2LNIA

Solution nmr structure of stress-induced-phosphoprotein 1 sti1 from homo sapiens, northeast structural genomics consortium target hr4403e
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
133
structure length
133
Chain Sequence
MGHHHHHHSHMNPDLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Stress-induced-phosphoprotein 1
publication title Northeast Structural Genomics Consortium Target HR4403E
rcsb
source organism Homo sapiens
total genus 46
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lniA00
4WNEA 4WNGA 5CCMA 2L6JA 2HO1A 4J8FA 1OUVA 3LYAA 4UQZA 4XI0A 5LCWC 2ONDA 3TG5A 4YNDA 3ASHA 3CK7A 4GYYA 3UQ3A 5FJYA 4N2SA 2NC9A 4UQYA 1E96B 4GA1A 3QKYA 3ZHEA 5D0OD 5ARGA 4RG9A 2PQRA 3LY7A 5HI7A 1IHGA 3KAEA 2E2EA 2KC7A 3ZHEB 4BTBA 1KLXA 2C0MA 3Q47B 4RG6A 2VGXA 5CHEE 1W3BA 5CCLA 4G1TA 5FZRA 5FZQA 3S7BA 2FBNA 3GW4A 3TAXA 5G05J 3S7JA 3ZN3A 2FI7A 4BT9A 4WUYA 1XNFA 4Y6WA 2IFUA 4HOSA 4AY5A 4ABNA 4AM9A 3E4BA 2XEVA 2XCBA 4U0ZA 3O48A 3GZ1A 1ELWA 5EX3A 3N71A 4GZ6A 3LKUA 2KCKA 5EKQD 4XI9A 4UQXA 5D0QD 4Y6CA 4UI9K 5FTPA 2KCLA 2WPVA 3OXFA 1P5QA 3TG4A 3Q49B 4I17A 5FZSA 4NRHB 4N3CA 3QWPA 3ASFA 2YQ8A 3ZPJA 1NZNA 1A17A 4WNFA 2VYIA 3FP3A 4A1SA 2Y4TA 2HR2A 3AS5A 4KYOB 4N2QA 4U04A 3TGOA 3AS4A 2KATA 4H7XA 2FF4A 2KCVA 4J8DA 2R5SA 2VSNA 3RO2A 3JYSA 4J8EA 5KJMA 3LCAA 5LCWJ 4GZ5A 2JLBA 3ASDA 4I9CA 1QQEA 4N5CA 5A7DB 4U0UA 3URZA 4GZ3A 2XGMA 3UUXA 5BW8C 2V5FA 3UPVA 2LNIA 3EDTB 4HOQA 5ARFA 1ZU2A 4CGWA 3CKBA 3GYZA 4YVOA 3CEQA 3KS2A 3CVNA 1Y8MA 3CVLA 4UI9C 2WQHA 2VGXB 4XIFA 3CKCA 3ZGQA 1NA3A 2I6HA 5FT9A 2UY1A 4JA7A 3RIBA 3ZFWA 3PDNA 1YA0A 3S7DA 3U3WA 3LPZA 3ESKA 4I2WA 4I1AA 4BWRA 3Q4AB 2Y4UA 1KT1A 4HOUA 2PL2A 4G24A 5JJTA 2QFCA 1KT0A 2YHCA 3MA5A 3MV3B 3LY9A 4G23A 5BT1A 3ULQA 3S7FA 3RU0A 4EQFA 3ASGA 4HOTA 4B94A 3FWVA 2PQNA 5A6CA 5C1DA 3VTYA 2Q7FA 5KJKA 2GW1A 3VTXA 3WXXA 2LSVA 3Q5MA 3MKRA 3OXLA 2IF4A 3AS8A 5HQ8A 5BNWA 4GCNA 4F3VA 3PE3A 5G04C 1HXIA 3BEEA 2VQ2A 3LY8A 1WM5A 5JJ7A 5M72A 3MEKA 4GPKA 2UWJG 4G2VA 3RKVA 2J9QA 1QZ2A 1HZ4A 2C0LA 2LSUA 2C2LA 4U07A 3PE4A 3QWVA 4KXKB 1B89A 4W9RA 1HH8A 2OOEA 3HYMB 4N3BA 2FEZA 4BT8A 4J0UA 2HYZA 2P58C 4I2ZA 2XPIA 5DBKA 2VSYA 3R9AB 4CDRA 3CV0A 3OXGA 4HORA 4LEUA 4UI9J 4CGVA 3CVPA 4JA9A 4N3AA 1ELRA 5G05C 5AYWD 3QWWA 2FO7A 3RO3A 2UY1B 5JJ6A 2VGYA 1IYGA 2AVPA 1PC2A 4GYOA 3RJVA 4JHRA 3CK8A 4JL0A 3U4TA 4AY6A 3CVQA 2PZIA 1NA0A 4GCOA 1ZBPA 2DBAA 4GYWA 3QDNA 5KJNA 4WNDA 1FCHA 1WAO1 3SF4A 4IN3B 4N39A 5DIZA 4I9EA 2XGOA 5KJLA 3QOUA 3NF1A 3FFLA 2BUGA 4APOA 2XCCA 3K9IA 1TJCA 4KBQA 3CK9A 3IEGA 4GA2A 4AIFA 4G25A 2MHKA 4ME2A 4BTAA 4H7YA 4O6FA 3Q15A 2XGSA 3KD7A 4NQ0A 4GA0A 5G04J 4U0SA 3MV2B 3GZ2A 4G26A 3SZ7A 4YVQC 5EX0A
chains in the Genus database with same CATH superfamily
5LFAA 5D66A 4CZ2D 4QQIA 4ACKA 4J8FA 1JCRA 4O1OA 3RRNB 3PNTB 3LYAA 4XI0A 4DX5D 5LCWC 3FUJA 4AV7A 4FADA 3MJWA 1ELKA 4N2SA 2EIJE 2F8YA 4FJYA 3UM1A 3QKYA 4GZCA 5D0OD 3CGHA 3SFZA 2PQRA 2V0PA 5AQ7A 2KC7A 4AP2A 3HXEA 5EYPF 1Q2ZA 2VGXA 1W3BA 5CCLA 2P9NG 5FZQA 3S7BA 4U63A 3TWUA 5ENRD 4JW1A 1BU9A 3B7UX 3CVWA 1N0QA 3X2QE 4BT9A 3Q9NC 4AY5A 4ABNA 3MX3A 1BPOA 3ASOE 4J6IA 3FUKA 3O48A 3PZ2A 5EX3A 3KEAA 3KSLA 3CSFA 2VGEA 1WDYA 4ANWA 1GW6A 4WAFA 1ZB1A 2WPVA 2RKKA 3OXFA 4JEUA 1RZ4A 1P5QA 5AENA 3EHMA 2CFZA 3TWWA 3VLEA 3FTUA 3Q49B 2OEWA 4I17A 2CHZA 3SBTB 2LAIA 2YQ8A 1OCZE 1NZNA 4FHJA 1A17A 5AJLA 4WNFA 2VYIA 4A1SA 4E6HA 2YINA 2B0OE 1HU3A 2MRIA 3PRZA 2F8XK 4N2QA 3TGOA 2KATA 4DI4A 3OTNA 3UT7A 4YDYA 4DX1A 2FF4A 3MGBA 2Y3AA 4B89A 4I1MA 3EIQC 3LCAA 2XEEA 2JLBA 4I9CA 3VLDA 4AOFA 4BX9A 5A7DB 3IBEA 3URZA 2XGMA 3R9MA 4GTTA 4GPMA 4HOQA 5ARFA 3L16A 1ZU2A 3GYZA 2F37A 3HXCA 3D9NA 4XIFA 4UWFA 3ZGQA 5FT9A 4HRMB 4FJZA 2UY1A 4DK5A 4JHKA 4E85A 4UWHA 4BX8A 3S7DA 3LPZA 4I2WA 4DJAA 4BWRA 1XGWA 2H6FA 3D3MA 1KT1A 4G24A 3ABME 1Z3XA 2GROB 3TXNA 1RW2A 3FU5A 5C2YA 4I6GA 2QFCA 4K5AB 3ASNE 5HS0A 4F6RD 1SVXA 1SW6A 3MV3B 5LX8A 2P9SG 4G23A 3V2XA 3ULQA 3S7FA 3TJPA 2YHEA 4AEZC 4HOTA 4B94A 1S64A 5H7PA 2X6HA 3DXMG 1HF8A 2GW1A 3WXXA 4HQDA 3Q5MA 2CG2A 4U7EB 3FDHA 3FEXA 5T3RA 4MRUA 1UOHA 3Q73A 4AXHA 1H6PA 4A63B 5G04C 4CEMA 4RVBA 3SO8A 3LY8A 2M63A 2ZU6B 1WM5A 1FVFA 3CIAA 4GTMA 5M72A 3RKVA 1K1AA 4CCAA 4U07A 1SA5A 4YDOA 3ZKJA 1K3ZD 2XEHA 1JCSA 2X6JA 1JWGA 3DWLG 3NOCD 1MX6A 1IQRA 4N3BA 1H6KA 3Q7FA 2QYUA 4M7CA 2P58C 3EIJA 2XPIA 5DBKA 3FUDA 1E8WA 4GZDA 2ETAA 3ZRHA 4GTQA 4JA9A 1ELRA 5AYWD 3RO3A 3FTVA 4XKCA 4JPSA 3EU5A 1PC2A 3CVUA 2ZGGA 4M3OA 2KBXA 3T8KA 3U4TA 3RSEG 4AY6A 2CHWA 3CSTA 4UUCA 2P9KG 3T5XA 3Q79A 3R7QA 4KZCA 4L2YA 1FCHA 3LVQE 4I1OB 4G8LA 2IU1A 5CBOA 2XGOA 2WXLA 3C3QA 4FULA 3NF1A 3NQPA 2NSZA 2BUGA 4F1SA 1BI8B 2WXIA 2P9LG 5KNGA 4KBQA 1TNZA 1IHBA 3AG4E 3IEGA 3SD5A 3CHQA 3CHMA 2X38A 1K1BA 2MHKA 2AXUA 3EHRA 3ONKA 5ENPD 2AXZA 1HE8A 3JQ0A 3SZ7A 4LRZA 4F53A 5EX0A 3DRAA 4WNEA 2AWIA 2OCCE 3G2VA 4U8HA 4WNGA 2WVIA 1LD8A 2L6JA 2HO1A 3T8MA 4L7TA 5E75A 4NURA 4JD2G 3TG5A 2WXPA 5BUZA 2KM4A 3UQ3A 4TXPA 2DVWA 5FJYA 1AP7A 2DCPA 3ZHEA 4HRNA 3UM2A 2V4LA 1JPLA 2E2EA 3ZHEB 2AJAA 1KLXA 3U64A 3ENEA 2ETBA 1QYMA 2LAHA 3NB2A 5FZRA 3C3RA 4R7LA 4U95D 2FBNA 3TAXA 5G05J 2P2CP 2R59A 3CQGB 3S7JA 2XPYA 4B93B 2FI7A 1XNFA 4HOSA 4KZ0A 2ZISA 4AM9A 3SBSA 1EDUA 3L54A 3U9WA 1TJFA 3G2SA 4WWOA 2XCBA 4U0ZA 4DLQA 3GZ1A 3FUEA 3AG1E 2GRRB 4J8YA 4FLBA 4UQXA 3ULEG 4HB5A 1S0PA 4Y6CA 2PNNA 4ILHB 5FTPA 2KCLA 3IHYA 1BLXB 2H6HA 3LS8A 4A1GA 5IY5E 3C3OA 3SGHA 2IJGX 3E37A 2JABA 3BUAA 1OWPA 4N3CA 5AQBA 2IO2C 4C48B 3QWPA 3RRMB 1SZAA 3FHEA 3NBNB 3FP3A 4V3IA 2PM7A 4U8YD 2Y4TA 2HR2A 4KYOB 2L0IA 1OCOE 4U04A 3AS4A 2P9UG 4H7XA 3E32A 3FUHA 3DBSA 4J8DA 2R5SA 4JB8P 3MKQA 5AN8A 5AQAA 1G3NB 5KJMA 3MKQB 5LCWJ 4GZ5A 4IRUA 4WWNA 3PVLA 3ONLA 2F0YA 4N5CA 4ANUA 4U0UA 3D9KA 3QARA 2XQ0A 3CHOA 5BW8C 3L17A 3UPVA 3LVRE 2LNIA 3CHPA 1YCSB 4CGWA 4D10C 3B7TA 5D2MC 1HFAA 2WMNA 3FY4A 3CVNA 1Y8MA 4UI9C 2WQHA 2P9PG 2VGXB 1HG5A 3APDA 4K0RA 2WXOA 1NA3A 3E33A 2A5EA 3ZFWA 2WXGA 3PH0C 3LJ3A 3DXKG 4GTPA 4APFA 3ESKA 1TNUA 3U66A 5EILA 3TWQA 4IYPA 4YDWA 2YNQA 2PL2A 4FHKA 2L0TB 2Y1LE 2DZNA 4G8KA 4EZLA 2IONA 1OWMA 3LY9A 5KCMA 2XS8A 4EQFA 3ASGA 1MHQA 3JXIA 3HRAA 4DUIA 2FULA 5A6CA 3TWRA 3Q7AA 2AXVA 3VTYA 3LDZA 4NACA 5AAOA 3UIPC 4BETA 3UM0A 3MKRA 4G11A 1FT1A 3ZYQA 3FU0A 2WXMA 1IQUA 4DI3A 1N4QA 1N52A 4F1PA 5ENOD 1HXIA 3DSTA 3ESLA 5ENTD 3FUMA 4L2LA 2RFMA 3RRUA 4JEHA 2I1JA 4BFRA 2C2LA 3PE4A 3QWVA 4W9RA 3DSVA 2XRYA 5BXOA 1E7UA 5EDSA 4NIKA 1Y6IA 4GMLA 5FQ4A 1MQSA 4GU5A 4EHMA 4J0UA 5CEAA 2WM9A 3I3NA 4YDEA 2V4HC 4I2ZA 3MZLB 4MBGA 3FTZA 1NP7A 3PZ4A 1Z3YA 3OXGA 2AW6A 3FH7A 4OYSA 2MOWA 2NXPA 1OY3D 3D9PA 1N11A 3IXEA 2FO7A 2UY1B 5EIBE 4AVXA 5JJ6A 1VDYA 1IYGA 4AJWA 5J90A 4CT0A 1PAQA 1PY1A 1SZ9A 3V30A 3UMVA 2PZIA 1D8EA 4LG6A 2XZDG 2XENA 4PUCA 2WQ7A 1U2VG 3ISMC 4GB9A 1NI1A 5FQ8A 3JXJA 3QK0A 3SF4A 3I5PA 1H6OA 5B3SE 2QYJA 3JUEA 5KJLA 1E8YA 3QNKA 3JQ1A 5LOZA 1N4RA 1HG2A 2OVFA 3UIOC 2ZIRA 5ENNA 4CDMA 2IOSA 1WY6A 2GRQB 1N4PA 1DC2A 3AAAC 4ME2A 4BTAA 4H7YA 4JVSA 2DZOA 4HI9A 2RFAA 4O6FA 2XGSA 3C98A 3KD7A 4NQ0A 3PZ1A 5G04J 4BEPA 3FTSA 5CCMA 2WXKA 2I2OA 4DX7D 4HVBA 2V8SE 4UQZA 1TR4A 4RQIA 3RAUA 1HX8A 4YNDA 3ZYKA 5KNHD 3ASHA 3CK7A 4B8CB 3FEYA 2NC9A 1E96B 1S63A 4A3VA 3PS6A 5FINA 2ZGDA 4BY6A 1DNPA 4RG9A 5HI7A 3DEOA 4KVOA 1IHGA 3FU6A 3SI5A 4EECA 1OCRE 2C0MA 4RG6A 2CG3A 4LCTA 5CHEE 5CECB 2Y69E 2J07A 2I9CA 1O5MA 2VTBA 2CFUA 1LF8A 5CMYA 4GAAA 5J08A 4Q69A 4IULA 2VTBB 3V79K 5KBAA 4O1PA 3ZN3A 4K03A 2X6FA 3DSSA 4Y6WA 2WXFA 5B1BE 3FH5A 3G2WA 4K5CA 1N0RA 1N94A 1ELWA 3EHQA 2EINE 3DSUA 4GZ6A 3J5QB 4PS7A 2H6IA 3NZUA 5EKQD 4XI9A 1X5BA 2KZTA 5EIDA 4ZFHA 1FVHA 2R03A 5D0QD 2X3MA 4UI9K 3FULA 3IV0A 3LJNA 3DEPA 5FWQA 2QZAA 3EJNA 2QY7A 1H2VC 5ANRA 3UM3A 3CVVA 5FZSA 3CVYA 4WWPA 4GTVA 1INZA 3MCXA 3ASFA 2J8SD 2VSXE 4MS6A 5G55A 1LD7A 2BKGA 1Z5SC 3TL5A 3CHRA 4JC8A 1TNBA 1KZOA 1SQMA 4P29A 1A5EA 3FUFA 4L9PA 5B1AE 4LUNU 4OAUC 2KCVA 2VSNA 3RO2A 3JYSA 5HKPA 5AARA 4J8EA 1NFIE 3SNXA 1UJKA 1TEZA 3QJZA 5BV1A 4UWGA 5KWDA 3ASDA 3B7BA 2GRPB 1QQEA 5T8IA 4KMOA 2ETCA 4GZ3A 3FUIA 3UUXA 2XRZA 2OVBA 3AG3E 3EUVA 3CQCB 2B6CA 4C9BB 2IO3C 2DWZA 4L1BA 3HXBA 3G2UA 3RK6A 3B95A 4K5BA 4ACLA 2WQ6A 2OV8A 4YVOA 3CEQA 3CVLA 2J4DA 1U3DA 1E7VA 4ATZD 2I6HA 3D9OA 2WXJA 3Q78A 3D9MA 4ILIA 3ZNGA 5AQ9A 3RIBA 3L82A 1HS6A 3PDNA 4BSZB 1YA0A 3ZEFA 5G2NA 5JMND 3IKOB 1TNYA 4I1AA 4ZHBA 2GRLA 3Q4AB 4ANXA 2GRNB 4HOUA 3BU8A 2VJ8A 2CHXA 5CEDB 4XEIG 5CRUA 1KT0A 4DX6D 3ZW3A 4DPRA 2WB2A 4TXQA 4A55A 4FU3A 2IOLA 3RU0A 3ULYA 1MJ0A 3FWVA 2PQNA 1OWNA 5C1DA 4HRLA 4GMRA 2J4BA 2Q7FA 5KJKA 2HM8A 4TUUA 2PM6A 2LSVA 3W9GA 2MYOA 3OXLA 2ZXWE 3ZIMA 3AS8A 5HQ8A 4U96D 1N9AA 4F3VA 3SFXA 1D8DA 4I43A 2H6GA 3HHMA 3BEEA 4ATGA 2VQ2A 1DCEA 3R7RA 4JHJA 3L08A 4HS2A 4C0EA 2WMOA 4GPKA 2X6KA 2IEJA 2J9QA 1S70B 3Q9UC 1HZ4A 2C0LA 1B89A 3D9JA 1HH8A 4JZYA 2OOEA 3HYMB 1BI7B 2XZTG 4MLPA 3SHFA 1TN8A 4BT8A 1N95A 4PS8A 4XKBA 4OVUA 3G2TA 4CYMD 2A4ZA 3NAWA 5BXUA 1WG0A 1TNOA 2VSYA 4TXRA 3R9AB 3PEVB 4UI9J 5FQ7A 4HLLA 2VSOE 4CGVA 3PNLB 3CVPA 4J8SA 3C5RA 3GZSA 3B7SA 5CRVA 3RJVA 4FC8A 3T5VA 2DYSE 4RLYA 2L6BA 1FT2A 3NZSA 3F6QA 3P2BA 1NA0A 4F7AA 4TUMA 4GCOA 1ZBPA 5ENSD 2IQCA 2DBAA 3E34A 3ZYLA 5HRYA 5LP0A 3QDNA 4XX5A 1TN7A 2BEDA 5KJNA 3ABLE 4PDXA 4O60A 3PREA 3B13A 3IHVA 4N39A 5DIZA 4I9EA 4GTRA 1EF1C 3QOUA 1H2UA 4TRQA 3FFLA 2P9IG 4APOA 4BSXA 3D9IA 2XCCA 3K9IA 1TJCA 4HBDA 3CK9A 3KEZA 5EN5D 2JEKA 4GA2A 1N4SA 3B7RL 1E90A 3Q15A 1UN9A 3V2OA 3ML8A 4GA0A 4FLHA 4GTSA 3WG7E 3E30A 3UT8A 1OUVA 4B8AA 3QAQA 2R17C 5T4YA 4KT6B 4QFVA 2ONDA 4GYYA 1YMPA 3I4GA 4UQYA 2BF0X 1V54E 4GA1A 3ZYMA 1H19A 2WXQA 5ARGA 3LY7A 4BERA 3KAEA 3PZ3A 5BPPA 2BKKB 4BTBA 1KPSB 2GRMA 2Y0BG 3Q47B 3D9HA 4UWLA 4HLEA 4Q94A 4G1TA 3GW4A 5JHBA 1LTXA 1QNFA 4L23A 1YYHA 4DRXE 4I6EA 1E8ZA 4WUYA 5JA4D 2IFUA 3TWSA 3E4BA 1N54A 2XEVA 3L9TA 1BD8A 3N71A 3CLJA 3LKUA 4X8QA 2KCKA 5JHAA 3AG2E 4U8VD 4HNAD 1HO8A 3DSWA 4RSYA 2L9BA 4GMJA 3EU9A 2V5QC 4XE0A 2LO6A 4EZJA 2GGFA 3TG4A 4JXTA 1OCCE 3T9KA 3JCKC 3QB2A 4NRHB 2LXMA 2RD0A 3ZVVA 2EIKE 1IKND 4C0MA 3ZPJA 4KVMA 4BESA 3ZXPA 3JUIA 2LUHA 4DLOA 1SA4A 1EPUA 3AS5A 4PH4B 3UI2A 4Q96A 3NOGD 3ABKE 3LEWA 1U3CA 2EQXA 4OAVB 3FH8A 1MYOA 1JCQA 3L22A 3SQVA 3APCA 1OWLA 2OEVA 1O1RA 2J09A 1UG3A 3HXDA 3UT4A 4PS3A 2XPZA 3APFA 2V5FA 4EPZA 1L5JA 3EDTB 5FQ6A 3CKBA 1UJJA 1DCQA 1UN8A 3FU3A 3HG0D 3V31A 3KS2A 4CRWA 1EYHA 3MYVA 2WXNA 3CKCA 2J08A 1H2TC 1E8XA 2FO1E 3UKUG 4URKA 4JA7A 1OWOA 2LXLA 1JWFA 2XS1A 3D9LA 3HIZA 4XZ4A 3U3WA 1O1TA 3AU5A 4J7WA 1V55E 5AIJA 5CMWA 2Y4UA 5CERB 3J5PA 1FPPA 4LERA 3TXMA 2R2LA 5ANLA 2KZTB 2RG8A 5JJTA 3EHNA 4LNGA 5FIOA 3OAWA 3CHSA 2WXRA 3UXGA 2YHCA 3MA5A 1QBQA 3PUJA 5BT1A 3CVXA 3PEUB 1OXJA 2ILRA 3FTYA 4LSZE 5BV0A 1AWCB 5CBNA 3VTXA 5ENQD 4EZKA 1TYQG 1O1SA 2A5UA 2DIWA 5A23A 1IXVA 1X81A 2IF4A 5BNWA 4GCNA 3SFYA 4A3TA 3PE3A 3HDXA 1TN6A 3L13A 3I4RB 5JJ7A 4CT4A 2NYJA 1OT8A 3MEKA 2UWJG 4FA6A 4G2VA 4GTOA 1QZ2A 3BG0B 2XHEA 2HE0A 2LSUA 4TV3A 4UWKA 4KXKB 5ITZF 2E0IA 2FEZA 4I6JA 4HI8A 2DYRE 3PUKA 3L6AA 2HYZA 1KZPA 2EILE 3AU4A 5AJDA 4HXIA 4ANVA 2BTDA 4CDRA 3CV0A 3QC1A 4HFGA 4HORA 4OVVA 4LEUA 3ML9A 2R05A 4LNUD 3PZDA 1MZCA 3ZXSA 4N3AA 5G05C 3FUNA 3LXUX 3QWWA 1Z6TA 3HVEA 2IY0C 3TWXA 3FTWA 3DSXA 2VGYA 4EBAA 2AVPA 3HVEB 2KXPC 4GYOA 3VLFA 4JHRA 4LNBA 3AJIA 3SY2A 3CR3A 3C72A 3CK8A 2I1KA 4JL0A 3BG1B 3CVQA 2QC9A 3DPDA 4B0ZA 4GYWA 1H0AA 3DPYA 2X6IA 3TWVA 3FTXA 3BQOA 4WNDA 3ZU7B 1WAO1 1K8KG 2EIME 4IN3B 1UW4B 4MKTA 3W9FA 2J49A 1DVPA 4FP7A 3Q75A 2R02A 4N5QA 5EYLA 1D9SA 4DX2A 4Z68A 4ILGA 4AIFA 4EBAG 4G25A 5E76A 1MX2A 3UX4A 3UINC 1MX4A 3S2AA 3HXFA 1JUQA 3ZUVB 3TWTA 3O4ZA 3P1UA 4U0SA 3UKRG 3MV2B 3GZ2A 4G26A 3UTMA 4YVQC 2WXHA 4CDNA 3KSQA 1NL4A
chains in the Genus database with same CATH topology
5LFAA 4WNEA 2AWIA 3G2VA 4U8HA 4WNGA 5CCMA 2WVIA 2L6JA 4ACKA 2HO1A 2WXKA 4J8FA 4L7TA 1OUVA 2I2OA 3T8MA 3UT8A 3RRNB 5E75A 4NURA 4B8AA 4HVBA 2V8SE 3QAQA 2R17C 3PNTB 3LYAA 4UQZA 4KT6B 4XI0A 5T4YA 1HX8A 5LCWC 4QFVA 2ONDA 3TG5A 3FUJA 4YNDA 2WXPA 3ZYKA 4AV7A 5BUZA 4FADA 3ASHA 3CK7A 3MJWA 2KM4A 4B8CB 4GYYA 1ELKA 3UQ3A 3FEYA 5FJYA 3I4GA 4N2SA 2NC9A 4UQYA 1E96B 2BF0X 4GA1A 4FJYA 4A3VA 3PS6A 3ZYMA 1H19A 3QKYA 2DCPA 2WXQA 4GZCA 3ZHEA 5D0OD 3CGHA 5ARGA 4BY6A 1DNPA 3SFZA 4RG9A 2PQRA 3LY7A 2V4LA 5HI7A 2V0PA 1IHGA 3KAEA 4KVOA 1JPLA 2E2EA 2KC7A 3FU6A 3ZHEB 3SI5A 4BTBA 4EECA 5BPPA 4AP2A 1KLXA 2C0MA 2GRMA 3Q47B 4RG6A 2CG3A 2VGXA 1W3BA 4LCTA 5CHEE 4UWLA 3U64A 4HLEA 2J07A 3ENEA 4Q94A 5CCLA 2LAHA 4G1TA 2I9CA 5FZRA 2VTBA 2CFUA 1LF8A 5CMYA 5FZQA 3S7BA 4R7LA 4U63A 4GAAA 5J08A 2FBNA 3GW4A 4JW1A 3TAXA 5G05J 5JHBA 3B7UX 2R59A 3CVWA 4Q69A 4IULA 2VTBB 1QNFA 4L23A 3CQGB 3S7JA 2XPYA 4I6EA 3ZN3A 2FI7A 1E8ZA 4K03A 4WUYA 4BT9A 2X6FA 1XNFA 4Y6WA 2IFUA 4KZ0A 4AY5A 4ABNA 4AM9A 4HOSA 3MX3A 3SBSA 1EDUA 2WXFA 3L54A 1BPOA 3FH5A 3E4BA 3G2WA 1N54A 3U9WA 2XEVA 1TJFA 4J6IA 3G2SA 4WWOA 2XCBA 4U0ZA 3FUKA 3O48A 1ELWA 3GZ1A 4DLQA 5EX3A 3N71A 3CLJA 3FUEA 3LKUA 4GZ6A 2KCKA 4PS7A 3CSFA 3NZUA 5EKQD 5JHAA 4XI9A 1X5BA 2KZTA 4FLBA 1FVHA 4UQXA 4ANWA 1HO8A 1S0PA 4Y6CA 5D0QD 2X3MA 4UI9K 1GW6A 4ILHB 5FTPA 4RSYA 3FULA 2KCLA 2L9BA 4GMJA 4WAFA 3IV0A 2WPVA 3IHYA 3OXFA 4XE0A 2LO6A 4EZJA 3LS8A 4JEUA 4A1GA 1P5QA 5AENA 3EHMA 3SGHA 2CFZA 3VLEA 2GGFA 5FWQA 3TG4A 2IJGX 4JXTA 3EJNA 2QY7A 1H2VC 3FTUA 3Q49B 5ANRA 3JCKC 4I17A 3QB2A 3CVVA 1OWPA 5FZSA 3CVYA 2CHZA 4NRHB 4N3CA 4WWPA 2RD0A 3SBTB 2LAIA 1INZA 3ZVVA 4C0MA 3QWPA 3MCXA 3ASFA 2YQ8A 3RRMB 1SZAA 3ZPJA 2VSXE 1NZNA 3FHEA 4FHJA 4KVMA 4MS6A 5G55A 1A17A 3JUIA 5AJLA 4WNFA 4DLOA 2VYIA 3FP3A 4V3IA 4A1SA 3TL5A 4E6HA 2YINA 2PM7A 1EPUA 1HU3A 2MRIA 2Y4TA 3CHRA 3PRZA 4JC8A 2HR2A 3AS5A 4PH4B 1SQMA 4KYOB 4N2QA 2L0IA 4P29A 4U04A 3TGOA 3AS4A 2KATA 3FUFA 4DI4A 4Q96A 3OTNA 3UT7A 4H7XA 3FUHA 4LUNU 2FF4A 3DBSA 2KCVA 3MGBA 4J8DA 2R5SA 3LEWA 1U3CA 2VSNA 2Y3AA 3RO2A 4B89A 3JYSA 4I1MA 3MKQA 2EQXA 3EIQC 4J8EA 3SNXA 5KJMA 1UJKA 3LCAA 1TEZA 3QJZA 3MKQB 3FH8A 5LCWJ 5BV1A 4GZ5A 3L22A 4IRUA 4WWNA 4UWGA 2JLBA 3ASDA 4I9CA 3APCA 1OWLA 3PVLA 3ONLA 2J09A 3VLDA 1QQEA 1UG3A 5T8IA 4AOFA 4BX9A 4N5CA 5A7DB 4ANUA 3IBEA 3D9KA 4U0UA 3URZA 3QARA 4KMOA 4GZ3A 2XGMA 2XQ0A 3FUIA 3UT4A 3UUXA 3CHOA 4PS3A 2XRZA 2XPZA 2OVBA 3APFA 2V5FA 3L17A 5BW8C 4EPZA 3UPVA 1L5JA 3CQCB 3LVRE 2LNIA 3CHPA 3EDTB 4HOQA 5ARFA 5FQ6A 4C9BB 3L16A 1ZU2A 4CGWA 4D10C 3B7TA 3CKBA 3GYZA 1UJJA 4L1BA 3G2UA 3RK6A 1HFAA 4ACLA 2WQ6A 2OV8A 1UN8A 2WMNA 3FU3A 4YVOA 3D9NA 3CEQA 3FY4A 3KS2A 3CVNA 1Y8MA 3CVLA 4UI9C 4CRWA 2WQHA 2VGXB 2J4DA 1HG5A 1U3DA 4XIFA 1E7VA 1EYHA 3APDA 4K0RA 3MYVA 2WXNA 4UWFA 3CKCA 3ZGQA 2WXOA 1NA3A 2J08A 2I6HA 3D9OA 1H2TC 1E8XA 2WXJA 5FT9A 3D9MA 4FJZA 2UY1A 4URKA 4ILIA 4JA7A 3RIBA 4JHKA 3ZFWA 4DK5A 2WXGA 1OWOA 3PH0C 1JWFA 3D9LA 3LJ3A 3HIZA 1HS6A 4E85A 3PDNA 4UWHA 1YA0A 4XZ4A 3S7DA 3ZEFA 4APFA 4BX8A 3U3WA 3LPZA 5G2NA 3ESKA 3AU5A 3U66A 3IKOB 4I2WA 4I1AA 4IYPA 2GRLA 4BWRA 4DJAA 5AIJA 1XGWA 3D3MA 3Q4AB 4ANXA 5CMWA 2Y4UA 1KT1A 4HOUA 2YNQA 2VJ8A 2PL2A 2CHXA 4FHKA 4G24A 4LERA 3TXMA 1Z3XA 3TXNA 3FU5A 5ANLA 5C2YA 2L0TB 4I6GA 2KZTB 2RG8A 2QFCA 3EHNA 5JJTA 1KT0A 3OAWA 4EZLA 3ZW3A 2IONA 3CHSA 2WXRA 4DPRA 2YHCA 2WB2A 3MA5A 1OWMA 3MV3B 5LX8A 3LY9A 5KCMA 3PUJA 4G23A 5BT1A 3CVXA 4A55A 4FU3A 2IOLA 3ULQA 3PEUB 3RU0A 3S7FA 3TJPA 4EQFA 3ASGA 2YHEA 4AEZC 2ILRA 3FTYA 4HOTA 4B94A 1MHQA 3FWVA 2PQNA 2FULA 1OWNA 5A6CA 2X6HA 5C1DA 2AXVA 3VTYA 3LDZA 2J4BA 2Q7FA 1HF8A 5KJKA 5BV0A 2HM8A 2GW1A 3VTXA 4NACA 4EZKA 4TUUA 3WXXA 2PM6A 2LSVA 2A5UA 3Q5MA 2DIWA 3MKRA 4G11A 5A23A 2CG2A 3ZYQA 3OXLA 3FU0A 2WXMA 3ZIMA 2IF4A 1IQUA 3AS8A 5HQ8A 4DI3A 4GCNA 4F3VA 5BNWA 3FDHA 1N52A 3FEXA 5T3RA 4MRUA 4A3TA 4I43A 4AXHA 3PE3A 5G04C 1HXIA 3HHMA 3BEEA 4CEMA 3ESLA 4RVBA 4ATGA 2VQ2A 3FUMA 3LY8A 2M63A 3HDXA 2ZU6B 1WM5A 4JHJA 1FVFA 3L08A 3R7RA 3L13A 3CIAA 3I4RB 5JJ7A 4CT4A 4HS2A 4L2LA 4C0EA 5M72A 2WMOA 3MEKA 4GPKA 2UWJG 2X6KA 4FA6A 4G2VA 3RKVA 4CCAA 3RRUA 4JEHA 2I1JA 2J9QA 1QZ2A 4BFRA 3BG0B 2XHEA 1HZ4A 2C0LA 2LSUA 2C2LA 4TV3A 4U07A 3PE4A 3QWVA 4UWKA 4KXKB 1B89A 3D9JA 1HH8A 4JZYA 4W9RA 2OOEA 2XRYA 3HYMB 1E7UA 2E0IA 1JWGA 2X6JA 4MLPA 1IQRA 5EDSA 1Y6IA 4N3BA 2FEZA 3SHFA 4GMLA 4I6JA 5FQ4A 1MQSA 4GU5A 4BT8A 3PUKA 4PS8A 4J0UA 1H6KA 2WM9A 3L6AA 4XKBA 2HYZA 3G2TA 4OVUA 3I3NA 2A4ZA 2P58C 4I2ZA 3AU4A 3MZLB 3EIJA 2XPIA 5AJDA 5DBKA 2VSYA 3FTZA 4HXIA 1NP7A 4ANVA 3R9AB 1Z3YA 3FUDA 2BTDA 4CDRA 3CV0A 3OXGA 2AW6A 3PEVB 3QC1A 3FH7A 4HFGA 1E8WA 4OYSA 4OVVA 4GZDA 4HORA 4LEUA 3ML9A 4UI9J 5FQ7A 2MOWA 2NXPA 3PZDA 3ZRHA 4CGVA 2VSOE 3D9PA 3ZXSA 3PNLB 3CVPA 4J8SA 4JA9A 4N3AA 1ELRA 5G05C 3FUNA 5AYWD 3LXUX 3QWWA 1Z6TA 2FO7A 3HVEA 3RO3A 2UY1B 3FTVA 4XKCA 4JPSA 3FTWA 4AVXA 3GZSA 5JJ6A 2VGYA 1VDYA 4EBAA 1IYGA 4AJWA 2AVPA 1PC2A 5J90A 3B7SA 3HVEB 4GYOA 3CVUA 4CT0A 3RJVA 3VLFA 4JHRA 4FC8A 4M3OA 3T5VA 3CR3A 3CK8A 1PAQA 1PY1A 2I1KA 4JL0A 3U4TA 3NZSA 3BG1B 4AY6A 1SZ9A 3CVQA 3P2BA 2CHWA 3UMVA 3CSTA 2PZIA 1NA0A 3DPDA 4F7AA 4B0ZA 4GCOA 1ZBPA 2IQCA 3T5XA 4PUCA 2DBAA 3ZYLA 4GYWA 1H0AA 5LP0A 3QDNA 2WQ7A 4XX5A 4GB9A 5KJNA 4KZCA 2X6IA 3FTXA 4L2YA 4WNDA 4PDXA 5FQ8A 3R7QA 1FCHA 3LVQE 4I1OB 1WAO1 3QK0A 3PREA 3SF4A 3B13A 4IN3B 3IHVA 4N39A 5DIZA 3I5PA 2IU1A 4I9EA 1EF1C 2XGOA 2WXLA 5KJLA 1UW4B 4FULA 4MKTA 3QOUA 1E8YA 2J49A 3QNKA 3NF1A 3NQPA 1H2UA 1DVPA 2NSZA 3JQ1A 4FP7A 4TRQA 3FFLA 5LOZA 1HG2A 2BUGA 2OVFA 4APOA 4F1SA 5ENNA 4BSXA 2WXIA 4CDMA 3D9IA 2IOSA 1WY6A 1TJCA 2XCCA 3K9IA 4KBQA 3CK9A 3IEGA 3KEZA 2JEKA 4GA2A 3SD5A 3CHQA 3CHMA 4ILGA 2X38A 4AIFA 4EBAG 4G25A 5E76A 2MHKA 4ME2A 3UX4A 2AXUA 4BTAA 3S2AA 4H7YA 4JVSA 4O6FA 3ONKA 1JUQA 2AXZA 3B7RL 1E90A 3Q15A 2XGSA 1UN9A 3C98A 3KD7A 4NQ0A 1HE8A 3ML8A 4GA0A 5G04J 3O4ZA 3P1UA 4U0SA 4FLHA 3JQ0A 3MV2B 3GZ2A 4G26A 3SZ7A 3FTSA 4YVQC 2WXHA 4CDNA 4LRZA 4F53A 5EX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNE A;  4WNG A;  5CCM A;  2L6J A;  2HO1 A;  4J8F A;  1OUV A;  3LYA A;  4UQZ A;  4XI0 A;  5LCW C;  2OND A;  3TG5 A;  4YND A;  3ASH A;  3CK7 A;  4GYY A;  3UQ3 A;  5FJY A;  4N2S A;  2NC9 A;  4UQY A;  1E96 B;  4GA1 A;  3QKY A;  3ZHE A;  5D0O D;  5ARG A;  4RG9 A;  2PQR A;  3LY7 A;  5HI7 A;  1IHG A;  3KAE A;  2E2E A;  2KC7 A;  3ZHE B;  4BTB A;  1KLX A;  2C0M A;  3Q47 B;  4RG6 A;  2VGX A;  5CHE E;  1W3B A;  5CCL A;  4G1T A;  5FZR A;  5FZQ A;  3S7B A;  2FBN A;  3GW4 A;  3TAX A;  5G05 J;  3S7J A;  3ZN3 A;  2FI7 A;  4BT9 A;  4WUY A;  1XNF A;  4Y6W A;  2IFU A;  4HOS A;  4AY5 A;  4ABN A;  4AM9 A;  3E4B A;  2XEV A;  2XCB A;  4U0Z A;  3O48 A;  3GZ1 A;  1ELW A;  5EX3 A;  3N71 A;  4GZ6 A;  3LKU A;  2KCK A;  5EKQ D;  4XI9 A;  4UQX A;  5D0Q D;  4Y6C A;  4UI9 K;  5FTP A;  2KCL A;  2WPV A;  3OXF A;  1P5Q A;  3TG4 A;  3Q49 B;  4I17 A;  5FZS A;  4NRH B;  4N3C A;  3QWP A;  3ASF A;  2YQ8 A;  3ZPJ A;  1NZN A;  1A17 A;  4WNF A;  2VYI A;  3FP3 A;  4A1S A;  2Y4T A;  2HR2 A;  3AS5 A;  4KYO B;  4N2Q A;  4U04 A;  3TGO A;  3AS4 A;  2KAT A;  4H7X A;  2FF4 A;  2KCV A;  4J8D A;  2R5S A;  2VSN A;  3RO2 A;  3JYS A;  4J8E A;  5KJM A;  3LCA A;  5LCW J;  4GZ5 A;  2JLB A;  3ASD A;  4I9C A;  1QQE A;  4N5C A;  5A7D B;  4U0U A;  3URZ A;  4GZ3 A;  2XGM A;  3UUX A;  5BW8 C;  2V5F A;  3UPV A;  2LNI A;  3EDT B;  4HOQ A;  5ARF A;  1ZU2 A;  4CGW A;  3CKB A;  3GYZ A;  4YVO A;  3CEQ A;  3KS2 A;  3CVN A;  1Y8M A;  3CVL A;  4UI9 C;  2WQH A;  2VGX B;  4XIF A;  3CKC A;  3ZGQ A;  1NA3 A;  2I6H A;  5FT9 A;  2UY1 A;  4JA7 A;  3RIB A;  3ZFW A;  3PDN A;  1YA0 A;  3S7D A;  3U3W A;  3LPZ A;  3ESK A;  4I2W A;  4I1A A;  4BWR A;  3Q4A B;  2Y4U A;  1KT1 A;  4HOU A;  2PL2 A;  4G24 A;  5JJT A;  2QFC A;  1KT0 A;  2YHC A;  3MA5 A;  3MV3 B;  3LY9 A;  4G23 A;  5BT1 A;  3ULQ A;  3S7F A;  3RU0 A;  4EQF A;  3ASG A;  4HOT A;  4B94 A;  3FWV A;  2PQN A;  5A6C A;  5C1D A;  3VTY A;  2Q7F A;  5KJK A;  2GW1 A;  3VTX A;  3WXX A;  2LSV A;  3Q5M A;  3MKR A;  3OXL A;  2IF4 A;  3AS8 A;  5HQ8 A;  5BNW A;  4GCN A;  4F3V A;  3PE3 A;  5G04 C;  1HXI A;  3BEE A;  2VQ2 A;  3LY8 A;  1WM5 A;  5JJ7 A;  5M72 A;  3MEK A;  4GPK A;  2UWJ G;  4G2V A;  3RKV A;  2J9Q A;  1QZ2 A;  1HZ4 A;  2C0L A;  2LSU A;  2C2L A;  4U07 A;  3PE4 A;  3QWV A;  4KXK B;  1B89 A;  4W9R A;  1HH8 A;  2OOE A;  3HYM B;  4N3B A;  2FEZ A;  4BT8 A;  4J0U A;  2HYZ A;  2P58 C;  4I2Z A;  2XPI A;  5DBK A;  2VSY A;  3R9A B;  4CDR A;  3CV0 A;  3OXG A;  4HOR A;  4LEU A;  4UI9 J;  4CGV A;  3CVP A;  4JA9 A;  4N3A A;  1ELR A;  5G05 C;  5AYW D;  3QWW A;  2FO7 A;  3RO3 A;  2UY1 B;  5JJ6 A;  2VGY A;  1IYG A;  2AVP A;  1PC2 A;  4GYO A;  3RJV A;  4JHR A;  3CK8 A;  4JL0 A;  3U4T A;  4AY6 A;  3CVQ A;  2PZI A;  1NA0 A;  4GCO A;  1ZBP A;  2DBA A;  4GYW A;  3QDN A;  5KJN A;  4WND A;  1FCH A;  1WAO 1;  3SF4 A;  4IN3 B;  4N39 A;  5DIZ A;  4I9E A;  2XGO A;  5KJL A;  3QOU A;  3NF1 A;  3FFL A;  2BUG A;  4APO A;  2XCC A;  3K9I A;  1TJC A;  4KBQ A;  3CK9 A;  3IEG A;  4GA2 A;  4AIF A;  4G25 A;  2MHK A;  4ME2 A;  4BTA A;  4H7Y A;  4O6F A;  3Q15 A;  2XGS A;  3KD7 A;  4NQ0 A;  4GA0 A;  5G04 J;  4U0S A;  3MV2 B;  3GZ2 A;  4G26 A;  3SZ7 A;  4YVQ C;  5EX0 A; 
#chains in the Genus database with same CATH topology
 5LFA A;  5D66 A;  4CZ2 D;  4QQI A;  4ACK A;  4J8F A;  1JCR A;  4O1O A;  3RRN B;  3PNT B;  3LYA A;  4XI0 A;  4DX5 D;  5LCW C;  3FUJ A;  4AV7 A;  4FAD A;  3MJW A;  1ELK A;  4N2S A;  2EIJ E;  2F8Y A;  4FJY A;  3UM1 A;  3QKY A;  4GZC A;  5D0O D;  3CGH A;  3SFZ A;  2PQR A;  2V0P A;  5AQ7 A;  2KC7 A;  4AP2 A;  3HXE A;  5EYP F;  1Q2Z A;  2VGX A;  1W3B A;  5CCL A;  2P9N G;  5FZQ A;  3S7B A;  4U63 A;  3TWU A;  5ENR D;  4JW1 A;  1BU9 A;  3B7U X;  3CVW A;  1N0Q A;  3X2Q E;  4BT9 A;  3Q9N C;  4AY5 A;  4ABN A;  3MX3 A;  1BPO A;  3ASO E;  4J6I A;  3FUK A;  3O48 A;  3PZ2 A;  5EX3 A;  3KEA A;  3KSL A;  3CSF A;  2VGE A;  1WDY A;  4ANW A;  1GW6 A;  4WAF A;  1ZB1 A;  2WPV A;  2RKK A;  3OXF A;  4JEU A;  1RZ4 A;  1P5Q A;  5AEN A;  3EHM A;  2CFZ A;  3TWW A;  3VLE A;  3FTU A;  3Q49 B;  2OEW A;  4I17 A;  2CHZ A;  3SBT B;  2LAI A;  2YQ8 A;  1OCZ E;  1NZN A;  4FHJ A;  1A17 A;  5AJL A;  4WNF A;  2VYI A;  4A1S A;  4E6H A;  2YIN A;  2B0O E;  1HU3 A;  2MRI A;  3PRZ A;  2F8X K;  4N2Q A;  3TGO A;  2KAT A;  4DI4 A;  3OTN A;  3UT7 A;  4YDY A;  4DX1 A;  2FF4 A;  3MGB A;  2Y3A A;  4B89 A;  4I1M A;  3EIQ C;  3LCA A;  2XEE A;  2JLB A;  4I9C A;  3VLD A;  4AOF A;  4BX9 A;  5A7D B;  3IBE A;  3URZ A;  2XGM A;  3R9M A;  4GTT A;  4GPM A;  4HOQ A;  5ARF A;  3L16 A;  1ZU2 A;  3GYZ A;  2F37 A;  3HXC A;  3D9N A;  4XIF A;  4UWF A;  3ZGQ A;  5FT9 A;  4HRM B;  4FJZ A;  2UY1 A;  4DK5 A;  4JHK A;  4E85 A;  4UWH A;  4BX8 A;  3S7D A;  3LPZ A;  4I2W A;  4DJA A;  4BWR A;  1XGW A;  2H6F A;  3D3M A;  1KT1 A;  4G24 A;  3ABM E;  1Z3X A;  2GRO B;  3TXN A;  1RW2 A;  3FU5 A;  5C2Y A;  4I6G A;  2QFC A;  4K5A B;  3ASN E;  5HS0 A;  4F6R D;  1SVX A;  1SW6 A;  3MV3 B;  5LX8 A;  2P9S G;  4G23 A;  3V2X A;  3ULQ A;  3S7F A;  3TJP A;  2YHE A;  4AEZ C;  4HOT A;  4B94 A;  1S64 A;  5H7P A;  2X6H A;  3DXM G;  1HF8 A;  2GW1 A;  3WXX A;  4HQD A;  3Q5M A;  2CG2 A;  4U7E B;  3FDH A;  3FEX A;  5T3R A;  4MRU A;  1UOH A;  3Q73 A;  4AXH A;  1H6P A;  4A63 B;  5G04 C;  4CEM A;  4RVB A;  3SO8 A;  3LY8 A;  2M63 A;  2ZU6 B;  1WM5 A;  1FVF A;  3CIA A;  4GTM A;  5M72 A;  3RKV A;  1K1A A;  4CCA A;  4U07 A;  1SA5 A;  4YDO A;  3ZKJ A;  1K3Z D;  2XEH A;  1JCS A;  2X6J A;  1JWG A;  3DWL G;  3NOC D;  1MX6 A;  1IQR A;  4N3B A;  1H6K A;  3Q7F A;  2QYU A;  4M7C A;  2P58 C;  3EIJ A;  2XPI A;  5DBK A;  3FUD A;  1E8W A;  4GZD A;  2ETA A;  3ZRH A;  4GTQ A;  4JA9 A;  1ELR A;  5AYW D;  3RO3 A;  3FTV A;  4XKC A;  4JPS A;  3EU5 A;  1PC2 A;  3CVU A;  2ZGG A;  4M3O A;  2KBX A;  3T8K A;  3U4T A;  3RSE G;  4AY6 A;  2CHW A;  3CST A;  4UUC A;  2P9K G;  3T5X A;  3Q79 A;  3R7Q A;  4KZC A;  4L2Y A;  1FCH A;  3LVQ E;  4I1O B;  4G8L A;  2IU1 A;  5CBO A;  2XGO A;  2WXL A;  3C3Q A;  4FUL A;  3NF1 A;  3NQP A;  2NSZ A;  2BUG A;  4F1S A;  1BI8 B;  2WXI A;  2P9L G;  5KNG A;  4KBQ A;  1TNZ A;  1IHB A;  3AG4 E;  3IEG A;  3SD5 A;  3CHQ A;  3CHM A;  2X38 A;  1K1B A;  2MHK A;  2AXU A;  3EHR A;  3ONK A;  5ENP D;  2AXZ A;  1HE8 A;  3JQ0 A;  3SZ7 A;  4LRZ A;  4F53 A;  5EX0 A;  3DRA A;  4WNE A;  2AWI A;  2OCC E;  3G2V A;  4U8H A;  4WNG A;  2WVI A;  1LD8 A;  2L6J A;  2HO1 A;  3T8M A;  4L7T A;  5E75 A;  4NUR A;  4JD2 G;  3TG5 A;  2WXP A;  5BUZ A;  2KM4 A;  3UQ3 A;  4TXP A;  2DVW A;  5FJY A;  1AP7 A;  2DCP A;  3ZHE A;  4HRN A;  3UM2 A;  2V4L A;  1JPL A;  2E2E A;  3ZHE B;  2AJA A;  1KLX A;  3U64 A;  3ENE A;  2ETB A;  1QYM A;  2LAH A;  3NB2 A;  5FZR A;  3C3R A;  4R7L A;  4U95 D;  2FBN A;  3TAX A;  5G05 J;  2P2C P;  2R59 A;  3CQG B;  3S7J A;  2XPY A;  4B93 B;  2FI7 A;  1XNF A;  4HOS A;  4KZ0 A;  2ZIS A;  4AM9 A;  3SBS A;  1EDU A;  3L54 A;  3U9W A;  1TJF A;  3G2S A;  4WWO A;  2XCB A;  4U0Z A;  4DLQ A;  3GZ1 A;  3FUE A;  3AG1 E;  2GRR B;  4J8Y A;  4FLB A;  4UQX A;  3ULE G;  4HB5 A;  1S0P A;  4Y6C A;  2PNN A;  4ILH B;  5FTP A;  2KCL A;  3IHY A;  1BLX B;  2H6H A;  3LS8 A;  4A1G A;  5IY5 E;  3C3O A;  3SGH A;  2IJG X;  3E37 A;  2JAB A;  3BUA A;  1OWP A;  4N3C A;  5AQB A;  2IO2 C;  4C48 B;  3QWP A;  3RRM B;  1SZA A;  3FHE A;  3NBN B;  3FP3 A;  4V3I A;  2PM7 A;  4U8Y D;  2Y4T A;  2HR2 A;  4KYO B;  2L0I A;  1OCO E;  4U04 A;  3AS4 A;  2P9U G;  4H7X A;  3E32 A;  3FUH A;  3DBS A;  4J8D A;  2R5S A;  4JB8 P;  3MKQ A;  5AN8 A;  5AQA A;  1G3N B;  5KJM A;  3MKQ B;  5LCW J;  4GZ5 A;  4IRU A;  4WWN A;  3PVL A;  3ONL A;  2F0Y A;  4N5C A;  4ANU A;  4U0U A;  3D9K A;  3QAR A;  2XQ0 A;  3CHO A;  5BW8 C;  3L17 A;  3UPV A;  3LVR E;  2LNI A;  3CHP A;  1YCS B;  4CGW A;  4D10 C;  3B7T A;  5D2M C;  1HFA A;  2WMN A;  3FY4 A;  3CVN A;  1Y8M A;  4UI9 C;  2WQH A;  2P9P G;  2VGX B;  1HG5 A;  3APD A;  4K0R A;  2WXO A;  1NA3 A;  3E33 A;  2A5E A;  3ZFW A;  2WXG A;  3PH0 C;  3LJ3 A;  3DXK G;  4GTP A;  4APF A;  3ESK A;  1TNU A;  3U66 A;  5EIL A;  3TWQ A;  4IYP A;  4YDW A;  2YNQ A;  2PL2 A;  4FHK A;  2L0T B;  2Y1L E;  2DZN A;  4G8K A;  4EZL A;  2ION A;  1OWM A;  3LY9 A;  5KCM A;  2XS8 A;  4EQF A;  3ASG A;  1MHQ A;  3JXI A;  3HRA A;  4DUI A;  2FUL A;  5A6C A;  3TWR A;  3Q7A A;  2AXV A;  3VTY A;  3LDZ A;  4NAC A;  5AAO A;  3UIP C;  4BET A;  3UM0 A;  3MKR A;  4G11 A;  1FT1 A;  3ZYQ A;  3FU0 A;  2WXM A;  1IQU A;  4DI3 A;  1N4Q A;  1N52 A;  4F1P A;  5ENO D;  1HXI A;  3DST A;  3ESL A;  5ENT D;  3FUM A;  4L2L A;  2RFM A;  3RRU A;  4JEH A;  2I1J A;  4BFR A;  2C2L A;  3PE4 A;  3QWV A;  4W9R A;  3DSV A;  2XRY A;  5BXO A;  1E7U A;  5EDS A;  4NIK A;  1Y6I A;  4GML A;  5FQ4 A;  1MQS A;  4GU5 A;  4EHM A;  4J0U A;  5CEA A;  2WM9 A;  3I3N A;  4YDE A;  2V4H C;  4I2Z A;  3MZL B;  4MBG A;  3FTZ A;  1NP7 A;  3PZ4 A;  1Z3Y A;  3OXG A;  2AW6 A;  3FH7 A;  4OYS A;  2MOW A;  2NXP A;  1OY3 D;  3D9P A;  1N11 A;  3IXE A;  2FO7 A;  2UY1 B;  5EIB E;  4AVX A;  5JJ6 A;  1VDY A;  1IYG A;  4AJW A;  5J90 A;  4CT0 A;  1PAQ A;  1PY1 A;  1SZ9 A;  3V30 A;  3UMV A;  2PZI A;  1D8E A;  4LG6 A;  2XZD G;  2XEN A;  4PUC A;  2WQ7 A;  1U2V G;  3ISM C;  4GB9 A;  1NI1 A;  5FQ8 A;  3JXJ A;  3QK0 A;  3SF4 A;  3I5P A;  1H6O A;  5B3S E;  2QYJ A;  3JUE A;  5KJL A;  1E8Y A;  3QNK A;  3JQ1 A;  5LOZ A;  1N4R A;  1HG2 A;  2OVF A;  3UIO C;  2ZIR A;  5ENN A;  4CDM A;  2IOS A;  1WY6 A;  2GRQ B;  1N4P A;  1DC2 A;  3AAA C;  4ME2 A;  4BTA A;  4H7Y A;  4JVS A;  2DZO A;  4HI9 A;  2RFA A;  4O6F A;  2XGS A;  3C98 A;  3KD7 A;  4NQ0 A;  3PZ1 A;  5G04 J;  4BEP A;  3FTS A;  5CCM A;  2WXK A;  2I2O A;  4DX7 D;  4HVB A;  2V8S E;  4UQZ A;  1TR4 A;  4RQI A;  3RAU A;  1HX8 A;  4YND A;  3ZYK A;  5KNH D;  3ASH A;  3CK7 A;  4B8C B;  3FEY A;  2NC9 A;  1E96 B;  1S63 A;  4A3V A;  3PS6 A;  5FIN A;  2ZGD A;  4BY6 A;  1DNP A;  4RG9 A;  5HI7 A;  3DEO A;  4KVO A;  1IHG A;  3FU6 A;  3SI5 A;  4EEC A;  1OCR E;  2C0M A;  4RG6 A;  2CG3 A;  4LCT A;  5CHE E;  5CEC B;  2Y69 E;  2J07 A;  2I9C A;  1O5M A;  2VTB A;  2CFU A;  1LF8 A;  5CMY A;  4GAA A;  5J08 A;  4Q69 A;  4IUL A;  2VTB B;  3V79 K;  5KBA A;  4O1P A;  3ZN3 A;  4K03 A;  2X6F A;  3DSS A;  4Y6W A;  2WXF A;  5B1B E;  3FH5 A;  3G2W A;  4K5C A;  1N0R A;  1N94 A;  1ELW A;  3EHQ A;  2EIN E;  3DSU A;  4GZ6 A;  3J5Q B;  4PS7 A;  2H6I A;  3NZU A;  5EKQ D;  4XI9 A;  1X5B A;  2KZT A;  5EID A;  4ZFH A;  1FVH A;  2R03 A;  5D0Q D;  2X3M A;  4UI9 K;  3FUL A;  3IV0 A;  3LJN A;  3DEP A;  5FWQ A;  2QZA A;  3EJN A;  2QY7 A;  1H2V C;  5ANR A;  3UM3 A;  3CVV A;  5FZS A;  3CVY A;  4WWP A;  4GTV A;  1INZ A;  3MCX A;  3ASF A;  2J8S D;  2VSX E;  4MS6 A;  5G55 A;  1LD7 A;  2BKG A;  1Z5S C;  3TL5 A;  3CHR A;  4JC8 A;  1TNB A;  1KZO A;  1SQM A;  4P29 A;  1A5E A;  3FUF A;  4L9P A;  5B1A E;  4LUN U;  4OAU C;  2KCV A;  2VSN A;  3RO2 A;  3JYS A;  5HKP A;  5AAR A;  4J8E A;  1NFI E;  3SNX A;  1UJK A;  1TEZ A;  3QJZ A;  5BV1 A;  4UWG A;  5KWD A;  3ASD A;  3B7B A;  2GRP B;  1QQE A;  5T8I A;  4KMO A;  2ETC A;  4GZ3 A;  3FUI A;  3UUX A;  2XRZ A;  2OVB A;  3AG3 E;  3EUV A;  3CQC B;  2B6C A;  4C9B B;  2IO3 C;  2DWZ A;  4L1B A;  3HXB A;  3G2U A;  3RK6 A;  3B95 A;  4K5B A;  4ACL A;  2WQ6 A;  2OV8 A;  4YVO A;  3CEQ A;  3CVL A;  2J4D A;  1U3D A;  1E7V A;  4ATZ D;  2I6H A;  3D9O A;  2WXJ A;  3Q78 A;  3D9M A;  4ILI A;  3ZNG A;  5AQ9 A;  3RIB A;  3L82 A;  1HS6 A;  3PDN A;  4BSZ B;  1YA0 A;  3ZEF A;  5G2N A;  5JMN D;  3IKO B;  1TNY A;  4I1A A;  4ZHB A;  2GRL A;  3Q4A B;  4ANX A;  2GRN B;  4HOU A;  3BU8 A;  2VJ8 A;  2CHX A;  5CED B;  4XEI G;  5CRU A;  1KT0 A;  4DX6 D;  3ZW3 A;  4DPR A;  2WB2 A;  4TXQ A;  4A55 A;  4FU3 A;  2IOL A;  3RU0 A;  3ULY A;  1MJ0 A;  3FWV A;  2PQN A;  1OWN A;  5C1D A;  4HRL A;  4GMR A;  2J4B A;  2Q7F A;  5KJK A;  2HM8 A;  4TUU A;  2PM6 A;  2LSV A;  3W9G A;  2MYO A;  3OXL A;  2ZXW E;  3ZIM A;  3AS8 A;  5HQ8 A;  4U96 D;  1N9A A;  4F3V A;  3SFX A;  1D8D A;  4I43 A;  2H6G A;  3HHM A;  3BEE A;  4ATG A;  2VQ2 A;  1DCE A;  3R7R A;  4JHJ A;  3L08 A;  4HS2 A;  4C0E A;  2WMO A;  4GPK A;  2X6K A;  2IEJ A;  2J9Q A;  1S70 B;  3Q9U C;  1HZ4 A;  2C0L A;  1B89 A;  3D9J A;  1HH8 A;  4JZY A;  2OOE A;  3HYM B;  1BI7 B;  2XZT G;  4MLP A;  3SHF A;  1TN8 A;  4BT8 A;  1N95 A;  4PS8 A;  4XKB A;  4OVU A;  3G2T A;  4CYM D;  2A4Z A;  3NAW A;  5BXU A;  1WG0 A;  1TNO A;  2VSY A;  4TXR A;  3R9A B;  3PEV B;  4UI9 J;  5FQ7 A;  4HLL A;  2VSO E;  4CGV A;  3PNL B;  3CVP A;  4J8S A;  3C5R A;  3GZS A;  3B7S A;  5CRV A;  3RJV A;  4FC8 A;  3T5V A;  2DYS E;  4RLY A;  2L6B A;  1FT2 A;  3NZS A;  3F6Q A;  3P2B A;  1NA0 A;  4F7A A;  4TUM A;  4GCO A;  1ZBP A;  5ENS D;  2IQC A;  2DBA A;  3E34 A;  3ZYL A;  5HRY A;  5LP0 A;  3QDN A;  4XX5 A;  1TN7 A;  2BED A;  5KJN A;  3ABL E;  4PDX A;  4O60 A;  3PRE A;  3B13 A;  3IHV A;  4N39 A;  5DIZ A;  4I9E A;  4GTR A;  1EF1 C;  3QOU A;  1H2U A;  4TRQ A;  3FFL A;  2P9I G;  4APO A;  4BSX A;  3D9I A;  2XCC A;  3K9I A;  1TJC A;  4HBD A;  3CK9 A;  3KEZ A;  5EN5 D;  2JEK A;  4GA2 A;  1N4S A;  3B7R L;  1E90 A;  3Q15 A;  1UN9 A;  3V2O A;  3ML8 A;  4GA0 A;  4FLH A;  4GTS A;  3WG7 E;  3E30 A;  3UT8 A;  1OUV A;  4B8A A;  3QAQ A;  2R17 C;  5T4Y A;  4KT6 B;  4QFV A;  2OND A;  4GYY A;  1YMP A;  3I4G A;  4UQY A;  2BF0 X;  1V54 E;  4GA1 A;  3ZYM A;  1H19 A;  2WXQ A;  5ARG A;  3LY7 A;  4BER A;  3KAE A;  3PZ3 A;  5BPP A;  2BKK B;  4BTB A;  1KPS B;  2GRM A;  2Y0B G;  3Q47 B;  3D9H A;  4UWL A;  4HLE A;  4Q94 A;  4G1T A;  3GW4 A;  5JHB A;  1LTX A;  1QNF A;  4L23 A;  1YYH A;  4DRX E;  4I6E A;  1E8Z A;  4WUY A;  5JA4 D;  2IFU A;  3TWS A;  3E4B A;  1N54 A;  2XEV A;  3L9T A;  1BD8 A;  3N71 A;  3CLJ A;  3LKU A;  4X8Q A;  2KCK A;  5JHA A;  3AG2 E;  4U8V D;  4HNA D;  1HO8 A;  3DSW A;  4RSY A;  2L9B A;  4GMJ A;  3EU9 A;  2V5Q C;  4XE0 A;  2LO6 A;  4EZJ A;  2GGF A;  3TG4 A;  4JXT A;  1OCC E;  3T9K A;  3JCK C;  3QB2 A;  4NRH B;  2LXM A;  2RD0 A;  3ZVV A;  2EIK E;  1IKN D;  4C0M A;  3ZPJ A;  4KVM A;  4BES A;  3ZXP A;  3JUI A;  2LUH A;  4DLO A;  1SA4 A;  1EPU A;  3AS5 A;  4PH4 B;  3UI2 A;  4Q96 A;  3NOG D;  3ABK E;  3LEW A;  1U3C A;  2EQX A;  4OAV B;  3FH8 A;  1MYO A;  1JCQ A;  3L22 A;  3SQV A;  3APC A;  1OWL A;  2OEV A;  1O1R A;  2J09 A;  1UG3 A;  3HXD A;  3UT4 A;  4PS3 A;  2XPZ A;  3APF A;  2V5F A;  4EPZ A;  1L5J A;  3EDT B;  5FQ6 A;  3CKB A;  1UJJ A;  1DCQ A;  1UN8 A;  3FU3 A;  3HG0 D;  3V31 A;  3KS2 A;  4CRW A;  1EYH A;  3MYV A;  2WXN A;  3CKC A;  2J08 A;  1H2T C;  1E8X A;  2FO1 E;  3UKU G;  4URK A;  4JA7 A;  1OWO A;  2LXL A;  1JWF A;  2XS1 A;  3D9L A;  3HIZ A;  4XZ4 A;  3U3W A;  1O1T A;  3AU5 A;  4J7W A;  1V55 E;  5AIJ A;  5CMW A;  2Y4U A;  5CER B;  3J5P A;  1FPP A;  4LER A;  3TXM A;  2R2L A;  5ANL A;  2KZT B;  2RG8 A;  5JJT A;  3EHN A;  4LNG A;  5FIO A;  3OAW A;  3CHS A;  2WXR A;  3UXG A;  2YHC A;  3MA5 A;  1QBQ A;  3PUJ A;  5BT1 A;  3CVX A;  3PEU B;  1OXJ A;  2ILR A;  3FTY A;  4LSZ E;  5BV0 A;  1AWC B;  5CBN A;  3VTX A;  5ENQ D;  4EZK A;  1TYQ G;  1O1S A;  2A5U A;  2DIW A;  5A23 A;  1IXV A;  1X81 A;  2IF4 A;  5BNW A;  4GCN A;  3SFY A;  4A3T A;  3PE3 A;  3HDX A;  1TN6 A;  3L13 A;  3I4R B;  5JJ7 A;  4CT4 A;  2NYJ A;  1OT8 A;  3MEK A;  2UWJ G;  4FA6 A;  4G2V A;  4GTO A;  1QZ2 A;  3BG0 B;  2XHE A;  2HE0 A;  2LSU A;  4TV3 A;  4UWK A;  4KXK B;  5ITZ F;  2E0I A;  2FEZ A;  4I6J A;  4HI8 A;  2DYR E;  3PUK A;  3L6A A;  2HYZ A;  1KZP A;  2EIL E;  3AU4 A;  5AJD A;  4HXI A;  4ANV A;  2BTD A;  4CDR A;  3CV0 A;  3QC1 A;  4HFG A;  4HOR A;  4OVV A;  4LEU A;  3ML9 A;  2R05 A;  4LNU D;  3PZD A;  1MZC A;  3ZXS A;  4N3A A;  5G05 C;  3FUN A;  3LXU X;  3QWW A;  1Z6T A;  3HVE A;  2IY0 C;  3TWX A;  3FTW A;  3DSX A;  2VGY A;  4EBA A;  2AVP A;  3HVE B;  2KXP C;  4GYO A;  3VLF A;  4JHR A;  4LNB A;  3AJI A;  3SY2 A;  3CR3 A;  3C72 A;  3CK8 A;  2I1K A;  4JL0 A;  3BG1 B;  3CVQ A;  2QC9 A;  3DPD A;  4B0Z A;  4GYW A;  1H0A A;  3DPY A;  2X6I A;  3TWV A;  3FTX A;  3BQO A;  4WND A;  3ZU7 B;  1WAO 1;  1K8K G;  2EIM E;  4IN3 B;  1UW4 B;  4MKT A;  3W9F A;  2J49 A;  1DVP A;  4FP7 A;  3Q75 A;  2R02 A;  4N5Q A;  5EYL A;  1D9S A;  4DX2 A;  4Z68 A;  4ILG A;  4AIF A;  4EBA G;  4G25 A;  5E76 A;  1MX2 A;  3UX4 A;  3UIN C;  1MX4 A;  3S2A A;  3HXF A;  1JUQ A;  3ZUV B;  3TWT A;  3O4Z A;  3P1U A;  4U0S A;  3UKR G;  3MV2 B;  3GZ2 A;  4G26 A;  3UTM A;  4YVQ C;  2WXH A;  4CDN A;  3KSQ A;  1NL4 A; 
#chains in the Genus database with same CATH homology
 5LFA A;  4WNE A;  2AWI A;  3G2V A;  4U8H A;  4WNG A;  5CCM A;  2WVI A;  2L6J A;  4ACK A;  2HO1 A;  2WXK A;  4J8F A;  4L7T A;  1OUV A;  2I2O A;  3T8M A;  3UT8 A;  3RRN B;  5E75 A;  4NUR A;  4B8A A;  4HVB A;  2V8S E;  3QAQ A;  2R17 C;  3PNT B;  3LYA A;  4UQZ A;  4KT6 B;  4XI0 A;  5T4Y A;  1HX8 A;  5LCW C;  4QFV A;  2OND A;  3TG5 A;  3FUJ A;  4YND A;  2WXP A;  3ZYK A;  4AV7 A;  5BUZ A;  4FAD A;  3ASH A;  3CK7 A;  3MJW A;  2KM4 A;  4B8C B;  4GYY A;  1ELK A;  3UQ3 A;  3FEY A;  5FJY A;  3I4G A;  4N2S A;  2NC9 A;  4UQY A;  1E96 B;  2BF0 X;  4GA1 A;  4FJY A;  4A3V A;  3PS6 A;  3ZYM A;  1H19 A;  3QKY A;  2DCP A;  2WXQ A;  4GZC A;  3ZHE A;  5D0O D;  3CGH A;  5ARG A;  4BY6 A;  1DNP A;  3SFZ A;  4RG9 A;  2PQR A;  3LY7 A;  2V4L A;  5HI7 A;  2V0P A;  1IHG A;  3KAE A;  4KVO A;  1JPL A;  2E2E A;  2KC7 A;  3FU6 A;  3ZHE B;  3SI5 A;  4BTB A;  4EEC A;  5BPP A;  4AP2 A;  1KLX A;  2C0M A;  2GRM A;  3Q47 B;  4RG6 A;  2CG3 A;  2VGX A;  1W3B A;  4LCT A;  5CHE E;  4UWL A;  3U64 A;  4HLE A;  2J07 A;  3ENE A;  4Q94 A;  5CCL A;  2LAH A;  4G1T A;  2I9C A;  5FZR A;  2VTB A;  2CFU A;  1LF8 A;  5CMY A;  5FZQ A;  3S7B A;  4R7L A;  4U63 A;  4GAA A;  5J08 A;  2FBN A;  3GW4 A;  4JW1 A;  3TAX A;  5G05 J;  5JHB A;  3B7U X;  2R59 A;  3CVW A;  4Q69 A;  4IUL A;  2VTB B;  1QNF A;  4L23 A;  3CQG B;  3S7J A;  2XPY A;  4I6E A;  3ZN3 A;  2FI7 A;  1E8Z A;  4K03 A;  4WUY A;  4BT9 A;  2X6F A;  1XNF A;  4Y6W A;  2IFU A;  4KZ0 A;  4AY5 A;  4ABN A;  4AM9 A;  4HOS A;  3MX3 A;  3SBS A;  1EDU A;  2WXF A;  3L54 A;  1BPO A;  3FH5 A;  3E4B A;  3G2W A;  1N54 A;  3U9W A;  2XEV A;  1TJF A;  4J6I A;  3G2S A;  4WWO A;  2XCB A;  4U0Z A;  3FUK A;  3O48 A;  1ELW A;  3GZ1 A;  4DLQ A;  5EX3 A;  3N71 A;  3CLJ A;  3FUE A;  3LKU A;  4GZ6 A;  2KCK A;  4PS7 A;  3CSF A;  3NZU A;  5EKQ D;  5JHA A;  4XI9 A;  1X5B A;  2KZT A;  4FLB A;  1FVH A;  4UQX A;  4ANW A;  1HO8 A;  1S0P A;  4Y6C A;  5D0Q D;  2X3M A;  4UI9 K;  1GW6 A;  4ILH B;  5FTP A;  4RSY A;  3FUL A;  2KCL A;  2L9B A;  4GMJ A;  4WAF A;  3IV0 A;  2WPV A;  3IHY A;  3OXF A;  4XE0 A;  2LO6 A;  4EZJ A;  3LS8 A;  4JEU A;  4A1G A;  1P5Q A;  5AEN A;  3EHM A;  3SGH A;  2CFZ A;  3VLE A;  2GGF A;  5FWQ A;  3TG4 A;  2IJG X;  4JXT A;  3EJN A;  2QY7 A;  1H2V C;  3FTU A;  3Q49 B;  5ANR A;  3JCK C;  4I17 A;  3QB2 A;  3CVV A;  1OWP A;  5FZS A;  3CVY A;  2CHZ A;  4NRH B;  4N3C A;  4WWP A;  2RD0 A;  3SBT B;  2LAI A;  1INZ A;  3ZVV A;  4C0M A;  3QWP A;  3MCX A;  3ASF A;  2YQ8 A;  3RRM B;  1SZA A;  3ZPJ A;  2VSX E;  1NZN A;  3FHE A;  4FHJ A;  4KVM A;  4MS6 A;  5G55 A;  1A17 A;  3JUI A;  5AJL A;  4WNF A;  4DLO A;  2VYI A;  3FP3 A;  4V3I A;  4A1S A;  3TL5 A;  4E6H A;  2YIN A;  2PM7 A;  1EPU A;  1HU3 A;  2MRI A;  2Y4T A;  3CHR A;  3PRZ A;  4JC8 A;  2HR2 A;  3AS5 A;  4PH4 B;  1SQM A;  4KYO B;  4N2Q A;  2L0I A;  4P29 A;  4U04 A;  3TGO A;  3AS4 A;  2KAT A;  3FUF A;  4DI4 A;  4Q96 A;  3OTN A;  3UT7 A;  4H7X A;  3FUH A;  4LUN U;  2FF4 A;  3DBS A;  2KCV A;  3MGB A;  4J8D A;  2R5S A;  3LEW A;  1U3C A;  2VSN A;  2Y3A A;  3RO2 A;  4B89 A;  3JYS A;  4I1M A;  3MKQ A;  2EQX A;  3EIQ C;  4J8E A;  3SNX A;  5KJM A;  1UJK A;  3LCA A;  1TEZ A;  3QJZ A;  3MKQ B;  3FH8 A;  5LCW J;  5BV1 A;  4GZ5 A;  3L22 A;  4IRU A;  4WWN A;  4UWG A;  2JLB A;  3ASD A;  4I9C A;  3APC A;  1OWL A;  3PVL A;  3ONL A;  2J09 A;  3VLD A;  1QQE A;  1UG3 A;  5T8I A;  4AOF A;  4BX9 A;  4N5C A;  5A7D B;  4ANU A;  3IBE A;  3D9K A;  4U0U A;  3URZ A;  3QAR A;  4KMO A;  4GZ3 A;  2XGM A;  2XQ0 A;  3FUI A;  3UT4 A;  3UUX A;  3CHO A;  4PS3 A;  2XRZ A;  2XPZ A;  2OVB A;  3APF A;  2V5F A;  3L17 A;  5BW8 C;  4EPZ A;  3UPV A;  1L5J A;  3CQC B;  3LVR E;  2LNI A;  3CHP A;  3EDT B;  4HOQ A;  5ARF A;  5FQ6 A;  4C9B B;  3L16 A;  1ZU2 A;  4CGW A;  4D10 C;  3B7T A;  3CKB A;  3GYZ A;  1UJJ A;  4L1B A;  3G2U A;  3RK6 A;  1HFA A;  4ACL A;  2WQ6 A;  2OV8 A;  1UN8 A;  2WMN A;  3FU3 A;  4YVO A;  3D9N A;  3CEQ A;  3FY4 A;  3KS2 A;  3CVN A;  1Y8M A;  3CVL A;  4UI9 C;  4CRW A;  2WQH A;  2VGX B;  2J4D A;  1HG5 A;  1U3D A;  4XIF A;  1E7V A;  1EYH A;  3APD A;  4K0R A;  3MYV A;  2WXN A;  4UWF A;  3CKC A;  3ZGQ A;  2WXO A;  1NA3 A;  2J08 A;  2I6H A;  3D9O A;  1H2T C;  1E8X A;  2WXJ A;  5FT9 A;  3D9M A;  4FJZ A;  2UY1 A;  4URK A;  4ILI A;  4JA7 A;  3RIB A;  4JHK A;  3ZFW A;  4DK5 A;  2WXG A;  1OWO A;  3PH0 C;  1JWF A;  3D9L A;  3LJ3 A;  3HIZ A;  1HS6 A;  4E85 A;  3PDN A;  4UWH A;  1YA0 A;  4XZ4 A;  3S7D A;  3ZEF A;  4APF A;  4BX8 A;  3U3W A;  3LPZ A;  5G2N A;  3ESK A;  3AU5 A;  3U66 A;  3IKO B;  4I2W A;  4I1A A;  4IYP A;  2GRL A;  4BWR A;  4DJA A;  5AIJ A;  1XGW A;  3D3M A;  3Q4A B;  4ANX A;  5CMW A;  2Y4U A;  1KT1 A;  4HOU A;  2YNQ A;  2VJ8 A;  2PL2 A;  2CHX A;  4FHK A;  4G24 A;  4LER A;  3TXM A;  1Z3X A;  3TXN A;  3FU5 A;  5ANL A;  5C2Y A;  2L0T B;  4I6G A;  2KZT B;  2RG8 A;  2QFC A;  3EHN A;  5JJT A;  1KT0 A;  3OAW A;  4EZL A;  3ZW3 A;  2ION A;  3CHS A;  2WXR A;  4DPR A;  2YHC A;  2WB2 A;  3MA5 A;  1OWM A;  3MV3 B;  5LX8 A;  3LY9 A;  5KCM A;  3PUJ A;  4G23 A;  5BT1 A;  3CVX A;  4A55 A;  4FU3 A;  2IOL A;  3ULQ A;  3PEU B;  3RU0 A;  3S7F A;  3TJP A;  4EQF A;  3ASG A;  2YHE A;  4AEZ C;  2ILR A;  3FTY A;  4HOT A;  4B94 A;  1MHQ A;  3FWV A;  2PQN A;  2FUL A;  1OWN A;  5A6C A;  2X6H A;  5C1D A;  2AXV A;  3VTY A;  3LDZ A;  2J4B A;  2Q7F A;  1HF8 A;  5KJK A;  5BV0 A;  2HM8 A;  2GW1 A;  3VTX A;  4NAC A;  4EZK A;  4TUU A;  3WXX A;  2PM6 A;  2LSV A;  2A5U A;  3Q5M A;  2DIW A;  3MKR A;  4G11 A;  5A23 A;  2CG2 A;  3ZYQ A;  3OXL A;  3FU0 A;  2WXM A;  3ZIM A;  2IF4 A;  1IQU A;  3AS8 A;  5HQ8 A;  4DI3 A;  4GCN A;  4F3V A;  5BNW A;  3FDH A;  1N52 A;  3FEX A;  5T3R A;  4MRU A;  4A3T A;  4I43 A;  4AXH A;  3PE3 A;  5G04 C;  1HXI A;  3HHM A;  3BEE A;  4CEM A;  3ESL A;  4RVB A;  4ATG A;  2VQ2 A;  3FUM A;  3LY8 A;  2M63 A;  3HDX A;  2ZU6 B;  1WM5 A;  4JHJ A;  1FVF A;  3L08 A;  3R7R A;  3L13 A;  3CIA A;  3I4R B;  5JJ7 A;  4CT4 A;  4HS2 A;  4L2L A;  4C0E A;  5M72 A;  2WMO A;  3MEK A;  4GPK A;  2UWJ G;  2X6K A;  4FA6 A;  4G2V A;  3RKV A;  4CCA A;  3RRU A;  4JEH A;  2I1J A;  2J9Q A;  1QZ2 A;  4BFR A;  3BG0 B;  2XHE A;  1HZ4 A;  2C0L A;  2LSU A;  2C2L A;  4TV3 A;  4U07 A;  3PE4 A;  3QWV A;  4UWK A;  4KXK B;  1B89 A;  3D9J A;  1HH8 A;  4JZY A;  4W9R A;  2OOE A;  2XRY A;  3HYM B;  1E7U A;  2E0I A;  1JWG A;  2X6J A;  4MLP A;  1IQR A;  5EDS A;  1Y6I A;  4N3B A;  2FEZ A;  3SHF A;  4GML A;  4I6J A;  5FQ4 A;  1MQS A;  4GU5 A;  4BT8 A;  3PUK A;  4PS8 A;  4J0U A;  1H6K A;  2WM9 A;  3L6A A;  4XKB A;  2HYZ A;  3G2T A;  4OVU A;  3I3N A;  2A4Z A;  2P58 C;  4I2Z A;  3AU4 A;  3MZL B;  3EIJ A;  2XPI A;  5AJD A;  5DBK A;  2VSY A;  3FTZ A;  4HXI A;  1NP7 A;  4ANV A;  3R9A B;  1Z3Y A;  3FUD A;  2BTD A;  4CDR A;  3CV0 A;  3OXG A;  2AW6 A;  3PEV B;  3QC1 A;  3FH7 A;  4HFG A;  1E8W A;  4OYS A;  4OVV A;  4GZD A;  4HOR A;  4LEU A;  3ML9 A;  4UI9 J;  5FQ7 A;  2MOW A;  2NXP A;  3PZD A;  3ZRH A;  4CGV A;  2VSO E;  3D9P A;  3ZXS A;  3PNL B;  3CVP A;  4J8S A;  4JA9 A;  4N3A A;  1ELR A;  5G05 C;  3FUN A;  5AYW D;  3LXU X;  3QWW A;  1Z6T A;  2FO7 A;  3HVE A;  3RO3 A;  2UY1 B;  3FTV A;  4XKC A;  4JPS A;  3FTW A;  4AVX A;  3GZS A;  5JJ6 A;  2VGY A;  1VDY A;  4EBA A;  1IYG A;  4AJW A;  2AVP A;  1PC2 A;  5J90 A;  3B7S A;  3HVE B;  4GYO A;  3CVU A;  4CT0 A;  3RJV A;  3VLF A;  4JHR A;  4FC8 A;  4M3O A;  3T5V A;  3CR3 A;  3CK8 A;  1PAQ A;  1PY1 A;  2I1K A;  4JL0 A;  3U4T A;  3NZS A;  3BG1 B;  4AY6 A;  1SZ9 A;  3CVQ A;  3P2B A;  2CHW A;  3UMV A;  3CST A;  2PZI A;  1NA0 A;  3DPD A;  4F7A A;  4B0Z A;  4GCO A;  1ZBP A;  2IQC A;  3T5X A;  4PUC A;  2DBA A;  3ZYL A;  4GYW A;  1H0A A;  5LP0 A;  3QDN A;  2WQ7 A;  4XX5 A;  4GB9 A;  5KJN A;  4KZC A;  2X6I A;  3FTX A;  4L2Y A;  4WND A;  4PDX A;  5FQ8 A;  3R7Q A;  1FCH A;  3LVQ E;  4I1O B;  1WAO 1;  3QK0 A;  3PRE A;  3SF4 A;  3B13 A;  4IN3 B;  3IHV A;  4N39 A;  5DIZ A;  3I5P A;  2IU1 A;  4I9E A;  1EF1 C;  2XGO A;  2WXL A;  5KJL A;  1UW4 B;  4FUL A;  4MKT A;  3QOU A;  1E8Y A;  2J49 A;  3QNK A;  3NF1 A;  3NQP A;  1H2U A;  1DVP A;  2NSZ A;  3JQ1 A;  4FP7 A;  4TRQ A;  3FFL A;  5LOZ A;  1HG2 A;  2BUG A;  2OVF A;  4APO A;  4F1S A;  5ENN A;  4BSX A;  2WXI A;  4CDM A;  3D9I A;  2IOS A;  1WY6 A;  1TJC A;  2XCC A;  3K9I A;  4KBQ A;  3CK9 A;  3IEG A;  3KEZ A;  2JEK A;  4GA2 A;  3SD5 A;  3CHQ A;  3CHM A;  4ILG A;  2X38 A;  4AIF A;  4EBA G;  4G25 A;  5E76 A;  2MHK A;  4ME2 A;  3UX4 A;  2AXU A;  4BTA A;  3S2A A;  4H7Y A;  4JVS A;  4O6F A;  3ONK A;  1JUQ A;  2AXZ A;  3B7R L;  1E90 A;  3Q15 A;  2XGS A;  1UN9 A;  3C98 A;  3KD7 A;  4NQ0 A;  1HE8 A;  3ML8 A;  4GA0 A;  5G04 J;  3O4Z A;  3P1U A;  4U0S A;  4FLH A;  3JQ0 A;  3MV2 B;  3GZ2 A;  4G26 A;  3SZ7 A;  3FTS A;  4YVQ C;  2WXH A;  4CDN A;  4LRZ A;  4F53 A;  5EX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...