1JUQA

Gga3 vhs domain complexed with c-terminal peptide from cation-dependent mannose 6-phosphate receptor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
151
structure length
151
Chain Sequence
ESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA3
publication title Structural basis for acidic-cluster-dileucine sorting-signal recognition by VHS domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 151
sequence length 151
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1juqA00
1X5BA 1HF8A 1HG5A 3RRUA 4GZDA 3D9JA 3G2UA 4HFGA 5LOZA 1HX8A 4FLBA 3G2VA 4Q94A 5CMWA 4JXTA 1LF8A 1JPLA 1EDUA 2V8SE 4Q96A 4GZCA 1HFAA 1SZAA 3D9OA 2QY7A 1XGWA 2BF0X 3ZYLA 1PY1A 3D9MA 1JWFA 3ZYKA 2KM4A 3ONKA 1DVPA 2DIWA 1VDYA 4FU3A 1UJKA 4AVXA 1H0AA 1EYHA 3D9KA 3D9PA 3G2SA 1UJJA 3G2WA 4NACA 3ZYQA 1JUQA 3ZYMA 5CMYA 3D9NA 1JWGA 5J08A 1INZA 3G2TA 2L0IA 3D9LA 3ONLA 3D9IA 1SZ9A 1HG2A 1MHQA 2MOWA 3CLJA 1ELKA 2DCPA 2L0TB 5LP0A 3LDZA 2LO6A
chains in the Genus database with same CATH superfamily
5G05C 3LVQE 4X8QA 2KATA 3AS8A 1YA0A 1TNZA 5ARGA 3PNTB 3TXNA 3PNLB 3TWSA 3UIOC 3RIBA 5ENTD 2WXNA 2J4BA 4GTVA 2C0LA 1N4RA 1LD8A 4GU5A 2MRIA 2WXMA 4B8AA 4Q94A 3NQPA 3QAQA 5ENNA 2IU1A 3ISMC 2P9IG 3VLDA 3HXEA 3CSFA 3CHRA 3FTSA 3RO3A 2X3MA 1MHQA 3APDA 4N39A 4TRQA 3CIAA 4G23A 2IJGX 4I1AA 3FU3A 1RW2A 4I17A 4GAAA 1E96B 3D9PA 1H2UA 4U8VD 4EECA 4DLQA 4HXIA 3C3RA 3GZ2A 4EZJA 4N5CA 1HH8A 3PZ1A 4GPKA 4WWOA 3QWWA 5AENA 4K5CA 4J8DA 3KSLA 5G55A 1OWOA 4JHKA 3UPVA 4I9EA 2ZU6B 3PE3A 1JPLA 3RAUA 3MV3B 3OXFA 3Q75A 3AU5A 4XKBA 4HOQA 3ZYQA 5E75A 5KWDA 4OYSA 2XPIA 3FY4A 2P2CP 3IXEA 4JC8A 2GRPB 5JHBA 5FQ8A 4L2YA 3L22A 3T9KA 4CCAA 4AXHA 4G2VA 4L23A 4GZ6A 2NXPA 4WWPA 5BXOA 1O1SA 3UMVA 4P29A 3ZNGA 3LVRE 2EQXA 4FHJA 2I1JA 2HR2A 2GRLA 2F37A 2F8YA 3UI2A 2WXJA 1E7UA 3QKYA 2FO1E 4DX5D 2M63A 1NFIE 2KCLA 3PZDA 3D9KA 4F1SA 3ZYMA 3G2WA 3PEUB 3PDNA 3VTXA 3QK0A 1OWLA 5JJ6A 3BG0B 2WB2A 3B7BA 4U8HA 3G2VA 1OWPA 3CVXA 3U66A 4GZCA 5CCMA 4BX8A 2ILRA 2A4ZA 3L82A 2GRMA 2ONDA 1UJJA 3LCAA 4UWLA 1JCRA 1KPSB 4FC8A 3FUKA 5LP0A 5CEAA 4JHJA 3I5PA 2IONA 3CVLA 3ULQA 4CZ2D 2GRRB 4U0UA 5ENRD 5JJTA 5T8IA 3D3MA 2WXFA 3TL5A 4HB5A 2VGEA 1Y8MA 3LY9A 3V30A 3Q9NC 5CRUA 1HF8A 3AJIA 1K1BA 4EZKA 4KBQA 3O4ZA 4GMRA 3MX3A 3EU9A 1N54A 4K03A 2P9SG 3KS2A 5IY5E 2AVPA 4N3AA 4ATZD 2C2LA 4HLEA 3HDXA 4HI8A 3FFLA 3SFXA 3ABKE 2KM4A 2CHWA 4G8KA 2XZDG 3CHMA 4Q69A 3EUVA 4GTQA 5A6CA 1AWCB 4N3CA 3NOGD 2Q7FA 3D9HA 4FADA 3TWVA 5DIZA 3NB2A 2V5QC 5C1DA 4YDOA 4CT0A 4H7XA 1N11A 2VGYA 5CBNA 3MGBA 5BV1A 3E30A 4LCTA 3L17A 2KXPC 5AQAA 1NZNA 2P9KG 3UT8A 2WMOA 1WAO1 4AIFA 2BEDA 3KAEA 3B13A 3ZRHA 2XPZA 2GRNB 4Z68A 3B7SA 3OAWA 4GMLA 2OCCE 3UM0A 4JA9A 1SA4A 5FIOA 3PZ2A 1OWNA 2J07A 3JXJA 5LOZA 4PS7A 2XGSA 4GYWA 4J6IA 2JABA 4ANUA 3TWRA 1O1TA 4NACA 1SVXA 3PEVB 4UWGA 2VGXB 2X6KA 3ABME 3LYAA 4WNEA 3DXKG 3DSSA 1SZ9A 2P9UG 1ZU2A 5AAOA 4CGVA 1NI1A 1U3DA 2XENA 1HE8A 3TWUA 3Q73A 1H6OA 3PH0C 4LSZE 3TWWA 2WXPA 4OVUA 1N4SA 3SY2A 1FVHA 3G2TA 3CVUA 1B89A 3BUAA 4U04A 2FULA 3P1UA 4B93B 1P5QA 4UUCA 4J0UA 4A1GA 4BERA 3MA5A 4AJWA 3MKQA 4XI0A 4A55A 2L6JA 3UQ3A 4CRWA 5BV0A 4RG9A 3D9NA 2PL2A 4IRUA 1H19A 3PS6A 4G24A 4FLBA 2R03A 1TJFA 2VGXA 2WQHA 4C0MA 3ZPJA 3SFZA 1DCEA 1U2VG 4LNBA 1S64A 3CVQA 1E7VA 3LDZA 3GYZA 5FQ4A 3Q5MA 2XGMA 4YVOA 1HS6A 1NA0A 5E76A 4EPZA 3ZW3A 2EIKE 3S7JA 3EJNA 2UY1A 4IYPA 3Q7FA 4RSYA 3T5VA 1K1AA 2CG2A 5EYLA 2DYRE 4A3VA 1V55E 4MS6A 4CDNA 1KT1A 4F1PA 3GW4A 2LUHA 2WPVA 2A5EA 4FJYA 4MBGA 4QFVA 5AN8A 2XGOA 4CT4A 4ILGA 2DVWA 4I9CA 1OY3D 4U8YD 5H7PA 2IOSA 1SW6A 4APFA 1N94A 3FU5A 3FUNA 4GZ5A 2XEVA 3D9OA 2Y4TA 3UIPC 4NURA 3U9WA 4DX6D 5A23A 1IKND 3RO2A 3NZSA 3X2QE 4HFGA 4ZHBA 4H7YA 2RFAA 2E0IA 3HXFA 4UWFA 4JEUA 2NSZA 3VLEA 2VSYA 2P9NG 5KNGA 4M7CA 3F6QA 2GRQB 2LO6A 1MYOA 2BKGA 4HORA 3ULEG 4EBAA 1YYHA 1W3BA 3PVLA 5JMND 3CVWA 1TR4A 4PDXA 4DLOA 4F53A 3E4BA 3Q79A 1WG0A 3SBTB 2AXVA 3DSWA 4G26A 1S63A 2AWIA 3PZ4A 4BTAA 1SZAA 4HI9A 2R05A 2OV8A 4GCOA 4TUUA 4K0RA 2P9PG 3FUMA 2WXRA 4AV7A 4PS3A 4XX5A 3SZ7A 3UINC 4L9PA 5FQ6A 3E34A 2LAIA 3ULYA 2BF0X 3D9MA 2XCBA 3ONKA 3L08A 3ZN3A 3TGOA 2PQNA 1OT8A 4HRNA 4ATGA 4GTTA 4IN3B 2P9LG 1BI8B 3S7FA 3LJ3A 5BPPA 2XZTG 5ARFA 2QFCA 3HRAA 4LUNU 1IHGA 5BW8C 4AVXA 4AM9A 5J08A 3SO8A 3UX4A 2L0IA 2OEWA 3V2OA 3EHRA 2XS8A 3AS5A 5EX0A 3MJWA 4ANXA 5CMWA 2VSXE 3HIZA 3MCXA 2QYUA 3OXGA 3C5RA 2WXGA 1JUQA 2H6GA 1HG2A 3TWQA 5CCLA 5EDSA 3B7TA 4MLPA 3CHSA 1Y6IA 2QYJA 1D8DA 4K5AB 3KEAA 3SQVA 2AW6A 3QOUA 4ME2A 2XRZA 2DWZA 2FI7A 3FUEA 4YVQC 3FH8A 4JW1A 4DX7D 4RVBA 1WY6A 4G11A 5FZQA 1MX2A 4WNGA 3CVVA 3GZ1A 5KNHD 3CHQA 2WQ6A 3JQ0A 2IOLA 4A3TA 4HOTA 3NZUA 4UQYA 4GA2A 4MKTA 5AJLA 4BTBA 3CGHA 1QBQA 4E6HA 2H6FA 2GROB 4D10C 3CKBA 3JYSA 1X5BA 2VSNA 3P2BA 3L13A 1OCOE 4KZ0A 4XI9A 1LD7A 1D9SA 2R17C 3DSVA 2Y0BG 3CR3A 4NRHB 1AP7A 4J8EA 4RQIA 2DZOA 3LY8A 3J5PA 4TUMA 1HX8A 5D0QD 3FU0A 5B3SE 3SGHA 3CVNA 1N9AA 3APFA 1OCRE 3ASGA 2EINE 4L7TA 4FJZA 4U96D 2VJ8A 3HYMB 3O48A 3UM1A 5AQ7A 2XEEA 3FUIA 3IHVA 4BEPA 5EN5D 3VLFA 3MYVA 1IHBA 3U3WA 5CHEE 3WXXA 5FT9A 5G2NA 3Q78A 4LERA 5KJKA 4DRXE 3PE4A 2R2LA 4U07A 4URKA 1UG3A 2DBAA 4GMJA 2FBNA 3JXIA 1EDUA 4J8YA 1HFAA 3R9MA 1MQSA 3JQ1A 3ZXPA 3T8MA 3KSQA 4PH4B 2X6FA 2KCVA 3MEKA 1JCSA 4CEMA 4GTOA 4RG6A 4BX9A 2QZAA 3FHEA 2DCPA 2L0TB 2GGFA 4UWKA 3ZIMA 4OVVA 1UOHA 5C2YA 4K5BA 2IY0C 4YDWA 3Q47B 4I2ZA 5JJ7A 3DEOA 1BU9A 2LNIA 3RSEG 4DI3A 3CV0A 1Z6TA 2WM9A 3L9TA 2BTDA 5AQBA 5KJMA 1BD8A 4WAFA 1ELWA 4ANVA 4F3VA 3TJPA 5ENPD 3JCKC 3MKQB 2OVFA 2EIME 2V5FA 4GTMA 4N2QA 3FWVA 3EIQC 2ZISA 1MZCA 4BSZB 1H2TC 1TNUA 3UT7A 2OVBA 2B0OE 4TXQA 4AP2A 2Y69E 4U0ZA 1RZ4A 5FWQA 3IHYA 1DVPA 2JLBA 4U0SA 3HVEB 4HS2A 4FLHA 3UUXA 1K8KG 2KBXA 4GTSA 4GZ3A 1HG5A 1KZPA 3FUHA 3TG5A 5ENSD 4JA7A 3TWTA 2V4LA 2EIJE 5BT1A 4BT8A 5AJDA 5CRVA 4U7EB 2Y3AA 3UXGA 3FUDA 2UY1B 2HYZA 3FUJA 4FP7A 3CKCA 4JD2G 3HG0D 1U3CA 4GYOA 4N2SA 3G2UA 4UI9K 5FTPA 1OUVA 1LF8A 1IYGA 3IBEA 4JEHA 2R59A 1YCSB 3LKUA 3C3OA 5HKPA 4DX2A 3AAAC 2DZNA 4HNAD 4PUCA 2DIWA 5LFAA 1H0AA 2ETAA 3CQGB 4JZYA 3HXCA 3RRMB 2ETBA 2IQCA 4ILIA 2YNQA 2WVIA 3CLJA 4G1TA 5ENQD 1FT1A 2FF4A 3PREA 3GZSA 3HVEA 3K9IA 5T4YA 2I6HA 2PZIA 2J08A 4DI4A 4C9BB 2PM6A 3DEPA 3RJVA 3FUFA 3EIJA 2FEZA 4ACKA 4LRZA 5AARA 4XEIG 3S2AA 3Q4AB 4C48B 5AYWD 3RRNB 2KCKA 3AG1E 1OCZE 2UWJG 2V8SE 4GYYA 1TNBA 3DWLG 1L5JA 4AOFA 2KZTB 3LS8A 3DSXA 1LTXA 4BETA 3DSUA 3ABLE 2YINA 4Y6CA 4OAUC 4ANWA 4RLYA 1H6KA 5D0OD 3TXMA 4ACLA 3Q7AA 2CHZA 2NYJA 4YDYA 2E2EA 3QARA 2FO7A 3OTNA 2CHXA 3ENEA 5FJYA 4I6JA 3QWVA 4TXPA 3Q15A 4F7AA 4I1OB 3BQOA 3QWPA 2CG3A 3KEZA 3L54A 2LSUA 4N3BA 4DX1A 4U63A 3U64A 3SF4A 2I1KA 4EZLA 3ZYLA 3NAWA 4LG6A 1TNOA 4AY6A 4M3OA 5JA4D 3ASNE 2IFUA 5EIBE 2ZIRA 3ONLA 1A5EA 4HRLA 3B7UX 5BNWA 4N5QA 1N0QA 2KZTA 3UM2A 1E90A 3I3NA 3NOCD 3UKRG 1JWFA 1O5MA 5EIDA 4QQIA 4JVSA 1FVFA 3UM3A 3UT4A 4A63B 4NQ0A 5CEDB 1Z3XA 1DNPA 2XS1A 4GPMA 5M72A 1NA3A 1QQEA 3PRZA 2MHKA 1IXVA 4UI9C 4L1BA 3ZGQA 1E8YA 3FDHA 4O1PA 1JCQA 3JUIA 5HI7A 2KC7A 2WXQA 3UKUG 4XKCA 4L2LA 3CEQA 5FQ7A 4CDRA 2RKKA 4HLLA 3J5QB 4I6EA 4F6RD 3LXUX 1GW6A 2VTBB 2Y4UA 4KVOA 3E37A 5ANLA 1S70B 3CHPA 3S7DA 2J8SD 5D2MC 3AG2E 1N4PA 4YDEA 1YMPA 1WM5A 4JL0A 1KLXA 3TWXA 3HHMA 4JHRA 4R7LA 3ASHA 3FTXA 1JWGA 3I4RB 5LCWC 1IQRA 3FTUA 3CSTA 3SBSA 3ZVVA 3D9JA 5AQ9A 5KCMA 4GZDA 3JUEA 5EX3A 2XHEA 4Q96A 1A17A 4XIFA 3RU0A 3RK6A 3KD7A 1SQMA 1QZ2A 1WDYA 1NL4A 3FP3A 3CQCB 2X6IA 4G8LA 3HXDA 5ANRA 1TYQG 5HS0A 3MV2B 4O1OA 4GB9A 1NP7A 2VTBA 5JHAA 1ZB1A 3FH7A 3ZEFA 3V79K 5G04C 1TN7A 3DSTA 2OEVA 1MJ0A 4WWNA 2C0MA 1E8XA 3NBNB 5T3RA 4CGWA 3IKOB 4LEUA 2CFUA 3AS4A 4BWRA 1ELKA 3WG7E 3APCA 4WNFA 3LEWA 3FEYA 5ITZF 5CECB 2GW1A 1EF1C 2ZXWE 4GA0A 4Y6WA 2H6HA 4BY6A 4U95D 5FZSA 3CVPA 2CFZA 3ASFA 4HBDA 4NIKA 2QC9A 2VQ2A 3BG1B 2V0PA 4ABNA 3RRUA 3ZFWA 2X38A 1BI7B 3W9FA 1PC2A 1EPUA 3ZXSA 3DRAA 1XGWA 4UQZA 3AU4A 1FCHA 2WXLA 1UJKA 2HO1A 3MZLB 1N52A 2R02A 4KZCA 5AIJA 2ZGGA 1MX6A 4J7WA 4XE0A 3PUJA 4J8SA 1BLXB 5LX8A 1DCQA 1IQUA 4WUYA 2F0YA 1Q2ZA 4HVBA 3ZYKA 4YNDA 3ZHEB 4KYOB 4FU3A 1EYHA 4JPSA 2IO3C 4O60A 3R7QA 4UI9J 3VTYA 3FTWA 3FH5A 5HRYA 3R9AB 5FZRA 2XQ0A 3V31A 2IF4A 4PS8A 2XRYA 1D8EA 2LXLA 5G05J 5J90A 2L9BA 2V4HC 4I1MA 4HOUA 4AY5A 2NC9A 1TN6A 3EDTB 3UTMA 1INZA 3TG4A 3RKVA 3Q49B 3LY7A 3DBSA 1OCCE 4B89A 4JB8P 4GTRA 3SNXA 3OXLA 4J8FA 3ESKA 3SFYA 4DJAA 3CK7A 3R7RA 2PM7A 3ML8A 1BPOA 3QC1A 2J9QA 4GTPA 4KXKB 4A1SA 5LCWJ 3N71A 3QJZA 5ENOD 3ZHEA 3HXBA 4HQDA 4W9RA 3SHFA 1TJCA 4DK5A 4KT6B 4WNDA 1MX4A 1TNYA 3CVYA 3IEGA 3PZ3A 2I2OA 2L6BA 5BXUA 1QNFA 1V54E 3ZUVB 3B95A 3C98A 1HZ4A 5D66A 4APOA 3S7BA 2RG8A 2JEKA 1E8WA 1UW4B 2J4DA 1VDYA 1HO8A 3B7RL 2A5UA 3CK9A 1OWMA 2WXKA 3LJNA 2VSOE 2WXIA 3ZU7B 5G04J 3E33A 3SD5A 3FTZA 3DPDA 5EYPF 3ASDA 3BU8A 2HM8A 4EBAG 1UN8A 2BUGA 4FA6A 1H6PA 2OOEA 2YHCA 4E85A 3D9IA 3EU5A 1G3NB 2F8XK 4LNGA 3FU6A 3EHNA 2XPYA 2B6CA 4EQFA 4JXTA 2WXOA 3QB2A 2XEHA 5KBAA 1ELRA 5FINA 4BSXA 1FT2A 4DPRA 1N4QA 1E8ZA 5BUZA 3CK8A 4I2WA 4C0EA 1OXJA 1Z3YA 3ML9A 5CERB 2DYSE 2LXMA 3IV0A 4BT9A 2WMNA 4UWHA 3FTYA 3DPYA 5HQ8A 3PUKA 5CBOA 3W9GA 3T8KA 3C3QA 3AG3E 1S0PA 4MRUA 1KT0A 4B94A 4O6FA 2LSVA 2EILE 2BKKB 4ZFHA 4I43A 3ASOE 3NF1A 2R5SA 3CHOA 1DC2A 5KJLA 4B8CB 3SI5A 1PAQA 2WXHA 5EKQD 5DBKA 5A7DB 2VYIA 3QNKA 3TAXA 3QDNA 5EILA 3EHQA 1Z5SC 2MYOA 3FEXA 4DUIA 1X81A 2J09A 4V3IA 2YHEA 1N0RA 2PQRA 4TV3A 2Y1LE 1XNFA 4CYMD 2ETCA 3I4GA 4OAVB 4XZ4A 5KJNA 2XCCA 4BFRA 3L16A 5B1BE 4KMOA 2IEJA 1N95A 3G2SA 3LPZA 2X6HA 4EHMA 2PNNA 3ZKJA 1TEZA 3FULA 3E32A 4BESA 4HRMB 1SA5A 4FHKA 1QYMA 1K3ZD 2YQ8A 2HE0A 3D9LA 4CDMA 4UQXA 3ESLA 3T5XA 4ILHB 1O1RA 3Q9UC 4AEZC 1ZBPA 3AG4E 4B0ZA 2AJAA 2LAHA 3FTVA 3EHMA 3DXMG 4LNUD 1PY1A 4HOSA 3L6AA 1HXIA 4IULA 2AXZA 2ZGDA 1H2VC 2X6JA 2RFMA 4GA1A 4KVMA 4G25A 2RD0A 2P58C 2J49A 2AXUA 4I6GA 3URZA 1FPPA 1HU3A 2QY7A 4TXRA 1UN9A 3MKRA 3U4TA 4FULA 3BEEA 2I9CA 3V2XA 2H6IA 5CMYA 1KZOA 4GCNA 1TN8A 2IO2C 3C72A 2MOWA 5B1AE 2WQ7A
chains in the Genus database with same CATH topology
2PL2A 4IRUA 4UWKA 3ZIMA 4OVVA 1H19A 3APCA 3PS6A 4G24A 4WNFA 5G05C 3LEWA 4FLBA 5C2YA 1TJFA 3FEYA 2VGXA 3LVQE 2GW1A 1EF1C 2WQHA 3Q47B 2KATA 3AS8A 4GA0A 1YA0A 4Y6WA 4C0MA 4BY6A 5ARGA 3ZPJA 4I2ZA 3SFZA 3PNTB 5JJ7A 3TXNA 3PNLB 5FZSA 3CVPA 3RIBA 2CFZA 3ASFA 2WXNA 2J4BA 2LNIA 3CVQA 1E7VA 2C0LA 2VQ2A 3CV0A 3BG1B 4DI3A 2V0PA 3LDZA 1Z6TA 4GU5A 4ABNA 2WM9A 3GYZA 5FQ4A 3Q5MA 3RRUA 2X38A 2XGMA 3ZFWA 2MRIA 2BTDA 4YVOA 1HS6A 2WXMA 1NA0A 5E76A 4EPZA 4B8AA 3ZW3A 4Q94A 3S7JA 3EJNA 5KJMA 1PC2A 2UY1A 1EPUA 3NQPA 3QAQA 4IYPA 2IU1A 4WAFA 5ENNA 3ZXSA 4RSYA 3T5VA 1XGWA 1ELWA 4UQZA 3VLDA 4ANVA 4F3VA 3AU4A 1FCHA 2WXLA 1UJKA 2CG2A 3TJPA 2HO1A 3MZLB 1N52A 3CSFA 3JCKC 3CHRA 4KZCA 4A3VA 5AIJA 3FTSA 3RO3A 3MKQB 2OVFA 4MS6A 3APDA 1MHQA 2X3MA 4CDNA 1KT1A 4N39A 2V5FA 4TRQA 4XE0A 4N2QA 3CIAA 3PUJA 3FWVA 3EIQC 4J8SA 4G23A 2IJGX 3GW4A 2WPVA 5LX8A 1IQUA 1H2TC 4WUYA 4FJYA 4I1AA 3UT7A 2OVBA 3FU3A 4QFVA 4HVBA 3ZYKA 4AP2A 2XGOA 4I17A 4U0ZA 4YNDA 5FWQA 3IHYA 4ILGA 4CT4A 1DVPA 2JLBA 4I9CA 4GAAA 4KYOB 3ZHEB 4FU3A 4U0SA 1E96B 1EYHA 3D9PA 3HVEB 1H2UA 4JPSA 4HS2A 4FLHA 2IOSA 3R7QA 4UI9J 3VTYA 4EECA 3FTWA 3FH5A 3R9AB 4APFA 4DLQA 4HXIA 3UUXA 5FZRA 2XQ0A 2IF4A 4GZ3A 1HG5A 4PS8A 3FUHA 3FU5A 2XRYA 3TG5A 5G05J 3FUNA 3GZ2A 4JA7A 4GZ5A 5J90A 4EZJA 2L9BA 2V4LA 5BT1A 2XEVA 3D9OA 4N5CA 5AJDA 4BT8A 2Y4TA 1HH8A 4I1MA 4HOUA 4WWOA 4AY5A 4GPKA 2Y3AA 2NC9A 3QWWA 4NURA 3U9WA 5AENA 3EDTB 3FUDA 2UY1B 4J8DA 2HYZA 3FUJA 1INZA 4FP7A 3TG4A 3CKCA 3Q49B 5G55A 3RKVA 3LY7A 1U3CA 3DBSA 5A23A 4GYOA 1OWOA 4N2SA 3RO2A 3NZSA 4JHKA 4B89A 4I9EA 3UPVA 2ZU6B 3G2UA 4HFGA 4UI9K 4H7YA 5FTPA 3PE3A 1OUVA 1JPLA 1LF8A 3SNXA 1IYGA 3IBEA 2E0IA 2R59A 4JEHA 3MV3B 3OXLA 4J8FA 3ESKA 3OXFA 3LKUA 4UWFA 4JEUA 3AU5A 4PUCA 2DIWA 4XKBA 5LFAA 4DJAA 3CK7A 4HOQA 1H0AA 3R7RA 3ZYQA 2NSZA 3VLEA 2PM7A 3CQGB 3ML8A 4JZYA 2VSYA 5E75A 1BPOA 3QC1A 4OYSA 2J9QA 3RRMB 2IQCA 2XPIA 3FY4A 4ILIA 4KXKB 2YNQA 2WVIA 4A1SA 3CLJA 5LCWJ 4G1TA 2LO6A 4JC8A 5JHBA 3N71A 3QJZA 5FQ8A 2FF4A 3ZHEA 4HORA 3PREA 3GZSA 4L2YA 3HVEA 3L22A 4EBAA 4W9RA 3SHFA 1W3BA 3PVLA 1TJCA 3K9IA 5T4YA 2I6HA 4CCAA 4AXHA 3CVWA 4DK5A 4KT6B 4G2VA 4WNDA 4L23A 4GZ6A 2PZIA 2J08A 4DI4A 3CVYA 4C9BB 2NXPA 3IEGA 4PDXA 4WWPA 2PM6A 3UMVA 4P29A 3RJVA 3FUFA 3EIJA 4DLOA 4F53A 2FEZA 3LVRE 4ACKA 2I2OA 4LRZA 1QNFA 3S2AA 2EQXA 4FHJA 2I1JA 3Q4AB 2HR2A 3E4BA 2GRLA 3C98A 1HZ4A 3SBTB 4APOA 2AXVA 4G26A 5AYWD 3RRNB 2KCKA 3S7BA 2AWIA 2RG8A 2UWJG 2WXJA 2V8SE 1E7UA 3QKYA 4BTAA 2JEKA 1SZAA 1E8WA 2M63A 4GYYA 1UW4B 2J4DA 2KCLA 1L5JA 2OV8A 4GCOA 2KZTB 4TUUA 4AOFA 4K0RA 1VDYA 1HO8A 3LS8A 3PZDA 3D9KA 4F1SA 3ZYMA 3G2WA 3PEUB 3FUMA 3B7RL 2YINA 2WXRA 4Y6CA 4AV7A 2A5UA 3CK9A 1OWMA 4ANWA 2WXKA 4PS3A 3PDNA 3VTXA 1H6KA 3QK0A 5D0OD 4XX5A 3SZ7A 3TXMA 1OWLA 2VSOE 4ACLA 2WXIA 5JJ6A 5G04J 3BG0B 3SD5A 3FTZA 5FQ6A 3DPDA 2WB2A 2LAIA 3ASDA 4U8HA 3G2VA 2CHZA 1OWPA 2HM8A 3U66A 4GZCA 3CVXA 5CCMA 4BX8A 2ILRA 2BF0X 2A4ZA 2E2EA 3D9MA 2XCBA 4EBAG 3ONKA 1UN8A 2GRMA 3QARA 2ONDA 2FO7A 3OTNA 2CHXA 2BUGA 3L08A 3ZN3A 4FA6A 1UJJA 3ENEA 3LCAA 4UWLA 3TGOA 5FJYA 2OOEA 4I6JA 4FC8A 3QWVA 3FUKA 3Q15A 4F7AA 2PQNA 2YHCA 3D9IA 4I1OB 4E85A 5LP0A 3FU6A 4ATGA 3EHNA 4IN3B 4JHJA 3I5PA 2IONA 3QWPA 2CG3A 3KEZA 3CVLA 2XPYA 3L54A 2LSUA 4N3BA 3ULQA 3S7FA 4U63A 3U64A 4EQFA 3LJ3A 4JXTA 5BPPA 4U0UA 3SF4A 2WXOA 5JJTA 5ARFA 3QB2A 5T8IA 3D3MA 2I1KA 4EZLA 3ZYLA 2WXFA 2QFCA 4LUNU 1IHGA 3TL5A 1ELRA 5BW8C 1Y8MA 4AVXA 4AY6A 4M3OA 4AM9A 3LY9A 5J08A 2IFUA 3UX4A 2L0IA 3ONLA 4BSXA 4DPRA 3B7UX 5BNWA 1HF8A 1E8ZA 3AS5A 5BUZA 3CK8A 2KZTA 4EZKA 5EX0A 3MJWA 4I2WA 4ANXA 4KBQA 4C0EA 1E90A 5CMWA 1Z3YA 3I3NA 3ML9A 3O4ZA 3MX3A 3IV0A 1N54A 2VSXE 1JWFA 3HIZA 3MCXA 4K03A 4BT9A 3OXGA 2WMNA 4UWHA 3FTYA 2WXGA 5HQ8A 3PUKA 3KS2A 1JUQA 2AVPA 4JVSA 1FVFA 3UT4A 4N3AA 5EDSA 1HG2A 2C2LA 5CCLA 3B7TA 1S0PA 4MLPA 3CHSA 1Y6IA 4MRUA 4NQ0A 4HLEA 3HDXA 1KT0A 1Z3XA 4B94A 3FFLA 4O6FA 1DNPA 2LSVA 5M72A 1NA3A 1QQEA 4I43A 2KM4A 2AW6A 3NF1A 2CHWA 3PRZA 3QOUA 2MHKA 4ME2A 2R5SA 2XRZA 3FUEA 2FI7A 4UI9C 3CHMA 3CHOA 4L1BA 4YVQC 4Q69A 5KJLA 3ZGQA 1E8YA 3FH8A 4JW1A 3FDHA 4B8CB 5A6CA 4RVBA 1WY6A 4G11A 3SI5A 4N3CA 5HI7A 3JUIA 1PAQA 5FZQA 4WNGA 3CVVA 2KC7A 2WXHA 5EKQD 5DBKA 5A7DB 2Q7FA 2VYIA 3CHQA 3GZ1A 3QNKA 3TAXA 4FADA 3JQ0A 2WQ6A 2WXQA 2IOLA 3QDNA 4A3TA 4XKCA 4L2LA 3CEQA 5FQ7A 3FEXA 4CDRA 5DIZA 2J09A 4HOTA 5C1DA 3NZUA 4UQYA 4V3IA 2YHEA 4CT0A 4I6EA 4H7XA 2VGYA 4GA2A 2PQRA 4MKTA 3MGBA 5AJLA 4TV3A 4BTBA 5BV1A 3LXUX 1GW6A 3CGHA 4LCTA 2VTBB 2Y4UA 4KVOA 3L17A 1XNFA 4E6HA 5ANLA 3I4GA 3CHPA 4D10C 3CKBA 3S7DA 1NZNA 3JYSA 1X5BA 2VSNA 3P2BA 3UT8A 3L13A 2WMOA 1WAO1 4KZ0A 4XI9A 4AIFA 4XZ4A 3KAEA 3B13A 3ZRHA 5KJNA 2R17C 2XCCA 3CR3A 1WM5A 2XPZA 4JL0A 4NRHB 1KLXA 3B7SA 4J8EA 4BFRA 3OAWA 3HHMA 3L16A 4JHRA 4R7LA 3ASHA 3LY8A 3FTXA 4GMLA 1JWGA 3I4RB 4KMOA 5LCWC 1IQRA 3FTUA 3CSTA 4JA9A 3SBSA 3ZVVA 3D9JA 3G2SA 5KCMA 1OWNA 2J07A 4GZDA 3LPZA 5LOZA 2X6HA 1HX8A 4PS7A 5EX3A 2XHEA 4Q96A 5D0QD 1A17A 3FU0A 1TEZA 2XGSA 4XIFA 3SGHA 4GYWA 3RU0A 3FULA 3RK6A 3CVNA 4J6IA 3KD7A 1SQMA 4ANUA 3APFA 4FHKA 4NACA 1QZ2A 3PEVB 4UWGA 2VGXB 2X6KA 2YQ8A 3ASGA 3LYAA 4WNEA 3D9LA 3FP3A 4UQXA 4CDMA 1SZ9A 3CQCB 4FJZA 2X6IA 4L7TA 3ESLA 3T5XA 2VJ8A 3HYMB 3O48A 4ILHB 5ANRA 1ZU2A 4AEZC 1ZBPA 3MV2B 4CGVA 1U3DA 4B0ZA 4GB9A 2LAHA 3FUIA 3FTVA 3EHMA 3IHVA 1NP7A 2VTBA 1HE8A 1PY1A 3VLFA 3MYVA 5JHAA 4HOSA 3L6AA 3PH0C 1HXIA 3FH7A 4IULA 2WXPA 4OVUA 3U3WA 5CHEE 3WXXA 2AXZA 5FT9A 1FVHA 3G2TA 5G2NA 3ZEFA 3CVUA 5KJKA 4LERA 1H2VC 3PE4A 1B89A 4U07A 5G04C 2X6JA 4U04A 4GA1A 4URKA 2FULA 4KVMA 3P1UA 4WWNA 4G25A 2RD0A 2P58C 2J49A 1UG3A 2AXUA 1P5QA 2DBAA 4I6GA 3URZA 4GMJA 4J0UA 2FBNA 2C0MA 1E8XA 4A1GA 1EDUA 5T3RA 1HFAA 3MA5A 4AJWA 1HU3A 2QY7A 1MQSA 3MKQA 4XI0A 4CGWA 1UN9A 3JQ1A 3T8MA 4A55A 3IKOB 2L6JA 3MKRA 3U4TA 4PH4B 4FULA 3UQ3A 2X6FA 2KCVA 4LEUA 4CRWA 5BV0A 3BEEA 2I9CA 3MEKA 2CFUA 4RG9A 4CEMA 5CMYA 3D9NA 3AS4A 4GCNA 4BWRA 4RG6A 4BX9A 3FHEA 2MOWA 2WQ7A 1ELKA 2DCPA 2L0TB 2GGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X5B A;  1HF8 A;  1HG5 A;  3RRU A;  4GZD A;  3D9J A;  3G2U A;  4HFG A;  5LOZ A;  1HX8 A;  4FLB A;  3G2V A;  4Q94 A;  5CMW A;  4JXT A;  1LF8 A;  1JPL A;  1EDU A;  2V8S E;  4Q96 A;  4GZC A;  1HFA A;  1SZA A;  3D9O A;  2QY7 A;  1XGW A;  2BF0 X;  3ZYL A;  1PY1 A;  3D9M A;  1JWF A;  3ZYK A;  2KM4 A;  3ONK A;  1DVP A;  2DIW A;  1VDY A;  4FU3 A;  1UJK A;  4AVX A;  1H0A A;  1EYH A;  3D9K A;  3D9P A;  3G2S A;  1UJJ A;  3G2W A;  4NAC A;  3ZYQ A;  1JUQ A;  3ZYM A;  5CMY A;  3D9N A;  1JWG A;  5J08 A;  1INZ A;  3G2T A;  2L0I A;  3D9L A;  3ONL A;  3D9I A;  1SZ9 A;  1HG2 A;  1MHQ A;  2MOW A;  3CLJ A;  1ELK A;  2DCP A;  2L0T B;  5LP0 A;  3LDZ A;  2LO6 A; 
#chains in the Genus database with same CATH topology
 5G05 C;  3LVQ E;  4X8Q A;  2KAT A;  3AS8 A;  1YA0 A;  1TNZ A;  5ARG A;  3PNT B;  3TXN A;  3PNL B;  3TWS A;  3UIO C;  3RIB A;  5ENT D;  2WXN A;  2J4B A;  4GTV A;  2C0L A;  1N4R A;  1LD8 A;  4GU5 A;  2MRI A;  2WXM A;  4B8A A;  4Q94 A;  3NQP A;  3QAQ A;  5ENN A;  2IU1 A;  3ISM C;  2P9I G;  3VLD A;  3HXE A;  3CSF A;  3CHR A;  3FTS A;  3RO3 A;  2X3M A;  1MHQ A;  3APD A;  4N39 A;  4TRQ A;  3CIA A;  4G23 A;  2IJG X;  4I1A A;  3FU3 A;  1RW2 A;  4I17 A;  4GAA A;  1E96 B;  3D9P A;  1H2U A;  4U8V D;  4EEC A;  4DLQ A;  4HXI A;  3C3R A;  3GZ2 A;  4EZJ A;  4N5C A;  1HH8 A;  3PZ1 A;  4GPK A;  4WWO A;  3QWW A;  5AEN A;  4K5C A;  4J8D A;  3KSL A;  5G55 A;  1OWO A;  4JHK A;  3UPV A;  4I9E A;  2ZU6 B;  3PE3 A;  1JPL A;  3RAU A;  3MV3 B;  3OXF A;  3Q75 A;  3AU5 A;  4XKB A;  4HOQ A;  3ZYQ A;  5E75 A;  5KWD A;  4OYS A;  2XPI A;  3FY4 A;  2P2C P;  3IXE A;  4JC8 A;  2GRP B;  5JHB A;  5FQ8 A;  4L2Y A;  3L22 A;  3T9K A;  4CCA A;  4AXH A;  4G2V A;  4L23 A;  4GZ6 A;  2NXP A;  4WWP A;  5BXO A;  1O1S A;  3UMV A;  4P29 A;  3ZNG A;  3LVR E;  2EQX A;  4FHJ A;  2I1J A;  2HR2 A;  2GRL A;  2F37 A;  2F8Y A;  3UI2 A;  2WXJ A;  1E7U A;  3QKY A;  2FO1 E;  4DX5 D;  2M63 A;  1NFI E;  2KCL A;  3PZD A;  3D9K A;  4F1S A;  3ZYM A;  3G2W A;  3PEU B;  3PDN A;  3VTX A;  3QK0 A;  1OWL A;  5JJ6 A;  3BG0 B;  2WB2 A;  3B7B A;  4U8H A;  3G2V A;  1OWP A;  3CVX A;  3U66 A;  4GZC A;  5CCM A;  4BX8 A;  2ILR A;  2A4Z A;  3L82 A;  2GRM A;  2OND A;  1UJJ A;  3LCA A;  4UWL A;  1JCR A;  1KPS B;  4FC8 A;  3FUK A;  5LP0 A;  5CEA A;  4JHJ A;  3I5P A;  2ION A;  3CVL A;  3ULQ A;  4CZ2 D;  2GRR B;  4U0U A;  5ENR D;  5JJT A;  5T8I A;  3D3M A;  2WXF A;  3TL5 A;  4HB5 A;  2VGE A;  1Y8M A;  3LY9 A;  3V30 A;  3Q9N C;  5CRU A;  1HF8 A;  3AJI A;  1K1B A;  4EZK A;  4KBQ A;  3O4Z A;  4GMR A;  3MX3 A;  3EU9 A;  1N54 A;  4K03 A;  2P9S G;  3KS2 A;  5IY5 E;  2AVP A;  4N3A A;  4ATZ D;  2C2L A;  4HLE A;  3HDX A;  4HI8 A;  3FFL A;  3SFX A;  3ABK E;  2KM4 A;  2CHW A;  4G8K A;  2XZD G;  3CHM A;  4Q69 A;  3EUV A;  4GTQ A;  5A6C A;  1AWC B;  4N3C A;  3NOG D;  2Q7F A;  3D9H A;  4FAD A;  3TWV A;  5DIZ A;  3NB2 A;  2V5Q C;  5C1D A;  4YDO A;  4CT0 A;  4H7X A;  1N11 A;  2VGY A;  5CBN A;  3MGB A;  5BV1 A;  3E30 A;  4LCT A;  3L17 A;  2KXP C;  5AQA A;  1NZN A;  2P9K G;  3UT8 A;  2WMO A;  1WAO 1;  4AIF A;  2BED A;  3KAE A;  3B13 A;  3ZRH A;  2XPZ A;  2GRN B;  4Z68 A;  3B7S A;  3OAW A;  4GML A;  2OCC E;  3UM0 A;  4JA9 A;  1SA4 A;  5FIO A;  3PZ2 A;  1OWN A;  2J07 A;  3JXJ A;  5LOZ A;  4PS7 A;  2XGS A;  4GYW A;  4J6I A;  2JAB A;  4ANU A;  3TWR A;  1O1T A;  4NAC A;  1SVX A;  3PEV B;  4UWG A;  2VGX B;  2X6K A;  3ABM E;  3LYA A;  4WNE A;  3DXK G;  3DSS A;  1SZ9 A;  2P9U G;  1ZU2 A;  5AAO A;  4CGV A;  1NI1 A;  1U3D A;  2XEN A;  1HE8 A;  3TWU A;  3Q73 A;  1H6O A;  3PH0 C;  4LSZ E;  3TWW A;  2WXP A;  4OVU A;  1N4S A;  3SY2 A;  1FVH A;  3G2T A;  3CVU A;  1B89 A;  3BUA A;  4U04 A;  2FUL A;  3P1U A;  4B93 B;  1P5Q A;  4UUC A;  4J0U A;  4A1G A;  4BER A;  3MA5 A;  4AJW A;  3MKQ A;  4XI0 A;  4A55 A;  2L6J A;  3UQ3 A;  4CRW A;  5BV0 A;  4RG9 A;  3D9N A;  2PL2 A;  4IRU A;  1H19 A;  3PS6 A;  4G24 A;  4FLB A;  2R03 A;  1TJF A;  2VGX A;  2WQH A;  4C0M A;  3ZPJ A;  3SFZ A;  1DCE A;  1U2V G;  4LNB A;  1S64 A;  3CVQ A;  1E7V A;  3LDZ A;  3GYZ A;  5FQ4 A;  3Q5M A;  2XGM A;  4YVO A;  1HS6 A;  1NA0 A;  5E76 A;  4EPZ A;  3ZW3 A;  2EIK E;  3S7J A;  3EJN A;  2UY1 A;  4IYP A;  3Q7F A;  4RSY A;  3T5V A;  1K1A A;  2CG2 A;  5EYL A;  2DYR E;  4A3V A;  1V55 E;  4MS6 A;  4CDN A;  1KT1 A;  4F1P A;  3GW4 A;  2LUH A;  2WPV A;  2A5E A;  4FJY A;  4MBG A;  4QFV A;  5AN8 A;  2XGO A;  4CT4 A;  4ILG A;  2DVW A;  4I9C A;  1OY3 D;  4U8Y D;  5H7P A;  2IOS A;  1SW6 A;  4APF A;  1N94 A;  3FU5 A;  3FUN A;  4GZ5 A;  2XEV A;  3D9O A;  2Y4T A;  3UIP C;  4NUR A;  3U9W A;  4DX6 D;  5A23 A;  1IKN D;  3RO2 A;  3NZS A;  3X2Q E;  4HFG A;  4ZHB A;  4H7Y A;  2RFA A;  2E0I A;  3HXF A;  4UWF A;  4JEU A;  2NSZ A;  3VLE A;  2VSY A;  2P9N G;  5KNG A;  4M7C A;  3F6Q A;  2GRQ B;  2LO6 A;  1MYO A;  2BKG A;  4HOR A;  3ULE G;  4EBA A;  1YYH A;  1W3B A;  3PVL A;  5JMN D;  3CVW A;  1TR4 A;  4PDX A;  4DLO A;  4F53 A;  3E4B A;  3Q79 A;  1WG0 A;  3SBT B;  2AXV A;  3DSW A;  4G26 A;  1S63 A;  2AWI A;  3PZ4 A;  4BTA A;  1SZA A;  4HI9 A;  2R05 A;  2OV8 A;  4GCO A;  4TUU A;  4K0R A;  2P9P G;  3FUM A;  2WXR A;  4AV7 A;  4PS3 A;  4XX5 A;  3SZ7 A;  3UIN C;  4L9P A;  5FQ6 A;  3E34 A;  2LAI A;  3ULY A;  2BF0 X;  3D9M A;  2XCB A;  3ONK A;  3L08 A;  3ZN3 A;  3TGO A;  2PQN A;  1OT8 A;  4HRN A;  4ATG A;  4GTT A;  4IN3 B;  2P9L G;  1BI8 B;  3S7F A;  3LJ3 A;  5BPP A;  2XZT G;  5ARF A;  2QFC A;  3HRA A;  4LUN U;  1IHG A;  5BW8 C;  4AVX A;  4AM9 A;  5J08 A;  3SO8 A;  3UX4 A;  2L0I A;  2OEW A;  3V2O A;  3EHR A;  2XS8 A;  3AS5 A;  5EX0 A;  3MJW A;  4ANX A;  5CMW A;  2VSX E;  3HIZ A;  3MCX A;  2QYU A;  3OXG A;  3C5R A;  2WXG A;  1JUQ A;  2H6G A;  1HG2 A;  3TWQ A;  5CCL A;  5EDS A;  3B7T A;  4MLP A;  3CHS A;  1Y6I A;  2QYJ A;  1D8D A;  4K5A B;  3KEA A;  3SQV A;  2AW6 A;  3QOU A;  4ME2 A;  2XRZ A;  2DWZ A;  2FI7 A;  3FUE A;  4YVQ C;  3FH8 A;  4JW1 A;  4DX7 D;  4RVB A;  1WY6 A;  4G11 A;  5FZQ A;  1MX2 A;  4WNG A;  3CVV A;  3GZ1 A;  5KNH D;  3CHQ A;  2WQ6 A;  3JQ0 A;  2IOL A;  4A3T A;  4HOT A;  3NZU A;  4UQY A;  4GA2 A;  4MKT A;  5AJL A;  4BTB A;  3CGH A;  1QBQ A;  4E6H A;  2H6F A;  2GRO B;  4D10 C;  3CKB A;  3JYS A;  1X5B A;  2VSN A;  3P2B A;  3L13 A;  1OCO E;  4KZ0 A;  4XI9 A;  1LD7 A;  1D9S A;  2R17 C;  3DSV A;  2Y0B G;  3CR3 A;  4NRH B;  1AP7 A;  4J8E A;  4RQI A;  2DZO A;  3LY8 A;  3J5P A;  4TUM A;  1HX8 A;  5D0Q D;  3FU0 A;  5B3S E;  3SGH A;  3CVN A;  1N9A A;  3APF A;  1OCR E;  3ASG A;  2EIN E;  4L7T A;  4FJZ A;  4U96 D;  2VJ8 A;  3HYM B;  3O48 A;  3UM1 A;  5AQ7 A;  2XEE A;  3FUI A;  3IHV A;  4BEP A;  5EN5 D;  3VLF A;  3MYV A;  1IHB A;  3U3W A;  5CHE E;  3WXX A;  5FT9 A;  5G2N A;  3Q78 A;  4LER A;  5KJK A;  4DRX E;  3PE4 A;  2R2L A;  4U07 A;  4URK A;  1UG3 A;  2DBA A;  4GMJ A;  2FBN A;  3JXI A;  1EDU A;  4J8Y A;  1HFA A;  3R9M A;  1MQS A;  3JQ1 A;  3ZXP A;  3T8M A;  3KSQ A;  4PH4 B;  2X6F A;  2KCV A;  3MEK A;  1JCS A;  4CEM A;  4GTO A;  4RG6 A;  4BX9 A;  2QZA A;  3FHE A;  2DCP A;  2L0T B;  2GGF A;  4UWK A;  3ZIM A;  4OVV A;  1UOH A;  5C2Y A;  4K5B A;  2IY0 C;  4YDW A;  3Q47 B;  4I2Z A;  5JJ7 A;  3DEO A;  1BU9 A;  2LNI A;  3RSE G;  4DI3 A;  3CV0 A;  1Z6T A;  2WM9 A;  3L9T A;  2BTD A;  5AQB A;  5KJM A;  1BD8 A;  4WAF A;  1ELW A;  4ANV A;  4F3V A;  3TJP A;  5ENP D;  3JCK C;  3MKQ B;  2OVF A;  2EIM E;  2V5F A;  4GTM A;  4N2Q A;  3FWV A;  3EIQ C;  2ZIS A;  1MZC A;  4BSZ B;  1H2T C;  1TNU A;  3UT7 A;  2OVB A;  2B0O E;  4TXQ A;  4AP2 A;  2Y69 E;  4U0Z A;  1RZ4 A;  5FWQ A;  3IHY A;  1DVP A;  2JLB A;  4U0S A;  3HVE B;  4HS2 A;  4FLH A;  3UUX A;  1K8K G;  2KBX A;  4GTS A;  4GZ3 A;  1HG5 A;  1KZP A;  3FUH A;  3TG5 A;  5ENS D;  4JA7 A;  3TWT A;  2V4L A;  2EIJ E;  5BT1 A;  4BT8 A;  5AJD A;  5CRV A;  4U7E B;  2Y3A A;  3UXG A;  3FUD A;  2UY1 B;  2HYZ A;  3FUJ A;  4FP7 A;  3CKC A;  4JD2 G;  3HG0 D;  1U3C A;  4GYO A;  4N2S A;  3G2U A;  4UI9 K;  5FTP A;  1OUV A;  1LF8 A;  1IYG A;  3IBE A;  4JEH A;  2R59 A;  1YCS B;  3LKU A;  3C3O A;  5HKP A;  4DX2 A;  3AAA C;  2DZN A;  4HNA D;  4PUC A;  2DIW A;  5LFA A;  1H0A A;  2ETA A;  3CQG B;  4JZY A;  3HXC A;  3RRM B;  2ETB A;  2IQC A;  4ILI A;  2YNQ A;  2WVI A;  3CLJ A;  4G1T A;  5ENQ D;  1FT1 A;  2FF4 A;  3PRE A;  3GZS A;  3HVE A;  3K9I A;  5T4Y A;  2I6H A;  2PZI A;  2J08 A;  4DI4 A;  4C9B B;  2PM6 A;  3DEP A;  3RJV A;  3FUF A;  3EIJ A;  2FEZ A;  4ACK A;  4LRZ A;  5AAR A;  4XEI G;  3S2A A;  3Q4A B;  4C48 B;  5AYW D;  3RRN B;  2KCK A;  3AG1 E;  1OCZ E;  2UWJ G;  2V8S E;  4GYY A;  1TNB A;  3DWL G;  1L5J A;  4AOF A;  2KZT B;  3LS8 A;  3DSX A;  1LTX A;  4BET A;  3DSU A;  3ABL E;  2YIN A;  4Y6C A;  4OAU C;  4ANW A;  4RLY A;  1H6K A;  5D0O D;  3TXM A;  4ACL A;  3Q7A A;  2CHZ A;  2NYJ A;  4YDY A;  2E2E A;  3QAR A;  2FO7 A;  3OTN A;  2CHX A;  3ENE A;  5FJY A;  4I6J A;  3QWV A;  4TXP A;  3Q15 A;  4F7A A;  4I1O B;  3BQO A;  3QWP A;  2CG3 A;  3KEZ A;  3L54 A;  2LSU A;  4N3B A;  4DX1 A;  4U63 A;  3U64 A;  3SF4 A;  2I1K A;  4EZL A;  3ZYL A;  3NAW A;  4LG6 A;  1TNO A;  4AY6 A;  4M3O A;  5JA4 D;  3ASN E;  2IFU A;  5EIB E;  2ZIR A;  3ONL A;  1A5E A;  4HRL A;  3B7U X;  5BNW A;  4N5Q A;  1N0Q A;  2KZT A;  3UM2 A;  1E90 A;  3I3N A;  3NOC D;  3UKR G;  1JWF A;  1O5M A;  5EID A;  4QQI A;  4JVS A;  1FVF A;  3UM3 A;  3UT4 A;  4A63 B;  4NQ0 A;  5CED B;  1Z3X A;  1DNP A;  2XS1 A;  4GPM A;  5M72 A;  1NA3 A;  1QQE A;  3PRZ A;  2MHK A;  1IXV A;  4UI9 C;  4L1B A;  3ZGQ A;  1E8Y A;  3FDH A;  4O1P A;  1JCQ A;  3JUI A;  5HI7 A;  2KC7 A;  2WXQ A;  3UKU G;  4XKC A;  4L2L A;  3CEQ A;  5FQ7 A;  4CDR A;  2RKK A;  4HLL A;  3J5Q B;  4I6E A;  4F6R D;  3LXU X;  1GW6 A;  2VTB B;  2Y4U A;  4KVO A;  3E37 A;  5ANL A;  1S70 B;  3CHP A;  3S7D A;  2J8S D;  5D2M C;  3AG2 E;  1N4P A;  4YDE A;  1YMP A;  1WM5 A;  4JL0 A;  1KLX A;  3TWX A;  3HHM A;  4JHR A;  4R7L A;  3ASH A;  3FTX A;  1JWG A;  3I4R B;  5LCW C;  1IQR A;  3FTU A;  3CST A;  3SBS A;  3ZVV A;  3D9J A;  5AQ9 A;  5KCM A;  4GZD A;  3JUE A;  5EX3 A;  2XHE A;  4Q96 A;  1A17 A;  4XIF A;  3RU0 A;  3RK6 A;  3KD7 A;  1SQM A;  1QZ2 A;  1WDY A;  1NL4 A;  3FP3 A;  3CQC B;  2X6I A;  4G8L A;  3HXD A;  5ANR A;  1TYQ G;  5HS0 A;  3MV2 B;  4O1O A;  4GB9 A;  1NP7 A;  2VTB A;  5JHA A;  1ZB1 A;  3FH7 A;  3ZEF A;  3V79 K;  5G04 C;  1TN7 A;  3DST A;  2OEV A;  1MJ0 A;  4WWN A;  2C0M A;  1E8X A;  3NBN B;  5T3R A;  4CGW A;  3IKO B;  4LEU A;  2CFU A;  3AS4 A;  4BWR A;  1ELK A;  3WG7 E;  3APC A;  4WNF A;  3LEW A;  3FEY A;  5ITZ F;  5CEC B;  2GW1 A;  1EF1 C;  2ZXW E;  4GA0 A;  4Y6W A;  2H6H A;  4BY6 A;  4U95 D;  5FZS A;  3CVP A;  2CFZ A;  3ASF A;  4HBD A;  4NIK A;  2QC9 A;  2VQ2 A;  3BG1 B;  2V0P A;  4ABN A;  3RRU A;  3ZFW A;  2X38 A;  1BI7 B;  3W9F A;  1PC2 A;  1EPU A;  3ZXS A;  3DRA A;  1XGW A;  4UQZ A;  3AU4 A;  1FCH A;  2WXL A;  1UJK A;  2HO1 A;  3MZL B;  1N52 A;  2R02 A;  4KZC A;  5AIJ A;  2ZGG A;  1MX6 A;  4J7W A;  4XE0 A;  3PUJ A;  4J8S A;  1BLX B;  5LX8 A;  1DCQ A;  1IQU A;  4WUY A;  2F0Y A;  1Q2Z A;  4HVB A;  3ZYK A;  4YND A;  3ZHE B;  4KYO B;  4FU3 A;  1EYH A;  4JPS A;  2IO3 C;  4O60 A;  3R7Q A;  4UI9 J;  3VTY A;  3FTW A;  3FH5 A;  5HRY A;  3R9A B;  5FZR A;  2XQ0 A;  3V31 A;  2IF4 A;  4PS8 A;  2XRY A;  1D8E A;  2LXL A;  5G05 J;  5J90 A;  2L9B A;  2V4H C;  4I1M A;  4HOU A;  4AY5 A;  2NC9 A;  1TN6 A;  3EDT B;  3UTM A;  1INZ A;  3TG4 A;  3RKV A;  3Q49 B;  3LY7 A;  3DBS A;  1OCC E;  4B89 A;  4JB8 P;  4GTR A;  3SNX A;  3OXL A;  4J8F A;  3ESK A;  3SFY A;  4DJA A;  3CK7 A;  3R7R A;  2PM7 A;  3ML8 A;  1BPO A;  3QC1 A;  2J9Q A;  4GTP A;  4KXK B;  4A1S A;  5LCW J;  3N71 A;  3QJZ A;  5ENO D;  3ZHE A;  3HXB A;  4HQD A;  4W9R A;  3SHF A;  1TJC A;  4DK5 A;  4KT6 B;  4WND A;  1MX4 A;  1TNY A;  3CVY A;  3IEG A;  3PZ3 A;  2I2O A;  2L6B A;  5BXU A;  1QNF A;  1V54 E;  3ZUV B;  3B95 A;  3C98 A;  1HZ4 A;  5D66 A;  4APO A;  3S7B A;  2RG8 A;  2JEK A;  1E8W A;  1UW4 B;  2J4D A;  1VDY A;  1HO8 A;  3B7R L;  2A5U A;  3CK9 A;  1OWM A;  2WXK A;  3LJN A;  2VSO E;  2WXI A;  3ZU7 B;  5G04 J;  3E33 A;  3SD5 A;  3FTZ A;  3DPD A;  5EYP F;  3ASD A;  3BU8 A;  2HM8 A;  4EBA G;  1UN8 A;  2BUG A;  4FA6 A;  1H6P A;  2OOE A;  2YHC A;  4E85 A;  3D9I A;  3EU5 A;  1G3N B;  2F8X K;  4LNG A;  3FU6 A;  3EHN A;  2XPY A;  2B6C A;  4EQF A;  4JXT A;  2WXO A;  3QB2 A;  2XEH A;  5KBA A;  1ELR A;  5FIN A;  4BSX A;  1FT2 A;  4DPR A;  1N4Q A;  1E8Z A;  5BUZ A;  3CK8 A;  4I2W A;  4C0E A;  1OXJ A;  1Z3Y A;  3ML9 A;  5CER B;  2DYS E;  2LXM A;  3IV0 A;  4BT9 A;  2WMN A;  4UWH A;  3FTY A;  3DPY A;  5HQ8 A;  3PUK A;  5CBO A;  3W9G A;  3T8K A;  3C3Q A;  3AG3 E;  1S0P A;  4MRU A;  1KT0 A;  4B94 A;  4O6F A;  2LSV A;  2EIL E;  2BKK B;  4ZFH A;  4I43 A;  3ASO E;  3NF1 A;  2R5S A;  3CHO A;  1DC2 A;  5KJL A;  4B8C B;  3SI5 A;  1PAQ A;  2WXH A;  5EKQ D;  5DBK A;  5A7D B;  2VYI A;  3QNK A;  3TAX A;  3QDN A;  5EIL A;  3EHQ A;  1Z5S C;  2MYO A;  3FEX A;  4DUI A;  1X81 A;  2J09 A;  4V3I A;  2YHE A;  1N0R A;  2PQR A;  4TV3 A;  2Y1L E;  1XNF A;  4CYM D;  2ETC A;  3I4G A;  4OAV B;  4XZ4 A;  5KJN A;  2XCC A;  4BFR A;  3L16 A;  5B1B E;  4KMO A;  2IEJ A;  1N95 A;  3G2S A;  3LPZ A;  2X6H A;  4EHM A;  2PNN A;  3ZKJ A;  1TEZ A;  3FUL A;  3E32 A;  4BES A;  4HRM B;  1SA5 A;  4FHK A;  1QYM A;  1K3Z D;  2YQ8 A;  2HE0 A;  3D9L A;  4CDM A;  4UQX A;  3ESL A;  3T5X A;  4ILH B;  1O1R A;  3Q9U C;  4AEZ C;  1ZBP A;  3AG4 E;  4B0Z A;  2AJA A;  2LAH A;  3FTV A;  3EHM A;  3DXM G;  4LNU D;  1PY1 A;  4HOS A;  3L6A A;  1HXI A;  4IUL A;  2AXZ A;  2ZGD A;  1H2V C;  2X6J A;  2RFM A;  4GA1 A;  4KVM A;  4G25 A;  2RD0 A;  2P58 C;  2J49 A;  2AXU A;  4I6G A;  3URZ A;  1FPP A;  1HU3 A;  2QY7 A;  4TXR A;  1UN9 A;  3MKR A;  3U4T A;  4FUL A;  3BEE A;  2I9C A;  3V2X A;  2H6I A;  5CMY A;  1KZO A;  4GCN A;  1TN8 A;  2IO2 C;  3C72 A;  2MOW A;  5B1A E;  2WQ7 A; 
#chains in the Genus database with same CATH homology
 2PL2 A;  4IRU A;  4UWK A;  3ZIM A;  4OVV A;  1H19 A;  3APC A;  3PS6 A;  4G24 A;  4WNF A;  5G05 C;  3LEW A;  4FLB A;  5C2Y A;  1TJF A;  3FEY A;  2VGX A;  3LVQ E;  2GW1 A;  1EF1 C;  2WQH A;  3Q47 B;  2KAT A;  3AS8 A;  4GA0 A;  1YA0 A;  4Y6W A;  4C0M A;  4BY6 A;  5ARG A;  3ZPJ A;  4I2Z A;  3SFZ A;  3PNT B;  5JJ7 A;  3TXN A;  3PNL B;  5FZS A;  3CVP A;  3RIB A;  2CFZ A;  3ASF A;  2WXN A;  2J4B A;  2LNI A;  3CVQ A;  1E7V A;  2C0L A;  2VQ2 A;  3CV0 A;  3BG1 B;  4DI3 A;  2V0P A;  3LDZ A;  1Z6T A;  4GU5 A;  4ABN A;  2WM9 A;  3GYZ A;  5FQ4 A;  3Q5M A;  3RRU A;  2X38 A;  2XGM A;  3ZFW A;  2MRI A;  2BTD A;  4YVO A;  1HS6 A;  2WXM A;  1NA0 A;  5E76 A;  4EPZ A;  4B8A A;  3ZW3 A;  4Q94 A;  3S7J A;  3EJN A;  5KJM A;  1PC2 A;  2UY1 A;  1EPU A;  3NQP A;  3QAQ A;  4IYP A;  2IU1 A;  4WAF A;  5ENN A;  3ZXS A;  4RSY A;  3T5V A;  1XGW A;  1ELW A;  4UQZ A;  3VLD A;  4ANV A;  4F3V A;  3AU4 A;  1FCH A;  2WXL A;  1UJK A;  2CG2 A;  3TJP A;  2HO1 A;  3MZL B;  1N52 A;  3CSF A;  3JCK C;  3CHR A;  4KZC A;  4A3V A;  5AIJ A;  3FTS A;  3RO3 A;  3MKQ B;  2OVF A;  4MS6 A;  3APD A;  1MHQ A;  2X3M A;  4CDN A;  1KT1 A;  4N39 A;  2V5F A;  4TRQ A;  4XE0 A;  4N2Q A;  3CIA A;  3PUJ A;  3FWV A;  3EIQ C;  4J8S A;  4G23 A;  2IJG X;  3GW4 A;  2WPV A;  5LX8 A;  1IQU A;  1H2T C;  4WUY A;  4FJY A;  4I1A A;  3UT7 A;  2OVB A;  3FU3 A;  4QFV A;  4HVB A;  3ZYK A;  4AP2 A;  2XGO A;  4I17 A;  4U0Z A;  4YND A;  5FWQ A;  3IHY A;  4ILG A;  4CT4 A;  1DVP A;  2JLB A;  4I9C A;  4GAA A;  4KYO B;  3ZHE B;  4FU3 A;  4U0S A;  1E96 B;  1EYH A;  3D9P A;  3HVE B;  1H2U A;  4JPS A;  4HS2 A;  4FLH A;  2IOS A;  3R7Q A;  4UI9 J;  3VTY A;  4EEC A;  3FTW A;  3FH5 A;  3R9A B;  4APF A;  4DLQ A;  4HXI A;  3UUX A;  5FZR A;  2XQ0 A;  2IF4 A;  4GZ3 A;  1HG5 A;  4PS8 A;  3FUH A;  3FU5 A;  2XRY A;  3TG5 A;  5G05 J;  3FUN A;  3GZ2 A;  4JA7 A;  4GZ5 A;  5J90 A;  4EZJ A;  2L9B A;  2V4L A;  5BT1 A;  2XEV A;  3D9O A;  4N5C A;  5AJD A;  4BT8 A;  2Y4T A;  1HH8 A;  4I1M A;  4HOU A;  4WWO A;  4AY5 A;  4GPK A;  2Y3A A;  2NC9 A;  3QWW A;  4NUR A;  3U9W A;  5AEN A;  3EDT B;  3FUD A;  2UY1 B;  4J8D A;  2HYZ A;  3FUJ A;  1INZ A;  4FP7 A;  3TG4 A;  3CKC A;  3Q49 B;  5G55 A;  3RKV A;  3LY7 A;  1U3C A;  3DBS A;  5A23 A;  4GYO A;  1OWO A;  4N2S A;  3RO2 A;  3NZS A;  4JHK A;  4B89 A;  4I9E A;  3UPV A;  2ZU6 B;  3G2U A;  4HFG A;  4UI9 K;  4H7Y A;  5FTP A;  3PE3 A;  1OUV A;  1JPL A;  1LF8 A;  3SNX A;  1IYG A;  3IBE A;  2E0I A;  2R59 A;  4JEH A;  3MV3 B;  3OXL A;  4J8F A;  3ESK A;  3OXF A;  3LKU A;  4UWF A;  4JEU A;  3AU5 A;  4PUC A;  2DIW A;  4XKB A;  5LFA A;  4DJA A;  3CK7 A;  4HOQ A;  1H0A A;  3R7R A;  3ZYQ A;  2NSZ A;  3VLE A;  2PM7 A;  3CQG B;  3ML8 A;  4JZY A;  2VSY A;  5E75 A;  1BPO A;  3QC1 A;  4OYS A;  2J9Q A;  3RRM B;  2IQC A;  2XPI A;  3FY4 A;  4ILI A;  4KXK B;  2YNQ A;  2WVI A;  4A1S A;  3CLJ A;  5LCW J;  4G1T A;  2LO6 A;  4JC8 A;  5JHB A;  3N71 A;  3QJZ A;  5FQ8 A;  2FF4 A;  3ZHE A;  4HOR A;  3PRE A;  3GZS A;  4L2Y A;  3HVE A;  3L22 A;  4EBA A;  4W9R A;  3SHF A;  1W3B A;  3PVL A;  1TJC A;  3K9I A;  5T4Y A;  2I6H A;  4CCA A;  4AXH A;  3CVW A;  4DK5 A;  4KT6 B;  4G2V A;  4WND A;  4L23 A;  4GZ6 A;  2PZI A;  2J08 A;  4DI4 A;  3CVY A;  4C9B B;  2NXP A;  3IEG A;  4PDX A;  4WWP A;  2PM6 A;  3UMV A;  4P29 A;  3RJV A;  3FUF A;  3EIJ A;  4DLO A;  4F53 A;  2FEZ A;  3LVR E;  4ACK A;  2I2O A;  4LRZ A;  1QNF A;  3S2A A;  2EQX A;  4FHJ A;  2I1J A;  3Q4A B;  2HR2 A;  3E4B A;  2GRL A;  3C98 A;  1HZ4 A;  3SBT B;  4APO A;  2AXV A;  4G26 A;  5AYW D;  3RRN B;  2KCK A;  3S7B A;  2AWI A;  2RG8 A;  2UWJ G;  2WXJ A;  2V8S E;  1E7U A;  3QKY A;  4BTA A;  2JEK A;  1SZA A;  1E8W A;  2M63 A;  4GYY A;  1UW4 B;  2J4D A;  2KCL A;  1L5J A;  2OV8 A;  4GCO A;  2KZT B;  4TUU A;  4AOF A;  4K0R A;  1VDY A;  1HO8 A;  3LS8 A;  3PZD A;  3D9K A;  4F1S A;  3ZYM A;  3G2W A;  3PEU B;  3FUM A;  3B7R L;  2YIN A;  2WXR A;  4Y6C A;  4AV7 A;  2A5U A;  3CK9 A;  1OWM A;  4ANW A;  2WXK A;  4PS3 A;  3PDN A;  3VTX A;  1H6K A;  3QK0 A;  5D0O D;  4XX5 A;  3SZ7 A;  3TXM A;  1OWL A;  2VSO E;  4ACL A;  2WXI A;  5JJ6 A;  5G04 J;  3BG0 B;  3SD5 A;  3FTZ A;  5FQ6 A;  3DPD A;  2WB2 A;  2LAI A;  3ASD A;  4U8H A;  3G2V A;  2CHZ A;  1OWP A;  2HM8 A;  3U66 A;  4GZC A;  3CVX A;  5CCM A;  4BX8 A;  2ILR A;  2BF0 X;  2A4Z A;  2E2E A;  3D9M A;  2XCB A;  4EBA G;  3ONK A;  1UN8 A;  2GRM A;  3QAR A;  2OND A;  2FO7 A;  3OTN A;  2CHX A;  2BUG A;  3L08 A;  3ZN3 A;  4FA6 A;  1UJJ A;  3ENE A;  3LCA A;  4UWL A;  3TGO A;  5FJY A;  2OOE A;  4I6J A;  4FC8 A;  3QWV A;  3FUK A;  3Q15 A;  4F7A A;  2PQN A;  2YHC A;  3D9I A;  4I1O B;  4E85 A;  5LP0 A;  3FU6 A;  4ATG A;  3EHN A;  4IN3 B;  4JHJ A;  3I5P A;  2ION A;  3QWP A;  2CG3 A;  3KEZ A;  3CVL A;  2XPY A;  3L54 A;  2LSU A;  4N3B A;  3ULQ A;  3S7F A;  4U63 A;  3U64 A;  4EQF A;  3LJ3 A;  4JXT A;  5BPP A;  4U0U A;  3SF4 A;  2WXO A;  5JJT A;  5ARF A;  3QB2 A;  5T8I A;  3D3M A;  2I1K A;  4EZL A;  3ZYL A;  2WXF A;  2QFC A;  4LUN U;  1IHG A;  3TL5 A;  1ELR A;  5BW8 C;  1Y8M A;  4AVX A;  4AY6 A;  4M3O A;  4AM9 A;  3LY9 A;  5J08 A;  2IFU A;  3UX4 A;  2L0I A;  3ONL A;  4BSX A;  4DPR A;  3B7U X;  5BNW A;  1HF8 A;  1E8Z A;  3AS5 A;  5BUZ A;  3CK8 A;  2KZT A;  4EZK A;  5EX0 A;  3MJW A;  4I2W A;  4ANX A;  4KBQ A;  4C0E A;  1E90 A;  5CMW A;  1Z3Y A;  3I3N A;  3ML9 A;  3O4Z A;  3MX3 A;  3IV0 A;  1N54 A;  2VSX E;  1JWF A;  3HIZ A;  3MCX A;  4K03 A;  4BT9 A;  3OXG A;  2WMN A;  4UWH A;  3FTY A;  2WXG A;  5HQ8 A;  3PUK A;  3KS2 A;  1JUQ A;  2AVP A;  4JVS A;  1FVF A;  3UT4 A;  4N3A A;  5EDS A;  1HG2 A;  2C2L A;  5CCL A;  3B7T A;  1S0P A;  4MLP A;  3CHS A;  1Y6I A;  4MRU A;  4NQ0 A;  4HLE A;  3HDX A;  1KT0 A;  1Z3X A;  4B94 A;  3FFL A;  4O6F A;  1DNP A;  2LSV A;  5M72 A;  1NA3 A;  1QQE A;  4I43 A;  2KM4 A;  2AW6 A;  3NF1 A;  2CHW A;  3PRZ A;  3QOU A;  2MHK A;  4ME2 A;  2R5S A;  2XRZ A;  3FUE A;  2FI7 A;  4UI9 C;  3CHM A;  3CHO A;  4L1B A;  4YVQ C;  4Q69 A;  5KJL A;  3ZGQ A;  1E8Y A;  3FH8 A;  4JW1 A;  3FDH A;  4B8C B;  5A6C A;  4RVB A;  1WY6 A;  4G11 A;  3SI5 A;  4N3C A;  5HI7 A;  3JUI A;  1PAQ A;  5FZQ A;  4WNG A;  3CVV A;  2KC7 A;  2WXH A;  5EKQ D;  5DBK A;  5A7D B;  2Q7F A;  2VYI A;  3CHQ A;  3GZ1 A;  3QNK A;  3TAX A;  4FAD A;  3JQ0 A;  2WQ6 A;  2WXQ A;  2IOL A;  3QDN A;  4A3T A;  4XKC A;  4L2L A;  3CEQ A;  5FQ7 A;  3FEX A;  4CDR A;  5DIZ A;  2J09 A;  4HOT A;  5C1D A;  3NZU A;  4UQY A;  4V3I A;  2YHE A;  4CT0 A;  4I6E A;  4H7X A;  2VGY A;  4GA2 A;  2PQR A;  4MKT A;  3MGB A;  5AJL A;  4TV3 A;  4BTB A;  5BV1 A;  3LXU X;  1GW6 A;  3CGH A;  4LCT A;  2VTB B;  2Y4U A;  4KVO A;  3L17 A;  1XNF A;  4E6H A;  5ANL A;  3I4G A;  3CHP A;  4D10 C;  3CKB A;  3S7D A;  1NZN A;  3JYS A;  1X5B A;  2VSN A;  3P2B A;  3UT8 A;  3L13 A;  2WMO A;  1WAO 1;  4KZ0 A;  4XI9 A;  4AIF A;  4XZ4 A;  3KAE A;  3B13 A;  3ZRH A;  5KJN A;  2R17 C;  2XCC A;  3CR3 A;  1WM5 A;  2XPZ A;  4JL0 A;  4NRH B;  1KLX A;  3B7S A;  4J8E A;  4BFR A;  3OAW A;  3HHM A;  3L16 A;  4JHR A;  4R7L A;  3ASH A;  3LY8 A;  3FTX A;  4GML A;  1JWG A;  3I4R B;  4KMO A;  5LCW C;  1IQR A;  3FTU A;  3CST A;  4JA9 A;  3SBS A;  3ZVV A;  3D9J A;  3G2S A;  5KCM A;  1OWN A;  2J07 A;  4GZD A;  3LPZ A;  5LOZ A;  2X6H A;  1HX8 A;  4PS7 A;  5EX3 A;  2XHE A;  4Q96 A;  5D0Q D;  1A17 A;  3FU0 A;  1TEZ A;  2XGS A;  4XIF A;  3SGH A;  4GYW A;  3RU0 A;  3FUL A;  3RK6 A;  3CVN A;  4J6I A;  3KD7 A;  1SQM A;  4ANU A;  3APF A;  4FHK A;  4NAC A;  1QZ2 A;  3PEV B;  4UWG A;  2VGX B;  2X6K A;  2YQ8 A;  3ASG A;  3LYA A;  4WNE A;  3D9L A;  3FP3 A;  4UQX A;  4CDM A;  1SZ9 A;  3CQC B;  4FJZ A;  2X6I A;  4L7T A;  3ESL A;  3T5X A;  2VJ8 A;  3HYM B;  3O48 A;  4ILH B;  5ANR A;  1ZU2 A;  4AEZ C;  1ZBP A;  3MV2 B;  4CGV A;  1U3D A;  4B0Z A;  4GB9 A;  2LAH A;  3FUI A;  3FTV A;  3EHM A;  3IHV A;  1NP7 A;  2VTB A;  1HE8 A;  1PY1 A;  3VLF A;  3MYV A;  5JHA A;  4HOS A;  3L6A A;  3PH0 C;  1HXI A;  3FH7 A;  4IUL A;  2WXP A;  4OVU A;  3U3W A;  5CHE E;  3WXX A;  2AXZ A;  5FT9 A;  1FVH A;  3G2T A;  5G2N A;  3ZEF A;  3CVU A;  5KJK A;  4LER A;  1H2V C;  3PE4 A;  1B89 A;  4U07 A;  5G04 C;  2X6J A;  4U04 A;  4GA1 A;  4URK A;  2FUL A;  4KVM A;  3P1U A;  4WWN A;  4G25 A;  2RD0 A;  2P58 C;  2J49 A;  1UG3 A;  2AXU A;  1P5Q A;  2DBA A;  4I6G A;  3URZ A;  4GMJ A;  4J0U A;  2FBN A;  2C0M A;  1E8X A;  4A1G A;  1EDU A;  5T3R A;  1HFA A;  3MA5 A;  4AJW A;  1HU3 A;  2QY7 A;  1MQS A;  3MKQ A;  4XI0 A;  4CGW A;  1UN9 A;  3JQ1 A;  3T8M A;  4A55 A;  3IKO B;  2L6J A;  3MKR A;  3U4T A;  4PH4 B;  4FUL A;  3UQ3 A;  2X6F A;  2KCV A;  4LEU A;  4CRW A;  5BV0 A;  3BEE A;  2I9C A;  3MEK A;  2CFU A;  4RG9 A;  4CEM A;  5CMY A;  3D9N A;  3AS4 A;  4GCN A;  4BWR A;  4RG6 A;  4BX9 A;  3FHE A;  2MOW A;  2WQ7 A;  1ELK A;  2DCP A;  2L0T B;  2GGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...