5ENTD

Minocycline bound structure of bacterial efflux pump.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
161
structure length
161
Chain Sequence
HHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 48
structure length 161
sequence length 161
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5entD00
4ZHBA 2DZNA 2BKKB 1G3NB 3JUEA 4HLLA 3ZKJA 3ZUVB 4CZ2D 4BETA 3T9KA 4U96D 2JABA 1YYHA 2DWZA 2AJAA 3T8KA 4G8KA 4BESA 4F1PA 4BSZB 4J8YA 1IKND 2P2CP 1A5EA 3TWUA 1K1BA 2DZOA 4TUMA 3UXGA 3C5RA 5ENSD 1WDYA 2F37A 3V79K 4QQIA 3NOCD 2FO1E 2RFAA 2F8YA 5KNGA 3HG0D 3AAAC 1YCSB 3LJNA 4BERA 5ITZF 1IHBA 2QC9A 1BI8B 4HRNA 3NBNB 1BI7B 1K3ZD 3V30A 2F8XK 4ZFHA 2ETBA 3W9FA 4YDYA 2HE0A 4DX1A 1DCQA 3Q9NC 1MX2A 2Y0BG 3TWQA 5KBAA 1OT8A 2XZDG 4O1PA 2QYJA 2MYOA 3TWRA 3J5QB 4K5CA 5FINA 3EU9A 4DUIA 2XEHA 1BLXB 4U95D 4N5QA 4JB8P 1TR4A 3DEOA 5D66A 4QFVA 4U8VD 1YMPA 2ETAA 4HI9A 2BKGA 1WG0A 3ZU7B 5CBNA 1MX6A 5EIBE 3AJIA 4U8YD 1AP7A 3DEPA 2VGEA 3B95A 3EHQA 1OY3D 4HB5A 4O1OA 4HRLA 2Y1LE 4RLYA 2J8SD 1DC2A 1N11A 1SW6A 1BD8A 4F6RD 1BU9A 4BEPA 2ZGDA 5HKPA 4HRMB 5JMND 4G8LA 4HQDA 4LG6A 1MYOA 2XEEA 2KBXA 4ATZD 4DX5D 3W9GA 5JA4D 2V5QC 4K5AB 1N0RA 4Z68A 3EHRA 3JXIA 4YDWA 5AQBA 5AQAA 1S70B 1MX4A 4J7WA 4DX6D 3B7BA 5AAOA 2A5EA 3KEAA 1AWCB 3V31A 1SVXA 4C48B 3TWTA 5BXUA 4OAVB 2XENA 3Q9UC 5KNHD 3V2OA 4A63B 3ZNGA 4K5BA 5EYPF 2L6BA 4GPMA 4DRXE 2DVWA 5HS0A 3NOGD 4HI8A 5ENQD 1NFIE 2ZGGA 4UUCA 3V2XA 5CERB 5EN5D 1UOHA 5FIOA 2KXPC 1IXVA 3IXEA 2ETCA 5CEAA 3UTMA 1D9SA 1K1AA 4DX2A 5ENTD 1QYMA 5CEDB 4HNAD 5ENRD 5BXOA 4OAUC 4LNUD 2XZTG 3F6QA 4O60A 5AQ9A 5KWDA 2NYJA 4GMRA 1MJ0A 5ENPD 3UI2A 4HBDA 4NIKA 3D9HA 3TWXA 5CBOA 3TWVA 5CECB 3HRAA 5EYLA 2B0OE 5AQ7A 2PNNA 5ENOD 5HRYA 5AARA 5EILA 3SO8A 4B93B 4CYMD 1N0QA 3TWSA 2RFMA 5AN8A 3J5PA 3TWWA 4LSZE 2V4HC 4DX7D 3JXJA 5EIDA
chains in the Genus database with same CATH superfamily
4LNBA 2WMOA 3Q7FA 3S7BA 1BPOA 3JYSA 3T5XA 3I5PA 2KZTB 3SGHA 1SA4A 3CQCB 2RFAA 3NZUA 2F8YA 4BERA 3LJNA 4EBAA 3GYZA 3U4TA 2UWJG 5D2MC 4U0UA 2PZIA 3D9LA 3GW4A 4WNFA 4N5QA 4CGWA 3UKUG 3ASHA 2V4LA 3APCA 4F53A 3E34A 2XHEA 1O1SA 1UG3A 3SI5A 2WPVA 4FADA 4DX5D 5JA4D 4K5AB 5A6CA 1VDYA 5C2YA 3EIJA 2L6BA 1MQSA 3FUJA 3LY8A 3Q75A 5ENQD 5FIOA 3CGHA 4BY6A 4AJWA 2CHZA 2GRRB 5ENPD 5A7DB 1O5MA 3G2VA 4UQZA 5ENOD 3D9OA 5FQ7A 3RAUA 4GZ3A 3UM2A 2AW6A 5C1DA 3C3RA 4GCOA 4A3TA 2VSNA 1EYHA 4GTPA 2HO1A 3WG7E 3CV0A 3ZGQA 1A17A 3ULQA 2J07A 4FHJA 3KEZA 4HRNA 2HM8A 5G2NA 3PH0C 3CVYA 2IEJA 3FUIA 3CQGB 2E0IA 2PQNA 3ZEFA 1FVHA 4GCNA 4K5CA 2OVBA 3D9IA 1SZAA 3EU9A 5BUZA 5AYWD 3APFA 4IULA 3K9IA 3QC1A 4GTTA 1U2VG 5HKPA 2XRYA 4YDEA 2KBXA 3DSTA 4IYPA 4UWHA 4KVOA 4KVMA 2AXZA 3ZXSA 5AAOA 4GMLA 5G04C 3JUIA 4JPSA 3CHPA 2ETCA 1NZNA 4ANUA 1K1AA 4YVQC 2QZAA 4TXPA 1UJKA 2NYJA 4ANVA 3TWXA 3RIBA 5JJ6A 4HOTA 3CHQA 5AN8A 4GYWA 5G05C 4I2ZA 3CSTA 2YHCA 4BETA 1X81A 4EZLA 3TG5A 3TWUA 3KSLA 1KT0A 4I6EA 2P9IG 1QBQA 5ENSD 2F37A 3NOCD 4NACA 2VSYA 3W9FA 3CIAA 3C3OA 4DLQA 4I43A 1OT8A 3CHMA 3B7TA 4O1PA 4CCAA 2XPYA 2WXMA 4J8DA 1MZCA 5JJ7A 4HOQA 3SHFA 1YMPA 3OAWA 2BKGA 3CK8A 2IF4A 2VGEA 3B95A 2VGXB 2Y1LE 4XKCA 2KATA 1WM5A 2OEWA 3SFZA 2P58C 1Z3YA 3ONLA 3V31A 3PS6A 3Q9UC 1N4SA 4I6JA 3KD7A 3PE3A 4Y6WA 4U63A 2XGSA 3UTMA 3GZSA 5BV1A 3FUKA 4BT8A 3ZYMA 2ONDA 1TN6A 1LTXA 4DI4A 5AQ7A 5EDSA 3IV0A 5EILA 2WXQA 3B7RL 4AVXA 5EIDA 4GU5A 2WXFA 3CEQA 4LRZA 3HXBA 3RKVA 3ZYKA 3FTUA 3BQOA 4BESA 2X6JA 4F3VA 3ZXPA 3L54A 3PUJA 5JHAA 2Q7FA 1HE8A 3FEYA 3MGBA 1DVPA 2M63A 1HH8A 3ULEG 1WDYA 3LCAA 3IEGA 3NZSA 3UIPC 1K3ZD 3L9TA 2P9LG 1HF8A 2H6FA 1TYQG 2MHKA 2LXLA 3E37A 3CK7A 3URZA 3TXNA 3UUXA 2LUHA 4BX9A 2GRMA 3DEOA 3CVVA 3AS5A 2BF0X 3FUFA 4C0MA 3G2SA 4XZ4A 1KPSB 4A55A 3UT8A 4G26A 2L6JA 4HRMB 5ANLA 2P9UG 3QWPA 3RO3A 1N0RA 3I4GA 4TXQA 5LCWC 3KEAA 2R03A 3NAWA 4I1MA 4XIFA 3ML8A 3NOGD 4V3IA 4UUCA 2YHEA 4L23A 2C0LA 5BXOA 5CRVA 4OAUC 4LNUD 3ISMC 4GMRA 3Q73A 5LFAA 3MKQB 1MJ0A 1OWPA 2GRPB 3UI2A 3UMVA 3E4BA 2B6CA 4XX5A 4U04A 2OVFA 4WUYA 3VLDA 3IKOB 3J5PA 2HYZA 4HORA 3ZPJA 2WMNA 3CVQA 3GZ1A 1IYGA 1TNZA 3T8KA 3FWVA 2PM6A 1TJCA 2DZOA 4G11A 5G55A 4MKTA 3MV2B 5BNWA 1U3CA 1IHBA 4FLHA 1H2TC 2BTDA 2X6HA 4J8EA 5T4YA 2KCVA 2VQ2A 3UM3A 3FTWA 5FINA 2WXPA 2AVPA 3BUAA 1E8ZA 4QFVA 5B1AE 1OWMA 1RZ4A 4RG9A 3AG4E 3ML9A 3FH5A 5AJLA 3CVNA 3LS8A 3DPDA 4TUUA 3DSVA 5FTPA 4I9CA 4J7WA 4HFGA 4O6FA 4YNDA 1FVFA 2AWIA 4JW1A 1K8KG 5CERB 1NP7A 4M7CA 5CCLA 2DBAA 5ENTD 3EJNA 2DCPA 5D0OD 3UM0A 4J8FA 4HBDA 3TWVA 2R5SA 4PS7A 3JXJA 4JC8A 1N9AA 4ZHBA 2PL2A 3CVWA 2BKKB 3ZVVA 3MJWA 2I2OA 1YA0A 2LSUA 3FTYA 4B0ZA 2LAHA 4AM9A 3CSFA 3MV3B 1IKND 3HXCA 2H6GA 2LXMA 4A1SA 5J90A 2OCCE 3HG0D 5ITZF 3RU0A 3GZ2A 4MS6A 1OWLA 4AP2A 4AEZC 3QDNA 3Q9NC 5CCMA 4GYYA 5EX3A 2KM4A 1N52A 3C72A 3HXDA 1OCRE 2YQ8A 5CBNA 4CDMA 3CLJA 3RRMB 5AIJA 1ZBPA 2RKKA 1TNBA 2IFUA 3SNXA 4BSXA 1BU9A 5AJDA 3Q78A 4NURA 3JXIA 2EIME 2BEDA 4GTSA 3RSEG 4WNEA 3TWTA 4OAVB 3ZRHA 3MYVA 4K5BA 3AG1E 4DRXE 2DVWA 3TG4A 1IQRA 2KXPC 2R2LA 3LKUA 5CEDB 2XZTG 4AXHA 3QWVA 4WNGA 4ABNA 3SFXA 3PZ4A 4DK5A 4NIKA 1E7UA 3E30A 2PNNA 5BW8C 5G04J 2CFZA 3TJPA 1SQMA 3LY9A 4DX7D 4TXRA 1Z5SC 3FU0A 2IOSA 5FZQA 4HLLA 5FJYA 3CHOA 1LD7A 2JABA 3AU5A 3HYMB 5HQ8A 3SF4A 1KZOA 1D8EA 2Y69E 4PDXA 4DI3A 1OXJA 4KZ0A 4XI9A 5DIZA 3V79K 1N94A 5KNGA 3L22A 5G05J 2WXKA 3G2WA 2VTBA 5KJMA 4UWGA 1E7VA 4BWRA 3MEKA 2XZDG 5BT1A 4U0ZA 2QYJA 3CKBA 4GA2A 4FHKA 5D66A 4GZ5A 4U07A 4TRQA 2ZIRA 2VSOE 5EIBE 3UT4A 3FUEA 3LPZA 1UN8A 2IJGX 3D9MA 5HI7A 3FTXA 2A5EA 3D9PA 2FO7A 5KNHD 3QK0A 3ZNGA 1NA0A 3U64A 4EECA 4CGVA 1KT1A 3ESKA 2DYRE 2WXJA 3ABME 3Q79A 4GA1A 2IO2C 5BV0A 3R9MA 2YNQA 3FU3A 3R7QA 2EQXA 1OWNA 1NI1A 1OWOA 2J9QA 3SO8A 3AU4A 5LP0A 3TWSA 4HOUA 3ZKJA 3E32A 3O4ZA 1Q2ZA 3LY7A 2VJ8A 1LD8A 4EBAG 2ZISA 1BI8B 3N71A 3CVUA 5ARGA 1FT2A 1OCCE 2I1JA 3MKRA 3TWQA 4ILGA 2WXNA 1JCSA 1E96B 4UI9K 3HXFA 1BLXB 4UWLA 2WQ6A 2VYIA 3ESLA 3DWLG 2A5UA 4U0SA 2ETAA 3ZYLA 3AJIA 1HXIA 2P9KG 4WAFA 4F6RD 1H6PA 1ZB1A 2OOEA 4LERA 1TNYA 2GGFA 2KC7A 4N2SA 2NXPA 4D10C 1SVXA 3MCXA 3D3MA 3V2OA 3SQVA 3CR3A 4JXTA 2WB2A 3FTZA 4JVSA 3EHNA 2OV8A 1D9SA 5ENRD 1SZ9A 3EU5A 3F6QA 4O60A 5LCWJ 5EYLA 1DCEA 5AARA 3ZHEB 5AENA 5T8IA 2QYUA 1FT1A 4XEIG 3FHEA 4WWNA 4C9BB 4CZ2D 4GTOA 1Z6TA 1OCOE 2PQRA 3L08A 1K1BA 3UM1A 2WM9A 2CFUA 3VTXA 3FH7A 4G2VA 2F8XK 2WXOA 4GTVA 3ZFWA 5KBAA 1FCHA 4JA9A 2P9NG 3QAQA 3J5QB 2BUGA 5CMYA 3Q47B 3FU6A 3FU5A 2X6IA 2VSXE 1N54A 1W3BA 2GROB 2XS1A 4GZCA 3PRZA 3ZU7B 3U66A 1MX6A 4U8YD 4O1OA 1V54E 3DPYA 3UINC 4YDOA 1SW6A 4ANWA 3DRAA 3Q15A 1MYOA 3Q7AA 4RQIA 3W9GA 3BG1B 4Z68A 4FJYA 4R7LA 4YDWA 3PNLB 3SFYA 2FI7A 5KCMA 1QNFA 4A63B 2LAIA 5EYPF 2ZGGA 2J4BA 4RVBA 1H0AA 4UI9C 1TNOA 4FU3A 4J8SA 5KWDA 4PUCA 3D9KA 3NQPA 1TN8A 3NF1A 1UN9A 3L13A 2ZXWE 5CMWA 4K03A 4B93B 1N0QA 4AY6A 3TWWA 2RG8A 1NA3A 4PS3A 3PNTB 3KS2A 4JA7A 4J8YA 3FDHA 4EZKA 4JHRA 4YVOA 3RK6A 5LX8A 2E2EA 4AOFA 4I6GA 5H7PA 2NSZA 3DSWA 3WXXA 2XPZA 1L5JA 2EILE 1TN7A 4XKBA 3ZHEA 3ZN3A 3ZYQA 4ZFHA 4EPZA 2HE0A 2R02A 3FY4A 5KJKA 3TL5A 3TWRA 4BTBA 1O1TA 2L9BA 1Y6IA 2H6HA 4UWFA 4U8VD 3ASOE 4X8QA 4AY5A 3HHMA 1OY3D 4RLYA 2J4DA 4CEMA 3S2AA 3UPVA 2ZGDA 2WXGA 4G8LA 1UJJA 4LG6A 4E85A 5FZSA 4GZDA 3EHRA 5FT9A 3UQ3A 4FLBA 3JQ0A 1UW4B 2R17C 4PH4B 3G2UA 5FQ8A 1E8WA 4I2WA 2XPIA 1NFIE 1S0PA 4ACLA 4HLEA 1QYMA 1N95A 4HNAD 2DYSE 3NB2A 2V8SE 4KZCA 2PM7A 5AQ9A 4WWPA 4ILIA 1JPLA 2WQHA 4J6IA 2AXVA 1ELRA 3LVQE 3HRAA 3LXUX 3SBSA 2XEVA 3G2TA 2CG2A 3PUKA 2LSVA 4N2QA 1JUQA 4F1SA 4H7YA 4G8KA 4BSZB 3PVLA 3UXGA 3PDNA 2I6HA 3LJ3A 1HG5A 4W9RA 2Y4UA 1TJFA 4G24A 4NQ0A 1E8XA 2FO1E 4LNGA 2VTBB 4CT0A 2ETBA 4L7TA 4OYSA 4GA0A 4DX1A 1DCQA 2AXUA 4N3CA 2MRIA 5FQ4A 1EPUA 3AS8A 2RD0A 2ZU6B 4HS2A 1O1RA 5KJNA 4U95D 4N5CA 3QOUA 3D9NA 3O48A 1HZ4A 3HVEB 3DXKG 4HOSA 3L6AA 4HI9A 1WG0A 4AIFA 1AP7A 3DEPA 1PY1A 4I9EA 3QARA 3E33A 1N11A 1BD8A 3DSUA 3ZIMA 3IHYA 5EKQD 4J0UA 1HU3A 5AQBA 4UQXA 4DPRA 1U3DA 4H7XA 4C48B 2FEZA 3ONKA 2F0YA 3ABKE 3FP3A 1DNPA 4GPMA 1WAO1 2UY1A 3V2XA 3ABLE 2IY0C 2V0PA 3QNKA 2GRQB 3VTYA 3PZ3A 3UX4A 4CYMD 4AV7A 4LSZE 5E76A 2YINA 2DZNA 2EIKE 3T9KA 4UQYA 4L2LA 4JZYA 2LO6A 3LDZA 4BFRA 3Q49B 3OTNA 3C98A 1A5EA 2XCCA 4TUMA 1S64A 4LEUA 4A3VA 2CG3A 3OXGA 4G1TA 1H2UA 1ELWA 2KCLA 1V55E 2HR2A 3SY2A 2R59A 1N4RA 2QC9A 3B7UX 3I3NA 1BI7B 3V30A 3FUMA 2IO3C 1KZPA 4K0RA 2X38A 3ZW3A 3SBTB 2LNIA 5B3SE 2CHXA 5A23A 4B8AA 3DBSA 1MHQA 4GTMA 4M3OA 2Y3AA 1QQEA 4EQFA 1HO8A 2GRLA 3OXLA 3IHVA 2I1KA 4HB5A 2WXLA 3PEVB 4HQDA 2XEEA 4ATZD 1H6OA 1IQUA 5AQAA 1MX4A 3DSXA 5JJTA 1AWCB 1GW6A 1PC2A 2FF4A 2IU1A 4IN3B 1ELKA 4FA6A 1LF8A 3CVLA 4HI8A 3HVEA 5EN5D 4JEUA 1IXVA 4I1OB 5T3RA 4KXKB 3CK9A 4LCTA 1NL4A 1N4QA 3EIQC 2GW1A 5CHEE 3AG2E 1H19A 4MRUA 2WVIA 4CRWA 4ACKA 2WXIA 4I17A 1G3NB 4JD2G 3UT7A 2XGMA 4U96D 3DSSA 2AJAA 3FUDA 3JQ1A 3S7JA 5B1BE 2Y4TA 4C0EA 2L0TB 4ILHB 4GAAA 4KYOB 3HIZA 4DLOA 3AG3E 4U7EB 2XQ0A 2KZTA 4JL0A 4ME2A 3DXMG 3LVRE 2WXHA 5IY5E 2EIJE 3NBNB 3FFLA 3QJZA 4OVUA 3BU8A 2XCBA 3ULYA 4DUIA 2XEHA 2A4ZA 2GRNB 4FJZA 3MZLB 4G23A 3U9WA 1HG2A 5ARFA 3RJVA 4EHMA 1DC2A 3CHRA 3FTVA 3LEWA 2P9SG 3I4RB 4APFA 3RO2A 1HS6A 1PAQA 2XENA 2FULA 2OEVA 4HXIA 4PS8A 5JHBA 5CEAA 3EUVA 4BTAA 4DX2A 3ASNE 1P5QA 2DIWA 4DJAA 3HXEA 2H6IA 4BT9A 4FP7A 3D9HA 5CBOA 4U8HA 3CKCA 2B0OE 2L0IA 3BG0B 2ILRA 2V4HC 3JUEA 4UI9J 3ZUVB 3FEXA 2XGOA 2J08A 4FULA 2P2CP 4G25A 2NC9A 2CHWA 4Q96A 2IONA 3Q5MA 2FBNA 5LOZA 2WXRA 3SZ7A 5J08A 3ENEA 3ASDA 1X5BA 4YDYA 1JCQA 4APOA 2R05A 3JCKC 2QFCA 4URKA 1S63A 2IOLA 3LYAA 3Q4AB 5KJLA 4L2YA 3FULA 3EHMA 4N3AA 4HVBA 5JMND 4Q94A 3PZ2A 4UWKA 4KT6B 4L9PA 4DX6D 1OCZE 4GTRA 4XI0A 3B13A 4FC8A 3PE4A 1E90A 4N39A 3P1UA 2QY7A 5M72A 5FWQA 4CT4A 3IXEA 3SD5A 4B89A 5ENNA 4IRUA 3C3QA 1JWGA 2C2LA 5CECB 1SA5A 3FUNA 4LUNU 3HDXA 3T5VA 3S7FA 2RFMA 4GTQA 3CHSA 3R7RA 1FPPA 4GB9A 4WWOA 3L16A 3KAEA 3X2QE 2P9PG 1TEZA 5CRUA 4F1PA 4JHKA 1H2VC 3PZDA 2EINE 3C5RA 2MOWA 4NRHB 1EF1C 1HX8A 4KBQA 3VLEA 3APDA 4GPKA 1JWFA 1MX2A 1OUVA 5EX0A 2XRZA 2MYOA 3L17A 1D8DA 2JEKA 5E75A 4GMJA 4L1BA 3PREA 3QWWA 3S7DA 1TNUA 3EDTB 4Y6CA 4HRLA 3TXMA 2J8SD 2VGYA 2VGXA 1H6KA 3BEEA 3QB2A 2V5QC 4GYOA 4CDNA 2V5FA 3T8MA 4Q69A 1S70B 5BXUA 2UY1B 1XNFA 4JEHA 3CVXA 4E6HA 3KSQA 3D9JA 5HS0A 3B7SA 1HFAA 4RG6A 3QKYA 1XGWA 3UKRG 1B89A 2X6KA 4WNDA 4N3BA 4XE0A 4OVVA 3MA5A 4B8CB 3PEUB 3RRUA 1WY6A 3CVPA 1YYHA 2DWZA 3P2BA 1JCRA 4B94A 3ASGA 3IBEA 3U3WA 3PZ1A 3FH8A 4QQIA 4JHJA 2J09A 2X6FA 1YCSB 3AAAC 4ATGA 4P29A 2XS8A 4ANXA 1KLXA 1EDUA 2X3MA 1QZ2A 2Y0BG 5DBKA 4TV3A 3AS4A 3L82A 3ASFA 4BX8A 4CDRA 3TAXA 4JB8P 1TR4A 5BPPA 2J49A 4I1AA 3FUHA 1Y8MA 4RSYA 3EHQA 5FQ6A 4MBGA 2IQCA 4BEPA 1INZA 4A1GA 5FZRA 2JLBA 2KCKA 1RW2A 2WQ7A 1N4PA 3B7BA 5ANRA 4F7AA 3R9AB 1E8YA 4MLPA 1Z3XA 3UIOC 3TGOA 1UOHA 2I9CA 2C0MA 3OXFA 4KMOA 3RRNB 3FTSA 3MKQA 5D0QD 4EZJA 1ZU2A 5HRYA 1IHGA 4GZ6A 3VLFA 3MX3A
chains in the Genus database with same CATH topology
4ZHBA 2DZNA 2BKKB 1G3NB 3JUEA 4HLLA 3ZKJA 3ZUVB 4CZ2D 4BETA 3T9KA 4U96D 2JABA 1YYHA 2DWZA 2AJAA 3T8KA 4G8KA 4BESA 4F1PA 4BSZB 4J8YA 1IKND 2P2CP 1A5EA 3TWUA 1K1BA 2DZOA 4TUMA 3UXGA 3C5RA 5ENSD 1WDYA 2F37A 3V79K 4QQIA 3NOCD 2FO1E 2RFAA 2F8YA 5KNGA 3HG0D 3AAAC 1YCSB 3LJNA 4BERA 5ITZF 1IHBA 2QC9A 1BI8B 4HRNA 3NBNB 1BI7B 1K3ZD 3V30A 2F8XK 4ZFHA 2ETBA 3W9FA 4YDYA 2HE0A 4DX1A 1DCQA 3Q9NC 1MX2A 2Y0BG 3TWQA 5KBAA 1OT8A 2XZDG 4O1PA 2QYJA 2MYOA 3TWRA 3J5QB 4K5CA 5FINA 3EU9A 4DUIA 2XEHA 1BLXB 4U95D 4N5QA 4JB8P 1TR4A 3DEOA 5D66A 4QFVA 4U8VD 1YMPA 2ETAA 4HI9A 2BKGA 1WG0A 3ZU7B 5CBNA 1MX6A 5EIBE 3AJIA 4U8YD 1AP7A 3DEPA 2VGEA 3B95A 3EHQA 1OY3D 4HB5A 4O1OA 4HRLA 2Y1LE 4RLYA 2J8SD 1DC2A 1N11A 1SW6A 1BD8A 4F6RD 1BU9A 4BEPA 2ZGDA 5HKPA 4HRMB 5JMND 4G8LA 4HQDA 4LG6A 1MYOA 2XEEA 2KBXA 4ATZD 4DX5D 3W9GA 5JA4D 2V5QC 4K5AB 1N0RA 4Z68A 3EHRA 3JXIA 4YDWA 5AQBA 5AQAA 1S70B 1MX4A 4J7WA 4DX6D 3B7BA 5AAOA 2A5EA 3KEAA 1AWCB 3V31A 1SVXA 4C48B 3TWTA 5BXUA 4OAVB 2XENA 3Q9UC 5KNHD 3V2OA 4A63B 3ZNGA 4K5BA 5EYPF 2L6BA 4GPMA 4DRXE 2DVWA 5HS0A 3NOGD 4HI8A 5ENQD 1NFIE 2ZGGA 4UUCA 3V2XA 5CERB 5EN5D 1UOHA 5FIOA 2KXPC 1IXVA 3IXEA 2ETCA 5CEAA 3UTMA 1D9SA 1K1AA 4DX2A 5ENTD 1QYMA 5CEDB 4HNAD 5ENRD 5BXOA 4OAUC 4LNUD 2XZTG 3F6QA 4O60A 5AQ9A 5KWDA 2NYJA 4GMRA 1MJ0A 5ENPD 3UI2A 4HBDA 4NIKA 3D9HA 3TWXA 5CBOA 3TWVA 5CECB 3HRAA 5EYLA 2B0OE 5AQ7A 2PNNA 5ENOD 5HRYA 5AARA 5EILA 3SO8A 4B93B 4CYMD 1N0QA 3TWSA 2RFMA 5AN8A 3J5PA 3TWWA 4LSZE 2V4HC 4DX7D 3JXJA 5EIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHB A;  2DZN A;  2BKK B;  1G3N B;  3JUE A;  4HLL A;  3ZKJ A;  3ZUV B;  4CZ2 D;  4BET A;  3T9K A;  4U96 D;  2JAB A;  1YYH A;  2DWZ A;  2AJA A;  3T8K A;  4G8K A;  4BES A;  4F1P A;  4BSZ B;  4J8Y A;  1IKN D;  2P2C P;  1A5E A;  3TWU A;  1K1B A;  2DZO A;  4TUM A;  3UXG A;  3C5R A;  5ENS D;  1WDY A;  2F37 A;  3V79 K;  4QQI A;  3NOC D;  2FO1 E;  2RFA A;  2F8Y A;  5KNG A;  3HG0 D;  3AAA C;  1YCS B;  3LJN A;  4BER A;  5ITZ F;  1IHB A;  2QC9 A;  1BI8 B;  4HRN A;  3NBN B;  1BI7 B;  1K3Z D;  3V30 A;  2F8X K;  4ZFH A;  2ETB A;  3W9F A;  4YDY A;  2HE0 A;  4DX1 A;  1DCQ A;  3Q9N C;  1MX2 A;  2Y0B G;  3TWQ A;  5KBA A;  1OT8 A;  2XZD G;  4O1P A;  2QYJ A;  2MYO A;  3TWR A;  3J5Q B;  4K5C A;  5FIN A;  3EU9 A;  4DUI A;  2XEH A;  1BLX B;  4U95 D;  4N5Q A;  4JB8 P;  1TR4 A;  3DEO A;  5D66 A;  4QFV A;  4U8V D;  1YMP A;  2ETA A;  4HI9 A;  2BKG A;  1WG0 A;  3ZU7 B;  5CBN A;  1MX6 A;  5EIB E;  3AJI A;  4U8Y D;  1AP7 A;  3DEP A;  2VGE A;  3B95 A;  3EHQ A;  1OY3 D;  4HB5 A;  4O1O A;  4HRL A;  2Y1L E;  4RLY A;  2J8S D;  1DC2 A;  1N11 A;  1SW6 A;  1BD8 A;  4F6R D;  1BU9 A;  4BEP A;  2ZGD A;  5HKP A;  4HRM B;  5JMN D;  4G8L A;  4HQD A;  4LG6 A;  1MYO A;  2XEE A;  2KBX A;  4ATZ D;  4DX5 D;  3W9G A;  5JA4 D;  2V5Q C;  4K5A B;  1N0R A;  4Z68 A;  3EHR A;  3JXI A;  4YDW A;  5AQB A;  5AQA A;  1S70 B;  1MX4 A;  4J7W A;  4DX6 D;  3B7B A;  5AAO A;  2A5E A;  3KEA A;  1AWC B;  3V31 A;  1SVX A;  4C48 B;  3TWT A;  5BXU A;  4OAV B;  2XEN A;  3Q9U C;  5KNH D;  3V2O A;  4A63 B;  3ZNG A;  4K5B A;  5EYP F;  2L6B A;  4GPM A;  4DRX E;  2DVW A;  5HS0 A;  3NOG D;  4HI8 A;  5ENQ D;  1NFI E;  2ZGG A;  4UUC A;  3V2X A;  5CER B;  5EN5 D;  1UOH A;  5FIO A;  2KXP C;  1IXV A;  3IXE A;  2ETC A;  5CEA A;  3UTM A;  1D9S A;  1K1A A;  4DX2 A;  5ENT D;  1QYM A;  5CED B;  4HNA D;  5ENR D;  5BXO A;  4OAU C;  4LNU D;  2XZT G;  3F6Q A;  4O60 A;  5AQ9 A;  5KWD A;  2NYJ A;  4GMR A;  1MJ0 A;  5ENP D;  3UI2 A;  4HBD A;  4NIK A;  3D9H A;  3TWX A;  5CBO A;  3TWV A;  5CEC B;  3HRA A;  5EYL A;  2B0O E;  5AQ7 A;  2PNN A;  5ENO D;  5HRY A;  5AAR A;  5EIL A;  3SO8 A;  4B93 B;  4CYM D;  1N0Q A;  3TWS A;  2RFM A;  5AN8 A;  3J5P A;  3TWW A;  4LSZ E;  2V4H C;  4DX7 D;  3JXJ A;  5EID A; 
#chains in the Genus database with same CATH topology
 4LNB A;  2WMO A;  3Q7F A;  3S7B A;  1BPO A;  3JYS A;  3T5X A;  3I5P A;  2KZT B;  3SGH A;  1SA4 A;  3CQC B;  2RFA A;  3NZU A;  2F8Y A;  4BER A;  3LJN A;  4EBA A;  3GYZ A;  3U4T A;  2UWJ G;  5D2M C;  4U0U A;  2PZI A;  3D9L A;  3GW4 A;  4WNF A;  4N5Q A;  4CGW A;  3UKU G;  3ASH A;  2V4L A;  3APC A;  4F53 A;  3E34 A;  2XHE A;  1O1S A;  1UG3 A;  3SI5 A;  2WPV A;  4FAD A;  4DX5 D;  5JA4 D;  4K5A B;  5A6C A;  1VDY A;  5C2Y A;  3EIJ A;  2L6B A;  1MQS A;  3FUJ A;  3LY8 A;  3Q75 A;  5ENQ D;  5FIO A;  3CGH A;  4BY6 A;  4AJW A;  2CHZ A;  2GRR B;  5ENP D;  5A7D B;  1O5M A;  3G2V A;  4UQZ A;  5ENO D;  3D9O A;  5FQ7 A;  3RAU A;  4GZ3 A;  3UM2 A;  2AW6 A;  5C1D A;  3C3R A;  4GCO A;  4A3T A;  2VSN A;  1EYH A;  4GTP A;  2HO1 A;  3WG7 E;  3CV0 A;  3ZGQ A;  1A17 A;  3ULQ A;  2J07 A;  4FHJ A;  3KEZ A;  4HRN A;  2HM8 A;  5G2N A;  3PH0 C;  3CVY A;  2IEJ A;  3FUI A;  3CQG B;  2E0I A;  2PQN A;  3ZEF A;  1FVH A;  4GCN A;  4K5C A;  2OVB A;  3D9I A;  1SZA A;  3EU9 A;  5BUZ A;  5AYW D;  3APF A;  4IUL A;  3K9I A;  3QC1 A;  4GTT A;  1U2V G;  5HKP A;  2XRY A;  4YDE A;  2KBX A;  3DST A;  4IYP A;  4UWH A;  4KVO A;  4KVM A;  2AXZ A;  3ZXS A;  5AAO A;  4GML A;  5G04 C;  3JUI A;  4JPS A;  3CHP A;  2ETC A;  1NZN A;  4ANU A;  1K1A A;  4YVQ C;  2QZA A;  4TXP A;  1UJK A;  2NYJ A;  4ANV A;  3TWX A;  3RIB A;  5JJ6 A;  4HOT A;  3CHQ A;  5AN8 A;  4GYW A;  5G05 C;  4I2Z A;  3CST A;  2YHC A;  4BET A;  1X81 A;  4EZL A;  3TG5 A;  3TWU A;  3KSL A;  1KT0 A;  4I6E A;  2P9I G;  1QBQ A;  5ENS D;  2F37 A;  3NOC D;  4NAC A;  2VSY A;  3W9F A;  3CIA A;  3C3O A;  4DLQ A;  4I43 A;  1OT8 A;  3CHM A;  3B7T A;  4O1P A;  4CCA A;  2XPY A;  2WXM A;  4J8D A;  1MZC A;  5JJ7 A;  4HOQ A;  3SHF A;  1YMP A;  3OAW A;  2BKG A;  3CK8 A;  2IF4 A;  2VGE A;  3B95 A;  2VGX B;  2Y1L E;  4XKC A;  2KAT A;  1WM5 A;  2OEW A;  3SFZ A;  2P58 C;  1Z3Y A;  3ONL A;  3V31 A;  3PS6 A;  3Q9U C;  1N4S A;  4I6J A;  3KD7 A;  3PE3 A;  4Y6W A;  4U63 A;  2XGS A;  3UTM A;  3GZS A;  5BV1 A;  3FUK A;  4BT8 A;  3ZYM A;  2OND A;  1TN6 A;  1LTX A;  4DI4 A;  5AQ7 A;  5EDS A;  3IV0 A;  5EIL A;  2WXQ A;  3B7R L;  4AVX A;  5EID A;  4GU5 A;  2WXF A;  3CEQ A;  4LRZ A;  3HXB A;  3RKV A;  3ZYK A;  3FTU A;  3BQO A;  4BES A;  2X6J A;  4F3V A;  3ZXP A;  3L54 A;  3PUJ A;  5JHA A;  2Q7F A;  1HE8 A;  3FEY A;  3MGB A;  1DVP A;  2M63 A;  1HH8 A;  3ULE G;  1WDY A;  3LCA A;  3IEG A;  3NZS A;  3UIP C;  1K3Z D;  3L9T A;  2P9L G;  1HF8 A;  2H6F A;  1TYQ G;  2MHK A;  2LXL A;  3E37 A;  3CK7 A;  3URZ A;  3TXN A;  3UUX A;  2LUH A;  4BX9 A;  2GRM A;  3DEO A;  3CVV A;  3AS5 A;  2BF0 X;  3FUF A;  4C0M A;  3G2S A;  4XZ4 A;  1KPS B;  4A55 A;  3UT8 A;  4G26 A;  2L6J A;  4HRM B;  5ANL A;  2P9U G;  3QWP A;  3RO3 A;  1N0R A;  3I4G A;  4TXQ A;  5LCW C;  3KEA A;  2R03 A;  3NAW A;  4I1M A;  4XIF A;  3ML8 A;  3NOG D;  4V3I A;  4UUC A;  2YHE A;  4L23 A;  2C0L A;  5BXO A;  5CRV A;  4OAU C;  4LNU D;  3ISM C;  4GMR A;  3Q73 A;  5LFA A;  3MKQ B;  1MJ0 A;  1OWP A;  2GRP B;  3UI2 A;  3UMV A;  3E4B A;  2B6C A;  4XX5 A;  4U04 A;  2OVF A;  4WUY A;  3VLD A;  3IKO B;  3J5P A;  2HYZ A;  4HOR A;  3ZPJ A;  2WMN A;  3CVQ A;  3GZ1 A;  1IYG A;  1TNZ A;  3T8K A;  3FWV A;  2PM6 A;  1TJC A;  2DZO A;  4G11 A;  5G55 A;  4MKT A;  3MV2 B;  5BNW A;  1U3C A;  1IHB A;  4FLH A;  1H2T C;  2BTD A;  2X6H A;  4J8E A;  5T4Y A;  2KCV A;  2VQ2 A;  3UM3 A;  3FTW A;  5FIN A;  2WXP A;  2AVP A;  3BUA A;  1E8Z A;  4QFV A;  5B1A E;  1OWM A;  1RZ4 A;  4RG9 A;  3AG4 E;  3ML9 A;  3FH5 A;  5AJL A;  3CVN A;  3LS8 A;  3DPD A;  4TUU A;  3DSV A;  5FTP A;  4I9C A;  4J7W A;  4HFG A;  4O6F A;  4YND A;  1FVF A;  2AWI A;  4JW1 A;  1K8K G;  5CER B;  1NP7 A;  4M7C A;  5CCL A;  2DBA A;  5ENT D;  3EJN A;  2DCP A;  5D0O D;  3UM0 A;  4J8F A;  4HBD A;  3TWV A;  2R5S A;  4PS7 A;  3JXJ A;  4JC8 A;  1N9A A;  4ZHB A;  2PL2 A;  3CVW A;  2BKK B;  3ZVV A;  3MJW A;  2I2O A;  1YA0 A;  2LSU A;  3FTY A;  4B0Z A;  2LAH A;  4AM9 A;  3CSF A;  3MV3 B;  1IKN D;  3HXC A;  2H6G A;  2LXM A;  4A1S A;  5J90 A;  2OCC E;  3HG0 D;  5ITZ F;  3RU0 A;  3GZ2 A;  4MS6 A;  1OWL A;  4AP2 A;  4AEZ C;  3QDN A;  3Q9N C;  5CCM A;  4GYY A;  5EX3 A;  2KM4 A;  1N52 A;  3C72 A;  3HXD A;  1OCR E;  2YQ8 A;  5CBN A;  4CDM A;  3CLJ A;  3RRM B;  5AIJ A;  1ZBP A;  2RKK A;  1TNB A;  2IFU A;  3SNX A;  4BSX A;  1BU9 A;  5AJD A;  3Q78 A;  4NUR A;  3JXI A;  2EIM E;  2BED A;  4GTS A;  3RSE G;  4WNE A;  3TWT A;  4OAV B;  3ZRH A;  3MYV A;  4K5B A;  3AG1 E;  4DRX E;  2DVW A;  3TG4 A;  1IQR A;  2KXP C;  2R2L A;  3LKU A;  5CED B;  2XZT G;  4AXH A;  3QWV A;  4WNG A;  4ABN A;  3SFX A;  3PZ4 A;  4DK5 A;  4NIK A;  1E7U A;  3E30 A;  2PNN A;  5BW8 C;  5G04 J;  2CFZ A;  3TJP A;  1SQM A;  3LY9 A;  4DX7 D;  4TXR A;  1Z5S C;  3FU0 A;  2IOS A;  5FZQ A;  4HLL A;  5FJY A;  3CHO A;  1LD7 A;  2JAB A;  3AU5 A;  3HYM B;  5HQ8 A;  3SF4 A;  1KZO A;  1D8E A;  2Y69 E;  4PDX A;  4DI3 A;  1OXJ A;  4KZ0 A;  4XI9 A;  5DIZ A;  3V79 K;  1N94 A;  5KNG A;  3L22 A;  5G05 J;  2WXK A;  3G2W A;  2VTB A;  5KJM A;  4UWG A;  1E7V A;  4BWR A;  3MEK A;  2XZD G;  5BT1 A;  4U0Z A;  2QYJ A;  3CKB A;  4GA2 A;  4FHK A;  5D66 A;  4GZ5 A;  4U07 A;  4TRQ A;  2ZIR A;  2VSO E;  5EIB E;  3UT4 A;  3FUE A;  3LPZ A;  1UN8 A;  2IJG X;  3D9M A;  5HI7 A;  3FTX A;  2A5E A;  3D9P A;  2FO7 A;  5KNH D;  3QK0 A;  3ZNG A;  1NA0 A;  3U64 A;  4EEC A;  4CGV A;  1KT1 A;  3ESK A;  2DYR E;  2WXJ A;  3ABM E;  3Q79 A;  4GA1 A;  2IO2 C;  5BV0 A;  3R9M A;  2YNQ A;  3FU3 A;  3R7Q A;  2EQX A;  1OWN A;  1NI1 A;  1OWO A;  2J9Q A;  3SO8 A;  3AU4 A;  5LP0 A;  3TWS A;  4HOU A;  3ZKJ A;  3E32 A;  3O4Z A;  1Q2Z A;  3LY7 A;  2VJ8 A;  1LD8 A;  4EBA G;  2ZIS A;  1BI8 B;  3N71 A;  3CVU A;  5ARG A;  1FT2 A;  1OCC E;  2I1J A;  3MKR A;  3TWQ A;  4ILG A;  2WXN A;  1JCS A;  1E96 B;  4UI9 K;  3HXF A;  1BLX B;  4UWL A;  2WQ6 A;  2VYI A;  3ESL A;  3DWL G;  2A5U A;  4U0S A;  2ETA A;  3ZYL A;  3AJI A;  1HXI A;  2P9K G;  4WAF A;  4F6R D;  1H6P A;  1ZB1 A;  2OOE A;  4LER A;  1TNY A;  2GGF A;  2KC7 A;  4N2S A;  2NXP A;  4D10 C;  1SVX A;  3MCX A;  3D3M A;  3V2O A;  3SQV A;  3CR3 A;  4JXT A;  2WB2 A;  3FTZ A;  4JVS A;  3EHN A;  2OV8 A;  1D9S A;  5ENR D;  1SZ9 A;  3EU5 A;  3F6Q A;  4O60 A;  5LCW J;  5EYL A;  1DCE A;  5AAR A;  3ZHE B;  5AEN A;  5T8I A;  2QYU A;  1FT1 A;  4XEI G;  3FHE A;  4WWN A;  4C9B B;  4CZ2 D;  4GTO A;  1Z6T A;  1OCO E;  2PQR A;  3L08 A;  1K1B A;  3UM1 A;  2WM9 A;  2CFU A;  3VTX A;  3FH7 A;  4G2V A;  2F8X K;  2WXO A;  4GTV A;  3ZFW A;  5KBA A;  1FCH A;  4JA9 A;  2P9N G;  3QAQ A;  3J5Q B;  2BUG A;  5CMY A;  3Q47 B;  3FU6 A;  3FU5 A;  2X6I A;  2VSX E;  1N54 A;  1W3B A;  2GRO B;  2XS1 A;  4GZC A;  3PRZ A;  3ZU7 B;  3U66 A;  1MX6 A;  4U8Y D;  4O1O A;  1V54 E;  3DPY A;  3UIN C;  4YDO A;  1SW6 A;  4ANW A;  3DRA A;  3Q15 A;  1MYO A;  3Q7A A;  4RQI A;  3W9G A;  3BG1 B;  4Z68 A;  4FJY A;  4R7L A;  4YDW A;  3PNL B;  3SFY A;  2FI7 A;  5KCM A;  1QNF A;  4A63 B;  2LAI A;  5EYP F;  2ZGG A;  2J4B A;  4RVB A;  1H0A A;  4UI9 C;  1TNO A;  4FU3 A;  4J8S A;  5KWD A;  4PUC A;  3D9K A;  3NQP A;  1TN8 A;  3NF1 A;  1UN9 A;  3L13 A;  2ZXW E;  5CMW A;  4K03 A;  4B93 B;  1N0Q A;  4AY6 A;  3TWW A;  2RG8 A;  1NA3 A;  4PS3 A;  3PNT B;  3KS2 A;  4JA7 A;  4J8Y A;  3FDH A;  4EZK A;  4JHR A;  4YVO A;  3RK6 A;  5LX8 A;  2E2E A;  4AOF A;  4I6G A;  5H7P A;  2NSZ A;  3DSW A;  3WXX A;  2XPZ A;  1L5J A;  2EIL E;  1TN7 A;  4XKB A;  3ZHE A;  3ZN3 A;  3ZYQ A;  4ZFH A;  4EPZ A;  2HE0 A;  2R02 A;  3FY4 A;  5KJK A;  3TL5 A;  3TWR A;  4BTB A;  1O1T A;  2L9B A;  1Y6I A;  2H6H A;  4UWF A;  4U8V D;  3ASO E;  4X8Q A;  4AY5 A;  3HHM A;  1OY3 D;  4RLY A;  2J4D A;  4CEM A;  3S2A A;  3UPV A;  2ZGD A;  2WXG A;  4G8L A;  1UJJ A;  4LG6 A;  4E85 A;  5FZS A;  4GZD A;  3EHR A;  5FT9 A;  3UQ3 A;  4FLB A;  3JQ0 A;  1UW4 B;  2R17 C;  4PH4 B;  3G2U A;  5FQ8 A;  1E8W A;  4I2W A;  2XPI A;  1NFI E;  1S0P A;  4ACL A;  4HLE A;  1QYM A;  1N95 A;  4HNA D;  2DYS E;  3NB2 A;  2V8S E;  4KZC A;  2PM7 A;  5AQ9 A;  4WWP A;  4ILI A;  1JPL A;  2WQH A;  4J6I A;  2AXV A;  1ELR A;  3LVQ E;  3HRA A;  3LXU X;  3SBS A;  2XEV A;  3G2T A;  2CG2 A;  3PUK A;  2LSV A;  4N2Q A;  1JUQ A;  4F1S A;  4H7Y A;  4G8K A;  4BSZ B;  3PVL A;  3UXG A;  3PDN A;  2I6H A;  3LJ3 A;  1HG5 A;  4W9R A;  2Y4U A;  1TJF A;  4G24 A;  4NQ0 A;  1E8X A;  2FO1 E;  4LNG A;  2VTB B;  4CT0 A;  2ETB A;  4L7T A;  4OYS A;  4GA0 A;  4DX1 A;  1DCQ A;  2AXU A;  4N3C A;  2MRI A;  5FQ4 A;  1EPU A;  3AS8 A;  2RD0 A;  2ZU6 B;  4HS2 A;  1O1R A;  5KJN A;  4U95 D;  4N5C A;  3QOU A;  3D9N A;  3O48 A;  1HZ4 A;  3HVE B;  3DXK G;  4HOS A;  3L6A A;  4HI9 A;  1WG0 A;  4AIF A;  1AP7 A;  3DEP A;  1PY1 A;  4I9E A;  3QAR A;  3E33 A;  1N11 A;  1BD8 A;  3DSU A;  3ZIM A;  3IHY A;  5EKQ D;  4J0U A;  1HU3 A;  5AQB A;  4UQX A;  4DPR A;  1U3D A;  4H7X A;  4C48 B;  2FEZ A;  3ONK A;  2F0Y A;  3ABK E;  3FP3 A;  1DNP A;  4GPM A;  1WAO 1;  2UY1 A;  3V2X A;  3ABL E;  2IY0 C;  2V0P A;  3QNK A;  2GRQ B;  3VTY A;  3PZ3 A;  3UX4 A;  4CYM D;  4AV7 A;  4LSZ E;  5E76 A;  2YIN A;  2DZN A;  2EIK E;  3T9K A;  4UQY A;  4L2L A;  4JZY A;  2LO6 A;  3LDZ A;  4BFR A;  3Q49 B;  3OTN A;  3C98 A;  1A5E A;  2XCC A;  4TUM A;  1S64 A;  4LEU A;  4A3V A;  2CG3 A;  3OXG A;  4G1T A;  1H2U A;  1ELW A;  2KCL A;  1V55 E;  2HR2 A;  3SY2 A;  2R59 A;  1N4R A;  2QC9 A;  3B7U X;  3I3N A;  1BI7 B;  3V30 A;  3FUM A;  2IO3 C;  1KZP A;  4K0R A;  2X38 A;  3ZW3 A;  3SBT B;  2LNI A;  5B3S E;  2CHX A;  5A23 A;  4B8A A;  3DBS A;  1MHQ A;  4GTM A;  4M3O A;  2Y3A A;  1QQE A;  4EQF A;  1HO8 A;  2GRL A;  3OXL A;  3IHV A;  2I1K A;  4HB5 A;  2WXL A;  3PEV B;  4HQD A;  2XEE A;  4ATZ D;  1H6O A;  1IQU A;  5AQA A;  1MX4 A;  3DSX A;  5JJT A;  1AWC B;  1GW6 A;  1PC2 A;  2FF4 A;  2IU1 A;  4IN3 B;  1ELK A;  4FA6 A;  1LF8 A;  3CVL A;  4HI8 A;  3HVE A;  5EN5 D;  4JEU A;  1IXV A;  4I1O B;  5T3R A;  4KXK B;  3CK9 A;  4LCT A;  1NL4 A;  1N4Q A;  3EIQ C;  2GW1 A;  5CHE E;  3AG2 E;  1H19 A;  4MRU A;  2WVI A;  4CRW A;  4ACK A;  2WXI A;  4I17 A;  1G3N B;  4JD2 G;  3UT7 A;  2XGM A;  4U96 D;  3DSS A;  2AJA A;  3FUD A;  3JQ1 A;  3S7J A;  5B1B E;  2Y4T A;  4C0E A;  2L0T B;  4ILH B;  4GAA A;  4KYO B;  3HIZ A;  4DLO A;  3AG3 E;  4U7E B;  2XQ0 A;  2KZT A;  4JL0 A;  4ME2 A;  3DXM G;  3LVR E;  2WXH A;  5IY5 E;  2EIJ E;  3NBN B;  3FFL A;  3QJZ A;  4OVU A;  3BU8 A;  2XCB A;  3ULY A;  4DUI A;  2XEH A;  2A4Z A;  2GRN B;  4FJZ A;  3MZL B;  4G23 A;  3U9W A;  1HG2 A;  5ARF A;  3RJV A;  4EHM A;  1DC2 A;  3CHR A;  3FTV A;  3LEW A;  2P9S G;  3I4R B;  4APF A;  3RO2 A;  1HS6 A;  1PAQ A;  2XEN A;  2FUL A;  2OEV A;  4HXI A;  4PS8 A;  5JHB A;  5CEA A;  3EUV A;  4BTA A;  4DX2 A;  3ASN E;  1P5Q A;  2DIW A;  4DJA A;  3HXE A;  2H6I A;  4BT9 A;  4FP7 A;  3D9H A;  5CBO A;  4U8H A;  3CKC A;  2B0O E;  2L0I A;  3BG0 B;  2ILR A;  2V4H C;  3JUE A;  4UI9 J;  3ZUV B;  3FEX A;  2XGO A;  2J08 A;  4FUL A;  2P2C P;  4G25 A;  2NC9 A;  2CHW A;  4Q96 A;  2ION A;  3Q5M A;  2FBN A;  5LOZ A;  2WXR A;  3SZ7 A;  5J08 A;  3ENE A;  3ASD A;  1X5B A;  4YDY A;  1JCQ A;  4APO A;  2R05 A;  3JCK C;  2QFC A;  4URK A;  1S63 A;  2IOL A;  3LYA A;  3Q4A B;  5KJL A;  4L2Y A;  3FUL A;  3EHM A;  4N3A A;  4HVB A;  5JMN D;  4Q94 A;  3PZ2 A;  4UWK A;  4KT6 B;  4L9P A;  4DX6 D;  1OCZ E;  4GTR A;  4XI0 A;  3B13 A;  4FC8 A;  3PE4 A;  1E90 A;  4N39 A;  3P1U A;  2QY7 A;  5M72 A;  5FWQ A;  4CT4 A;  3IXE A;  3SD5 A;  4B89 A;  5ENN A;  4IRU A;  3C3Q A;  1JWG A;  2C2L A;  5CEC B;  1SA5 A;  3FUN A;  4LUN U;  3HDX A;  3T5V A;  3S7F A;  2RFM A;  4GTQ A;  3CHS A;  3R7R A;  1FPP A;  4GB9 A;  4WWO A;  3L16 A;  3KAE A;  3X2Q E;  2P9P G;  1TEZ A;  5CRU A;  4F1P A;  4JHK A;  1H2V C;  3PZD A;  2EIN E;  3C5R A;  2MOW A;  4NRH B;  1EF1 C;  1HX8 A;  4KBQ A;  3VLE A;  3APD A;  4GPK A;  1JWF A;  1MX2 A;  1OUV A;  5EX0 A;  2XRZ A;  2MYO A;  3L17 A;  1D8D A;  2JEK A;  5E75 A;  4GMJ A;  4L1B A;  3PRE A;  3QWW A;  3S7D A;  1TNU A;  3EDT B;  4Y6C A;  4HRL A;  3TXM A;  2J8S D;  2VGY A;  2VGX A;  1H6K A;  3BEE A;  3QB2 A;  2V5Q C;  4GYO A;  4CDN A;  2V5F A;  3T8M A;  4Q69 A;  1S70 B;  5BXU A;  2UY1 B;  1XNF A;  4JEH A;  3CVX A;  4E6H A;  3KSQ A;  3D9J A;  5HS0 A;  3B7S A;  1HFA A;  4RG6 A;  3QKY A;  1XGW A;  3UKR G;  1B89 A;  2X6K A;  4WND A;  4N3B A;  4XE0 A;  4OVV A;  3MA5 A;  4B8C B;  3PEU B;  3RRU A;  1WY6 A;  3CVP A;  1YYH A;  2DWZ A;  3P2B A;  1JCR A;  4B94 A;  3ASG A;  3IBE A;  3U3W A;  3PZ1 A;  3FH8 A;  4QQI A;  4JHJ A;  2J09 A;  2X6F A;  1YCS B;  3AAA C;  4ATG A;  4P29 A;  2XS8 A;  4ANX A;  1KLX A;  1EDU A;  2X3M A;  1QZ2 A;  2Y0B G;  5DBK A;  4TV3 A;  3AS4 A;  3L82 A;  3ASF A;  4BX8 A;  4CDR A;  3TAX A;  4JB8 P;  1TR4 A;  5BPP A;  2J49 A;  4I1A A;  3FUH A;  1Y8M A;  4RSY A;  3EHQ A;  5FQ6 A;  4MBG A;  2IQC A;  4BEP A;  1INZ A;  4A1G A;  5FZR A;  2JLB A;  2KCK A;  1RW2 A;  2WQ7 A;  1N4P A;  3B7B A;  5ANR A;  4F7A A;  3R9A B;  1E8Y A;  4MLP A;  1Z3X A;  3UIO C;  3TGO A;  1UOH A;  2I9C A;  2C0M A;  3OXF A;  4KMO A;  3RRN B;  3FTS A;  3MKQ A;  5D0Q D;  4EZJ A;  1ZU2 A;  5HRY A;  1IHG A;  4GZ6 A;  3VLF A;  3MX3 A; 
#chains in the Genus database with same CATH homology
 4ZHB A;  2DZN A;  2BKK B;  1G3N B;  3JUE A;  4HLL A;  3ZKJ A;  3ZUV B;  4CZ2 D;  4BET A;  3T9K A;  4U96 D;  2JAB A;  1YYH A;  2DWZ A;  2AJA A;  3T8K A;  4G8K A;  4BES A;  4F1P A;  4BSZ B;  4J8Y A;  1IKN D;  2P2C P;  1A5E A;  3TWU A;  1K1B A;  2DZO A;  4TUM A;  3UXG A;  3C5R A;  5ENS D;  1WDY A;  2F37 A;  3V79 K;  4QQI A;  3NOC D;  2FO1 E;  2RFA A;  2F8Y A;  5KNG A;  3HG0 D;  3AAA C;  1YCS B;  3LJN A;  4BER A;  5ITZ F;  1IHB A;  2QC9 A;  1BI8 B;  4HRN A;  3NBN B;  1BI7 B;  1K3Z D;  3V30 A;  2F8X K;  4ZFH A;  2ETB A;  3W9F A;  4YDY A;  2HE0 A;  4DX1 A;  1DCQ A;  3Q9N C;  1MX2 A;  2Y0B G;  3TWQ A;  5KBA A;  1OT8 A;  2XZD G;  4O1P A;  2QYJ A;  2MYO A;  3TWR A;  3J5Q B;  4K5C A;  5FIN A;  3EU9 A;  4DUI A;  2XEH A;  1BLX B;  4U95 D;  4N5Q A;  4JB8 P;  1TR4 A;  3DEO A;  5D66 A;  4QFV A;  4U8V D;  1YMP A;  2ETA A;  4HI9 A;  2BKG A;  1WG0 A;  3ZU7 B;  5CBN A;  1MX6 A;  5EIB E;  3AJI A;  4U8Y D;  1AP7 A;  3DEP A;  2VGE A;  3B95 A;  3EHQ A;  1OY3 D;  4HB5 A;  4O1O A;  4HRL A;  2Y1L E;  4RLY A;  2J8S D;  1DC2 A;  1N11 A;  1SW6 A;  1BD8 A;  4F6R D;  1BU9 A;  4BEP A;  2ZGD A;  5HKP A;  4HRM B;  5JMN D;  4G8L A;  4HQD A;  4LG6 A;  1MYO A;  2XEE A;  2KBX A;  4ATZ D;  4DX5 D;  3W9G A;  5JA4 D;  2V5Q C;  4K5A B;  1N0R A;  4Z68 A;  3EHR A;  3JXI A;  4YDW A;  5AQB A;  5AQA A;  1S70 B;  1MX4 A;  4J7W A;  4DX6 D;  3B7B A;  5AAO A;  2A5E A;  3KEA A;  1AWC B;  3V31 A;  1SVX A;  4C48 B;  3TWT A;  5BXU A;  4OAV B;  2XEN A;  3Q9U C;  5KNH D;  3V2O A;  4A63 B;  3ZNG A;  4K5B A;  5EYP F;  2L6B A;  4GPM A;  4DRX E;  2DVW A;  5HS0 A;  3NOG D;  4HI8 A;  5ENQ D;  1NFI E;  2ZGG A;  4UUC A;  3V2X A;  5CER B;  5EN5 D;  1UOH A;  5FIO A;  2KXP C;  1IXV A;  3IXE A;  2ETC A;  5CEA A;  3UTM A;  1D9S A;  1K1A A;  4DX2 A;  5ENT D;  1QYM A;  5CED B;  4HNA D;  5ENR D;  5BXO A;  4OAU C;  4LNU D;  2XZT G;  3F6Q A;  4O60 A;  5AQ9 A;  5KWD A;  2NYJ A;  4GMR A;  1MJ0 A;  5ENP D;  3UI2 A;  4HBD A;  4NIK A;  3D9H A;  3TWX A;  5CBO A;  3TWV A;  5CEC B;  3HRA A;  5EYL A;  2B0O E;  5AQ7 A;  2PNN A;  5ENO D;  5HRY A;  5AAR A;  5EIL A;  3SO8 A;  4B93 B;  4CYM D;  1N0Q A;  3TWS A;  2RFM A;  5AN8 A;  3J5P A;  3TWW A;  4LSZ E;  2V4H C;  4DX7 D;  3JXJ A;  5EID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...