1X81A

Farnesyl transferase structure of jansen compound
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Design, synthesis, and activity of 4-quinolone and pyridone compounds as nonthiol-containing farnesyltransferase inhibitors.
pubmed doi rcsb
molecule tags Transferase
total genus 103
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1x81A00
1O1TA 1TNUA 1LTXA 1JCQA 2BEDA 3KSQA 4LNGA 3HXEA 1FPPA 3Q78A 1X81A 1JCRA 1S64A 3DSVA 3SFXA 3PZ3A 3DSTA 1D8DA 1TNBA 4GTOA 1TN7A 3EU5A 1O1SA 3Q7AA 1DCEA 1NL4A 4LNBA 4GTMA 1SA5A 4EHMA 3HXBA 4GTVA 1D8EA 3DSWA 3PZ4A 4MBGA 3E32A 2ZIRA 1N4SA 2F0YA 3HXCA 1N4RA 1N4PA 2IEJA 1MZCA 3Q73A 1QBQA 1N9AA 1N94A 3PZ1A 3Q79A 1KZPA 4GTQA 2ZISA 4GTTA 3HXDA 1LD7A 1N95A 3EUVA 1S63A 2H6HA 3E30A 4YDOA 1N4QA 1KZOA 1TNYA 2H6FA 1O5MA 4L9PA 3C72A 3PZ2A 4YDEA 1LD8A 3Q7FA 1O1RA 3Q75A 3DSSA 4GTRA 3E33A 2R2LA 3KSLA 1TN6A 1TNZA 3E34A 1TNOA 3E37A 1FT2A 1JCSA 3DRAA 3DPYA 3DSXA 4GTSA 3DSUA 1SA4A 2H6GA 3SFYA 1FT1A 1TN8A 1NI1A 2H6IA 4GTPA 3HXFA
chains in the Genus database with same CATH superfamily
1EF1C 5JHBA 1HS6A 1SQMA 3ZN3A 3ABKE 4EBAA 1JCRA 1N11A 3LY9A 3CVUA 4XIFA 1UG3A 3CIAA 1QNFA 2WXJA 4HQDA 2R02A 3WXXA 1N0RA 2DYRE 3RAUA 3ZIMA 2LNIA 4ZFHA 2GRNB 3ZYLA 4BFRA 1K1AA 3TWXA 3E32A 5C1DA 4Z68A 3SD5A 4AVXA 1H2TC 4KZCA 3FUMA 3RKVA 1W3BA 2XPYA 3RK6A 2LO6A 2P58C 4U8YD 3SY2A 4QFVA 1S70B 3AJIA 3PUKA 5LX8A 2IQCA 4YDOA 1N4QA 3CK7A 3D9OA 2AXUA 1BI8B 3Q47B 3D9MA 3U64A 3SO8A 3CR3A 4GTRA 3U9WA 4JA9A 2VGYA 1QQEA 3ZEFA 3KD7A 2Y69E 1DNPA 5T8IA 3TWQA 1TN8A 4JHKA 4APFA 1OWMA 3TAXA 4CZ2D 2L9BA 3HXFA 3KEZA 3TWVA 1H6PA 5C2YA 4GCNA 2Q7FA 1D9SA 3FTVA 4FLBA 3T8KA 1X81A 2MOWA 2WXKA 2P9LG 4CDMA 2WQHA 3JUEA 4BSXA 4DRXE 2L6JA 4HS2A 1SVXA 1K3ZD 1ELWA 3RSEG 4JZYA 1IHGA 3TWUA 3F6QA 2JLBA 2X6HA 2J4DA 3X2QE 3HYMB 4XKCA 2IO3C 2DIWA 4WAFA 2VYIA 2J08A 2WXIA 3SF4A 4BSZB 1NA3A 2L6BA 2I6HA 3W9GA 3ABLE 5HI7A 3TWWA 2WXHA 3U4TA 2ZU6B 2AXZA 2UY1A 2WM9A 4UQZA 3FHEA 5M72A 4NACA 3PE3A 4TUMA 1FCHA 2A5UA 3P2BA 4ATGA 1KLXA 3ZNGA 3ZXPA 3CQCB 4EECA 5G55A 2WB2A 1UJJA 3ZYMA 4F1PA 4GA2A 4UWFA 2CFZA 3LKUA 2XPZA 1LTXA 1NZNA 1OUVA 4HXIA 3KSQA 4CGWA 4J8SA 4AY6A 4I43A 4RG6A 4ATZD 5FZSA 5AQ7A 3L22A 5KJNA 2CFUA 2EILE 2L0TB 3D9IA 3B7SA 1O1SA 1DCEA 2YHEA 4LNBA 1WY6A 3CVQA 2XS1A 2J07A 5KJLA 3UM1A 3ZYKA 3P1UA 2XZTG 1D8EA 3MZLB 2KCVA 5BW8C 3FUKA 5HS0A 3DXKG 5AQAA 5G2NA 4BERA 2XGSA 4K5AB 4BWRA 3EIJA 2DZOA 4J6IA 3IHVA 3JYSA 2X6FA 3JXJA 2FBNA 2CG2A 1KZPA 3GZ2A 2WMOA 3PUJA 2FF4A 4U63A 4AOFA 3IHYA 4G23A 3G2TA 1SZ9A 3FTSA 5BV1A 1KZOA 3LYAA 1MX2A 1E8XA 4R7LA 2ETCA 1H2UA 5A6CA 2V4LA 4CDRA 4K0RA 4JL0A 5AJLA 4Q69A 4U8VD 4K03A 4J7WA 3E37A 5CRVA 4A1SA 3CSTA 2WPVA 4JEUA 1NI1A 4RQIA 4TUUA 3EDTB 3L82A 3W9FA 3LJNA 1Y8MA 3AG1E 2NSZA 1K8KG 1OXJA 3MA5A 3MEKA 4BT8A 3UI2A 2GROB 3JQ0A 3B13A 4FADA 3OXGA 3TGOA 2GGFA 4CEMA 4U8HA 1A17A 1B89A 2XGOA 1OCRE 1Z6TA 3UIPC 3ZU7B 4RSYA 5CCLA 3O4ZA 1H19A 4MBGA 1ZB1A 3RRUA 2F0YA 4PH4B 3FH8A 3J5PA 4FP7A 4GYYA 1PAQA 2QZAA 4IULA 1QBQA 5BPPA 3CK9A 3R9MA 3VLDA 1WG0A 3PZ1A 4UWGA 2J4BA 4JHRA 3JXIA 3CKCA 2V5QC 1E7UA 1Q2ZA 1LD7A 3APFA 3EUVA 3QWWA 3CVVA 2Y3AA 3PNTB 4PUCA 3UT7A 1BU9A 3PZ2A 4U96D 1UW4B 5FJYA 3SNXA 1BLXB 1JWGA 5ENSD 3LDZA 3ENEA 3E33A 1MJ0A 5ANLA 4XE0A 4MS6A 3GYZA 3OXFA 2WXNA 4L2LA 3E34A 4A55A 4ACLA 4NRHB 3DSUA 4OAUC 4CGVA 4FHKA 3ABME 3SQVA 3ASGA 2NC9A 4GYOA 5CRUA 2IY0C 3RJVA 2IFUA 1S64A 3UINC 3B7BA 1PY1A 3EHMA 3ML8A 2MRIA 4WNFA 4CYMD 5FQ8A 4APOA 4OVVA 3QWVA 3Q7AA 4PS7A 1NL4A 4FHJA 4HOTA 4GTMA 4GZ5A 3D9JA 2C0MA 3ASNE 5AARA 5CEDB 5BXUA 3ZXSA 4UWHA 2WQ6A 2ZIRA 3D3MA 3IEGA 5AQ9A 1N0QA 4GB9A 3IKOB 4ZHBA 3FUFA 3MCXA 2IEJA 3EIQC 3PREA 1N9AA 2PNNA 3FUIA 3AG4E 3MJWA 4AM9A 2KATA 4ANWA 3Q15A 2IJGX 2VTBB 4OAVB 5BV0A 5BXOA 1WM5A 4N3BA 2J8SD 1TNYA 1X5BA 3DEPA 2XRYA 1HG2A 3HIZA 1TEZA 1EPUA 1LD8A 2ZGGA 3APCA 1GW6A 5FQ7A 1E96B 4WNGA 3ZHEA 3J5QB 3AG3E 2IU1A 3DSXA 5AN8A 1BI7B 5T3RA 3QJZA 1JCQA 4GPMA 2YINA 3CQGB 4MLPA 3V79K 3DSVA 1E90A 3OTNA 1Z3XA 3CVLA 3ULYA 4KT6B 2J49A 4MKTA 3U3WA 3C3QA 3ULQA 2YNQA 3FTXA 2OEVA 4DX6D 3FFLA 2ILRA 3PH0C 3RRNB 2X6KA 4I1OB 1LF8A 3ZW3A 2ZGDA 4I17A 2HM8A 2XQ0A 3B95A 2PM6A 3L17A 2EINE 2V8SE 3K9IA 1IKND 4KVOA 3C3OA 3UX4A 4BETA 3FDHA 1FVFA 2XS8A 1PC2A 3CHSA 4GTQA 4C0EA 4ANUA 4OVUA 4IN3B 1HU3A 5ENTD 3NB2A 2BKGA 2LXMA 1S0PA 3AS8A 4V3IA 1HFAA 3FU3A 3UUXA 3PEVB 3URZA 4BESA 3CHRA 3I4GA 4GA0A 5JMND 3AG2E 3T5XA 4H7YA 2VJ8A 4G26A 1EYHA 2DCPA 2J09A 1JCSA 5IY5E 3SFYA 2RFMA 3TXNA 2GRPB 2DYSE 4YNDA 3ASOE 3HRAA 3QWPA 5BNWA 4NIKA 4A63B 4GYWA 2VGEA 5AAOA 5B1AE 2V5FA 3SZ7A 3KEAA 4UI9J 4KMOA 2E0IA 1E8WA 3LY7A 3DPDA 5D66A 4TXRA 3UPVA 3V2XA 2AWIA 4HNAD 5CHEE 2Y0BG 3HVEA 3TWTA 3CEQA 4F7AA 3WG7E 3Q9UC 3ZFWA 3HDXA 3BG0B 3UT8A 3LPZA 5ENNA 3ASDA 4XI9A 3ZPJA 1N94A 2LUHA 4N3CA 3RU0A 1V54E 2ZISA 1P5QA 4C9BB 2DWZA 3RO3A 5FZRA 1G3NB 4HBDA 1XNFA 4DJAA 3QKYA 4BTBA 3UIOC 3FULA 4GU5A 2I9CA 3CSFA 3FH7A 4EBAG 1TNOA 3ML9A 1FT2A 3LCAA 4HORA 3TG5A 3DRAA 4GTSA 2C2LA 4UI9C 3UQ3A 2F8XK 2R03A 4P29A 3TWSA 1O1TA 1SZAA 4JPSA 2CHWA 2PZIA 4FJZA 2KCKA 3V2OA 2LSUA 5KWDA 3C98A 5D2MC 4BEPA 4I6GA 1DC2A 4GZ6A 1ELRA 2R05A 4J8YA 3S2AA 4A3TA 4GZCA 4BT9A 4HOQA 5D0OD 1IXVA 3NQPA 3L16A 4ANVA 3NF1A 4IRUA 1UOHA 4FA6A 2XRZA 1BPOA 5J90A 4KVMA 4M7CA 4MRUA 2E2EA 1Y6IA 2CHXA 3CHOA 3ZRHA 2QYUA 5CMWA 5AQBA 3FEYA 3G2VA 4GZ3A 4TXQA 3CKBA 4WNDA 4HOSA 3L54A 2CHZA 4DX1A 2X3MA 4UUCA 2DVWA 4DUIA 4L7TA 4DI4A 5FTPA 3BG1B 3B7UX 1N95A 3NZSA 5EYPF 1WDYA 1IYGA 4E6HA 5ARGA 3FUDA 2FO1E 1O1RA 5DBKA 3UT4A 4AJWA 1HXIA 1U2VG 3LY8A 4FULA 4XZ4A 1IQRA 3CHMA 3FH5A 2FO7A 3ASFA 4DX7D 2YQ8A 5KJMA 4G24A 4KZ0A 5CERB 3KS2A 2AVPA 4AIFA 3Q49B 4WWNA 3C3RA 5E76A 2WVIA 1FPPA 4NQ0A 4L23A 3Q78A 1UN8A 4G25A 4GMLA 5CEAA 3SFXA 3BEEA 4LERA 5G04C 2VGXA 1D8DA 2WXMA 1TNBA 5EX3A 2X6IA 4HI8A 3T8MA 1HH8A 4N3AA 1OY3D 3Q4AB 4JB8P 1H6KA 2ZXWE 5DIZA 3FP3A 3FUNA 4XKBA 5JJTA 3LXUX 3EHNA 2UY1B 2I1JA 3CGHA 2GRQB 3JUIA 4ABNA 3FUHA 4CT4A 3Q79A 4HLLA 3IBEA 1Z3YA 5CBNA 3QB2A 1U3CA 4DX2A 3TJPA 4HRLA 3E30A 2RG8A 2RFAA 3CVWA 3DSSA 4HI9A 2OVBA 4KXKB 4J8FA 1MX4A 5EKQD 4ILHB 3NBNB 4AP2A 2RD0A 3ZYQA 2KZTA 3EHRA 3ISMC 1IHBA 3OXLA 5KNGA 3LVQE 1E8ZA 1ELKA 4Y6CA 3HXEA 2HE0A 4G1TA 3B7RL 1HF8A 3MKQA 3RO2A 4K5BA 4IYPA 3FTUA 5AENA 4J8DA 3FTWA 3O48A 2KM4A 1MHQA 3UTMA 2OCCE 4E85A 4BX8A 2R59A 4N2QA 4N39A 4LG6A 1HO8A 3DSWA 4I1MA 1TJCA 3IV0A 4GPKA 1N4SA 3D9PA 3R7QA 2XHEA 2MYOA 3SBSA 1N4RA 1ZU2A 1YA0A 1Z5SC 2IOLA 5EDSA 4XI0A 2P9KG 2XCBA 2GRRB 5EX0A 3TL5A 2ETBA 3MX3A 4L9PA 3U66A 3UM2A 3FUEA 3I3NA 2F8YA 3I4RB 4HLEA 3PEUB 5AIJA 2X6JA 3FTYA 3KSLA 3V30A 4BY6A 1TNZA 1HZ4A 5J08A 4FLHA 3D9LA 2BKKB 4URKA 5EILA 4JC8A 2H6IA 2OV8A 2YHCA 3S7DA 1TNUA 5FWQA 4U95D 3UM0A 3T5VA 4FC8A 3NOGD 4O1OA 4TXPA 4AEZC 4CT0A 1AP7A 2CG3A 4XX5A 2UWJG 2LSVA 4I9EA 2ONDA 2M63A 1HG5A 3L9TA 4HB5A 3EU5A 4G8KA 5BUZA 4YDYA 3D9NA 3SHFA 1JPLA 4KBQA 3NOCD 4N5QA 3EHQA 4JHJA 3T9KA 4Y6WA 5CMYA 1N54A 2WXOA 5JJ7A 4RLYA 2PM7A 5ENOD 3LEWA 2J9QA 4C48B 1OCOE 1A5EA 4LSZE 5FT9A 4YVOA 5FINA 3PE4A 4O60A 4G11A 2H6HA 3FY4A 3E4BA 3VLEA 4JD2G 4PS3A 3L6AA 4I6JA 2IONA 2WXFA 5ENPD 2XCCA 2EIKE 5E75A 4UWLA 5CBOA 4AV7A 3PS6A 4LCTA 3R9AB 2EQXA 2XPIA 4ACKA 5ARFA 4YDWA 4DX5D 1SA4A 1OCZE 3CVXA 1JWFA 3I5PA 2GRLA 1YYHA 3DEOA 2FULA 4DK5A 4LNGA 3PRZA 2QYJA 4I2ZA 4B93B 2EIJE 1RW2A 4CRWA 4I1AA 1HE8A 3RRMB 1EDUA 3MKRA 1TN7A 2WXRA 4JXTA 4HRMB 2AW6A 4ANXA 4JVSA 4L2YA 3FWVA 3SI5A 2X38A 3HXBA 4GTVA 5LCWC 5A23A 2I2OA 2XEVA 3FU5A 4LNUD 4EZJA 2IOSA 3AS4A 3KAEA 4B89A 4Q96A 3L13A 2JABA 1KPSB 3FTZA 4K5CA 4TV3A 3ZHEB 2BUGA 3TG4A 3N71A 4UI9K 5G05J 2H6FA 2EIME 2PQNA 3D9KA 1ZBPA 1TJFA 3Q7FA 2F37A 2WXPA 4DI3A 5CCMA 3ZUVB 4AY5A 1INZA 4GCOA 5FZQA 2KC7A 2DBAA 2R5SA 5ENQD 2PQRA 3HHMA 4DLQA 3VTXA 1FT1A 5EIDA 3S7JA 3NZUA 2XGMA 4C0MA 4CCAA 1IQUA 4U0SA 4QQIA 5HKPA 2JEKA 2WQ7A 3APDA 4HVBA 5FQ4A 3DSTA 3PZDA 5LP0A 3CVYA 1DVPA 5H7PA 3CVPA 4HOUA 2P9NG 4U7EB 2DZNA 5AJDA 4EHMA 4EPZA 2PL2A 1DCQA 2XENA 2XZDG 5LFAA 4U04A 5G05C 3VLFA 1UN9A 2C0LA 1OWOA 4UQYA 4GA1A 4FU3A 2HYZA 1OWLA 2IF4A 3HXDA 5G04J 3ONKA 3LVRE 2VQ2A 5FIOA 1K1BA 3UKRG 2BF0X 2R2LA 3TWRA 4DPRA 4OYSA 4L1BA 3LS8A 3DPYA 5KJKA 3BUAA 3CVNA 4XEIG 3D9HA 1YCSB 1QYMA 4U0UA 2V4HC 3Q9NC 3HVEB 4Q94A 3DXMG 3MV3B 1OT8A 3UM3A 4FJYA 2B0OE 2WMNA 5HRYA 3QARA 2KBXA 3G2WA 2Y4TA 3ESKA 3IXEA 3DBSA 3GZ1A 3AU4A 5BT1A 4B0ZA 3VTYA 3S7FA 3PZ4A 3CHQA 5ENRD 3QC1A 4F3VA 1SW6A 1JUQA 2Y1LE 1N4PA 1RZ4A 5KNHD 3Q5MA 1OWNA 1H2VC 4UQXA 1L5JA 5A7DB 3FUJA 2A5EA 4ILIA 4J8EA 5JJ6A 1XGWA 3SFZA 4YVQC 1TR4A 3AAAC 4G2VA 3RIBA 1UJKA 1KT0A 1O5MA 1QZ2A 2VSOE 4JA7A 3C72A 5LOZA 1VDYA 3QNKA 4W9RA 1NP7A 3PDNA 3AU5A 4WUYA 1MQSA 3L08A 2AXVA 1FVHA 2GW1A 2LXLA 2Y4UA 5EYLA 2FI7A 2OEWA 2VTBA 2OOEA 4GMRA 1MX6A 2LAIA 3BU8A 3ASHA 2RKKA 4GTPA 2B6CA 2P9PG 3HG0D 2BEDA 4LRZA 4ILGA 3SBTB 4UWKA 3MV2B 4I9CA 4U0ZA 1N52A 2XEHA 3EJNA 5FQ6A 2VSNA 2WXQA 1HX8A 2I1KA 2XEEA 3PVLA 1AWCB 3PZ3A 2AJAA 3JCKC 3FU6A 5B3SE 2QY7A 4B8AA 4EZLA 4A3VA 3C5RA 4GZDA 5ITZF 2OVFA 2VSYA 3UKUG 5ANRA 4I6EA 2P2CP 3G2UA 1H0AA 1H6OA 4F53A 4HRNA 4AXHA 3B7TA 3CK8A 2NYJA 1MZCA 3Q73A 4F6RD 3LJ3A 5AYWD 4I2WA 4PS8A 2NXPA 3CHPA 2KXPC 3G2SA 2BTDA 2IO2C 2QC9A 3QDNA 3BQOA 4EZKA 4RG9A 2LAHA 4WNEA 1OWPA 4KYOB 3GZSA 3AS5A 3FU0A 3ZGQA 4B8CB 3ULEG 3TXMA 1TN6A 4B94A 5HQ8A 2VGXB 1E8YA 4RVBA 1BD8A 4JW1A 3OAWA 5KBAA 1NA0A 3FEXA 4H7XA 2KCLA 1YMPA 5KCMA 3S7BA 2P9IG 4PDXA 2HO1A 2GRMA 2ETAA 5D0QD 5B1BE 1WAO1 4GAAA 4DLOA 4M3OA 4GTOA 4N5CA 4U07A 4WWPA 3V31A 4EQFA 4J0UA 2V0PA 3EU9A 2FEZA 4WWOA 5CECB 2MHKA 1SA5A 4O1PA 5EIBE 3R7RA 1NFIE 3ESLA 3GW4A 3MGBA 4JEHA 4X8QA 2L0IA 3QOUA 1E7VA 1TYQG 4N2SA 2A4ZA 3MYVA 2WXLA 3HXCA 3NAWA 3PNLB 3QAQA 4BTAA 3CV0A 2P9SG 2VSXE 4G8LA 1OCCE 5JHAA 3ONLA 2HR2A 4GTTA 4F1SA 4TRQA 3UMVA 3QK0A 1MYOA 1S63A 4HFGA 2KZTB 2QFCA 5EN5D 1KT1A 3SGHA 4D10C 4NURA 1V55E 1U3DA 4YDEA 3Q75A 4CDNA 4A1GA 2P9UG 5T4YA 3UXGA 4GMJA 4BX9A 3CLJA 3MKQB 3JQ1A 3DWLG 5LCWJ 3ZKJA 3ZVVA 4LEUA 4O6FA 2WXGA 2H6GA 5JA4D 4ME2A 2R17C 4LUNU
chains in the Genus database with same CATH topology
1O1TA 1TNUA 1LTXA 1JCQA 2BEDA 3KSQA 4LNGA 3HXEA 1FPPA 3Q78A 1X81A 1JCRA 1S64A 3DSVA 3SFXA 3PZ3A 3DSTA 1D8DA 1TNBA 4GTOA 1TN7A 3EU5A 1O1SA 3Q7AA 1DCEA 1NL4A 4LNBA 4GTMA 1SA5A 4EHMA 3HXBA 4GTVA 1D8EA 3DSWA 3PZ4A 4MBGA 3E32A 2ZIRA 1N4SA 2F0YA 3HXCA 1N4RA 1N4PA 2IEJA 1MZCA 3Q73A 1QBQA 1N9AA 1N94A 3PZ1A 3Q79A 1KZPA 4GTQA 2ZISA 4GTTA 3HXDA 1LD7A 1N95A 3EUVA 1S63A 2H6HA 3E30A 4YDOA 1N4QA 1KZOA 1TNYA 2H6FA 1O5MA 4L9PA 3C72A 3PZ2A 4YDEA 1LD8A 3Q7FA 1O1RA 3Q75A 3DSSA 4GTRA 3E33A 2R2LA 3KSLA 1TN6A 1TNZA 3E34A 1TNOA 3E37A 1FT2A 1JCSA 3DRAA 3DPYA 3DSXA 4GTSA 3DSUA 1SA4A 2H6GA 3SFYA 1FT1A 1TN8A 1NI1A 2H6IA 4GTPA 3HXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O1T A;  1TNU A;  1LTX A;  1JCQ A;  2BED A;  3KSQ A;  4LNG A;  3HXE A;  1FPP A;  3Q78 A;  1X81 A;  1JCR A;  1S64 A;  3DSV A;  3SFX A;  3PZ3 A;  3DST A;  1D8D A;  1TNB A;  4GTO A;  1TN7 A;  3EU5 A;  1O1S A;  3Q7A A;  1DCE A;  1NL4 A;  4LNB A;  4GTM A;  1SA5 A;  4EHM A;  3HXB A;  4GTV A;  1D8E A;  3DSW A;  3PZ4 A;  4MBG A;  3E32 A;  2ZIR A;  1N4S A;  2F0Y A;  3HXC A;  1N4R A;  1N4P A;  2IEJ A;  1MZC A;  3Q73 A;  1QBQ A;  1N9A A;  1N94 A;  3PZ1 A;  3Q79 A;  1KZP A;  4GTQ A;  2ZIS A;  4GTT A;  3HXD A;  1LD7 A;  1N95 A;  3EUV A;  1S63 A;  2H6H A;  3E30 A;  4YDO A;  1N4Q A;  1KZO A;  1TNY A;  2H6F A;  1O5M A;  4L9P A;  3C72 A;  3PZ2 A;  4YDE A;  1LD8 A;  3Q7F A;  1O1R A;  3Q75 A;  3DSS A;  4GTR A;  3E33 A;  2R2L A;  3KSL A;  1TN6 A;  1TNZ A;  3E34 A;  1TNO A;  3E37 A;  1FT2 A;  1JCS A;  3DRA A;  3DPY A;  3DSX A;  4GTS A;  3DSU A;  1SA4 A;  2H6G A;  3SFY A;  1FT1 A;  1TN8 A;  1NI1 A;  2H6I A;  4GTP A;  3HXF A; 
#chains in the Genus database with same CATH topology
 1EF1 C;  5JHB A;  1HS6 A;  1SQM A;  3ZN3 A;  3ABK E;  4EBA A;  1JCR A;  1N11 A;  3LY9 A;  3CVU A;  4XIF A;  1UG3 A;  3CIA A;  1QNF A;  2WXJ A;  4HQD A;  2R02 A;  3WXX A;  1N0R A;  2DYR E;  3RAU A;  3ZIM A;  2LNI A;  4ZFH A;  2GRN B;  3ZYL A;  4BFR A;  1K1A A;  3TWX A;  3E32 A;  5C1D A;  4Z68 A;  3SD5 A;  4AVX A;  1H2T C;  4KZC A;  3FUM A;  3RKV A;  1W3B A;  2XPY A;  3RK6 A;  2LO6 A;  2P58 C;  4U8Y D;  3SY2 A;  4QFV A;  1S70 B;  3AJI A;  3PUK A;  5LX8 A;  2IQC A;  4YDO A;  1N4Q A;  3CK7 A;  3D9O A;  2AXU A;  1BI8 B;  3Q47 B;  3D9M A;  3U64 A;  3SO8 A;  3CR3 A;  4GTR A;  3U9W A;  4JA9 A;  2VGY A;  1QQE A;  3ZEF A;  3KD7 A;  2Y69 E;  1DNP A;  5T8I A;  3TWQ A;  1TN8 A;  4JHK A;  4APF A;  1OWM A;  3TAX A;  4CZ2 D;  2L9B A;  3HXF A;  3KEZ A;  3TWV A;  1H6P A;  5C2Y A;  4GCN A;  2Q7F A;  1D9S A;  3FTV A;  4FLB A;  3T8K A;  1X81 A;  2MOW A;  2WXK A;  2P9L G;  4CDM A;  2WQH A;  3JUE A;  4BSX A;  4DRX E;  2L6J A;  4HS2 A;  1SVX A;  1K3Z D;  1ELW A;  3RSE G;  4JZY A;  1IHG A;  3TWU A;  3F6Q A;  2JLB A;  2X6H A;  2J4D A;  3X2Q E;  3HYM B;  4XKC A;  2IO3 C;  2DIW A;  4WAF A;  2VYI A;  2J08 A;  2WXI A;  3SF4 A;  4BSZ B;  1NA3 A;  2L6B A;  2I6H A;  3W9G A;  3ABL E;  5HI7 A;  3TWW A;  2WXH A;  3U4T A;  2ZU6 B;  2AXZ A;  2UY1 A;  2WM9 A;  4UQZ A;  3FHE A;  5M72 A;  4NAC A;  3PE3 A;  4TUM A;  1FCH A;  2A5U A;  3P2B A;  4ATG A;  1KLX A;  3ZNG A;  3ZXP A;  3CQC B;  4EEC A;  5G55 A;  2WB2 A;  1UJJ A;  3ZYM A;  4F1P A;  4GA2 A;  4UWF A;  2CFZ A;  3LKU A;  2XPZ A;  1LTX A;  1NZN A;  1OUV A;  4HXI A;  3KSQ A;  4CGW A;  4J8S A;  4AY6 A;  4I43 A;  4RG6 A;  4ATZ D;  5FZS A;  5AQ7 A;  3L22 A;  5KJN A;  2CFU A;  2EIL E;  2L0T B;  3D9I A;  3B7S A;  1O1S A;  1DCE A;  2YHE A;  4LNB A;  1WY6 A;  3CVQ A;  2XS1 A;  2J07 A;  5KJL A;  3UM1 A;  3ZYK A;  3P1U A;  2XZT G;  1D8E A;  3MZL B;  2KCV A;  5BW8 C;  3FUK A;  5HS0 A;  3DXK G;  5AQA A;  5G2N A;  4BER A;  2XGS A;  4K5A B;  4BWR A;  3EIJ A;  2DZO A;  4J6I A;  3IHV A;  3JYS A;  2X6F A;  3JXJ A;  2FBN A;  2CG2 A;  1KZP A;  3GZ2 A;  2WMO A;  3PUJ A;  2FF4 A;  4U63 A;  4AOF A;  3IHY A;  4G23 A;  3G2T A;  1SZ9 A;  3FTS A;  5BV1 A;  1KZO A;  3LYA A;  1MX2 A;  1E8X A;  4R7L A;  2ETC A;  1H2U A;  5A6C A;  2V4L A;  4CDR A;  4K0R A;  4JL0 A;  5AJL A;  4Q69 A;  4U8V D;  4K03 A;  4J7W A;  3E37 A;  5CRV A;  4A1S A;  3CST A;  2WPV A;  4JEU A;  1NI1 A;  4RQI A;  4TUU A;  3EDT B;  3L82 A;  3W9F A;  3LJN A;  1Y8M A;  3AG1 E;  2NSZ A;  1K8K G;  1OXJ A;  3MA5 A;  3MEK A;  4BT8 A;  3UI2 A;  2GRO B;  3JQ0 A;  3B13 A;  4FAD A;  3OXG A;  3TGO A;  2GGF A;  4CEM A;  4U8H A;  1A17 A;  1B89 A;  2XGO A;  1OCR E;  1Z6T A;  3UIP C;  3ZU7 B;  4RSY A;  5CCL A;  3O4Z A;  1H19 A;  4MBG A;  1ZB1 A;  3RRU A;  2F0Y A;  4PH4 B;  3FH8 A;  3J5P A;  4FP7 A;  4GYY A;  1PAQ A;  2QZA A;  4IUL A;  1QBQ A;  5BPP A;  3CK9 A;  3R9M A;  3VLD A;  1WG0 A;  3PZ1 A;  4UWG A;  2J4B A;  4JHR A;  3JXI A;  3CKC A;  2V5Q C;  1E7U A;  1Q2Z A;  1LD7 A;  3APF A;  3EUV A;  3QWW A;  3CVV A;  2Y3A A;  3PNT B;  4PUC A;  3UT7 A;  1BU9 A;  3PZ2 A;  4U96 D;  1UW4 B;  5FJY A;  3SNX A;  1BLX B;  1JWG A;  5ENS D;  3LDZ A;  3ENE A;  3E33 A;  1MJ0 A;  5ANL A;  4XE0 A;  4MS6 A;  3GYZ A;  3OXF A;  2WXN A;  4L2L A;  3E34 A;  4A55 A;  4ACL A;  4NRH B;  3DSU A;  4OAU C;  4CGV A;  4FHK A;  3ABM E;  3SQV A;  3ASG A;  2NC9 A;  4GYO A;  5CRU A;  2IY0 C;  3RJV A;  2IFU A;  1S64 A;  3UIN C;  3B7B A;  1PY1 A;  3EHM A;  3ML8 A;  2MRI A;  4WNF A;  4CYM D;  5FQ8 A;  4APO A;  4OVV A;  3QWV A;  3Q7A A;  4PS7 A;  1NL4 A;  4FHJ A;  4HOT A;  4GTM A;  4GZ5 A;  3D9J A;  2C0M A;  3ASN E;  5AAR A;  5CED B;  5BXU A;  3ZXS A;  4UWH A;  2WQ6 A;  2ZIR A;  3D3M A;  3IEG A;  5AQ9 A;  1N0Q A;  4GB9 A;  3IKO B;  4ZHB A;  3FUF A;  3MCX A;  2IEJ A;  3EIQ C;  3PRE A;  1N9A A;  2PNN A;  3FUI A;  3AG4 E;  3MJW A;  4AM9 A;  2KAT A;  4ANW A;  3Q15 A;  2IJG X;  2VTB B;  4OAV B;  5BV0 A;  5BXO A;  1WM5 A;  4N3B A;  2J8S D;  1TNY A;  1X5B A;  3DEP A;  2XRY A;  1HG2 A;  3HIZ A;  1TEZ A;  1EPU A;  1LD8 A;  2ZGG A;  3APC A;  1GW6 A;  5FQ7 A;  1E96 B;  4WNG A;  3ZHE A;  3J5Q B;  3AG3 E;  2IU1 A;  3DSX A;  5AN8 A;  1BI7 B;  5T3R A;  3QJZ A;  1JCQ A;  4GPM A;  2YIN A;  3CQG B;  4MLP A;  3V79 K;  3DSV A;  1E90 A;  3OTN A;  1Z3X A;  3CVL A;  3ULY A;  4KT6 B;  2J49 A;  4MKT A;  3U3W A;  3C3Q A;  3ULQ A;  2YNQ A;  3FTX A;  2OEV A;  4DX6 D;  3FFL A;  2ILR A;  3PH0 C;  3RRN B;  2X6K A;  4I1O B;  1LF8 A;  3ZW3 A;  2ZGD A;  4I17 A;  2HM8 A;  2XQ0 A;  3B95 A;  2PM6 A;  3L17 A;  2EIN E;  2V8S E;  3K9I A;  1IKN D;  4KVO A;  3C3O A;  3UX4 A;  4BET A;  3FDH A;  1FVF A;  2XS8 A;  1PC2 A;  3CHS A;  4GTQ A;  4C0E A;  4ANU A;  4OVU A;  4IN3 B;  1HU3 A;  5ENT D;  3NB2 A;  2BKG A;  2LXM A;  1S0P A;  3AS8 A;  4V3I A;  1HFA A;  3FU3 A;  3UUX A;  3PEV B;  3URZ A;  4BES A;  3CHR A;  3I4G A;  4GA0 A;  5JMN D;  3AG2 E;  3T5X A;  4H7Y A;  2VJ8 A;  4G26 A;  1EYH A;  2DCP A;  2J09 A;  1JCS A;  5IY5 E;  3SFY A;  2RFM A;  3TXN A;  2GRP B;  2DYS E;  4YND A;  3ASO E;  3HRA A;  3QWP A;  5BNW A;  4NIK A;  4A63 B;  4GYW A;  2VGE A;  5AAO A;  5B1A E;  2V5F A;  3SZ7 A;  3KEA A;  4UI9 J;  4KMO A;  2E0I A;  1E8W A;  3LY7 A;  3DPD A;  5D66 A;  4TXR A;  3UPV A;  3V2X A;  2AWI A;  4HNA D;  5CHE E;  2Y0B G;  3HVE A;  3TWT A;  3CEQ A;  4F7A A;  3WG7 E;  3Q9U C;  3ZFW A;  3HDX A;  3BG0 B;  3UT8 A;  3LPZ A;  5ENN A;  3ASD A;  4XI9 A;  3ZPJ A;  1N94 A;  2LUH A;  4N3C A;  3RU0 A;  1V54 E;  2ZIS A;  1P5Q A;  4C9B B;  2DWZ A;  3RO3 A;  5FZR A;  1G3N B;  4HBD A;  1XNF A;  4DJA A;  3QKY A;  4BTB A;  3UIO C;  3FUL A;  4GU5 A;  2I9C A;  3CSF A;  3FH7 A;  4EBA G;  1TNO A;  3ML9 A;  1FT2 A;  3LCA A;  4HOR A;  3TG5 A;  3DRA A;  4GTS A;  2C2L A;  4UI9 C;  3UQ3 A;  2F8X K;  2R03 A;  4P29 A;  3TWS A;  1O1T A;  1SZA A;  4JPS A;  2CHW A;  2PZI A;  4FJZ A;  2KCK A;  3V2O A;  2LSU A;  5KWD A;  3C98 A;  5D2M C;  4BEP A;  4I6G A;  1DC2 A;  4GZ6 A;  1ELR A;  2R05 A;  4J8Y A;  3S2A A;  4A3T A;  4GZC A;  4BT9 A;  4HOQ A;  5D0O D;  1IXV A;  3NQP A;  3L16 A;  4ANV A;  3NF1 A;  4IRU A;  1UOH A;  4FA6 A;  2XRZ A;  1BPO A;  5J90 A;  4KVM A;  4M7C A;  4MRU A;  2E2E A;  1Y6I A;  2CHX A;  3CHO A;  3ZRH A;  2QYU A;  5CMW A;  5AQB A;  3FEY A;  3G2V A;  4GZ3 A;  4TXQ A;  3CKB A;  4WND A;  4HOS A;  3L54 A;  2CHZ A;  4DX1 A;  2X3M A;  4UUC A;  2DVW A;  4DUI A;  4L7T A;  4DI4 A;  5FTP A;  3BG1 B;  3B7U X;  1N95 A;  3NZS A;  5EYP F;  1WDY A;  1IYG A;  4E6H A;  5ARG A;  3FUD A;  2FO1 E;  1O1R A;  5DBK A;  3UT4 A;  4AJW A;  1HXI A;  1U2V G;  3LY8 A;  4FUL A;  4XZ4 A;  1IQR A;  3CHM A;  3FH5 A;  2FO7 A;  3ASF A;  4DX7 D;  2YQ8 A;  5KJM A;  4G24 A;  4KZ0 A;  5CER B;  3KS2 A;  2AVP A;  4AIF A;  3Q49 B;  4WWN A;  3C3R A;  5E76 A;  2WVI A;  1FPP A;  4NQ0 A;  4L23 A;  3Q78 A;  1UN8 A;  4G25 A;  4GML A;  5CEA A;  3SFX A;  3BEE A;  4LER A;  5G04 C;  2VGX A;  1D8D A;  2WXM A;  1TNB A;  5EX3 A;  2X6I A;  4HI8 A;  3T8M A;  1HH8 A;  4N3A A;  1OY3 D;  3Q4A B;  4JB8 P;  1H6K A;  2ZXW E;  5DIZ A;  3FP3 A;  3FUN A;  4XKB A;  5JJT A;  3LXU X;  3EHN A;  2UY1 B;  2I1J A;  3CGH A;  2GRQ B;  3JUI A;  4ABN A;  3FUH A;  4CT4 A;  3Q79 A;  4HLL A;  3IBE A;  1Z3Y A;  5CBN A;  3QB2 A;  1U3C A;  4DX2 A;  3TJP A;  4HRL A;  3E30 A;  2RG8 A;  2RFA A;  3CVW A;  3DSS A;  4HI9 A;  2OVB A;  4KXK B;  4J8F A;  1MX4 A;  5EKQ D;  4ILH B;  3NBN B;  4AP2 A;  2RD0 A;  3ZYQ A;  2KZT A;  3EHR A;  3ISM C;  1IHB A;  3OXL A;  5KNG A;  3LVQ E;  1E8Z A;  1ELK A;  4Y6C A;  3HXE A;  2HE0 A;  4G1T A;  3B7R L;  1HF8 A;  3MKQ A;  3RO2 A;  4K5B A;  4IYP A;  3FTU A;  5AEN A;  4J8D A;  3FTW A;  3O48 A;  2KM4 A;  1MHQ A;  3UTM A;  2OCC E;  4E85 A;  4BX8 A;  2R59 A;  4N2Q A;  4N39 A;  4LG6 A;  1HO8 A;  3DSW A;  4I1M A;  1TJC A;  3IV0 A;  4GPK A;  1N4S A;  3D9P A;  3R7Q A;  2XHE A;  2MYO A;  3SBS A;  1N4R A;  1ZU2 A;  1YA0 A;  1Z5S C;  2IOL A;  5EDS A;  4XI0 A;  2P9K G;  2XCB A;  2GRR B;  5EX0 A;  3TL5 A;  2ETB A;  3MX3 A;  4L9P A;  3U66 A;  3UM2 A;  3FUE A;  3I3N A;  2F8Y A;  3I4R B;  4HLE A;  3PEU B;  5AIJ A;  2X6J A;  3FTY A;  3KSL A;  3V30 A;  4BY6 A;  1TNZ A;  1HZ4 A;  5J08 A;  4FLH A;  3D9L A;  2BKK B;  4URK A;  5EIL A;  4JC8 A;  2H6I A;  2OV8 A;  2YHC A;  3S7D A;  1TNU A;  5FWQ A;  4U95 D;  3UM0 A;  3T5V A;  4FC8 A;  3NOG D;  4O1O A;  4TXP A;  4AEZ C;  4CT0 A;  1AP7 A;  2CG3 A;  4XX5 A;  2UWJ G;  2LSV A;  4I9E A;  2OND A;  2M63 A;  1HG5 A;  3L9T A;  4HB5 A;  3EU5 A;  4G8K A;  5BUZ A;  4YDY A;  3D9N A;  3SHF A;  1JPL A;  4KBQ A;  3NOC D;  4N5Q A;  3EHQ A;  4JHJ A;  3T9K A;  4Y6W A;  5CMY A;  1N54 A;  2WXO A;  5JJ7 A;  4RLY A;  2PM7 A;  5ENO D;  3LEW A;  2J9Q A;  4C48 B;  1OCO E;  1A5E A;  4LSZ E;  5FT9 A;  4YVO A;  5FIN A;  3PE4 A;  4O60 A;  4G11 A;  2H6H A;  3FY4 A;  3E4B A;  3VLE A;  4JD2 G;  4PS3 A;  3L6A A;  4I6J A;  2ION A;  2WXF A;  5ENP D;  2XCC A;  2EIK E;  5E75 A;  4UWL A;  5CBO A;  4AV7 A;  3PS6 A;  4LCT A;  3R9A B;  2EQX A;  2XPI A;  4ACK A;  5ARF A;  4YDW A;  4DX5 D;  1SA4 A;  1OCZ E;  3CVX A;  1JWF A;  3I5P A;  2GRL A;  1YYH A;  3DEO A;  2FUL A;  4DK5 A;  4LNG A;  3PRZ A;  2QYJ A;  4I2Z A;  4B93 B;  2EIJ E;  1RW2 A;  4CRW A;  4I1A A;  1HE8 A;  3RRM B;  1EDU A;  3MKR A;  1TN7 A;  2WXR A;  4JXT A;  4HRM B;  2AW6 A;  4ANX A;  4JVS A;  4L2Y A;  3FWV A;  3SI5 A;  2X38 A;  3HXB A;  4GTV A;  5LCW C;  5A23 A;  2I2O A;  2XEV A;  3FU5 A;  4LNU D;  4EZJ A;  2IOS A;  3AS4 A;  3KAE A;  4B89 A;  4Q96 A;  3L13 A;  2JAB A;  1KPS B;  3FTZ A;  4K5C A;  4TV3 A;  3ZHE B;  2BUG A;  3TG4 A;  3N71 A;  4UI9 K;  5G05 J;  2H6F A;  2EIM E;  2PQN A;  3D9K A;  1ZBP A;  1TJF A;  3Q7F A;  2F37 A;  2WXP A;  4DI3 A;  5CCM A;  3ZUV B;  4AY5 A;  1INZ A;  4GCO A;  5FZQ A;  2KC7 A;  2DBA A;  2R5S A;  5ENQ D;  2PQR A;  3HHM A;  4DLQ A;  3VTX A;  1FT1 A;  5EID A;  3S7J A;  3NZU A;  2XGM A;  4C0M A;  4CCA A;  1IQU A;  4U0S A;  4QQI A;  5HKP A;  2JEK A;  2WQ7 A;  3APD A;  4HVB A;  5FQ4 A;  3DST A;  3PZD A;  5LP0 A;  3CVY A;  1DVP A;  5H7P A;  3CVP A;  4HOU A;  2P9N G;  4U7E B;  2DZN A;  5AJD A;  4EHM A;  4EPZ A;  2PL2 A;  1DCQ A;  2XEN A;  2XZD G;  5LFA A;  4U04 A;  5G05 C;  3VLF A;  1UN9 A;  2C0L A;  1OWO A;  4UQY A;  4GA1 A;  4FU3 A;  2HYZ A;  1OWL A;  2IF4 A;  3HXD A;  5G04 J;  3ONK A;  3LVR E;  2VQ2 A;  5FIO A;  1K1B A;  3UKR G;  2BF0 X;  2R2L A;  3TWR A;  4DPR A;  4OYS A;  4L1B A;  3LS8 A;  3DPY A;  5KJK A;  3BUA A;  3CVN A;  4XEI G;  3D9H A;  1YCS B;  1QYM A;  4U0U A;  2V4H C;  3Q9N C;  3HVE B;  4Q94 A;  3DXM G;  3MV3 B;  1OT8 A;  3UM3 A;  4FJY A;  2B0O E;  2WMN A;  5HRY A;  3QAR A;  2KBX A;  3G2W A;  2Y4T A;  3ESK A;  3IXE A;  3DBS A;  3GZ1 A;  3AU4 A;  5BT1 A;  4B0Z A;  3VTY A;  3S7F A;  3PZ4 A;  3CHQ A;  5ENR D;  3QC1 A;  4F3V A;  1SW6 A;  1JUQ A;  2Y1L E;  1N4P A;  1RZ4 A;  5KNH D;  3Q5M A;  1OWN A;  1H2V C;  4UQX A;  1L5J A;  5A7D B;  3FUJ A;  2A5E A;  4ILI A;  4J8E A;  5JJ6 A;  1XGW A;  3SFZ A;  4YVQ C;  1TR4 A;  3AAA C;  4G2V A;  3RIB A;  1UJK A;  1KT0 A;  1O5M A;  1QZ2 A;  2VSO E;  4JA7 A;  3C72 A;  5LOZ A;  1VDY A;  3QNK A;  4W9R A;  1NP7 A;  3PDN A;  3AU5 A;  4WUY A;  1MQS A;  3L08 A;  2AXV A;  1FVH A;  2GW1 A;  2LXL A;  2Y4U A;  5EYL A;  2FI7 A;  2OEW A;  2VTB A;  2OOE A;  4GMR A;  1MX6 A;  2LAI A;  3BU8 A;  3ASH A;  2RKK A;  4GTP A;  2B6C A;  2P9P G;  3HG0 D;  2BED A;  4LRZ A;  4ILG A;  3SBT B;  4UWK A;  3MV2 B;  4I9C A;  4U0Z A;  1N52 A;  2XEH A;  3EJN A;  5FQ6 A;  2VSN A;  2WXQ A;  1HX8 A;  2I1K A;  2XEE A;  3PVL A;  1AWC B;  3PZ3 A;  2AJA A;  3JCK C;  3FU6 A;  5B3S E;  2QY7 A;  4B8A A;  4EZL A;  4A3V A;  3C5R A;  4GZD A;  5ITZ F;  2OVF A;  2VSY A;  3UKU G;  5ANR A;  4I6E A;  2P2C P;  3G2U A;  1H0A A;  1H6O A;  4F53 A;  4HRN A;  4AXH A;  3B7T A;  3CK8 A;  2NYJ A;  1MZC A;  3Q73 A;  4F6R D;  3LJ3 A;  5AYW D;  4I2W A;  4PS8 A;  2NXP A;  3CHP A;  2KXP C;  3G2S A;  2BTD A;  2IO2 C;  2QC9 A;  3QDN A;  3BQO A;  4EZK A;  4RG9 A;  2LAH A;  4WNE A;  1OWP A;  4KYO B;  3GZS A;  3AS5 A;  3FU0 A;  3ZGQ A;  4B8C B;  3ULE G;  3TXM A;  1TN6 A;  4B94 A;  5HQ8 A;  2VGX B;  1E8Y A;  4RVB A;  1BD8 A;  4JW1 A;  3OAW A;  5KBA A;  1NA0 A;  3FEX A;  4H7X A;  2KCL A;  1YMP A;  5KCM A;  3S7B A;  2P9I G;  4PDX A;  2HO1 A;  2GRM A;  2ETA A;  5D0Q D;  5B1B E;  1WAO 1;  4GAA A;  4DLO A;  4M3O A;  4GTO A;  4N5C A;  4U07 A;  4WWP A;  3V31 A;  4EQF A;  4J0U A;  2V0P A;  3EU9 A;  2FEZ A;  4WWO A;  5CEC B;  2MHK A;  1SA5 A;  4O1P A;  5EIB E;  3R7R A;  1NFI E;  3ESL A;  3GW4 A;  3MGB A;  4JEH A;  4X8Q A;  2L0I A;  3QOU A;  1E7V A;  1TYQ G;  4N2S A;  2A4Z A;  3MYV A;  2WXL A;  3HXC A;  3NAW A;  3PNL B;  3QAQ A;  4BTA A;  3CV0 A;  2P9S G;  2VSX E;  4G8L A;  1OCC E;  5JHA A;  3ONL A;  2HR2 A;  4GTT A;  4F1S A;  4TRQ A;  3UMV A;  3QK0 A;  1MYO A;  1S63 A;  4HFG A;  2KZT B;  2QFC A;  5EN5 D;  1KT1 A;  3SGH A;  4D10 C;  4NUR A;  1V55 E;  1U3D A;  4YDE A;  3Q75 A;  4CDN A;  4A1G A;  2P9U G;  5T4Y A;  3UXG A;  4GMJ A;  4BX9 A;  3CLJ A;  3MKQ B;  3JQ1 A;  3DWL G;  5LCW J;  3ZKJ A;  3ZVV A;  4LEU A;  4O6F A;  2WXG A;  2H6G A;  5JA4 D;  4ME2 A;  2R17 C;  4LUN U; 
#chains in the Genus database with same CATH homology
 1O1T A;  1TNU A;  1LTX A;  1JCQ A;  2BED A;  3KSQ A;  4LNG A;  3HXE A;  1FPP A;  3Q78 A;  1X81 A;  1JCR A;  1S64 A;  3DSV A;  3SFX A;  3PZ3 A;  3DST A;  1D8D A;  1TNB A;  4GTO A;  1TN7 A;  3EU5 A;  1O1S A;  3Q7A A;  1DCE A;  1NL4 A;  4LNB A;  4GTM A;  1SA5 A;  4EHM A;  3HXB A;  4GTV A;  1D8E A;  3DSW A;  3PZ4 A;  4MBG A;  3E32 A;  2ZIR A;  1N4S A;  2F0Y A;  3HXC A;  1N4R A;  1N4P A;  2IEJ A;  1MZC A;  3Q73 A;  1QBQ A;  1N9A A;  1N94 A;  3PZ1 A;  3Q79 A;  1KZP A;  4GTQ A;  2ZIS A;  4GTT A;  3HXD A;  1LD7 A;  1N95 A;  3EUV A;  1S63 A;  2H6H A;  3E30 A;  4YDO A;  1N4Q A;  1KZO A;  1TNY A;  2H6F A;  1O5M A;  4L9P A;  3C72 A;  3PZ2 A;  4YDE A;  1LD8 A;  3Q7F A;  1O1R A;  3Q75 A;  3DSS A;  4GTR A;  3E33 A;  2R2L A;  3KSL A;  1TN6 A;  1TNZ A;  3E34 A;  1TNO A;  3E37 A;  1FT2 A;  1JCS A;  3DRA A;  3DPY A;  3DSX A;  4GTS A;  3DSU A;  1SA4 A;  2H6G A;  3SFY A;  1FT1 A;  1TN8 A;  1NI1 A;  2H6I A;  4GTP A;  3HXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...