2LNIA

Solution nmr structure of stress-induced-phosphoprotein 1 sti1 from homo sapiens, northeast structural genomics consortium target hr4403e
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
133
structure length
133
Chain Sequence
MGHHHHHHSHMNPDLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stress-induced-phosphoprotein 1
publication title Northeast Structural Genomics Consortium Target HR4403E
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 46
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lniA00
4RG9A 3GYZA 3O48A 2OOEA 5C1DA 3Q47B 4F3VA 2Y4UA 1TJCA 4WUYA 4HOQA 5KJNA 1HXIA 5BNWA 3PDNA 3CEQA 3UUXA 2WPVA 4G1TA 5JJ7A 3OXGA 4IN3B 3LKUA 5DIZA 4GYYA 4JA9A 3VTXA 4N2QA 3FWVA 3LY7A 2LSUA 1HZ4A 3IEGA 2FO7A 4UQYA 1ELRA 3TG5A 4WNFA 2XEVA 4N5CA 3QWPA 3TGOA 2GW1A 4N3CA 3CVNA 3LPZA 3AS5A 4GCOA 5JJ6A 3CVQA 4G26A 1IYGA 2Q7FA 2C0LA 3PE3A 4J8DA 3ASGA 3QKYA 2VSNA 4AY6A 4U0UA 3KAEA 3MKRA 3QWVA 3GZ2A 2XCBA 4GZ3A 3SF4A 4U07A 4Y6WA 1WAO1 5LCWC 4AY5A 3BEEA 4I9CA 2XGOA 5EKQD 5CCLA 2E2EA 4HOUA 2KCKA 5LCWJ 2AVPA 3QWWA 1QZ2A 4Y6CA 5AYWD 3Q4AB 2V5FA 4UI9C 2YQ8A 4I1AA 4O6FA 4U04A 4GZ6A 2NC9A 3EDTB 3CVLA 1ZBPA 4UI9J 2FF4A 1PC2A 5HI7A 5A6CA 2YHCA 3RJVA 3FP3A 2JLBA 5ARGA 2XPIA 5BW8C 3URZA 5DBKA 4N3BA 2FBNA 4ABNA 2VQ2A 3ZN3A 3GZ1A 1NA0A 3MV3B 2LSVA 4B94A 5JJTA 4KYOB 2KATA 3ZGQA 1KT0A 3R9AB 2C2LA 4HOTA 3AS8A 3CKBA 5FZQA 3E4BA 2PZIA 4RG6A 3U3WA 1P5QA 3ESKA 2J9QA 3ZHEB 5FT9A 3RIBA 4HOSA 2VGXA 4YVQC 1QQEA 1Y8MA 4CGVA 3NF1A 3TG4A 4GZ5A 1KT1A 1ELWA 1W3BA 2I6HA 2HYZA 5D0QD 5A7DB 3U4TA 5ARFA 1FCHA 3S7JA 4YVOA 2WQHA 2XGSA 2LNIA 4LEUA 2L6JA 3KD7A 3KS2A 4J0UA 5FZSA 2FI7A 3ZPJA 5G05C 4H7YA 5BT1A 2Y4TA 1HH8A 2MHKA 3HYMB 2VYIA 4AM9A 3LY9A 4WNEA 2KCVA 4GA1A 3GW4A 4G25A 4KBQA 5CCMA 4XIFA 5G05J 3OXLA 4WNDA 4NRHB 2R5SA 3OXFA 3ULQA 3ASHA 4AIFA 1NA3A 3UQ3A 4BT9A 4JA7A 3MA5A 1A17A 5KJKA 3WXXA 5FTPA 2KC7A 3PE4A 4GCNA 2UWJG 2VGYA 3SZ7A 2PQNA 3K9IA 2C0MA 4GYOA 5KJMA 3LYAA 1ZU2A 3QOUA 2UY1A 4N39A 3CVPA 4WNGA 4G2VA 1IHGA 3N71A 4GPKA 2P58C 4ME2A 3RO2A 3S7FA 4UQXA 3ASFA 2HR2A 4CDRA 2IFUA 5HQ8A 3RU0A 3MEKA 1KLXA 2FEZA 2KCLA 1B89A 3S7DA 4UI9K 4J8EA 2HO1A 4UQZA 3CKCA 4A1SA 4XI9A 4GA0A 2XGMA 5G04C 4I2WA 5D0OD 4HORA 2ONDA 4I9EA 3CK9A 4H7XA 1XNFA 1OUVA 4JL0A 5FZRA 1WM5A 4BWRA 3QDNA 4JHRA 3CK7A 5G04J 5EX3A 4XI0A 4EQFA 4GYWA 5EX0A 4I2ZA 4BT8A 3S7BA 4U0SA 3ZFWA 5FJYA 3ASDA 3RO3A 4J8FA 2UY1B 2VSYA 3CV0A 4BTAA 4GA2A 3TAXA 3MV2B 5CHEE 3UPVA 2PQRA 2PL2A 4APOA 3Q5MA 4W9RA 5M72A 1NZNA 4BTBA 4YNDA 4U0ZA 3JYSA 4N3AA 3ZHEA 2VGXB 3Q49B 2IF4A 1YA0A 3LY8A 1E96B 3CK8A 3LCAA 3FFLA 4G24A 4N2SA 2QFCA 4KXKB 3VTYA 2XCCA 3AS4A 4CGWA 5KJLA 2BUGA 3RKVA 4G23A 3Q15A 4NQ0A 4I17A 2DBAA
chains in the Genus database with same CATH superfamily
3GYZA 4KVOA 3EHQA 1VDYA 1SA4A 2BKGA 4F3VA 1TNUA 2Y4UA 1TJCA 1K1BA 3D9JA 4HOQA 3C98A 4G1TA 4IN3B 3ML9A 4HRNA 5DIZA 3Q7FA 1QBQA 1IQUA 3TXMA 4JA9A 1SZAA 3LJ3A 3VTXA 3FWVA 1E7UA 2EIJE 4URKA 4WNFA 4ILGA 4C9BB 4U8HA 3LDZA 3UIPC 3QNKA 2WXJA 4N3CA 2M63A 1S70B 3B13A 3CVNA 3LPZA 3VLFA 3AS5A 2ILRA 3CVQA 3CSTA 4I43A 2IO2C 3HXFA 4IULA 3JXIA 5FWQA 3PE3A 4YDOA 3J5PA 4DLQA 3MKRA 3D9HA 1H6KA 2ZIRA 1S64A 2YNQA 2DIWA 4MRUA 1Z6TA 3QJZA 3L9TA 5A23A 4Y6WA 2GRRB 4A3TA 1U3DA 4RVBA 3DXKG 2A4ZA 1UW4B 1WG0A 3HXCA 3MYVA 3QARA 4JB8P 4RLYA 5LCWJ 1DNPA 3ZNGA 1QZ2A 2DZOA 1UN8A 1N94A 1SVXA 4C0EA 4U8YD 4K5BA 3JQ1A 3ZYQA 3TWXA 5AQ9A 2V5FA 1UOHA 1K8KG 2AXVA 2IY0C 4O6FA 1OWLA 4N5QA 2OEVA 2WXQA 1E8ZA 4WWOA 4K0RA 5KNGA 2WQ7A 3FP3A 1TNYA 4U8VD 5B3SE 2A5UA 3KSLA 3SBTB 5ARGA 5KCMA 3L16A 2XPIA 4L23A 3AAAC 3B7TA 1V54E 4N3BA 2QY7A 3APCA 4GU5A 3FY4A 1EPUA 3GZ1A 1NA0A 3SGHA 2R03A 4CEMA 5EN5D 4JHKA 3SD5A 5JHAA 1BPOA 4RG6A 3T5XA 3B7BA 3FUEA 3ESKA 4B8CB 2J9QA 4DI4A 2P9LG 4B93B 1E8XA 4EBAA 1QQEA 2XHEA 3NF1A 1KPSB 3HDXA 1AWCB 1ZB1A 3D9LA 3U9WA 4LERA 4AVXA 3LJNA 1W3BA 2HYZA 4G8KA 1N11A 3EU9A 2YINA 4GMJA 1LF8A 2LAHA 5CERB 3G2TA 5AARA 4U63A 5FIOA 2LNIA 5C2YA 3ASNE 2RG8A 1KZOA 3KD7A 2F37A 2J09A 2CG2A 3QB2A 3HVEA 4J0UA 3C3OA 4BY6A 4TXPA 1G3NB 1N4PA 2PM6A 3HYMB 2EINE 4LRZA 1OWOA 2GROB 2L9BA 3G2WA 4Q94A 2X6IA 3DSUA 2OEWA 4GTSA 1IQRA 2XZDG 4RQIA 4DPRA 3EJNA 2EILE 2XEHA 4GMLA 1OCRE 1BLXB 4JA7A 4J6IA 3WXXA 2PM7A 3RRNB 4G11A 1LD8A 2OCCE 4ATGA 4K03A 2UWJG 4TRQA 5E75A 4GYOA 2VTBB 3ZXSA 1KZPA 3QOUA 2DVWA 2HM8A 2UY1A 3AJIA 5BV1A 3ASOE 1HFAA 3DSWA 1DCEA 4C0MA 5AAOA 1TJFA 5EYPF 4A55A 1E8WA 3SHFA 4UQXA 2J4BA 2HR2A 5G2NA 1X81A 4HRLA 1KLXA 2V4LA 3S7DA 3APDA 4UI9K 4UQZA 1MQSA 2XPYA 2P9SG 3CKCA 4A3VA 3RSEG 3FU0A 4I2WA 2NYJA 5CRUA 4I9EA 5BV0A 4I1MA 1U3CA 4H7XA 1MYOA 2F8YA 1OUVA 4GTQA 4E85A 3PREA 5EX3A 4XI0A 1YCSB 4GYWA 3FUHA 3CVUA 2FULA 3ZFWA 3JXJA 3Q78A 2KM4A 3RO3A 4BERA 4J8FA 4LCTA 2P2CP 2VSYA 3EIQC 4BTAA 4DUIA 3ZW3A 1OT8A 3UPVA 2XZTG 5KBAA 2AXZA 1NZNA 4YNDA 5T3RA 3RAUA 3HRAA 3ZHEA 3ZUVB 3ZYMA 3Q49B 1FT1A 3E37A 1YA0A 4EECA 4HI8A 3S2AA 2WMOA 3CK8A 4BSZB 1JPLA 2QFCA 5CRVA 3CVXA 4F7AA 2XCCA 3C3RA 3AS4A 4CGWA 1U2VG 2QYJA 3F6QA 4AP2A 2BUGA 2GRQB 3X2QE 3Q15A 2LXLA 3W9FA 4JZYA 1Y6IA 4GB9A 2EIKE 1DVPA 4UUCA 4O60A 4LNUD 3O48A 2OOEA 2JEKA 3CSFA 1BI7B 1FVHA 2J8SD 2F0YA 3BQOA 5KJNA 3PDNA 3FUIA 5JJ7A 2L6BA 1MX6A 3C3QA 3U66A 5JA4D 3I4GA 2XRZA 3HIZA 2CHXA 4JC8A 4N2QA 3PZ1A 3BG1B 4B8AA 2LSUA 4FLHA 4UQYA 3TG5A 2R02A 2XEVA 2XPZA 4J7WA 3W9GA 3TGOA 4GMRA 2GW1A 2DYRE 2KZTA 5FQ4A 2X3MA 2IOLA 5T8IA 5JJ6A 2R05A 1IYGA 1D8DA 4BX9A 2GRNB 4APFA 2V5QC 4FHKA 4CDNA 2C0LA 5EILA 4J8DA 3SNXA 3QKYA 3D9OA 4E6HA 4F6RD 3FUFA 3Q79A 1TNZA 4ZHBA 3GZ2A 2R17C 4U07A 1TN8A 2B6CA 1N4QA 1WAO1 5LCWC 5LFAA 4AY5A 3BEEA 5AN8A 4DX2A 3PNTB 4FHJA 2A5EA 3B7UX 4HOUA 2KCKA 3FEXA 3KEAA 2AVPA 3QWWA 3AU5A 3ML8A 2XEEA 4YDYA 3NZSA 2P9IG 3JUIA 4I1AA 2AWIA 5EIDA 3HXBA 3T8KA 3NB2A 4DX1A 1NP7A 2XRYA 2NC9A 3EDTB 1BI8B 4DI3A 5HRYA 4I6EA 3UM3A 2RFAA 5HI7A 4CT0A 2YHCA 2BF0X 3RJVA 2JLBA 4HB5A 1LTXA 5DBKA 3DRAA 3CHSA 4AV7A 3ZN3A 4LG6A 3ZKJA 3JCKC 3MV3B 3ZGQA 1KT0A 3R9AB 2C2LA 3FU6A 4HOTA 1QNFA 3KEZA 2PZIA 4FJYA 3FUKA 2FO1E 1Z3XA 3ONKA 1SQMA 5FT9A 2VGXA 2DCPA 3FTUA 3MKQB 1Y8MA 3D9IA 4GZ5A 3TWTA 4HI9A 4LSZE 4XX5A 5ENOD 4GTOA 3U4TA 2VSOE 2CFZA 1FCHA 4YVOA 2XGSA 3UT4A 4NIKA 5FINA 1MJ0A 3ZU7B 3U64A 3HG0D 4QFVA 5FZSA 4NACA 3ZPJA 2IONA 1E8YA 2LUHA 4JD2G 1HH8A 2XENA 2V0PA 3R7RA 4R7LA 5ENTD 4WNEA 2RKKA 2KCVA 3FTXA 1E7VA 5CCMA 2Y3AA 2GRMA 5G05J 4M7CA 2WQ6A 3J5QB 2XS1A 3PUJA 5D66A 1TR4A 5ANLA 1JWFA 4A1GA 3ULQA 3TWVA 3UQ3A 4GZCA 4XE0A 4XZ4A 5ENNA 3AU4A 1AP7A 5KJKA 2PNNA 1TN6A 2WXGA 3E30A 1WDYA 3ABKE 5AQBA 3LVRE 2C0MA 4I6JA 5KJMA 1D8EA 4O1OA 4CYMD 2AJAA 4CZ2D 3LYAA 1ZU2A 1TNOA 2B0OE 2IJGX 3LS8A 3B7SA 3UKUG 1H0AA 4WNGA 1WY6A 3OAWA 3ZEFA 4K5CA 4GPKA 4XEIG 5LOZA 3PZ4A 4AXHA 1HF8A 4PUCA 2MRIA 4CDRA 3DEOA 1NI1A 3RU0A 5EDSA 3MEKA 4ACKA 4J8EA 3AG2E 4B0ZA 4HS2A 1IKND 4GA0A 4FULA 2XGMA 1TN7A 1HU3A 4B89A 5D0OD 1OWPA 2ONDA 3SFYA 4UWHA 1HE8A 2P9KG 1JCQA 2RFMA 1WM5A 3FUJA 4BWRA 4JHRA 4FA6A 4KZ0A 4EQFA 4BT8A 4I2ZA 5FJYA 4DX6D 4HNAD 1HS6A 1OXJA 3ASDA 3L17A 4EZKA 2UY1B 5AQAA 3L82A 4YDWA 1N52A 1SZ9A 4OYSA 3FUMA 4APOA 2PL2A 2H6IA 3ZRHA 4BTBA 4U0ZA 1N54A 1YMPA 3ZYLA 1E96B 1O1RA 4WWPA 4J8SA 2HE0A 4N2SA 3TWSA 3AG4E 5LX8A 4EPZA 2R2LA 3FTZA 3WG7E 1K1AA 3HXEA 1FVFA 2H6FA 2L0IA 4I17A 2Y1LE 3R9MA 3I4RB 2DBAA 2MOWA 4HLEA 2H6HA 4JW1A 3Q47B 3TWWA 3NQPA 3RRUA 5BNWA 3JUEA 3EHNA 3UUXA 2WPVA 3UTMA 4ILHB 2KXPC 3IHYA 4GZDA 1MHQA 3UT7A 3QC1A 4ATZD 3T9KA 3CR3A 1O1TA 3LY7A 3TWQA 3VLDA 4FP7A 3P2BA 3PS6A 1INZA 4N5CA 4DK5A 4QQIA 1H19A 5ENQD 3V31A 4G26A 3DSSA 3ASGA 3UM0A 4MS6A 2IQCA 4DX7D 2CG3A 5J90A 4U0UA 4IRUA 3QWVA 3LEWA 4BFRA 4DJAA 2I1JA 2XCBA 4GZ3A 1JUQA 3PZ2A 4J8YA 2VTBA 3DBSA 1TNBA 5EKQD 4KZCA 5CCLA 3MX3A 5E76A 4P29A 1D9SA 2QYUA 2IO3C 4U7EB 3V2XA 2WXIA 5BXUA 4KMOA 5AYWD 4GTPA 4CT4A 2WXNA 4IYPA 4PDXA 4Q69A 3HXDA 4ANUA 3SQVA 3ZYKA 4OAUC 4U04A 2NSZA 4HXIA 1X5BA 3GZSA 2WXHA 2MYOA 1N4RA 2WXFA 1ZBPA 4UI9J 3P1UA 3FH5A 4JVSA 4OVVA 4FJZA 5A6CA 4DRXE 2JABA 1EDUA 3PH0C 2XS8A 3CGHA 4ABNA 2VQ2A 3MJWA 3NOGD 1PAQA 1LD7A 2LSVA 5JJTA 2E0IA 4U96D 2ZISA 3CVWA 1O1SA 1DCQA 3AS8A 5FZQA 4UWKA 3U3WA 4FC8A 4FU3A 1OCZE 4DX5D 3EIJA 3RIBA 4HOSA 5FQ7A 4YVQC 3PEUB 4JEHA 5J08A 3G2UA 3R7QA 1NFIE 5KNHD 2GGFA 1KT1A 1ELWA 1UJKA 4HQDA 2I6HA 4TUUA 5D0QD 4CCAA 3L08A 3ESLA 3V79K 3AG3E 5ARFA 1YYHA 3S7JA 5AENA 2VGEA 2GRLA 3ULYA 4HRMB 5G05C 5ANRA 3DPDA 1UG3A 5BT1A 3FTSA 2Y4TA 1TEZA 2VYIA 4AM9A 4UWGA 3GW4A 4KBQA 3CHPA 3FU5A 4TXQA 3FH7A 3DSTA 4CDMA 2R5SA 1NA3A 2WXLA 1FT2A 3FTYA 3Q73A 3FDHA 3SI5A 4BT9A 2X38A 3ABME 3MA5A 1A17A 3NAWA 3FEYA 4NURA 1K3ZD 3IHVA 1A5EA 4BETA 3ABLE 2VGYA 4LUNU 4K5AB 2PQNA 1H2TC 2IEJA 2BEDA 4N39A 4ILIA 3EHRA 5ITZF 3CVPA 1XGWA 4LNGA 4G2VA 1IHGA 3Q9UC 1RZ4A 3PZ3A 3CHQA 4I1OB 2X6HA 2P58C 3B95A 5CBNA 1E90A 2Y69E 3ASFA 4HFGA 1JCRA 2IFUA 3Q9NC 3CQGB 5AIJA 3G2SA 5B1AE 2FEZA 2KCLA 1B89A 1NL4A 2HO1A 3I3NA 3MCXA 5EIBE 4A1SA 2DWZA 2LXMA 4XI9A 2BTDA 1OWNA 4TXRA 3QK0A 3CK9A 2J07A 4L2LA 4A63B 3QDNA 5LP0A 3UXGA 5G04J 5KWDA 4AOFA 3D9NA 1N0QA 3S7BA 3KSQA 3UX4A 1JCSA 5FQ6A 3D9MA 2WXMA 4JEUA 3LVQE 2ZXWE 5BPPA 5BXOA 3ULEG 3TAXA 3FTVA 3TXNA 1S0PA 3IKOB 2AXUA 3L13A 3PNLB 3CLJA 1HO8A 4N3AA 3TWRA 4BEPA 2P9PG 3MKQA 3UM1A 3LY8A 1OWMA 3LCAA 3FFLA 4G24A 1SW6A 5BUZA 4D10C 1L5JA 4KXKB 3VTYA 1H6PA 3UIOC 4EZJA 2X6KA 4WWNA 4MKTA 3NOCD 5CBOA 3RKVA 5B1BE 4WAFA 1S63A 2LO6A 4NQ0A 1IHBA 2V8SE 3E32A 4ANXA 4PS7A 4RG9A 5FQ8A 4F1SA 4C48B 4ANWA 5C1DA 1H2UA 3HVEB 5AJDA 2KBXA 4WUYA 1HXIA 1UN9A 3CEQA 2P9NG 3CHOA 2ETAA 1BD8A 3OXGA 1H6OA 3LKUA 4L9PA 4GYYA 4MBGA 3L6AA 4ACLA 4GTRA 3L22A 1HZ4A 3IEGA 2FO7A 3MGBA 1ELRA 2WXOA 3QWPA 3DXMG 4OVUA 4XKCA 4GCOA 3BG0B 4O1PA 3EUVA 4JPSA 2Q7FA 2VSNA 4AY6A 3DEPA 4ANVA 3KAEA 4GAAA 2J4DA 5JHBA 2WXKA 4TUMA 1N95A 3TL5A 3SF4A 2I1KA 4AEZC 5HKPA 4I9CA 2XGOA 1H2VC 2IU1A 2E2EA 2ETCA 3I5PA 3CVVA 4X8QA 1N0RA 3SFXA 4Y6CA 4FLBA 2XQ0A 3FULA 1OCOE 5G55A 2EIME 3T8MA 1MX4A 1OY3D 3Q4AB 2X6FA 3UI2A 3SBSA 4UI9C 2YQ8A 3FUDA 4CRWA 4EZLA 4MLPA 4GZ6A 3PVLA 3CVLA 4YDEA 3UM2A 3G2VA 5JMND 2FF4A 1PC2A 5CEAA 2DZNA 5BW8C 3ZIMA 4Q96A 3URZA 1EF1C 2Y0BG 3IXEA 2FBNA 3E34A 4PH4B 3E33A 4KVMA 5EYLA 4B94A 4GTTA 4LNBA 5ENSD 3EU5A 2KATA 4KYOB 4KT6B 3EHMA 3CKBA 3E4BA 1P5QA 3SO8A 5AQ7A 2VJ8A 3ZHEB 4L7TA 5ENRD 2L0TB 4CGVA 3SY2A 4L2YA 3TG4A 3D9PA 4Z68A 4RSYA 2X6JA 3Q75A 5AJLA 5A7DB 2OVBA 4M3OA 5CMYA 1GW6A 3V2OA 4BESA 4AJWA 4ZFHA 3UKRG 1MZCA 2YHEA 1PY1A 1OCCE 2P9UG 4HBDA 2WQHA 4EBAG 3BUAA 3CHRA 4LEUA 1N4SA 2L6JA 2QZAA 3KS2A 2WB2A 1Z3YA 3FHEA 5CEDB 5IY5E 2FI7A 4UWLA 2OVFA 2DYSE 4H7YA 3C72A 4EHMA 4UWFA 3AG1E 2CFUA 2MHKA 3ONLA 4L1BA 3LY9A 3FUNA 4BSXA 4GA1A 4G25A 4XIFA 3DSXA 3IBEA 3OXLA 4G8LA 3VLEA 2WXRA 3UMVA 2RD0A 4WNDA 4XKBA 3JQ0A 4NRHB 1UJJA 3OXFA 2KZTB 4I6GA 3ASHA 4AIFA 3HHMA 3PEVB 2WVIA 4BX8A 3LXUX 4JHJA 4F1PA 3L54A 2EQXA 3UINC 5FTPA 2KC7A 2I2OA 3IV0A 3PE4A 1TYQG 4GCNA 1N9AA 2ZGGA 3SZ7A 4HLLA 2VSXE 3K9IA 1IXVA 1MX2A 2WM9A 5CMWA 3APFA 2H6GA 4HVBA 1DC2A 3DWLG 4TV3A 3FTWA 3BU8A 4GPMA 2J08A 3C5RA 3TJPA 3N71A 3FU3A 4PS8A 3ENEA 4ME2A 3RO2A 1SA5A 2I9CA 3S7FA 3SFZA 2CHZA 4V3IA 5HQ8A 3PZDA 2J49A 3V30A 5HS0A 2R59A 2OV8A 3UT8A 1O5MA 2BKKB 3NZUA 3RK6A 4GTMA 3CVYA 2LAIA 4GTVA 5G04C 2ETBA 4HORA 4FADA 1QYMA 2NXPA 2AW6A 1JWGA 3DSVA 1XNFA 1HX8A 3O4ZA 4JL0A 5FZRA 2V4HC 4JXTA 2ZGDA 3B7RL 3DPYA 4F53A 1HG5A 3CK7A 3OTNA 2IOSA 5EX0A 1HG2A 1Q2ZA 4U0SA 3NBNB 1ELKA 2WMNA 5ENPD 3TWUA 3QAQA 3D3MA 1V55E 3PUKA 2F8XK 3CV0A 4GA2A 3T5VA 3ZXPA 3MV2B 5CHEE 2PQRA 2ZU6B 3D9KA 3Q5MA 4W9RA 5M72A 1RW2A 3JYSA 3RRMB 2VGXB 5H7PA 3ISMC 2IF4A 3ZVVA 4U95D 3MZLB 3CHMA 2CHWA 3CQCB 2GRPB 3FH8A 5D2MC 1Z5SC 5CECB 2WXPA 3Q7AA 2QC9A 4OAVB 5KJLA 4G23A 4DLOA 3PRZA 3CIAA 1FPPA 1EYHA 5T4YA 4PS3A 1BU9A
chains in the Genus database with same CATH topology
4RG9A 3GYZA 3O48A 2OOEA 2JEKA 3CSFA 5FQ8A 4F1SA 2MOWA 4ANWA 4HLEA 4KVOA 1FVHA 4JW1A 5C1DA 1VDYA 3Q47B 1H2UA 3HVEB 5AJDA 4F3VA 2Y4UA 1TJCA 3NQPA 3D9JA 4WUYA 3RRUA 4HOQA 5KJNA 1HXIA 5BNWA 3PDNA 1UN9A 3CEQA 3C98A 3EHNA 3UUXA 2WPVA 3FUIA 3CHOA 4G1TA 4ILHB 5JJ7A 3IHYA 3OXGA 4IN3B 3LKUA 3ML9A 5DIZA 4GZDA 1MHQA 3UT7A 4GYYA 3U66A 1IQUA 3QC1A 3TXMA 3I4GA 3L6AA 4JA9A 1SZAA 3CR3A 3HIZA 2CHXA 3LJ3A 4JC8A 3VTXA 4N2QA 3BG1B 4ACLA 3FWVA 3LY7A 4B8AA 2LSUA 4FLHA 3L22A 1HZ4A 3IEGA 1E7UA 2FO7A 3MGBA 3VLDA 4URKA 4UQYA 4FP7A 3P2BA 1ELRA 3TG5A 4WNFA 2WXOA 2XEVA 3PS6A 4N5CA 1INZA 2XPZA 3QWPA 4ILGA 4DK5A 3TGOA 2GW1A 4C9BB 4OVUA 2KZTA 4U8HA 1H19A 3LDZA 5FQ4A 3QNKA 2WXJA 4N3CA 2X3MA 2M63A 3B13A 3CVNA 3LPZA 4XKCA 3VLFA 2IOLA 5T8IA 3AS5A 4GCOA 5JJ6A 2ILRA 3BG0B 3CVQA 4G26A 3CSTA 1IYGA 4I43A 4IULA 4BX9A 4APFA 4JPSA 2Q7FA 4FHKA 4CDNA 5FWQA 2C0LA 3PE3A 4J8DA 3ASGA 3SNXA 4MS6A 3QKYA 3D9OA 2IQCA 2VSNA 4DLQA 4E6HA 2CG3A 4AY6A 5J90A 3FUFA 4ANVA 4U0UA 3KAEA 3MKRA 4GAAA 2J4DA 4IRUA 1H6KA 5JHBA 2WXKA 3QWVA 3LEWA 4BFRA 4DJAA 2I1JA 2YNQA 3GZ2A 2R17C 2XCBA 2DIWA 4GZ3A 3TL5A 4MRUA 1Z6TA 1JUQA 2I1KA 3QJZA 4U07A 4Y6WA 3SF4A 4AEZC 5A23A 2VTBA 4A3TA 3DBSA 1WAO1 1U3DA 5LCWC 5LFAA 4AY5A 3BEEA 4I9CA 2XGOA 5EKQD 4KZCA 1H2VC 3PNTB 2IU1A 4RVBA 4FHJA 2A4ZA 5CCLA 3B7UX 1UW4B 2E2EA 3MX3A 5E76A 3MYVA 3QARA 4HOUA 4P29A 2KCKA 3FEXA 3I5PA 3CVVA 5LCWJ 2AVPA 1DNPA 3QWWA 1QZ2A 4Y6CA 4FLBA 3AU5A 2XQ0A 1UN8A 3FULA 3ML8A 5G55A 2WXIA 4KMOA 3T8MA 4C0EA 5AYWD 3Q4AB 4CT4A 2WXNA 3JQ1A 3ZYQA 4IYPA 2X6FA 4PDXA 4Q69A 3NZSA 2V5FA 3SBSA 4ANUA 4UI9C 2YQ8A 2AXVA 3JUIA 4I1AA 4O6FA 2AWIA 1OWLA 3FUDA 4CRWA 4EZLA 3ZYKA 4MLPA 4U04A 2NSZA 4HXIA 1NP7A 1X5BA 3GZSA 2XRYA 2WXHA 4GZ6A 2NC9A 3EDTB 2WXFA 3PVLA 2WXQA 1E8ZA 4DI3A 3CVLA 1ZBPA 4UI9J 4WWOA 3G2VA 3P1UA 4K0RA 2FF4A 4I6EA 3FH5A 1PC2A 4JVSA 5HI7A 4OVVA 4FJZA 4CT0A 2YHCA 5A6CA 2WQ7A 2BF0X 3RJVA 1EDUA 3FP3A 2JLBA 2A5UA 3SBTB 3PH0C 5ARGA 5KCMA 3L16A 2XPIA 4L23A 3CGHA 5BW8C 4Q96A 3URZA 3ZIMA 3B7TA 5DBKA 1EF1C 4N3BA 2FBNA 2QY7A 3APCA 4ABNA 4PH4B 3CHSA 4GU5A 3FY4A 4KVMA 2VQ2A 4AV7A 3ZN3A 1EPUA 3GZ1A 1NA0A 3MJWA 3JCKC 3MV3B 1PAQA 2LSVA 3SGHA 4B94A 5JJTA 2E0IA 4KYOB 2KATA 4CEMA 3ZGQA 3CVWA 1KT0A 3R9AB 2C2LA 4JHKA 3EHMA 4KT6B 3SD5A 3FU6A 5JHAA 4HOTA 3AS8A 3CKBA 5FZQA 3E4BA 4UWKA 1BPOA 1QNFA 3KEZA 2PZIA 4RG6A 3U3WA 4FJYA 3FUKA 1P5QA 3T5XA 1Z3XA 4FC8A 3FUEA 4FU3A 3ONKA 3ESKA 2VJ8A 4B8CB 1SQMA 2J9QA 3EIJA 3ZHEB 4DI4A 5FT9A 3RIBA 4HOSA 2VGXA 5FQ7A 4L7TA 4YVQC 3PEUB 2DCPA 3FTUA 3MKQB 2L0TB 4JEHA 1E8XA 4EBAA 1QQEA 1Y8MA 4CGVA 2XHEA 3NF1A 3HDXA 5J08A 4L2YA 3G2UA 3TG4A 3R7QA 3D9IA 3D9PA 4GZ5A 4RSYA 2GGFA 3D9LA 3U9WA 4LERA 1KT1A 4AVXA 1ELWA 1UJKA 1W3BA 2XRZA 2I6HA 2X6JA 2HYZA 4XX5A 5AJLA 4TUUA 5D0QD 4CCAA 5A7DB 2OVBA 4M3OA 2YINA 4GMJA 5CMYA 1GW6A 3U4TA 1LF8A 3L08A 2VSOE 4AJWA 2CFZA 3ESLA 2LAHA 5ARFA 2YHEA 1PY1A 1FCHA 3G2TA 4U63A 4YVOA 2WQHA 3S7JA 4EBAG 3CHRA 5AENA 2XGSA 2LNIA 4LEUA 5C2YA 3UT4A 2RG8A 2L6JA 3KD7A 3U64A 2J09A 2CG2A 2GRLA 3KS2A 2WB2A 1Z3YA 3QB2A 3FHEA 3HVEA 4QFVA 4J0UA 5FZSA 4NACA 2FI7A 4UWLA 3ZPJA 4BY6A 2OVFA 5G05C 2IONA 1E8YA 4H7YA 5ANRA 3DPDA 1UG3A 4UWFA 5BT1A 3FTSA 2CFUA 2Y4TA 1HH8A 1TEZA 2PM6A 2MHKA 3HYMB 4LRZA 2V0PA 3ONLA 3R7RA 2VYIA 4L1BA 1OWOA 4R7LA 3LY9A 4UWGA 4AM9A 4WNEA 3FUNA 4BSXA 2L9BA 2KCVA 3G2WA 4GA1A 3FTXA 3GW4A 4G25A 1E7VA 4KBQA 3CHPA 4Q94A 5CCMA 2Y3AA 2GRMA 4XIFA 5G05J 3IBEA 3OXLA 3FU5A 3VLEA 2WXRA 2X6IA 3UMVA 2WQ6A 3PUJA 1IQRA 2RD0A 4WNDA 4XKBA 5ANLA 1JWFA 3FH7A 3JQ0A 4NRHB 1UJJA 2R5SA 3OXFA 2KZTB 4I6GA 3ULQA 4A1GA 4CDMA 4DPRA 3ASHA 3EJNA 4AIFA 3HHMA 3PEVB 1NA3A 2WXLA 2WVIA 3FTYA 3UQ3A 4GZCA 4XE0A 4BX8A 4XZ4A 3LXUX 4GMLA 4JHJA 3FDHA 3SI5A 5ENNA 2X38A 4BT9A 3AU4A 4JA7A 3MA5A 1A17A 5KJKA 3L54A 4J6IA 2EQXA 3FEYA 3WXXA 2PM7A 4NURA 5FTPA 2KC7A 3IHVA 3RRNB 4G11A 2I2OA 3IV0A 2WXGA 3PE4A 4ATGA 4GCNA 4K03A 2UWJG 2VGYA 3SZ7A 4LUNU 2VSXE 3LVRE 2PQNA 3K9IA 2C0MA 4TRQA 5E75A 4GYOA 4I6JA 2WM9A 5KJMA 5CMWA 2VTBB 1H2TC 3ZXSA 3LYAA 1ZU2A 3QOUA 2HM8A 2IJGX 2UY1A 3APFA 4N39A 3LS8A 5BV1A 4HVBA 3B7SA 4ILIA 1HFAA 4TV3A 1H0AA 3CVPA 1XGWA 4WNGA 1WY6A 3FTWA 4C0MA 3OAWA 1TJFA 4G2VA 1IHGA 2J08A 3ZEFA 4A55A 3TJPA 1E8WA 3N71A 4GPKA 3FU3A 3CHQA 4PS8A 4I1OB 3ENEA 2X6HA 5LOZA 2P58C 4ME2A 3RO2A 2I9CA 4AXHA 3S7FA 1E90A 1HF8A 4PUCA 4UQXA 3ASFA 2J4BA 2HR2A 4HFGA 3SHFA 3SFZA 2MRIA 2CHZA 5G2NA 4CDRA 4V3IA 2IFUA 5HQ8A 3CQGB 3RU0A 3PZDA 5EDSA 3MEKA 5AIJA 2J49A 3G2SA 1KLXA 2FEZA 4ACKA 2KCLA 1B89A 2V4LA 3S7DA 3APDA 4UI9K 4J8EA 2R59A 2OV8A 3UT8A 2HO1A 4UQZA 1MQSA 2XPYA 3NZUA 4B0ZA 3I3NA 3RK6A 3CKCA 3MCXA 4HS2A 4A1SA 3CVYA 2LAIA 4XI9A 4A3VA 4GA0A 4FULA 2XGMA 3FU0A 1HU3A 5G04C 2BTDA 4B89A 4I2WA 5D0OD 1OWPA 1OWNA 4HORA 4FADA 2ONDA 5BV0A 4I9EA 2NXPA 4I1MA 2AW6A 1JWGA 3QK0A 1U3CA 3CK9A 4UWHA 1HE8A 4H7XA 1XNFA 1HX8A 1OUVA 2J07A 3O4ZA 4L2LA 4JL0A 5FZRA 4JXTA 3B7RL 4F53A 1WM5A 3FUJA 4BWRA 3QDNA 4E85A 5LP0A 4JHRA 1HG5A 3CK7A 3OTNA 3PREA 2IOSA 5EX3A 4KZ0A 5G04J 4AOFA 4FA6A 3D9NA 4XI0A 4EQFA 4GYWA 5EX0A 1HG2A 4I2ZA 4BT8A 3FUHA 3S7BA 3CVUA 4U0SA 2FULA 3ZFWA 1ELKA 2WMNA 5FJYA 3UX4A 5FQ6A 1HS6A 3L17A 3D9MA 2WXMA 3ASDA 3D3MA 3QAQA 4EZKA 2KM4A 3RO3A 4JEUA 3LVQE 4J8FA 4LCTA 3PUKA 5BPPA 2UY1B 2VSYA 3CV0A 3EIQC 4BTAA 4GA2A 3TAXA 3FTVA 3T5VA 3MV2B 1N52A 1SZ9A 5CHEE 3ZW3A 4OYSA 3FUMA 2PQRA 2PL2A 3TXNA 4APOA 3UPVA 2ZU6B 3ZRHA 3D9KA 3Q5MA 4W9RA 2AXZA 5M72A 1S0PA 3IKOB 2AXUA 3L13A 1NZNA 3PNLB 3CLJA 4YNDA 4BTBA 4U0ZA 3JYSA 1HO8A 4N3AA 5T3RA 3ZHEA 1N54A 3RRMB 2VGXB 3ZYMA 3Q49B 3ZYLA 2IF4A 3MKQA 1YA0A 3LY8A 4EECA 1OWMA 3ZVVA 1E96B 3S2AA 2WMOA 3CK8A 3CHMA 3MZLB 3LCAA 2CHWA 3FFLA 4J8SA 4G24A 4WWPA 5BUZA 4N2SA 4D10C 1L5JA 1JPLA 2QFCA 3CVXA 3CQCB 3FH8A 4F7AA 4KXKB 3VTYA 2WXPA 2XCCA 3AS4A 4EZJA 4CGWA 5LX8A 2X6KA 4EPZA 5KJLA 4WWNA 4MKTA 3FTZA 4AP2A 2BUGA 3RKVA 4G23A 4WAFA 3Q15A 4DLOA 1FVFA 2LO6A 4JZYA 3PRZA 3CIAA 4NQ0A 1Y6IA 2L0IA 2V8SE 4GB9A 1EYHA 5T4YA 4I17A 1DVPA 3I4RB 4ANXA 4PS3A 2DBAA 4PS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RG9 A;  3GYZ A;  3O48 A;  2OOE A;  5C1D A;  3Q47 B;  4F3V A;  2Y4U A;  1TJC A;  4WUY A;  4HOQ A;  5KJN A;  1HXI A;  5BNW A;  3PDN A;  3CEQ A;  3UUX A;  2WPV A;  4G1T A;  5JJ7 A;  3OXG A;  4IN3 B;  3LKU A;  5DIZ A;  4GYY A;  4JA9 A;  3VTX A;  4N2Q A;  3FWV A;  3LY7 A;  2LSU A;  1HZ4 A;  3IEG A;  2FO7 A;  4UQY A;  1ELR A;  3TG5 A;  4WNF A;  2XEV A;  4N5C A;  3QWP A;  3TGO A;  2GW1 A;  4N3C A;  3CVN A;  3LPZ A;  3AS5 A;  4GCO A;  5JJ6 A;  3CVQ A;  4G26 A;  1IYG A;  2Q7F A;  2C0L A;  3PE3 A;  4J8D A;  3ASG A;  3QKY A;  2VSN A;  4AY6 A;  4U0U A;  3KAE A;  3MKR A;  3QWV A;  3GZ2 A;  2XCB A;  4GZ3 A;  3SF4 A;  4U07 A;  4Y6W A;  1WAO 1;  5LCW C;  4AY5 A;  3BEE A;  4I9C A;  2XGO A;  5EKQ D;  5CCL A;  2E2E A;  4HOU A;  2KCK A;  5LCW J;  2AVP A;  3QWW A;  1QZ2 A;  4Y6C A;  5AYW D;  3Q4A B;  2V5F A;  4UI9 C;  2YQ8 A;  4I1A A;  4O6F A;  4U04 A;  4GZ6 A;  2NC9 A;  3EDT B;  3CVL A;  1ZBP A;  4UI9 J;  2FF4 A;  1PC2 A;  5HI7 A;  5A6C A;  2YHC A;  3RJV A;  3FP3 A;  2JLB A;  5ARG A;  2XPI A;  5BW8 C;  3URZ A;  5DBK A;  4N3B A;  2FBN A;  4ABN A;  2VQ2 A;  3ZN3 A;  3GZ1 A;  1NA0 A;  3MV3 B;  2LSV A;  4B94 A;  5JJT A;  4KYO B;  2KAT A;  3ZGQ A;  1KT0 A;  3R9A B;  2C2L A;  4HOT A;  3AS8 A;  3CKB A;  5FZQ A;  3E4B A;  2PZI A;  4RG6 A;  3U3W A;  1P5Q A;  3ESK A;  2J9Q A;  3ZHE B;  5FT9 A;  3RIB A;  4HOS A;  2VGX A;  4YVQ C;  1QQE A;  1Y8M A;  4CGV A;  3NF1 A;  3TG4 A;  4GZ5 A;  1KT1 A;  1ELW A;  1W3B A;  2I6H A;  2HYZ A;  5D0Q D;  5A7D B;  3U4T A;  5ARF A;  1FCH A;  3S7J A;  4YVO A;  2WQH A;  2XGS A;  2LNI A;  4LEU A;  2L6J A;  3KD7 A;  3KS2 A;  4J0U A;  5FZS A;  2FI7 A;  3ZPJ A;  5G05 C;  4H7Y A;  5BT1 A;  2Y4T A;  1HH8 A;  2MHK A;  3HYM B;  2VYI A;  4AM9 A;  3LY9 A;  4WNE A;  2KCV A;  4GA1 A;  3GW4 A;  4G25 A;  4KBQ A;  5CCM A;  4XIF A;  5G05 J;  3OXL A;  4WND A;  4NRH B;  2R5S A;  3OXF A;  3ULQ A;  3ASH A;  4AIF A;  1NA3 A;  3UQ3 A;  4BT9 A;  4JA7 A;  3MA5 A;  1A17 A;  5KJK A;  3WXX A;  5FTP A;  2KC7 A;  3PE4 A;  4GCN A;  2UWJ G;  2VGY A;  3SZ7 A;  2PQN A;  3K9I A;  2C0M A;  4GYO A;  5KJM A;  3LYA A;  1ZU2 A;  3QOU A;  2UY1 A;  4N39 A;  3CVP A;  4WNG A;  4G2V A;  1IHG A;  3N71 A;  4GPK A;  2P58 C;  4ME2 A;  3RO2 A;  3S7F A;  4UQX A;  3ASF A;  2HR2 A;  4CDR A;  2IFU A;  5HQ8 A;  3RU0 A;  3MEK A;  1KLX A;  2FEZ A;  2KCL A;  1B89 A;  3S7D A;  4UI9 K;  4J8E A;  2HO1 A;  4UQZ A;  3CKC A;  4A1S A;  4XI9 A;  4GA0 A;  2XGM A;  5G04 C;  4I2W A;  5D0O D;  4HOR A;  2OND A;  4I9E A;  3CK9 A;  4H7X A;  1XNF A;  1OUV A;  4JL0 A;  5FZR A;  1WM5 A;  4BWR A;  3QDN A;  4JHR A;  3CK7 A;  5G04 J;  5EX3 A;  4XI0 A;  4EQF A;  4GYW A;  5EX0 A;  4I2Z A;  4BT8 A;  3S7B A;  4U0S A;  3ZFW A;  5FJY A;  3ASD A;  3RO3 A;  4J8F A;  2UY1 B;  2VSY A;  3CV0 A;  4BTA A;  4GA2 A;  3TAX A;  3MV2 B;  5CHE E;  3UPV A;  2PQR A;  2PL2 A;  4APO A;  3Q5M A;  4W9R A;  5M72 A;  1NZN A;  4BTB A;  4YND A;  4U0Z A;  3JYS A;  4N3A A;  3ZHE A;  2VGX B;  3Q49 B;  2IF4 A;  1YA0 A;  3LY8 A;  1E96 B;  3CK8 A;  3LCA A;  3FFL A;  4G24 A;  4N2S A;  2QFC A;  4KXK B;  3VTY A;  2XCC A;  3AS4 A;  4CGW A;  5KJL A;  2BUG A;  3RKV A;  4G23 A;  3Q15 A;  4NQ0 A;  4I17 A;  2DBA A; 
#chains in the Genus database with same CATH topology
 3GYZ A;  4KVO A;  3EHQ A;  1VDY A;  1SA4 A;  2BKG A;  4F3V A;  1TNU A;  2Y4U A;  1TJC A;  1K1B A;  3D9J A;  4HOQ A;  3C98 A;  4G1T A;  4IN3 B;  3ML9 A;  4HRN A;  5DIZ A;  3Q7F A;  1QBQ A;  1IQU A;  3TXM A;  4JA9 A;  1SZA A;  3LJ3 A;  3VTX A;  3FWV A;  1E7U A;  2EIJ E;  4URK A;  4WNF A;  4ILG A;  4C9B B;  4U8H A;  3LDZ A;  3UIP C;  3QNK A;  2WXJ A;  4N3C A;  2M63 A;  1S70 B;  3B13 A;  3CVN A;  3LPZ A;  3VLF A;  3AS5 A;  2ILR A;  3CVQ A;  3CST A;  4I43 A;  2IO2 C;  3HXF A;  4IUL A;  3JXI A;  5FWQ A;  3PE3 A;  4YDO A;  3J5P A;  4DLQ A;  3MKR A;  3D9H A;  1H6K A;  2ZIR A;  1S64 A;  2YNQ A;  2DIW A;  4MRU A;  1Z6T A;  3QJZ A;  3L9T A;  5A23 A;  4Y6W A;  2GRR B;  4A3T A;  1U3D A;  4RVB A;  3DXK G;  2A4Z A;  1UW4 B;  1WG0 A;  3HXC A;  3MYV A;  3QAR A;  4JB8 P;  4RLY A;  5LCW J;  1DNP A;  3ZNG A;  1QZ2 A;  2DZO A;  1UN8 A;  1N94 A;  1SVX A;  4C0E A;  4U8Y D;  4K5B A;  3JQ1 A;  3ZYQ A;  3TWX A;  5AQ9 A;  2V5F A;  1UOH A;  1K8K G;  2AXV A;  2IY0 C;  4O6F A;  1OWL A;  4N5Q A;  2OEV A;  2WXQ A;  1E8Z A;  4WWO A;  4K0R A;  5KNG A;  2WQ7 A;  3FP3 A;  1TNY A;  4U8V D;  5B3S E;  2A5U A;  3KSL A;  3SBT B;  5ARG A;  5KCM A;  3L16 A;  2XPI A;  4L23 A;  3AAA C;  3B7T A;  1V54 E;  4N3B A;  2QY7 A;  3APC A;  4GU5 A;  3FY4 A;  1EPU A;  3GZ1 A;  1NA0 A;  3SGH A;  2R03 A;  4CEM A;  5EN5 D;  4JHK A;  3SD5 A;  5JHA A;  1BPO A;  4RG6 A;  3T5X A;  3B7B A;  3FUE A;  3ESK A;  4B8C B;  2J9Q A;  4DI4 A;  2P9L G;  4B93 B;  1E8X A;  4EBA A;  1QQE A;  2XHE A;  3NF1 A;  1KPS B;  3HDX A;  1AWC B;  1ZB1 A;  3D9L A;  3U9W A;  4LER A;  4AVX A;  3LJN A;  1W3B A;  2HYZ A;  4G8K A;  1N11 A;  3EU9 A;  2YIN A;  4GMJ A;  1LF8 A;  2LAH A;  5CER B;  3G2T A;  5AAR A;  4U63 A;  5FIO A;  2LNI A;  5C2Y A;  3ASN E;  2RG8 A;  1KZO A;  3KD7 A;  2F37 A;  2J09 A;  2CG2 A;  3QB2 A;  3HVE A;  4J0U A;  3C3O A;  4BY6 A;  4TXP A;  1G3N B;  1N4P A;  2PM6 A;  3HYM B;  2EIN E;  4LRZ A;  1OWO A;  2GRO B;  2L9B A;  3G2W A;  4Q94 A;  2X6I A;  3DSU A;  2OEW A;  4GTS A;  1IQR A;  2XZD G;  4RQI A;  4DPR A;  3EJN A;  2EIL E;  2XEH A;  4GML A;  1OCR E;  1BLX B;  4JA7 A;  4J6I A;  3WXX A;  2PM7 A;  3RRN B;  4G11 A;  1LD8 A;  2OCC E;  4ATG A;  4K03 A;  2UWJ G;  4TRQ A;  5E75 A;  4GYO A;  2VTB B;  3ZXS A;  1KZP A;  3QOU A;  2DVW A;  2HM8 A;  2UY1 A;  3AJI A;  5BV1 A;  3ASO E;  1HFA A;  3DSW A;  1DCE A;  4C0M A;  5AAO A;  1TJF A;  5EYP F;  4A55 A;  1E8W A;  3SHF A;  4UQX A;  2J4B A;  2HR2 A;  5G2N A;  1X81 A;  4HRL A;  1KLX A;  2V4L A;  3S7D A;  3APD A;  4UI9 K;  4UQZ A;  1MQS A;  2XPY A;  2P9S G;  3CKC A;  4A3V A;  3RSE G;  3FU0 A;  4I2W A;  2NYJ A;  5CRU A;  4I9E A;  5BV0 A;  4I1M A;  1U3C A;  4H7X A;  1MYO A;  2F8Y A;  1OUV A;  4GTQ A;  4E85 A;  3PRE A;  5EX3 A;  4XI0 A;  1YCS B;  4GYW A;  3FUH A;  3CVU A;  2FUL A;  3ZFW A;  3JXJ A;  3Q78 A;  2KM4 A;  3RO3 A;  4BER A;  4J8F A;  4LCT A;  2P2C P;  2VSY A;  3EIQ C;  4BTA A;  4DUI A;  3ZW3 A;  1OT8 A;  3UPV A;  2XZT G;  5KBA A;  2AXZ A;  1NZN A;  4YND A;  5T3R A;  3RAU A;  3HRA A;  3ZHE A;  3ZUV B;  3ZYM A;  3Q49 B;  1FT1 A;  3E37 A;  1YA0 A;  4EEC A;  4HI8 A;  3S2A A;  2WMO A;  3CK8 A;  4BSZ B;  1JPL A;  2QFC A;  5CRV A;  3CVX A;  4F7A A;  2XCC A;  3C3R A;  3AS4 A;  4CGW A;  1U2V G;  2QYJ A;  3F6Q A;  4AP2 A;  2BUG A;  2GRQ B;  3X2Q E;  3Q15 A;  2LXL A;  3W9F A;  4JZY A;  1Y6I A;  4GB9 A;  2EIK E;  1DVP A;  4UUC A;  4O60 A;  4LNU D;  3O48 A;  2OOE A;  2JEK A;  3CSF A;  1BI7 B;  1FVH A;  2J8S D;  2F0Y A;  3BQO A;  5KJN A;  3PDN A;  3FUI A;  5JJ7 A;  2L6B A;  1MX6 A;  3C3Q A;  3U66 A;  5JA4 D;  3I4G A;  2XRZ A;  3HIZ A;  2CHX A;  4JC8 A;  4N2Q A;  3PZ1 A;  3BG1 B;  4B8A A;  2LSU A;  4FLH A;  4UQY A;  3TG5 A;  2R02 A;  2XEV A;  2XPZ A;  4J7W A;  3W9G A;  3TGO A;  4GMR A;  2GW1 A;  2DYR E;  2KZT A;  5FQ4 A;  2X3M A;  2IOL A;  5T8I A;  5JJ6 A;  2R05 A;  1IYG A;  1D8D A;  4BX9 A;  2GRN B;  4APF A;  2V5Q C;  4FHK A;  4CDN A;  2C0L A;  5EIL A;  4J8D A;  3SNX A;  3QKY A;  3D9O A;  4E6H A;  4F6R D;  3FUF A;  3Q79 A;  1TNZ A;  4ZHB A;  3GZ2 A;  2R17 C;  4U07 A;  1TN8 A;  2B6C A;  1N4Q A;  1WAO 1;  5LCW C;  5LFA A;  4AY5 A;  3BEE A;  5AN8 A;  4DX2 A;  3PNT B;  4FHJ A;  2A5E A;  3B7U X;  4HOU A;  2KCK A;  3FEX A;  3KEA A;  2AVP A;  3QWW A;  3AU5 A;  3ML8 A;  2XEE A;  4YDY A;  3NZS A;  2P9I G;  3JUI A;  4I1A A;  2AWI A;  5EID A;  3HXB A;  3T8K A;  3NB2 A;  4DX1 A;  1NP7 A;  2XRY A;  2NC9 A;  3EDT B;  1BI8 B;  4DI3 A;  5HRY A;  4I6E A;  3UM3 A;  2RFA A;  5HI7 A;  4CT0 A;  2YHC A;  2BF0 X;  3RJV A;  2JLB A;  4HB5 A;  1LTX A;  5DBK A;  3DRA A;  3CHS A;  4AV7 A;  3ZN3 A;  4LG6 A;  3ZKJ A;  3JCK C;  3MV3 B;  3ZGQ A;  1KT0 A;  3R9A B;  2C2L A;  3FU6 A;  4HOT A;  1QNF A;  3KEZ A;  2PZI A;  4FJY A;  3FUK A;  2FO1 E;  1Z3X A;  3ONK A;  1SQM A;  5FT9 A;  2VGX A;  2DCP A;  3FTU A;  3MKQ B;  1Y8M A;  3D9I A;  4GZ5 A;  3TWT A;  4HI9 A;  4LSZ E;  4XX5 A;  5ENO D;  4GTO A;  3U4T A;  2VSO E;  2CFZ A;  1FCH A;  4YVO A;  2XGS A;  3UT4 A;  4NIK A;  5FIN A;  1MJ0 A;  3ZU7 B;  3U64 A;  3HG0 D;  4QFV A;  5FZS A;  4NAC A;  3ZPJ A;  2ION A;  1E8Y A;  2LUH A;  4JD2 G;  1HH8 A;  2XEN A;  2V0P A;  3R7R A;  4R7L A;  5ENT D;  4WNE A;  2RKK A;  2KCV A;  3FTX A;  1E7V A;  5CCM A;  2Y3A A;  2GRM A;  5G05 J;  4M7C A;  2WQ6 A;  3J5Q B;  2XS1 A;  3PUJ A;  5D66 A;  1TR4 A;  5ANL A;  1JWF A;  4A1G A;  3ULQ A;  3TWV A;  3UQ3 A;  4GZC A;  4XE0 A;  4XZ4 A;  5ENN A;  3AU4 A;  1AP7 A;  5KJK A;  2PNN A;  1TN6 A;  2WXG A;  3E30 A;  1WDY A;  3ABK E;  5AQB A;  3LVR E;  2C0M A;  4I6J A;  5KJM A;  1D8E A;  4O1O A;  4CYM D;  2AJA A;  4CZ2 D;  3LYA A;  1ZU2 A;  1TNO A;  2B0O E;  2IJG X;  3LS8 A;  3B7S A;  3UKU G;  1H0A A;  4WNG A;  1WY6 A;  3OAW A;  3ZEF A;  4K5C A;  4GPK A;  4XEI G;  5LOZ A;  3PZ4 A;  4AXH A;  1HF8 A;  4PUC A;  2MRI A;  4CDR A;  3DEO A;  1NI1 A;  3RU0 A;  5EDS A;  3MEK A;  4ACK A;  4J8E A;  3AG2 E;  4B0Z A;  4HS2 A;  1IKN D;  4GA0 A;  4FUL A;  2XGM A;  1TN7 A;  1HU3 A;  4B89 A;  5D0O D;  1OWP A;  2OND A;  3SFY A;  4UWH A;  1HE8 A;  2P9K G;  1JCQ A;  2RFM A;  1WM5 A;  3FUJ A;  4BWR A;  4JHR A;  4FA6 A;  4KZ0 A;  4EQF A;  4BT8 A;  4I2Z A;  5FJY A;  4DX6 D;  4HNA D;  1HS6 A;  1OXJ A;  3ASD A;  3L17 A;  4EZK A;  2UY1 B;  5AQA A;  3L82 A;  4YDW A;  1N52 A;  1SZ9 A;  4OYS A;  3FUM A;  4APO A;  2PL2 A;  2H6I A;  3ZRH A;  4BTB A;  4U0Z A;  1N54 A;  1YMP A;  3ZYL A;  1E96 B;  1O1R A;  4WWP A;  4J8S A;  2HE0 A;  4N2S A;  3TWS A;  3AG4 E;  5LX8 A;  4EPZ A;  2R2L A;  3FTZ A;  3WG7 E;  1K1A A;  3HXE A;  1FVF A;  2H6F A;  2L0I A;  4I17 A;  2Y1L E;  3R9M A;  3I4R B;  2DBA A;  2MOW A;  4HLE A;  2H6H A;  4JW1 A;  3Q47 B;  3TWW A;  3NQP A;  3RRU A;  5BNW A;  3JUE A;  3EHN A;  3UUX A;  2WPV A;  3UTM A;  4ILH B;  2KXP C;  3IHY A;  4GZD A;  1MHQ A;  3UT7 A;  3QC1 A;  4ATZ D;  3T9K A;  3CR3 A;  1O1T A;  3LY7 A;  3TWQ A;  3VLD A;  4FP7 A;  3P2B A;  3PS6 A;  1INZ A;  4N5C A;  4DK5 A;  4QQI A;  1H19 A;  5ENQ D;  3V31 A;  4G26 A;  3DSS A;  3ASG A;  3UM0 A;  4MS6 A;  2IQC A;  4DX7 D;  2CG3 A;  5J90 A;  4U0U A;  4IRU A;  3QWV A;  3LEW A;  4BFR A;  4DJA A;  2I1J A;  2XCB A;  4GZ3 A;  1JUQ A;  3PZ2 A;  4J8Y A;  2VTB A;  3DBS A;  1TNB A;  5EKQ D;  4KZC A;  5CCL A;  3MX3 A;  5E76 A;  4P29 A;  1D9S A;  2QYU A;  2IO3 C;  4U7E B;  3V2X A;  2WXI A;  5BXU A;  4KMO A;  5AYW D;  4GTP A;  4CT4 A;  2WXN A;  4IYP A;  4PDX A;  4Q69 A;  3HXD A;  4ANU A;  3SQV A;  3ZYK A;  4OAU C;  4U04 A;  2NSZ A;  4HXI A;  1X5B A;  3GZS A;  2WXH A;  2MYO A;  1N4R A;  2WXF A;  1ZBP A;  4UI9 J;  3P1U A;  3FH5 A;  4JVS A;  4OVV A;  4FJZ A;  5A6C A;  4DRX E;  2JAB A;  1EDU A;  3PH0 C;  2XS8 A;  3CGH A;  4ABN A;  2VQ2 A;  3MJW A;  3NOG D;  1PAQ A;  1LD7 A;  2LSV A;  5JJT A;  2E0I A;  4U96 D;  2ZIS A;  3CVW A;  1O1S A;  1DCQ A;  3AS8 A;  5FZQ A;  4UWK A;  3U3W A;  4FC8 A;  4FU3 A;  1OCZ E;  4DX5 D;  3EIJ A;  3RIB A;  4HOS A;  5FQ7 A;  4YVQ C;  3PEU B;  4JEH A;  5J08 A;  3G2U A;  3R7Q A;  1NFI E;  5KNH D;  2GGF A;  1KT1 A;  1ELW A;  1UJK A;  4HQD A;  2I6H A;  4TUU A;  5D0Q D;  4CCA A;  3L08 A;  3ESL A;  3V79 K;  3AG3 E;  5ARF A;  1YYH A;  3S7J A;  5AEN A;  2VGE A;  2GRL A;  3ULY A;  4HRM B;  5G05 C;  5ANR A;  3DPD A;  1UG3 A;  5BT1 A;  3FTS A;  2Y4T A;  1TEZ A;  2VYI A;  4AM9 A;  4UWG A;  3GW4 A;  4KBQ A;  3CHP A;  3FU5 A;  4TXQ A;  3FH7 A;  3DST A;  4CDM A;  2R5S A;  1NA3 A;  2WXL A;  1FT2 A;  3FTY A;  3Q73 A;  3FDH A;  3SI5 A;  4BT9 A;  2X38 A;  3ABM E;  3MA5 A;  1A17 A;  3NAW A;  3FEY A;  4NUR A;  1K3Z D;  3IHV A;  1A5E A;  4BET A;  3ABL E;  2VGY A;  4LUN U;  4K5A B;  2PQN A;  1H2T C;  2IEJ A;  2BED A;  4N39 A;  4ILI A;  3EHR A;  5ITZ F;  3CVP A;  1XGW A;  4LNG A;  4G2V A;  1IHG A;  3Q9U C;  1RZ4 A;  3PZ3 A;  3CHQ A;  4I1O B;  2X6H A;  2P58 C;  3B95 A;  5CBN A;  1E90 A;  2Y69 E;  3ASF A;  4HFG A;  1JCR A;  2IFU A;  3Q9N C;  3CQG B;  5AIJ A;  3G2S A;  5B1A E;  2FEZ A;  2KCL A;  1B89 A;  1NL4 A;  2HO1 A;  3I3N A;  3MCX A;  5EIB E;  4A1S A;  2DWZ A;  2LXM A;  4XI9 A;  2BTD A;  1OWN A;  4TXR A;  3QK0 A;  3CK9 A;  2J07 A;  4L2L A;  4A63 B;  3QDN A;  5LP0 A;  3UXG A;  5G04 J;  5KWD A;  4AOF A;  3D9N A;  1N0Q A;  3S7B A;  3KSQ A;  3UX4 A;  1JCS A;  5FQ6 A;  3D9M A;  2WXM A;  4JEU A;  3LVQ E;  2ZXW E;  5BPP A;  5BXO A;  3ULE G;  3TAX A;  3FTV A;  3TXN A;  1S0P A;  3IKO B;  2AXU A;  3L13 A;  3PNL B;  3CLJ A;  1HO8 A;  4N3A A;  3TWR A;  4BEP A;  2P9P G;  3MKQ A;  3UM1 A;  3LY8 A;  1OWM A;  3LCA A;  3FFL A;  4G24 A;  1SW6 A;  5BUZ A;  4D10 C;  1L5J A;  4KXK B;  3VTY A;  1H6P A;  3UIO C;  4EZJ A;  2X6K A;  4WWN A;  4MKT A;  3NOC D;  5CBO A;  3RKV A;  5B1B E;  4WAF A;  1S63 A;  2LO6 A;  4NQ0 A;  1IHB A;  2V8S E;  3E32 A;  4ANX A;  4PS7 A;  4RG9 A;  5FQ8 A;  4F1S A;  4C48 B;  4ANW A;  5C1D A;  1H2U A;  3HVE B;  5AJD A;  2KBX A;  4WUY A;  1HXI A;  1UN9 A;  3CEQ A;  2P9N G;  3CHO A;  2ETA A;  1BD8 A;  3OXG A;  1H6O A;  3LKU A;  4L9P A;  4GYY A;  4MBG A;  3L6A A;  4ACL A;  4GTR A;  3L22 A;  1HZ4 A;  3IEG A;  2FO7 A;  3MGB A;  1ELR A;  2WXO A;  3QWP A;  3DXM G;  4OVU A;  4XKC A;  4GCO A;  3BG0 B;  4O1P A;  3EUV A;  4JPS A;  2Q7F A;  2VSN A;  4AY6 A;  3DEP A;  4ANV A;  3KAE A;  4GAA A;  2J4D A;  5JHB A;  2WXK A;  4TUM A;  1N95 A;  3TL5 A;  3SF4 A;  2I1K A;  4AEZ C;  5HKP A;  4I9C A;  2XGO A;  1H2V C;  2IU1 A;  2E2E A;  2ETC A;  3I5P A;  3CVV A;  4X8Q A;  1N0R A;  3SFX A;  4Y6C A;  4FLB A;  2XQ0 A;  3FUL A;  1OCO E;  5G55 A;  2EIM E;  3T8M A;  1MX4 A;  1OY3 D;  3Q4A B;  2X6F A;  3UI2 A;  3SBS A;  4UI9 C;  2YQ8 A;  3FUD A;  4CRW A;  4EZL A;  4MLP A;  4GZ6 A;  3PVL A;  3CVL A;  4YDE A;  3UM2 A;  3G2V A;  5JMN D;  2FF4 A;  1PC2 A;  5CEA A;  2DZN A;  5BW8 C;  3ZIM A;  4Q96 A;  3URZ A;  1EF1 C;  2Y0B G;  3IXE A;  2FBN A;  3E34 A;  4PH4 B;  3E33 A;  4KVM A;  5EYL A;  4B94 A;  4GTT A;  4LNB A;  5ENS D;  3EU5 A;  2KAT A;  4KYO B;  4KT6 B;  3EHM A;  3CKB A;  3E4B A;  1P5Q A;  3SO8 A;  5AQ7 A;  2VJ8 A;  3ZHE B;  4L7T A;  5ENR D;  2L0T B;  4CGV A;  3SY2 A;  4L2Y A;  3TG4 A;  3D9P A;  4Z68 A;  4RSY A;  2X6J A;  3Q75 A;  5AJL A;  5A7D B;  2OVB A;  4M3O A;  5CMY A;  1GW6 A;  3V2O A;  4BES A;  4AJW A;  4ZFH A;  3UKR G;  1MZC A;  2YHE A;  1PY1 A;  1OCC E;  2P9U G;  4HBD A;  2WQH A;  4EBA G;  3BUA A;  3CHR A;  4LEU A;  1N4S A;  2L6J A;  2QZA A;  3KS2 A;  2WB2 A;  1Z3Y A;  3FHE A;  5CED B;  5IY5 E;  2FI7 A;  4UWL A;  2OVF A;  2DYS E;  4H7Y A;  3C72 A;  4EHM A;  4UWF A;  3AG1 E;  2CFU A;  2MHK A;  3ONL A;  4L1B A;  3LY9 A;  3FUN A;  4BSX A;  4GA1 A;  4G25 A;  4XIF A;  3DSX A;  3IBE A;  3OXL A;  4G8L A;  3VLE A;  2WXR A;  3UMV A;  2RD0 A;  4WND A;  4XKB A;  3JQ0 A;  4NRH B;  1UJJ A;  3OXF A;  2KZT B;  4I6G A;  3ASH A;  4AIF A;  3HHM A;  3PEV B;  2WVI A;  4BX8 A;  3LXU X;  4JHJ A;  4F1P A;  3L54 A;  2EQX A;  3UIN C;  5FTP A;  2KC7 A;  2I2O A;  3IV0 A;  3PE4 A;  1TYQ G;  4GCN A;  1N9A A;  2ZGG A;  3SZ7 A;  4HLL A;  2VSX E;  3K9I A;  1IXV A;  1MX2 A;  2WM9 A;  5CMW A;  3APF A;  2H6G A;  4HVB A;  1DC2 A;  3DWL G;  4TV3 A;  3FTW A;  3BU8 A;  4GPM A;  2J08 A;  3C5R A;  3TJP A;  3N71 A;  3FU3 A;  4PS8 A;  3ENE A;  4ME2 A;  3RO2 A;  1SA5 A;  2I9C A;  3S7F A;  3SFZ A;  2CHZ A;  4V3I A;  5HQ8 A;  3PZD A;  2J49 A;  3V30 A;  5HS0 A;  2R59 A;  2OV8 A;  3UT8 A;  1O5M A;  2BKK B;  3NZU A;  3RK6 A;  4GTM A;  3CVY A;  2LAI A;  4GTV A;  5G04 C;  2ETB A;  4HOR A;  4FAD A;  1QYM A;  2NXP A;  2AW6 A;  1JWG A;  3DSV A;  1XNF A;  1HX8 A;  3O4Z A;  4JL0 A;  5FZR A;  2V4H C;  4JXT A;  2ZGD A;  3B7R L;  3DPY A;  4F53 A;  1HG5 A;  3CK7 A;  3OTN A;  2IOS A;  5EX0 A;  1HG2 A;  1Q2Z A;  4U0S A;  3NBN B;  1ELK A;  2WMN A;  5ENP D;  3TWU A;  3QAQ A;  3D3M A;  1V55 E;  3PUK A;  2F8X K;  3CV0 A;  4GA2 A;  3T5V A;  3ZXP A;  3MV2 B;  5CHE E;  2PQR A;  2ZU6 B;  3D9K A;  3Q5M A;  4W9R A;  5M72 A;  1RW2 A;  3JYS A;  3RRM B;  2VGX B;  5H7P A;  3ISM C;  2IF4 A;  3ZVV A;  4U95 D;  3MZL B;  3CHM A;  2CHW A;  3CQC B;  2GRP B;  3FH8 A;  5D2M C;  1Z5S C;  5CEC B;  2WXP A;  3Q7A A;  2QC9 A;  4OAV B;  5KJL A;  4G23 A;  4DLO A;  3PRZ A;  3CIA A;  1FPP A;  1EYH A;  5T4Y A;  4PS3 A;  1BU9 A; 
#chains in the Genus database with same CATH homology
 4RG9 A;  3GYZ A;  3O48 A;  2OOE A;  2JEK A;  3CSF A;  5FQ8 A;  4F1S A;  2MOW A;  4ANW A;  4HLE A;  4KVO A;  1FVH A;  4JW1 A;  5C1D A;  1VDY A;  3Q47 B;  1H2U A;  3HVE B;  5AJD A;  4F3V A;  2Y4U A;  1TJC A;  3NQP A;  3D9J A;  4WUY A;  3RRU A;  4HOQ A;  5KJN A;  1HXI A;  5BNW A;  3PDN A;  1UN9 A;  3CEQ A;  3C98 A;  3EHN A;  3UUX A;  2WPV A;  3FUI A;  3CHO A;  4G1T A;  4ILH B;  5JJ7 A;  3IHY A;  3OXG A;  4IN3 B;  3LKU A;  3ML9 A;  5DIZ A;  4GZD A;  1MHQ A;  3UT7 A;  4GYY A;  3U66 A;  1IQU A;  3QC1 A;  3TXM A;  3I4G A;  3L6A A;  4JA9 A;  1SZA A;  3CR3 A;  3HIZ A;  2CHX A;  3LJ3 A;  4JC8 A;  3VTX A;  4N2Q A;  3BG1 B;  4ACL A;  3FWV A;  3LY7 A;  4B8A A;  2LSU A;  4FLH A;  3L22 A;  1HZ4 A;  3IEG A;  1E7U A;  2FO7 A;  3MGB A;  3VLD A;  4URK A;  4UQY A;  4FP7 A;  3P2B A;  1ELR A;  3TG5 A;  4WNF A;  2WXO A;  2XEV A;  3PS6 A;  4N5C A;  1INZ A;  2XPZ A;  3QWP A;  4ILG A;  4DK5 A;  3TGO A;  2GW1 A;  4C9B B;  4OVU A;  2KZT A;  4U8H A;  1H19 A;  3LDZ A;  5FQ4 A;  3QNK A;  2WXJ A;  4N3C A;  2X3M A;  2M63 A;  3B13 A;  3CVN A;  3LPZ A;  4XKC A;  3VLF A;  2IOL A;  5T8I A;  3AS5 A;  4GCO A;  5JJ6 A;  2ILR A;  3BG0 B;  3CVQ A;  4G26 A;  3CST A;  1IYG A;  4I43 A;  4IUL A;  4BX9 A;  4APF A;  4JPS A;  2Q7F A;  4FHK A;  4CDN A;  5FWQ A;  2C0L A;  3PE3 A;  4J8D A;  3ASG A;  3SNX A;  4MS6 A;  3QKY A;  3D9O A;  2IQC A;  2VSN A;  4DLQ A;  4E6H A;  2CG3 A;  4AY6 A;  5J90 A;  3FUF A;  4ANV A;  4U0U A;  3KAE A;  3MKR A;  4GAA A;  2J4D A;  4IRU A;  1H6K A;  5JHB A;  2WXK A;  3QWV A;  3LEW A;  4BFR A;  4DJA A;  2I1J A;  2YNQ A;  3GZ2 A;  2R17 C;  2XCB A;  2DIW A;  4GZ3 A;  3TL5 A;  4MRU A;  1Z6T A;  1JUQ A;  2I1K A;  3QJZ A;  4U07 A;  4Y6W A;  3SF4 A;  4AEZ C;  5A23 A;  2VTB A;  4A3T A;  3DBS A;  1WAO 1;  1U3D A;  5LCW C;  5LFA A;  4AY5 A;  3BEE A;  4I9C A;  2XGO A;  5EKQ D;  4KZC A;  1H2V C;  3PNT B;  2IU1 A;  4RVB A;  4FHJ A;  2A4Z A;  5CCL A;  3B7U X;  1UW4 B;  2E2E A;  3MX3 A;  5E76 A;  3MYV A;  3QAR A;  4HOU A;  4P29 A;  2KCK A;  3FEX A;  3I5P A;  3CVV A;  5LCW J;  2AVP A;  1DNP A;  3QWW A;  1QZ2 A;  4Y6C A;  4FLB A;  3AU5 A;  2XQ0 A;  1UN8 A;  3FUL A;  3ML8 A;  5G55 A;  2WXI A;  4KMO A;  3T8M A;  4C0E A;  5AYW D;  3Q4A B;  4CT4 A;  2WXN A;  3JQ1 A;  3ZYQ A;  4IYP A;  2X6F A;  4PDX A;  4Q69 A;  3NZS A;  2V5F A;  3SBS A;  4ANU A;  4UI9 C;  2YQ8 A;  2AXV A;  3JUI A;  4I1A A;  4O6F A;  2AWI A;  1OWL A;  3FUD A;  4CRW A;  4EZL A;  3ZYK A;  4MLP A;  4U04 A;  2NSZ A;  4HXI A;  1NP7 A;  1X5B A;  3GZS A;  2XRY A;  2WXH A;  4GZ6 A;  2NC9 A;  3EDT B;  2WXF A;  3PVL A;  2WXQ A;  1E8Z A;  4DI3 A;  3CVL A;  1ZBP A;  4UI9 J;  4WWO A;  3G2V A;  3P1U A;  4K0R A;  2FF4 A;  4I6E A;  3FH5 A;  1PC2 A;  4JVS A;  5HI7 A;  4OVV A;  4FJZ A;  4CT0 A;  2YHC A;  5A6C A;  2WQ7 A;  2BF0 X;  3RJV A;  1EDU A;  3FP3 A;  2JLB A;  2A5U A;  3SBT B;  3PH0 C;  5ARG A;  5KCM A;  3L16 A;  2XPI A;  4L23 A;  3CGH A;  5BW8 C;  4Q96 A;  3URZ A;  3ZIM A;  3B7T A;  5DBK A;  1EF1 C;  4N3B A;  2FBN A;  2QY7 A;  3APC A;  4ABN A;  4PH4 B;  3CHS A;  4GU5 A;  3FY4 A;  4KVM A;  2VQ2 A;  4AV7 A;  3ZN3 A;  1EPU A;  3GZ1 A;  1NA0 A;  3MJW A;  3JCK C;  3MV3 B;  1PAQ A;  2LSV A;  3SGH A;  4B94 A;  5JJT A;  2E0I A;  4KYO B;  2KAT A;  4CEM A;  3ZGQ A;  3CVW A;  1KT0 A;  3R9A B;  2C2L A;  4JHK A;  3EHM A;  4KT6 B;  3SD5 A;  3FU6 A;  5JHA A;  4HOT A;  3AS8 A;  3CKB A;  5FZQ A;  3E4B A;  4UWK A;  1BPO A;  1QNF A;  3KEZ A;  2PZI A;  4RG6 A;  3U3W A;  4FJY A;  3FUK A;  1P5Q A;  3T5X A;  1Z3X A;  4FC8 A;  3FUE A;  4FU3 A;  3ONK A;  3ESK A;  2VJ8 A;  4B8C B;  1SQM A;  2J9Q A;  3EIJ A;  3ZHE B;  4DI4 A;  5FT9 A;  3RIB A;  4HOS A;  2VGX A;  5FQ7 A;  4L7T A;  4YVQ C;  3PEU B;  2DCP A;  3FTU A;  3MKQ B;  2L0T B;  4JEH A;  1E8X A;  4EBA A;  1QQE A;  1Y8M A;  4CGV A;  2XHE A;  3NF1 A;  3HDX A;  5J08 A;  4L2Y A;  3G2U A;  3TG4 A;  3R7Q A;  3D9I A;  3D9P A;  4GZ5 A;  4RSY A;  2GGF A;  3D9L A;  3U9W A;  4LER A;  1KT1 A;  4AVX A;  1ELW A;  1UJK A;  1W3B A;  2XRZ A;  2I6H A;  2X6J A;  2HYZ A;  4XX5 A;  5AJL A;  4TUU A;  5D0Q D;  4CCA A;  5A7D B;  2OVB A;  4M3O A;  2YIN A;  4GMJ A;  5CMY A;  1GW6 A;  3U4T A;  1LF8 A;  3L08 A;  2VSO E;  4AJW A;  2CFZ A;  3ESL A;  2LAH A;  5ARF A;  2YHE A;  1PY1 A;  1FCH A;  3G2T A;  4U63 A;  4YVO A;  2WQH A;  3S7J A;  4EBA G;  3CHR A;  5AEN A;  2XGS A;  2LNI A;  4LEU A;  5C2Y A;  3UT4 A;  2RG8 A;  2L6J A;  3KD7 A;  3U64 A;  2J09 A;  2CG2 A;  2GRL A;  3KS2 A;  2WB2 A;  1Z3Y A;  3QB2 A;  3FHE A;  3HVE A;  4QFV A;  4J0U A;  5FZS A;  4NAC A;  2FI7 A;  4UWL A;  3ZPJ A;  4BY6 A;  2OVF A;  5G05 C;  2ION A;  1E8Y A;  4H7Y A;  5ANR A;  3DPD A;  1UG3 A;  4UWF A;  5BT1 A;  3FTS A;  2CFU A;  2Y4T A;  1HH8 A;  1TEZ A;  2PM6 A;  2MHK A;  3HYM B;  4LRZ A;  2V0P A;  3ONL A;  3R7R A;  2VYI A;  4L1B A;  1OWO A;  4R7L A;  3LY9 A;  4UWG A;  4AM9 A;  4WNE A;  3FUN A;  4BSX A;  2L9B A;  2KCV A;  3G2W A;  4GA1 A;  3FTX A;  3GW4 A;  4G25 A;  1E7V A;  4KBQ A;  3CHP A;  4Q94 A;  5CCM A;  2Y3A A;  2GRM A;  4XIF A;  5G05 J;  3IBE A;  3OXL A;  3FU5 A;  3VLE A;  2WXR A;  2X6I A;  3UMV A;  2WQ6 A;  3PUJ A;  1IQR A;  2RD0 A;  4WND A;  4XKB A;  5ANL A;  1JWF A;  3FH7 A;  3JQ0 A;  4NRH B;  1UJJ A;  2R5S A;  3OXF A;  2KZT B;  4I6G A;  3ULQ A;  4A1G A;  4CDM A;  4DPR A;  3ASH A;  3EJN A;  4AIF A;  3HHM A;  3PEV B;  1NA3 A;  2WXL A;  2WVI A;  3FTY A;  3UQ3 A;  4GZC A;  4XE0 A;  4BX8 A;  4XZ4 A;  3LXU X;  4GML A;  4JHJ A;  3FDH A;  3SI5 A;  5ENN A;  2X38 A;  4BT9 A;  3AU4 A;  4JA7 A;  3MA5 A;  1A17 A;  5KJK A;  3L54 A;  4J6I A;  2EQX A;  3FEY A;  3WXX A;  2PM7 A;  4NUR A;  5FTP A;  2KC7 A;  3IHV A;  3RRN B;  4G11 A;  2I2O A;  3IV0 A;  2WXG A;  3PE4 A;  4ATG A;  4GCN A;  4K03 A;  2UWJ G;  2VGY A;  3SZ7 A;  4LUN U;  2VSX E;  3LVR E;  2PQN A;  3K9I A;  2C0M A;  4TRQ A;  5E75 A;  4GYO A;  4I6J A;  2WM9 A;  5KJM A;  5CMW A;  2VTB B;  1H2T C;  3ZXS A;  3LYA A;  1ZU2 A;  3QOU A;  2HM8 A;  2IJG X;  2UY1 A;  3APF A;  4N39 A;  3LS8 A;  5BV1 A;  4HVB A;  3B7S A;  4ILI A;  1HFA A;  4TV3 A;  1H0A A;  3CVP A;  1XGW A;  4WNG A;  1WY6 A;  3FTW A;  4C0M A;  3OAW A;  1TJF A;  4G2V A;  1IHG A;  2J08 A;  3ZEF A;  4A55 A;  3TJP A;  1E8W A;  3N71 A;  4GPK A;  3FU3 A;  3CHQ A;  4PS8 A;  4I1O B;  3ENE A;  2X6H A;  5LOZ A;  2P58 C;  4ME2 A;  3RO2 A;  2I9C A;  4AXH A;  3S7F A;  1E90 A;  1HF8 A;  4PUC A;  4UQX A;  3ASF A;  2J4B A;  2HR2 A;  4HFG A;  3SHF A;  3SFZ A;  2MRI A;  2CHZ A;  5G2N A;  4CDR A;  4V3I A;  2IFU A;  5HQ8 A;  3CQG B;  3RU0 A;  3PZD A;  5EDS A;  3MEK A;  5AIJ A;  2J49 A;  3G2S A;  1KLX A;  2FEZ A;  4ACK A;  2KCL A;  1B89 A;  2V4L A;  3S7D A;  3APD A;  4UI9 K;  4J8E A;  2R59 A;  2OV8 A;  3UT8 A;  2HO1 A;  4UQZ A;  1MQS A;  2XPY A;  3NZU A;  4B0Z A;  3I3N A;  3RK6 A;  3CKC A;  3MCX A;  4HS2 A;  4A1S A;  3CVY A;  2LAI A;  4XI9 A;  4A3V A;  4GA0 A;  4FUL A;  2XGM A;  3FU0 A;  1HU3 A;  5G04 C;  2BTD A;  4B89 A;  4I2W A;  5D0O D;  1OWP A;  1OWN A;  4HOR A;  4FAD A;  2OND A;  5BV0 A;  4I9E A;  2NXP A;  4I1M A;  2AW6 A;  1JWG A;  3QK0 A;  1U3C A;  3CK9 A;  4UWH A;  1HE8 A;  4H7X A;  1XNF A;  1HX8 A;  1OUV A;  2J07 A;  3O4Z A;  4L2L A;  4JL0 A;  5FZR A;  4JXT A;  3B7R L;  4F53 A;  1WM5 A;  3FUJ A;  4BWR A;  3QDN A;  4E85 A;  5LP0 A;  4JHR A;  1HG5 A;  3CK7 A;  3OTN A;  3PRE A;  2IOS A;  5EX3 A;  4KZ0 A;  5G04 J;  4AOF A;  4FA6 A;  3D9N A;  4XI0 A;  4EQF A;  4GYW A;  5EX0 A;  1HG2 A;  4I2Z A;  4BT8 A;  3FUH A;  3S7B A;  3CVU A;  4U0S A;  2FUL A;  3ZFW A;  1ELK A;  2WMN A;  5FJY A;  3UX4 A;  5FQ6 A;  1HS6 A;  3L17 A;  3D9M A;  2WXM A;  3ASD A;  3D3M A;  3QAQ A;  4EZK A;  2KM4 A;  3RO3 A;  4JEU A;  3LVQ E;  4J8F A;  4LCT A;  3PUK A;  5BPP A;  2UY1 B;  2VSY A;  3CV0 A;  3EIQ C;  4BTA A;  4GA2 A;  3TAX A;  3FTV A;  3T5V A;  3MV2 B;  1N52 A;  1SZ9 A;  5CHE E;  3ZW3 A;  4OYS A;  3FUM A;  2PQR A;  2PL2 A;  3TXN A;  4APO A;  3UPV A;  2ZU6 B;  3ZRH A;  3D9K A;  3Q5M A;  4W9R A;  2AXZ A;  5M72 A;  1S0P A;  3IKO B;  2AXU A;  3L13 A;  1NZN A;  3PNL B;  3CLJ A;  4YND A;  4BTB A;  4U0Z A;  3JYS A;  1HO8 A;  4N3A A;  5T3R A;  3ZHE A;  1N54 A;  3RRM B;  2VGX B;  3ZYM A;  3Q49 B;  3ZYL A;  2IF4 A;  3MKQ A;  1YA0 A;  3LY8 A;  4EEC A;  1OWM A;  3ZVV A;  1E96 B;  3S2A A;  2WMO A;  3CK8 A;  3CHM A;  3MZL B;  3LCA A;  2CHW A;  3FFL A;  4J8S A;  4G24 A;  4WWP A;  5BUZ A;  4N2S A;  4D10 C;  1L5J A;  1JPL A;  2QFC A;  3CVX A;  3CQC B;  3FH8 A;  4F7A A;  4KXK B;  3VTY A;  2WXP A;  2XCC A;  3AS4 A;  4EZJ A;  4CGW A;  5LX8 A;  2X6K A;  4EPZ A;  5KJL A;  4WWN A;  4MKT A;  3FTZ A;  4AP2 A;  2BUG A;  3RKV A;  4G23 A;  4WAF A;  3Q15 A;  4DLO A;  1FVF A;  2LO6 A;  4JZY A;  3PRZ A;  3CIA A;  4NQ0 A;  1Y6I A;  2L0I A;  2V8S E;  4GB9 A;  1EYH A;  5T4Y A;  4I17 A;  1DVP A;  3I4R B;  4ANX A;  4PS3 A;  2DBA A;  4PS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...