1N94A

Aryl tetrahydropyridine inhbitors of farnesyltransferase: glycine, phenylalanine and histidine derivates
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aryl tetrahydropyridine inhibitors of farnesyltransferase: glycine, phenylalanine and histidine derivatives.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase alpha subunit
total genus 106
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n94A00
4LNBA 3PZ3A 1FT2A 2ZISA 1TNUA 1TNOA 3E37A 3Q7FA 3HXDA 3E32A 3SFYA 1D8DA 3PZ1A 1O1TA 1NL4A 2BEDA 4YDOA 4EHMA 1SA4A 3DSVA 3DSXA 4GTVA 4GTTA 3DRAA 3Q73A 1TN8A 2H6GA 1O1RA 3E34A 2ZIRA 4MBGA 1LD8A 3HXEA 3HXFA 3SFXA 1N9AA 1TNBA 1MZCA 3DPYA 3DSWA 4GTMA 1SA5A 1LTXA 4GTRA 2IEJA 1JCSA 3DSUA 3KSQA 2H6IA 2F0YA 1JCRA 3HXCA 1LD7A 1N4RA 3PZ4A 4GTPA 1KZPA 3DSTA 1TN6A 1S63A 3C72A 4LNGA 1D8EA 3Q78A 4GTQA 1FPPA 3DSSA 1N94A 1QBQA 1X81A 1N4PA 4YDEA 3Q79A 3EU5A 3PZ2A 3E30A 4GTOA 3HXBA 1TN7A 2H6FA 2H6HA 4GTSA 1KZOA 4L9PA 1TNYA 1TNZA 3KSLA 1FT1A 3Q75A 3Q7AA 3E33A 1S64A 1N4QA 1N4SA 1O1SA 2R2LA 1O5MA 1DCEA 1JCQA 1N95A 3EUVA 1NI1A
chains in the Genus database with same CATH superfamily
3IXEA 3GZ2A 3ESKA 1S0PA 4G25A 3ENEA 5KNHD 2XEEA 5CRUA 1NL4A 1QZ2A 3QDNA 5BPPA 3LVRE 3L13A 2R02A 4N3AA 2VQ2A 3G2UA 2Y1LE 3RRUA 4MRUA 1HX8A 3N71A 3F6QA 4AVXA 3DSWA 3PEVB 2VTBB 3T5XA 2ONDA 4I2WA 5CECB 2ETAA 3D9IA 3S7JA 4BY6A 2ZGDA 1E8WA 3RKVA 4RQIA 2NYJA 2X6JA 5AYWD 1TN6A 3LY7A 2ZXWE 3LJNA 4OAVB 5AQBA 3MGBA 3PVLA 1E8YA 4I1AA 4CYMD 3CVVA 2LXLA 3AG2E 3JQ0A 3JXJA 1YA0A 3FP3A 3OXLA 4HI9A 4RVBA 2F8XK 4AXHA 1PC2A 3FUKA 3EUVA 3MV3B 4FLBA 2WXGA 2ILRA 2NXPA 3SFZA 3FUJA 3FUFA 2QY7A 3SO8A 4TXPA 1OWPA 4EBAA 3LY8A 3OAWA 1O1TA 2QFCA 4TXQA 5JJ6A 3UPVA 1JPLA 3CK7A 4NIKA 3UKRG 4F1SA 4HLEA 2UWJG 4Q94A 4XKCA 3E34A 1K3ZD 4X8QA 4MBGA 2IONA 1LD8A 5D0QD 1N9AA 3S2AA 1AP7A 3JCKC 3CK9A 4DLQA 1OWMA 4BT8A 4JPSA 4BFRA 3Q9UC 1BI8B 4LERA 3UXGA 4D10C 3CKCA 4XX5A 3CLJA 5AQ9A 2PNNA 1IHGA 2PL2A 1ELRA 3PUJA 2KC7A 1KLXA 1NA0A 2RKKA 3KAEA 1OWLA 4H7YA 2IJGX 5ARFA 1TN7A 4XZ4A 3MKQB 3IV0A 2E2EA 2WB2A 5BXOA 3KSLA 3Q7AA 1BD8A 1PAQA 2X3MA 3FUNA 3FH5A 5G05J 4A3TA 3LEWA 3QKYA 3O48A 3CHMA 4M3OA 2WXKA 2J4BA 3FUDA 2MHKA 2I2OA 2XPZA 2CFUA 3FU0A 4ILGA 2WXFA 2FF4A 4YDWA 4DLOA 3SZ7A 4GTTA 3W9FA 4WAFA 3IHYA 4UI9J 2XHEA 3D9JA 3LYAA 2ETBA 3TWRA 3HXEA 2OCCE 4ATGA 3CV0A 4QQIA 3EIJA 1IKND 4C0MA 3FFLA 2BKGA 3MCXA 1RZ4A 3S7DA 3EHNA 3P1UA 4IN3B 2X6FA 1UJKA 3QARA 5EYLA 1N4RA 3CHSA 1OCRE 3CKBA 4KVMA 2DYRE 1QYMA 1BU9A 3DSSA 3ZHEA 2CHXA 4G23A 2P9PG 2GRMA 5ANLA 4P29A 4HOSA 4JA9A 3S7BA 4BSXA 5C2YA 3ASDA 1Z3XA 1JCQA 1OXJA 1D9SA 4DRXE 4I2ZA 3MJWA 2KBXA 3EHQA 3PZ3A 3CQCB 3TWVA 2DZOA 4APOA 4GYWA 5BW8C 2RFAA 2J09A 4ILHB 3GW4A 5JHAA 3DSVA 4U96D 5KBAA 2GRNB 1A5EA 3JUIA 4BETA 4UQZA 1E8XA 2EINE 4N5QA 3UMVA 3V30A 4L2YA 4I43A 2B6CA 3SF4A 4G8LA 3ESLA 3CVPA 4RG9A 4HOQA 1UW4B 2HE0A 3ABLE 3GZSA 4NACA 3AS5A 4DX7D 1JCRA 5LCWJ 3RU0A 2AW6A 4K0RA 5EX3A 1H2VC 2WM9A 3DSTA 3Q49B 4KXKB 3CSTA 3NZUA 2EQXA 3CVNA 1D8EA 4BTBA 3ML8A 2YNQA 2I6HA 4U7EB 3TXMA 2WXJA 1IQUA 2VSYA 3Q79A 1VDYA 1SZAA 2F8YA 5FZSA 4M7CA 3E30A 1WY6A 1YCSB 3OTNA 3QNKA 5T8IA 3LXUX 3ZXSA 4A1SA 4AV7A 2WXPA 1FT1A 3ULYA 2MOWA 4FHJA 2XCCA 3VLEA 1SW6A 4FP7A 1DC2A 4J0UA 3AU4A 1HG2A 5ANRA 3Q4AB 2VGXA 1H6KA 2A4ZA 3BQOA 3E32A 4N39A 4HI8A 2X6IA 3TWXA 2DCPA 4DPRA 1H0AA 4OVVA 2XQ0A 2Y4UA 2C2LA 3C3RA 2KCLA 2KXPC 3X2QE 5EILA 5CBNA 4JC8A 1TN8A 4GA0A 3G2WA 4AY5A 5LFAA 3RK6A 4F6RD 2P9KG 4UI9C 3T8KA 1H19A 5CRVA 4O1OA 3V79K 3IBEA 3VTYA 1HG5A 4BX9A 1KZPA 2WQHA 4U8YD 4ILIA 3I3NA 4FLHA 1OCOE 1SQMA 2X38A 4RSYA 1K1BA 2JABA 2V5QC 5LOZA 3SI5A 3B7BA 5EDSA 3C3QA 3OXGA 4J8FA 1AWCB 4MLPA 4EECA 4G1TA 5G05C 3D9KA 4XEIG 3ML9A 4GMLA 2H6HA 2J49A 5HQ8A 4GU5A 1JWFA 2LUHA 2OVBA 5BV0A 3ZKJA 2XGSA 1O5MA 4NURA 3W9GA 4PDXA 3MYVA 4UWLA 3ZW3A 4LNBA 3CEQA 4O1PA 4GZ5A 3NBNB 1IXVA 3CVYA 3JXIA 1UN9A 3ASFA 4OVUA 1LF8A 2WXOA 4AEZC 2EIJE 3ASOE 2E0IA 4R7LA 2CG3A 1DCQA 1SA4A 3PNLB 4GB9A 2M63A 4BWRA 4K03A 3ZFWA 4UWFA 1HFAA 4N2QA 4OYSA 3SFXA 2JEKA 3TWSA 2WQ6A 4XE0A 2LSVA 4G2VA 2YHEA 1DNPA 4PS8A 4U07A 1LD7A 4CCAA 2KZTA 3CK8A 5B1BE 3DEPA 2FO7A 5EN5D 5LP0A 1WG0A 4KT6B 2DZNA 2F37A 4E85A 3U4TA 1Y8MA 1QNFA 3P2BA 3KEZA 3ZGQA 2XEHA 4HBDA 4HXIA 5A6CA 4JHJA 2J9QA 1TNZA 1WAO1 3MZLB 4MS6A 4CDMA 1NP7A 3ULQA 4I9EA 3QWVA 2RFMA 3PH0C 1FVFA 4HRNA 5IY5E 3G2VA 4G8KA 4CRWA 4F3VA 1TNUA 2DBAA 3Q7FA 5KJNA 1TEZA 4OAUC 3V31A 4ACLA 3ZNGA 1E96B 3JYSA 3FTSA 4CT4A 1OCCE 3D3MA 1TJFA 5KJLA 2A5EA 3V2OA 2C0LA 4I9CA 1HXIA 4KZ0A 2OVFA 5BNWA 4I6JA 4GZDA 3AG3E 3DRAA 3Q73A 4K5BA 3FEYA 3R7QA 3L22A 3U3WA 2X6KA 2P9IG 1KPSB 5KJMA 5FZQA 2NSZA 4GTMA 5EYPF 1SA5A 3FUIA 4GTRA 3AG4E 3FHEA 3RRMB 1JUQA 4J8EA 4L7TA 4U8HA 4DX6D 4UWKA 1HE8A 3Q5MA 3UT7A 5LCWC 5FT9A 3TGOA 2NC9A 3PE3A 1S63A 2KZTB 5FIOA 3SBSA 4UQYA 1QQEA 1FPPA 2FEZA 4CDRA 3EHRA 5HS0A 3TXNA 2J8SD 3O4ZA 3LY9A 3VTXA 3UM2A 5CERB 3K9IA 3ABME 3RO3A 4FADA 4B8CB 5HKPA 4HVBA 3HHMA 1XNFA 3JQ1A 2OEWA 4GTSA 3LVQE 1KZOA 4B0ZA 4DJAA 4GYYA 3UIPC 4B8AA 5AARA 3C3OA 5ENPD 3Q75A 1HS6A 2WXRA 4ANXA 3ULEG 1HZ4A 2BUGA 3D9PA 5BXUA 3EIQC 2XPIA 2IF4A 3IEGA 5KNGA 4DX1A 3DXKG 4G24A 1GW6A 2R59A 1PY1A 1ZB1A 4URKA 3CHRA 1WM5A 1HF8A 3L6AA 5KJKA 4J8YA 3B7SA 4UUCA 4HLLA 3FU5A 4ANVA 2EIME 2P9UG 1G3NB 2ZU6B 2V4HC 2ZIRA 4LRZA 4DUIA 2HR2A 3DPYA 4XIFA 3IHVA 2KCVA 3CSFA 4JW1A 4J6IA 1NFIE 2WMOA 1HU3A 3ZYQA 3ZU7B 4GTPA 2MYOA 3JUEA 4U0ZA 2R03A 3VLFA 3L17A 1U3DA 4U63A 3SY2A 5AQAA 3EU5A 1BPOA 4U04A 3PDNA 3URZA 2VJ8A 5ENOD 2I1KA 4NQ0A 1MJ0A 1W3BA 3UQ3A 1TNYA 4JHRA 5CHEE 1EF1C 4N3CA 2KATA 3FUMA 3S7FA 2VYIA 1N4QA 4JHKA 5D2MC 4I1OB 4K5CA 1V55E 4DX5D 2HM8A 4DI4A 2QZAA 4L2LA 5DIZA 3ZPJA 1SZ9A 1EPUA 3AG1E 4W9RA 3PE4A 2AXUA 5J90A 3PNTB 2XS1A 3BUAA 3AAAC 3L9TA 4CGVA 4C9BB 3PEUB 2DVWA 4BERA 3TJPA 4AY6A 3QWWA 3NOGD 1OUVA 1UOHA 3FULA 3D9OA 4WUYA 2Q7FA 3FTWA 3MX3A 2GW1A 4BT9A 3LJ3A 4JEUA 3ZEFA 1JCSA 3DSUA 2P2CP 3UIOC 2JLBA 4HOTA 1FVHA 5JA4D 3PZ4A 1K1AA 2VGXB 4Y6CA 4CEMA 3C72A 3BU8A 4G26A 4YVOA 4JL0A 2HO1A 1QBQA 1BLXB 2PM7A 3QAQA 1Z3YA 3UI2A 2YINA 2AXVA 1E90A 3ZYLA 3HXBA 3TG4A 3PRZA 1IHBA 4ZHBA 3UM3A 4ATZD 3MEKA 2WMNA 4J8DA 2HYZA 2LXMA 4LCTA 2A5UA 3ZXPA 3B95A 2WXHA 3UM0A 3QK0A 3FWVA 1N0RA 2PQRA 2WXMA 5JHBA 1MX6A 4V3IA 3UKUG 3ZVVA 3FEXA 1BI7B 3NAWA 5CBOA 2XGMA 4F53A 2OV8A 2DIWA 5FJYA 2XRZA 2FO1E 1A17A 3B7TA 1IQRA 5LX8A 4ZFHA 2X6HA 4GPKA 4G11A 3G2TA 2P9LG 4HNAD 4TUMA 1NA3A 5FQ6A 3ZYMA 2FULA 2J4DA 5G2NA 4HFGA 3ZIMA 2WXQA 2F0YA 5KCMA 3L16A 3B7RL 2DYSE 3G2SA 4EZLA 2VGEA 2XENA 2BF0X 3Q78A 2PZIA 4GMRA 1ELWA 4LEUA 2L6JA 5HRYA 4Q96A 4F7AA 3AU5A 5BT1A 4UQXA 4GCOA 2UY1A 3T9KA 5AJDA 2IO2C 1EDUA 3ABKE 3CVWA 3FTZA 2J07A 3ZHEB 3FU3A 4N2SA 1N0QA 3GZ1A 2WXNA 5ENQD 2BTDA 3Q15A 2FI7A 3NOCD 3HXDA 3EHMA 3SFYA 4KVOA 2OEVA 3CVLA 3PS6A 2XPYA 2IOSA 2QYJA 5E76A 4LNUD 2BKKB 4I6EA 3DPDA 4N5CA 1O1RA 2AWIA 3LPZA 5CMYA 1Z6TA 1U2VG 3TWWA 3MV2B 1LTXA 1KT1A 3V2XA 3DXMG 5FQ8A 2XCBA 4WWNA 3HXCA 1Q2ZA 4IRUA 1UN8A 5D0OD 4U0SA 4CDNA 1NZNA 2WXIA 4LNGA 4AOFA 3D9LA 4IYPA 1TR4A 3PZDA 4LUNU 5CCMA 5ENTD 4UWGA 4YDEA 2V8SE 5AIJA 3R7RA 3U9WA 4YNDA 3UINC 5T4YA 1ELKA 1XGWA 2LAIA 4TRQA 2FBNA 5AENA 2VSNA 2WXLA 1OY3D 4FJZA 2V0PA 4WNDA 4ME2A 4L9PA 3UUXA 4KMOA 5G04J 4HB5A 1S64A 2RD0A 4NRHB 4HOUA 2V5FA 2CHWA 5EKQD 2AJAA 1N95A 3FDHA 2DWZA 1TNOA 3LCAA 3ONLA 5AQ7A 3CHOA 4GCNA 4RLYA 1P5QA 4GAAA 4EHMA 4WNGA 2LNIA 4GZCA 1JWGA 4HRMB 2IU1A 3ZRHA 3QC1A 3ZN3A 4JZYA 5HI7A 4O6FA 1Y6IA 4BESA 3QOUA 2XGOA 3PUKA 2H6IA 3DBSA 3D9HA 4A55A 3CGHA 4LSZE 4TV3A 5ITZF 3T5VA 2WPVA 2Y4TA 3HG0D 4CZ2D 1HH8A 1H2TC 5DBKA 2B0OE 3T8MA 4PS7A 5D66A 3ASNE 4CT0A 2R5SA 5CEDB 2AVPA 2PM6A 2Y69E 5ARGA 3ONKA 3SD5A 3RAUA 3SHFA 2H6FA 4U95D 2GRQB 3FTXA 3CHQA 3D9NA 1N4SA 4FU3A 4GA2A 4GZ6A 1OT8A 1RW2A 2IQCA 4DX2A 4DI3A 5C1DA 2L6BA 2P9NG 3DWLG 1U3CA 1TJCA 3L08A 5A23A 2PQNA 3HRAA 1K8KG 2Y3AA 4A63B 2R05A 2XRYA 4B89A 4WNFA 3FUEA 4GTVA 4AM9A 2EIKE 2QC9A 2I1JA 3I4GA 4B93B 1OCZE 4CGWA 1E7UA 3EU9A 3Q9NC 3APDA 4XI9A 4J8SA 4QFVA 3J5PA 2XZDG 5B3SE 3NB2A 1INZA 4LG6A 3ZUVB 4AJWA 4WNEA 2IOLA 2XZTG 2V4LA 3FH7A 3LS8A 4JEHA 3E4BA 4A3VA 5KWDA 3I4RB 3GYZA 4O60A 5CCLA 4JB8P 1N94A 4I1MA 3AS4A 4KZCA 4UI9K 4I6GA 5G55A 3CVQA 2J08A 3ASGA 4KBQA 4FULA 4F1PA 1OWNA 4BX8A 3E33A 3AS8A 4EZKA 3WG7E 4A1GA 3UTMA 4YDYA 5H7PA 2R2LA 4L1BA 4ANUA 1E8ZA 3CQGB 4XI0A 2WVIA 1FT2A 5FWQA 4BTAA 4GMJA 2VSXE 3TWUA 4U8VD 3I5PA 3KEAA 5FINA 1N54A 4C48B 4JD2G 5JJ7A 2BEDA 4YDOA 4PS3A 5B1AE 3APCA 3QB2A 2VGYA 4ABNA 2LAHA 2GRLA 1MYOA 4N3BA 3NF1A 3UX4A 4FA6A 4GZ3A 3FH8A 3RSEG 3RO2A 2RG8A 1TNBA 2R17C 3QWPA 3APFA 5ENRD 2XEVA 3KSQA 5A7DB 1YMPA 3TAXA 4AIFA 2QYUA 1H6OA 1UJJA 3LKUA 4EPZA 3SNXA 2KM4A 1WDYA 4GA1A 2IO3C 2ETCA 3ASHA 3MKRA 3QJZA 1YYHA 2GGFA 5JJTA 3J5QB 3PZ2A 2YQ8A 2MRIA 5T3RA 1SVXA 3RRNB 4J7WA 3KS2A 3CVXA 3AJIA 3HVEB 4YVQC 4EZJA 1MX2A 3CIAA 1MQSA 1O1SA 3BEEA 1DCEA 3B13A 3HDXA 4Y6WA 1NI1A 2OOEA 4K5AB 3EJNA 4WWOA 4EBAG 1ZBPA 4JXTA 3FTYA 3TWTA 3L82A 4TXRA 3UT4A 4DK5A 3SBTB 1KT0A 1H2UA 2P58C 1D8DA 3PZ1A 4TUUA 3PREA 3FU6A 3CR3A 4U0UA 2Y0BG 1V54E 3ISMC 3C98A 3Q47B 3DSXA 4HQDA 5CMWA 2C0MA 1L5JA 3U66A 2H6GA 3D9MA 2UY1B 2VTBA 4GYOA 3MKQA 1FCHA 4H7XA 1TYQG 3FTVA 3ZYKA 3U64A 1MZCA 2EILE 5G04C 3KD7A 2IY0C 4JA7A 2IEJA 3CVUA 4XKBA 2GRRB 5BUZA 5AAOA 2CG2A 5EIDA 4Q69A 2WQ7A 4HRLA 4B94A 3UM1A 3MA5A 3SQVA 2KCKA 5M72A 1X81A 1N4PA 1N52A 2I9CA 2LSUA 3TG5A 4GTOA 5BV1A 4HS2A 1EYHA 1ZU2A 5EIBE 3R9MA 4FC8A 4MKTA 4PUCA 5E75A 3VLDA 1MX4A 2CFZA 5FQ4A 2XS8A 3UT8A 1X5BA 4GPMA 4AP2A 5AJLA 3TL5A 4RG6A 4I17A 1HO8A 4JVSA 2ZISA 3L54A 3E37A 3RJVA 2IFUA 3R9AB 2L0IA 2GRPB 5FZRA 3CHPA 4BEPA 3DEOA 3B7UX 3NQPA 1N11A 5FQ7A 3OXFA 5AN8A 2VSOE 5J08A 2CHZA 5ENSD 3HYMB 1E7VA 4WWPA 2L9BA 4EQFA 3RIBA 2ZGGA 5ENNA 3HXFA 4C0EA 3HVEA 3C5RA 3WXXA 1H6PA 1Z5SC 3FY4A 4ACKA 4FJYA 1S70B 3EDTB 5CEAA 4APFA 3HIZA 3BG1B 5EX0A 2GROB 3NZSA 5JMND 4PH4B 1UG3A 4GTQA 3BG0B 4IULA 2L0TB 4KYOB 3TWQA 4Z68A 3FTUA 4ANWA 4HORA 2YHCA 3IKOB 4BSZB 2P9SG 1MHQA 4L23A 2LO6A 4UWHA 3LDZA 1IYGA 4FHKA 3FUHA 1OWOA 2AXZA 1B89A 4E6HA 1DVPA 3SGHA 5FTPA
chains in the Genus database with same CATH topology
4LNBA 3PZ3A 1FT2A 2ZISA 1TNUA 1TNOA 3E37A 3Q7FA 3HXDA 3E32A 3SFYA 1D8DA 3PZ1A 1O1TA 1NL4A 2BEDA 4YDOA 4EHMA 1SA4A 3DSVA 3DSXA 4GTVA 4GTTA 3DRAA 3Q73A 1TN8A 2H6GA 1O1RA 3E34A 2ZIRA 4MBGA 1LD8A 3HXEA 3HXFA 3SFXA 1N9AA 1TNBA 1MZCA 3DPYA 3DSWA 4GTMA 1SA5A 1LTXA 4GTRA 2IEJA 1JCSA 3DSUA 3KSQA 2H6IA 2F0YA 1JCRA 3HXCA 1LD7A 1N4RA 3PZ4A 4GTPA 1KZPA 3DSTA 1TN6A 1S63A 3C72A 4LNGA 1D8EA 3Q78A 4GTQA 1FPPA 3DSSA 1N94A 1QBQA 1X81A 1N4PA 4YDEA 3Q79A 3EU5A 3PZ2A 3E30A 4GTOA 3HXBA 1TN7A 2H6FA 2H6HA 4GTSA 1KZOA 4L9PA 1TNYA 1TNZA 3KSLA 1FT1A 3Q75A 3Q7AA 3E33A 1S64A 1N4QA 1N4SA 1O1SA 2R2LA 1O5MA 1DCEA 1JCQA 1N95A 3EUVA 1NI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LNB A;  3PZ3 A;  1FT2 A;  2ZIS A;  1TNU A;  1TNO A;  3E37 A;  3Q7F A;  3HXD A;  3E32 A;  3SFY A;  1D8D A;  3PZ1 A;  1O1T A;  1NL4 A;  2BED A;  4YDO A;  4EHM A;  1SA4 A;  3DSV A;  3DSX A;  4GTV A;  4GTT A;  3DRA A;  3Q73 A;  1TN8 A;  2H6G A;  1O1R A;  3E34 A;  2ZIR A;  4MBG A;  1LD8 A;  3HXE A;  3HXF A;  3SFX A;  1N9A A;  1TNB A;  1MZC A;  3DPY A;  3DSW A;  4GTM A;  1SA5 A;  1LTX A;  4GTR A;  2IEJ A;  1JCS A;  3DSU A;  3KSQ A;  2H6I A;  2F0Y A;  1JCR A;  3HXC A;  1LD7 A;  1N4R A;  3PZ4 A;  4GTP A;  1KZP A;  3DST A;  1TN6 A;  1S63 A;  3C72 A;  4LNG A;  1D8E A;  3Q78 A;  4GTQ A;  1FPP A;  3DSS A;  1N94 A;  1QBQ A;  1X81 A;  1N4P A;  4YDE A;  3Q79 A;  3EU5 A;  3PZ2 A;  3E30 A;  4GTO A;  3HXB A;  1TN7 A;  2H6F A;  2H6H A;  4GTS A;  1KZO A;  4L9P A;  1TNY A;  1TNZ A;  3KSL A;  1FT1 A;  3Q75 A;  3Q7A A;  3E33 A;  1S64 A;  1N4Q A;  1N4S A;  1O1S A;  2R2L A;  1O5M A;  1DCE A;  1JCQ A;  1N95 A;  3EUV A;  1NI1 A; 
#chains in the Genus database with same CATH topology
 3IXE A;  3GZ2 A;  3ESK A;  1S0P A;  4G25 A;  3ENE A;  5KNH D;  2XEE A;  5CRU A;  1NL4 A;  1QZ2 A;  3QDN A;  5BPP A;  3LVR E;  3L13 A;  2R02 A;  4N3A A;  2VQ2 A;  3G2U A;  2Y1L E;  3RRU A;  4MRU A;  1HX8 A;  3N71 A;  3F6Q A;  4AVX A;  3DSW A;  3PEV B;  2VTB B;  3T5X A;  2OND A;  4I2W A;  5CEC B;  2ETA A;  3D9I A;  3S7J A;  4BY6 A;  2ZGD A;  1E8W A;  3RKV A;  4RQI A;  2NYJ A;  2X6J A;  5AYW D;  1TN6 A;  3LY7 A;  2ZXW E;  3LJN A;  4OAV B;  5AQB A;  3MGB A;  3PVL A;  1E8Y A;  4I1A A;  4CYM D;  3CVV A;  2LXL A;  3AG2 E;  3JQ0 A;  3JXJ A;  1YA0 A;  3FP3 A;  3OXL A;  4HI9 A;  4RVB A;  2F8X K;  4AXH A;  1PC2 A;  3FUK A;  3EUV A;  3MV3 B;  4FLB A;  2WXG A;  2ILR A;  2NXP A;  3SFZ A;  3FUJ A;  3FUF A;  2QY7 A;  3SO8 A;  4TXP A;  1OWP A;  4EBA A;  3LY8 A;  3OAW A;  1O1T A;  2QFC A;  4TXQ A;  5JJ6 A;  3UPV A;  1JPL A;  3CK7 A;  4NIK A;  3UKR G;  4F1S A;  4HLE A;  2UWJ G;  4Q94 A;  4XKC A;  3E34 A;  1K3Z D;  4X8Q A;  4MBG A;  2ION A;  1LD8 A;  5D0Q D;  1N9A A;  3S2A A;  1AP7 A;  3JCK C;  3CK9 A;  4DLQ A;  1OWM A;  4BT8 A;  4JPS A;  4BFR A;  3Q9U C;  1BI8 B;  4LER A;  3UXG A;  4D10 C;  3CKC A;  4XX5 A;  3CLJ A;  5AQ9 A;  2PNN A;  1IHG A;  2PL2 A;  1ELR A;  3PUJ A;  2KC7 A;  1KLX A;  1NA0 A;  2RKK A;  3KAE A;  1OWL A;  4H7Y A;  2IJG X;  5ARF A;  1TN7 A;  4XZ4 A;  3MKQ B;  3IV0 A;  2E2E A;  2WB2 A;  5BXO A;  3KSL A;  3Q7A A;  1BD8 A;  1PAQ A;  2X3M A;  3FUN A;  3FH5 A;  5G05 J;  4A3T A;  3LEW A;  3QKY A;  3O48 A;  3CHM A;  4M3O A;  2WXK A;  2J4B A;  3FUD A;  2MHK A;  2I2O A;  2XPZ A;  2CFU A;  3FU0 A;  4ILG A;  2WXF A;  2FF4 A;  4YDW A;  4DLO A;  3SZ7 A;  4GTT A;  3W9F A;  4WAF A;  3IHY A;  4UI9 J;  2XHE A;  3D9J A;  3LYA A;  2ETB A;  3TWR A;  3HXE A;  2OCC E;  4ATG A;  3CV0 A;  4QQI A;  3EIJ A;  1IKN D;  4C0M A;  3FFL A;  2BKG A;  3MCX A;  1RZ4 A;  3S7D A;  3EHN A;  3P1U A;  4IN3 B;  2X6F A;  1UJK A;  3QAR A;  5EYL A;  1N4R A;  3CHS A;  1OCR E;  3CKB A;  4KVM A;  2DYR E;  1QYM A;  1BU9 A;  3DSS A;  3ZHE A;  2CHX A;  4G23 A;  2P9P G;  2GRM A;  5ANL A;  4P29 A;  4HOS A;  4JA9 A;  3S7B A;  4BSX A;  5C2Y A;  3ASD A;  1Z3X A;  1JCQ A;  1OXJ A;  1D9S A;  4DRX E;  4I2Z A;  3MJW A;  2KBX A;  3EHQ A;  3PZ3 A;  3CQC B;  3TWV A;  2DZO A;  4APO A;  4GYW A;  5BW8 C;  2RFA A;  2J09 A;  4ILH B;  3GW4 A;  5JHA A;  3DSV A;  4U96 D;  5KBA A;  2GRN B;  1A5E A;  3JUI A;  4BET A;  4UQZ A;  1E8X A;  2EIN E;  4N5Q A;  3UMV A;  3V30 A;  4L2Y A;  4I43 A;  2B6C A;  3SF4 A;  4G8L A;  3ESL A;  3CVP A;  4RG9 A;  4HOQ A;  1UW4 B;  2HE0 A;  3ABL E;  3GZS A;  4NAC A;  3AS5 A;  4DX7 D;  1JCR A;  5LCW J;  3RU0 A;  2AW6 A;  4K0R A;  5EX3 A;  1H2V C;  2WM9 A;  3DST A;  3Q49 B;  4KXK B;  3CST A;  3NZU A;  2EQX A;  3CVN A;  1D8E A;  4BTB A;  3ML8 A;  2YNQ A;  2I6H A;  4U7E B;  3TXM A;  2WXJ A;  1IQU A;  2VSY A;  3Q79 A;  1VDY A;  1SZA A;  2F8Y A;  5FZS A;  4M7C A;  3E30 A;  1WY6 A;  1YCS B;  3OTN A;  3QNK A;  5T8I A;  3LXU X;  3ZXS A;  4A1S A;  4AV7 A;  2WXP A;  1FT1 A;  3ULY A;  2MOW A;  4FHJ A;  2XCC A;  3VLE A;  1SW6 A;  4FP7 A;  1DC2 A;  4J0U A;  3AU4 A;  1HG2 A;  5ANR A;  3Q4A B;  2VGX A;  1H6K A;  2A4Z A;  3BQO A;  3E32 A;  4N39 A;  4HI8 A;  2X6I A;  3TWX A;  2DCP A;  4DPR A;  1H0A A;  4OVV A;  2XQ0 A;  2Y4U A;  2C2L A;  3C3R A;  2KCL A;  2KXP C;  3X2Q E;  5EIL A;  5CBN A;  4JC8 A;  1TN8 A;  4GA0 A;  3G2W A;  4AY5 A;  5LFA A;  3RK6 A;  4F6R D;  2P9K G;  4UI9 C;  3T8K A;  1H19 A;  5CRV A;  4O1O A;  3V79 K;  3IBE A;  3VTY A;  1HG5 A;  4BX9 A;  1KZP A;  2WQH A;  4U8Y D;  4ILI A;  3I3N A;  4FLH A;  1OCO E;  1SQM A;  2X38 A;  4RSY A;  1K1B A;  2JAB A;  2V5Q C;  5LOZ A;  3SI5 A;  3B7B A;  5EDS A;  3C3Q A;  3OXG A;  4J8F A;  1AWC B;  4MLP A;  4EEC A;  4G1T A;  5G05 C;  3D9K A;  4XEI G;  3ML9 A;  4GML A;  2H6H A;  2J49 A;  5HQ8 A;  4GU5 A;  1JWF A;  2LUH A;  2OVB A;  5BV0 A;  3ZKJ A;  2XGS A;  1O5M A;  4NUR A;  3W9G A;  4PDX A;  3MYV A;  4UWL A;  3ZW3 A;  4LNB A;  3CEQ A;  4O1P A;  4GZ5 A;  3NBN B;  1IXV A;  3CVY A;  3JXI A;  1UN9 A;  3ASF A;  4OVU A;  1LF8 A;  2WXO A;  4AEZ C;  2EIJ E;  3ASO E;  2E0I A;  4R7L A;  2CG3 A;  1DCQ A;  1SA4 A;  3PNL B;  4GB9 A;  2M63 A;  4BWR A;  4K03 A;  3ZFW A;  4UWF A;  1HFA A;  4N2Q A;  4OYS A;  3SFX A;  2JEK A;  3TWS A;  2WQ6 A;  4XE0 A;  2LSV A;  4G2V A;  2YHE A;  1DNP A;  4PS8 A;  4U07 A;  1LD7 A;  4CCA A;  2KZT A;  3CK8 A;  5B1B E;  3DEP A;  2FO7 A;  5EN5 D;  5LP0 A;  1WG0 A;  4KT6 B;  2DZN A;  2F37 A;  4E85 A;  3U4T A;  1Y8M A;  1QNF A;  3P2B A;  3KEZ A;  3ZGQ A;  2XEH A;  4HBD A;  4HXI A;  5A6C A;  4JHJ A;  2J9Q A;  1TNZ A;  1WAO 1;  3MZL B;  4MS6 A;  4CDM A;  1NP7 A;  3ULQ A;  4I9E A;  3QWV A;  2RFM A;  3PH0 C;  1FVF A;  4HRN A;  5IY5 E;  3G2V A;  4G8K A;  4CRW A;  4F3V A;  1TNU A;  2DBA A;  3Q7F A;  5KJN A;  1TEZ A;  4OAU C;  3V31 A;  4ACL A;  3ZNG A;  1E96 B;  3JYS A;  3FTS A;  4CT4 A;  1OCC E;  3D3M A;  1TJF A;  5KJL A;  2A5E A;  3V2O A;  2C0L A;  4I9C A;  1HXI A;  4KZ0 A;  2OVF A;  5BNW A;  4I6J A;  4GZD A;  3AG3 E;  3DRA A;  3Q73 A;  4K5B A;  3FEY A;  3R7Q A;  3L22 A;  3U3W A;  2X6K A;  2P9I G;  1KPS B;  5KJM A;  5FZQ A;  2NSZ A;  4GTM A;  5EYP F;  1SA5 A;  3FUI A;  4GTR A;  3AG4 E;  3FHE A;  3RRM B;  1JUQ A;  4J8E A;  4L7T A;  4U8H A;  4DX6 D;  4UWK A;  1HE8 A;  3Q5M A;  3UT7 A;  5LCW C;  5FT9 A;  3TGO A;  2NC9 A;  3PE3 A;  1S63 A;  2KZT B;  5FIO A;  3SBS A;  4UQY A;  1QQE A;  1FPP A;  2FEZ A;  4CDR A;  3EHR A;  5HS0 A;  3TXN A;  2J8S D;  3O4Z A;  3LY9 A;  3VTX A;  3UM2 A;  5CER B;  3K9I A;  3ABM E;  3RO3 A;  4FAD A;  4B8C B;  5HKP A;  4HVB A;  3HHM A;  1XNF A;  3JQ1 A;  2OEW A;  4GTS A;  3LVQ E;  1KZO A;  4B0Z A;  4DJA A;  4GYY A;  3UIP C;  4B8A A;  5AAR A;  3C3O A;  5ENP D;  3Q75 A;  1HS6 A;  2WXR A;  4ANX A;  3ULE G;  1HZ4 A;  2BUG A;  3D9P A;  5BXU A;  3EIQ C;  2XPI A;  2IF4 A;  3IEG A;  5KNG A;  4DX1 A;  3DXK G;  4G24 A;  1GW6 A;  2R59 A;  1PY1 A;  1ZB1 A;  4URK A;  3CHR A;  1WM5 A;  1HF8 A;  3L6A A;  5KJK A;  4J8Y A;  3B7S A;  4UUC A;  4HLL A;  3FU5 A;  4ANV A;  2EIM E;  2P9U G;  1G3N B;  2ZU6 B;  2V4H C;  2ZIR A;  4LRZ A;  4DUI A;  2HR2 A;  3DPY A;  4XIF A;  3IHV A;  2KCV A;  3CSF A;  4JW1 A;  4J6I A;  1NFI E;  2WMO A;  1HU3 A;  3ZYQ A;  3ZU7 B;  4GTP A;  2MYO A;  3JUE A;  4U0Z A;  2R03 A;  3VLF A;  3L17 A;  1U3D A;  4U63 A;  3SY2 A;  5AQA A;  3EU5 A;  1BPO A;  4U04 A;  3PDN A;  3URZ A;  2VJ8 A;  5ENO D;  2I1K A;  4NQ0 A;  1MJ0 A;  1W3B A;  3UQ3 A;  1TNY A;  4JHR A;  5CHE E;  1EF1 C;  4N3C A;  2KAT A;  3FUM A;  3S7F A;  2VYI A;  1N4Q A;  4JHK A;  5D2M C;  4I1O B;  4K5C A;  1V55 E;  4DX5 D;  2HM8 A;  4DI4 A;  2QZA A;  4L2L A;  5DIZ A;  3ZPJ A;  1SZ9 A;  1EPU A;  3AG1 E;  4W9R A;  3PE4 A;  2AXU A;  5J90 A;  3PNT B;  2XS1 A;  3BUA A;  3AAA C;  3L9T A;  4CGV A;  4C9B B;  3PEU B;  2DVW A;  4BER A;  3TJP A;  4AY6 A;  3QWW A;  3NOG D;  1OUV A;  1UOH A;  3FUL A;  3D9O A;  4WUY A;  2Q7F A;  3FTW A;  3MX3 A;  2GW1 A;  4BT9 A;  3LJ3 A;  4JEU A;  3ZEF A;  1JCS A;  3DSU A;  2P2C P;  3UIO C;  2JLB A;  4HOT A;  1FVH A;  5JA4 D;  3PZ4 A;  1K1A A;  2VGX B;  4Y6C A;  4CEM A;  3C72 A;  3BU8 A;  4G26 A;  4YVO A;  4JL0 A;  2HO1 A;  1QBQ A;  1BLX B;  2PM7 A;  3QAQ A;  1Z3Y A;  3UI2 A;  2YIN A;  2AXV A;  1E90 A;  3ZYL A;  3HXB A;  3TG4 A;  3PRZ A;  1IHB A;  4ZHB A;  3UM3 A;  4ATZ D;  3MEK A;  2WMN A;  4J8D A;  2HYZ A;  2LXM A;  4LCT A;  2A5U A;  3ZXP A;  3B95 A;  2WXH A;  3UM0 A;  3QK0 A;  3FWV A;  1N0R A;  2PQR A;  2WXM A;  5JHB A;  1MX6 A;  4V3I A;  3UKU G;  3ZVV A;  3FEX A;  1BI7 B;  3NAW A;  5CBO A;  2XGM A;  4F53 A;  2OV8 A;  2DIW A;  5FJY A;  2XRZ A;  2FO1 E;  1A17 A;  3B7T A;  1IQR A;  5LX8 A;  4ZFH A;  2X6H A;  4GPK A;  4G11 A;  3G2T A;  2P9L G;  4HNA D;  4TUM A;  1NA3 A;  5FQ6 A;  3ZYM A;  2FUL A;  2J4D A;  5G2N A;  4HFG A;  3ZIM A;  2WXQ A;  2F0Y A;  5KCM A;  3L16 A;  3B7R L;  2DYS E;  3G2S A;  4EZL A;  2VGE A;  2XEN A;  2BF0 X;  3Q78 A;  2PZI A;  4GMR A;  1ELW A;  4LEU A;  2L6J A;  5HRY A;  4Q96 A;  4F7A A;  3AU5 A;  5BT1 A;  4UQX A;  4GCO A;  2UY1 A;  3T9K A;  5AJD A;  2IO2 C;  1EDU A;  3ABK E;  3CVW A;  3FTZ A;  2J07 A;  3ZHE B;  3FU3 A;  4N2S A;  1N0Q A;  3GZ1 A;  2WXN A;  5ENQ D;  2BTD A;  3Q15 A;  2FI7 A;  3NOC D;  3HXD A;  3EHM A;  3SFY A;  4KVO A;  2OEV A;  3CVL A;  3PS6 A;  2XPY A;  2IOS A;  2QYJ A;  5E76 A;  4LNU D;  2BKK B;  4I6E A;  3DPD A;  4N5C A;  1O1R A;  2AWI A;  3LPZ A;  5CMY A;  1Z6T A;  1U2V G;  3TWW A;  3MV2 B;  1LTX A;  1KT1 A;  3V2X A;  3DXM G;  5FQ8 A;  2XCB A;  4WWN A;  3HXC A;  1Q2Z A;  4IRU A;  1UN8 A;  5D0O D;  4U0S A;  4CDN A;  1NZN A;  2WXI A;  4LNG A;  4AOF A;  3D9L A;  4IYP A;  1TR4 A;  3PZD A;  4LUN U;  5CCM A;  5ENT D;  4UWG A;  4YDE A;  2V8S E;  5AIJ A;  3R7R A;  3U9W A;  4YND A;  3UIN C;  5T4Y A;  1ELK A;  1XGW A;  2LAI A;  4TRQ A;  2FBN A;  5AEN A;  2VSN A;  2WXL A;  1OY3 D;  4FJZ A;  2V0P A;  4WND A;  4ME2 A;  4L9P A;  3UUX A;  4KMO A;  5G04 J;  4HB5 A;  1S64 A;  2RD0 A;  4NRH B;  4HOU A;  2V5F A;  2CHW A;  5EKQ D;  2AJA A;  1N95 A;  3FDH A;  2DWZ A;  1TNO A;  3LCA A;  3ONL A;  5AQ7 A;  3CHO A;  4GCN A;  4RLY A;  1P5Q A;  4GAA A;  4EHM A;  4WNG A;  2LNI A;  4GZC A;  1JWG A;  4HRM B;  2IU1 A;  3ZRH A;  3QC1 A;  3ZN3 A;  4JZY A;  5HI7 A;  4O6F A;  1Y6I A;  4BES A;  3QOU A;  2XGO A;  3PUK A;  2H6I A;  3DBS A;  3D9H A;  4A55 A;  3CGH A;  4LSZ E;  4TV3 A;  5ITZ F;  3T5V A;  2WPV A;  2Y4T A;  3HG0 D;  4CZ2 D;  1HH8 A;  1H2T C;  5DBK A;  2B0O E;  3T8M A;  4PS7 A;  5D66 A;  3ASN E;  4CT0 A;  2R5S A;  5CED B;  2AVP A;  2PM6 A;  2Y69 E;  5ARG A;  3ONK A;  3SD5 A;  3RAU A;  3SHF A;  2H6F A;  4U95 D;  2GRQ B;  3FTX A;  3CHQ A;  3D9N A;  1N4S A;  4FU3 A;  4GA2 A;  4GZ6 A;  1OT8 A;  1RW2 A;  2IQC A;  4DX2 A;  4DI3 A;  5C1D A;  2L6B A;  2P9N G;  3DWL G;  1U3C A;  1TJC A;  3L08 A;  5A23 A;  2PQN A;  3HRA A;  1K8K G;  2Y3A A;  4A63 B;  2R05 A;  2XRY A;  4B89 A;  4WNF A;  3FUE A;  4GTV A;  4AM9 A;  2EIK E;  2QC9 A;  2I1J A;  3I4G A;  4B93 B;  1OCZ E;  4CGW A;  1E7U A;  3EU9 A;  3Q9N C;  3APD A;  4XI9 A;  4J8S A;  4QFV A;  3J5P A;  2XZD G;  5B3S E;  3NB2 A;  1INZ A;  4LG6 A;  3ZUV B;  4AJW A;  4WNE A;  2IOL A;  2XZT G;  2V4L A;  3FH7 A;  3LS8 A;  4JEH A;  3E4B A;  4A3V A;  5KWD A;  3I4R B;  3GYZ A;  4O60 A;  5CCL A;  4JB8 P;  1N94 A;  4I1M A;  3AS4 A;  4KZC A;  4UI9 K;  4I6G A;  5G55 A;  3CVQ A;  2J08 A;  3ASG A;  4KBQ A;  4FUL A;  4F1P A;  1OWN A;  4BX8 A;  3E33 A;  3AS8 A;  4EZK A;  3WG7 E;  4A1G A;  3UTM A;  4YDY A;  5H7P A;  2R2L A;  4L1B A;  4ANU A;  1E8Z A;  3CQG B;  4XI0 A;  2WVI A;  1FT2 A;  5FWQ A;  4BTA A;  4GMJ A;  2VSX E;  3TWU A;  4U8V D;  3I5P A;  3KEA A;  5FIN A;  1N54 A;  4C48 B;  4JD2 G;  5JJ7 A;  2BED A;  4YDO A;  4PS3 A;  5B1A E;  3APC A;  3QB2 A;  2VGY A;  4ABN A;  2LAH A;  2GRL A;  1MYO A;  4N3B A;  3NF1 A;  3UX4 A;  4FA6 A;  4GZ3 A;  3FH8 A;  3RSE G;  3RO2 A;  2RG8 A;  1TNB A;  2R17 C;  3QWP A;  3APF A;  5ENR D;  2XEV A;  3KSQ A;  5A7D B;  1YMP A;  3TAX A;  4AIF A;  2QYU A;  1H6O A;  1UJJ A;  3LKU A;  4EPZ A;  3SNX A;  2KM4 A;  1WDY A;  4GA1 A;  2IO3 C;  2ETC A;  3ASH A;  3MKR A;  3QJZ A;  1YYH A;  2GGF A;  5JJT A;  3J5Q B;  3PZ2 A;  2YQ8 A;  2MRI A;  5T3R A;  1SVX A;  3RRN B;  4J7W A;  3KS2 A;  3CVX A;  3AJI A;  3HVE B;  4YVQ C;  4EZJ A;  1MX2 A;  3CIA A;  1MQS A;  1O1S A;  3BEE A;  1DCE A;  3B13 A;  3HDX A;  4Y6W A;  1NI1 A;  2OOE A;  4K5A B;  3EJN A;  4WWO A;  4EBA G;  1ZBP A;  4JXT A;  3FTY A;  3TWT A;  3L82 A;  4TXR A;  3UT4 A;  4DK5 A;  3SBT B;  1KT0 A;  1H2U A;  2P58 C;  1D8D A;  3PZ1 A;  4TUU A;  3PRE A;  3FU6 A;  3CR3 A;  4U0U A;  2Y0B G;  1V54 E;  3ISM C;  3C98 A;  3Q47 B;  3DSX A;  4HQD A;  5CMW A;  2C0M A;  1L5J A;  3U66 A;  2H6G A;  3D9M A;  2UY1 B;  2VTB A;  4GYO A;  3MKQ A;  1FCH A;  4H7X A;  1TYQ G;  3FTV A;  3ZYK A;  3U64 A;  1MZC A;  2EIL E;  5G04 C;  3KD7 A;  2IY0 C;  4JA7 A;  2IEJ A;  3CVU A;  4XKB A;  2GRR B;  5BUZ A;  5AAO A;  2CG2 A;  5EID A;  4Q69 A;  2WQ7 A;  4HRL A;  4B94 A;  3UM1 A;  3MA5 A;  3SQV A;  2KCK A;  5M72 A;  1X81 A;  1N4P A;  1N52 A;  2I9C A;  2LSU A;  3TG5 A;  4GTO A;  5BV1 A;  4HS2 A;  1EYH A;  1ZU2 A;  5EIB E;  3R9M A;  4FC8 A;  4MKT A;  4PUC A;  5E75 A;  3VLD A;  1MX4 A;  2CFZ A;  5FQ4 A;  2XS8 A;  3UT8 A;  1X5B A;  4GPM A;  4AP2 A;  5AJL A;  3TL5 A;  4RG6 A;  4I17 A;  1HO8 A;  4JVS A;  2ZIS A;  3L54 A;  3E37 A;  3RJV A;  2IFU A;  3R9A B;  2L0I A;  2GRP B;  5FZR A;  3CHP A;  4BEP A;  3DEO A;  3B7U X;  3NQP A;  1N11 A;  5FQ7 A;  3OXF A;  5AN8 A;  2VSO E;  5J08 A;  2CHZ A;  5ENS D;  3HYM B;  1E7V A;  4WWP A;  2L9B A;  4EQF A;  3RIB A;  2ZGG A;  5ENN A;  3HXF A;  4C0E A;  3HVE A;  3C5R A;  3WXX A;  1H6P A;  1Z5S C;  3FY4 A;  4ACK A;  4FJY A;  1S70 B;  3EDT B;  5CEA A;  4APF A;  3HIZ A;  3BG1 B;  5EX0 A;  2GRO B;  3NZS A;  5JMN D;  4PH4 B;  1UG3 A;  4GTQ A;  3BG0 B;  4IUL A;  2L0T B;  4KYO B;  3TWQ A;  4Z68 A;  3FTU A;  4ANW A;  4HOR A;  2YHC A;  3IKO B;  4BSZ B;  2P9S G;  1MHQ A;  4L23 A;  2LO6 A;  4UWH A;  3LDZ A;  1IYG A;  4FHK A;  3FUH A;  1OWO A;  2AXZ A;  1B89 A;  4E6H A;  1DVP A;  3SGH A;  5FTP A; 
#chains in the Genus database with same CATH homology
 4LNB A;  3PZ3 A;  1FT2 A;  2ZIS A;  1TNU A;  1TNO A;  3E37 A;  3Q7F A;  3HXD A;  3E32 A;  3SFY A;  1D8D A;  3PZ1 A;  1O1T A;  1NL4 A;  2BED A;  4YDO A;  4EHM A;  1SA4 A;  3DSV A;  3DSX A;  4GTV A;  4GTT A;  3DRA A;  3Q73 A;  1TN8 A;  2H6G A;  1O1R A;  3E34 A;  2ZIR A;  4MBG A;  1LD8 A;  3HXE A;  3HXF A;  3SFX A;  1N9A A;  1TNB A;  1MZC A;  3DPY A;  3DSW A;  4GTM A;  1SA5 A;  1LTX A;  4GTR A;  2IEJ A;  1JCS A;  3DSU A;  3KSQ A;  2H6I A;  2F0Y A;  1JCR A;  3HXC A;  1LD7 A;  1N4R A;  3PZ4 A;  4GTP A;  1KZP A;  3DST A;  1TN6 A;  1S63 A;  3C72 A;  4LNG A;  1D8E A;  3Q78 A;  4GTQ A;  1FPP A;  3DSS A;  1N94 A;  1QBQ A;  1X81 A;  1N4P A;  4YDE A;  3Q79 A;  3EU5 A;  3PZ2 A;  3E30 A;  4GTO A;  3HXB A;  1TN7 A;  2H6F A;  2H6H A;  4GTS A;  1KZO A;  4L9P A;  1TNY A;  1TNZ A;  3KSL A;  1FT1 A;  3Q75 A;  3Q7A A;  3E33 A;  1S64 A;  1N4Q A;  1N4S A;  1O1S A;  2R2L A;  1O5M A;  1DCE A;  1JCQ A;  1N95 A;  3EUV A;  1NI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...