1JUQA

Gga3 vhs domain complexed with c-terminal peptide from cation-dependent mannose 6-phosphate receptor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
151
structure length
151
Chain Sequence
ESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA3
publication title Structural basis for acidic-cluster-dileucine sorting-signal recognition by VHS domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 49
structure length 151
sequence length 151
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1juqA00
1MHQA 1HF8A 5CMYA 2DCPA 2L0IA 3ONKA 3ZYKA 3D9NA 4FLBA 2V8SE 3LDZA 4AVXA 3D9IA 3D9OA 1SZ9A 2BF0X 2MOWA 4GZDA 3RRUA 1H0AA 1XGWA 3ZYQA 3CLJA 4FU3A 1LF8A 5LP0A 1UJKA 3G2WA 1VDYA 1X5BA 2QY7A 3D9KA 3D9LA 1JPLA 3ZYLA 1HFAA 1HX8A 3ONLA 5J08A 5LOZA 2DIWA 1INZA 3G2VA 3D9JA 2KM4A 4GZCA 3D9PA 5CMWA 1EDUA 1UJJA 3D9MA 1PY1A 1JUQA 4Q96A 3G2UA 1ELKA 1DVPA 2LO6A 2L0TB 3ZYMA 1HG5A 3G2SA 3G2TA 4JXTA 1JWGA 4NACA 1JWFA 4Q94A 1EYHA 1SZAA 1HG2A 4HFGA
chains in the Genus database with same CATH superfamily
2RG8A 4CDRA 2CG3A 5EX0A 4JZYA 5LP0A 1P5QA 2OV8A 5A23A 3BEEA 1EDUA 3SBTB 1PC2A 1OWNA 2FEZA 4PDXA 3Q4AB 4I2ZA 3CVXA 1TN6A 1LTXA 4GYWA 2LSUA 4FU3A 4KZCA 3EHRA 4OYSA 2EIJE 3UT4A 3CVWA 3E4BA 3RKVA 4BY6A 4ACLA 1DNPA 2X3MA 3SFZA 3U9WA 5LCWJ 1Z6TA 5CRVA 2DCPA 4F3VA 5B3SE 3ZIMA 3KSQA 3JUEA 3LEWA 3S7FA 3IXEA 1UJJA 3X2QE 3Q5MA 2ZU6B 3DSWA 3B7SA 3ENEA 2VSNA 1TNOA 4B8AA 2I2OA 4XX5A 3ZW3A 3ZRHA 3OXFA 3DEPA 5AQ9A 4WWPA 2WXMA 2R59A 3UQ3A 4AY6A 3ZKJA 1FVHA 4A3VA 1FT1A 4V3IA 2WXKA 4KBQA 4BT9A 3SD5A 5AENA 4HNAD 4FA6A 2WXIA 4R7LA 1UJKA 4UQXA 4DPRA 4ILGA 3B7RL 1OCRE 3E33A 4N2SA 2VGXB 4Z68A 2P9IG 4XI0A 3FUMA 4MBGA 5CERB 2FO7A 2J09A 3L16A 3B95A 4NIKA 1DCEA 3AG3E 4GZCA 1TJCA 2WXNA 5B1BE 3SBSA 3T9KA 4B93B 1JUQA 4PUCA 3DWLG 3LYAA 3HHMA 2VYIA 1YMPA 5BXUA 3CVVA 3L82A 3LDZA 4NQ0A 4HB5A 4LG6A 3CV0A 1E7VA 3ZYQA 3CLJA 1ZBPA 2WXPA 1N52A 2VGXA 2OVBA 4FHJA 3JXJA 4KXKB 2M63A 5LCWC 1O1SA 1QBQA 4GTMA 2I1KA 3ZEFA 3ASNE 1OCCE 2ZXWE 3UX4A 2V5FA 3Q73A 2WQHA 4N39A 4LNUD 3CEQA 5E75A 1ELKA 3MCXA 3NOGD 2XRZA 4UWFA 2EINE 3AS8A 2VSOE 3FUFA 3MYVA 1WY6A 3FUNA 2KCKA 3HDXA 3IV0A 3JQ0A 3ULEG 4L7TA 3FUEA 3L54A 5DBKA 2ETBA 4DX1A 2WXJA 1IYGA 2XS1A 4LUNU 2P9UG 2V5QC 4E85A 2XPYA 3FEXA 1V54E 2JLBA 4AVXA 3LPZA 4EZLA 3ZHEB 3QNKA 3ABKE 3RO3A 3RJVA 3WG7E 1MZCA 4I6EA 4BWRA 3J5PA 3FH8A 3RSEG 1DVPA 2RKKA 1H6KA 2GRLA 4G24A 4APFA 2YHEA 4N3AA 5G05C 3UT7A 3ASOE 4GMRA 3Q49B 2WXQA 3QARA 1ELWA 1TNUA 3ZPJA 2KZTA 4G8LA 4O1OA 1N4SA 5KJKA 4RLYA 1EYHA 4I17A 4GA2A 3GZSA 3EHQA 2WXOA 2XZDG 1SZ9A 5BV0A 4EBAG 3ZYLA 4GTVA 3LKUA 2AWIA 2P58C 1PY1A 3UIOC 5EKQD 3I4RB 2OEWA 3UMVA 4XEIG 4FHKA 3CVYA 3OAWA 5AQ7A 1TNZA 5AJDA 4TXPA 4O1PA 1MX4A 3ABME 1E8WA 3FWVA 1LD8A 3L17A 4OAVB 3Q7FA 2PQNA 4XIFA 2EIME 3TWWA 4HBDA 2E0IA 3L6AA 2HR2A 2XENA 3D9KA 3PVLA 5ARFA 3CHRA 4EPZA 3ONLA 4GTPA 5T3RA 4FJZA 4JD2G 4ANXA 1K3ZD 2QYUA 3PZ1A 1S63A 4KT6B 3E34A 3SFXA 1NI1A 3GZ2A 3UT8A 3S7JA 3CHPA 1NFIE 4H7YA 4GZ5A 4B0ZA 3UKRG 2BKGA 4RVBA 3DXKG 5ENNA 3S7DA 5C2YA 4IYPA 2IU1A 3ZYMA 1AWCB 4RSYA 4FP7A 4WNEA 3Q7AA 3QWWA 2QZAA 3KEZA 5CEAA 3UM0A 1H0AA 5FTPA 3G2WA 3HXFA 3FUKA 4LNBA 3MKQB 3TWRA 4KMOA 4TRQA 2KCLA 5KJLA 3LY9A 2B0OE 3FUJA 4I1OB 1WM5A 4AXHA 1YA0A 2ETAA 3BG0B 2UY1A 4PH4B 2JABA 3NF1A 4I6JA 3W9GA 5CCMA 2FBNA 1E8ZA 4U8YD 4DI4A 4L23A 2GRPB 2LXMA 5BV1A 4HVBA 3PE4A 4GCOA 1MQSA 4H7XA 3MKQA 4W9RA 4F1SA 3D9OA 2GRNB 4JEHA 3RK6A 4AM9A 5FJYA 4EZJA 3R9MA 2OOEA 4JA9A 2PZIA 1D9SA 2J4DA 4BTBA 2QC9A 2KC7A 2BKKB 3MZLB 1G3NB 4FC8A 3P2BA 1EF1C 4ATGA 1LD7A 1RZ4A 3JQ1A 4IN3B 1BI8B 1TNBA 3N71A 2ILRA 4G11A 1NZNA 3I4GA 3CQGB 3QJZA 4GYYA 5BPPA 2R02A 4JB8P 2IJGX 4JHRA 3MKRA 3FH5A 3Q78A 4DX2A 5JJTA 2LNIA 3EUVA 4GCNA 3ZUVB 5AQAA 2VGYA 3UIPC 4N2QA 5A6CA 4NURA 4KVMA 3UM3A 1PAQA 4GA0A 4MLPA 5JJ7A 2AXVA 3NZUA 3RRNB 2A4ZA 3FTXA 1OY3D 3LJ3A 2Y3AA 4HOUA 4G8KA 3UINC 1H6PA 2Y1LE 3FULA 1JPLA 2VTBA 4L2YA 3QWVA 1SA5A 3VTYA 4Y6CA 2ZISA 4MS6A 2WXGA 4U8HA 4HI9A 3DXMG 4QQIA 2J4BA 3QC1A 2H6HA 4FLBA 4DJAA 3Q15A 3MGBA 1OWPA 1X5BA 3CVQA 3URZA 5JHAA 4N5QA 5EILA 3ZXSA 3TXMA 4GZ6A 4YVQC 4U0UA 4N3BA 3G2TA 1U3DA 4I1AA 3TXNA 1SZAA 1H2VC 3LVRE 1HZ4A 2YQ8A 5EN5D 1SVXA 4EBAA 3TG5A 3CHOA 3V2OA 2L6JA 4HOQA 4F53A 3PZ2A 3NZSA 3SY2A 3CHMA 4AIFA 4M7CA 1N54A 3CK8A 3L13A 2XRYA 1FT2A 1IHBA 3IHVA 5HRYA 4A3TA 1KZOA 3HXEA 3FP3A 3V2XA 4G2VA 4KYOB 4CYMD 3UUXA 3DSTA 2P9KG 1UN9A 3DSSA 3HVEB 4LCTA 4K0RA 3AJIA 4GYOA 4B94A 4TXRA 5G2NA 1IQUA 4UI9J 3ZFWA 3RIBA 4GTOA 3AG2E 3CK9A 2DYSE 4HRMB 3R7RA 1AP7A 4LRZA 3APFA 5M72A 3OXLA 4P29A 1FPPA 3FH7A 3SFYA 3PRZA 3EJNA 3UXGA 1HS6A 4N5CA 4HRNA 2DYRE 1LF8A 1VDYA 1HO8A 5CHEE 3VLFA 5G55A 1D8EA 4GTQA 3IBEA 5FWQA 4TV3A 5T4YA 4JW1A 2AJAA 3L22A 3AS5A 4U95D 2DWZA 2VSYA 2A5UA 2CFZA 3VLDA 4YDOA 3AS4A 2ETCA 2NXPA 1JCSA 3D9LA 5G05J 2XPIA 4UWGA 2RD0A 2IOLA 2EIKE 1KT1A 2CHXA 3T8KA 4BTAA 2LO6A 3HRAA 3T5VA 2GROB 2GGFA 4U63A 2WMOA 4B89A 2KXPC 3NBNB 3BG1B 5DIZA 3RRMB 4A63B 5BUZA 2P9NG 3FTVA 5FIOA 2AXUA 1YCSB 4CDNA 3DRAA 3PNLB 4Q94A 4JC8A 1N9AA 4LERA 3DBSA 3U4TA 1E7UA 4KVOA 3RAUA 3HXDA 2QFCA 3D9HA 3D3MA 2C2LA 4YDWA 3J5QB 3PUKA 2X6KA 5ENOD 4AJWA 5HI7A 4K5AB 4BSZB 1UW4B 2PQRA 3I5PA 3C72A 3NOCD 3SO8A 4OVUA 1IXVA 4UI9C 5ARGA 3CHSA 4XKBA 2Y69E 5CMWA 2V4LA 5FQ6A 4F1PA 3QOUA 4M3OA 4O60A 3VTXA 3ZYKA 3B7UX 1XNFA 2DZOA 3FDHA 3V30A 2WXLA 2YHCA 5FQ7A 4BX8A 2IFUA 4GTTA 3SF4A 2CFUA 1A17A 5KJNA 2OCCE 3HYMB 4F7AA 4OVVA 4NACA 3DEOA 1E8XA 2WM9A 3APCA 3FFLA 2ZGDA 5BW8C 3CQCB 4XE0A 3MEKA 1QZ2A 3NQPA 4GZ3A 2FULA 5JMND 5CBOA 5C1DA 1JCRA 3ESLA 1RW2A 3ZHEA 4WAFA 2WXFA 4JA7A 4J8FA 1TN7A 4DX7D 2XCBA 3EDTB 4GTSA 1B89A 1FVFA 4BERA 1KPSB 2MOWA 4YDYA 3FU0A 5FQ4A 1E8YA 3TG4A 2XGMA 1N4RA 2OEVA 4DX6D 4JPSA 1D8DA 2WPVA 4WWNA 3FU5A 4JHKA 3PZ4A 4ACKA 4O6FA 1BLXB 4CGWA 2VSXE 4C0MA 2DBAA 2HM8A 1NA3A 4K5BA 4YNDA 4BX9A 1TN8A 3QB2A 2P9LG 3CIAA 1TJFA 1MX6A 4GAAA 3DPDA 2WMNA 1IHGA 4J7WA 1Y6IA 5LX8A 1MX2A 5AJLA 4ZHBA 2J49A 4WNGA 3Q47B 3CHQA 1N0RA 3HG0D 3MV3B 3C98A 3OXGA 4HFGA 4IRUA 5HS0A 3V79K 3HIZA 3CVLA 3DPYA 3AU5A 4L1BA 2F8XK 3PDNA 4HS2A 4RG9A 2I6HA 3FU6A 3WXXA 4GMJA 2LSVA 3GW4A 3ASHA 5LFAA 3RO2A 2XHEA 3ZU7B 4ANUA 4XKCA 1O1TA 2C0MA 4GTRA 4UWKA 4OAUC 4CRWA 3ULYA 3TWXA 4GPMA 2ZIRA 2QY7A 3L9TA 2KATA 4BETA 4WNDA 1K1AA 2QYJA 3TWUA 4A55A 2GRRB 4LSZE 2LAIA 2R05A 3ZXPA 3K9IA 4HI8A 4FULA 3E30A 1S0PA 4CT4A 2R5SA 1NP7A 5G04C 1OCZE 1HU3A 1O5MA 2WB2A 3D9MA 4DRXE 3ONKA 4EZKA 3EHNA 3C3QA 3PREA 1HX8A 1N94A 3KD7A 3AU4A 4HQDA 1NA0A 3SQVA 2V0PA 4J8YA 5EYPF 4BT8A 1MYOA 4CZ2D 2BF0X 2X38A 2MRIA 5CECB 1K1BA 3PE3A 4CEMA 1ZU2A 2F0YA 3EHMA 2DZNA 4ME2A 3F6QA 1OWOA 2XZTG 1TR4A 4NRHB 5AAOA 5EYLA 1A5EA 4ILIA 5ENQD 3Q75A 2IO2C 2CHWA 3LXUX 1QYMA 2WQ7A 3MA5A 3TGOA 1E96B 3B7BA 2B6CA 3PS6A 2R03A 1S70B 5BXOA 3LY7A 3ZN3A 4ANVA 3CVPA 4JXTA 3R7QA 4GPKA 4AEZC 2WQ6A 4U04A 3FTUA 2X6JA 2LUHA 3FTZA 3KAEA 3TJPA 2BTDA 3W9FA 5KBAA 3TAXA 1JWGA 3C3OA 3FEYA 1OWLA 3ASFA 1X81A 2OVFA 3TWVA 1MJ0A 3KSLA 2WVIA 3O4ZA 1BD8A 4ABNA 5KJMA 5EX3A 4U07A 3ULQA 2NYJA 3PUJA 2YNQA 4LNGA 4APOA 4ZFHA 3Q79A 3TWTA 4RQIA 1H2UA 4N3CA 1O1RA 1FCHA 4LEUA 1HE8A 3V31A 2FO1E 2GRMA 1HG2A 2VQ2A 3TL5A 3QK0A 2FF4A 1S64A 5J08A 4WWOA 3ML9A 2KM4A 2H6FA 4X8QA 5AYWD 2ONDA 4URKA 3JXIA 1JCQA 3NAWA 2H6GA 3FTYA 4XI9A 5AQBA 3TWSA 2LAHA 3PZ3A 3D9NA 5B1AE 2XEHA 4GZDA 4U0SA 5IY5E 2VJ8A 4UI9K 4L9PA 4GU5A 5CBNA 2L6BA 5CRUA 3CK7A 2CG2A 1H2TC 4FLHA 3P1UA 3HVEA 1QQEA 1QNFA 3T8MA 3FUDA 3Q9NC 2C0LA 1ZB1A 1H6OA 3SNXA 2BUGA 1BU9A 2WXRA 1HXIA 2KBXA 4J8EA 4D10C 3JYSA 2UWJG 1UOHA 4A1GA 3U66A 5FINA 4C48B 1U2VG 3KEAA 2IF4A 5E76A 5CMYA 4DLOA 4J8DA 4KZ0A 4UUCA 5JHBA 1K8KG 1BPOA 3FUIA 3AG4E 1Z3YA 1H19A 5ANRA 4J6IA 4QFVA 1SA4A 3LY8A 1HH8A 3MX3A 3NB2A 5HQ8A 1KLXA 1N0QA 5H7PA 5A7DB 4I1MA 5AN8A 3B13A 4G25A 3QWPA 3O48A 3QKYA 3JUIA 1Z3XA 2AVPA 4K03A 4I9CA 3LCAA 4BEPA 1MHQA 1OUVA 4DLQA 4FJYA 1GW6A 4IULA 3ZNGA 4PS3A 2PM7A 4G1TA 2IOSA 2E2EA 5FZSA 1N11A 3CKBA 4F6RD 2XGSA 3PH0C 5J90A 2WXHA 3L08A 2IY0C 2PM6A 4CDMA 1IKND 3JCKC 5ITZF 4AV7A 3EU5A 1OXJA 1Y8MA 4UQYA 2XEEA 2GRQB 1OWMA 3ASDA 2PNNA 1Z5SC 3HXCA 4BSXA 4I6GA 1HG5A 2RFAA 3EU9A 5T8IA 3S2AA 1HF8A 2P9PG 2KZTB 3KS2A 2X6FA 5D0QD 4RG6A 4HXIA 3MV2B 3RRUA 4HRLA 3UM1A 1OCOE 2XCCA 3FUHA 1SW6A 1UG3A 2MHKA 2JEKA 1YYHA 2VGEA 4I2WA 4FADA 2F8YA 3FU3A 4WNFA 3HXBA 2KCVA 4U7EB 2H6IA 3TWQA 5G04J 5KNGA 3U64A 2L0TB 5ENSD 4JVSA 5D66A 3BQOA 2V8SE 4I43A 3FHEA 1N4PA 4UQZA 2X6IA 3GYZA 1INZA 2XEVA 3CR3A 3FTSA 4DK5A 2HYZA 1U3CA 3APDA 2P2CP 3UM2A 1WAO1 3FY4A 2MYOA 3PEUB 1OT8A 3IHYA 2L0IA 4GMLA 3MJWA 3CSFA 1DC2A 4PS7A 2AW6A 2RFMA 3SI5A 4ILHB 3D9JA 3B7TA 3ASGA 1UN8A 5FZRA 3DSUA 2A5EA 2J9QA 4Q96A 4TUUA 4E6HA 3ABLE 3G2SA 1JWFA 5FZQA 3AAAC 2F37A 3ESKA 2V4HC 3S7BA 2I1JA 3BUAA 5AARA 3LJNA 1DCQA 4J8SA 4MRUA 4CT0A 2NSZA 2XS8A 3CVNA 1HFAA 5FQ8A 5LOZA 1Q2ZA 4A1SA 3OTNA 3AG1E 3ML8A 1TNYA 4J0UA 3QAQA 5KWDA 3PNTB 4UWLA 5ENTD 3Q9UC 4TUMA 4DX5D 1NL4A 2IEJA 2HE0A 3DSXA 4HLEA 2UY1B 2CHZA 5ENRD 3FTWA 4PS8A 3QDNA 2DVWA 4AY5A 3SGHA 5AIJA 3C5RA 5EIBE 3EIQC 4CGVA 3I3NA 4XZ4A 4MKTA 2NC9A 3E37A 4HOSA 3VLEA 2HO1A 3ZGQA 1BI7B 2Y4TA 5D2MC 3DSVA 3R9AB 4BFRA 4AOFA 1IQRA 2YINA 2X6HA 5CCLA 2GW1A 4C0EA 3C3RA 1WG0A 3CGHA 1WDYA 2J08A 3CVUA 5CEDB 2DIWA 3D9PA 4HORA 5BT1A 4U96D 5D0OD 3LVQE 4TXQA 3ZVVA 2ZGGA 4K5CA 3PZDA 3UPVA 2AXZA 4YVOA 1L5JA 2R2LA 3E32A 1ELRA 3SZ7A 5EDSA 1E90A 3IEGA 4UWHA 3UTMA 3GZ1A 4C9BB 2I9CA 4JHJA 1N95A 2IQCA 4ATZD 1SQMA 4L2LA 4G26A 4EECA 4GB9A 3G2UA 4I9EA 3UKUG 2XPZA 2IO3C 4B8CB 1EPUA 3EIJA 4HLLA 2L9BA 3SHFA 4YDEA 3U3WA 2BEDA 4DI3A 2J07A 5HKPA 4EHMA 4G23A 4AP2A 5ENPD 3G2VA 2Y0BG 4Q69A 4U8VD 1V55E 2J8SD 4U0ZA 2VTBB 4ANWA 2LXLA 1TEZA 1TYQG 1KT0A 5FT9A 3BU8A 4BESA 4HOTA 2FI7A 3CKCA 4GA1A 1KZPA 4JL0A 2EILE 2PL2A 2XQ0A 3CSTA 4CCAA 1W3BA 2EQXA 4DUIA 3LS8A 4JEUA 3UI2A 5KCMA 5KNHD 5JA4D 2P9SG 2XGOA 3D9IA 2R17C 3PEVB 4EQFA 3ISMC 1XGWA 2IONA 5ANLA 2Q7FA 3T5XA 1N4QA 5BNWA 3RU0A 3IKOB 2Y4UA 4WUYA 5JJ6A 5EIDA 4Y6WA
chains in the Genus database with same CATH topology
2WXFA 2IF4A 4JA7A 5CMYA 5E76A 1YA0A 4J8FA 4DLOA 2XCBA 3EDTB 4J8DA 4KZ0A 3BG0B 1B89A 1FVFA 2RG8A 2UY1A 4PH4B 4CDRA 5JHBA 2CG3A 2MOWA 1BPOA 5EX0A 4JZYA 3NF1A 4I6JA 3FU0A 5LP0A 3FUIA 1P5QA 5FQ4A 1E8YA 1Z3YA 1H19A 5ANRA 3TG4A 2OV8A 4J6IA 5CCMA 2FBNA 5A23A 1E8ZA 2XGMA 4QFVA 3BEEA 1EDUA 3LY8A 3SBTB 1HH8A 3MX3A 4DI4A 4JPSA 1PC2A 1OWNA 2FEZA 2WPVA 4L23A 4WWNA 4PDXA 3FU5A 3Q4AB 4JHKA 1KLXA 4I2ZA 5HQ8A 5A7DB 4ACKA 5BV1A 3CVXA 4I1MA 4HVBA 3PE4A 4GCOA 4O6FA 1MQSA 4CGWA 3B13A 4H7XA 2VSXE 3MKQA 4G25A 4W9RA 4F1SA 3QWPA 3D9OA 3O48A 2DBAA 4GYWA 2LSUA 4C0MA 2HM8A 1NA3A 4JEHA 3RK6A 3QKYA 4FU3A 4AM9A 4KZCA 5FJYA 4EZJA 4YNDA 4BX9A 4OYSA 3UT4A 3QB2A 3JUIA 2OOEA 3CVWA 4JA9A 2PZIA 3E4BA 3RKVA 3CIAA 1TJFA 4BY6A 2J4DA 4BTBA 1Z3XA 4ACLA 1DNPA 2X3MA 2KC7A 4GAAA 3SFZA 2AVPA 3DPDA 4K03A 3U9WA 4I9CA 5LCWJ 2WMNA 1Z6TA 1IHGA 3LCAA 3MZLB 1MHQA 4FC8A 2DCPA 1Y6IA 3P2BA 1EF1C 1OUVA 4F3VA 5LX8A 4DLQA 4FJYA 3ZIMA 4ATGA 1GW6A 3LEWA 4IULA 3S7FA 4PS3A 3JQ1A 2PM7A 4IN3B 4G1TA 5AJLA 2IOSA 3N71A 2E2EA 2J49A 2ILRA 5FZSA 4G11A 1UJJA 4WNGA 3Q47B 1NZNA 3CHQA 3Q5MA 2ZU6B 3B7SA 3CKBA 2VSNA 3ENEA 3I4GA 3MV3B 3CQGB 3QJZA 2XGSA 3C98A 3OXGA 3PH0C 4GYYA 5J90A 5BPPA 2WXHA 3L08A 2IJGX 4HFGA 2PM6A 4CDMA 4B8AA 3JCKC 4JHRA 2I2OA 4IRUA 3MKRA 3FH5A 4XX5A 3ZW3A 3HIZA 3CVLA 2LNIA 3OXFA 3AU5A 4GCNA 3ZRHA 4AV7A 5JJTA 1Y8MA 4UQYA 4L1BA 3PDNA 1OWMA 2VGYA 4WWPA 2WXMA 2R59A 3ASDA 4HS2A 3UQ3A 4N2QA 4RG9A 2I6HA 4AY6A 5A6CA 4NURA 3FU6A 4KVMA 3WXXA 4GMJA 4BSXA 2LSVA 1PAQA 3ASHA 3GW4A 1FVHA 4GA0A 4I6GA 4MLPA 4A3VA 5LFAA 1HG5A 3RO2A 2XHEA 5JJ7A 4V3IA 2AXVA 3NZUA 4ANUA 5T8IA 3S2AA 3RRNB 2A4ZA 1HF8A 4XKCA 2WXKA 3FTXA 2KZTB 3LJ3A 3KS2A 2X6FA 5D0QD 2C0MA 4KBQA 2Y3AA 4BT9A 4RG6A 4HOUA 4HXIA 4UWKA 3MV2B 3SD5A 3RRUA 5AENA 4CRWA 4FA6A 2WXIA 4R7LA 1UJKA 4UQXA 2QY7A 3FULA 1JPLA 4ILGA 2XCCA 3B7RL 3FUHA 2KATA 4DPRA 2VTBA 4L2YA 3QWVA 4WNDA 1UG3A 2MHKA 3VTYA 2JEKA 4N2SA 4Y6CA 4MS6A 4I2WA 2WXGA 4U8HA 4FADA 2VGXB 3FU3A 4A55A 2J4BA 3QC1A 2LAIA 4WNFA 3K9IA 4FLBA 4DJAA 4XI0A 4FULA 3Q15A 3FUMA 1S0PA 2FO7A 3MGBA 2J09A 2KCVA 4CT4A 2R5SA 3L16A 1OWPA 1X5BA 3CVQA 3URZA 5JHAA 1NP7A 5G04C 1HU3A 4GZCA 1TJCA 2WXNA 3SBSA 3ZXSA 5G04J 2WB2A 3TXMA 4GZ6A 4YVQC 3D9MA 1JUQA 4U0UA 3U64A 4N3BA 2L0TB 4PUCA 3G2TA 3LYAA 1U3DA 4I1AA 3TXNA 3HHMA 4JVSA 1SZAA 2VYIA 1H2VC 3LVRE 3ONKA 3CVVA 1HZ4A 2YQ8A 2V8SE 3LDZA 4NQ0A 4EZKA 3EHNA 4I43A 3CV0A 3FHEA 1E7VA 3ZYQA 3CLJA 4EBAA 1ZBPA 2WXPA 4UQZA 2X6IA 1N52A 2VGXA 3PREA 2OVBA 1HX8A 3GYZA 1INZA 4FHJA 3TG5A 2XEVA 3CR3A 3CHOA 3FTSA 3KD7A 2HYZA 4DK5A 1U3CA 3APDA 4KXKB 3AU4A 2L6JA 1NA0A 1WAO1 3FY4A 2M63A 3PEUB 4HOQA 4F53A 5LCWC 3NZSA 3CHMA 4AIFA 2I1KA 3ZEFA 1N54A 2V0PA 3IHYA 3CK8A 2L0IA 3L13A 4BT8A 2XRYA 4GMLA 2BF0X 3MJWA 2X38A 3CSFA 3IHVA 3UX4A 2V5FA 2MRIA 2WQHA 4PS7A 2AW6A 4N39A 3SI5A 4ILHB 4A3TA 3D9JA 3PE3A 3B7TA 3ASGA 3CEQA 4CEMA 1UN8A 5FZRA 5E75A 1ZU2A 4Q96A 2J9QA 1ELKA 4TUUA 4E6HA 3MCXA 3G2SA 3FP3A 3EHMA 1JWFA 5FZQA 4ME2A 2XRZA 4G2VA 4KYOB 4UWFA 3AS8A 3FUFA 2VSOE 3UUXA 3MYVA 1UN9A 1WY6A 2KCKA 1OWOA 3ESKA 3FUNA 3HDXA 3HVEB 3IV0A 3JQ0A 4K0RA 4L7TA 4LCTA 4GYOA 3S7BA 2I1JA 3FUEA 3L54A 5DBKA 4NRHB 4B94A 4J8SA 4MRUA 4CT0A 2NSZA 5G2NA 2WXJA 1IQUA 1HFAA 3CVNA 4UI9J 5FQ8A 3RIBA 3ZFWA 5LOZA 4A1SA 3CK9A 1IYGA 3OTNA 3ML8A 3R7RA 4ILIA 4LUNU 4LRZA 4J0UA 3QAQA 3ZHEA 3APFA 5M72A 3OXLA 3PNTB 4P29A 4E85A 2CHWA 4UWLA 2XPYA 3FEXA 2JLBA 3FH7A 3LXUX 3PRZA 3EJNA 4AVXA 3LPZA 4EZLA 2WQ7A 3ZHEB 3MA5A 1HS6A 3TGOA 4N5CA 1E96B 1LF8A 3QNKA 1VDYA 4HLEA 1HO8A 3PS6A 5CHEE 3VLFA 2UY1B 3RO3A 3RJVA 5G55A 2CHZA 4I6EA 3IBEA 4BWRA 3LY7A 3FTWA 5FWQA 4PS8A 4TV3A 3FH8A 5T4YA 3ZN3A 4JW1A 1DVPA 3CVPA 4ANVA 3QDNA 4JXTA 3L22A 3AS5A 3R7QA 4AY5A 3SGHA 5AIJA 4AEZC 1H6KA 4GPKA 2WQ6A 2VSYA 2GRLA 4U04A 2A5UA 2CFZA 3FTUA 2X6JA 4G24A 3VLDA 4APFA 3EIQC 4CGVA 2YHEA 3AS4A 4N3AA 5G05C 3I3NA 4XZ4A 3FTZA 4MKTA 3KAEA 3UT7A 3Q49B 2NC9A 2NXPA 5G05J 3D9LA 3TJPA 2BTDA 2WXQA 4HOSA 3VLEA 2HO1A 2XPIA 3ZGQA 4UWGA 3QARA 2RD0A 2IOLA 1ELWA 1KT1A 2Y4TA 3ZPJA 2CHXA 3TAXA 2KZTA 4BTAA 2LO6A 3T5VA 2GGFA 3R9AB 4BFRA 4AOFA 1JWGA 5KJKA 1IQRA 3FEYA 4U63A 1OWLA 1EYHA 2WMOA 3ASFA 4B89A 2OVFA 2YINA 2X6HA 4GA2A 3GZSA 4I17A 2WXOA 5CCLA 2GW1A 4C0EA 1SZ9A 3CGHA 5BV0A 3BG1B 5DIZA 2J08A 4EBAG 3CVUA 3RRMB 5BUZA 2WVIA 3FTVA 3O4ZA 2AXUA 3ZYLA 2DIWA 3LKUA 2AWIA 3D9PA 4HORA 4ABNA 4CDNA 5BT1A 5D0OD 2P58C 1PY1A 3LVQE 5KJMA 3PNLB 3ZVVA 5EKQD 5EX3A 4U07A 3PZDA 3ULQA 3I4RB 3UPVA 4Q94A 3PUJA 2YNQA 4JC8A 4LERA 2AXZA 4YVOA 1L5JA 3DBSA 4APOA 1ELRA 3SZ7A 3UMVA 5EDSA 3U4TA 1E90A 4FHKA 1E7UA 3IEGA 3CVYA 3OAWA 4KVOA 4UWHA 2QFCA 3D3MA 3GZ1A 1H2UA 2C2LA 5AJDA 4C9BB 4N3CA 2I9CA 4JHJA 2IQCA 1FCHA 3PUKA 1E8WA 1HE8A 1SQMA 3FWVA 4L2LA 4LEUA 4G26A 2X6KA 4EECA 3L17A 4AJWA 4GB9A 5HI7A 2PQNA 3G2UA 4I9EA 4XIFA 1UW4B 2PQRA 2XPZA 4B8CB 3I5PA 1EPUA 2GRMA 1HG2A 3EIJA 2L9BA 3SHFA 2VQ2A 3U3WA 2E0IA 3TL5A 3QK0A 2J07A 4OVUA 4DI3A 3L6AA 2HR2A 2FF4A 4UI9C 4G23A 5ARGA 3D9KA 3PVLA 5ARFA 4AP2A 3CHSA 3CHRA 4EPZA 3ONLA 5J08A 4WWOA 3ML9A 4XKBA 3G2VA 5T3RA 2KM4A 4FJZA 4Q69A 5CMWA 4ANXA 5AYWD 2V4LA 2ONDA 4URKA 5FQ6A 4U0ZA 3QOUA 2VTBB 4KT6B 4ANWA 3FTYA 4XI9A 4M3OA 1TEZA 1KT0A 2LAHA 3GZ2A 5FT9A 3VTXA 3B7UX 3UT8A 3ZYKA 4HOTA 3D9NA 2FI7A 1XNFA 3CKCA 3CHPA 4GA1A 3S7JA 4GZDA 4U0SA 4AXHA 3FDHA 2VJ8A 4UI9K 4JL0A 4GU5A 2WXLA 4H7YA 4GZ5A 4B0ZA 2YHCA 5FQ7A 4BX8A 2IFUA 3SF4A 2PL2A 4RVBA 2CFUA 2XQ0A 3CSTA 1A17A 5ENNA 4CCAA 3CK7A 5KJNA 3S7DA 1W3BA 2CG2A 5C2YA 1H2TC 3HYMB 4FLHA 2EQXA 3P1UA 3HVEA 1QQEA 2IU1A 1QNFA 4IYPA 4RSYA 3ZYMA 4F7AA 4FP7A 3LS8A 4OVVA 4WNEA 4JEUA 3T8MA 3FUDA 3QWWA 2C0LA 4NACA 5KCMA 1E8XA 2WM9A 3APCA 3SNXA 2BUGA 3FFLA 2XGOA 3D9IA 3KEZA 5BW8C 2R17C 2WXRA 3PEVB 4EQFA 1H0AA 1XGWA 5FTPA 2IONA 3G2WA 3CQCB 4XE0A 5ANLA 1HXIA 2Q7FA 4J8EA 3FUKA 3MEKA 3T5XA 4D10C 3JYSA 2UWJG 3MKQB 5BNWA 1QZ2A 4KMOA 3RU0A 3NQPA 4A1GA 4GZ3A 3IKOB 2FULA 4TRQA 3U66A 2KCLA 2Y4UA 5KJLA 5C1DA 4WUYA 3ESLA 3LY9A 5JJ6A 3FUJA 4I1OB 1WM5A 4WAFA 4Y6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHQ A;  1HF8 A;  5CMY A;  2DCP A;  2L0I A;  3ONK A;  3ZYK A;  3D9N A;  4FLB A;  2V8S E;  3LDZ A;  4AVX A;  3D9I A;  3D9O A;  1SZ9 A;  2BF0 X;  2MOW A;  4GZD A;  3RRU A;  1H0A A;  1XGW A;  3ZYQ A;  3CLJ A;  4FU3 A;  1LF8 A;  5LP0 A;  1UJK A;  3G2W A;  1VDY A;  1X5B A;  2QY7 A;  3D9K A;  3D9L A;  1JPL A;  3ZYL A;  1HFA A;  1HX8 A;  3ONL A;  5J08 A;  5LOZ A;  2DIW A;  1INZ A;  3G2V A;  3D9J A;  2KM4 A;  4GZC A;  3D9P A;  5CMW A;  1EDU A;  1UJJ A;  3D9M A;  1PY1 A;  1JUQ A;  4Q96 A;  3G2U A;  1ELK A;  1DVP A;  2LO6 A;  2L0T B;  3ZYM A;  1HG5 A;  3G2S A;  3G2T A;  4JXT A;  1JWG A;  4NAC A;  1JWF A;  4Q94 A;  1EYH A;  1SZA A;  1HG2 A;  4HFG A; 
#chains in the Genus database with same CATH topology
 2RG8 A;  4CDR A;  2CG3 A;  5EX0 A;  4JZY A;  5LP0 A;  1P5Q A;  2OV8 A;  5A23 A;  3BEE A;  1EDU A;  3SBT B;  1PC2 A;  1OWN A;  2FEZ A;  4PDX A;  3Q4A B;  4I2Z A;  3CVX A;  1TN6 A;  1LTX A;  4GYW A;  2LSU A;  4FU3 A;  4KZC A;  3EHR A;  4OYS A;  2EIJ E;  3UT4 A;  3CVW A;  3E4B A;  3RKV A;  4BY6 A;  4ACL A;  1DNP A;  2X3M A;  3SFZ A;  3U9W A;  5LCW J;  1Z6T A;  5CRV A;  2DCP A;  4F3V A;  5B3S E;  3ZIM A;  3KSQ A;  3JUE A;  3LEW A;  3S7F A;  3IXE A;  1UJJ A;  3X2Q E;  3Q5M A;  2ZU6 B;  3DSW A;  3B7S A;  3ENE A;  2VSN A;  1TNO A;  4B8A A;  2I2O A;  4XX5 A;  3ZW3 A;  3ZRH A;  3OXF A;  3DEP A;  5AQ9 A;  4WWP A;  2WXM A;  2R59 A;  3UQ3 A;  4AY6 A;  3ZKJ A;  1FVH A;  4A3V A;  1FT1 A;  4V3I A;  2WXK A;  4KBQ A;  4BT9 A;  3SD5 A;  5AEN A;  4HNA D;  4FA6 A;  2WXI A;  4R7L A;  1UJK A;  4UQX A;  4DPR A;  4ILG A;  3B7R L;  1OCR E;  3E33 A;  4N2S A;  2VGX B;  4Z68 A;  2P9I G;  4XI0 A;  3FUM A;  4MBG A;  5CER B;  2FO7 A;  2J09 A;  3L16 A;  3B95 A;  4NIK A;  1DCE A;  3AG3 E;  4GZC A;  1TJC A;  2WXN A;  5B1B E;  3SBS A;  3T9K A;  4B93 B;  1JUQ A;  4PUC A;  3DWL G;  3LYA A;  3HHM A;  2VYI A;  1YMP A;  5BXU A;  3CVV A;  3L82 A;  3LDZ A;  4NQ0 A;  4HB5 A;  4LG6 A;  3CV0 A;  1E7V A;  3ZYQ A;  3CLJ A;  1ZBP A;  2WXP A;  1N52 A;  2VGX A;  2OVB A;  4FHJ A;  3JXJ A;  4KXK B;  2M63 A;  5LCW C;  1O1S A;  1QBQ A;  4GTM A;  2I1K A;  3ZEF A;  3ASN E;  1OCC E;  2ZXW E;  3UX4 A;  2V5F A;  3Q73 A;  2WQH A;  4N39 A;  4LNU D;  3CEQ A;  5E75 A;  1ELK A;  3MCX A;  3NOG D;  2XRZ A;  4UWF A;  2EIN E;  3AS8 A;  2VSO E;  3FUF A;  3MYV A;  1WY6 A;  3FUN A;  2KCK A;  3HDX A;  3IV0 A;  3JQ0 A;  3ULE G;  4L7T A;  3FUE A;  3L54 A;  5DBK A;  2ETB A;  4DX1 A;  2WXJ A;  1IYG A;  2XS1 A;  4LUN U;  2P9U G;  2V5Q C;  4E85 A;  2XPY A;  3FEX A;  1V54 E;  2JLB A;  4AVX A;  3LPZ A;  4EZL A;  3ZHE B;  3QNK A;  3ABK E;  3RO3 A;  3RJV A;  3WG7 E;  1MZC A;  4I6E A;  4BWR A;  3J5P A;  3FH8 A;  3RSE G;  1DVP A;  2RKK A;  1H6K A;  2GRL A;  4G24 A;  4APF A;  2YHE A;  4N3A A;  5G05 C;  3UT7 A;  3ASO E;  4GMR A;  3Q49 B;  2WXQ A;  3QAR A;  1ELW A;  1TNU A;  3ZPJ A;  2KZT A;  4G8L A;  4O1O A;  1N4S A;  5KJK A;  4RLY A;  1EYH A;  4I17 A;  4GA2 A;  3GZS A;  3EHQ A;  2WXO A;  2XZD G;  1SZ9 A;  5BV0 A;  4EBA G;  3ZYL A;  4GTV A;  3LKU A;  2AWI A;  2P58 C;  1PY1 A;  3UIO C;  5EKQ D;  3I4R B;  2OEW A;  3UMV A;  4XEI G;  4FHK A;  3CVY A;  3OAW A;  5AQ7 A;  1TNZ A;  5AJD A;  4TXP A;  4O1P A;  1MX4 A;  3ABM E;  1E8W A;  3FWV A;  1LD8 A;  3L17 A;  4OAV B;  3Q7F A;  2PQN A;  4XIF A;  2EIM E;  3TWW A;  4HBD A;  2E0I A;  3L6A A;  2HR2 A;  2XEN A;  3D9K A;  3PVL A;  5ARF A;  3CHR A;  4EPZ A;  3ONL A;  4GTP A;  5T3R A;  4FJZ A;  4JD2 G;  4ANX A;  1K3Z D;  2QYU A;  3PZ1 A;  1S63 A;  4KT6 B;  3E34 A;  3SFX A;  1NI1 A;  3GZ2 A;  3UT8 A;  3S7J A;  3CHP A;  1NFI E;  4H7Y A;  4GZ5 A;  4B0Z A;  3UKR G;  2BKG A;  4RVB A;  3DXK G;  5ENN A;  3S7D A;  5C2Y A;  4IYP A;  2IU1 A;  3ZYM A;  1AWC B;  4RSY A;  4FP7 A;  4WNE A;  3Q7A A;  3QWW A;  2QZA A;  3KEZ A;  5CEA A;  3UM0 A;  1H0A A;  5FTP A;  3G2W A;  3HXF A;  3FUK A;  4LNB A;  3MKQ B;  3TWR A;  4KMO A;  4TRQ A;  2KCL A;  5KJL A;  3LY9 A;  2B0O E;  3FUJ A;  4I1O B;  1WM5 A;  4AXH A;  1YA0 A;  2ETA A;  3BG0 B;  2UY1 A;  4PH4 B;  2JAB A;  3NF1 A;  4I6J A;  3W9G A;  5CCM A;  2FBN A;  1E8Z A;  4U8Y D;  4DI4 A;  4L23 A;  2GRP B;  2LXM A;  5BV1 A;  4HVB A;  3PE4 A;  4GCO A;  1MQS A;  4H7X A;  3MKQ A;  4W9R A;  4F1S A;  3D9O A;  2GRN B;  4JEH A;  3RK6 A;  4AM9 A;  5FJY A;  4EZJ A;  3R9M A;  2OOE A;  4JA9 A;  2PZI A;  1D9S A;  2J4D A;  4BTB A;  2QC9 A;  2KC7 A;  2BKK B;  3MZL B;  1G3N B;  4FC8 A;  3P2B A;  1EF1 C;  4ATG A;  1LD7 A;  1RZ4 A;  3JQ1 A;  4IN3 B;  1BI8 B;  1TNB A;  3N71 A;  2ILR A;  4G11 A;  1NZN A;  3I4G A;  3CQG B;  3QJZ A;  4GYY A;  5BPP A;  2R02 A;  4JB8 P;  2IJG X;  4JHR A;  3MKR A;  3FH5 A;  3Q78 A;  4DX2 A;  5JJT A;  2LNI A;  3EUV A;  4GCN A;  3ZUV B;  5AQA A;  2VGY A;  3UIP C;  4N2Q A;  5A6C A;  4NUR A;  4KVM A;  3UM3 A;  1PAQ A;  4GA0 A;  4MLP A;  5JJ7 A;  2AXV A;  3NZU A;  3RRN B;  2A4Z A;  3FTX A;  1OY3 D;  3LJ3 A;  2Y3A A;  4HOU A;  4G8K A;  3UIN C;  1H6P A;  2Y1L E;  3FUL A;  1JPL A;  2VTB A;  4L2Y A;  3QWV A;  1SA5 A;  3VTY A;  4Y6C A;  2ZIS A;  4MS6 A;  2WXG A;  4U8H A;  4HI9 A;  3DXM G;  4QQI A;  2J4B A;  3QC1 A;  2H6H A;  4FLB A;  4DJA A;  3Q15 A;  3MGB A;  1OWP A;  1X5B A;  3CVQ A;  3URZ A;  5JHA A;  4N5Q A;  5EIL A;  3ZXS A;  3TXM A;  4GZ6 A;  4YVQ C;  4U0U A;  4N3B A;  3G2T A;  1U3D A;  4I1A A;  3TXN A;  1SZA A;  1H2V C;  3LVR E;  1HZ4 A;  2YQ8 A;  5EN5 D;  1SVX A;  4EBA A;  3TG5 A;  3CHO A;  3V2O A;  2L6J A;  4HOQ A;  4F53 A;  3PZ2 A;  3NZS A;  3SY2 A;  3CHM A;  4AIF A;  4M7C A;  1N54 A;  3CK8 A;  3L13 A;  2XRY A;  1FT2 A;  1IHB A;  3IHV A;  5HRY A;  4A3T A;  1KZO A;  3HXE A;  3FP3 A;  3V2X A;  4G2V A;  4KYO B;  4CYM D;  3UUX A;  3DST A;  2P9K G;  1UN9 A;  3DSS A;  3HVE B;  4LCT A;  4K0R A;  3AJI A;  4GYO A;  4B94 A;  4TXR A;  5G2N A;  1IQU A;  4UI9 J;  3ZFW A;  3RIB A;  4GTO A;  3AG2 E;  3CK9 A;  2DYS E;  4HRM B;  3R7R A;  1AP7 A;  4LRZ A;  3APF A;  5M72 A;  3OXL A;  4P29 A;  1FPP A;  3FH7 A;  3SFY A;  3PRZ A;  3EJN A;  3UXG A;  1HS6 A;  4N5C A;  4HRN A;  2DYR E;  1LF8 A;  1VDY A;  1HO8 A;  5CHE E;  3VLF A;  5G55 A;  1D8E A;  4GTQ A;  3IBE A;  5FWQ A;  4TV3 A;  5T4Y A;  4JW1 A;  2AJA A;  3L22 A;  3AS5 A;  4U95 D;  2DWZ A;  2VSY A;  2A5U A;  2CFZ A;  3VLD A;  4YDO A;  3AS4 A;  2ETC A;  2NXP A;  1JCS A;  3D9L A;  5G05 J;  2XPI A;  4UWG A;  2RD0 A;  2IOL A;  2EIK E;  1KT1 A;  2CHX A;  3T8K A;  4BTA A;  2LO6 A;  3HRA A;  3T5V A;  2GRO B;  2GGF A;  4U63 A;  2WMO A;  4B89 A;  2KXP C;  3NBN B;  3BG1 B;  5DIZ A;  3RRM B;  4A63 B;  5BUZ A;  2P9N G;  3FTV A;  5FIO A;  2AXU A;  1YCS B;  4CDN A;  3DRA A;  3PNL B;  4Q94 A;  4JC8 A;  1N9A A;  4LER A;  3DBS A;  3U4T A;  1E7U A;  4KVO A;  3RAU A;  3HXD A;  2QFC A;  3D9H A;  3D3M A;  2C2L A;  4YDW A;  3J5Q B;  3PUK A;  2X6K A;  5ENO D;  4AJW A;  5HI7 A;  4K5A B;  4BSZ B;  1UW4 B;  2PQR A;  3I5P A;  3C72 A;  3NOC D;  3SO8 A;  4OVU A;  1IXV A;  4UI9 C;  5ARG A;  3CHS A;  4XKB A;  2Y69 E;  5CMW A;  2V4L A;  5FQ6 A;  4F1P A;  3QOU A;  4M3O A;  4O60 A;  3VTX A;  3ZYK A;  3B7U X;  1XNF A;  2DZO A;  3FDH A;  3V30 A;  2WXL A;  2YHC A;  5FQ7 A;  4BX8 A;  2IFU A;  4GTT A;  3SF4 A;  2CFU A;  1A17 A;  5KJN A;  2OCC E;  3HYM B;  4F7A A;  4OVV A;  4NAC A;  3DEO A;  1E8X A;  2WM9 A;  3APC A;  3FFL A;  2ZGD A;  5BW8 C;  3CQC B;  4XE0 A;  3MEK A;  1QZ2 A;  3NQP A;  4GZ3 A;  2FUL A;  5JMN D;  5CBO A;  5C1D A;  1JCR A;  3ESL A;  1RW2 A;  3ZHE A;  4WAF A;  2WXF A;  4JA7 A;  4J8F A;  1TN7 A;  4DX7 D;  2XCB A;  3EDT B;  4GTS A;  1B89 A;  1FVF A;  4BER A;  1KPS B;  2MOW A;  4YDY A;  3FU0 A;  5FQ4 A;  1E8Y A;  3TG4 A;  2XGM A;  1N4R A;  2OEV A;  4DX6 D;  4JPS A;  1D8D A;  2WPV A;  4WWN A;  3FU5 A;  4JHK A;  3PZ4 A;  4ACK A;  4O6F A;  1BLX B;  4CGW A;  2VSX E;  4C0M A;  2DBA A;  2HM8 A;  1NA3 A;  4K5B A;  4YND A;  4BX9 A;  1TN8 A;  3QB2 A;  2P9L G;  3CIA A;  1TJF A;  1MX6 A;  4GAA A;  3DPD A;  2WMN A;  1IHG A;  4J7W A;  1Y6I A;  5LX8 A;  1MX2 A;  5AJL A;  4ZHB A;  2J49 A;  4WNG A;  3Q47 B;  3CHQ A;  1N0R A;  3HG0 D;  3MV3 B;  3C98 A;  3OXG A;  4HFG A;  4IRU A;  5HS0 A;  3V79 K;  3HIZ A;  3CVL A;  3DPY A;  3AU5 A;  4L1B A;  2F8X K;  3PDN A;  4HS2 A;  4RG9 A;  2I6H A;  3FU6 A;  3WXX A;  4GMJ A;  2LSV A;  3GW4 A;  3ASH A;  5LFA A;  3RO2 A;  2XHE A;  3ZU7 B;  4ANU A;  4XKC A;  1O1T A;  2C0M A;  4GTR A;  4UWK A;  4OAU C;  4CRW A;  3ULY A;  3TWX A;  4GPM A;  2ZIR A;  2QY7 A;  3L9T A;  2KAT A;  4BET A;  4WND A;  1K1A A;  2QYJ A;  3TWU A;  4A55 A;  2GRR B;  4LSZ E;  2LAI A;  2R05 A;  3ZXP A;  3K9I A;  4HI8 A;  4FUL A;  3E30 A;  1S0P A;  4CT4 A;  2R5S A;  1NP7 A;  5G04 C;  1OCZ E;  1HU3 A;  1O5M A;  2WB2 A;  3D9M A;  4DRX E;  3ONK A;  4EZK A;  3EHN A;  3C3Q A;  3PRE A;  1HX8 A;  1N94 A;  3KD7 A;  3AU4 A;  4HQD A;  1NA0 A;  3SQV A;  2V0P A;  4J8Y A;  5EYP F;  4BT8 A;  1MYO A;  4CZ2 D;  2BF0 X;  2X38 A;  2MRI A;  5CEC B;  1K1B A;  3PE3 A;  4CEM A;  1ZU2 A;  2F0Y A;  3EHM A;  2DZN A;  4ME2 A;  3F6Q A;  1OWO A;  2XZT G;  1TR4 A;  4NRH B;  5AAO A;  5EYL A;  1A5E A;  4ILI A;  5ENQ D;  3Q75 A;  2IO2 C;  2CHW A;  3LXU X;  1QYM A;  2WQ7 A;  3MA5 A;  3TGO A;  1E96 B;  3B7B A;  2B6C A;  3PS6 A;  2R03 A;  1S70 B;  5BXO A;  3LY7 A;  3ZN3 A;  4ANV A;  3CVP A;  4JXT A;  3R7Q A;  4GPK A;  4AEZ C;  2WQ6 A;  4U04 A;  3FTU A;  2X6J A;  2LUH A;  3FTZ A;  3KAE A;  3TJP A;  2BTD A;  3W9F A;  5KBA A;  3TAX A;  1JWG A;  3C3O A;  3FEY A;  1OWL A;  3ASF A;  1X81 A;  2OVF A;  3TWV A;  1MJ0 A;  3KSL A;  2WVI A;  3O4Z A;  1BD8 A;  4ABN A;  5KJM A;  5EX3 A;  4U07 A;  3ULQ A;  2NYJ A;  3PUJ A;  2YNQ A;  4LNG A;  4APO A;  4ZFH A;  3Q79 A;  3TWT A;  4RQI A;  1H2U A;  4N3C A;  1O1R A;  1FCH A;  4LEU A;  1HE8 A;  3V31 A;  2FO1 E;  2GRM A;  1HG2 A;  2VQ2 A;  3TL5 A;  3QK0 A;  2FF4 A;  1S64 A;  5J08 A;  4WWO A;  3ML9 A;  2KM4 A;  2H6F A;  4X8Q A;  5AYW D;  2OND A;  4URK A;  3JXI A;  1JCQ A;  3NAW A;  2H6G A;  3FTY A;  4XI9 A;  5AQB A;  3TWS A;  2LAH A;  3PZ3 A;  3D9N A;  5B1A E;  2XEH A;  4GZD A;  4U0S A;  5IY5 E;  2VJ8 A;  4UI9 K;  4L9P A;  4GU5 A;  5CBN A;  2L6B A;  5CRU A;  3CK7 A;  2CG2 A;  1H2T C;  4FLH A;  3P1U A;  3HVE A;  1QQE A;  1QNF A;  3T8M A;  3FUD A;  3Q9N C;  2C0L A;  1ZB1 A;  1H6O A;  3SNX A;  2BUG A;  1BU9 A;  2WXR A;  1HXI A;  2KBX A;  4J8E A;  4D10 C;  3JYS A;  2UWJ G;  1UOH A;  4A1G A;  3U66 A;  5FIN A;  4C48 B;  1U2V G;  3KEA A;  2IF4 A;  5E76 A;  5CMY A;  4DLO A;  4J8D A;  4KZ0 A;  4UUC A;  5JHB A;  1K8K G;  1BPO A;  3FUI A;  3AG4 E;  1Z3Y A;  1H19 A;  5ANR A;  4J6I A;  4QFV A;  1SA4 A;  3LY8 A;  1HH8 A;  3MX3 A;  3NB2 A;  5HQ8 A;  1KLX A;  1N0Q A;  5H7P A;  5A7D B;  4I1M A;  5AN8 A;  3B13 A;  4G25 A;  3QWP A;  3O48 A;  3QKY A;  3JUI A;  1Z3X A;  2AVP A;  4K03 A;  4I9C A;  3LCA A;  4BEP A;  1MHQ A;  1OUV A;  4DLQ A;  4FJY A;  1GW6 A;  4IUL A;  3ZNG A;  4PS3 A;  2PM7 A;  4G1T A;  2IOS A;  2E2E A;  5FZS A;  1N11 A;  3CKB A;  4F6R D;  2XGS A;  3PH0 C;  5J90 A;  2WXH A;  3L08 A;  2IY0 C;  2PM6 A;  4CDM A;  1IKN D;  3JCK C;  5ITZ F;  4AV7 A;  3EU5 A;  1OXJ A;  1Y8M A;  4UQY A;  2XEE A;  2GRQ B;  1OWM A;  3ASD A;  2PNN A;  1Z5S C;  3HXC A;  4BSX A;  4I6G A;  1HG5 A;  2RFA A;  3EU9 A;  5T8I A;  3S2A A;  1HF8 A;  2P9P G;  2KZT B;  3KS2 A;  2X6F A;  5D0Q D;  4RG6 A;  4HXI A;  3MV2 B;  3RRU A;  4HRL A;  3UM1 A;  1OCO E;  2XCC A;  3FUH A;  1SW6 A;  1UG3 A;  2MHK A;  2JEK A;  1YYH A;  2VGE A;  4I2W A;  4FAD A;  2F8Y A;  3FU3 A;  4WNF A;  3HXB A;  2KCV A;  4U7E B;  2H6I A;  3TWQ A;  5G04 J;  5KNG A;  3U64 A;  2L0T B;  5ENS D;  4JVS A;  5D66 A;  3BQO A;  2V8S E;  4I43 A;  3FHE A;  1N4P A;  4UQZ A;  2X6I A;  3GYZ A;  1INZ A;  2XEV A;  3CR3 A;  3FTS A;  4DK5 A;  2HYZ A;  1U3C A;  3APD A;  2P2C P;  3UM2 A;  1WAO 1;  3FY4 A;  2MYO A;  3PEU B;  1OT8 A;  3IHY A;  2L0I A;  4GML A;  3MJW A;  3CSF A;  1DC2 A;  4PS7 A;  2AW6 A;  2RFM A;  3SI5 A;  4ILH B;  3D9J A;  3B7T A;  3ASG A;  1UN8 A;  5FZR A;  3DSU A;  2A5E A;  2J9Q A;  4Q96 A;  4TUU A;  4E6H A;  3ABL E;  3G2S A;  1JWF A;  5FZQ A;  3AAA C;  2F37 A;  3ESK A;  2V4H C;  3S7B A;  2I1J A;  3BUA A;  5AAR A;  3LJN A;  1DCQ A;  4J8S A;  4MRU A;  4CT0 A;  2NSZ A;  2XS8 A;  3CVN A;  1HFA A;  5FQ8 A;  5LOZ A;  1Q2Z A;  4A1S A;  3OTN A;  3AG1 E;  3ML8 A;  1TNY A;  4J0U A;  3QAQ A;  5KWD A;  3PNT B;  4UWL A;  5ENT D;  3Q9U C;  4TUM A;  4DX5 D;  1NL4 A;  2IEJ A;  2HE0 A;  3DSX A;  4HLE A;  2UY1 B;  2CHZ A;  5ENR D;  3FTW A;  4PS8 A;  3QDN A;  2DVW A;  4AY5 A;  3SGH A;  5AIJ A;  3C5R A;  5EIB E;  3EIQ C;  4CGV A;  3I3N A;  4XZ4 A;  4MKT A;  2NC9 A;  3E37 A;  4HOS A;  3VLE A;  2HO1 A;  3ZGQ A;  1BI7 B;  2Y4T A;  5D2M C;  3DSV A;  3R9A B;  4BFR A;  4AOF A;  1IQR A;  2YIN A;  2X6H A;  5CCL A;  2GW1 A;  4C0E A;  3C3R A;  1WG0 A;  3CGH A;  1WDY A;  2J08 A;  3CVU A;  5CED B;  2DIW A;  3D9P A;  4HOR A;  5BT1 A;  4U96 D;  5D0O D;  3LVQ E;  4TXQ A;  3ZVV A;  2ZGG A;  4K5C A;  3PZD A;  3UPV A;  2AXZ A;  4YVO A;  1L5J A;  2R2L A;  3E32 A;  1ELR A;  3SZ7 A;  5EDS A;  1E90 A;  3IEG A;  4UWH A;  3UTM A;  3GZ1 A;  4C9B B;  2I9C A;  4JHJ A;  1N95 A;  2IQC A;  4ATZ D;  1SQM A;  4L2L A;  4G26 A;  4EEC A;  4GB9 A;  3G2U A;  4I9E A;  3UKU G;  2XPZ A;  2IO3 C;  4B8C B;  1EPU A;  3EIJ A;  4HLL A;  2L9B A;  3SHF A;  4YDE A;  3U3W A;  2BED A;  4DI3 A;  2J07 A;  5HKP A;  4EHM A;  4G23 A;  4AP2 A;  5ENP D;  3G2V A;  2Y0B G;  4Q69 A;  4U8V D;  1V55 E;  2J8S D;  4U0Z A;  2VTB B;  4ANW A;  2LXL A;  1TEZ A;  1TYQ G;  1KT0 A;  5FT9 A;  3BU8 A;  4BES A;  4HOT A;  2FI7 A;  3CKC A;  4GA1 A;  1KZP A;  4JL0 A;  2EIL E;  2PL2 A;  2XQ0 A;  3CST A;  4CCA A;  1W3B A;  2EQX A;  4DUI A;  3LS8 A;  4JEU A;  3UI2 A;  5KCM A;  5KNH D;  5JA4 D;  2P9S G;  2XGO A;  3D9I A;  2R17 C;  3PEV B;  4EQF A;  3ISM C;  1XGW A;  2ION A;  5ANL A;  2Q7F A;  3T5X A;  1N4Q A;  5BNW A;  3RU0 A;  3IKO B;  2Y4U A;  4WUY A;  5JJ6 A;  5EID A;  4Y6W A; 
#chains in the Genus database with same CATH homology
 2WXF A;  2IF4 A;  4JA7 A;  5CMY A;  5E76 A;  1YA0 A;  4J8F A;  4DLO A;  2XCB A;  3EDT B;  4J8D A;  4KZ0 A;  3BG0 B;  1B89 A;  1FVF A;  2RG8 A;  2UY1 A;  4PH4 B;  4CDR A;  5JHB A;  2CG3 A;  2MOW A;  1BPO A;  5EX0 A;  4JZY A;  3NF1 A;  4I6J A;  3FU0 A;  5LP0 A;  3FUI A;  1P5Q A;  5FQ4 A;  1E8Y A;  1Z3Y A;  1H19 A;  5ANR A;  3TG4 A;  2OV8 A;  4J6I A;  5CCM A;  2FBN A;  5A23 A;  1E8Z A;  2XGM A;  4QFV A;  3BEE A;  1EDU A;  3LY8 A;  3SBT B;  1HH8 A;  3MX3 A;  4DI4 A;  4JPS A;  1PC2 A;  1OWN A;  2FEZ A;  2WPV A;  4L23 A;  4WWN A;  4PDX A;  3FU5 A;  3Q4A B;  4JHK A;  1KLX A;  4I2Z A;  5HQ8 A;  5A7D B;  4ACK A;  5BV1 A;  3CVX A;  4I1M A;  4HVB A;  3PE4 A;  4GCO A;  4O6F A;  1MQS A;  4CGW A;  3B13 A;  4H7X A;  2VSX E;  3MKQ A;  4G25 A;  4W9R A;  4F1S A;  3QWP A;  3D9O A;  3O48 A;  2DBA A;  4GYW A;  2LSU A;  4C0M A;  2HM8 A;  1NA3 A;  4JEH A;  3RK6 A;  3QKY A;  4FU3 A;  4AM9 A;  4KZC A;  5FJY A;  4EZJ A;  4YND A;  4BX9 A;  4OYS A;  3UT4 A;  3QB2 A;  3JUI A;  2OOE A;  3CVW A;  4JA9 A;  2PZI A;  3E4B A;  3RKV A;  3CIA A;  1TJF A;  4BY6 A;  2J4D A;  4BTB A;  1Z3X A;  4ACL A;  1DNP A;  2X3M A;  2KC7 A;  4GAA A;  3SFZ A;  2AVP A;  3DPD A;  4K03 A;  3U9W A;  4I9C A;  5LCW J;  2WMN A;  1Z6T A;  1IHG A;  3LCA A;  3MZL B;  1MHQ A;  4FC8 A;  2DCP A;  1Y6I A;  3P2B A;  1EF1 C;  1OUV A;  4F3V A;  5LX8 A;  4DLQ A;  4FJY A;  3ZIM A;  4ATG A;  1GW6 A;  3LEW A;  4IUL A;  3S7F A;  4PS3 A;  3JQ1 A;  2PM7 A;  4IN3 B;  4G1T A;  5AJL A;  2IOS A;  3N71 A;  2E2E A;  2J49 A;  2ILR A;  5FZS A;  4G11 A;  1UJJ A;  4WNG A;  3Q47 B;  1NZN A;  3CHQ A;  3Q5M A;  2ZU6 B;  3B7S A;  3CKB A;  2VSN A;  3ENE A;  3I4G A;  3MV3 B;  3CQG B;  3QJZ A;  2XGS A;  3C98 A;  3OXG A;  3PH0 C;  4GYY A;  5J90 A;  5BPP A;  2WXH A;  3L08 A;  2IJG X;  4HFG A;  2PM6 A;  4CDM A;  4B8A A;  3JCK C;  4JHR A;  2I2O A;  4IRU A;  3MKR A;  3FH5 A;  4XX5 A;  3ZW3 A;  3HIZ A;  3CVL A;  2LNI A;  3OXF A;  3AU5 A;  4GCN A;  3ZRH A;  4AV7 A;  5JJT A;  1Y8M A;  4UQY A;  4L1B A;  3PDN A;  1OWM A;  2VGY A;  4WWP A;  2WXM A;  2R59 A;  3ASD A;  4HS2 A;  3UQ3 A;  4N2Q A;  4RG9 A;  2I6H A;  4AY6 A;  5A6C A;  4NUR A;  3FU6 A;  4KVM A;  3WXX A;  4GMJ A;  4BSX A;  2LSV A;  1PAQ A;  3ASH A;  3GW4 A;  1FVH A;  4GA0 A;  4I6G A;  4MLP A;  4A3V A;  5LFA A;  1HG5 A;  3RO2 A;  2XHE A;  5JJ7 A;  4V3I A;  2AXV A;  3NZU A;  4ANU A;  5T8I A;  3S2A A;  3RRN B;  2A4Z A;  1HF8 A;  4XKC A;  2WXK A;  3FTX A;  2KZT B;  3LJ3 A;  3KS2 A;  2X6F A;  5D0Q D;  2C0M A;  4KBQ A;  2Y3A A;  4BT9 A;  4RG6 A;  4HOU A;  4HXI A;  4UWK A;  3MV2 B;  3SD5 A;  3RRU A;  5AEN A;  4CRW A;  4FA6 A;  2WXI A;  4R7L A;  1UJK A;  4UQX A;  2QY7 A;  3FUL A;  1JPL A;  4ILG A;  2XCC A;  3B7R L;  3FUH A;  2KAT A;  4DPR A;  2VTB A;  4L2Y A;  3QWV A;  4WND A;  1UG3 A;  2MHK A;  3VTY A;  2JEK A;  4N2S A;  4Y6C A;  4MS6 A;  4I2W A;  2WXG A;  4U8H A;  4FAD A;  2VGX B;  3FU3 A;  4A55 A;  2J4B A;  3QC1 A;  2LAI A;  4WNF A;  3K9I A;  4FLB A;  4DJA A;  4XI0 A;  4FUL A;  3Q15 A;  3FUM A;  1S0P A;  2FO7 A;  3MGB A;  2J09 A;  2KCV A;  4CT4 A;  2R5S A;  3L16 A;  1OWP A;  1X5B A;  3CVQ A;  3URZ A;  5JHA A;  1NP7 A;  5G04 C;  1HU3 A;  4GZC A;  1TJC A;  2WXN A;  3SBS A;  3ZXS A;  5G04 J;  2WB2 A;  3TXM A;  4GZ6 A;  4YVQ C;  3D9M A;  1JUQ A;  4U0U A;  3U64 A;  4N3B A;  2L0T B;  4PUC A;  3G2T A;  3LYA A;  1U3D A;  4I1A A;  3TXN A;  3HHM A;  4JVS A;  1SZA A;  2VYI A;  1H2V C;  3LVR E;  3ONK A;  3CVV A;  1HZ4 A;  2YQ8 A;  2V8S E;  3LDZ A;  4NQ0 A;  4EZK A;  3EHN A;  4I43 A;  3CV0 A;  3FHE A;  1E7V A;  3ZYQ A;  3CLJ A;  4EBA A;  1ZBP A;  2WXP A;  4UQZ A;  2X6I A;  1N52 A;  2VGX A;  3PRE A;  2OVB A;  1HX8 A;  3GYZ A;  1INZ A;  4FHJ A;  3TG5 A;  2XEV A;  3CR3 A;  3CHO A;  3FTS A;  3KD7 A;  2HYZ A;  4DK5 A;  1U3C A;  3APD A;  4KXK B;  3AU4 A;  2L6J A;  1NA0 A;  1WAO 1;  3FY4 A;  2M63 A;  3PEU B;  4HOQ A;  4F53 A;  5LCW C;  3NZS A;  3CHM A;  4AIF A;  2I1K A;  3ZEF A;  1N54 A;  2V0P A;  3IHY A;  3CK8 A;  2L0I A;  3L13 A;  4BT8 A;  2XRY A;  4GML A;  2BF0 X;  3MJW A;  2X38 A;  3CSF A;  3IHV A;  3UX4 A;  2V5F A;  2MRI A;  2WQH A;  4PS7 A;  2AW6 A;  4N39 A;  3SI5 A;  4ILH B;  4A3T A;  3D9J A;  3PE3 A;  3B7T A;  3ASG A;  3CEQ A;  4CEM A;  1UN8 A;  5FZR A;  5E75 A;  1ZU2 A;  4Q96 A;  2J9Q A;  1ELK A;  4TUU A;  4E6H A;  3MCX A;  3G2S A;  3FP3 A;  3EHM A;  1JWF A;  5FZQ A;  4ME2 A;  2XRZ A;  4G2V A;  4KYO B;  4UWF A;  3AS8 A;  3FUF A;  2VSO E;  3UUX A;  3MYV A;  1UN9 A;  1WY6 A;  2KCK A;  1OWO A;  3ESK A;  3FUN A;  3HDX A;  3HVE B;  3IV0 A;  3JQ0 A;  4K0R A;  4L7T A;  4LCT A;  4GYO A;  3S7B A;  2I1J A;  3FUE A;  3L54 A;  5DBK A;  4NRH B;  4B94 A;  4J8S A;  4MRU A;  4CT0 A;  2NSZ A;  5G2N A;  2WXJ A;  1IQU A;  1HFA A;  3CVN A;  4UI9 J;  5FQ8 A;  3RIB A;  3ZFW A;  5LOZ A;  4A1S A;  3CK9 A;  1IYG A;  3OTN A;  3ML8 A;  3R7R A;  4ILI A;  4LUN U;  4LRZ A;  4J0U A;  3QAQ A;  3ZHE A;  3APF A;  5M72 A;  3OXL A;  3PNT B;  4P29 A;  4E85 A;  2CHW A;  4UWL A;  2XPY A;  3FEX A;  2JLB A;  3FH7 A;  3LXU X;  3PRZ A;  3EJN A;  4AVX A;  3LPZ A;  4EZL A;  2WQ7 A;  3ZHE B;  3MA5 A;  1HS6 A;  3TGO A;  4N5C A;  1E96 B;  1LF8 A;  3QNK A;  1VDY A;  4HLE A;  1HO8 A;  3PS6 A;  5CHE E;  3VLF A;  2UY1 B;  3RO3 A;  3RJV A;  5G55 A;  2CHZ A;  4I6E A;  3IBE A;  4BWR A;  3LY7 A;  3FTW A;  5FWQ A;  4PS8 A;  4TV3 A;  3FH8 A;  5T4Y A;  3ZN3 A;  4JW1 A;  1DVP A;  3CVP A;  4ANV A;  3QDN A;  4JXT A;  3L22 A;  3AS5 A;  3R7Q A;  4AY5 A;  3SGH A;  5AIJ A;  4AEZ C;  1H6K A;  4GPK A;  2WQ6 A;  2VSY A;  2GRL A;  4U04 A;  2A5U A;  2CFZ A;  3FTU A;  2X6J A;  4G24 A;  3VLD A;  4APF A;  3EIQ C;  4CGV A;  2YHE A;  3AS4 A;  4N3A A;  5G05 C;  3I3N A;  4XZ4 A;  3FTZ A;  4MKT A;  3KAE A;  3UT7 A;  3Q49 B;  2NC9 A;  2NXP A;  5G05 J;  3D9L A;  3TJP A;  2BTD A;  2WXQ A;  4HOS A;  3VLE A;  2HO1 A;  2XPI A;  3ZGQ A;  4UWG A;  3QAR A;  2RD0 A;  2IOL A;  1ELW A;  1KT1 A;  2Y4T A;  3ZPJ A;  2CHX A;  3TAX A;  2KZT A;  4BTA A;  2LO6 A;  3T5V A;  2GGF A;  3R9A B;  4BFR A;  4AOF A;  1JWG A;  5KJK A;  1IQR A;  3FEY A;  4U63 A;  1OWL A;  1EYH A;  2WMO A;  3ASF A;  4B89 A;  2OVF A;  2YIN A;  2X6H A;  4GA2 A;  3GZS A;  4I17 A;  2WXO A;  5CCL A;  2GW1 A;  4C0E A;  1SZ9 A;  3CGH A;  5BV0 A;  3BG1 B;  5DIZ A;  2J08 A;  4EBA G;  3CVU A;  3RRM B;  5BUZ A;  2WVI A;  3FTV A;  3O4Z A;  2AXU A;  3ZYL A;  2DIW A;  3LKU A;  2AWI A;  3D9P A;  4HOR A;  4ABN A;  4CDN A;  5BT1 A;  5D0O D;  2P58 C;  1PY1 A;  3LVQ E;  5KJM A;  3PNL B;  3ZVV A;  5EKQ D;  5EX3 A;  4U07 A;  3PZD A;  3ULQ A;  3I4R B;  3UPV A;  4Q94 A;  3PUJ A;  2YNQ A;  4JC8 A;  4LER A;  2AXZ A;  4YVO A;  1L5J A;  3DBS A;  4APO A;  1ELR A;  3SZ7 A;  3UMV A;  5EDS A;  3U4T A;  1E90 A;  4FHK A;  1E7U A;  3IEG A;  3CVY A;  3OAW A;  4KVO A;  4UWH A;  2QFC A;  3D3M A;  3GZ1 A;  1H2U A;  2C2L A;  5AJD A;  4C9B B;  4N3C A;  2I9C A;  4JHJ A;  2IQC A;  1FCH A;  3PUK A;  1E8W A;  1HE8 A;  1SQM A;  3FWV A;  4L2L A;  4LEU A;  4G26 A;  2X6K A;  4EEC A;  3L17 A;  4AJW A;  4GB9 A;  5HI7 A;  2PQN A;  3G2U A;  4I9E A;  4XIF A;  1UW4 B;  2PQR A;  2XPZ A;  4B8C B;  3I5P A;  1EPU A;  2GRM A;  1HG2 A;  3EIJ A;  2L9B A;  3SHF A;  2VQ2 A;  3U3W A;  2E0I A;  3TL5 A;  3QK0 A;  2J07 A;  4OVU A;  4DI3 A;  3L6A A;  2HR2 A;  2FF4 A;  4UI9 C;  4G23 A;  5ARG A;  3D9K A;  3PVL A;  5ARF A;  4AP2 A;  3CHS A;  3CHR A;  4EPZ A;  3ONL A;  5J08 A;  4WWO A;  3ML9 A;  4XKB A;  3G2V A;  5T3R A;  2KM4 A;  4FJZ A;  4Q69 A;  5CMW A;  4ANX A;  5AYW D;  2V4L A;  2OND A;  4URK A;  5FQ6 A;  4U0Z A;  3QOU A;  2VTB B;  4KT6 B;  4ANW A;  3FTY A;  4XI9 A;  4M3O A;  1TEZ A;  1KT0 A;  2LAH A;  3GZ2 A;  5FT9 A;  3VTX A;  3B7U X;  3UT8 A;  3ZYK A;  4HOT A;  3D9N A;  2FI7 A;  1XNF A;  3CKC A;  3CHP A;  4GA1 A;  3S7J A;  4GZD A;  4U0S A;  4AXH A;  3FDH A;  2VJ8 A;  4UI9 K;  4JL0 A;  4GU5 A;  2WXL A;  4H7Y A;  4GZ5 A;  4B0Z A;  2YHC A;  5FQ7 A;  4BX8 A;  2IFU A;  3SF4 A;  2PL2 A;  4RVB A;  2CFU A;  2XQ0 A;  3CST A;  1A17 A;  5ENN A;  4CCA A;  3CK7 A;  5KJN A;  3S7D A;  1W3B A;  2CG2 A;  5C2Y A;  1H2T C;  3HYM B;  4FLH A;  2EQX A;  3P1U A;  3HVE A;  1QQE A;  2IU1 A;  1QNF A;  4IYP A;  4RSY A;  3ZYM A;  4F7A A;  4FP7 A;  3LS8 A;  4OVV A;  4WNE A;  4JEU A;  3T8M A;  3FUD A;  3QWW A;  2C0L A;  4NAC A;  5KCM A;  1E8X A;  2WM9 A;  3APC A;  3SNX A;  2BUG A;  3FFL A;  2XGO A;  3D9I A;  3KEZ A;  5BW8 C;  2R17 C;  2WXR A;  3PEV B;  4EQF A;  1H0A A;  1XGW A;  5FTP A;  2ION A;  3G2W A;  3CQC B;  4XE0 A;  5ANL A;  1HXI A;  2Q7F A;  4J8E A;  3FUK A;  3MEK A;  3T5X A;  4D10 C;  3JYS A;  2UWJ G;  3MKQ B;  5BNW A;  1QZ2 A;  4KMO A;  3RU0 A;  3NQP A;  4A1G A;  4GZ3 A;  3IKO B;  2FUL A;  4TRQ A;  3U66 A;  2KCL A;  2Y4U A;  5KJL A;  5C1D A;  4WUY A;  3ESL A;  3LY9 A;  5JJ6 A;  3FUJ A;  4I1O B;  1WM5 A;  4WAF A;  4Y6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...