1N94A

Aryl tetrahydropyridine inhbitors of farnesyltransferase: glycine, phenylalanine and histidine derivates
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Aryl tetrahydropyridine inhibitors of farnesyltransferase: glycine, phenylalanine and histidine derivatives.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 106
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n94A00
1NI1A 1LTXA 3EU5A 1N4RA 1FT2A 2H6HA 3DPYA 3PZ3A 1TN8A 1TNOA 4YDOA 3PZ1A 1JCSA 1O1SA 1N4SA 1LD8A 3DSWA 1FT1A 1FPPA 1SA5A 2H6GA 4YDEA 3EUVA 1S63A 1TNBA 3SFYA 3E37A 3HXDA 3KSLA 3PZ2A 2ZIRA 4GTMA 4GTQA 3SFXA 1JCRA 3DSXA 1TN6A 2H6IA 3KSQA 3Q75A 1O1RA 1QBQA 1D8DA 1D8EA 2F0YA 4LNBA 1TN7A 1N94A 1O5MA 4MBGA 3HXCA 3Q7FA 3DSSA 4LNGA 1S64A 4GTVA 3Q73A 1N9AA 1DCEA 3DSTA 3HXFA 1MZCA 4EHMA 1NL4A 4GTPA 4L9PA 3E33A 3Q7AA 1TNZA 4GTTA 1X81A 3Q78A 1KZOA 2H6FA 3E32A 3PZ4A 1JCQA 1N4PA 1N95A 1SA4A 1TNUA 3HXBA 1LD7A 3DRAA 3C72A 4GTSA 2IEJA 3DSUA 3E34A 3HXEA 4GTRA 3Q79A 3DSVA 2BEDA 1N4QA 1TNYA 2ZISA 2R2LA 1O1TA 1KZPA 3E30A 4GTOA
chains in the Genus database with same CATH superfamily
1D9SA 3HHMA 1E90A 4IN3B 1NZNA 2FBNA 1O1SA 3FTSA 4FADA 5ENPD 3K9IA 1W3BA 4BSZB 4QQIA 5AJDA 2LXLA 4GB9A 5ANLA 5FQ6A 3ZRHA 3FDHA 4TXRA 2LSUA 1SQMA 3G2TA 3ZXSA 3SZ7A 3BG0B 4ME2A 3SNXA 5T4YA 5CECB 3DSXA 2PNNA 2H6IA 4G23A 3RRMB 1IYGA 3HVEA 1S0PA 3UT4A 4GA0A 2WXIA 5CMYA 3IEGA 4WNFA 5EX3A 5AYWD 4LNUD 1HFAA 2RFAA 3CSTA 4L2LA 5AQ9A 2GRLA 3NQPA 3PUKA 3D9LA 5JA4D 5DIZA 2OV8A 4EECA 1MYOA 3ASHA 3UTMA 3QWPA 4MLPA 2R5SA 4B0ZA 5FINA 4CT0A 4BX9A 3FUIA 5HRYA 1OT8A 2GRPB 5D0QD 3V31A 2AW6A 2MYOA 4BT8A 1OY3D 1OXJA 2FEZA 2J8SD 3JUEA 3EJNA 3LCAA 1OWOA 3I4GA 4KVMA 2ETAA 1RZ4A 5A23A 2F37A 3T8MA 3T5XA 5BPPA 4CRWA 3ML9A 3C98A 3LXUX 2WB2A 4XIFA 4BSXA 4YDEA 4DX2A 3B7TA 3HYMB 3P2BA 4GZ6A 4M7CA 5JMND 2P9PG 4N5QA 1ELRA 1OUVA 2JLBA 3KSQA 2QYJA 2RKKA 3FH7A 4GMRA 4TXPA 4GA2A 5G05J 1H2TC 3V30A 2DZNA 1YA0A 3SI5A 2EIME 3ZVVA 1JUQA 3PS6A 4B94A 1SZ9A 2EIJE 1DVPA 2OOEA 3CK7A 4AEZC 1AWCB 1BI8B 2DBAA 3RRUA 3ASFA 1HH8A 5LCWC 3CV0A 4WWOA 4D10C 4KYOB 5JJ7A 5FQ4A 2AVPA 2DYRE 3FUHA 3HXEA 3LY9A 4GTRA 3PZDA 3Q79A 3ASGA 4J8DA 3ZFWA 1TNYA 3KS2A 4L2YA 3HG0D 5JHAA 5KNHD 3ZN3A 4G24A 4H7XA 3EHRA 5LX8A 3QARA 2P2CP 2KZTB 1OWMA 4BT9A 3L54A 3FU3A 2BUGA 1PAQA 2I1JA 3UQ3A 3B7UX 3JXIA 1XGWA 3TG4A 4WWPA 3ABME 1KPSB 4JHKA 2P9KG 4HRNA 2J07A 2P58C 4BWRA 1NP7A 1IQUA 1NA3A 5LFAA 1SW6A 2F0YA 3GZ2A 4XKBA 3UMVA 4G11A 4JW1A 2PQNA 5HI7A 5ENNA 4LERA 2DZOA 2VQ2A 4ATZD 1HE8A 1IKND 3JUIA 4LG6A 4LNGA 1INZA 3PNLB 4UWFA 1MJ0A 2X6JA 4AP2A 3ULEG 2KM4A 3OAWA 3R7QA 2QFCA 3FUNA 2I2OA 3TWTA 3EHMA 2I6HA 2VSNA 4WUYA 4Q94A 3Q49B 4J0UA 4GCOA 5EDSA 4JB8P 2ETBA 3D9JA 3TWVA 3DSUA 3E34A 1K3ZD 5D2MC 3FEYA 5EKQD 2BEDA 5FQ8A 2XEEA 1EPUA 3NAWA 3MKQB 3CGHA 4RLYA 5AQ7A 1NI1A 4BTAA 3TXMA 3RU0A 2PQRA 5AQBA 1E8ZA 3V2XA 5EYLA 4U8HA 3FEXA 1HX8A 3O4ZA 4ABNA 4BESA 3D9IA 4UWGA 1P5QA 3GYZA 3KD7A 3BUAA 5G05C 2KZTA 3ZPJA 4JA9A 1Z5SC 3JYSA 4DLOA 4TV3A 3S7FA 1XNFA 3DEPA 1EYHA 2YNQA 4ZHBA 3FTZA 3O48A 3SY2A 2BKKB 5CHEE 1S64A 4GTVA 3ZYLA 2V0PA 2NYJA 2WXRA 3JXJA 2LAHA 2CG3A 1U3CA 2LUHA 4OAVB 1E8XA 3LEWA 2WXKA 5FIOA 3I5PA 1UOHA 4CEMA 4KXKB 3RO3A 2XHEA 3PE3A 4ACLA 1SA4A 3L82A 3NOCD 2IOLA 3CVWA 5BUZA 3R7RA 3LJ3A 2IF4A 2Q7FA 4AM9A 1G3NB 4GMJA 2IQCA 4WNGA 4G26A 2KATA 2ZISA 4G8LA 2DCPA 4YVOA 4ACKA 4GTOA 5LP0A 2XEHA 2V8SE 4XX5A 4PS8A 4CT4A 5J08A 5BNWA 3MKQA 3GZSA 3CEQA 2YINA 1K1BA 3Q5MA 1OCCE 2IY0C 5J90A 3UM3A 4U07A 1AP7A 5E75A 2ZIRA 3SFXA 1MHQA 4NACA 1O1RA 3ASOE 2IONA 3SF4A 3TWRA 1TN7A 3CK8A 4G2VA 3FUEA 4MBGA 3APFA 3CR3A 1V54E 2WMNA 5CEDB 1KT0A 2CFUA 2LSVA 4U8YD 2AWIA 3DWLG 1GW6A 1MX2A 3ZXPA 5JHBA 3NZUA 4JD2G 4OAUC 1JCQA 3EU9A 3LY7A 2VTBB 1K8KG 4A1SA 4IULA 1U3DA 2WXNA 2WXMA 4RSYA 5FT9A 4BTBA 3IHVA 4FHJA 3IXEA 5BXUA 4WAFA 4A3TA 1HXIA 3EU5A 3SO8A 4EZJA 1ZBPA 4GPMA 3B13A 3R9MA 3RSEG 5EN5D 4KMOA 4YDOA 2J4BA 3D9PA 3UIPC 4N5CA 2B0OE 4A55A 4H7YA 3MYVA 3SFZA 2Y69E 2H6GA 4AJWA 1H2UA 4C0EA 2P9LG 1N52A 2FF4A 3I4RB 4EQFA 2XS8A 2ZGDA 1H6OA 3SBTB 4JPSA 1TN6A 3TWWA 2OVBA 4J6IA 4UQZA 3CVXA 4NQ0A 1O5MA 3TAXA 4AV7A 5AENA 3UI2A 3G2VA 4L7TA 4UWHA 1DCEA 4GA1A 4P29A 2RG8A 1IQRA 3RAUA 2LXMA 4I43A 3DPDA 4IYPA 2KC7A 3KEZA 2J09A 3FTWA 1VDYA 1PY1A 4ANXA 3E32A 3AG4E 3Q47B 3QC1A 1HO8A 3RJVA 4MS6A 4J7WA 1TNUA 2EQXA 5EIDA 2YHCA 4Y6CA 2C0LA 1NA0A 1A5EA 2A5EA 1JPLA 2R59A 2XPYA 3SQVA 2VJ8A 3MCXA 2WQ6A 4J8EA 2XQ0A 2P9SG 2VTBA 2ZU6B 4JL0A 3ZEFA 4FHKA 3N71A 2ZXWE 4W9RA 3FTUA 3SD5A 5AARA 2WQHA 3AAAC 3MV2B 2I9CA 4GZ5A 1TN8A 4DRXE 4DX5D 3C3QA 3R9AB 4LUNU 3SGHA 2MHKA 1JWGA 3CHQA 3EHQA 3UT8A 3CVUA 3FTVA 4FLHA 4N3CA 3ZGQA 3CLJA 2FO7A 5CBOA 3E37A 2C2LA 3EIJA 3PRZA 4E6HA 3LKUA 3C3RA 4I9EA 1QBQA 1BLXB 1WM5A 4JEHA 2A5UA 4X8QA 2FO1E 5AIJA 1H2VC 3LPZA 4U96D 1SVXA 4J8FA 2MRIA 4EHMA 2IO3C 3ULYA 1KT1A 2PZIA 3GZ1A 4DX7D 5EIBE 2YQ8A 1OCOE 4RG9A 2VYIA 1N95A 4I1MA 4I17A 1ELKA 4BFRA 4AXHA 4ILHB 4B8AA 4K0RA 5B1AE 3VLFA 3WXXA 2X6HA 4WNEA 2X6KA 2RD0A 1K1AA 3ZYMA 4L23A 2OEVA 3FUJA 3OXGA 4PDXA 3SHFA 5A7DB 3EHNA 4Q69A 3Q9NC 4GYOA 4HRLA 1FVFA 3CHRA 3S7BA 3DSWA 5CMWA 2P9NG 4JHJA 5ENTD 5AN8A 2IU1A 4CGWA 4DK5A 3MGBA 4M3OA 2WXQA 3KSLA 4UUCA 2DYSE 4CYMD 2L6BA 5BV0A 2VGEA 4LNBA 3ABKE 4HNAD 2KCKA 1WDYA 1TR4A 3RK6A 3TWXA 2OVFA 4ILIA 4YDYA 3TXNA 1N9AA 3RO2A 4UWLA 2OEWA 2CHZA 2WXHA 1DCQA 4APOA 4TUMA 3CVVA 2MOWA 1YYHA 4U95D 5B3SE 1L5JA 3X2QE 3ULQA 4DLQA 2X6IA 3BG1B 5T3RA 2IJGX 3HXBA 1UN9A 3QDNA 5FZQA 1NFIE 3DXKG 2VGXB 3FWVA 1PC2A 4DI4A 4Q96A 3MX3A 4XI0A 3E30A 4K5BA 4GZDA 4HS2A 2HE0A 3PEVB 5AQAA 2J4DA 4JC8A 4AOFA 3DBSA 3APCA 2EIKE 2X3MA 3CQCB 3LDZA 4DPRA 2GGFA 3S7DA 2V4LA 4HOQA 2WXJA 4ANVA 4I6JA 4MKTA 2BKGA 1X5BA 4I9CA 2PM7A 2XCCA 3LS8A 3SFYA 5M72A 4UQYA 3PE4A 4ATGA 5ENRD 5KJNA 2J9QA 3Q75A 2QZAA 2QC9A 5KCMA 1ZB1A 3QKYA 4ANUA 2E2EA 4XE0A 5ARGA 3L9TA 3DSTA 3Q4AB 4I6EA 3CVPA 4L9PA 1FVHA 4DX6D 1HG5A 1KZOA 4NIKA 4U7EB 3HIZA 3FU0A 4FJZA 1H6PA 1N0RA 3Q9UC 2NSZA 5ENOD 5CERB 4TXQA 3S7JA 3QK0A 1QZ2A 3ZIMA 5HS0A 5A6CA 1Z3XA 3T5VA 3PREA 2A4ZA 1MX6A 4RVBA 5D66A 2R2LA 4N2QA 5FZSA 1Q2ZA 3FULA 3FUDA 4JHRA 3CVYA 2Y1LE 2GRMA 5ITZF 2R17C 4RQIA 2VGXA 3DPYA 4J8SA 3PZ1A 3OTNA 1N4SA 3VLEA 2XPZA 3NB2A 2KBXA 2GRQB 2WVIA 4NURA 3B7SA 3HXDA 3PZ2A 4DUIA 4BX8A 4GMLA 4JZYA 3QWVA 4FP7A 3AU5A 3Q15A 2VSYA 3JQ0A 4HORA 1UN8A 3QB2A 4GU5A 1ZU2A 3HXFA 2P9IG 4F7AA 5T8IA 2KXPC 3Q7AA 4URKA 1QYMA 1X81A 1B89A 3AG1E 3ABLE 5HQ8A 4F1PA 3WG7E 1H6KA 3EIQC 3G2SA 1Y6IA 1MQSA 4UQXA 3JCKC 4G8KA 2WXOA 3UINC 4AIFA 4CGVA 4UI9J 2AXVA 5CRUA 1S70B 1LD7A 3IKOB 3MA5A 2GROB 4GZ3A 2WMOA 3GW4A 5JJTA 4LCTA 4O1OA 1N4QA 3AS4A 3TJPA 2CG2A 5BV1A 2L0IA 2XPIA 4G25A 1LF8A 3B7BA 3FP3A 5DBKA 4V3IA 3VTXA 2GRNB 4HB5A 3SBSA 2H6HA 3CHSA 3UT7A 3D9NA 3D9HA 5KNGA 4E85A 4CDMA 5CBNA 1OWLA 3FU5A 3I3NA 5FJYA 4I2ZA 2HYZA 3FUKA 3ASNE 2VSXE 1UG3A 3EDTB 4I1AA 3CK9A 3TWUA 3HRAA 5KBAA 1HF8A 3LVQE 3AG3E 3T8KA 4ANWA 4HOUA 1DC2A 2L6JA 4HOTA 3BEEA 4DJAA 2XENA 2EINE 3ZKJA 2J49A 2ILRA 3ONKA 1MZCA 4K03A 1KLXA 3CKCA 3FY4A 3OXFA 1JWFA 4UI9K 2AXZA 2H6FA 4AY5A 3CQGB 3QJZA 1WG0A 2WXLA 2WXGA 3CHMA 2RFMA 3ASDA 3APDA 2IEJA 3CIAA 1HZ4A 2IFUA 3DSVA 5BT1A 4WNDA 3KAEA 2OCCE 4ILGA 1O1TA 3FU6A 3PUJA 2X6FA 5JJ6A 1H19A 3PEUB 3UUXA 3TL5A 4A3VA 2VGYA 1OWNA 2UY1B 1TNOA 2CFZA 3W9FA 1JCSA 2F8YA 1LD8A 2UWJG 4HI9A 3NOGD 2IO2C 3EUVA 1S63A 1QQEA 2LO6A 4N39A 4UWKA 3AJIA 4LSZE 4GTMA 4PS3A 3L08A 4EBAG 2KCLA 4AVXA 4HQDA 5ARFA 3S2AA 2CHXA 5ENQD 3U66A 1WAO1 3UKRG 4U04A 1IHBA 4B89A 4FA6A 5LOZA 3ZUVB 3CHPA 4O6FA 5ANRA 3UM0A 3HDXA 2Y4TA 2QYUA 2R03A 4DI3A 4UI9C 4B8CB 1TNZA 2BTDA 2Y4UA 2XS1A 3D3MA 3FTXA 4I1OB 2WXPA 4DX1A 1N4PA 2EILE 3AG2E 4XI9A 5E76A 4C48B 2E0IA 3MV3B 3ZU7B 3C72A 3NF1A 1BU9A 4JXTA 5IY5E 4I6GA 4WWNA 1E8WA 4YNDA 1E96B 1LTXA 4F53A 4FJYA 1WY6A 4OVVA 3ONLA 3L22A 2XRYA 3UPVA 3PZ3A 2YHEA 3ISMC 4HFGA 3ML8A 3OXLA 2WPVA 3FUFA 3L16A 4EZKA 1YCSB 4A63B 3D9KA 3NZSA 1DNPA 4PS7A 3U4TA 2P9UG 3ZYQA 2ZGGA 1OWPA 5H7PA 3UX4A 1RW2A 2UY1A 4YDWA 3U9WA 2XZTG 2ONDA 3V2OA 2LAIA 3VLDA 4C0MA 4PUCA 3FTYA 5G55A 3MZLB 3E33A 3U3WA 3F6QA 3PNTB 3U64A 2NC9A 4EBAA 2XGMA 4A1GA 2R05A 3ESLA 4C9BB 2F8XK 3TG5A 4CDNA 3UIOC 2L0TB 3RRNB 4J8YA 1N0QA 4HOSA 5AJLA 4XZ4A 3FH5A 3AS5A 3CKBA 1SZAA 4K5CA 3FHEA 4BEPA 1N4RA 3C5RA 4U0ZA 3DXMG 4FULA 2NXPA 1EF1C 3RIBA 4TUUA 1UJKA 5G04J 2FULA 3JQ1A 4IRUA 1TNBA 3D9OA 3L6AA 4GZCA 1HU3A 2HR2A 5C2YA 4GTQA 4U63A 1JCRA 5ENSD 3UM1A 3W9GA 4BERA 1D8EA 2GRRB 4HLEA 4GPKA 1N94A 3AU4A 2DIWA 1N54A 3ZHEB 3HXCA 1FCHA 3V79K 2XZDG 1HS6A 4KVOA 1NL4A 2ETCA 2R02A 4N3AA 5C1DA 4L1BA 1OCZE 3CVLA 3AS8A 5CEAA 3MKRA 4AY6A 5CRVA 2L9BA 1OCRE 2XGOA 1TJFA 5KJLA 4HVBA 4R7LA 3BQOA 5FZRA 4GYYA 2XGSA 2IOSA 3PH0C 3DRAA 4GTSA 5BXOA 4FU3A 4F3VA 3T9KA 2VSOE 5CCLA 4GCNA 5G2NA 2KCVA 2FI7A 2HM8A 4B93B 5BW8C 3CVNA 4RG6A 4LRZA 1BD8A 4HI8A 5EX0A 2WM9A 1FT2A 3P1UA 4APFA 3TGOA 3ENEA 4U0SA 3UXGA 3ESKA 2DWZA 4OVUA 1ELWA 3DEOA 4XKCA 2DVWA 1V55E 3LJNA 5FTPA 1FPPA 3LY8A 1YMPA 1Z3YA 3QOUA 1E7VA 2CHWA 4NRHB 1EDUA 2BF0X 3URZA 1MX4A 1E8YA 2PM6A 3B95A 3KEAA 1N11A 1D8DA 3CSFA 4F1SA 3L13A 2WQ7A 4BETA 2XRZA 2V5QC 3C3OA 3UM2A 2J08A 3Q7FA 5EILA 3DSSA 3G2UA 1H0AA 1TJCA 4I2WA 5HKPA 1A17A 4GTTA 2WXFA 3IBEA 2X38A 4U8VD 4TRQA 5FWQA 4EPZA 2HO1A 3QAQA 3Q78A 5D0OD 4KZ0A 3ZNGA 3ZHEA 1E7UA 4CDRA 3E4BA 4XEIG 3L17A 3QWWA 3B7RL 2JEKA 4U0UA 4O1PA 3D9MA 3QNKA 1U2VG 4GAAA 5B1BE 4KZCA 3CVQA 4YVQC 4HRMB 4JVSA 5EYPF 4HBDA 2PL2A 4PH4B 3NBNB 5G04C 3TWQA 1UJJA 1BI7B 4Y6WA 4ZFHA 2V4HC 3VTYA 5KJKA 2I1KA 2AJAA 5CCMA 4CZ2D 2QY7A 3RKVA 3UKUG 4HLLA 4O60A 3FH8A 4BY6A 2XEVA 4MRUA 3J5PA 1FT1A 3G2WA 1SA5A 3IHYA 4GYWA 1Z6TA 3HVEB 5AAOA 2C0MA 1UW4B 4QFVA 4Z68A 3MJWA 2B6CA 2Y0BG 4OYSA 5FQ7A 2Y3AA 4KBQA 2XCBA 3MEKA 2JABA 3LYAA 4EZLA 3J5QB 4KT6B 2AXUA 3PDNA 3BU8A 3Q73A 3FFLA 3FUMA 4JA7A 4CCAA 4GTPA 4FC8A 4LEUA 4F6RD 4G1TA 3PZ4A 1IHGA 3ZW3A 1BPOA 1TYQG 3CHOA 4N2SA 4K5AB 3LVRE 1TEZA 1IXVA 3TWSA 4N3BA 1HG2A 2M63A 3PVLA 1QNFA 4HXIA 4JEUA 3IV0A 5KJMA 5LCWJ 3ZYKA 2V5FA 1Y8MA 2LNIA 4FLBA 5KWDA 1KZPA 2GW1A
chains in the Genus database with same CATH topology
1NI1A 1LTXA 3EU5A 1N4RA 1FT2A 2H6HA 3DPYA 3PZ3A 1TN8A 1TNOA 4YDOA 3PZ1A 1JCSA 1O1SA 1N4SA 1LD8A 3DSWA 1FT1A 1FPPA 1SA5A 2H6GA 4YDEA 3EUVA 1S63A 1TNBA 3SFYA 3E37A 3HXDA 3KSLA 3PZ2A 2ZIRA 4GTMA 4GTQA 3SFXA 1JCRA 3DSXA 1TN6A 2H6IA 3KSQA 3Q75A 1O1RA 1QBQA 1D8DA 1D8EA 2F0YA 4LNBA 1TN7A 1N94A 1O5MA 4MBGA 3HXCA 3Q7FA 3DSSA 4LNGA 1S64A 4GTVA 3Q73A 1N9AA 1DCEA 3DSTA 3HXFA 1MZCA 4EHMA 1NL4A 4GTPA 4L9PA 3E33A 3Q7AA 1TNZA 4GTTA 1X81A 3Q78A 1KZOA 2H6FA 3E32A 3PZ4A 1JCQA 1N4PA 1N95A 1SA4A 1TNUA 3HXBA 1LD7A 3DRAA 3C72A 4GTSA 2IEJA 3DSUA 3E34A 3HXEA 4GTRA 3Q79A 3DSVA 2BEDA 1N4QA 1TNYA 2ZISA 2R2LA 1O1TA 1KZPA 3E30A 4GTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI1 A;  1LTX A;  3EU5 A;  1N4R A;  1FT2 A;  2H6H A;  3DPY A;  3PZ3 A;  1TN8 A;  1TNO A;  4YDO A;  3PZ1 A;  1JCS A;  1O1S A;  1N4S A;  1LD8 A;  3DSW A;  1FT1 A;  1FPP A;  1SA5 A;  2H6G A;  4YDE A;  3EUV A;  1S63 A;  1TNB A;  3SFY A;  3E37 A;  3HXD A;  3KSL A;  3PZ2 A;  2ZIR A;  4GTM A;  4GTQ A;  3SFX A;  1JCR A;  3DSX A;  1TN6 A;  2H6I A;  3KSQ A;  3Q75 A;  1O1R A;  1QBQ A;  1D8D A;  1D8E A;  2F0Y A;  4LNB A;  1TN7 A;  1N94 A;  1O5M A;  4MBG A;  3HXC A;  3Q7F A;  3DSS A;  4LNG A;  1S64 A;  4GTV A;  3Q73 A;  1N9A A;  1DCE A;  3DST A;  3HXF A;  1MZC A;  4EHM A;  1NL4 A;  4GTP A;  4L9P A;  3E33 A;  3Q7A A;  1TNZ A;  4GTT A;  1X81 A;  3Q78 A;  1KZO A;  2H6F A;  3E32 A;  3PZ4 A;  1JCQ A;  1N4P A;  1N95 A;  1SA4 A;  1TNU A;  3HXB A;  1LD7 A;  3DRA A;  3C72 A;  4GTS A;  2IEJ A;  3DSU A;  3E34 A;  3HXE A;  4GTR A;  3Q79 A;  3DSV A;  2BED A;  1N4Q A;  1TNY A;  2ZIS A;  2R2L A;  1O1T A;  1KZP A;  3E30 A;  4GTO A; 
#chains in the Genus database with same CATH topology
 1D9S A;  3HHM A;  1E90 A;  4IN3 B;  1NZN A;  2FBN A;  1O1S A;  3FTS A;  4FAD A;  5ENP D;  3K9I A;  1W3B A;  4BSZ B;  4QQI A;  5AJD A;  2LXL A;  4GB9 A;  5ANL A;  5FQ6 A;  3ZRH A;  3FDH A;  4TXR A;  2LSU A;  1SQM A;  3G2T A;  3ZXS A;  3SZ7 A;  3BG0 B;  4ME2 A;  3SNX A;  5T4Y A;  5CEC B;  3DSX A;  2PNN A;  2H6I A;  4G23 A;  3RRM B;  1IYG A;  3HVE A;  1S0P A;  3UT4 A;  4GA0 A;  2WXI A;  5CMY A;  3IEG A;  4WNF A;  5EX3 A;  5AYW D;  4LNU D;  1HFA A;  2RFA A;  3CST A;  4L2L A;  5AQ9 A;  2GRL A;  3NQP A;  3PUK A;  3D9L A;  5JA4 D;  5DIZ A;  2OV8 A;  4EEC A;  1MYO A;  3ASH A;  3UTM A;  3QWP A;  4MLP A;  2R5S A;  4B0Z A;  5FIN A;  4CT0 A;  4BX9 A;  3FUI A;  5HRY A;  1OT8 A;  2GRP B;  5D0Q D;  3V31 A;  2AW6 A;  2MYO A;  4BT8 A;  1OY3 D;  1OXJ A;  2FEZ A;  2J8S D;  3JUE A;  3EJN A;  3LCA A;  1OWO A;  3I4G A;  4KVM A;  2ETA A;  1RZ4 A;  5A23 A;  2F37 A;  3T8M A;  3T5X A;  5BPP A;  4CRW A;  3ML9 A;  3C98 A;  3LXU X;  2WB2 A;  4XIF A;  4BSX A;  4YDE A;  4DX2 A;  3B7T A;  3HYM B;  3P2B A;  4GZ6 A;  4M7C A;  5JMN D;  2P9P G;  4N5Q A;  1ELR A;  1OUV A;  2JLB A;  3KSQ A;  2QYJ A;  2RKK A;  3FH7 A;  4GMR A;  4TXP A;  4GA2 A;  5G05 J;  1H2T C;  3V30 A;  2DZN A;  1YA0 A;  3SI5 A;  2EIM E;  3ZVV A;  1JUQ A;  3PS6 A;  4B94 A;  1SZ9 A;  2EIJ E;  1DVP A;  2OOE A;  3CK7 A;  4AEZ C;  1AWC B;  1BI8 B;  2DBA A;  3RRU A;  3ASF A;  1HH8 A;  5LCW C;  3CV0 A;  4WWO A;  4D10 C;  4KYO B;  5JJ7 A;  5FQ4 A;  2AVP A;  2DYR E;  3FUH A;  3HXE A;  3LY9 A;  4GTR A;  3PZD A;  3Q79 A;  3ASG A;  4J8D A;  3ZFW A;  1TNY A;  3KS2 A;  4L2Y A;  3HG0 D;  5JHA A;  5KNH D;  3ZN3 A;  4G24 A;  4H7X A;  3EHR A;  5LX8 A;  3QAR A;  2P2C P;  2KZT B;  1OWM A;  4BT9 A;  3L54 A;  3FU3 A;  2BUG A;  1PAQ A;  2I1J A;  3UQ3 A;  3B7U X;  3JXI A;  1XGW A;  3TG4 A;  4WWP A;  3ABM E;  1KPS B;  4JHK A;  2P9K G;  4HRN A;  2J07 A;  2P58 C;  4BWR A;  1NP7 A;  1IQU A;  1NA3 A;  5LFA A;  1SW6 A;  2F0Y A;  3GZ2 A;  4XKB A;  3UMV A;  4G11 A;  4JW1 A;  2PQN A;  5HI7 A;  5ENN A;  4LER A;  2DZO A;  2VQ2 A;  4ATZ D;  1HE8 A;  1IKN D;  3JUI A;  4LG6 A;  4LNG A;  1INZ A;  3PNL B;  4UWF A;  1MJ0 A;  2X6J A;  4AP2 A;  3ULE G;  2KM4 A;  3OAW A;  3R7Q A;  2QFC A;  3FUN A;  2I2O A;  3TWT A;  3EHM A;  2I6H A;  2VSN A;  4WUY A;  4Q94 A;  3Q49 B;  4J0U A;  4GCO A;  5EDS A;  4JB8 P;  2ETB A;  3D9J A;  3TWV A;  3DSU A;  3E34 A;  1K3Z D;  5D2M C;  3FEY A;  5EKQ D;  2BED A;  5FQ8 A;  2XEE A;  1EPU A;  3NAW A;  3MKQ B;  3CGH A;  4RLY A;  5AQ7 A;  1NI1 A;  4BTA A;  3TXM A;  3RU0 A;  2PQR A;  5AQB A;  1E8Z A;  3V2X A;  5EYL A;  4U8H A;  3FEX A;  1HX8 A;  3O4Z A;  4ABN A;  4BES A;  3D9I A;  4UWG A;  1P5Q A;  3GYZ A;  3KD7 A;  3BUA A;  5G05 C;  2KZT A;  3ZPJ A;  4JA9 A;  1Z5S C;  3JYS A;  4DLO A;  4TV3 A;  3S7F A;  1XNF A;  3DEP A;  1EYH A;  2YNQ A;  4ZHB A;  3FTZ A;  3O48 A;  3SY2 A;  2BKK B;  5CHE E;  1S64 A;  4GTV A;  3ZYL A;  2V0P A;  2NYJ A;  2WXR A;  3JXJ A;  2LAH A;  2CG3 A;  1U3C A;  2LUH A;  4OAV B;  1E8X A;  3LEW A;  2WXK A;  5FIO A;  3I5P A;  1UOH A;  4CEM A;  4KXK B;  3RO3 A;  2XHE A;  3PE3 A;  4ACL A;  1SA4 A;  3L82 A;  3NOC D;  2IOL A;  3CVW A;  5BUZ A;  3R7R A;  3LJ3 A;  2IF4 A;  2Q7F A;  4AM9 A;  1G3N B;  4GMJ A;  2IQC A;  4WNG A;  4G26 A;  2KAT A;  2ZIS A;  4G8L A;  2DCP A;  4YVO A;  4ACK A;  4GTO A;  5LP0 A;  2XEH A;  2V8S E;  4XX5 A;  4PS8 A;  4CT4 A;  5J08 A;  5BNW A;  3MKQ A;  3GZS A;  3CEQ A;  2YIN A;  1K1B A;  3Q5M A;  1OCC E;  2IY0 C;  5J90 A;  3UM3 A;  4U07 A;  1AP7 A;  5E75 A;  2ZIR A;  3SFX A;  1MHQ A;  4NAC A;  1O1R A;  3ASO E;  2ION A;  3SF4 A;  3TWR A;  1TN7 A;  3CK8 A;  4G2V A;  3FUE A;  4MBG A;  3APF A;  3CR3 A;  1V54 E;  2WMN A;  5CED B;  1KT0 A;  2CFU A;  2LSV A;  4U8Y D;  2AWI A;  3DWL G;  1GW6 A;  1MX2 A;  3ZXP A;  5JHB A;  3NZU A;  4JD2 G;  4OAU C;  1JCQ A;  3EU9 A;  3LY7 A;  2VTB B;  1K8K G;  4A1S A;  4IUL A;  1U3D A;  2WXN A;  2WXM A;  4RSY A;  5FT9 A;  4BTB A;  3IHV A;  4FHJ A;  3IXE A;  5BXU A;  4WAF A;  4A3T A;  1HXI A;  3EU5 A;  3SO8 A;  4EZJ A;  1ZBP A;  4GPM A;  3B13 A;  3R9M A;  3RSE G;  5EN5 D;  4KMO A;  4YDO A;  2J4B A;  3D9P A;  3UIP C;  4N5C A;  2B0O E;  4A55 A;  4H7Y A;  3MYV A;  3SFZ A;  2Y69 E;  2H6G A;  4AJW A;  1H2U A;  4C0E A;  2P9L G;  1N52 A;  2FF4 A;  3I4R B;  4EQF A;  2XS8 A;  2ZGD A;  1H6O A;  3SBT B;  4JPS A;  1TN6 A;  3TWW A;  2OVB A;  4J6I A;  4UQZ A;  3CVX A;  4NQ0 A;  1O5M A;  3TAX A;  4AV7 A;  5AEN A;  3UI2 A;  3G2V A;  4L7T A;  4UWH A;  1DCE A;  4GA1 A;  4P29 A;  2RG8 A;  1IQR A;  3RAU A;  2LXM A;  4I43 A;  3DPD A;  4IYP A;  2KC7 A;  3KEZ A;  2J09 A;  3FTW A;  1VDY A;  1PY1 A;  4ANX A;  3E32 A;  3AG4 E;  3Q47 B;  3QC1 A;  1HO8 A;  3RJV A;  4MS6 A;  4J7W A;  1TNU A;  2EQX A;  5EID A;  2YHC A;  4Y6C A;  2C0L A;  1NA0 A;  1A5E A;  2A5E A;  1JPL A;  2R59 A;  2XPY A;  3SQV A;  2VJ8 A;  3MCX A;  2WQ6 A;  4J8E A;  2XQ0 A;  2P9S G;  2VTB A;  2ZU6 B;  4JL0 A;  3ZEF A;  4FHK A;  3N71 A;  2ZXW E;  4W9R A;  3FTU A;  3SD5 A;  5AAR A;  2WQH A;  3AAA C;  3MV2 B;  2I9C A;  4GZ5 A;  1TN8 A;  4DRX E;  4DX5 D;  3C3Q A;  3R9A B;  4LUN U;  3SGH A;  2MHK A;  1JWG A;  3CHQ A;  3EHQ A;  3UT8 A;  3CVU A;  3FTV A;  4FLH A;  4N3C A;  3ZGQ A;  3CLJ A;  2FO7 A;  5CBO A;  3E37 A;  2C2L A;  3EIJ A;  3PRZ A;  4E6H A;  3LKU A;  3C3R A;  4I9E A;  1QBQ A;  1BLX B;  1WM5 A;  4JEH A;  2A5U A;  4X8Q A;  2FO1 E;  5AIJ A;  1H2V C;  3LPZ A;  4U96 D;  1SVX A;  4J8F A;  2MRI A;  4EHM A;  2IO3 C;  3ULY A;  1KT1 A;  2PZI A;  3GZ1 A;  4DX7 D;  5EIB E;  2YQ8 A;  1OCO E;  4RG9 A;  2VYI A;  1N95 A;  4I1M A;  4I17 A;  1ELK A;  4BFR A;  4AXH A;  4ILH B;  4B8A A;  4K0R A;  5B1A E;  3VLF A;  3WXX A;  2X6H A;  4WNE A;  2X6K A;  2RD0 A;  1K1A A;  3ZYM A;  4L23 A;  2OEV A;  3FUJ A;  3OXG A;  4PDX A;  3SHF A;  5A7D B;  3EHN A;  4Q69 A;  3Q9N C;  4GYO A;  4HRL A;  1FVF A;  3CHR A;  3S7B A;  3DSW A;  5CMW A;  2P9N G;  4JHJ A;  5ENT D;  5AN8 A;  2IU1 A;  4CGW A;  4DK5 A;  3MGB A;  4M3O A;  2WXQ A;  3KSL A;  4UUC A;  2DYS E;  4CYM D;  2L6B A;  5BV0 A;  2VGE A;  4LNB A;  3ABK E;  4HNA D;  2KCK A;  1WDY A;  1TR4 A;  3RK6 A;  3TWX A;  2OVF A;  4ILI A;  4YDY A;  3TXN A;  1N9A A;  3RO2 A;  4UWL A;  2OEW A;  2CHZ A;  2WXH A;  1DCQ A;  4APO A;  4TUM A;  3CVV A;  2MOW A;  1YYH A;  4U95 D;  5B3S E;  1L5J A;  3X2Q E;  3ULQ A;  4DLQ A;  2X6I A;  3BG1 B;  5T3R A;  2IJG X;  3HXB A;  1UN9 A;  3QDN A;  5FZQ A;  1NFI E;  3DXK G;  2VGX B;  3FWV A;  1PC2 A;  4DI4 A;  4Q96 A;  3MX3 A;  4XI0 A;  3E30 A;  4K5B A;  4GZD A;  4HS2 A;  2HE0 A;  3PEV B;  5AQA A;  2J4D A;  4JC8 A;  4AOF A;  3DBS A;  3APC A;  2EIK E;  2X3M A;  3CQC B;  3LDZ A;  4DPR A;  2GGF A;  3S7D A;  2V4L A;  4HOQ A;  2WXJ A;  4ANV A;  4I6J A;  4MKT A;  2BKG A;  1X5B A;  4I9C A;  2PM7 A;  2XCC A;  3LS8 A;  3SFY A;  5M72 A;  4UQY A;  3PE4 A;  4ATG A;  5ENR D;  5KJN A;  2J9Q A;  3Q75 A;  2QZA A;  2QC9 A;  5KCM A;  1ZB1 A;  3QKY A;  4ANU A;  2E2E A;  4XE0 A;  5ARG A;  3L9T A;  3DST A;  3Q4A B;  4I6E A;  3CVP A;  4L9P A;  1FVH A;  4DX6 D;  1HG5 A;  1KZO A;  4NIK A;  4U7E B;  3HIZ A;  3FU0 A;  4FJZ A;  1H6P A;  1N0R A;  3Q9U C;  2NSZ A;  5ENO D;  5CER B;  4TXQ A;  3S7J A;  3QK0 A;  1QZ2 A;  3ZIM A;  5HS0 A;  5A6C A;  1Z3X A;  3T5V A;  3PRE A;  2A4Z A;  1MX6 A;  4RVB A;  5D66 A;  2R2L A;  4N2Q A;  5FZS A;  1Q2Z A;  3FUL A;  3FUD A;  4JHR A;  3CVY A;  2Y1L E;  2GRM A;  5ITZ F;  2R17 C;  4RQI A;  2VGX A;  3DPY A;  4J8S A;  3PZ1 A;  3OTN A;  1N4S A;  3VLE A;  2XPZ A;  3NB2 A;  2KBX A;  2GRQ B;  2WVI A;  4NUR A;  3B7S A;  3HXD A;  3PZ2 A;  4DUI A;  4BX8 A;  4GML A;  4JZY A;  3QWV A;  4FP7 A;  3AU5 A;  3Q15 A;  2VSY A;  3JQ0 A;  4HOR A;  1UN8 A;  3QB2 A;  4GU5 A;  1ZU2 A;  3HXF A;  2P9I G;  4F7A A;  5T8I A;  2KXP C;  3Q7A A;  4URK A;  1QYM A;  1X81 A;  1B89 A;  3AG1 E;  3ABL E;  5HQ8 A;  4F1P A;  3WG7 E;  1H6K A;  3EIQ C;  3G2S A;  1Y6I A;  1MQS A;  4UQX A;  3JCK C;  4G8K A;  2WXO A;  3UIN C;  4AIF A;  4CGV A;  4UI9 J;  2AXV A;  5CRU A;  1S70 B;  1LD7 A;  3IKO B;  3MA5 A;  2GRO B;  4GZ3 A;  2WMO A;  3GW4 A;  5JJT A;  4LCT A;  4O1O A;  1N4Q A;  3AS4 A;  3TJP A;  2CG2 A;  5BV1 A;  2L0I A;  2XPI A;  4G25 A;  1LF8 A;  3B7B A;  3FP3 A;  5DBK A;  4V3I A;  3VTX A;  2GRN B;  4HB5 A;  3SBS A;  2H6H A;  3CHS A;  3UT7 A;  3D9N A;  3D9H A;  5KNG A;  4E85 A;  4CDM A;  5CBN A;  1OWL A;  3FU5 A;  3I3N A;  5FJY A;  4I2Z A;  2HYZ A;  3FUK A;  3ASN E;  2VSX E;  1UG3 A;  3EDT B;  4I1A A;  3CK9 A;  3TWU A;  3HRA A;  5KBA A;  1HF8 A;  3LVQ E;  3AG3 E;  3T8K A;  4ANW A;  4HOU A;  1DC2 A;  2L6J A;  4HOT A;  3BEE A;  4DJA A;  2XEN A;  2EIN E;  3ZKJ A;  2J49 A;  2ILR A;  3ONK A;  1MZC A;  4K03 A;  1KLX A;  3CKC A;  3FY4 A;  3OXF A;  1JWF A;  4UI9 K;  2AXZ A;  2H6F A;  4AY5 A;  3CQG B;  3QJZ A;  1WG0 A;  2WXL A;  2WXG A;  3CHM A;  2RFM A;  3ASD A;  3APD A;  2IEJ A;  3CIA A;  1HZ4 A;  2IFU A;  3DSV A;  5BT1 A;  4WND A;  3KAE A;  2OCC E;  4ILG A;  1O1T A;  3FU6 A;  3PUJ A;  2X6F A;  5JJ6 A;  1H19 A;  3PEU B;  3UUX A;  3TL5 A;  4A3V A;  2VGY A;  1OWN A;  2UY1 B;  1TNO A;  2CFZ A;  3W9F A;  1JCS A;  2F8Y A;  1LD8 A;  2UWJ G;  4HI9 A;  3NOG D;  2IO2 C;  3EUV A;  1S63 A;  1QQE A;  2LO6 A;  4N39 A;  4UWK A;  3AJI A;  4LSZ E;  4GTM A;  4PS3 A;  3L08 A;  4EBA G;  2KCL A;  4AVX A;  4HQD A;  5ARF A;  3S2A A;  2CHX A;  5ENQ D;  3U66 A;  1WAO 1;  3UKR G;  4U04 A;  1IHB A;  4B89 A;  4FA6 A;  5LOZ A;  3ZUV B;  3CHP A;  4O6F A;  5ANR A;  3UM0 A;  3HDX A;  2Y4T A;  2QYU A;  2R03 A;  4DI3 A;  4UI9 C;  4B8C B;  1TNZ A;  2BTD A;  2Y4U A;  2XS1 A;  3D3M A;  3FTX A;  4I1O B;  2WXP A;  4DX1 A;  1N4P A;  2EIL E;  3AG2 E;  4XI9 A;  5E76 A;  4C48 B;  2E0I A;  3MV3 B;  3ZU7 B;  3C72 A;  3NF1 A;  1BU9 A;  4JXT A;  5IY5 E;  4I6G A;  4WWN A;  1E8W A;  4YND A;  1E96 B;  1LTX A;  4F53 A;  4FJY A;  1WY6 A;  4OVV A;  3ONL A;  3L22 A;  2XRY A;  3UPV A;  3PZ3 A;  2YHE A;  3ISM C;  4HFG A;  3ML8 A;  3OXL A;  2WPV A;  3FUF A;  3L16 A;  4EZK A;  1YCS B;  4A63 B;  3D9K A;  3NZS A;  1DNP A;  4PS7 A;  3U4T A;  2P9U G;  3ZYQ A;  2ZGG A;  1OWP A;  5H7P A;  3UX4 A;  1RW2 A;  2UY1 A;  4YDW A;  3U9W A;  2XZT G;  2OND A;  3V2O A;  2LAI A;  3VLD A;  4C0M A;  4PUC A;  3FTY A;  5G55 A;  3MZL B;  3E33 A;  3U3W A;  3F6Q A;  3PNT B;  3U64 A;  2NC9 A;  4EBA A;  2XGM A;  4A1G A;  2R05 A;  3ESL A;  4C9B B;  2F8X K;  3TG5 A;  4CDN A;  3UIO C;  2L0T B;  3RRN B;  4J8Y A;  1N0Q A;  4HOS A;  5AJL A;  4XZ4 A;  3FH5 A;  3AS5 A;  3CKB A;  1SZA A;  4K5C A;  3FHE A;  4BEP A;  1N4R A;  3C5R A;  4U0Z A;  3DXM G;  4FUL A;  2NXP A;  1EF1 C;  3RIB A;  4TUU A;  1UJK A;  5G04 J;  2FUL A;  3JQ1 A;  4IRU A;  1TNB A;  3D9O A;  3L6A A;  4GZC A;  1HU3 A;  2HR2 A;  5C2Y A;  4GTQ A;  4U63 A;  1JCR A;  5ENS D;  3UM1 A;  3W9G A;  4BER A;  1D8E A;  2GRR B;  4HLE A;  4GPK A;  1N94 A;  3AU4 A;  2DIW A;  1N54 A;  3ZHE B;  3HXC A;  1FCH A;  3V79 K;  2XZD G;  1HS6 A;  4KVO A;  1NL4 A;  2ETC A;  2R02 A;  4N3A A;  5C1D A;  4L1B A;  1OCZ E;  3CVL A;  3AS8 A;  5CEA A;  3MKR A;  4AY6 A;  5CRV A;  2L9B A;  1OCR E;  2XGO A;  1TJF A;  5KJL A;  4HVB A;  4R7L A;  3BQO A;  5FZR A;  4GYY A;  2XGS A;  2IOS A;  3PH0 C;  3DRA A;  4GTS A;  5BXO A;  4FU3 A;  4F3V A;  3T9K A;  2VSO E;  5CCL A;  4GCN A;  5G2N A;  2KCV A;  2FI7 A;  2HM8 A;  4B93 B;  5BW8 C;  3CVN A;  4RG6 A;  4LRZ A;  1BD8 A;  4HI8 A;  5EX0 A;  2WM9 A;  1FT2 A;  3P1U A;  4APF A;  3TGO A;  3ENE A;  4U0S A;  3UXG A;  3ESK A;  2DWZ A;  4OVU A;  1ELW A;  3DEO A;  4XKC A;  2DVW A;  1V55 E;  3LJN A;  5FTP A;  1FPP A;  3LY8 A;  1YMP A;  1Z3Y A;  3QOU A;  1E7V A;  2CHW A;  4NRH B;  1EDU A;  2BF0 X;  3URZ A;  1MX4 A;  1E8Y A;  2PM6 A;  3B95 A;  3KEA A;  1N11 A;  1D8D A;  3CSF A;  4F1S A;  3L13 A;  2WQ7 A;  4BET A;  2XRZ A;  2V5Q C;  3C3O A;  3UM2 A;  2J08 A;  3Q7F A;  5EIL A;  3DSS A;  3G2U A;  1H0A A;  1TJC A;  4I2W A;  5HKP A;  1A17 A;  4GTT A;  2WXF A;  3IBE A;  2X38 A;  4U8V D;  4TRQ A;  5FWQ A;  4EPZ A;  2HO1 A;  3QAQ A;  3Q78 A;  5D0O D;  4KZ0 A;  3ZNG A;  3ZHE A;  1E7U A;  4CDR A;  3E4B A;  4XEI G;  3L17 A;  3QWW A;  3B7R L;  2JEK A;  4U0U A;  4O1P A;  3D9M A;  3QNK A;  1U2V G;  4GAA A;  5B1B E;  4KZC A;  3CVQ A;  4YVQ C;  4HRM B;  4JVS A;  5EYP F;  4HBD A;  2PL2 A;  4PH4 B;  3NBN B;  5G04 C;  3TWQ A;  1UJJ A;  1BI7 B;  4Y6W A;  4ZFH A;  2V4H C;  3VTY A;  5KJK A;  2I1K A;  2AJA A;  5CCM A;  4CZ2 D;  2QY7 A;  3RKV A;  3UKU G;  4HLL A;  4O60 A;  3FH8 A;  4BY6 A;  2XEV A;  4MRU A;  3J5P A;  1FT1 A;  3G2W A;  1SA5 A;  3IHY A;  4GYW A;  1Z6T A;  3HVE B;  5AAO A;  2C0M A;  1UW4 B;  4QFV A;  4Z68 A;  3MJW A;  2B6C A;  2Y0B G;  4OYS A;  5FQ7 A;  2Y3A A;  4KBQ A;  2XCB A;  3MEK A;  2JAB A;  3LYA A;  4EZL A;  3J5Q B;  4KT6 B;  2AXU A;  3PDN A;  3BU8 A;  3Q73 A;  3FFL A;  3FUM A;  4JA7 A;  4CCA A;  4GTP A;  4FC8 A;  4LEU A;  4F6R D;  4G1T A;  3PZ4 A;  1IHG A;  3ZW3 A;  1BPO A;  1TYQ G;  3CHO A;  4N2S A;  4K5A B;  3LVR E;  1TEZ A;  1IXV A;  3TWS A;  4N3B A;  1HG2 A;  2M63 A;  3PVL A;  1QNF A;  4HXI A;  4JEU A;  3IV0 A;  5KJM A;  5LCW J;  3ZYK A;  2V5F A;  1Y8M A;  2LNI A;  4FLB A;  5KWD A;  1KZP A;  2GW1 A; 
#chains in the Genus database with same CATH homology
 1NI1 A;  1LTX A;  3EU5 A;  1N4R A;  1FT2 A;  2H6H A;  3DPY A;  3PZ3 A;  1TN8 A;  1TNO A;  4YDO A;  3PZ1 A;  1JCS A;  1O1S A;  1N4S A;  1LD8 A;  3DSW A;  1FT1 A;  1FPP A;  1SA5 A;  2H6G A;  4YDE A;  3EUV A;  1S63 A;  1TNB A;  3SFY A;  3E37 A;  3HXD A;  3KSL A;  3PZ2 A;  2ZIR A;  4GTM A;  4GTQ A;  3SFX A;  1JCR A;  3DSX A;  1TN6 A;  2H6I A;  3KSQ A;  3Q75 A;  1O1R A;  1QBQ A;  1D8D A;  1D8E A;  2F0Y A;  4LNB A;  1TN7 A;  1N94 A;  1O5M A;  4MBG A;  3HXC A;  3Q7F A;  3DSS A;  4LNG A;  1S64 A;  4GTV A;  3Q73 A;  1N9A A;  1DCE A;  3DST A;  3HXF A;  1MZC A;  4EHM A;  1NL4 A;  4GTP A;  4L9P A;  3E33 A;  3Q7A A;  1TNZ A;  4GTT A;  1X81 A;  3Q78 A;  1KZO A;  2H6F A;  3E32 A;  3PZ4 A;  1JCQ A;  1N4P A;  1N95 A;  1SA4 A;  1TNU A;  3HXB A;  1LD7 A;  3DRA A;  3C72 A;  4GTS A;  2IEJ A;  3DSU A;  3E34 A;  3HXE A;  4GTR A;  3Q79 A;  3DSV A;  2BED A;  1N4Q A;  1TNY A;  2ZIS A;  2R2L A;  1O1T A;  1KZP A;  3E30 A;  4GTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...