA 3RJVA 3OXLA 3ONLA 5A7DB 2GRNB 3D3MA 5KJNA 3CVQA 1JCQA 4I43A 2PNNA 3G2WA 4XKCA 3I4RB 2XQ0A 4DLQA 3FU5A 4BT8A 1TN8A 4Y6CA 3UM0A 5C1DA 2NXPA 2BEDA 4I17A 2VTBB 5J90A 4OYSA 3MCXA 1HZ4A 1W3BA 1QNFA 2WXMA 1AP7A 4KVOA 1QYMA 3KS2A 1NZNA 3MGBA 3O4ZA 3ZNGA 3U9WA 4L7TA 3RAUA 5CRVA 5HQ8A 5ENPD 3MX3A 4EBAG 3DXMG 3SBTB 2P9SG 3FULA 4J8DA 3DXKG 3JXIA 3ASDA 4G2VA 2VSOE 1EYHA 3CK8A 2KZTB 2JLBA 1KLXA 4U95D 4RVBA 2WQ7A 4GYOA 4GZCA 3SFYA 2FF4A 3PE4A 3WG7E 2XCBA 2XZDG 3UIOC 3ZYMA 4EBAA 1N54A 5KNHD 1MJ0A 3CGHA 5BNWA 3Q49B 4B93B 5AQ7A 2YHCA 1JUQA 2V8SE 1O5MA 4LG6A 1WAO1 3V30A 2HR2A 2R03A 2RFAA 1X5BA 4JHRA 2FBNA 2WXNA 3SFXA 3ZKJA 4CDMA 4FP7A 3FTZA 2AXZA 1Z3YA 3D9PA 1OWPA 2P9LG 1HF8A 2OEWA 4G24A 3PNLB 3KEZA 4UUCA 2WXHA 4I2WA 1V54E 3T5XA 4BEPA 3UKUG 5G04C 2EIME 4APFA 3R9MA 5EX3A 1Y6IA 4JVSA 1YCSB 3Q75A 4N2SA 3FEYA 2A5UA 3J5QB 4U7EB 5JA4D 2X3MA 4F1SA 4JC8A 4UWKA 3APCA 3DWLG 3CKBA 2MYOA 3NZSA 1N4RA 4X8QA 1YA0A 3FU6A 3N71A 4IULA 3HVEA 4A3VA 3C72A 1FVFA 5B3SE 2VSNA 3TWQA 3FEXA 5T8IA 4U0UA 3S2AA 4HNAD 5G05J 3FH5A 3FTYA 4IRUA 3L82A 4GTMA 4K5BA 2FI7A 4NIKA 1NA3A 2PQNA 5D2MC 2MRIA 3TWSA 2AWIA 4HOSA 3TWRA 1N4PA 5CMYA 2M63A 3DBSA 3TWXA 4WWOA 1BD8A 2EQXA 3E32A 5KNGA 2VGXA 1K1AA 3ABME 1TYQG 3FTSA 3ABKE 1H19A 1HG5A 2VGXB 4YVQC 5LCWJ 2R5SA 3GZSA 2PZIA 3F6QA 5AENA 2R05A 1UW4B 3JCKC 1UG3A 2WXLA 2CHZA 3UX4A 2UY1B 3QDNA 2NC9A 5HI7A 3NOGD 4G8KA 4UQYA 3HRAA 1LF8A 2IFUA 4JB8P 3RU0A 1A17A 3SGHA 3IBEA 4N3CA 2HM8A 2YQ8A 1L5JA 4F1PA 2Y69E 2WPVA 4K5AB 5HS0A 4BSXA 2ZGDA 4IN3B 2EINE 3S7FA 2XS8A 4GZ5A 1N0QA 4MRUA 5FZQA 2IONA 5KJLA 5EX0A 3HVEB 3T5VA 2JEKA 1H6PA 5KBAA 3HXEA 4TXQA 1OCRE 5LOZA 3ULQA 4NACA 3S7JA 3MA5A 4JEUA 4ZHBA 1WY6A 1X81A 2WQHA 2LAIA 4I6JA 4U0ZA 4U63A 5AQ9A 4G8LA 4G1TA 4JHKA 2XCCA 1OY3D 2A4ZA 3HIZA 4FHJA 2OVBA 3TAXA 4U07A 4FLBA 1EPUA 5ENQD 4J8YA 2XRZA 1H6OA 4BETA 5EYLA 3R7RA 4KZ0A 2XENA 4LNUD 1TEZA 1DCEA 3CVWA 2LAHA 2Y4UA 2CFZA 3MV3B 2XGMA 5B1AE 2AXUA 3E4BA 3E33A 5CCLA 4WNFA 2WXPA 4PS3A 4LEUA 1N4QA 4AY5A 4F6RD 2AXVA 2C0LA 3CKCA 3LY7A 4D10C 3L54A 2LNIA 2J4DA 1E8XA 5AJLA 3CHQA 4EPZA 4XIFA 1LTXA 3S7DA 2MHKA 2BTDA 4GZ3A 3B13A 4JZYA 2AW6A 3NZUA 1N11A 1HH8A 1FVHA 4UI9K 3JUIA 4R7LA 2WQ6A 5D0QD 3W9FA 3P1UA 5A6CA 3ZPJA 4OAVB 5LX8A 4MS6A 2KZTA 2P9IG 2C0MA 4OVUA 2VSXE 4GA0A 3FTVA 1UJKA 2GRPB 4AY6A 3EU9A 4N39A 3CVUA 3FFLA 4ATGA 5BUZA 2KBXA 3NB2A 4CRWA 3J5PA 2DZOA 2QZAA 4BTBA 3CHPA 2GROB 4FJZA 3TXMA 4DI4A 1ELKA 2P9NG 1YYHA 3T8KA 3FHEA 3ML9A 2X6FA 5BV0A 2KCLA 3CVLA 2XEVA 4A63B 3ZYKA 4ABNA 1E7VA 2V4HC 3TL5A 2OVFA 4JA7A 2H6IA 4PDXA 3UQ3A 2J08A 2VSYA 1H0AA 2P58C 5BXUA 1TNBA 3G2VA 3D9NA 2DZNA 3RRUA 4JEHA 3CVYA 3FUHA 5JJ7A 2WXJA 3UTMA 3ENEA 3LYAA 4HVBA 3DSUA 2B6CA 3Q79A 2PQRA 3DPDA 3LEWA 4YDWA 4EZJA 2YINA 4UI9C 2P9UG 1E96B 4ILGA 4WNEA 3L08A 5CECB 5FQ7A 2LUHA 1U2VG 2HE0A 1KZOA 1N4SA 4WNGA 4U96D 1O1RA 1A5EA 3C5RA 4CDNA 1OCCE 4LERA 2FULA 3RRMB 5IY5E 3HXCA 4B8CB 2Q7FA 3ISMC 1HG2A 2DWZA 4GCOA 4DX2A 4AEZC 5HRYA 4ILIA 3HHMA 1DVPA 3ASOE 2ETAA 3TGOA 1LD7A 4CGVA 3CIAA 4GTRA 5FT9A 5FQ6A 4DI3A 3CQCB 1SA5A 3FY4A 1E8ZA 1XNFA 1TJCA 3B7UX 2F8YA 4GAAA 3EU5A 1UJJA 4I9CA 4J8FA 4BESA 4TUUA 2IO2C 2PL2A 3ZU7B 2IF4A 3C98A 3SNXA 2I9CA 2GGFA 4BFRA 3LJNA 3LJ3A 3EDTB 2V5FA 5CMWA 3ZYLA 1WG0A 2DYRE 3CR3A 2KXPC 4EECA 4N5QA 3MKQB 1ELRA 4H7XA 4B0ZA 2P9PG 3PREA 3SBSA 3OTNA 3UM2A 5CEAA 4AJWA 3V31A 2WXQA 1KT0A 4AOFA 3UMVA 4AXHA 3DPYA 4EZKA 4ME2A 2OV8A 2VGYA 2R59A 2V4LA 5ITZF 1IQUA 1PC2A 2KATA 4DUIA 4KBQA 4E85A 2DCPA 4GA1A 3WXXA 4Y6WA 4GMLA 2NYJA 4YDOA 3PZ3A 1FCHA 3B7SA 4U8YD 1O1SA 4ZFHA 4BTAA 3ABLE 3ZN3A 4HB5A 1Z6TA 3IXEA 4GZ6A 2YNQA 3Q4AB 2LXMA 1V55E 1E8WA 4GPMA 3LPZA 4TXRA 1DNPA 3B7RL 3AG1E 3Q47B 2XPYA 3LY8A 3ASGA 4E6HA 4DX1A 2XGSA 5G2NA 4ANUA 3MKRA 3VTYA 1O1TA 2AVPA 2KC7A 4MKTA 1MX4A 4GYYA 4CCAA 2P2CP 3PUJA 4GMRA 4O6FA 3RIBA 3EUVA 4WWPA 3SO8A 4L2YA 1TNUA 4HFGA 4AP2A 2V5QC 4L23A 3ASNE 2XRYA 3E30A 3DEPA 1KT1A 1IHGA 3RO3A 1BI8B 5ANRA 2LXLA 2I6HA 3D9KA 4FADA 1PAQA 1K8KG 2R17C 3AS4A 5LCWC 2IOSA 3MYVA 3EHNA 3U64A 4I6EA 3UUXA 1K1BA 2EIJE 2YHEA 3PRZA 2GW1A 4ILHB 3AS8A 3HXBA 4FU3A 1IKND 3W9GA 5AAOA 3R9AB 2J49A 4O1OA 2OEVA 4TUMA 4EQFA 2C2LA 3LDZA 3HXDA 5EILA 4BX9A 2FO1E 4O60A 4WAFA 5E75A 3Q15A 3AAAC 4HBDA 2XEHA 4RLYA 3UPVA 3HYMB 1SVXA 2WMOA 2I1KA 2FO7A 3ZHEB 4XZ4A 4Z68A 5AARA 5EKQD 3OXGA 5FJYA 3ZRHA 1IQRA 5CRUA 4P29A 1MYOA 3DSXA 4WUYA 1U3DA 4URKA 2XPZA 1N94A 4J8SA 4FC8A 3BEEA 4JW1A 5ENRD 3AU4A 1FT2A 3UT8A 1N52A 2ZGGA 1SA4A 2KM4A 4HOTA 3CVPA 4WWNA 3OXFA 1JWFA 3T9KA 3I4GA 1MX2A 4V3IA 3CVNA 3V79K 2QC9A 3DSSA 1N95A 4OAUC 4G26A 4OVVA 5BT1A 5JJTA 4AVXA 4M3OA 5FZSA 5H7PA 3ZEFA 4U8VD 3R7QA 3MJWA 3CSFA 1NP7A 4FHKA 3EHMA 3KD7A 2JABA 2J9QA 3QARA 3CK7A 4YDEA 3GYZA 4F7AA 5JHBA 4DX7D 1SQMA 4JL0A 1FT1A 2X6IA 4XX5A 2A5EA 5AYWD 4A3TA 4UQZA 5BW8C 1MX6A 4I9EA 1PY1A 1JWGA 3FUMA 4LNBA 4MLPA 4HLEA 2J09A 4A1SA 1UOHA 3TWVA 4CT0A 4DPRA 3RKVA 2R2LA 3FUEA 4ANWA 3Q9UC 3TG4A 2DVWA 3DRAA 4PS7A 3LVQE 1GW6A 3EHQA 3PVLA 3FTXA 3Q7AA 2LSVA 4HI8A 2X6KA 3ZHEA 3JQ0A 2WXKA 3B7BA 2F0YA 5KWDA 3QNKA 5G04J 5ENSD 3QWPA 3AU5A 3BG0B 4KMOA 3NBNB 1OWNA 2B0OE 4HRNA 1N9AA 4BX8A 4GB9A 4YNDA 2XGOA 3DSTA 3Q9NC 4TRQA 1BI7B 1NA0A 4FULA 1JCSA 3GW4A 3OAWA 1EDUA 2PM7A 3CQGB 3UM1A 2NSZA 3C3RA 3UI2A 5FINA 3O48A 4N3BA 3QWWA 5ENNA 4GTTA 5EYPF 3D9IA 1TN6A 5ARFA 2Y0BG 3TG5A 3HG0D 1XGWA 3JYSA 4FA6A 2DBAA 4HQDA 2ZIRA 4XI9A 3TWUA 3G2TA 1OT8A 2J07A 4GZDA 4WNDA 2RKKA 5JJ6A 1YMPA 3LY9A 4KXKB 3PNTB 4RG9A 3ESLA 4KT6B 3SF4A 3ULYA 4F53A 2IO3C 2VYIA 1ZU2A 2ETCA 2WXOA 3X2QE 2ONDA 3I5PA 3ML8A 2VGEA 4LUNU 3L6AA 5E76A 1RW2A 4LNGA 1QZ2A 3QOUA 4APOA 2CHXA 2H6GA 1N0RA 5KJKA 4AIFA 4GMJA 5KCMA 3SQVA 1MZCA 2L0TB 2UWJG 1HU3A 3RO2A 4G11A 4HORA 4YVOA 4Q94A 2L0IA 3SY2A 3AJIA 3UXGA 3PZ2A 4HS2A 2BKGA 5D0OD 3MKQA 5ENOD 3GZ1A 3BQOA 4DLOA 1OWMA 2V0PA 3KSQA 3MEKA 4YDYA 3UT4A 1H2UA 1DCQA 1WM5A 3QKYA 4G25A 2IU1A 4N2QA 3SHFA 5BXOA 1SW6A 4PS8A 2CHWA 3KSLA 1INZA 1G3NB 1K3ZD 3IV0A 3DSWA 3ZGQA 3VTXA 4AM9A 1S63A 2ZISA 1ELWA 1QBQA 2BKKB 4C0EA 3Q78A 5G05C 3QC1A 1OWLA 2IEJA 4GTQA 4C0MA 3AG2E 3PH0C 4GTPA 3L13A 2RFMA 4I1OB 1D8DA 3IEGA 4AV7A 3APFA 3Q73A 2XPIA 3ASFA 1S0PA 4A55A 2OCCE 3IHYA 3B95A 5HKPA 3V2OA 4UI9J 4O1PA 3I3NA 2XZTG 1Y8MA 3D9MA 3PEVB 4I1MA 1LD8A 1KZPA 4HI9A 3VLFA 3CEQA 3QAQA 4CZ2D 2L6JA 4I6GA 4UQXA 1HO8A 4UWHA 3FWVA 5D66A 3NQPA 4LSZE 3S7BA 3PZ1A 3AS5A 3PZ4A 2R02A 4BWRA 1HFAA 3SFZA 3CVXA 2ETBA 2QY7A 3PEUB 3TWWA 2CFUA 3ZIMA 1JPLA 4N3AA 1IYGA 3G2SA 3NOCD 2H6FA 1ZBPA 5AIJA 3D9OA 4ACLA 3HXFA 5EIDA 4U0SA 5AN8A 3ZYQA 3FUKA 4M7CA 3LCAA 4JD2G 3CHOA 3MZLB 4C48B 1QQEA 3CV0A 2GRMA 3QK0A 3B7TA 3VLDA 3CHRA 4W9RA 4H7YA 4I1AA 3C3OA 2Y1LE 5BV1A 1JCRA 5FQ8A 5M72A 4NQ0A 4NURA 3PZDA 3L22A 3EIQC 3UM3A 2WB2A 3FU0A 2QFCA 1OCOE 2WXGA 3BUAA 4KZCA 3IKOB 1S70B 3DEOA 4N5CA 4K5CA 4XE0A 2I2OA 4CT4A 3Q5MA 2F8XK 5G55A
chains in the Genus database with same CATH topology
1TNZA 1N4PA 3Q7FA 3HXBA 1JCQA 3E37A 3PZ1A 3PZ3A 4YDOA 3PZ4A 1O1SA 3E34A 1LD7A 3KSQA 4GTRA 4GTTA 3E32A 1D8EA 3HXDA 1TN8A 4YDEA 4GTOA 1SA5A 1S64A 2BEDA 1TN6A 3KSLA 1FT1A 2H6IA 3DSWA 4GTVA 2H6FA 4L9PA 1S63A 3Q75A 3EU5A 2ZISA 2ZIRA 1QBQA 1DCEA 3Q78A 1FPPA 1NL4A 1TNBA 3HXFA 4LNBA 2IEJA 4GTQA 4GTPA 1TNOA 1D8DA 4EHMA 1O1TA 2R2LA 3Q73A 3E33A 3DSUA 4GTSA 3Q79A 1N4QA 1N4RA 1NI1A 3DRAA 3EUVA 2H6HA 3DSXA 1TNUA 3Q7AA 1JCRA 3C72A 3E30A 1LTXA 3SFYA 4LNGA 2F0YA 4MBGA 1N94A 1KZOA 1TN7A 1N4SA 2H6GA 1FT2A 1O1RA 1SA4A 1LD8A 1KZPA 1MZCA 3DPYA 3HXEA 1N9AA 1O5MA 3DSVA 4GTMA 3DSTA 1X81A 3HXCA 3SFXA 3DSSA 1N95A 1JCSA 3PZ2A 1TNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNZ A;  1N4P A;  3Q7F A;  3HXB A;  1JCQ A;  3E37 A;  3PZ1 A;  3PZ3 A;  4YDO A;  3PZ4 A;  1O1S A;  3E34 A;  1LD7 A;  3KSQ A;  4GTR A;  4GTT A;  3E32 A;  1D8E A;  3HXD A;  1TN8 A;  4YDE A;  4GTO A;  1SA5 A;  1S64 A;  2BED A;  1TN6 A;  3KSL A;  1FT1 A;  2H6I A;  3DSW A;  4GTV A;  2H6F A;  4L9P A;  1S63 A;  3Q75 A;  3EU5 A;  2ZIS A;  2ZIR A;  1QBQ A;  1DCE A;  3Q78 A;  1FPP A;  1NL4 A;  1TNB A;  3HXF A;  4LNB A;  2IEJ A;  4GTQ A;  4GTP A;  1TNO A;  1D8D A;  4EHM A;  1O1T A;  2R2L A;  3Q73 A;  3E33 A;  3DSU A;  4GTS A;  3Q79 A;  1N4Q A;  1N4R A;  1NI1 A;  3DRA A;  3EUV A;  2H6H A;  3DSX A;  1TNU A;  3Q7A A;  1JCR A;  3C72 A;  3E30 A;  1LTX A;  3SFY A;  4LNG A;  2F0Y A;  4MBG A;  1N94 A;  1KZO A;  1TN7 A;  1N4S A;  2H6G A;  1FT2 A;  1O1R A;  1SA4 A;  1LD8 A;  1KZP A;  1MZC A;  3DPY A;  3HXE A;  1N9A A;  1O5M A;  3DSV A;  4GTM A;  3DST A;  1X81 A;  3HXC A;  3SFX A;  3DSS A;  1N95 A;  1JCS A;  3PZ2 A;  1TNY A; 
#chains in the Genus database with same CATH topology
 1RZ4 A;  3Q7F A;  4PH4 B;  3CK9 A;  2E0I A;  5BPP A;  3LVR E;  5FQ4 A;  5B1B E;  5DBK A;  3SD5 A;  1E7U A;  3C3Q A;  4QFV A;  4XKB A;  4DRX E;  2XS1 A;  1D8E A;  2EIL E;  3BU8 A;  2F37 A;  5ARG A;  4DK5 A;  3KAE A;  1P5Q A;  4PUC A;  4B8A A;  3FUF A;  3QJZ A;  2XEE A;  3ZUV B;  5ANL A;  1FPP A;  3FUI A;  4BY6 A;  4HOU A;  1H2V C;  2MOW A;  1TNO A;  4NRH B;  3CHM A;  3NAW A;  3FUN A;  3FU3 A;  3CVV A;  3PS6 A;  4HLL A;  5T3R A;  5EN5 D;  5J08 A;  2X6H A;  4GA2 A;  3FUJ A;  2LSU A;  3L17 A;  4MBG A;  3AG4 E;  4JPS A;  2WVI A;  4Q96 A;  3D9L A;  3ZXP A;  5A23 A;  4BER A;  2QYU A;  3PDN A;  4XEI G;  3ASH A;  5JHA A;  2J4B A;  1U3C A;  4L2L A;  4K0R A;  2BUG A;  3ESK A;  4JHJ A;  2FEZ A;  1TNZ A;  4HOQ A;  2CG3 A;  1TR4 A;  2IQC A;  5JMN D;  3TJP A;  2Y4T A;  2CG2 A;  2WXF A;  1OUV A;  4GCN A;  2PM6 A;  3E34 A;  3FUD A;  3KEA A;  2UY1 A;  2GRR B;  4U8H A;  4CDR A;  2WMN A;  4U04 A;  5CER B;  4GPK A;  1UN9 A;  1NL4 A;  2BF0 X;  2L6B A;  3K9I A;  1SZA A;  4QQI A;  4RSY A;  5CBN A;  4EHM A;  3P2B A;  3APD A;  4GTS A;  4LRZ A;  4HRM B;  1NI1 A;  2RD0 A;  4J7W A;  1IXV A;  2J8S D;  3IHV A;  2P9K G;  3U4T A;  3RK6 A;  3LKU A;  1HX8 A;  2IJG X;  1TN7 A;  5CBO A;  3GZ2 A;  4GU5 A;  2KCK A;  2DIW A;  2HYZ A;  4RG6 A;  3SI5 A;  2LO6 A;  1H2T C;  4FLH A;  1AWC B;  5DIZ A;  5ENT D;  2RG8 A;  2Y3A A;  1E90 A;  2GRQ B;  3FH8 A;  4J8E A;  1E8Y A;  3URZ A;  2X38 A;  3JXJ A;  1BU9 A;  4J6I A;  1TNY A;  4TV3 A;  3ZW3 A;  1OCZ E;  2HO1 A;  5AJD A;  5AQB A;  3D9H A;  3E37 A;  4TXP A;  3MV2 B;  5CCM A;  3U66 A;  2WXR A;  4CYM D;  3HDX A;  4CEM A;  2VTB A;  5FZR A;  2AJA A;  3D9J A;  4ANV A;  1Q2Z A;  3AG3 E;  1NFI E;  4GTV A;  4L9P A;  3G2U A;  3FP3 A;  4HXI A;  2EIK E;  3UT7 A;  3PUK A;  3UKR G;  3CHS A;  3FTU A;  4DX5 D;  4I2Z A;  3ZXS A;  5LFA A;  3ONK A;  2IOL A;  1OXJ A;  3U3W A;  1MQS A;  4A1G A;  1UN8 A;  1H6K A;  3CLJ A;  4RQI A;  4C9B B;  3UIP C;  3JUE A;  2XHE A;  2KCV A;  4JA9 A;  3SZ7 A;  1Z3X A;  2QYJ A;  2WXI A;  4XI0 A;  1D9S A;  3FDH A;  1DC2 A;  5FIO A;  4FJY A;  3FH7 A;  3ULE G;  3EHR A;  5CHE E;  4B89 A;  3L16 A;  4DX6 D;  1MHQ A;  5FWQ A;  2OOE A;  3RRN B;  2ILR A;  4BSZ B;  4KVM A;  2GRL A;  3DSV A;  3LS8 A;  4JXT A;  3T8M A;  1VDY A;  3FTW A;  3QB2 A;  5AQA A;  4Q69 A;  4UWF A;  5C2Y A;  1Z5S C;  5T4Y A;  2WM9 A;  1EF1 C;  3JQ1 A;  1SZ9 A;  4ANX A;  3BG1 B;  3EIJ A;  1OWO A;  4ACK A;  2ZXW E;  3TXN A;  5KJM A;  4GTO A;  2X6J A;  1S64 A;  3V2X A;  2DYS E;  3TWT A;  1B89 A;  1BPO A;  3QWV A;  4HRL A;  4G23 A;  4KYO B;  5FTP A;  3PE3 A;  4BT9 A;  4GYW A;  3NF1 A;  4EZL A;  4B94 A;  4L1B A;  4DJA A;  4J0U A;  4K03 A;  2VJ8 A;  5LP0 A;  1WDY A;  3EJN A;  3CST A;  2VQ2 A;  2IY0 C;  2H6H A;  4ATZ D;  4UWL A;  1IHB A;  3LXU X;  3ZVV A;  5CED B;  3L9T A;  2I1J A;  1BLX B;  2ZU6 B;  1TJF A;  4F3V A;  1HXI A;  2E2E A;  3UIN C;  5EIB E;  4UWG A;  2L9B A;  4IYP A;  1HS6 A;  3RSE G;  1ZB1 A;  4CGW A;  1HE8 A;  3ZFW A;  4LCT A;  5EDS A;  1KPS B;  3VLE A;  3RJV A;  3OXL A;  3ONL A;  5A7D B;  2GRN B;  3D3M A;  5KJN A;  3CVQ A;  1JCQ A;  4I43 A;  2PNN A;  3G2W A;  4XKC A;  3I4R B;  2XQ0 A;  4DLQ A;  3FU5 A;  4BT8 A;  1TN8 A;  4Y6C A;  3UM0 A;  5C1D A;  2NXP A;  2BED A;  4I17 A;  2VTB B;  5J90 A;  4OYS A;  3MCX A;  1HZ4 A;  1W3B A;  1QNF A;  2WXM A;  1AP7 A;  4KVO A;  1QYM A;  3KS2 A;  1NZN A;  3MGB A;  3O4Z A;  3ZNG A;  3U9W A;  4L7T A;  3RAU A;  5CRV A;  5HQ8 A;  5ENP D;  3MX3 A;  4EBA G;  3DXM G;  3SBT B;  2P9S G;  3FUL A;  4J8D A;  3DXK G;  3JXI A;  3ASD A;  4G2V A;  2VSO E;  1EYH A;  3CK8 A;  2KZT B;  2JLB A;  1KLX A;  4U95 D;  4RVB A;  2WQ7 A;  4GYO A;  4GZC A;  3SFY A;  2FF4 A;  3PE4 A;  3WG7 E;  2XCB A;  2XZD G;  3UIO C;  3ZYM A;  4EBA A;  1N54 A;  5KNH D;  1MJ0 A;  3CGH A;  5BNW A;  3Q49 B;  4B93 B;  5AQ7 A;  2YHC A;  1JUQ A;  2V8S E;  1O5M A;  4LG6 A;  1WAO 1;  3V30 A;  2HR2 A;  2R03 A;  2RFA A;  1X5B A;  4JHR A;  2FBN A;  2WXN A;  3SFX A;  3ZKJ A;  4CDM A;  4FP7 A;  3FTZ A;  2AXZ A;  1Z3Y A;  3D9P A;  1OWP A;  2P9L G;  1HF8 A;  2OEW A;  4G24 A;  3PNL B;  3KEZ A;  4UUC A;  2WXH A;  4I2W A;  1V54 E;  3T5X A;  4BEP A;  3UKU G;  5G04 C;  2EIM E;  4APF A;  3R9M A;  5EX3 A;  1Y6I A;  4JVS A;  1YCS B;  3Q75 A;  4N2S A;  3FEY A;  2A5U A;  3J5Q B;  4U7E B;  5JA4 D;  2X3M A;  4F1S A;  4JC8 A;  4UWK A;  3APC A;  3DWL G;  3CKB A;  2MYO A;  3NZS A;  1N4R A;  4X8Q A;  1YA0 A;  3FU6 A;  3N71 A;  4IUL A;  3HVE A;  4A3V A;  3C72 A;  1FVF A;  5B3S E;  2VSN A;  3TWQ A;  3FEX A;  5T8I A;  4U0U A;  3S2A A;  4HNA D;  5G05 J;  3FH5 A;  3FTY A;  4IRU A;  3L82 A;  4GTM A;  4K5B A;  2FI7 A;  4NIK A;  1NA3 A;  2PQN A;  5D2M C;  2MRI A;  3TWS A;  2AWI A;  4HOS A;  3TWR A;  1N4P A;  5CMY A;  2M63 A;  3DBS A;  3TWX A;  4WWO A;  1BD8 A;  2EQX A;  3E32 A;  5KNG A;  2VGX A;  1K1A A;  3ABM E;  1TYQ G;  3FTS A;  3ABK E;  1H19 A;  1HG5 A;  2VGX B;  4YVQ C;  5LCW J;  2R5S A;  3GZS A;  2PZI A;  3F6Q A;  5AEN A;  2R05 A;  1UW4 B;  3JCK C;  1UG3 A;  2WXL A;  2CHZ A;  3UX4 A;  2UY1 B;  3QDN A;  2NC9 A;  5HI7 A;  3NOG D;  4G8K A;  4UQY A;  3HRA A;  1LF8 A;  2IFU A;  4JB8 P;  3RU0 A;  1A17 A;  3SGH A;  3IBE A;  4N3C A;  2HM8 A;  2YQ8 A;  1L5J A;  4F1P A;  2Y69 E;  2WPV A;  4K5A B;  5HS0 A;  4BSX A;  2ZGD A;  4IN3 B;  2EIN E;  3S7F A;  2XS8 A;  4GZ5 A;  1N0Q A;  4MRU A;  5FZQ A;  2ION A;  5KJL A;  5EX0 A;  3HVE B;  3T5V A;  2JEK A;  1H6P A;  5KBA A;  3HXE A;  4TXQ A;  1OCR E;  5LOZ A;  3ULQ A;  4NAC A;  3S7J A;  3MA5 A;  4JEU A;  4ZHB A;  1WY6 A;  1X81 A;  2WQH A;  2LAI A;  4I6J A;  4U0Z A;  4U63 A;  5AQ9 A;  4G8L A;  4G1T A;  4JHK A;  2XCC A;  1OY3 D;  2A4Z A;  3HIZ A;  4FHJ A;  2OVB A;  3TAX A;  4U07 A;  4FLB A;  1EPU A;  5ENQ D;  4J8Y A;  2XRZ A;  1H6O A;  4BET A;  5EYL A;  3R7R A;  4KZ0 A;  2XEN A;  4LNU D;  1TEZ A;  1DCE A;  3CVW A;  2LAH A;  2Y4U A;  2CFZ A;  3MV3 B;  2XGM A;  5B1A E;  2AXU A;  3E4B A;  3E33 A;  5CCL A;  4WNF A;  2WXP A;  4PS3 A;  4LEU A;  1N4Q A;  4AY5 A;  4F6R D;  2AXV A;  2C0L A;  3CKC A;  3LY7 A;  4D10 C;  3L54 A;  2LNI A;  2J4D A;  1E8X A;  5AJL A;  3CHQ A;  4EPZ A;  4XIF A;  1LTX A;  3S7D A;  2MHK A;  2BTD A;  4GZ3 A;  3B13 A;  4JZY A;  2AW6 A;  3NZU A;  1N11 A;  1HH8 A;  1FVH A;  4UI9 K;  3JUI A;  4R7L A;  2WQ6 A;  5D0Q D;  3W9F A;  3P1U A;  5A6C A;  3ZPJ A;  4OAV B;  5LX8 A;  4MS6 A;  2KZT A;  2P9I G;  2C0M A;  4OVU A;  2VSX E;  4GA0 A;  3FTV A;  1UJK A;  2GRP B;  4AY6 A;  3EU9 A;  4N39 A;  3CVU A;  3FFL A;  4ATG A;  5BUZ A;  2KBX A;  3NB2 A;  4CRW A;  3J5P A;  2DZO A;  2QZA A;  4BTB A;  3CHP A;  2GRO B;  4FJZ A;  3TXM A;  4DI4 A;  1ELK A;  2P9N G;  1YYH A;  3T8K A;  3FHE A;  3ML9 A;  2X6F A;  5BV0 A;  2KCL A;  3CVL A;  2XEV A;  4A63 B;  3ZYK A;  4ABN A;  1E7V A;  2V4H C;  3TL5 A;  2OVF A;  4JA7 A;  2H6I A;  4PDX A;  3UQ3 A;  2J08 A;  2VSY A;  1H0A A;  2P58 C;  5BXU A;  1TNB A;  3G2V A;  3D9N A;  2DZN A;  3RRU A;  4JEH A;  3CVY A;  3FUH A;  5JJ7 A;  2WXJ A;  3UTM A;  3ENE A;  3LYA A;  4HVB A;  3DSU A;  2B6C A;  3Q79 A;  2PQR A;  3DPD A;  3LEW A;  4YDW A;  4EZJ A;  2YIN A;  4UI9 C;  2P9U G;  1E96 B;  4ILG A;  4WNE A;  3L08 A;  5CEC B;  5FQ7 A;  2LUH A;  1U2V G;  2HE0 A;  1KZO A;  1N4S A;  4WNG A;  4U96 D;  1O1R A;  1A5E A;  3C5R A;  4CDN A;  1OCC E;  4LER A;  2FUL A;  3RRM B;  5IY5 E;  3HXC A;  4B8C B;  2Q7F A;  3ISM C;  1HG2 A;  2DWZ A;  4GCO A;  4DX2 A;  4AEZ C;  5HRY A;  4ILI A;  3HHM A;  1DVP A;  3ASO E;  2ETA A;  3TGO A;  1LD7 A;  4CGV A;  3CIA A;  4GTR A;  5FT9 A;  5FQ6 A;  4DI3 A;  3CQC B;  1SA5 A;  3FY4 A;  1E8Z A;  1XNF A;  1TJC A;  3B7U X;  2F8Y A;  4GAA A;  3EU5 A;  1UJJ A;  4I9C A;  4J8F A;  4BES A;  4TUU A;  2IO2 C;  2PL2 A;  3ZU7 B;  2IF4 A;  3C98 A;  3SNX A;  2I9C A;  2GGF A;  4BFR A;  3LJN A;  3LJ3 A;  3EDT B;  2V5F A;  5CMW A;  3ZYL A;  1WG0 A;  2DYR E;  3CR3 A;  2KXP C;  4EEC A;  4N5Q A;  3MKQ B;  1ELR A;  4H7X A;  4B0Z A;  2P9P G;  3PRE A;  3SBS A;  3OTN A;  3UM2 A;  5CEA A;  4AJW A;  3V31 A;  2WXQ A;  1KT0 A;  4AOF A;  3UMV A;  4AXH A;  3DPY A;  4EZK A;  4ME2 A;  2OV8 A;  2VGY A;  2R59 A;  2V4L A;  5ITZ F;  1IQU A;  1PC2 A;  2KAT A;  4DUI A;  4KBQ A;  4E85 A;  2DCP A;  4GA1 A;  3WXX A;  4Y6W A;  4GML A;  2NYJ A;  4YDO A;  3PZ3 A;  1FCH A;  3B7S A;  4U8Y D;  1O1S A;  4ZFH A;  4BTA A;  3ABL E;  3ZN3 A;  4HB5 A;  1Z6T A;  3IXE A;  4GZ6 A;  2YNQ A;  3Q4A B;  2LXM A;  1V55 E;  1E8W A;  4GPM A;  3LPZ A;  4TXR A;  1DNP A;  3B7R L;  3AG1 E;  3Q47 B;  2XPY A;  3LY8 A;  3ASG A;  4E6H A;  4DX1 A;  2XGS A;  5G2N A;  4ANU A;  3MKR A;  3VTY A;  1O1T A;  2AVP A;  2KC7 A;  4MKT A;  1MX4 A;  4GYY A;  4CCA A;  2P2C P;  3PUJ A;  4GMR A;  4O6F A;  3RIB A;  3EUV A;  4WWP A;  3SO8 A;  4L2Y A;  1TNU A;  4HFG A;  4AP2 A;  2V5Q C;  4L23 A;  3ASN E;  2XRY A;  3E30 A;  3DEP A;  1KT1 A;  1IHG A;  3RO3 A;  1BI8 B;  5ANR A;  2LXL A;  2I6H A;  3D9K A;  4FAD A;  1PAQ A;  1K8K G;  2R17 C;  3AS4 A;  5LCW C;  2IOS A;  3MYV A;  3EHN A;  3U64 A;  4I6E A;  3UUX A;  1K1B A;  2EIJ E;  2YHE A;  3PRZ A;  2GW1 A;  4ILH B;  3AS8 A;  3HXB A;  4FU3 A;  1IKN D;  3W9G A;  5AAO A;  3R9A B;  2J49 A;  4O1O A;  2OEV A;  4TUM A;  4EQF A;  2C2L A;  3LDZ A;  3HXD A;  5EIL A;  4BX9 A;  2FO1 E;  4O60 A;  4WAF A;  5E75 A;  3Q15 A;  3AAA C;  4HBD A;  2XEH A;  4RLY A;  3UPV A;  3HYM B;  1SVX A;  2WMO A;  2I1K A;  2FO7 A;  3ZHE B;  4XZ4 A;  4Z68 A;  5AAR A;  5EKQ D;  3OXG A;  5FJY A;  3ZRH A;  1IQR A;  5CRU A;  4P29 A;  1MYO A;  3DSX A;  4WUY A;  1U3D A;  4URK A;  2XPZ A;  1N94 A;  4J8S A;  4FC8 A;  3BEE A;  4JW1 A;  5ENR D;  3AU4 A;  1FT2 A;  3UT8 A;  1N52 A;  2ZGG A;  1SA4 A;  2KM4 A;  4HOT A;  3CVP A;  4WWN A;  3OXF A;  1JWF A;  3T9K A;  3I4G A;  1MX2 A;  4V3I A;  3CVN A;  3V79 K;  2QC9 A;  3DSS A;  1N95 A;  4OAU C;  4G26 A;  4OVV A;  5BT1 A;  5JJT A;  4AVX A;  4M3O A;  5FZS A;  5H7P A;  3ZEF A;  4U8V D;  3R7Q A;  3MJW A;  3CSF A;  1NP7 A;  4FHK A;  3EHM A;  3KD7 A;  2JAB A;  2J9Q A;  3QAR A;  3CK7 A;  4YDE A;  3GYZ A;  4F7A A;  5JHB A;  4DX7 D;  1SQM A;  4JL0 A;  1FT1 A;  2X6I A;  4XX5 A;  2A5E A;  5AYW D;  4A3T A;  4UQZ A;  5BW8 C;  1MX6 A;  4I9E A;  1PY1 A;  1JWG A;  3FUM A;  4LNB A;  4MLP A;  4HLE A;  2J09 A;  4A1S A;  1UOH A;  3TWV A;  4CT0 A;  4DPR A;  3RKV A;  2R2L A;  3FUE A;  4ANW A;  3Q9U C;  3TG4 A;  2DVW A;  3DRA A;  4PS7 A;  3LVQ E;  1GW6 A;  3EHQ A;  3PVL A;  3FTX A;  3Q7A A;  2LSV A;  4HI8 A;  2X6K A;  3ZHE A;  3JQ0 A;  2WXK A;  3B7B A;  2F0Y A;  5KWD A;  3QNK A;  5G04 J;  5ENS D;  3QWP A;  3AU5 A;  3BG0 B;  4KMO A;  3NBN B;  1OWN A;  2B0O E;  4HRN A;  1N9A A;  4BX8 A;  4GB9 A;  4YND A;  2XGO A;  3DST A;  3Q9N C;  4TRQ A;  1BI7 B;  1NA0 A;  4FUL A;  1JCS A;  3GW4 A;  3OAW A;  1EDU A;  2PM7 A;  3CQG B;  3UM1 A;  2NSZ A;  3C3R A;  3UI2 A;  5FIN A;  3O48 A;  4N3B A;  3QWW A;  5ENN A;  4GTT A;  5EYP F;  3D9I A;  1TN6 A;  5ARF A;  2Y0B G;  3TG5 A;  3HG0 D;  1XGW A;  3JYS A;  4FA6 A;  2DBA A;  4HQD A;  2ZIR A;  4XI9 A;  3TWU A;  3G2T A;  1OT8 A;  2J07 A;  4GZD A;  4WND A;  2RKK A;  5JJ6 A;  1YMP A;  3LY9 A;  4KXK B;  3PNT B;  4RG9 A;  3ESL A;  4KT6 B;  3SF4 A;  3ULY A;  4F53 A;  2IO3 C;  2VYI A;  1ZU2 A;  2ETC A;  2WXO A;  3X2Q E;  2OND A;  3I5P A;  3ML8 A;  2VGE A;  4LUN U;  3L6A A;  5E76 A;  1RW2 A;  4LNG A;  1QZ2 A;  3QOU A;  4APO A;  2CHX A;  2H6G A;  1N0R A;  5KJK A;  4AIF A;  4GMJ A;  5KCM A;  3SQV A;  1MZC A;  2L0T B;  2UWJ G;  1HU3 A;  3RO2 A;  4G11 A;  4HOR A;  4YVO A;  4Q94 A;  2L0I A;  3SY2 A;  3AJI A;  3UXG A;  3PZ2 A;  4HS2 A;  2BKG A;  5D0O D;  3MKQ A;  5ENO D;  3GZ1 A;  3BQO A;  4DLO A;  1OWM A;  2V0P A;  3KSQ A;  3MEK A;  4YDY A;  3UT4 A;  1H2U A;  1DCQ A;  1WM5 A;  3QKY A;  4G25 A;  2IU1 A;  4N2Q A;  3SHF A;  5BXO A;  1SW6 A;  4PS8 A;  2CHW A;  3KSL A;  1INZ A;  1G3N B;  1K3Z D;  3IV0 A;  3DSW A;  3ZGQ A;  3VTX A;  4AM9 A;  1S63 A;  2ZIS A;  1ELW A;  1QBQ A;  2BKK B;  4C0E A;  3Q78 A;  5G05 C;  3QC1 A;  1OWL A;  2IEJ A;  4GTQ A;  4C0M A;  3AG2 E;  3PH0 C;  4GTP A;  3L13 A;  2RFM A;  4I1O B;  1D8D A;  3IEG A;  4AV7 A;  3APF A;  3Q73 A;  2XPI A;  3ASF A;  1S0P A;  4A55 A;  2OCC E;  3IHY A;  3B95 A;  5HKP A;  3V2O A;  4UI9 J;  4O1P A;  3I3N A;  2XZT G;  1Y8M A;  3D9M A;  3PEV B;  4I1M A;  1LD8 A;  1KZP A;  4HI9 A;  3VLF A;  3CEQ A;  3QAQ A;  4CZ2 D;  2L6J A;  4I6G A;  4UQX A;  1HO8 A;  4UWH A;  3FWV A;  5D66 A;  3NQP A;  4LSZ E;  3S7B A;  3PZ1 A;  3AS5 A;  3PZ4 A;  2R02 A;  4BWR A;  1HFA A;  3SFZ A;  3CVX A;  2ETB A;  2QY7 A;  3PEU B;  3TWW A;  2CFU A;  3ZIM A;  1JPL A;  4N3A A;  1IYG A;  3G2S A;  3NOC D;  2H6F A;  1ZBP A;  5AIJ A;  3D9O A;  4ACL A;  3HXF A;  5EID A;  4U0S A;  5AN8 A;  3ZYQ A;  3FUK A;  4M7C A;  3LCA A;  4JD2 G;  3CHO A;  3MZL B;  4C48 B;  1QQE A;  3CV0 A;  2GRM A;  3QK0 A;  3B7T A;  3VLD A;  3CHR A;  4W9R A;  4H7Y A;  4I1A A;  3C3O A;  2Y1L E;  5BV1 A;  1JCR A;  5FQ8 A;  5M72 A;  4NQ0 A;  4NUR A;  3PZD A;  3L22 A;  3EIQ C;  3UM3 A;  2WB2 A;  3FU0 A;  2QFC A;  1OCO E;  2WXG A;  3BUA A;  4KZC A;  3IKO B;  1S70 B;  3DEO A;  4N5C A;  4K5C A;  4XE0 A;  2I2O A;  4CT4 A;  3Q5M A;  2F8X K;  5G55 A; 
#chains in the Genus database with same CATH homology
 1TNZ A;  1N4P A;  3Q7F A;  3HXB A;  1JCQ A;  3E37 A;  3PZ1 A;  3PZ3 A;  4YDO A;  3PZ4 A;  1O1S A;  3E34 A;  1LD7 A;  3KSQ A;  4GTR A;  4GTT A;  3E32 A;  1D8E A;  3HXD A;  1TN8 A;  4YDE A;  4GTO A;  1SA5 A;  1S64 A;  2BED A;  1TN6 A;  3KSL A;  1FT1 A;  2H6I A;  3DSW A;  4GTV A;  2H6F A;  4L9P A;  1S63 A;  3Q75 A;  3EU5 A;  2ZIS A;  2ZIR A;  1QBQ A;  1DCE A;  3Q78 A;  1FPP A;  1NL4 A;  1TNB A;  3HXF A;  4LNB A;  2IEJ A;  4GTQ A;  4GTP A;  1TNO A;  1D8D A;  4EHM A;  1O1T A;  2R2L A;  3Q73 A;  3E33 A;  3DSU A;  4GTS A;  3Q79 A;  1N4Q A;  1N4R A;  1NI1 A;  3DRA A;  3EUV A;  2H6H A;  3DSX A;  1TNU A;  3Q7A A;  1JCR A;  3C72 A;  3E30 A;  1LTX A;  3SFY A;  4LNG A;  2F0Y A;  4MBG A;  1N94 A;  1KZO A;  1TN7 A;  1N4S A;  2H6G A;  1FT2 A;  1O1R A;  1SA4 A;  1LD8 A;  1KZP A;  1MZC A;  3DPY A;  3HXE A;  1N9A A;  1O5M A;  3DSV A;  4GTM A;  3DST A;  1X81 A;  3HXC A;  3SFX A;  3DSS A;  1N95 A;  1JCS A;  3PZ2 A;  1TNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...