1N94A

Aryl tetrahydropyridine inhbitors of farnesyltransferase: glycine, phenylalanine and histidine derivates
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase alpha subunit
publication title Aryl tetrahydropyridine inhibitors of farnesyltransferase: glycine, phenylalanine and histidine derivatives.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 106
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n94A00
1FT1A 1TN6A 3DSWA 3KSQA 1LD7A 1O5MA 1N4PA 2H6GA 3DSXA 1D8EA 2ZIRA 2IEJA 1S64A 3HXDA 4L9PA 3DSTA 3EUVA 1X81A 1MZCA 4EHMA 1TNBA 1S63A 1N94A 1O1TA 3PZ1A 4YDOA 3DSUA 3E32A 3Q73A 1O1RA 3PZ4A 4GTTA 4MBGA 4GTPA 2H6FA 1TNYA 3DSSA 3KSLA 3HXEA 2R2LA 1FPPA 3Q7AA 3DPYA 2ZISA 1N4QA 3SFXA 3Q75A 1JCQA 3E30A 4GTVA 2H6IA 3PZ2A 1TN7A 1N95A 1O1SA 1NL4A 3DRAA 1LTXA 3HXBA 3Q7FA 4LNBA 1QBQA 1SA5A 4GTSA 1DCEA 1D8DA 1TN8A 4GTMA 4GTOA 3C72A 4LNGA 1LD8A 1KZOA 1KZPA 3E33A 1N4RA 2BEDA 2H6HA 4GTRA 3DSVA 3EU5A 1TNZA 1N9AA 1TNUA 1JCSA 3HXCA 1SA4A 3E34A 4YDEA 3SFYA 1TNOA 3E37A 3HXFA 1N4SA 1NI1A 1FT2A 3PZ3A 4GTQA 3Q78A 1JCRA 2F0YA 3Q79A
chains in the Genus database with same CATH superfamily
4GU5A 3JCKC 2GGFA 5A7DB 3AG3E 3LDZA 2IY0C 5KJMA 3B95A 4I1MA 4DI4A 3D9LA 2VGXB 3GZ2A 3ZNGA 4OAVB 3NZSA 2GW1A 5JJTA 5ENOD 4IULA 1A5EA 4KMOA 3FDHA 5CCMA 1E8YA 4NQ0A 2LAIA 3FFLA 3UTMA 3CQCB 3MA5A 3AAAC 4J7WA 3BG0B 2WXFA 4BT9A 4R7LA 3ASGA 3Q7AA 2FBNA 1JUQA 2ZISA 4A55A 1Y8MA 2AXZA 3PUJA 1Z3YA 3T9KA 3PS6A 4GYWA 4GYOA 3DPDA 2OVBA 4O60A 3IHVA 4F1PA 3ASFA 2GRMA 2FI7A 4LNGA 3UQ3A 4G25A 2WXNA 2IO3C 2IQCA 3APDA 4YVQC 3PEVB 3VLEA 4PH4B 3UIPC 2EQXA 4AV7A 3CKBA 3GZ1A 5JHBA 2A5EA 4BSXA 3HXFA 4HB5A 2AWIA 1N4SA 3SBSA 2L9BA 2VGYA 2HM8A 5JA4D 4FA6A 3SBTB 3ZYKA 3UIOC 1N52A 4YDYA 3QB2A 3BG1B 1HH8A 1Q2ZA 2F37A 3UUXA 3IEGA 4G11A 2IOLA 3HHMA 3Q5MA 3NZUA 1MX4A 5BNWA 3ONLA 2X6HA 1HE8A 1U3CA 4G23A 1INZA 3MJWA 3T8MA 4DX1A 1S63A 3ONKA 4AXHA 3DSUA 4FULA 2LNIA 3PUKA 3L13A 1K1BA 1IQUA 3UM0A 3CR3A 3FUEA 5BV0A 1RW2A 2WQHA 1JCQA 3UI2A 3CHRA 2KZTA 4GZCA 4K5CA 4N5QA 5C1DA 3R7RA 5CERB 3IBEA 3LY8A 5LOZA 3FUMA 2RFMA 3S7BA 1LF8A 2FEZA 4ZFHA 3B7RL 1IXVA 1LD8A 3ZIMA 5AARA 4KYOB 4DUIA 4GZ5A 5ENRD 2XRYA 2C0LA 1W3BA 3RU0A 2ONDA 2PNNA 2B0OE 1WDYA 2J8SD 1EPUA 3HXCA 2XGMA 1N0RA 4NRHB 4XKCA 3ZFWA 1B89A 1UOHA 4I6EA 4MRUA 3SF4A 3UPVA 5FJYA 5EX3A 3QARA 2LSVA 3T8KA 1MX6A 4UWHA 2GRPB 5JMND 4UWFA 3VTXA 3TJPA 3AU5A 4JHRA 3RRUA 3RSEG 5EN5D 2I9CA 1N4PA 3LVQE 3T5XA 2VGEA 3D9MA 3U3WA 4BEPA 2NYJA 2VGXA 4EBAG 3C3QA 1E8ZA 2R5SA 3WG7E 3V2OA 1OUVA 4HBDA 2I2OA 1DC2A 4MBGA 3UT4A 1U2VG 3CVWA 2DBAA 2RD0A 3FH7A 5LX8A 3I3NA 3OTNA 4U04A 3OXFA 3L54A 5ANRA 1E8XA 2WMOA 1SA5A 2P2CP 1E90A 3JUIA 4CGVA 4JC8A 3FTWA 1DCQA 2P9SG 2NXPA 4GZDA 4WNFA 4Q96A 1SA4A 3CKCA 4YDEA 3QNKA 1QZ2A 3Q4AB 4UWLA 2QC9A 4B94A 3PZ3A 3L6AA 2XPIA 3Q79A 4ANUA 3C98A 2R17C 3TWUA 3FTUA 1LD7A 3IKOB 3KEAA 5KJNA 3CVYA 4LCTA 3EUVA 4CYMD 3U4TA 3S2AA 2IFUA 2IF4A 2KCLA 2YHEA 2J4BA 3Q73A 4NACA 4GTTA 1XNFA 2CG3A 3ISMC 4GPKA 1HG2A 3CHQA 5AQAA 3LVRE 1TJCA 2OEWA 2Q7FA 1TEZA 2WQ6A 2LXMA 3E30A 2H6IA 3EHRA 2LXLA 2HE0A 3I4GA 4MKTA 2MRIA 3RAUA 1DNPA 1P5QA 4L7TA 3FTYA 5ARGA 2VTBA 3UT8A 1GW6A 4WNEA 3R9MA 5CRUA 2Y1LE 4HRLA 3EHNA 1KZPA 2V4LA 2H6HA 3FEYA 2WXRA 5FTPA 2VQ2A 2PZIA 4B8CB 2UY1B 3BUAA 2J07A 3ABME 3UMVA 3LY9A 4X8QA 4K0RA 4N3AA 3ZEFA 4G2VA 1KT1A 2ETBA 2J09A 2CFUA 4A63B 4F53A 2J08A 2BKKB 2RKKA 4BX8A 3JXJA 1E96B 4LNUD 2WXPA 1ELRA 2EIJE 5FWQA 4ACLA 1QQEA 2J9QA 3DSXA 4TXQA 2Y4UA 4JEHA 3O48A 3AG1E 3N71A 5G2NA 2DZNA 4L2LA 2FO1E 3K9IA 3FTXA 3RO3A 3CHOA 4CDRA 2WXMA 2XEVA 4HRNA 2AJAA 2EILE 3FWVA 3L17A 5BT1A 4XI9A 3EIQC 4CDMA 3LXUX 5G05C 3HXEA 3FH8A 4DX2A 5D0QD 3G2SA 4UI9J 3SFZA 1Z6TA 3Q75A 4LERA 3TWSA 5ENPD 3TWVA 1OY3D 4TXPA 4C0EA 4FADA 2P58C 1BLXB 3ABLE 3Q7FA 4JXTA 5AJLA 4GCOA 3KEZA 2X6KA 3IV0A 3PDNA 4OAUC 4P29A 5G05J 2HR2A 1ELKA 4DPRA 5ITZF 4EECA 3QWVA 5EILA 4ILIA 3HIZA 2RG8A 4DX6D 3PH0C 1H2VC 1HS6A 4NIKA 3CSFA 4B8AA 2I1KA 2LAHA 4A1SA 3SFYA 2P9UG 3BQOA 3UXGA 1PY1A 2ETAA 1NI1A 5T8IA 5D66A 4ME2A 3F6QA 4N2SA 3L22A 2WXHA 2WB2A 2EIKE 1YYHA 4HLEA 3S7FA 1V55E 4WWPA 4E85A 2ZIRA 4ABNA 3VLFA 3SO8A 3FH5A 4I17A 3B7SA 5FQ7A 5B3SE 4I43A 4U96D 2YHCA 4EHMA 4IRUA 4K03A 1IKND 4RLYA 1EDUA 3PZDA 4HQDA 2BKGA 3PE3A 4KVMA 2XGOA 3PNLB 4JZYA 4U8VD 1AP7A 3NQPA 4HXIA 4RG9A 2L0TB 1BI8B 1S70B 3MX3A 2KC7A 5CRVA 5T3RA 3LYAA 1NL4A 4OVUA 4CRWA 3LPZA 1ELWA 4PS7A 3AJIA 1KLXA 4N3CA 4KXKB 1OCRE 4U8YD 4HS2A 2YNQA 2UY1A 1MQSA 1OCCE 3U64A 4GZ6A 3E34A 3FUIA 5A23A 4WNDA 4Q69A 3SZ7A 2IU1A 4FHJA 4CT0A 3IXEA 1U3DA 4N39A 1O5MA 4FJYA 4G24A 1D8EA 4EQFA 2X6IA 4Q94A 4YNDA 3X2QE 2DIWA 4L9PA 3CVXA 3FHEA 1N54A 2I6HA 3W9GA 1A17A 3QC1A 4BTBA 4OYSA 4I2ZA 4BT8A 3SD5A 2PL2A 4Z68A 3TXNA 1N94A 1KT0A 3PZ1A 3PZ4A 2HO1A 2GROB 5AENA 1H0AA 5ANLA 4TUUA 2CHXA 3FUJA 4HI8A 1JPLA 3CGHA 4I1AA 4GTVA 4HLLA 2VSNA 5AQ9A 3G2UA 4N5CA 5G04J 4ZHBA 2FO7A 2P9NG 3QWWA 2F8XK 2MHKA 3LEWA 4DRXE 1KZOA 4HOUA 4I2WA 4J8FA 4DK5A 2IOSA 4GYYA 2VYIA 3DSVA 5HKPA 3FUKA 3EJNA 2Y4TA 1HG5A 3P2BA 3P1UA 3CVNA 3OAWA 4OVVA 1UN8A 3RIBA 4F7AA 4HVBA 2VTBB 1AWCB 1QNFA 4DX5D 3E4BA 4MLPA 1QYMA 3MV2B 5E75A 4ATZD 1H6KA 1MHQA 3Q47B 2B6CA 3ULYA 3Q78A 2WMNA 4U0ZA 5FQ4A 2OCCE 3RJVA 5J08A 3TWQA 4KT6B 4HI9A 5LFAA 2V0PA 3V2XA 3BEEA 1TJFA 1SW6A 4XI0A 1OWNA 2XHEA 1ZB1A 3SY2A 4XKBA 2GRQB 4UUCA 2A5UA 1IHGA 5ARFA 4LSZE 2X6FA 1Y6IA 2CHWA 3SNXA 3JUEA 2ZU6B 4J0UA 5FZSA 4TXRA 1YCSB 2AXUA 3G2WA 1PAQA 4C9BB 1N4QA 4WUYA 2R05A 4MS6A 1BPOA 4WWOA 3CK8A 1PC2A 3LKUA 5FZQA 3EDTB 3VTYA 4O1OA 2HYZA 4GA2A 4ATGA 4RSYA 4RQIA 3URZA 3ZKJA 2X38A 3CK9A 4GTOA 3HVEB 4WWNA 5KJKA 3CLJA 4JEUA 3Q9NC 3FU0A 3AS4A 3AG4E 2CFZA 3KD7A 1JCSA 4WAFA 4TV3A 3CVPA 3D9KA 5HS0A 1X5BA 1WY6A 5CEDB 5E76A 1ZBPA 3ML8A 4J8EA 3Q9UC 3EHQA 3TL5A 2LUHA 2XQ0A 3ASHA 3TWWA 2XPYA 4A3TA 4CEMA 5KWDA 5AIJA 3L08A 2H6GA 2XZTG 2XS1A 5FT9A 3L9TA 2GRLA 4JHJA 1E7UA 2ETCA 5B1BE 1BU9A 1EYHA 3KS2A 3ZPJA 4IYPA 4F1SA 5G55A 1O1TA 5FINA 4CDNA 5CCLA 2LSUA 1HFAA 3UM2A 5BV1A 4GMLA 2OEVA 4JVSA 2FULA 3FU3A 5DBKA 4FJZA 4CZ2D 3RKVA 1O1SA 4U0UA 5JJ7A 1QBQA 4DJAA 1G3NB 2JLBA 4AP2A 3D9HA 5DIZA 1D8DA 4APOA 1N0QA 2AW6A 4I9CA 3FUNA 3B13A 3NAWA 4GTRA 2PQNA 3C3RA 5B1AE 3FY4A 3PRZA 3I4RB 4FU3A 2MYOA 4M7CA 3U9WA 5AAOA 1IYGA 1JWGA 3ENEA 4I9EA 4HRMB 3IHYA 3ASDA 4GTQA 2AXVA 2IO2C 1MJ0A 4DX7D 1JWFA 1TN6A 2C2LA 3DSWA 3PVLA 3MEKA 2XPZA 2ZGGA 5H7PA 3ZXSA 5FQ8A 1IHBA 3HXDA 4B93B 4PS8A 3TGOA 1TNBA 2OOEA 3ZRHA 3CQGB 3AG2E 4AY5A 1D9SA 2BTDA 5EYLA 2IJGX 4GTPA 5ENTD 2H6FA 4HORA 2BF0X 3PREA 4ANVA 4UI9C 2XS8A 3ESLA 1WM5A 1DVPA 4GPMA 4EPZA 4BX9A 2KBXA 1NZNA 1N95A 3DRAA 4L1BA 4G8KA 2V8SE 3UT7A 1MX2A 4GMRA 1IQRA 3R7QA 3CVQA 3UKRG 2WXOA 4GTSA 3NF1A 1ZU2A 3FEXA 2LO6A 3HVEA 4K5BA 3UKUG 4ANWA 1N4RA 2DCPA 3FTZA 5D0OD 1H2UA 3ZYMA 2MOWA 2M63A 3C5RA 3QK0A 4DLQA 1RZ4A 4UI9K 2X6JA 2UWJG 3E37A 1OT8A 4XE0A 3CVVA 2WQ7A 4J8DA 4GZ3A 1JCRA 4YVOA 2XCBA 1FT1A 4CT4A 3DEOA 2V5FA 4RVBA 3LCAA 2J49A 3TG5A 4KZ0A 4UQXA 3HG0D 3RO2A 3LJNA 4EZKA 2XGSA 3GW4A 3GYZA 3UM3A 3G2TA 2IEJA 3MGBA 4H7XA 2QZAA 3CV0A 5FZRA 2WVIA 5LP0A 3DSTA 5IY5E 3CVLA 1N11A 2A4ZA 2JABA 1Z3XA 3AS5A 4BFRA 2WXJA 5JJ6A 4YDOA 3CHPA 4C48B 1UJKA 1S0PA 1NA3A 2XEEA 4LRZA 3SFXA 1YMPA 3PNTB 3ZHEB 4JW1A 3MKQA 3KAEA 5AYWD 4HOQA 3JQ1A 4C0MA 3ZU7B 1UG3A 4XX5A 3RRMB 3APFA 1L5JA 3NOCD 1OWLA 1OWOA 3OXGA 1E7VA 2BEDA 4UQYA 3EU5A 2XRZA 1TNUA 3PEUB 2WM9A 4JL0A 3HRAA 3T5VA 1WG0A 2ZXWE 2DZOA 4EBAA 3B7TA 2KCVA 4ANXA 4A3VA 2BUGA 1HZ4A 2PM6A 2V4HC 3CHMA 4B0ZA 3VLDA 2P9KG 2NC9A 4A1GA 3UINC 1HO8A 4EZJA 2IONA 5ENNA 4V3IA 3FTSA 4FHKA 4L23A 4XZ4A 5LCWC 1KPSB 4M3OA 4UQZA 4HOSA 4TRQA 2P9PG 4FC8A 4FLBA 3WXXA 4LNBA 4QFVA 2WXKA 3U66A 1UW4B 5EDSA 4JD2G 4U7EB 5G04C 1TN8A 3R9AB 4O1PA 3J5QB 5BXUA 5LCWJ 3C72A 2KXPC 3RK6A 4L2YA 3JXIA 1EF1C 3V31A 2PQRA 3ULQA 1FVFA 3SQVA 1MYOA 1TNZA 3ZW3A 1OCOE 2PM7A 3G2VA 4J6IA 1FCHA 3QDNA 3MZLB 2XEHA 2ZGDA 3RRNB 5CMWA 2GRNB 4GA0A 3LY7A 4NURA 2F0YA 3J5PA 4G26A 3CK7A 5KNHD 4G1TA 3JYSA 3ZGQA 4I6GA 3D9IA 4WNGA 4JPSA 2X3MA 4U95D 2RFAA 3S7JA 5ENQD 2VSOE 3V79K 4RG6A 4CCAA 1HF8A 3ZVVA 4AIFA 3LJ3A 3UM1A 2P9IG 1UN9A 2Y3AA 3DPYA 4BTAA 2EINE 4N3BA 2ILRA 3D9OA 4HOTA 3ZHEA 3PZ2A 4Y6CA 3NOGD 3EHMA 4XIFA 3MKRA 2YINA 5HRYA 4GMJA 4ILHB 2L6BA 3HYMB 4TUMA 2C0MA 2WPVA 2KM4A 1K8KG 3ZXPA 4LG6A 2DWZA 4FLHA 2WXIA 4U07A 1SVXA 2XZDG 3CHSA 4ACKA 3NBNB 4B89A 3V30A 5AJDA 3FP3A 4APFA 2XCCA 4J8YA 3QOUA 2QYUA 5AQ7A 1BI7B 1NA0A 5AN8A 1H6OA 3B7BA 4BERA 3LS8A 5CECB 4Y6WA 2QFCA 3I5PA 2QYJA 3CSTA 2VSYA 4BY6A 2L0IA 1S64A 3FU6A 5CBNA 3OXLA 4JB8P 1MZCA 4DLOA 3L82A 5A6CA 4BESA 1O1RA 2DYRE 3DSSA 4I6JA 3TWTA 3FUHA 3NB2A 4N2QA 4JA9A 1XGWA 2R2LA 3TAXA 4YDWA 3JQ0A 4AOFA 5CHEE 3D9NA 5BUZA 2V5QC 4XEIG 5M72A 3APCA 3B7UX 3CVUA 1TN7A 4W9RA 3C3OA 4AM9A 4H7YA 4PUCA 1FVHA 1H19A 4PDXA 1NP7A 2Y69E 2E2EA 1DCEA 5KBAA 2YQ8A 3FUFA 3AU4A 1K1AA 2L6JA 3TWXA 3DXMG 5ENSD 3MKQB 3CEQA 3MV3B 3ML9A 4HNAD 2CG2A 3HDXA 1HX8A 1UJJA 5EX0A 2OV8A 2GRRB 4IN3B 2EIME 3SHFA 1TNOA 4BWRA 2OVFA 4UWGA 3QWPA 4GAAA 5J90A 3ASOE 4ILGA 3PE4A 4KZCA 4AY6A 3KSQA 5FIOA 3TG4A 3AS8A 3DBSA 3DWLG 2WXGA 4LUNU 4JA7A 3GZSA 4BETA 2R02A 4AJWA 1X81A 5KCMA 5EIDA 2FF4A 2R59A 5BXOA 3KSLA 4U63A 1TR4A 3ZN3A 3FU5A 2KATA 1SZAA 3W9FA 2J4DA 1FPPA 1H6PA 2AVPA 2Y0BG 3QJZA 5KNGA 4GB9A 3S7DA 4DI3A 3QAQA 1K3ZD 1BD8A 1LTXA 2QY7A 2WXQA 2CHZA 1OXJA 2F8YA 5T4YA 4GTMA 1YA0A 1SZ9A 4K5AB 5BPPA 3E33A 5JHAA 4D10C 1HU3A 2DYSE 4F3VA 4KBQA 2NSZA 1N9AA 4KVOA 3D9PA 4GCNA 5CMYA 3ASNE 3O4ZA 3D9JA 2JEKA 1VDYA 1OWMA 1WAO1 1FT2A 1E8WA 4U0SA 2XENA 5AQBA 4EZLA 2VSXE 3DEPA 4URKA 1NFIE 3ZYLA 1TYQG 4J8SA 4I1OB 5HQ8A 1OWPA 4FP7A 3ULEG 3EU9A 3UX4A 5HI7A 4LEUA 4BSZB 3ZUVB 5D2MC 4UWKA 5KJLA 3CIAA 3TWRA 5EYPF 3Q49B 3DXKG 3E32A 4JHKA 1H2TC 3MYVA 2R03A 1TNYA 2DVWA 5EIBE 1V54E 4O6FA 2VJ8A 5BW8C 3BU8A 5CBOA 4F6RD 4U8HA 2KZTB 4QQIA 3FTVA 3QKYA 2I1JA 3HXBA 2E0IA 4E6HA 3L16A 3FULA 1HXIA 3TXMA 4AVXA 1SQMA 1OCZE 5C2YA 4GA1A 3EIJA 4AEZC 3ESKA 3ZYQA 3FUDA 3MCXA 4HFGA 5FQ6A 3SGHA 5CEAA 2KCKA 1Z5SC 3SI5A 3D3MA 3ABKE 4CGWA 2P9LG 2WXLA 5EKQD 4G8LA 3Q15A 4PS3A
chains in the Genus database with same CATH topology
1FT1A 1TN6A 3DSWA 3KSQA 1LD7A 1O5MA 1N4PA 2H6GA 3DSXA 1D8EA 2ZIRA 2IEJA 1S64A 3HXDA 4L9PA 3DSTA 3EUVA 1X81A 1MZCA 4EHMA 1TNBA 1S63A 1N94A 1O1TA 3PZ1A 4YDOA 3DSUA 3E32A 3Q73A 1O1RA 3PZ4A 4GTTA 4MBGA 4GTPA 2H6FA 1TNYA 3DSSA 3KSLA 3HXEA 2R2LA 1FPPA 3Q7AA 3DPYA 2ZISA 1N4QA 3SFXA 3Q75A 1JCQA 3E30A 4GTVA 2H6IA 3PZ2A 1TN7A 1N95A 1O1SA 1NL4A 3DRAA 1LTXA 3HXBA 3Q7FA 4LNBA 1QBQA 1SA5A 4GTSA 1DCEA 1D8DA 1TN8A 4GTMA 4GTOA 3C72A 4LNGA 1LD8A 1KZOA 1KZPA 3E33A 1N4RA 2BEDA 2H6HA 4GTRA 3DSVA 3EU5A 1TNZA 1N9AA 1TNUA 1JCSA 3HXCA 1SA4A 3E34A 4YDEA 3SFYA 1TNOA 3E37A 3HXFA 1N4SA 1NI1A 1FT2A 3PZ3A 4GTQA 3Q78A 1JCRA 2F0YA 3Q79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FT1 A;  1TN6 A;  3DSW A;  3KSQ A;  1LD7 A;  1O5M A;  1N4P A;  2H6G A;  3DSX A;  1D8E A;  2ZIR A;  2IEJ A;  1S64 A;  3HXD A;  4L9P A;  3DST A;  3EUV A;  1X81 A;  1MZC A;  4EHM A;  1TNB A;  1S63 A;  1N94 A;  1O1T A;  3PZ1 A;  4YDO A;  3DSU A;  3E32 A;  3Q73 A;  1O1R A;  3PZ4 A;  4GTT A;  4MBG A;  4GTP A;  2H6F A;  1TNY A;  3DSS A;  3KSL A;  3HXE A;  2R2L A;  1FPP A;  3Q7A A;  3DPY A;  2ZIS A;  1N4Q A;  3SFX A;  3Q75 A;  1JCQ A;  3E30 A;  4GTV A;  2H6I A;  3PZ2 A;  1TN7 A;  1N95 A;  1O1S A;  1NL4 A;  3DRA A;  1LTX A;  3HXB A;  3Q7F A;  4LNB A;  1QBQ A;  1SA5 A;  4GTS A;  1DCE A;  1D8D A;  1TN8 A;  4GTM A;  4GTO A;  3C72 A;  4LNG A;  1LD8 A;  1KZO A;  1KZP A;  3E33 A;  1N4R A;  2BED A;  2H6H A;  4GTR A;  3DSV A;  3EU5 A;  1TNZ A;  1N9A A;  1TNU A;  1JCS A;  3HXC A;  1SA4 A;  3E34 A;  4YDE A;  3SFY A;  1TNO A;  3E37 A;  3HXF A;  1N4S A;  1NI1 A;  1FT2 A;  3PZ3 A;  4GTQ A;  3Q78 A;  1JCR A;  2F0Y A;  3Q79 A; 
#chains in the Genus database with same CATH topology
 4GU5 A;  3JCK C;  2GGF A;  5A7D B;  3AG3 E;  3LDZ A;  2IY0 C;  5KJM A;  3B95 A;  4I1M A;  4DI4 A;  3D9L A;  2VGX B;  3GZ2 A;  3ZNG A;  4OAV B;  3NZS A;  2GW1 A;  5JJT A;  5ENO D;  4IUL A;  1A5E A;  4KMO A;  3FDH A;  5CCM A;  1E8Y A;  4NQ0 A;  2LAI A;  3FFL A;  3UTM A;  3CQC B;  3MA5 A;  3AAA C;  4J7W A;  3BG0 B;  2WXF A;  4BT9 A;  4R7L A;  3ASG A;  3Q7A A;  2FBN A;  1JUQ A;  2ZIS A;  4A55 A;  1Y8M A;  2AXZ A;  3PUJ A;  1Z3Y A;  3T9K A;  3PS6 A;  4GYW A;  4GYO A;  3DPD A;  2OVB A;  4O60 A;  3IHV A;  4F1P A;  3ASF A;  2GRM A;  2FI7 A;  4LNG A;  3UQ3 A;  4G25 A;  2WXN A;  2IO3 C;  2IQC A;  3APD A;  4YVQ C;  3PEV B;  3VLE A;  4PH4 B;  3UIP C;  2EQX A;  4AV7 A;  3CKB A;  3GZ1 A;  5JHB A;  2A5E A;  4BSX A;  3HXF A;  4HB5 A;  2AWI A;  1N4S A;  3SBS A;  2L9B A;  2VGY A;  2HM8 A;  5JA4 D;  4FA6 A;  3SBT B;  3ZYK A;  3UIO C;  1N52 A;  4YDY A;  3QB2 A;  3BG1 B;  1HH8 A;  1Q2Z A;  2F37 A;  3UUX A;  3IEG A;  4G11 A;  2IOL A;  3HHM A;  3Q5M A;  3NZU A;  1MX4 A;  5BNW A;  3ONL A;  2X6H A;  1HE8 A;  1U3C A;  4G23 A;  1INZ A;  3MJW A;  3T8M A;  4DX1 A;  1S63 A;  3ONK A;  4AXH A;  3DSU A;  4FUL A;  2LNI A;  3PUK A;  3L13 A;  1K1B A;  1IQU A;  3UM0 A;  3CR3 A;  3FUE A;  5BV0 A;  1RW2 A;  2WQH A;  1JCQ A;  3UI2 A;  3CHR A;  2KZT A;  4GZC A;  4K5C A;  4N5Q A;  5C1D A;  3R7R A;  5CER B;  3IBE A;  3LY8 A;  5LOZ A;  3FUM A;  2RFM A;  3S7B A;  1LF8 A;  2FEZ A;  4ZFH A;  3B7R L;  1IXV A;  1LD8 A;  3ZIM A;  5AAR A;  4KYO B;  4DUI A;  4GZ5 A;  5ENR D;  2XRY A;  2C0L A;  1W3B A;  3RU0 A;  2OND A;  2PNN A;  2B0O E;  1WDY A;  2J8S D;  1EPU A;  3HXC A;  2XGM A;  1N0R A;  4NRH B;  4XKC A;  3ZFW A;  1B89 A;  1UOH A;  4I6E A;  4MRU A;  3SF4 A;  3UPV A;  5FJY A;  5EX3 A;  3QAR A;  2LSV A;  3T8K A;  1MX6 A;  4UWH A;  2GRP B;  5JMN D;  4UWF A;  3VTX A;  3TJP A;  3AU5 A;  4JHR A;  3RRU A;  3RSE G;  5EN5 D;  2I9C A;  1N4P A;  3LVQ E;  3T5X A;  2VGE A;  3D9M A;  3U3W A;  4BEP A;  2NYJ A;  2VGX A;  4EBA G;  3C3Q A;  1E8Z A;  2R5S A;  3WG7 E;  3V2O A;  1OUV A;  4HBD A;  2I2O A;  1DC2 A;  4MBG A;  3UT4 A;  1U2V G;  3CVW A;  2DBA A;  2RD0 A;  3FH7 A;  5LX8 A;  3I3N A;  3OTN A;  4U04 A;  3OXF A;  3L54 A;  5ANR A;  1E8X A;  2WMO A;  1SA5 A;  2P2C P;  1E90 A;  3JUI A;  4CGV A;  4JC8 A;  3FTW A;  1DCQ A;  2P9S G;  2NXP A;  4GZD A;  4WNF A;  4Q96 A;  1SA4 A;  3CKC A;  4YDE A;  3QNK A;  1QZ2 A;  3Q4A B;  4UWL A;  2QC9 A;  4B94 A;  3PZ3 A;  3L6A A;  2XPI A;  3Q79 A;  4ANU A;  3C98 A;  2R17 C;  3TWU A;  3FTU A;  1LD7 A;  3IKO B;  3KEA A;  5KJN A;  3CVY A;  4LCT A;  3EUV A;  4CYM D;  3U4T A;  3S2A A;  2IFU A;  2IF4 A;  2KCL A;  2YHE A;  2J4B A;  3Q73 A;  4NAC A;  4GTT A;  1XNF A;  2CG3 A;  3ISM C;  4GPK A;  1HG2 A;  3CHQ A;  5AQA A;  3LVR E;  1TJC A;  2OEW A;  2Q7F A;  1TEZ A;  2WQ6 A;  2LXM A;  3E30 A;  2H6I A;  3EHR A;  2LXL A;  2HE0 A;  3I4G A;  4MKT A;  2MRI A;  3RAU A;  1DNP A;  1P5Q A;  4L7T A;  3FTY A;  5ARG A;  2VTB A;  3UT8 A;  1GW6 A;  4WNE A;  3R9M A;  5CRU A;  2Y1L E;  4HRL A;  3EHN A;  1KZP A;  2V4L A;  2H6H A;  3FEY A;  2WXR A;  5FTP A;  2VQ2 A;  2PZI A;  4B8C B;  2UY1 B;  3BUA A;  2J07 A;  3ABM E;  3UMV A;  3LY9 A;  4X8Q A;  4K0R A;  4N3A A;  3ZEF A;  4G2V A;  1KT1 A;  2ETB A;  2J09 A;  2CFU A;  4A63 B;  4F53 A;  2J08 A;  2BKK B;  2RKK A;  4BX8 A;  3JXJ A;  1E96 B;  4LNU D;  2WXP A;  1ELR A;  2EIJ E;  5FWQ A;  4ACL A;  1QQE A;  2J9Q A;  3DSX A;  4TXQ A;  2Y4U A;  4JEH A;  3O48 A;  3AG1 E;  3N71 A;  5G2N A;  2DZN A;  4L2L A;  2FO1 E;  3K9I A;  3FTX A;  3RO3 A;  3CHO A;  4CDR A;  2WXM A;  2XEV A;  4HRN A;  2AJA A;  2EIL E;  3FWV A;  3L17 A;  5BT1 A;  4XI9 A;  3EIQ C;  4CDM A;  3LXU X;  5G05 C;  3HXE A;  3FH8 A;  4DX2 A;  5D0Q D;  3G2S A;  4UI9 J;  3SFZ A;  1Z6T A;  3Q75 A;  4LER A;  3TWS A;  5ENP D;  3TWV A;  1OY3 D;  4TXP A;  4C0E A;  4FAD A;  2P58 C;  1BLX B;  3ABL E;  3Q7F A;  4JXT A;  5AJL A;  4GCO A;  3KEZ A;  2X6K A;  3IV0 A;  3PDN A;  4OAU C;  4P29 A;  5G05 J;  2HR2 A;  1ELK A;  4DPR A;  5ITZ F;  4EEC A;  3QWV A;  5EIL A;  4ILI A;  3HIZ A;  2RG8 A;  4DX6 D;  3PH0 C;  1H2V C;  1HS6 A;  4NIK A;  3CSF A;  4B8A A;  2I1K A;  2LAH A;  4A1S A;  3SFY A;  2P9U G;  3BQO A;  3UXG A;  1PY1 A;  2ETA A;  1NI1 A;  5T8I A;  5D66 A;  4ME2 A;  3F6Q A;  4N2S A;  3L22 A;  2WXH A;  2WB2 A;  2EIK E;  1YYH A;  4HLE A;  3S7F A;  1V55 E;  4WWP A;  4E85 A;  2ZIR A;  4ABN A;  3VLF A;  3SO8 A;  3FH5 A;  4I17 A;  3B7S A;  5FQ7 A;  5B3S E;  4I43 A;  4U96 D;  2YHC A;  4EHM A;  4IRU A;  4K03 A;  1IKN D;  4RLY A;  1EDU A;  3PZD A;  4HQD A;  2BKG A;  3PE3 A;  4KVM A;  2XGO A;  3PNL B;  4JZY A;  4U8V D;  1AP7 A;  3NQP A;  4HXI A;  4RG9 A;  2L0T B;  1BI8 B;  1S70 B;  3MX3 A;  2KC7 A;  5CRV A;  5T3R A;  3LYA A;  1NL4 A;  4OVU A;  4CRW A;  3LPZ A;  1ELW A;  4PS7 A;  3AJI A;  1KLX A;  4N3C A;  4KXK B;  1OCR E;  4U8Y D;  4HS2 A;  2YNQ A;  2UY1 A;  1MQS A;  1OCC E;  3U64 A;  4GZ6 A;  3E34 A;  3FUI A;  5A23 A;  4WND A;  4Q69 A;  3SZ7 A;  2IU1 A;  4FHJ A;  4CT0 A;  3IXE A;  1U3D A;  4N39 A;  1O5M A;  4FJY A;  4G24 A;  1D8E A;  4EQF A;  2X6I A;  4Q94 A;  4YND A;  3X2Q E;  2DIW A;  4L9P A;  3CVX A;  3FHE A;  1N54 A;  2I6H A;  3W9G A;  1A17 A;  3QC1 A;  4BTB A;  4OYS A;  4I2Z A;  4BT8 A;  3SD5 A;  2PL2 A;  4Z68 A;  3TXN A;  1N94 A;  1KT0 A;  3PZ1 A;  3PZ4 A;  2HO1 A;  2GRO B;  5AEN A;  1H0A A;  5ANL A;  4TUU A;  2CHX A;  3FUJ A;  4HI8 A;  1JPL A;  3CGH A;  4I1A A;  4GTV A;  4HLL A;  2VSN A;  5AQ9 A;  3G2U A;  4N5C A;  5G04 J;  4ZHB A;  2FO7 A;  2P9N G;  3QWW A;  2F8X K;  2MHK A;  3LEW A;  4DRX E;  1KZO A;  4HOU A;  4I2W A;  4J8F A;  4DK5 A;  2IOS A;  4GYY A;  2VYI A;  3DSV A;  5HKP A;  3FUK A;  3EJN A;  2Y4T A;  1HG5 A;  3P2B A;  3P1U A;  3CVN A;  3OAW A;  4OVV A;  1UN8 A;  3RIB A;  4F7A A;  4HVB A;  2VTB B;  1AWC B;  1QNF A;  4DX5 D;  3E4B A;  4MLP A;  1QYM A;  3MV2 B;  5E75 A;  4ATZ D;  1H6K A;  1MHQ A;  3Q47 B;  2B6C A;  3ULY A;  3Q78 A;  2WMN A;  4U0Z A;  5FQ4 A;  2OCC E;  3RJV A;  5J08 A;  3TWQ A;  4KT6 B;  4HI9 A;  5LFA A;  2V0P A;  3V2X A;  3BEE A;  1TJF A;  1SW6 A;  4XI0 A;  1OWN A;  2XHE A;  1ZB1 A;  3SY2 A;  4XKB A;  2GRQ B;  4UUC A;  2A5U A;  1IHG A;  5ARF A;  4LSZ E;  2X6F A;  1Y6I A;  2CHW A;  3SNX A;  3JUE A;  2ZU6 B;  4J0U A;  5FZS A;  4TXR A;  1YCS B;  2AXU A;  3G2W A;  1PAQ A;  4C9B B;  1N4Q A;  4WUY A;  2R05 A;  4MS6 A;  1BPO A;  4WWO A;  3CK8 A;  1PC2 A;  3LKU A;  5FZQ A;  3EDT B;  3VTY A;  4O1O A;  2HYZ A;  4GA2 A;  4ATG A;  4RSY A;  4RQI A;  3URZ A;  3ZKJ A;  2X38 A;  3CK9 A;  4GTO A;  3HVE B;  4WWN A;  5KJK A;  3CLJ A;  4JEU A;  3Q9N C;  3FU0 A;  3AS4 A;  3AG4 E;  2CFZ A;  3KD7 A;  1JCS A;  4WAF A;  4TV3 A;  3CVP A;  3D9K A;  5HS0 A;  1X5B A;  1WY6 A;  5CED B;  5E76 A;  1ZBP A;  3ML8 A;  4J8E A;  3Q9U C;  3EHQ A;  3TL5 A;  2LUH A;  2XQ0 A;  3ASH A;  3TWW A;  2XPY A;  4A3T A;  4CEM A;  5KWD A;  5AIJ A;  3L08 A;  2H6G A;  2XZT G;  2XS1 A;  5FT9 A;  3L9T A;  2GRL A;  4JHJ A;  1E7U A;  2ETC A;  5B1B E;  1BU9 A;  1EYH A;  3KS2 A;  3ZPJ A;  4IYP A;  4F1S A;  5G55 A;  1O1T A;  5FIN A;  4CDN A;  5CCL A;  2LSU A;  1HFA A;  3UM2 A;  5BV1 A;  4GML A;  2OEV A;  4JVS A;  2FUL A;  3FU3 A;  5DBK A;  4FJZ A;  4CZ2 D;  3RKV A;  1O1S A;  4U0U A;  5JJ7 A;  1QBQ A;  4DJA A;  1G3N B;  2JLB A;  4AP2 A;  3D9H A;  5DIZ A;  1D8D A;  4APO A;  1N0Q A;  2AW6 A;  4I9C A;  3FUN A;  3B13 A;  3NAW A;  4GTR A;  2PQN A;  3C3R A;  5B1A E;  3FY4 A;  3PRZ A;  3I4R B;  4FU3 A;  2MYO A;  4M7C A;  3U9W A;  5AAO A;  1IYG A;  1JWG A;  3ENE A;  4I9E A;  4HRM B;  3IHY A;  3ASD A;  4GTQ A;  2AXV A;  2IO2 C;  1MJ0 A;  4DX7 D;  1JWF A;  1TN6 A;  2C2L A;  3DSW A;  3PVL A;  3MEK A;  2XPZ A;  2ZGG A;  5H7P A;  3ZXS A;  5FQ8 A;  1IHB A;  3HXD A;  4B93 B;  4PS8 A;  3TGO A;  1TNB A;  2OOE A;  3ZRH A;  3CQG B;  3AG2 E;  4AY5 A;  1D9S A;  2BTD A;  5EYL A;  2IJG X;  4GTP A;  5ENT D;  2H6F A;  4HOR A;  2BF0 X;  3PRE A;  4ANV A;  4UI9 C;  2XS8 A;  3ESL A;  1WM5 A;  1DVP A;  4GPM A;  4EPZ A;  4BX9 A;  2KBX A;  1NZN A;  1N95 A;  3DRA A;  4L1B A;  4G8K A;  2V8S E;  3UT7 A;  1MX2 A;  4GMR A;  1IQR A;  3R7Q A;  3CVQ A;  3UKR G;  2WXO A;  4GTS A;  3NF1 A;  1ZU2 A;  3FEX A;  2LO6 A;  3HVE A;  4K5B A;  3UKU G;  4ANW A;  1N4R A;  2DCP A;  3FTZ A;  5D0O D;  1H2U A;  3ZYM A;  2MOW A;  2M63 A;  3C5R A;  3QK0 A;  4DLQ A;  1RZ4 A;  4UI9 K;  2X6J A;  2UWJ G;  3E37 A;  1OT8 A;  4XE0 A;  3CVV A;  2WQ7 A;  4J8D A;  4GZ3 A;  1JCR A;  4YVO A;  2XCB A;  1FT1 A;  4CT4 A;  3DEO A;  2V5F A;  4RVB A;  3LCA A;  2J49 A;  3TG5 A;  4KZ0 A;  4UQX A;  3HG0 D;  3RO2 A;  3LJN A;  4EZK A;  2XGS A;  3GW4 A;  3GYZ A;  3UM3 A;  3G2T A;  2IEJ A;  3MGB A;  4H7X A;  2QZA A;  3CV0 A;  5FZR A;  2WVI A;  5LP0 A;  3DST A;  5IY5 E;  3CVL A;  1N11 A;  2A4Z A;  2JAB A;  1Z3X A;  3AS5 A;  4BFR A;  2WXJ A;  5JJ6 A;  4YDO A;  3CHP A;  4C48 B;  1UJK A;  1S0P A;  1NA3 A;  2XEE A;  4LRZ A;  3SFX A;  1YMP A;  3PNT B;  3ZHE B;  4JW1 A;  3MKQ A;  3KAE A;  5AYW D;  4HOQ A;  3JQ1 A;  4C0M A;  3ZU7 B;  1UG3 A;  4XX5 A;  3RRM B;  3APF A;  1L5J A;  3NOC D;  1OWL A;  1OWO A;  3OXG A;  1E7V A;  2BED A;  4UQY A;  3EU5 A;  2XRZ A;  1TNU A;  3PEU B;  2WM9 A;  4JL0 A;  3HRA A;  3T5V A;  1WG0 A;  2ZXW E;  2DZO A;  4EBA A;  3B7T A;  2KCV A;  4ANX A;  4A3V A;  2BUG A;  1HZ4 A;  2PM6 A;  2V4H C;  3CHM A;  4B0Z A;  3VLD A;  2P9K G;  2NC9 A;  4A1G A;  3UIN C;  1HO8 A;  4EZJ A;  2ION A;  5ENN A;  4V3I A;  3FTS A;  4FHK A;  4L23 A;  4XZ4 A;  5LCW C;  1KPS B;  4M3O A;  4UQZ A;  4HOS A;  4TRQ A;  2P9P G;  4FC8 A;  4FLB A;  3WXX A;  4LNB A;  4QFV A;  2WXK A;  3U66 A;  1UW4 B;  5EDS A;  4JD2 G;  4U7E B;  5G04 C;  1TN8 A;  3R9A B;  4O1P A;  3J5Q B;  5BXU A;  5LCW J;  3C72 A;  2KXP C;  3RK6 A;  4L2Y A;  3JXI A;  1EF1 C;  3V31 A;  2PQR A;  3ULQ A;  1FVF A;  3SQV A;  1MYO A;  1TNZ A;  3ZW3 A;  1OCO E;  2PM7 A;  3G2V A;  4J6I A;  1FCH A;  3QDN A;  3MZL B;  2XEH A;  2ZGD A;  3RRN B;  5CMW A;  2GRN B;  4GA0 A;  3LY7 A;  4NUR A;  2F0Y A;  3J5P A;  4G26 A;  3CK7 A;  5KNH D;  4G1T A;  3JYS A;  3ZGQ A;  4I6G A;  3D9I A;  4WNG A;  4JPS A;  2X3M A;  4U95 D;  2RFA A;  3S7J A;  5ENQ D;  2VSO E;  3V79 K;  4RG6 A;  4CCA A;  1HF8 A;  3ZVV A;  4AIF A;  3LJ3 A;  3UM1 A;  2P9I G;  1UN9 A;  2Y3A A;  3DPY A;  4BTA A;  2EIN E;  4N3B A;  2ILR A;  3D9O A;  4HOT A;  3ZHE A;  3PZ2 A;  4Y6C A;  3NOG D;  3EHM A;  4XIF A;  3MKR A;  2YIN A;  5HRY A;  4GMJ A;  4ILH B;  2L6B A;  3HYM B;  4TUM A;  2C0M A;  2WPV A;  2KM4 A;  1K8K G;  3ZXP A;  4LG6 A;  2DWZ A;  4FLH A;  2WXI A;  4U07 A;  1SVX A;  2XZD G;  3CHS A;  4ACK A;  3NBN B;  4B89 A;  3V30 A;  5AJD A;  3FP3 A;  4APF A;  2XCC A;  4J8Y A;  3QOU A;  2QYU A;  5AQ7 A;  1BI7 B;  1NA0 A;  5AN8 A;  1H6O A;  3B7B A;  4BER A;  3LS8 A;  5CEC B;  4Y6W A;  2QFC A;  3I5P A;  2QYJ A;  3CST A;  2VSY A;  4BY6 A;  2L0I A;  1S64 A;  3FU6 A;  5CBN A;  3OXL A;  4JB8 P;  1MZC A;  4DLO A;  3L82 A;  5A6C A;  4BES A;  1O1R A;  2DYR E;  3DSS A;  4I6J A;  3TWT A;  3FUH A;  3NB2 A;  4N2Q A;  4JA9 A;  1XGW A;  2R2L A;  3TAX A;  4YDW A;  3JQ0 A;  4AOF A;  5CHE E;  3D9N A;  5BUZ A;  2V5Q C;  4XEI G;  5M72 A;  3APC A;  3B7U X;  3CVU A;  1TN7 A;  4W9R A;  3C3O A;  4AM9 A;  4H7Y A;  4PUC A;  1FVH A;  1H19 A;  4PDX A;  1NP7 A;  2Y69 E;  2E2E A;  1DCE A;  5KBA A;  2YQ8 A;  3FUF A;  3AU4 A;  1K1A A;  2L6J A;  3TWX A;  3DXM G;  5ENS D;  3MKQ B;  3CEQ A;  3MV3 B;  3ML9 A;  4HNA D;  2CG2 A;  3HDX A;  1HX8 A;  1UJJ A;  5EX0 A;  2OV8 A;  2GRR B;  4IN3 B;  2EIM E;  3SHF A;  1TNO A;  4BWR A;  2OVF A;  4UWG A;  3QWP A;  4GAA A;  5J90 A;  3ASO E;  4ILG A;  3PE4 A;  4KZC A;  4AY6 A;  3KSQ A;  5FIO A;  3TG4 A;  3AS8 A;  3DBS A;  3DWL G;  2WXG A;  4LUN U;  4JA7 A;  3GZS A;  4BET A;  2R02 A;  4AJW A;  1X81 A;  5KCM A;  5EID A;  2FF4 A;  2R59 A;  5BXO A;  3KSL A;  4U63 A;  1TR4 A;  3ZN3 A;  3FU5 A;  2KAT A;  1SZA A;  3W9F A;  2J4D A;  1FPP A;  1H6P A;  2AVP A;  2Y0B G;  3QJZ A;  5KNG A;  4GB9 A;  3S7D A;  4DI3 A;  3QAQ A;  1K3Z D;  1BD8 A;  1LTX A;  2QY7 A;  2WXQ A;  2CHZ A;  1OXJ A;  2F8Y A;  5T4Y A;  4GTM A;  1YA0 A;  1SZ9 A;  4K5A B;  5BPP A;  3E33 A;  5JHA A;  4D10 C;  1HU3 A;  2DYS E;  4F3V A;  4KBQ A;  2NSZ A;  1N9A A;  4KVO A;  3D9P A;  4GCN A;  5CMY A;  3ASN E;  3O4Z A;  3D9J A;  2JEK A;  1VDY A;  1OWM A;  1WAO 1;  1FT2 A;  1E8W A;  4U0S A;  2XEN A;  5AQB A;  4EZL A;  2VSX E;  3DEP A;  4URK A;  1NFI E;  3ZYL A;  1TYQ G;  4J8S A;  4I1O B;  5HQ8 A;  1OWP A;  4FP7 A;  3ULE G;  3EU9 A;  3UX4 A;  5HI7 A;  4LEU A;  4BSZ B;  3ZUV B;  5D2M C;  4UWK A;  5KJL A;  3CIA A;  3TWR A;  5EYP F;  3Q49 B;  3DXK G;  3E32 A;  4JHK A;  1H2T C;  3MYV A;  2R03 A;  1TNY A;  2DVW A;  5EIB E;  1V54 E;  4O6F A;  2VJ8 A;  5BW8 C;  3BU8 A;  5CBO A;  4F6R D;  4U8H A;  2KZT B;  4QQI A;  3FTV A;  3QKY A;  2I1J A;  3HXB A;  2E0I A;  4E6H A;  3L16 A;  3FUL A;  1HXI A;  3TXM A;  4AVX A;  1SQM A;  1OCZ E;  5C2Y A;  4GA1 A;  3EIJ A;  4AEZ C;  3ESK A;  3ZYQ A;  3FUD A;  3MCX A;  4HFG A;  5FQ6 A;  3SGH A;  5CEA A;  2KCK A;  1Z5S C;  3SI5 A;  3D3M A;  3ABK E;  4CGW A;  2P9L G;  2WXL A;  5EKQ D;  4G8L A;  3Q15 A;  4PS3 A; 
#chains in the Genus database with same CATH homology
 1FT1 A;  1TN6 A;  3DSW A;  3KSQ A;  1LD7 A;  1O5M A;  1N4P A;  2H6G A;  3DSX A;  1D8E A;  2ZIR A;  2IEJ A;  1S64 A;  3HXD A;  4L9P A;  3DST A;  3EUV A;  1X81 A;  1MZC A;  4EHM A;  1TNB A;  1S63 A;  1N94 A;  1O1T A;  3PZ1 A;  4YDO A;  3DSU A;  3E32 A;  3Q73 A;  1O1R A;  3PZ4 A;  4GTT A;  4MBG A;  4GTP A;  2H6F A;  1TNY A;  3DSS A;  3KSL A;  3HXE A;  2R2L A;  1FPP A;  3Q7A A;  3DPY A;  2ZIS A;  1N4Q A;  3SFX A;  3Q75 A;  1JCQ A;  3E30 A;  4GTV A;  2H6I A;  3PZ2 A;  1TN7 A;  1N95 A;  1O1S A;  1NL4 A;  3DRA A;  1LTX A;  3HXB A;  3Q7F A;  4LNB A;  1QBQ A;  1SA5 A;  4GTS A;  1DCE A;  1D8D A;  1TN8 A;  4GTM A;  4GTO A;  3C72 A;  4LNG A;  1LD8 A;  1KZO A;  1KZP A;  3E33 A;  1N4R A;  2BED A;  2H6H A;  4GTR A;  3DSV A;  3EU5 A;  1TNZ A;  1N9A A;  1TNU A;  1JCS A;  3HXC A;  1SA4 A;  3E34 A;  4YDE A;  3SFY A;  1TNO A;  3E37 A;  3HXF A;  1N4S A;  1NI1 A;  1FT2 A;  3PZ3 A;  4GTQ A;  3Q78 A;  1JCR A;  2F0Y A;  3Q79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...