5ENTD

Minocycline bound structure of bacterial efflux pump.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
161
structure length
161
Chain Sequence
HHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
total genus 48
structure length 161
sequence length 161
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5entD00
4O60A 4F6RD 1DCQA 1N11A 5JMND 5D66A 3TWSA 3ZNGA 3HG0D 2V5QC 3JXJA 4DX5D 2L6BA 2QC9A 2QYJA 3TWTA 4LNUD 2ETAA 2BKKB 5AQ9A 3NOGD 5CBNA 3Q9UC 3B95A 2XZTG 4YDWA 4U95D 1S70B 2PNNA 2J8SD 4CYMD 1G3NB 3J5QB 5ENTD 2HE0A 5ENQD 1TR4A 3D9HA 4HLLA 5CEAA 3V2XA 5ENSD 4ZFHA 5HKPA 2KBXA 5KWDA 1K1BA 3KEAA 3TWWA 4Z68A 3W9FA 1MX4A 4HB5A 4K5AB 4HI8A 4JB8P 1YMPA 3F6QA 5KBAA 5KNHD 4DX2A 4QFVA 4GMRA 4J8YA 4HRNA 5FINA 3T8KA 5HRYA 4O1OA 3DEOA 2XEEA 5HS0A 2Y1LE 3UXGA 5AARA 1YYHA 4BEPA 2KXPC 4K5CA 4ZHBA 4C48B 5BXUA 2RFAA 4U8YD 3NBNB 2V4HC 5AQ7A 4QQIA 1IXVA 4UUCA 2DZOA 5EIBE 4ATZD 3EU9A 4A63B 5FIOA 2RFMA 4YDYA 2Y0BG 4N5QA 5JA4D 1AWCB 5AN8A 3V2OA 1UOHA 3DEPA 3JXIA 3ZUVB 5ENRD 5CERB 5AQBA 1BD8A 5EYLA 5BXOA 3J5PA 3LJNA 4CZ2D 3C5RA 3AJIA 4DX6D 2F8YA 1N0RA 2DZNA 2ETCA 2MYOA 4BERA 4BESA 3TWVA 4NIKA 5EIDA 4HRLA 5KNGA 3EHQA 2NYJA 4DRXE 3TWRA 4DX7D 1BI7B 1MJ0A 2BKGA 4O1PA 3ZU7B 4BSZB 5EN5D 4TUMA 4GPMA 4OAUC 2ZGGA 4DUIA 2JABA 4BETA 4HBDA 3IXEA 2XZDG 1MX6A 1NFIE 3EHRA 4K5BA 3TWXA 4HRMB 3B7BA 2A5EA 1D9SA 1YCSB 5ENPD 1MX2A 4HNAD 4U8VD 1A5EA 3AAAC 4G8KA 5EYPF 1BLXB 1MYOA 3NOCD 1AP7A 5AAOA 4OAVB 1K3ZD 2P2CP 3SO8A 4F1PA 5ITZF 2XEHA 5AQAA 2B0OE 3W9GA 5CBOA 1OY3D 1SVXA 1OT8A 4HI9A 2ETBA 5CECB 4HQDA 1N0QA 4LG6A 1BU9A 1WDYA 2DWZA 1QYMA 1SW6A 3JUEA 3Q9NC 3ZKJA 2F8XK 1K1AA 3T9KA 1IKND 3V79K 1DC2A 2FO1E 4DX1A 4J7WA 4B93B 5EILA 3TWQA 5CEDB 4LSZE 2VGEA 1WG0A 3TWUA 3V31A 2AJAA 2XENA 1IHBA 2F37A 2DVWA 1BI8B 2ZGDA 3UTMA 5ENOD 4U96D 4G8LA 3UI2A 3V30A 3HRAA 4RLYA
chains in the Genus database with same CATH superfamily
4G26A 3R9AB 2E0IA 3FUDA 2IO3C 4MLPA 4TXRA 5CBNA 1KZPA 4BX8A 4MBGA 1UN9A 3KEZA 2DBAA 2LXMA 3KEAA 4XKBA 5ANRA 5KNHD 4B89A 1KT0A 5HS0A 3UXGA 3HVEB 2KZTB 5AARA 2OEVA 2WVIA 3ML8A 4C48B 2AXVA 2XGMA 3EU5A 4XIFA 2WM9A 1B89A 3Q75A 4PDXA 3G2VA 1OCRE 3ZUVB 4UWKA 4NRHB 3FTYA 3PZ2A 5BW8C 2WXNA 4EZKA 3CHMA 4G1TA 5IY5E 3VTXA 1N52A 4FU3A 2WXMA 3WXXA 3UT8A 3ESKA 3KS2A 4EQFA 3BG0B 2EIKE 4ANWA 2WQHA 5DBKA 1FCHA 1K3ZD 3PEUB 3ZXPA 5AYWD 3MX3A 2LXLA 1KLXA 4ACKA 3FTUA 3KAEA 2JEKA 3SZ7A 2IONA 3SQVA 5J08A 2XPYA 2L6JA 4J0UA 2F37A 3C3QA 4DK5A 4NQ0A 1DCQA 2KC7A 2WMNA 5CCLA 5D66A 3TWSA 2WXQA 3EDTB 3FH5A 1Y8MA 4GTPA 3URZA 5JHAA 3GYZA 3B95A 5ENTD 1YA0A 1E8XA 3E30A 4IULA 4HI8A 4RSYA 3QK0A 3WG7E 3DEOA 2Y1LE 4B94A 4AY6A 3T8MA 4DI4A 2P9KG 3OTNA 5C1DA 2OCCE 2GRRB 3FP3A 5FJYA 3QDNA 4FC8A 1BD8A 1E7UA 2KZTA 3ZN3A 3UPVA 4XEIG 2ZU6B 2QFCA 1UW4B 4RQIA 4O1PA 1NL4A 1DCEA 2JABA 3IXEA 1RW2A 1D9SA 1SA4A 4HOQA 1E8YA 4KYOB 5EYPF 3I4RB 5ITZF 4F1PA 4I9EA 2B0OE 4FP7A 3NF1A 4C0EA 3MJWA 3JUEA 2V8SE 3CHPA 3CSTA 3SHFA 4AM9A 3FUMA 2XENA 5HI7A 4I1AA 3UI2A 3HRAA 2P9NG 3SFXA 5JMND 2KCKA 2PM7A 5BPPA 4BX9A 3MZLB 3LY8A 4LNUD 5FZQA 3FUEA 3NOGD 3Q9UC 3CHSA 4L7TA 1N4SA 4GA1A 2CG2A 1TNZA 2FULA 1H19A 3LCAA 4O1OA 1HU3A 1Y6IA 4BEPA 1TJCA 1WAO1 5BXUA 2GRNB 4URKA 4N2SA 2H6GA 2DZOA 3KD7A 5FIOA 1HH8A 3ESLA 5EKQD 5AQBA 3FU6A 4FJYA 3C5RA 4BERA 3ZYLA 4HRLA 4DRXE 4CGWA 1BI7B 1NFIE 5C2YA 2YINA 3KSLA 2XS1A 4G11A 2VSYA 4HNAD 4ILGA 5AJLA 4F53A 5EX3A 2RKKA 4JHJA 4N5CA 3Q7AA 1IQRA 2WXOA 1N0QA 3Q7FA 4G23A 3LXUX 3PNLB 4BT9A 4J7WA 2L0IA 5LFAA 5A6CA 4Q69A 3V31A 2CHZA 3RIBA 4U0SA 2R17C 1QQEA 2DYRE 4V3IA 3D3MA 3B7UX 5G04C 3SBSA 3D9IA 1X81A 4N39A 3UM0A 2J8SD 3CHOA 3D9MA 4GTMA 2KM4A 4GU5A 1SZAA 5LOZA 3D9HA 2VGYA 2KBXA 5JJTA 3NZUA 3TWWA 4Z68A 1O5MA 2VSOE 4JB8P 3E34A 1TN8A 4JW1A 3IBEA 1XGWA 3U66A 3QARA 4LUNU 1TJFA 3PRZA 2ZIRA 5CRUA 1Z5SC 2H6IA 4BT8A 2IJGX 4A1SA 4JHKA 2ZISA 4GTRA 3P2BA 1KPSB 1MJ0A 4BSZB 3E4BA 3HXEA 1O1SA 2EINE 3KSQA 4DUIA 2X6FA 3PZ4A 4JEHA 4DLOA 2V4LA 1WM5A 2WXJA 3QB2A 2WQ6A 3ML9A 3AU5A 4G8KA 1QBQA 5EX0A 3PZDA 4K03A 1L5JA 1QNFA 4HVBA 3I5PA 4L9PA 3V79K 4U04A 1KT1A 3TWQA 3SGHA 3CVPA 1WY6A 4M3OA 3T5VA 5KJMA 2PQNA 5BUZA 3UM3A 2XRZA 3LKUA 2CHXA 1OWPA 3HG0D 2RD0A 2NSZA 3AG4E 1HE8A 5AQ9A 1ZU2A 4GZ6A 4CYMD 4IYPA 3FU3A 3MV2B 3S7JA 1INZA 3L54A 4LCTA 1K1BA 2R03A 3ABKE 1MX4A 3ISMC 5B3SE 3F6QA 4J8YA 3D9PA 5KCMA 2VTBB 2J4DA 4LNBA 3ZYKA 2KXPC 2JLBA 2J07A 3Q73A 1Q2ZA 2C0MA 1AWCB 3GZ1A 4TRQA 2UWJG 4ATGA 2XEVA 2ETCA 1H6PA 4EHMA 3FHEA 4X8QA 2ILRA 4GCOA 1HF8A 2XZDG 1OWMA 2LSUA 3L9TA 4ANUA 3ZHEB 4HOUA 1ELWA 4RG6A 3ZVVA 2I9CA 4GYYA 3CV0A 1OWOA 4HQDA 4GZDA 1BU9A 4AV7A 1FT2A 4GZCA 4W9RA 3DXMG 3FY4A 3QC1A 3QWVA 5LCWC 2Y4UA 3SFYA 1BI8B 2XRYA 2PZIA 2WXHA 3UIPC 3Q47B 1V55E 3DWLG 3OAWA 4JA7A 4JVSA 2Y69E 3BU8A 1TR4A 2J9QA 5JJ6A 1HG5A 3RAUA 1TNUA 4J8EA 4GCNA 3C98A 3B7SA 4EZJA 4HB5A 3PZ3A 2P9SG 3G2TA 3Q78A 3T8KA 4ZHBA 1TNBA 3LY9A 4U07A 4A3VA 5DIZA 3JXIA 3E32A 3ULYA 2CFUA 3EIQC 2OVFA 2GRMA 2MYOA 3DSUA 4LEUA 3I3NA 4FJZA 1U2VG 2AXZA 2LSVA 5ARFA 2EILE 4JA9A 2IOSA 1DNPA 2HO1A 4GA0A 4BSXA 4HBDA 3APFA 4YVOA 1HX8A 1SZ9A 2KATA 2WXFA 3LJ3A 2J4BA 4N3CA 2VQ2A 5AQAA 3W9GA 1PY1A 4FHKA 1QZ2A 4GA2A 5D2MC 1K1AA 4TXQA 3T9KA 4FHJA 3FUIA 4LNGA 3CVXA 1WG0A 3TWUA 1N95A 3RRUA 3UTMA 4Q96A 5ENOD 5KJKA 3D9JA 3E33A 4C9BB 2GRPB 4F6RD 1UJJA 5G2NA 4UI9J 1V54E 3TG5A 4GTSA 3LYAA 4AIFA 3PE3A 1N4QA 3SBTB 5EDSA 3CVWA 3IHYA 4GMRA 2I1JA 3IHVA 4KVOA 1P5QA 3NBNB 4H7XA 1E7VA 2HR2A 2YHEA 4YDYA 3CEQA 3PUJA 5ENRD 3QOUA 2IQCA 3HXCA 3CK9A 2DZNA 4B8CB 3MV3B 2IEJA 4KT6B 2P9UG 4EBAG 2XCCA 4JXTA 2MRIA 4OAVB 5T3RA 3HVEA 3CVVA 4XI0A 3FTVA 3B7RL 2VYIA 2FO1E 3L17A 1FVHA 5CEDB 2VGEA 3Q79A 4AY5A 4WWOA 2BF0X 2GGFA 2VSXE 4XZ4A 3R7RA 4HORA 4XI9A 5BV1A 3NB2A 3O48A 3JYSA 4RVBA 4CGVA 2OOEA 4TXPA 3HYMB 2BKKB 3DSTA 2V0PA 5HQ8A 3ZXSA 4U63A 5ENQD 3QKYA 4CDRA 4I1MA 2VGXB 3FEYA 2A4ZA 4BFRA 2I2OA 4K5AB 3ASOE 3SY2A 4QFVA 4AVXA 3FTSA 4K5CA 4RG9A 1OCOE 4BTBA 4UUCA 5EIBE 4OVVA 4U8HA 3ZYMA 1XNFA 1U3CA 2EIME 5BXOA 4A1GA 2FEZA 4DX6D 1N0RA 3E37A 3CVUA 4I9CA 3OXLA 3MKQB 1A5EA 3ZGQA 1BLXB 4UQYA 3CK7A 5CHEE 3SD5A 3EHNA 3LPZA 2WXKA 3IEGA 4KZ0A 1OT8A 3FUJA 4KMOA 4EECA 2PL2A 2AVPA 3Q9NC 4PUCA 5FZRA 1DC2A 1TN6A 2C0LA 3FH7A 2WPVA 3APDA 3PE4A 3PVLA 2AXUA 1E96B 3ABLE 4G8LA 4GZ3A 1NP7A 3ASGA 5JHBA 3UQ3A 4A3TA 5CCMA 1NA0A 3GZ2A 3Q15A 2P9PG 1OCCE 3ONKA 4YDWA 2PNNA 3QWPA 1MQSA 3R7QA 2NXPA 3OXGA 3V2XA 3BEEA 4CT0A 3S7BA 3W9FA 4I1OB 4HOSA 1NZNA 3PREA 3U64A 5KBAA 1JWGA 3EIJA 1OWLA 4GTTA 1YYHA 4GTVA 4AP2A 4PS8A 4I2WA 2VGXA 4ATZD 3EU9A 4I43A 1Z6TA 1HXIA 4KBQA 4CCAA 3SF4A 1UJKA 3TWRA 4TV3A 4UI9K 4TUMA 4GPMA 4OAUC 4O6FA 4M7CA 1MX6A 2UY1B 3RU0A 3PS6A 3ZW3A 4WUYA 4JL0A 3NOCD 2IY0C 4E6HA 5LCWJ 3HXBA 3FUFA 3UT7A 1OCZE 1QYMA 2R59A 1HS6A 4OYSA 2IU1A 4U0UA 1RZ4A 3MKQA 4LSZE 3GZSA 3RO3A 4U96D 4R7LA 4HOTA 4RLYA 4ME2A 3UM2A 1IQUA 3AS8A 3CKCA 3DXKG 2V5QC 3AG3E 3FU0A 3UIOC 1H6OA 4APFA 3MCXA 2IFUA 1JCRA 4GZ5A 3FULA 4GPKA 3AS5A 3DSVA 3FU5A 2ONDA 1YMPA 2BUGA 4HRNA 3ENEA 5HRYA 2CFZA 3CVQA 5FWQA 2KCVA 3L13A 2XQ0A 2RFAA 4QQIA 4P29A 4L2LA 2WXLA 1EF1C 5AN8A 4F1SA 5CERB 2M63A 3CGHA 2XPIA 3ULEG 2R5SA 5E75A 2F8YA 2C2LA 4IRUA 3VTYA 3UKUG 2ZGGA 3L08A 3CVNA 2VJ8A 3JUIA 4HS2A 1O1TA 1JCSA 3LDZA 5AENA 3ABME 4BTAA 4GMLA 2OVBA 2XEHA 3FUKA 2B6CA 4AOFA 1ELKA 5CBOA 1WDYA 2XGSA 2UY1A 1X5BA 3RK6A 4ABNA 1IKND 3UT4A 4E85A 1DVPA 3FTXA 3NAWA 4GMJA 3U9WA 4DPRA 2DVWA 4K0RA 4JEUA 1NI1A 3RO2A 1E90A 4F7AA 4J8FA 3JXJA 2WB2A 4DX5D 1N54A 2QC9A 2HYZA 2QYJA 5B1AE 2AWIA 3FFLA 1S70B 3Q49B 3LEWA 3ZEFA 4GB9A 4HLLA 5CEAA 3HHMA 1E8WA 3IKOB 3G2WA 3P1UA 4J6IA 1OWNA 3CQCB 2XEEA 4MKTA 2E2EA 2Y4TA 1U3DA 2CG3A 5M72A 4N5QA 1H2UA 3UX4A 2VSNA 2GW1A 4BY6A 3RKVA 3LJNA 3ZRHA 5AJDA 1VDYA 1H0AA 2I1KA 3MGBA 3G2UA 2NYJA 5FQ7A 4DX7D 5KJLA 3UINC 3U3WA 5BT1A 4I6EA 3DPDA 2BEDA 1EPUA 3TWXA 2XHEA 3B7BA 1YCSB 5ENPD 4U8VD 3X2QE 2EIJE 4DJAA 3Q4AB 4NURA 4Y6WA 2VTBA 2WMOA 4DLQA 3EHMA 4UWFA 4A55A 2FO7A 4ILHB 1A17A 3CQGB 3AG1E 2WXPA 1JWFA 4Q94A 3PEVB 5G05C 2XS8A 3UMVA 5A23A 2ZGDA 5FQ6A 1BPOA 1N11A 4HFGA 1N9AA 3BQOA 1H2TC 3ASDA 1K8KG 4I6JA 3J5QB 1ELRA 4I6GA 3N71A 3ZHEA 2X3MA 5ENSD 3RJVA 3FUNA 1Z3XA 2XCBA 3LVRE 3LS8A 3S7FA 1D8DA 2X6IA 1JCQA 2V4HC 3B7TA 1UG3A 2RFMA 4FULA 1D8EA 3DEPA 2YQ8A 5EYLA 3CK8A 4GTOA 2GRQB 3PH0C 1TEZA 4NIKA 1HFAA 3U4TA 4FLBA 1MZCA 2BKGA 4GYWA 5EN5D 4CDMA 4FADA 3DSWA 1TN7A 1MX2A 2H6FA 4GYOA 4PS7A 4HI9A 2DWZA 2OEWA 2LNIA 1N4PA 3FTZA 4CT4A 1S64A 2QYUA 2H6HA 1IHBA 5FT9A 3BUAA 5LX8A 4LRZA 4ANVA 3MKRA 1LTXA 4YDEA 4KXKB 4L2YA 3JQ0A 2QY7A 1JUQA 4L1BA 2MOWA 5D0QD 2EQXA 2J49A 2L6BA 2X6JA 3VLDA 3AS4A 2P58C 3MYVA 4XE0A 1PAQA 2OV8A 1HZ4A 5FTPA 1EYHA 4PS3A 5G04J 3FUHA 2Q7FA 5HKPA 4BWRA 5KWDA 3FDHA 2RG8A 2XPZA 3MA5A 5ENNA 1N4RA 4ILIA 2LO6A 4JC8A 1FPPA 3B13A 5LP0A 3NZSA 3EJNA 4UWLA 3DBSA 5B1BE 2L9BA 4UWHA 3G2SA 4U8YD 2L0TB 3TGOA 5A7DB 4N3AA 4L23A 2Y0BG 3K9IA 3TXMA 4WAFA 5FZSA 2KCLA 2V5FA 4H7YA 5KJNA 4AJWA 3L82A 4PH4B 4BESA 1LD7A 2XGOA 1HO8A 4BETA 2IOLA 4CRWA 2FI7A 1LF8A 1FVFA 1MYOA 5AAOA 2P2CP 3VLFA 4AEZC 2WQ7A 2PQRA 5CECB 2ETBA 3HDXA 4I17A 1OUVA 4G25A 4FLHA 3FTWA 3ZKJA 1E8ZA 3CHQA 4DX1A 4JZYA 5G55A 3D9NA 4UI9C 2AJAA 3JCKC 3TG4A 2R02A 4O60A 3SFZA 2BTDA 2GRLA 4U0ZA 5E76A 4N2QA 1W3BA 2X38A 4YVQC 4ACLA 3GW4A 3PUKA 4EBAA 3ULQA 4JHRA 2LAIA 4B0ZA 5D0OD 4FA6A 4WNDA 5ARGA 3AG2E 3I4GA 2IO2C 3CR3A 3ASNE 1O1RA 2P9LG 5T8IA 5FINA 2P9IG 4CDNA 3QNKA 3ZFWA 2GROB 1TYQG 3C3RA 3T5XA 3ZIMA 2DYSE 4HXIA 3QJZA 3L16A 4YDOA 3TXNA 2J09A 3TAXA 3EHQA 1H6KA 3PDNA 3PZ1A 3AU4A 4K5BA 4UQZA 4JPSA 3BG1B 1AP7A 4GTQA 3LY7A 2LAHA 5CMYA 5H7PA 1OY3D 1SVXA 4WNGA 3ASFA 1OXJA 2I6HA 1SW6A 2YHCA 3C72A 3NQPA 3RSEG 4XKCA 2DIWA 3DSSA 5ANLA 3SNXA 2WXGA 3PNTB 2J08A 3MEKA 1GW6A 3CHRA 1JPLA 4N3BA 4C0MA 3ZNGA 4KVMA 5T4YA 5FQ4A 2DCPA 2ETAA 2XZTG 3DSXA 4I2ZA 1G3NB 2NC9A 1PC2A 5AIJA 1EDUA 2R05A 4WNFA 4EPZA 4WWPA 3Q5MA 4APOA 3QWWA 1S0PA 4HLEA 4DX2A 4XX5A 2QZAA 4UWGA 3RRMB 3HXDA 1S63A 5AQ7A 4KZCA 4DI3A 2X6HA 4A63B 3UUXA 3V2OA 2R2LA 1SA5A 3J5PA 4CZ2D 3AJIA 4WNEA 2LUHA 4B8AA 1ZBPA 3TWVA 4G24A 3HIZA 5KNGA 3S2AA 1KZOA 1HG2A 4F3VA 2WXRA 4YNDA 3FWVA 4D10C 3EHRA 4TUUA 3TJPA 3SI5A 3CVLA 3AAAC 4CEMA 3O4ZA 1FT1A 1MHQA 3SO8A 3LVQE 5G05J 3UM1A 1UN8A 4LG6A 5JJ7A 3CSFA 2AW6A 1TNYA 5EILA 5FQ8A 3DPYA 4Y6CA 5J90A 2FBNA 3D9KA 2Y3AA 3S7DA 2MHKA 5CRVA 3VLEA 1Z3YA 3L22A 3C3OA 3IV0A 1LD8A 2F0YA 3TWTA 1NA3A 4U7EB 4IN3B 4U95D 2CHWA 4WWNA 2HE0A 4ZFHA 5BV0A 2YNQA 4J8SA 3R9MA 3CKBA 4AXHA 2HM8A 3FH8A 4LERA 4EZLA 4G2VA 3D9LA 3QAQA 3EUVA 5BNWA 1IXVA 1IYGA 3ZPJA 5JA4D 2A5UA 1UOHA 2WXIA 2IF4A 3ONLA 4NACA 3RRNB 1TNOA 1ZB1A 3TL5A 1H2VC 5EIDA 3FEXA 3ZU7B 5CMWA 4JD2G 2ZXWE 3CVYA 1IHGA 4MRUA 3CLJA 1SQMA 4HRMB 2A5EA 2FF4A 3ZYQA 4GAAA 3UKRG 4MS6A 3OXFA 3DRAA 3CIAA 2PM6A 3JQ1A 2F8XK 3L6AA 2X6KA 4B93B 3D9OA 3ASHA 3HXFA 3APCA 4UQXA 4ANXA 1N94A 3V30A 4OVUA 4J8DA
chains in the Genus database with same CATH topology
4O60A 4F6RD 1DCQA 1N11A 5JMND 5D66A 3TWSA 3ZNGA 3HG0D 2V5QC 3JXJA 4DX5D 2L6BA 2QC9A 2QYJA 3TWTA 4LNUD 2ETAA 2BKKB 5AQ9A 3NOGD 5CBNA 3Q9UC 3B95A 2XZTG 4YDWA 4U95D 1S70B 2PNNA 2J8SD 4CYMD 1G3NB 3J5QB 5ENTD 2HE0A 5ENQD 1TR4A 3D9HA 4HLLA 5CEAA 3V2XA 5ENSD 4ZFHA 5HKPA 2KBXA 5KWDA 1K1BA 3KEAA 3TWWA 4Z68A 3W9FA 1MX4A 4HB5A 4K5AB 4HI8A 4JB8P 1YMPA 3F6QA 5KBAA 5KNHD 4DX2A 4QFVA 4GMRA 4J8YA 4HRNA 5FINA 3T8KA 5HRYA 4O1OA 3DEOA 2XEEA 5HS0A 2Y1LE 3UXGA 5AARA 1YYHA 4BEPA 2KXPC 4K5CA 4ZHBA 4C48B 5BXUA 2RFAA 4U8YD 3NBNB 2V4HC 5AQ7A 4QQIA 1IXVA 4UUCA 2DZOA 5EIBE 4ATZD 3EU9A 4A63B 5FIOA 2RFMA 4YDYA 2Y0BG 4N5QA 5JA4D 1AWCB 5AN8A 3V2OA 1UOHA 3DEPA 3JXIA 3ZUVB 5ENRD 5CERB 5AQBA 1BD8A 5EYLA 5BXOA 3J5PA 3LJNA 4CZ2D 3C5RA 3AJIA 4DX6D 2F8YA 1N0RA 2DZNA 2ETCA 2MYOA 4BERA 4BESA 3TWVA 4NIKA 5EIDA 4HRLA 5KNGA 3EHQA 2NYJA 4DRXE 3TWRA 4DX7D 1BI7B 1MJ0A 2BKGA 4O1PA 3ZU7B 4BSZB 5EN5D 4TUMA 4GPMA 4OAUC 2ZGGA 4DUIA 2JABA 4BETA 4HBDA 3IXEA 2XZDG 1MX6A 1NFIE 3EHRA 4K5BA 3TWXA 4HRMB 3B7BA 2A5EA 1D9SA 1YCSB 5ENPD 1MX2A 4HNAD 4U8VD 1A5EA 3AAAC 4G8KA 5EYPF 1BLXB 1MYOA 3NOCD 1AP7A 5AAOA 4OAVB 1K3ZD 2P2CP 3SO8A 4F1PA 5ITZF 2XEHA 5AQAA 2B0OE 3W9GA 5CBOA 1OY3D 1SVXA 1OT8A 4HI9A 2ETBA 5CECB 4HQDA 1N0QA 4LG6A 1BU9A 1WDYA 2DWZA 1QYMA 1SW6A 3JUEA 3Q9NC 3ZKJA 2F8XK 1K1AA 3T9KA 1IKND 3V79K 1DC2A 2FO1E 4DX1A 4J7WA 4B93B 5EILA 3TWQA 5CEDB 4LSZE 2VGEA 1WG0A 3TWUA 3V31A 2AJAA 2XENA 1IHBA 2F37A 2DVWA 1BI8B 2ZGDA 3UTMA 5ENOD 4U96D 4G8LA 3UI2A 3V30A 3HRAA 4RLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O60 A;  4F6R D;  1DCQ A;  1N11 A;  5JMN D;  5D66 A;  3TWS A;  3ZNG A;  3HG0 D;  2V5Q C;  3JXJ A;  4DX5 D;  2L6B A;  2QC9 A;  2QYJ A;  3TWT A;  4LNU D;  2ETA A;  2BKK B;  5AQ9 A;  3NOG D;  5CBN A;  3Q9U C;  3B95 A;  2XZT G;  4YDW A;  4U95 D;  1S70 B;  2PNN A;  2J8S D;  4CYM D;  1G3N B;  3J5Q B;  5ENT D;  2HE0 A;  5ENQ D;  1TR4 A;  3D9H A;  4HLL A;  5CEA A;  3V2X A;  5ENS D;  4ZFH A;  5HKP A;  2KBX A;  5KWD A;  1K1B A;  3KEA A;  3TWW A;  4Z68 A;  3W9F A;  1MX4 A;  4HB5 A;  4K5A B;  4HI8 A;  4JB8 P;  1YMP A;  3F6Q A;  5KBA A;  5KNH D;  4DX2 A;  4QFV A;  4GMR A;  4J8Y A;  4HRN A;  5FIN A;  3T8K A;  5HRY A;  4O1O A;  3DEO A;  2XEE A;  5HS0 A;  2Y1L E;  3UXG A;  5AAR A;  1YYH A;  4BEP A;  2KXP C;  4K5C A;  4ZHB A;  4C48 B;  5BXU A;  2RFA A;  4U8Y D;  3NBN B;  2V4H C;  5AQ7 A;  4QQI A;  1IXV A;  4UUC A;  2DZO A;  5EIB E;  4ATZ D;  3EU9 A;  4A63 B;  5FIO A;  2RFM A;  4YDY A;  2Y0B G;  4N5Q A;  5JA4 D;  1AWC B;  5AN8 A;  3V2O A;  1UOH A;  3DEP A;  3JXI A;  3ZUV B;  5ENR D;  5CER B;  5AQB A;  1BD8 A;  5EYL A;  5BXO A;  3J5P A;  3LJN A;  4CZ2 D;  3C5R A;  3AJI A;  4DX6 D;  2F8Y A;  1N0R A;  2DZN A;  2ETC A;  2MYO A;  4BER A;  4BES A;  3TWV A;  4NIK A;  5EID A;  4HRL A;  5KNG A;  3EHQ A;  2NYJ A;  4DRX E;  3TWR A;  4DX7 D;  1BI7 B;  1MJ0 A;  2BKG A;  4O1P A;  3ZU7 B;  4BSZ B;  5EN5 D;  4TUM A;  4GPM A;  4OAU C;  2ZGG A;  4DUI A;  2JAB A;  4BET A;  4HBD A;  3IXE A;  2XZD G;  1MX6 A;  1NFI E;  3EHR A;  4K5B A;  3TWX A;  4HRM B;  3B7B A;  2A5E A;  1D9S A;  1YCS B;  5ENP D;  1MX2 A;  4HNA D;  4U8V D;  1A5E A;  3AAA C;  4G8K A;  5EYP F;  1BLX B;  1MYO A;  3NOC D;  1AP7 A;  5AAO A;  4OAV B;  1K3Z D;  2P2C P;  3SO8 A;  4F1P A;  5ITZ F;  2XEH A;  5AQA A;  2B0O E;  3W9G A;  5CBO A;  1OY3 D;  1SVX A;  1OT8 A;  4HI9 A;  2ETB A;  5CEC B;  4HQD A;  1N0Q A;  4LG6 A;  1BU9 A;  1WDY A;  2DWZ A;  1QYM A;  1SW6 A;  3JUE A;  3Q9N C;  3ZKJ A;  2F8X K;  1K1A A;  3T9K A;  1IKN D;  3V79 K;  1DC2 A;  2FO1 E;  4DX1 A;  4J7W A;  4B93 B;  5EIL A;  3TWQ A;  5CED B;  4LSZ E;  2VGE A;  1WG0 A;  3TWU A;  3V31 A;  2AJA A;  2XEN A;  1IHB A;  2F37 A;  2DVW A;  1BI8 B;  2ZGD A;  3UTM A;  5ENO D;  4U96 D;  4G8L A;  3UI2 A;  3V30 A;  3HRA A;  4RLY A; 
#chains in the Genus database with same CATH topology
 4G26 A;  3R9A B;  2E0I A;  3FUD A;  2IO3 C;  4MLP A;  4TXR A;  5CBN A;  1KZP A;  4BX8 A;  4MBG A;  1UN9 A;  3KEZ A;  2DBA A;  2LXM A;  3KEA A;  4XKB A;  5ANR A;  5KNH D;  4B89 A;  1KT0 A;  5HS0 A;  3UXG A;  3HVE B;  2KZT B;  5AAR A;  2OEV A;  2WVI A;  3ML8 A;  4C48 B;  2AXV A;  2XGM A;  3EU5 A;  4XIF A;  2WM9 A;  1B89 A;  3Q75 A;  4PDX A;  3G2V A;  1OCR E;  3ZUV B;  4UWK A;  4NRH B;  3FTY A;  3PZ2 A;  5BW8 C;  2WXN A;  4EZK A;  3CHM A;  4G1T A;  5IY5 E;  3VTX A;  1N52 A;  4FU3 A;  2WXM A;  3WXX A;  3UT8 A;  3ESK A;  3KS2 A;  4EQF A;  3BG0 B;  2EIK E;  4ANW A;  2WQH A;  5DBK A;  1FCH A;  1K3Z D;  3PEU B;  3ZXP A;  5AYW D;  3MX3 A;  2LXL A;  1KLX A;  4ACK A;  3FTU A;  3KAE A;  2JEK A;  3SZ7 A;  2ION A;  3SQV A;  5J08 A;  2XPY A;  2L6J A;  4J0U A;  2F37 A;  3C3Q A;  4DK5 A;  4NQ0 A;  1DCQ A;  2KC7 A;  2WMN A;  5CCL A;  5D66 A;  3TWS A;  2WXQ A;  3EDT B;  3FH5 A;  1Y8M A;  4GTP A;  3URZ A;  5JHA A;  3GYZ A;  3B95 A;  5ENT D;  1YA0 A;  1E8X A;  3E30 A;  4IUL A;  4HI8 A;  4RSY A;  3QK0 A;  3WG7 E;  3DEO A;  2Y1L E;  4B94 A;  4AY6 A;  3T8M A;  4DI4 A;  2P9K G;  3OTN A;  5C1D A;  2OCC E;  2GRR B;  3FP3 A;  5FJY A;  3QDN A;  4FC8 A;  1BD8 A;  1E7U A;  2KZT A;  3ZN3 A;  3UPV A;  4XEI G;  2ZU6 B;  2QFC A;  1UW4 B;  4RQI A;  4O1P A;  1NL4 A;  1DCE A;  2JAB A;  3IXE A;  1RW2 A;  1D9S A;  1SA4 A;  4HOQ A;  1E8Y A;  4KYO B;  5EYP F;  3I4R B;  5ITZ F;  4F1P A;  4I9E A;  2B0O E;  4FP7 A;  3NF1 A;  4C0E A;  3MJW A;  3JUE A;  2V8S E;  3CHP A;  3CST A;  3SHF A;  4AM9 A;  3FUM A;  2XEN A;  5HI7 A;  4I1A A;  3UI2 A;  3HRA A;  2P9N G;  3SFX A;  5JMN D;  2KCK A;  2PM7 A;  5BPP A;  4BX9 A;  3MZL B;  3LY8 A;  4LNU D;  5FZQ A;  3FUE A;  3NOG D;  3Q9U C;  3CHS A;  4L7T A;  1N4S A;  4GA1 A;  2CG2 A;  1TNZ A;  2FUL A;  1H19 A;  3LCA A;  4O1O A;  1HU3 A;  1Y6I A;  4BEP A;  1TJC A;  1WAO 1;  5BXU A;  2GRN B;  4URK A;  4N2S A;  2H6G A;  2DZO A;  3KD7 A;  5FIO A;  1HH8 A;  3ESL A;  5EKQ D;  5AQB A;  3FU6 A;  4FJY A;  3C5R A;  4BER A;  3ZYL A;  4HRL A;  4DRX E;  4CGW A;  1BI7 B;  1NFI E;  5C2Y A;  2YIN A;  3KSL A;  2XS1 A;  4G11 A;  2VSY A;  4HNA D;  4ILG A;  5AJL A;  4F53 A;  5EX3 A;  2RKK A;  4JHJ A;  4N5C A;  3Q7A A;  1IQR A;  2WXO A;  1N0Q A;  3Q7F A;  4G23 A;  3LXU X;  3PNL B;  4BT9 A;  4J7W A;  2L0I A;  5LFA A;  5A6C A;  4Q69 A;  3V31 A;  2CHZ A;  3RIB A;  4U0S A;  2R17 C;  1QQE A;  2DYR E;  4V3I A;  3D3M A;  3B7U X;  5G04 C;  3SBS A;  3D9I A;  1X81 A;  4N39 A;  3UM0 A;  2J8S D;  3CHO A;  3D9M A;  4GTM A;  2KM4 A;  4GU5 A;  1SZA A;  5LOZ A;  3D9H A;  2VGY A;  2KBX A;  5JJT A;  3NZU A;  3TWW A;  4Z68 A;  1O5M A;  2VSO E;  4JB8 P;  3E34 A;  1TN8 A;  4JW1 A;  3IBE A;  1XGW A;  3U66 A;  3QAR A;  4LUN U;  1TJF A;  3PRZ A;  2ZIR A;  5CRU A;  1Z5S C;  2H6I A;  4BT8 A;  2IJG X;  4A1S A;  4JHK A;  2ZIS A;  4GTR A;  3P2B A;  1KPS B;  1MJ0 A;  4BSZ B;  3E4B A;  3HXE A;  1O1S A;  2EIN E;  3KSQ A;  4DUI A;  2X6F A;  3PZ4 A;  4JEH A;  4DLO A;  2V4L A;  1WM5 A;  2WXJ A;  3QB2 A;  2WQ6 A;  3ML9 A;  3AU5 A;  4G8K A;  1QBQ A;  5EX0 A;  3PZD A;  4K03 A;  1L5J A;  1QNF A;  4HVB A;  3I5P A;  4L9P A;  3V79 K;  4U04 A;  1KT1 A;  3TWQ A;  3SGH A;  3CVP A;  1WY6 A;  4M3O A;  3T5V A;  5KJM A;  2PQN A;  5BUZ A;  3UM3 A;  2XRZ A;  3LKU A;  2CHX A;  1OWP A;  3HG0 D;  2RD0 A;  2NSZ A;  3AG4 E;  1HE8 A;  5AQ9 A;  1ZU2 A;  4GZ6 A;  4CYM D;  4IYP A;  3FU3 A;  3MV2 B;  3S7J A;  1INZ A;  3L54 A;  4LCT A;  1K1B A;  2R03 A;  3ABK E;  1MX4 A;  3ISM C;  5B3S E;  3F6Q A;  4J8Y A;  3D9P A;  5KCM A;  2VTB B;  2J4D A;  4LNB A;  3ZYK A;  2KXP C;  2JLB A;  2J07 A;  3Q73 A;  1Q2Z A;  2C0M A;  1AWC B;  3GZ1 A;  4TRQ A;  2UWJ G;  4ATG A;  2XEV A;  2ETC A;  1H6P A;  4EHM A;  3FHE A;  4X8Q A;  2ILR A;  4GCO A;  1HF8 A;  2XZD G;  1OWM A;  2LSU A;  3L9T A;  4ANU A;  3ZHE B;  4HOU A;  1ELW A;  4RG6 A;  3ZVV A;  2I9C A;  4GYY A;  3CV0 A;  1OWO A;  4HQD A;  4GZD A;  1BU9 A;  4AV7 A;  1FT2 A;  4GZC A;  4W9R A;  3DXM G;  3FY4 A;  3QC1 A;  3QWV A;  5LCW C;  2Y4U A;  3SFY A;  1BI8 B;  2XRY A;  2PZI A;  2WXH A;  3UIP C;  3Q47 B;  1V55 E;  3DWL G;  3OAW A;  4JA7 A;  4JVS A;  2Y69 E;  3BU8 A;  1TR4 A;  2J9Q A;  5JJ6 A;  1HG5 A;  3RAU A;  1TNU A;  4J8E A;  4GCN A;  3C98 A;  3B7S A;  4EZJ A;  4HB5 A;  3PZ3 A;  2P9S G;  3G2T A;  3Q78 A;  3T8K A;  4ZHB A;  1TNB A;  3LY9 A;  4U07 A;  4A3V A;  5DIZ A;  3JXI A;  3E32 A;  3ULY A;  2CFU A;  3EIQ C;  2OVF A;  2GRM A;  2MYO A;  3DSU A;  4LEU A;  3I3N A;  4FJZ A;  1U2V G;  2AXZ A;  2LSV A;  5ARF A;  2EIL E;  4JA9 A;  2IOS A;  1DNP A;  2HO1 A;  4GA0 A;  4BSX A;  4HBD A;  3APF A;  4YVO A;  1HX8 A;  1SZ9 A;  2KAT A;  2WXF A;  3LJ3 A;  2J4B A;  4N3C A;  2VQ2 A;  5AQA A;  3W9G A;  1PY1 A;  4FHK A;  1QZ2 A;  4GA2 A;  5D2M C;  1K1A A;  4TXQ A;  3T9K A;  4FHJ A;  3FUI A;  4LNG A;  3CVX A;  1WG0 A;  3TWU A;  1N95 A;  3RRU A;  3UTM A;  4Q96 A;  5ENO D;  5KJK A;  3D9J A;  3E33 A;  4C9B B;  2GRP B;  4F6R D;  1UJJ A;  5G2N A;  4UI9 J;  1V54 E;  3TG5 A;  4GTS A;  3LYA A;  4AIF A;  3PE3 A;  1N4Q A;  3SBT B;  5EDS A;  3CVW A;  3IHY A;  4GMR A;  2I1J A;  3IHV A;  4KVO A;  1P5Q A;  3NBN B;  4H7X A;  1E7V A;  2HR2 A;  2YHE A;  4YDY A;  3CEQ A;  3PUJ A;  5ENR D;  3QOU A;  2IQC A;  3HXC A;  3CK9 A;  2DZN A;  4B8C B;  3MV3 B;  2IEJ A;  4KT6 B;  2P9U G;  4EBA G;  2XCC A;  4JXT A;  2MRI A;  4OAV B;  5T3R A;  3HVE A;  3CVV A;  4XI0 A;  3FTV A;  3B7R L;  2VYI A;  2FO1 E;  3L17 A;  1FVH A;  5CED B;  2VGE A;  3Q79 A;  4AY5 A;  4WWO A;  2BF0 X;  2GGF A;  2VSX E;  4XZ4 A;  3R7R A;  4HOR A;  4XI9 A;  5BV1 A;  3NB2 A;  3O48 A;  3JYS A;  4RVB A;  4CGV A;  2OOE A;  4TXP A;  3HYM B;  2BKK B;  3DST A;  2V0P A;  5HQ8 A;  3ZXS A;  4U63 A;  5ENQ D;  3QKY A;  4CDR A;  4I1M A;  2VGX B;  3FEY A;  2A4Z A;  4BFR A;  2I2O A;  4K5A B;  3ASO E;  3SY2 A;  4QFV A;  4AVX A;  3FTS A;  4K5C A;  4RG9 A;  1OCO E;  4BTB A;  4UUC A;  5EIB E;  4OVV A;  4U8H A;  3ZYM A;  1XNF A;  1U3C A;  2EIM E;  5BXO A;  4A1G A;  2FEZ A;  4DX6 D;  1N0R A;  3E37 A;  3CVU A;  4I9C A;  3OXL A;  3MKQ B;  1A5E A;  3ZGQ A;  1BLX B;  4UQY A;  3CK7 A;  5CHE E;  3SD5 A;  3EHN A;  3LPZ A;  2WXK A;  3IEG A;  4KZ0 A;  1OT8 A;  3FUJ A;  4KMO A;  4EEC A;  2PL2 A;  2AVP A;  3Q9N C;  4PUC A;  5FZR A;  1DC2 A;  1TN6 A;  2C0L A;  3FH7 A;  2WPV A;  3APD A;  3PE4 A;  3PVL A;  2AXU A;  1E96 B;  3ABL E;  4G8L A;  4GZ3 A;  1NP7 A;  3ASG A;  5JHB A;  3UQ3 A;  4A3T A;  5CCM A;  1NA0 A;  3GZ2 A;  3Q15 A;  2P9P G;  1OCC E;  3ONK A;  4YDW A;  2PNN A;  3QWP A;  1MQS A;  3R7Q A;  2NXP A;  3OXG A;  3V2X A;  3BEE A;  4CT0 A;  3S7B A;  3W9F A;  4I1O B;  4HOS A;  1NZN A;  3PRE A;  3U64 A;  5KBA A;  1JWG A;  3EIJ A;  1OWL A;  4GTT A;  1YYH A;  4GTV A;  4AP2 A;  4PS8 A;  4I2W A;  2VGX A;  4ATZ D;  3EU9 A;  4I43 A;  1Z6T A;  1HXI A;  4KBQ A;  4CCA A;  3SF4 A;  1UJK A;  3TWR A;  4TV3 A;  4UI9 K;  4TUM A;  4GPM A;  4OAU C;  4O6F A;  4M7C A;  1MX6 A;  2UY1 B;  3RU0 A;  3PS6 A;  3ZW3 A;  4WUY A;  4JL0 A;  3NOC D;  2IY0 C;  4E6H A;  5LCW J;  3HXB A;  3FUF A;  3UT7 A;  1OCZ E;  1QYM A;  2R59 A;  1HS6 A;  4OYS A;  2IU1 A;  4U0U A;  1RZ4 A;  3MKQ A;  4LSZ E;  3GZS A;  3RO3 A;  4U96 D;  4R7L A;  4HOT A;  4RLY A;  4ME2 A;  3UM2 A;  1IQU A;  3AS8 A;  3CKC A;  3DXK G;  2V5Q C;  3AG3 E;  3FU0 A;  3UIO C;  1H6O A;  4APF A;  3MCX A;  2IFU A;  1JCR A;  4GZ5 A;  3FUL A;  4GPK A;  3AS5 A;  3DSV A;  3FU5 A;  2OND A;  1YMP A;  2BUG A;  4HRN A;  3ENE A;  5HRY A;  2CFZ A;  3CVQ A;  5FWQ A;  2KCV A;  3L13 A;  2XQ0 A;  2RFA A;  4QQI A;  4P29 A;  4L2L A;  2WXL A;  1EF1 C;  5AN8 A;  4F1S A;  5CER B;  2M63 A;  3CGH A;  2XPI A;  3ULE G;  2R5S A;  5E75 A;  2F8Y A;  2C2L A;  4IRU A;  3VTY A;  3UKU G;  2ZGG A;  3L08 A;  3CVN A;  2VJ8 A;  3JUI A;  4HS2 A;  1O1T A;  1JCS A;  3LDZ A;  5AEN A;  3ABM E;  4BTA A;  4GML A;  2OVB A;  2XEH A;  3FUK A;  2B6C A;  4AOF A;  1ELK A;  5CBO A;  1WDY A;  2XGS A;  2UY1 A;  1X5B A;  3RK6 A;  4ABN A;  1IKN D;  3UT4 A;  4E85 A;  1DVP A;  3FTX A;  3NAW A;  4GMJ A;  3U9W A;  4DPR A;  2DVW A;  4K0R A;  4JEU A;  1NI1 A;  3RO2 A;  1E90 A;  4F7A A;  4J8F A;  3JXJ A;  2WB2 A;  4DX5 D;  1N54 A;  2QC9 A;  2HYZ A;  2QYJ A;  5B1A E;  2AWI A;  3FFL A;  1S70 B;  3Q49 B;  3LEW A;  3ZEF A;  4GB9 A;  4HLL A;  5CEA A;  3HHM A;  1E8W A;  3IKO B;  3G2W A;  3P1U A;  4J6I A;  1OWN A;  3CQC B;  2XEE A;  4MKT A;  2E2E A;  2Y4T A;  1U3D A;  2CG3 A;  5M72 A;  4N5Q A;  1H2U A;  3UX4 A;  2VSN A;  2GW1 A;  4BY6 A;  3RKV A;  3LJN A;  3ZRH A;  5AJD A;  1VDY A;  1H0A A;  2I1K A;  3MGB A;  3G2U A;  2NYJ A;  5FQ7 A;  4DX7 D;  5KJL A;  3UIN C;  3U3W A;  5BT1 A;  4I6E A;  3DPD A;  2BED A;  1EPU A;  3TWX A;  2XHE A;  3B7B A;  1YCS B;  5ENP D;  4U8V D;  3X2Q E;  2EIJ E;  4DJA A;  3Q4A B;  4NUR A;  4Y6W A;  2VTB A;  2WMO A;  4DLQ A;  3EHM A;  4UWF A;  4A55 A;  2FO7 A;  4ILH B;  1A17 A;  3CQG B;  3AG1 E;  2WXP A;  1JWF A;  4Q94 A;  3PEV B;  5G05 C;  2XS8 A;  3UMV A;  5A23 A;  2ZGD A;  5FQ6 A;  1BPO A;  1N11 A;  4HFG A;  1N9A A;  3BQO A;  1H2T C;  3ASD A;  1K8K G;  4I6J A;  3J5Q B;  1ELR A;  4I6G A;  3N71 A;  3ZHE A;  2X3M A;  5ENS D;  3RJV A;  3FUN A;  1Z3X A;  2XCB A;  3LVR E;  3LS8 A;  3S7F A;  1D8D A;  2X6I A;  1JCQ A;  2V4H C;  3B7T A;  1UG3 A;  2RFM A;  4FUL A;  1D8E A;  3DEP A;  2YQ8 A;  5EYL A;  3CK8 A;  4GTO A;  2GRQ B;  3PH0 C;  1TEZ A;  4NIK A;  1HFA A;  3U4T A;  4FLB A;  1MZC A;  2BKG A;  4GYW A;  5EN5 D;  4CDM A;  4FAD A;  3DSW A;  1TN7 A;  1MX2 A;  2H6F A;  4GYO A;  4PS7 A;  4HI9 A;  2DWZ A;  2OEW A;  2LNI A;  1N4P A;  3FTZ A;  4CT4 A;  1S64 A;  2QYU A;  2H6H A;  1IHB A;  5FT9 A;  3BUA A;  5LX8 A;  4LRZ A;  4ANV A;  3MKR A;  1LTX A;  4YDE A;  4KXK B;  4L2Y A;  3JQ0 A;  2QY7 A;  1JUQ A;  4L1B A;  2MOW A;  5D0Q D;  2EQX A;  2J49 A;  2L6B A;  2X6J A;  3VLD A;  3AS4 A;  2P58 C;  3MYV A;  4XE0 A;  1PAQ A;  2OV8 A;  1HZ4 A;  5FTP A;  1EYH A;  4PS3 A;  5G04 J;  3FUH A;  2Q7F A;  5HKP A;  4BWR A;  5KWD A;  3FDH A;  2RG8 A;  2XPZ A;  3MA5 A;  5ENN A;  1N4R A;  4ILI A;  2LO6 A;  4JC8 A;  1FPP A;  3B13 A;  5LP0 A;  3NZS A;  3EJN A;  4UWL A;  3DBS A;  5B1B E;  2L9B A;  4UWH A;  3G2S A;  4U8Y D;  2L0T B;  3TGO A;  5A7D B;  4N3A A;  4L23 A;  2Y0B G;  3K9I A;  3TXM A;  4WAF A;  5FZS A;  2KCL A;  2V5F A;  4H7Y A;  5KJN A;  4AJW A;  3L82 A;  4PH4 B;  4BES A;  1LD7 A;  2XGO A;  1HO8 A;  4BET A;  2IOL A;  4CRW A;  2FI7 A;  1LF8 A;  1FVF A;  1MYO A;  5AAO A;  2P2C P;  3VLF A;  4AEZ C;  2WQ7 A;  2PQR A;  5CEC B;  2ETB A;  3HDX A;  4I17 A;  1OUV A;  4G25 A;  4FLH A;  3FTW A;  3ZKJ A;  1E8Z A;  3CHQ A;  4DX1 A;  4JZY A;  5G55 A;  3D9N A;  4UI9 C;  2AJA A;  3JCK C;  3TG4 A;  2R02 A;  4O60 A;  3SFZ A;  2BTD A;  2GRL A;  4U0Z A;  5E76 A;  4N2Q A;  1W3B A;  2X38 A;  4YVQ C;  4ACL A;  3GW4 A;  3PUK A;  4EBA A;  3ULQ A;  4JHR A;  2LAI A;  4B0Z A;  5D0O D;  4FA6 A;  4WND A;  5ARG A;  3AG2 E;  3I4G A;  2IO2 C;  3CR3 A;  3ASN E;  1O1R A;  2P9L G;  5T8I A;  5FIN A;  2P9I G;  4CDN A;  3QNK A;  3ZFW A;  2GRO B;  1TYQ G;  3C3R A;  3T5X A;  3ZIM A;  2DYS E;  4HXI A;  3QJZ A;  3L16 A;  4YDO A;  3TXN A;  2J09 A;  3TAX A;  3EHQ A;  1H6K A;  3PDN A;  3PZ1 A;  3AU4 A;  4K5B A;  4UQZ A;  4JPS A;  3BG1 B;  1AP7 A;  4GTQ A;  3LY7 A;  2LAH A;  5CMY A;  5H7P A;  1OY3 D;  1SVX A;  4WNG A;  3ASF A;  1OXJ A;  2I6H A;  1SW6 A;  2YHC A;  3C72 A;  3NQP A;  3RSE G;  4XKC A;  2DIW A;  3DSS A;  5ANL A;  3SNX A;  2WXG A;  3PNT B;  2J08 A;  3MEK A;  1GW6 A;  3CHR A;  1JPL A;  4N3B A;  4C0M A;  3ZNG A;  4KVM A;  5T4Y A;  5FQ4 A;  2DCP A;  2ETA A;  2XZT G;  3DSX A;  4I2Z A;  1G3N B;  2NC9 A;  1PC2 A;  5AIJ A;  1EDU A;  2R05 A;  4WNF A;  4EPZ A;  4WWP A;  3Q5M A;  4APO A;  3QWW A;  1S0P A;  4HLE A;  4DX2 A;  4XX5 A;  2QZA A;  4UWG A;  3RRM B;  3HXD A;  1S63 A;  5AQ7 A;  4KZC A;  4DI3 A;  2X6H A;  4A63 B;  3UUX A;  3V2O A;  2R2L A;  1SA5 A;  3J5P A;  4CZ2 D;  3AJI A;  4WNE A;  2LUH A;  4B8A A;  1ZBP A;  3TWV A;  4G24 A;  3HIZ A;  5KNG A;  3S2A A;  1KZO A;  1HG2 A;  4F3V A;  2WXR A;  4YND A;  3FWV A;  4D10 C;  3EHR A;  4TUU A;  3TJP A;  3SI5 A;  3CVL A;  3AAA C;  4CEM A;  3O4Z A;  1FT1 A;  1MHQ A;  3SO8 A;  3LVQ E;  5G05 J;  3UM1 A;  1UN8 A;  4LG6 A;  5JJ7 A;  3CSF A;  2AW6 A;  1TNY A;  5EIL A;  5FQ8 A;  3DPY A;  4Y6C A;  5J90 A;  2FBN A;  3D9K A;  2Y3A A;  3S7D A;  2MHK A;  5CRV A;  3VLE A;  1Z3Y A;  3L22 A;  3C3O A;  3IV0 A;  1LD8 A;  2F0Y A;  3TWT A;  1NA3 A;  4U7E B;  4IN3 B;  4U95 D;  2CHW A;  4WWN A;  2HE0 A;  4ZFH A;  5BV0 A;  2YNQ A;  4J8S A;  3R9M A;  3CKB A;  4AXH A;  2HM8 A;  3FH8 A;  4LER A;  4EZL A;  4G2V A;  3D9L A;  3QAQ A;  3EUV A;  5BNW A;  1IXV A;  1IYG A;  3ZPJ A;  5JA4 D;  2A5U A;  1UOH A;  2WXI A;  2IF4 A;  3ONL A;  4NAC A;  3RRN B;  1TNO A;  1ZB1 A;  3TL5 A;  1H2V C;  5EID A;  3FEX A;  3ZU7 B;  5CMW A;  4JD2 G;  2ZXW E;  3CVY A;  1IHG A;  4MRU A;  3CLJ A;  1SQM A;  4HRM B;  2A5E A;  2FF4 A;  3ZYQ A;  4GAA A;  3UKR G;  4MS6 A;  3OXF A;  3DRA A;  3CIA A;  2PM6 A;  3JQ1 A;  2F8X K;  3L6A A;  2X6K A;  4B93 B;  3D9O A;  3ASH A;  3HXF A;  3APC A;  4UQX A;  4ANX A;  1N94 A;  3V30 A;  4OVU A;  4J8D A; 
#chains in the Genus database with same CATH homology
 4O60 A;  4F6R D;  1DCQ A;  1N11 A;  5JMN D;  5D66 A;  3TWS A;  3ZNG A;  3HG0 D;  2V5Q C;  3JXJ A;  4DX5 D;  2L6B A;  2QC9 A;  2QYJ A;  3TWT A;  4LNU D;  2ETA A;  2BKK B;  5AQ9 A;  3NOG D;  5CBN A;  3Q9U C;  3B95 A;  2XZT G;  4YDW A;  4U95 D;  1S70 B;  2PNN A;  2J8S D;  4CYM D;  1G3N B;  3J5Q B;  5ENT D;  2HE0 A;  5ENQ D;  1TR4 A;  3D9H A;  4HLL A;  5CEA A;  3V2X A;  5ENS D;  4ZFH A;  5HKP A;  2KBX A;  5KWD A;  1K1B A;  3KEA A;  3TWW A;  4Z68 A;  3W9F A;  1MX4 A;  4HB5 A;  4K5A B;  4HI8 A;  4JB8 P;  1YMP A;  3F6Q A;  5KBA A;  5KNH D;  4DX2 A;  4QFV A;  4GMR A;  4J8Y A;  4HRN A;  5FIN A;  3T8K A;  5HRY A;  4O1O A;  3DEO A;  2XEE A;  5HS0 A;  2Y1L E;  3UXG A;  5AAR A;  1YYH A;  4BEP A;  2KXP C;  4K5C A;  4ZHB A;  4C48 B;  5BXU A;  2RFA A;  4U8Y D;  3NBN B;  2V4H C;  5AQ7 A;  4QQI A;  1IXV A;  4UUC A;  2DZO A;  5EIB E;  4ATZ D;  3EU9 A;  4A63 B;  5FIO A;  2RFM A;  4YDY A;  2Y0B G;  4N5Q A;  5JA4 D;  1AWC B;  5AN8 A;  3V2O A;  1UOH A;  3DEP A;  3JXI A;  3ZUV B;  5ENR D;  5CER B;  5AQB A;  1BD8 A;  5EYL A;  5BXO A;  3J5P A;  3LJN A;  4CZ2 D;  3C5R A;  3AJI A;  4DX6 D;  2F8Y A;  1N0R A;  2DZN A;  2ETC A;  2MYO A;  4BER A;  4BES A;  3TWV A;  4NIK A;  5EID A;  4HRL A;  5KNG A;  3EHQ A;  2NYJ A;  4DRX E;  3TWR A;  4DX7 D;  1BI7 B;  1MJ0 A;  2BKG A;  4O1P A;  3ZU7 B;  4BSZ B;  5EN5 D;  4TUM A;  4GPM A;  4OAU C;  2ZGG A;  4DUI A;  2JAB A;  4BET A;  4HBD A;  3IXE A;  2XZD G;  1MX6 A;  1NFI E;  3EHR A;  4K5B A;  3TWX A;  4HRM B;  3B7B A;  2A5E A;  1D9S A;  1YCS B;  5ENP D;  1MX2 A;  4HNA D;  4U8V D;  1A5E A;  3AAA C;  4G8K A;  5EYP F;  1BLX B;  1MYO A;  3NOC D;  1AP7 A;  5AAO A;  4OAV B;  1K3Z D;  2P2C P;  3SO8 A;  4F1P A;  5ITZ F;  2XEH A;  5AQA A;  2B0O E;  3W9G A;  5CBO A;  1OY3 D;  1SVX A;  1OT8 A;  4HI9 A;  2ETB A;  5CEC B;  4HQD A;  1N0Q A;  4LG6 A;  1BU9 A;  1WDY A;  2DWZ A;  1QYM A;  1SW6 A;  3JUE A;  3Q9N C;  3ZKJ A;  2F8X K;  1K1A A;  3T9K A;  1IKN D;  3V79 K;  1DC2 A;  2FO1 E;  4DX1 A;  4J7W A;  4B93 B;  5EIL A;  3TWQ A;  5CED B;  4LSZ E;  2VGE A;  1WG0 A;  3TWU A;  3V31 A;  2AJA A;  2XEN A;  1IHB A;  2F37 A;  2DVW A;  1BI8 B;  2ZGD A;  3UTM A;  5ENO D;  4U96 D;  4G8L A;  3UI2 A;  3V30 A;  3HRA A;  4RLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...