2LNIA

Solution nmr structure of stress-induced-phosphoprotein 1 sti1 from homo sapiens, northeast structural genomics consortium target hr4403e
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
133
structure length
133
Chain Sequence
MGHHHHHHSHMNPDLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target HR4403E
rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Stress-induced-phosphoprotein 1
total genus 46
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lniA00
3CVLA 3S7JA 3MKRA 3U3WA 2C2LA 3CVPA 3KD7A 1NA0A 1KLXA 2XGSA 2Q7FA 3RIBA 4WNGA 5HI7A 3CK7A 5CCLA 4F3VA 5KJMA 5KJKA 3ASHA 3QKYA 5FZRA 3ZGQA 2YQ8A 5BT1A 5D0QD 3R9AB 1HH8A 2VGYA 4J0UA 5DIZA 2C0MA 4RG6A 3CEQA 3OXGA 5ARGA 2UY1A 4GZ5A 5G05J 5JJ6A 3TG5A 4GPKA 2BUGA 3GYZA 3GZ1A 2OOEA 1HXIA 5FZQA 1WAO1 3ASFA 3S7FA 4HORA 4HOQA 3FFLA 3ASDA 2HR2A 5CHEE 3LKUA 1A17A 3MV2B 3URZA 4CGWA 3TGOA 2J9QA 3U4TA 3PE3A 3Q5MA 5G04J 4AY5A 3S7DA 3ULQA 4GYYA 4GA2A 2VGXB 3Q47B 4I9CA 3PDNA 4U0ZA 4YVOA 1ELWA 3UQ3A 2FBNA 2QFCA 1KT1A 3AS5A 3MEKA 3PE4A 2VSYA 2JLBA 4IN3B 4N3AA 5A6CA 4GCOA 5D0OD 2PZIA 4JL0A 3HYMB 2XEVA 3SZ7A 3CKBA 4CGVA 4NQ0A 3KAEA 4GA1A 4CDRA 2AVPA 4HOTA 4UQZA 4G2VA 5FTPA 3ZN3A 1IYGA 3MV3B 1W3BA 4I2ZA 2KATA 4G1TA 5EKQD 3ZPJA 5JJ7A 3VTYA 4AIFA 1P5QA 4APOA 4UQXA 4KXKB 3KS2A 4N3CA 5FT9A 2ONDA 4XIFA 1PC2A 3ZFWA 2Y4UA 4BTBA 4G25A 1E96B 4U04A 5EX0A 5M72A 2HO1A 3RJVA 2YHCA 4KBQA 5BNWA 2XCBA 4I2WA 4G24A 1XNFA 2GW1A 3EDTB 2VYIA 4J8DA 4BWRA 2LNIA 3QWVA 4UQYA 5FJYA 2DBAA 3RU0A 4GA0A 4UI9K 2PL2A 5CCMA 3N71A 4A1SA 1B89A 2NC9A 3FP3A 4XI9A 3UPVA 4ME2A 2FI7A 1HZ4A 3ZHEB 3JYSA 2I6HA 3BEEA 4WNEA 1Y8MA 4NRHB 4GYWA 3AS4A 3GW4A 3K9IA 2HYZA 5A7DB 3TG4A 2C0LA 2KC7A 4I9EA 3CVNA 3Q15A 4Y6WA 4U07A 3LY9A 4GZ3A 1QQEA 3AS8A 2R5SA 4UI9C 3ESKA 3LYAA 4I1AA 4WNFA 2MHKA 1NZNA 3S7BA 3SF4A 1WM5A 4WNDA 5LCWJ 2XCCA 4N3BA 4JHRA 4J8FA 2LSUA 2VGXA 1FCHA 5BW8C 5C1DA 3LY7A 4BTAA 4GYOA 2PQNA 3RKVA 4N39A 4JA7A 4BT8A 4Y6CA 3E4BA 2WPVA 4I17A 5KJLA 1OUVA 3IEGA 3MA5A 2XGOA 4XI0A 1IHGA 5EX3A 2PQRA 5AYWD 2FO7A 5JJTA 2UY1B 3LPZA 5G05C 2E2EA 3QWPA 2L6JA 4H7YA 3O48A 2VSNA 4W9RA 5KJNA 3QWWA 4H7XA 2WQHA 4J8EA 4GZ6A 4JA9A 1ZU2A 2XPIA 4HOUA 4LEUA 2UWJG 4YNDA 5ARFA 3WXXA 3TAXA 4ABNA 2FEZA 3RO3A 4GCNA 4HOSA 3CV0A 3CK8A 5FZSA 3CK9A 5G04C 3RO2A 5HQ8A 3LCAA 4AY6A 2Y4TA 4G26A 4O6FA 4KYOB 4N5CA 1NA3A 3OXFA 4RG9A 4WUYA 2P58C 4G23A 3ZHEA 3VTXA 3GZ2A 4U0UA 4B94A 2IF4A 2VQ2A 2XGMA 1QZ2A 5DBKA 4BT9A 4N2SA 3CKCA 1KT0A 1YA0A 1ZBPA 2KCKA 3NF1A 2FF4A 3Q4AB 4YVQC 3CVQA 4U0SA 4N2QA 1TJCA 2LSVA 3LY8A 2KCLA 4UI9J 3QOUA 5LCWC 3QDNA 4AM9A 3ASGA 3FWVA 3UUXA 3OXLA 4EQFA 2V5FA 1ELRA 2KCVA 3Q49B 2IFUA
chains in the Genus database with same CATH superfamily
3S7JA 5HI7A 2F37A 3QKYA 3CSTA 4J0UA 1N4QA 5JHAA 2EIJE 3PUJA 4DI4A 3PRZA 3C3QA 3J5QB 3DSWA 3PNLB 2ETAA 2I1JA 1ELWA 3TJPA 2XPYA 2IY0C 4KMOA 2BEDA 4JL0A 4FA6A 5AIJA 4NQ0A 1U3CA 3SFXA 4CDRA 4GMLA 3ZN3A 1W3BA 3ZPJA 3APCA 3I4GA 4NURA 5M72A 2HO1A 1E8YA 2ZGDA 2V4LA 4A1SA 3FP3A 2ZGGA 2FI7A 4C0EA 2C0LA 2A5EA 4MRUA 5LP0A 5KNGA 4RSYA 2CG2A 4BTAA 5E76A 4GTSA 2WPVA 3UIOC 3QNKA 3U9WA 2IO2C 2XENA 5JJTA 4Q94A 3VLEA 3MX3A 3WXXA 3CK8A 1TNZA 3KSQA 3CK9A 2IU1A 4FU3A 3I3NA 3E32A 3VTXA 5CEDB 4N2SA 3MJWA 3FU0A 4CZ2D 2J49A 4DLOA 3DSVA 3ASGA 3LS8A 3OXLA 4CT4A 3HXEA 3DXKG 4DX5D 3UT4A 4V3IA 2LAIA 5KCMA 3GZ1A 2EQXA 3GZSA 3ZYKA 1FVFA 3RRUA 4A63B 5AQBA 3ZXPA 2DZOA 3CR3A 1DC2A 1MX6A 1QYMA 4YVOA 1N11A 3E30A 5FTPA 1NL4A 4CDNA 5CRUA 4AIFA 1P5QA 4G8LA 4APOA 3ISMC 3Q9NC 1XNFA 2GW1A 3T5VA 3I5PA 2I6HA 1RW2A 1JWGA 3TL5A 3AG2E 3D9PA 4PS7A 3ZUVB 1HO8A 3EHMA 4OVVA 1EPUA 1JUQA 1H0AA 2GROB 4UWFA 4JPSA 4Y6CA 3RAUA 2XGOA 3QWPA 4GTRA 4U95D 4GZ6A 4JA9A 1AWCB 4O6FA 4N5CA 4U0UA 2DWZA 2RFMA 4ATZD 3JUEA 2GRNB 4U0SA 4HXIA 1S0PA 3SI5A 2IFUA 3JCKC 2BTDA 3PZ4A 4LNBA 4TUMA 3DPYA 3DRAA 3AG1E 3IKOB 3SFZA 2NYJA 2E0IA 4HRMB 4ACKA 3MKQA 3UM3A 2KXPC 2XQ0A 2WXFA 1BLXB 3FU6A 4PS3A 5EDSA 4GCOA 5D0OD 3C72A 2AVPA 4GB9A 4DX1A 3FUFA 5EILA 1BPOA 4EZLA 5FT9A 2IONA 3FTYA 3FTVA 2DYRE 4I2WA 3EDTB 1MJ0A 1PY1A 2V8SE 4K5CA 4UWHA 3PH0C 3CVWA 3HXDA 4DX7D 3BQOA 3BU8A 2VGXA 2HM8A 5CRVA 4KVMA 1TNUA 3E4BA 3MGBA 2EINE 1IHGA 3NZSA 1SZAA 2XPIA 4ABNA 1OCCE 5ENNA 4U8YD 1SA5A 4AY6A 1JCQA 3OXFA 4B94A 1DVPA 4G23A 3LDZA 4JC8A 4CDMA 1FPPA 3Q49B 2I9CA 4TV3A 3E33A 4OAUC 1QNFA 1S63A 3D3MA 4BERA 3FUMA 4HNAD 3FUNA 5BV1A 1NP7A 3U66A 3FFLA 3R7QA 3ZXSA 1SZ9A 1KZOA 3AS5A 3PE4A 1EF1C 2ZXWE 2IOSA 4MKTA 1BD8A 3IV0A 5EKQD 2F0YA 1MX2A 3EU9A 3ZYLA 3B7BA 2X6KA 3CQGB 5FINA 2WXKA 2OVBA 3HXFA 4FC8A 4EPZA 1OWNA 4NRHB 3AS4A 3TG4A 5A7DB 4YDEA 1H19A 3UKRG 2VTBB 4XE0A 4BY6A 5BT1A 3S7BA 1SA4A 3SF4A 2P9LG 3C98A 4L7TA 3T5XA 4G11A 1BI8B 3D9KA 2ZU6B 5KJLA 2H6IA 3MA5A 4JHKA 2PQRA 4HBDA 4PUCA 3LPZA 3JXIA 1YYHA 3AAAC 2WXLA 1EYHA 3JQ1A 4MBGA 5CEAA 4ANWA 1HS6A 1KT0A 3NF1A 2ETBA 3UM1A 3FTUA 3LEWA 3SBSA 2MYOA 5LCWC 5KBAA 2V5FA 1OWOA 3RRMB 3HG0D 4LRZA 4APFA 2RKKA 2RFAA 4DUIA 5FZRA 1V54E 4LSZE 4RG6A 3CQCB 3S7FA 3DWLG 1H6OA 4YDOA 4B8AA 1SW6A 4I9CA 4EBAG 3TWUA 2R02A 3UIPC 3EHNA 3J5PA 2KATA 4G1TA 1TNOA 5E75A 3VTYA 5EN5D 2GRMA 5AQ7A 3D9MA 4KXKB 3KS2A 4GU5A 4G25A 2XCBA 3PZDA 3LXUX 2KZTB 5JMND 4E85A 4BESA 4GTQA 3AU4A 3F6QA 3PEVB 1TN6A 3IBEA 4XKCA 3FUEA 3LYAA 5CBOA 1MZCA 1E8WA 3APDA 1DCQA 3ZNGA 5C1DA 1FCHA 4JB8P 4I6GA 3LY7A 2L9BA 4GYOA 2PQNA 4JVSA 4HRNA 2RD0A 3CLJA 4AOFA 4HOSA 4ILIA 4HQDA 2J4DA 1E8XA 1UN9A 4RG9A 5LX8A 3D9HA 1QZ2A 4BT9A 2QY7A 1N95A 3ASOE 2WXHA 3DSUA 1ELRA 3B95A 3SGHA 3U3WA 1UJJA 2WQ6A 3BG1B 4WNGA 5KJKA 3W9GA 4JXTA 5G05J 4BX8A 1Z3YA 1HXIA 3EU5A 5ENQD 4M7CA 1E8ZA 3OTNA 5KWDA 5G04J 1FT2A 3S7DA 5C2YA 2Y1LE 1RZ4A 1MQSA 3FUIA 3EIQC 4UQZA 1FT1A 3HRAA 1BI7B 4JW1A 3HXBA 1PAQA 5ENSD 4TRQA 4ILHB 4IYPA 1PC2A 4A3VA 2Y4UA 4G24A 3SQVA 1HFAA 2L6BA 3EUVA 1U3DA 2WXRA 4GA0A 3ZEFA 4GYWA 2HYZA 2A5UA 4LERA 2P9NG 1OXJA 2A4ZA 2R5SA 4O1PA 1WY6A 5JHBA 4JEHA 4JHJA 5FWQA 1IQRA 3JUIA 3C3RA 3PVLA 3SO8A 2V5QC 1H2TC 5G55A 3E34A 2B0OE 3TWQA 3U64A 2MOWA 3RO3A 1Y6IA 3MCXA 3TWVA 1NA3A 2L0IA 2ETCA 3TWSA 2J8SD 2VQ2A 1ZBPA 3PUKA 3LY8A 3APFA 4GPMA 1IHBA 2F8YA 1JPLA 5AN8A 4X8QA 3UXGA 3C3OA 4J8YA 3KEAA 2UY1A 5B1AE 2ILRA 2YHEA 1WAO1 2ZIRA 2DVWA 3KSLA 4GA2A 3PDNA 2FBNA 5A6CA 4B0ZA 3UTMA 3KAEA 4G2VA 2LO6A 4UQXA 3HDXA 4N3CA 1SQMA 4L1BA 4FHJA 1MX4A 4FLHA 3TWXA 3HXCA 5BXUA 4KBQA 4OAVB 5IY5E 5EIBE 2LNIA 3QWVA 4UQYA 3DSTA 1K1BA 1B89A 4ME2A 4B8CB 5G2NA 4DX6D 4U07A 3URZA 4WNDA 2I1KA 4I6JA 1ZB1A 2EIKE 5CECB 4L9PA 4A55A 2OVFA 3G2UA 5AQAA 4H7YA 3T8MA 3CIAA 4Q96A 5ARFA 2FEZA 3V30A 1OCOE 3ZHEA 3ESLA 1VDYA 3FUJA 3P1UA 1S70B 2LAHA 3ONKA 2X6FA 4EBAA 4AM9A 3ML8A 1HU3A 2WMOA 3FEYA 2VGXB 2P9SG 2R03A 3RIBA 5CBNA 3C5RA 3R9AB 4GPKA 4F6RD 2BUGA 4LNGA 3QC1A 3CVYA 2QYJA 3S2AA 1A17A 1TNYA 3TGOA 4AY5A 1MYOA 1Z5SC 3ZIMA 2DZNA 2PZIA 2OV8A 4GA1A 2PM6A 4R7LA 1FVHA 2CFZA 3FUHA 3OAWA 4TXRA 4C0MA 2KM4A 1E96B 2XPZA 2YHCA 5BNWA 2VJ8A 2J07A 4BWRA 1TN7A 4E6HA 4WNEA 1HX8A 2KC7A 3V2OA 3CVXA 1QQEA 4DX2A 4GZCA 3ESKA 2BF0X 2MHKA 2OEWA 3CGHA 1U2VG 3CHPA 3HIZA 4WAFA 2XZDG 4AJWA 3FTXA 3Q7FA 3QJZA 4H7XA 3G2TA 4U8HA 4Z68A 4BSZB 3LCAA 4FJYA 4ZFHA 2VSXE 1N54A 2GRLA 2AXZA 4I6EA 3Q79A 1KT1A 2C2LA 2FULA 2Q7FA 3B7TA 2R2LA 3MKQB 1HH8A 2VGYA 5FZQA 4HOQA 4DLQA 4CGWA 3Q5MA 3Q47B 4JEUA 4URKA 4J6IA 3ULYA 2XEVA 3FUKA 2WXGA 4J8SA 4I2ZA 3FUDA 2AWIA 3NAWA 2XHEA 3EJNA 5EX0A 3HVEA 3ULEG 1N4PA 4DPRA 4CEMA 2CHZA 1V55E 1O1RA 3Q15A 3R7RA 3G2WA 4HLEA 5D66A 1L5JA 4K03A 3AS8A 2Y69E 1OCZE 1WM5A 2WXMA 4L23A 5BW8C 3EIJA 1LD8A 2KBXA 3IEGA 1IYGA 5AYWD 3T9KA 2Y3AA 4GTVA 2V0PA 4GTMA 1AP7A 3TAXA 2R17C 3UMVA 1KZPA 2WMNA 5A23A 2P9IG 2MRIA 3PEUB 3D9IA 4A3TA 5T8IA 3ABKE 3NB2A 3FWVA 4EQFA 1E90A 3PZ2A 1K3ZD 3CVPA 4F3VA 1QBQA 3UT8A 3ASHA 3LVRE 3L82A 3CSFA 1HG5A 5JJ6A 4WWNA 4I43A 3ASFA 1Q2ZA 3ML9A 5D2MC 2EIME 4U0ZA 4LNUD 1WG0A 3WG7E 3BG0B 4F7AA 4IN3B 1H6PA 2DCPA 4JZYA 3SNXA 4PDXA 3DXMG 3SHFA 4BTBA 2R59A 5ENRD 2GGFA 3ZKJA 2HE0A 5ANRA 4GMJA 4I9EA 3FHEA 1H2VC 4WWPA 4LUNU 4UI9C 1NZNA 1KPSB 1UOHA 2LXLA 4HS2A 2H6GA 2AXUA 2YNQA 1E7VA 4CCAA 2P9UG 2UY1B 4OYSA 1H2UA 4D10C 5KJNA 3QWWA 3ZYMA 2PNNA 4OVUA 3VLDA 2UWJG 4CRWA 2XEHA 5ENOD 4GTOA 2Y0BG 4GTPA 4HFGA 2H6FA 5DBKA 3CVUA 2AW6A 3FU3A 4I1MA 3Q4AB 1TR4A 4AP2A 4UI9J 4HVBA 5ENPD 3AG3E 4ANVA 3L9TA 1NA0A 3JQ0A 3CEQA 5ARGA 4GZ5A 4HORA 4K0RA 3TWWA 5CHEE 2OCCE 3PE3A 1D9SA 2VSYA 3FH7A 2QZAA 3G2SA 3FULA 4HI9A 3D9LA 4MLPA 4G8KA 5AARA 5AENA 3ZU7B 3FTSA 1OY3D 2WXQA 2X3MA 4J8DA 3D9JA 2PL2A 4GMRA 2NC9A 4XI9A 4XKBA 2P9PG 4IULA 1INZA 3CVNA 3LY9A 4GZ3A 4UWKA 5FQ6A 4B89A 4XEIG 4N3BA 4JHRA 3AG4E 3B7UX 4QFVA 2IJGX 1YMPA 4JA7A 2WXOA 5B3SE 1E7UA 2XRZA 2FO7A 4NIKA 5BPPA 3O48A 3O4ZA 3ENEA 4CT0A 3ABLE 4GCNA 1N0RA 1YCSB 3VLFA 3RK6A 2M63A 3T8KA 2QC9A 3DEOA 4G26A 2P9KG 3PZ1A 4EECA 4DI3A 1SVXA 1K1AA 4GAAA 5T4YA 3X2QE 2LSVA 1O1TA 1O5MA 2IO3C 5CCLA 2JEKA 5AAOA 1G3NB 5D0QD 2J08A 4Q69A 3HHMA 1LTXA 5HRYA 1LF8A 3MV2B 2XS1A 3CHOA 3ZW3A 3NOGD 4M3OA 1BU9A 3E37A 2NSZA 4AXHA 1JWFA 3CKBA 3Q75A 2XS8A 3IHYA 3DSSA 3MV3B 4XIFA 3UX4A 3QK0A 4U04A 2WQ7A 3TWTA 5J08A 2R05A 5AQ9A 1N4RA 3JYSA 4EZKA 4TUUA 4HB5A 2F8XK 4Y6WA 1X81A 1N94A 4WNFA 4PS8A 4XX5A 2AXVA 4J8FA 1TEZA 4U8VD 4F1PA 2GRRB 1NFIE 1MHQA 4ANUA 2WB2A 1A5EA 2CG3A 5ENTD 3L54A 3FH8A 3Q73A 3DBSA 4YNDA 3R9MA 3LJNA 1S64A 4AVXA 1D8EA 3GZ2A 3UT7A 2IOLA 3FDHA 2KCKA 2FF4A 3ABME 4BEPA 5KNHD 2BKGA 2ZISA 2KCVA 3CVLA 1OWMA 3JXJA 3MKRA 4L2YA 2XGSA 2J09A 2WM9A 5KJMA 3L17A 3V31A 2FO1E 3ZGQA 1IXVA 5DIZA 3MZLB 4J7WA 3EHQA 3LKUA 3SBTB 3AJIA 4XZ4A 4KZ0A 1JCRA 3L08A 2QFCA 2GRPB 3NQPA 3SZ7A 4HOTA 3LVQE 1UJKA 2X6IA 3L22A 1OT8A 3LJ3A 3RJVA 1Z3XA 5FJYA 2DIWA 4BETA 2DBAA 3RU0A 4LCTA 3SFYA 1IQUA 4KZCA 2RG8A 3PS6A 3RRNB 4ANXA 4QQIA 1DCEA 2AJAA 3ZVVA 4XI0A 5G05C 1HF8A 2IQCA 4K5BA 2L6JA 3TXNA 3G2VA 2LUHA 2WQHA 4J8EA 4LEUA 5FIOA 3QAQA 1Z6TA 5HQ8A 5EYLA 4UWLA 4WUYA 3UM0A 3CKCA 4AV7A 3UINC 3CVVA 4RLYA 3QDNA 3UUXA 4O60A 4FADA 4ACLA 4N2QA 1KLXA 1HE8A 1TYQG 3QARA 3CK7A 2X38A 1H6KA 2J4BA 2XZTG 3L16A 4KVOA 3ASDA 4DK5A 1NI1A 2VSOE 3SD5A 3TWRA 3ULQA 4GYYA 3UQ3A 1OCRE 4HI8A 3AU5A 5ANLA 4TXPA 4FLBA 2WVIA 3TXMA 3CHRA 4JD2G 2I2OA 4RVBA 3CHQA 5JJ7A 4IRUA 3FEXA 3ZFWA 5FQ4A 2OEVA 4UUCA 2VYIA 2B6CA 4YDYA 4L2LA 2VTBA 1O1SA 4UI9K 5BV0A 2DYSE 5HKPA 3MYVA 3UPVA 1N9AA 1HZ4A 3ZHEB 3K9IA 4WWOA 4U63A 2XEEA 2VGEA 2V4HC 4I1AA 5LCWJ 2H6HA 4A1GA 4I1OB 1WDYA 3RKVA 4BT8A 4I17A 2CHXA 2E2EA 4B93B 4W9RA 3ZRHA 4GZDA 4HLLA 3D9NA 5LOZA 3RO2A 1DNPA 1TN8A 2YINA 5BXOA 4YDWA 2IF4A 3W9FA 1N4SA 4YVQC 2QYUA 3BUAA 2X6JA 3SY2A 3B7RL 3EHRA 3UI2A 3B7SA 3NZUA 1JCSA 3Q7AA 3KD7A 3DSXA 3L6AA 3P2BA 1OWPA 1XGWA 2C0MA 3DEPA 3TG5A 4K5AB 2GRQB 3GYZA 2OOEA 2JABA 5H7PA 5CERB 2HR2A 3NOCD 4FHKA 2L0TB 3MEKA 2WXIA 4CGVA 1D8DA 1UN8A 4DRXE 1N52A 4BFRA 3FH5A 5FQ7A 1UW4B 4U7EB 4KT6B 2KZTA 5FQ8A 1IKND 3BEEA 3GW4A 2XRYA 2WXNA 3FU5A 4P29A 4MS6A 3IXEA 2XCCA 4BX9A 5CMWA 4DJAA 3D9OA 3PNTB 3CHSA 4N39A 1OUVA 5EX3A 4HRLA 4BSXA 5BUZA 3FTWA 4HOUA 3B13A 3CV0A 5G04C 2Y4TA 2P58C 2IEJA 2XGMA 1N0QA 1YA0A 4UWGA 3NBNB 3CVQA 3PREA 4N5QA 2KCLA 3QOUA 2X6HA 5JA4D 2WXJA 3RSEG 3FY4A 3I4RB 2WXPA 1EDUA 3V2XA 2YQ8A 4U96D 3OXGA 1K8KG 5HS0A 3Q78A 4C9BB 5T3RA 1OWLA 1HG2A 4GTTA 2J9QA 2CFUA 3U4TA 3UM2A 5ITZF 3CHMA 5B1BE 5LFAA 3KEZA 3ASNE 4LG6A 4ATGA 4CYMD 2JLBA 4N3AA 3HYMB 5CMYA 5AJDA 3PZ3A 2P2CP 1TJFA 5J90A 4C48B 2LXMA 2PM7A 3FTZA 2BKKB 4FULA 2ONDA 3DPDA 5EYPF 4O1OA 3V79K 2CHWA 1TNBA 4NACA 5CCMA 3N71A 1Y8MA 2EILE 3QB2A 4TXQA 1LD7A 1X5BA 3ZYQA 1ELKA 2LSUA 2NXPA 4FJZA 5AJLA 5EIDA 3HVEB 3L13A 3ONLA 4ZHBA 3Q9UC 3UKUG 2VSNA 4ILGA 4F53A 1ZU2A 5FZSA 4F1SA 4KYOB 4AEZC 1UG3A 4RQIA 3IHVA 4EHMA 4FP7A 4EZJA 1GW6A 1TJCA 4PH4B
chains in the Genus database with same CATH topology
3CVLA 3S7JA 1OWMA 1OWOA 2C2LA 3MKRA 4L2YA 3RRMB 2XGSA 2FULA 2J09A 2Q7FA 2WM9A 3B7TA 3L17A 5HI7A 5KJMA 4LRZA 4APFA 3MKQB 3QKYA 5FZRA 3ZGQA 3CSTA 1HH8A 2VGYA 4J0UA 5DIZA 4RG6A 3MZLB 5JHAA 3PUJA 5FZQA 3CQCB 3S7FA 4DI4A 4HOQA 4DLQA 3LKUA 3PRZA 3SBTB 4CGWA 4XZ4A 3Q5MA 4B8AA 4KZ0A 3PNLB 3Q47B 4I9CA 4JEUA 4EBAG 2I1JA 4URKA 1ELWA 3TJPA 2XPYA 3L08A 4J6IA 2QFCA 4KMOA 4JL0A 3NQPA 2XEVA 3SZ7A 4FA6A 5AIJA 4NQ0A 1U3CA 3FUKA 4CDRA 4HOTA 2WXGA 3EHNA 4GMLA 4J8SA 3ZN3A 1W3BA 4I2ZA 2KATA 4G1TA 3ZPJA 5E75A 3LVQE 1UJKA 3FUDA 3VTYA 2X6IA 2GRMA 3APCA 3D9MA 3L22A 4KXKB 3KS2A 2AWIA 3LJ3A 3I4GA 4GU5A 2XHEA 4G25A 3EJNA 5EX0A 4NURA 5M72A 2HO1A 3RJVA 3HVEA 2XCBA 3PZDA 3LXUX 2KZTB 1E8YA 1Z3XA 5FJYA 2DIWA 2V4LA 2DBAA 3RU0A 4LCTA 4E85A 4A1SA 3FP3A 2FI7A 4DPRA 4CEMA 1IQUA 4KZCA 2CHZA 2C0LA 4C0EA 3AU4A 3Q15A 3R7RA 2RG8A 3G2WA 3PS6A 3RRNB 4ANXA 4HLEA 1L5JA 4K03A 3AS8A 3PEVB 3IBEA 4XKCA 4MRUA 3FUEA 3LYAA 1E8WA 1WM5A 3APDA 2WXMA 4L23A 5LP0A 5BW8C 5C1DA 4RSYA 1FCHA 4I6GA 3LY7A 2L9BA 2CG2A 3ZVVA 4BTAA 4GYOA 3EIJA 2PQNA 5E76A 4JVSA 2WPVA 3QNKA 3U9WA 3IEGA 1IYGA 4XI0A 5AYWD 2Y3AA 5JJTA 2RD0A 1HF8A 2IQCA 2V0PA 5G05C 2L6JA 3CLJA 3G2VA 3TXNA 4Q94A 3VLEA 3MX3A 2WQHA 4J8EA 4LEUA 3WXXA 3QAQA 4AOFA 3TAXA 4HOSA 4ILIA 2R17C 3CK8A 3CK9A 1Z6TA 2IU1A 2J4DA 2WMNA 3UMVA 4FU3A 5HQ8A 1E8XA 5A23A 1UN9A 4UWLA 2MRIA 3I3NA 4RG9A 4WUYA 5LX8A 3VTXA 1QZ2A 4BT9A 4AV7A 2QY7A 3CKCA 4N2SA 3PEUB 3MJWA 3FU0A 3D9IA 4A3TA 2J49A 4DLOA 5T8IA 3CVVA 3QDNA 2WXHA 3ASGA 3FWVA 3LS8A 1E90A 3OXLA 3UUXA 1ELRA 4EQFA 3SGHA 4FADA 3U3WA 4ACLA 3CVPA 4CT4A 4N2QA 1KLXA 1HE8A 1UJJA 3QARA 3BG1B 4WNGA 3CK7A 2X38A 4F3VA 5KJKA 2WQ6A 3UT8A 3ASHA 3UT4A 4V3IA 1H6KA 2J4BA 3LVRE 4JXTA 3CSFA 2LAIA 5G05J 4BX8A 5KCMA 1HG5A 5JJ6A 3L16A 1Z3YA 4WWNA 3GZ1A 4I43A 1HXIA 2EQXA 3ASFA 4KVOA 3GZSA 3ZYKA 1FVFA 3RRUA 3ASDA 4DK5A 3ML9A 1E8ZA 2VSOE 3OTNA 3SD5A 3CR3A 5G04J 3S7DA 3ULQA 4GYYA 5C2YA 4U0ZA 4YVOA 3UQ3A 3BG0B 4F7AA 4IN3B 3AU5A 5ANLA 2DCPA 4JZYA 1MQSA 3FUIA 3SNXA 4FLBA 2WVIA 3TXMA 3CHRA 4PDXA 3EIQC 4UQZA 5FTPA 4CDNA 4RVBA 2I2OA 3CHQA 5JJ7A 4JW1A 1P5QA 4IRUA 4AIFA 4APOA 1PAQA 3FEXA 4TRQA 4ILHB 4IYPA 1PC2A 3ZFWA 2Y4UA 3SHFA 5FQ4A 4A3VA 4BTBA 2R59A 2GGFA 4G24A 1XNFA 2GW1A 2VYIA 2VTBA 4L2LA 1HFAA 1U3DA 2WXRA 4GA0A 4UI9K 3T5VA 5BV0A 5ANRA 3MYVA 3UPVA 3I5PA 4GMJA 1HZ4A 3ZEFA 3ZHEB 2I6HA 1JWGA 4GYWA 3K9IA 4WWOA 4U63A 2HYZA 3TL5A 2A5UA 4I9EA 4LERA 3FHEA 3D9PA 1H2VC 4WWPA 4PS7A 4LUNU 2A4ZA 2R5SA 4UI9C 4I1AA 1HO8A 1WY6A 1NZNA 3EHMA 5JHBA 5LCWJ 4OVVA 4JEHA 4JHJA 1EPUA 5FWQA 4HS2A 1JUQA 1IQRA 1H0AA 2AXUA 4A1GA 4I1OB 2YNQA 4UWFA 4JPSA 3RKVA 4BT8A 3JUIA 1E7VA 4Y6CA 4I17A 3PVLA 4CCAA 1H2TC 2XGOA 2CHXA 2UY1B 4OYSA 2E2EA 3QWPA 1H2UA 4W9RA 4D10C 3ZRHA 5KJNA 3QWWA 5G55A 3ZYMA 4OVUA 4GZDA 4GZ6A 4JA9A 3U64A 3VLDA 2UWJG 2MOWA 3RO3A 3D9NA 4CRWA 1Y6IA 5LOZA 3RO2A 3MCXA 1DNPA 4O6FA 4N5CA 1NA3A 2L0IA 2YINA 4HFGA 4U0UA 2IF4A 2VQ2A 5DBKA 3CVUA 2AW6A 1ZBPA 3FU3A 4I1MA 4YVQC 3Q4AB 3PUKA 4U0SA 4AP2A 4HXIA 2X6JA 3LY8A 4UI9J 3B7RL 3APFA 4HVBA 4ANVA 3B7SA 1S0PA 3SI5A 3NZUA 2IFUA 3JCKC 3KD7A 3L6AA 1NA0A 3P2BA 1JPLA 2BTDA 3JQ0A 1OWPA 1XGWA 2C0MA 3CEQA 5ARGA 2UY1A 4GZ5A 3IKOB 3TG5A 3GYZA 2ILRA 2OOEA 3SFZA 2YHEA 1WAO1 4K0RA 4HORA 2E0IA 2HR2A 5CHEE 4ACKA 3MKQA 3PE3A 4GA2A 3PDNA 4FHKA 2XQ0A 2L0TB 2WXFA 2FBNA 3MEKA 2WXIA 3FU6A 4PS3A 2VSYA 3FH7A 5A6CA 4B0ZA 5EDSA 4GCOA 5D0OD 4CGVA 3KAEA 1UN8A 2AVPA 3G2SA 4GB9A 4G2VA 3FUFA 1BPOA 3FULA 4EZLA 2LO6A 3D9LA 4MLPA 4UQXA 3HDXA 5AENA 4N3CA 5FT9A 1N52A 2IONA 4BFRA 1SQMA 3FTYA 3FH5A 4L1BA 4FHJA 3FTVA 4FLHA 3FTSA 4KBQA 2WXQA 5FQ7A 1UW4B 2X3MA 4I2WA 3EDTB 4J8DA 1PY1A 2LNIA 3D9JA 3QWVA 2KZTA 4KT6B 4UQYA 5FQ8A 2V8SE 2PL2A 1B89A 2NC9A 4XI9A 4ME2A 4XKBA 3BEEA 4B8CB 4IULA 3GW4A 5G2NA 1INZA 4UWHA 3CVNA 2XRYA 2WXNA 3PH0C 4U07A 3CVWA 3FU5A 4P29A 3LY9A 4GZ3A 4UWKA 5FQ6A 4B89A 3URZA 4MS6A 4WNDA 2XCCA 4BX9A 5CMWA 4N3BA 4JHRA 2I1KA 4DJAA 2VGXA 3D9OA 4I6JA 3PNTB 3CHSA 3B7UX 2HM8A 4QFVA 2IJGX 4N39A 4JA7A 2WXOA 4KVMA 3E4BA 4A55A 3MGBA 1E7UA 1OUVA 2OVFA 5EX3A 2XRZA 1IHGA 2FO7A 3G2UA 5BPPA 4H7YA 3O48A 3O4ZA 3CIAA 3T8MA 4BSXA 5BUZA 3ENEA 3NZSA 3FTWA 4Q96A 5ARFA 1SZAA 4CT0A 2XPIA 4HOUA 4ABNA 3B13A 2FEZA 4GCNA 3CV0A 3VLFA 3RK6A 5ENNA 5G04C 2M63A 4AY6A 2Y4TA 4G26A 3OXFA 3ZHEA 1DVPA 3ESLA 2P58C 4G23A 4B94A 1VDYA 2XGMA 3FUJA 3LDZA 4EECA 3P1UA 4DI3A 1YA0A 2LAHA 3ONKA 4GAAA 4UWGA 5T4YA 3CVQA 3PREA 2X6FA 2LSVA 2KCLA 4JC8A 4EBAA 3QOUA 2X6HA 4CDMA 4AM9A 3ML8A 1HU3A 2WXJA 2WMOA 3FEYA 3Q49B 2VGXB 2I9CA 3FY4A 4TV3A 3RIBA 3I4RB 5CCLA 2JEKA 2WXPA 1QNFA 1EDUA 3D3MA 2YQ8A 5D0QD 3R9AB 2J08A 3FUMA 4Q69A 3OXGA 4GPKA 3HHMA 2BUGA 3FUNA 4C9BB 3QC1A 5BV1A 1NP7A 3U66A 5T3RA 1OWLA 3CVYA 1HG2A 3FFLA 3R7QA 1LF8A 3S2AA 1A17A 3MV2B 3TGOA 2J9QA 2CFUA 3U4TA 3ZXSA 3CHMA 4AY5A 5LFAA 3KEZA 1SZ9A 3ZIMA 3CHOA 3ZW3A 4M3OA 4ATGA 3AS5A 3PE4A 2JLBA 1EF1C 4N3AA 2NSZA 2PZIA 3HYMB 1JWFA 4AXHA 3CKBA 2OV8A 5CMYA 2IOSA 4GA1A 5AJDA 1TJFA 2PM6A 3IHYA 4R7LA 5J90A 4MKTA 3IV0A 3MV3B 1FVHA 2PM7A 2CFZA 5EKQD 3FTZA 3FUHA 3OAWA 4C0MA 4FULA 2ONDA 4XIFA 2KM4A 3UX4A 3QK0A 3ZYLA 1E96B 4U04A 2WQ7A 2XPZA 2YHCA 5BNWA 2VJ8A 2J07A 2X6KA 4BWRA 3CQGB 5J08A 2WXKA 3DPDA 2OVBA 2CHWA 4NACA 5CCMA 3N71A 4FC8A 4E6HA 4EPZA 1OWNA 3JYSA 4WNEA 4EZKA 1Y8MA 4NRHB 4TUUA 3AS4A 3QB2A 3TG4A 5A7DB 1HX8A 2KC7A 1H19A 4Y6WA 3CVXA 2VTBB 1QQEA 4XE0A 4BY6A 4GZCA 5BT1A 3ESKA 4WNFA 2BF0X 1X5BA 2MHKA 4PS8A 3S7BA 3SF4A 3ZYQA 3C98A 4L7TA 4XX5A 2AXVA 3T5XA 3CGHA 1ELKA 2LSUA 4G11A 4J8FA 1TEZA 3CHPA 2NXPA 3HIZA 4FJZA 5AJLA 3D9KA 2ZU6B 3HVEB 5KJLA 1MHQA 4WAFA 3L13A 3MA5A 3ONLA 4AJWA 4JHKA 2PQRA 4PUCA 3LPZA 4ANUA 2WB2A 3FTXA 2VSNA 3QJZA 4ILGA 4H7XA 2CG3A 3G2TA 4U8HA 3L54A 4F53A 3FH8A 1ZU2A 3DBSA 4YNDA 5FZSA 2WXLA 1EYHA 3LCAA 4FJYA 4F1SA 3JQ1A 4KYOB 4AVXA 3GZ2A 1UG3A 3UT7A 4AEZC 4ANWA 2VSXE 1HS6A 3IHVA 2IOLA 1N54A 4FP7A 1KT0A 3FDHA 2KCKA 3NF1A 2FF4A 4EZJA 3FTUA 1GW6A 1TJCA 3LEWA 3SBSA 5LCWC 2GRLA 4PH4B 2AXZA 4I6EA 2V5FA 2KCVA 1KT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CVL A;  3S7J A;  3MKR A;  3U3W A;  2C2L A;  3CVP A;  3KD7 A;  1NA0 A;  1KLX A;  2XGS A;  2Q7F A;  3RIB A;  4WNG A;  5HI7 A;  3CK7 A;  5CCL A;  4F3V A;  5KJM A;  5KJK A;  3ASH A;  3QKY A;  5FZR A;  3ZGQ A;  2YQ8 A;  5BT1 A;  5D0Q D;  3R9A B;  1HH8 A;  2VGY A;  4J0U A;  5DIZ A;  2C0M A;  4RG6 A;  3CEQ A;  3OXG A;  5ARG A;  2UY1 A;  4GZ5 A;  5G05 J;  5JJ6 A;  3TG5 A;  4GPK A;  2BUG A;  3GYZ A;  3GZ1 A;  2OOE A;  1HXI A;  5FZQ A;  1WAO 1;  3ASF A;  3S7F A;  4HOR A;  4HOQ A;  3FFL A;  3ASD A;  2HR2 A;  5CHE E;  3LKU A;  1A17 A;  3MV2 B;  3URZ A;  4CGW A;  3TGO A;  2J9Q A;  3U4T A;  3PE3 A;  3Q5M A;  5G04 J;  4AY5 A;  3S7D A;  3ULQ A;  4GYY A;  4GA2 A;  2VGX B;  3Q47 B;  4I9C A;  3PDN A;  4U0Z A;  4YVO A;  1ELW A;  3UQ3 A;  2FBN A;  2QFC A;  1KT1 A;  3AS5 A;  3MEK A;  3PE4 A;  2VSY A;  2JLB A;  4IN3 B;  4N3A A;  5A6C A;  4GCO A;  5D0O D;  2PZI A;  4JL0 A;  3HYM B;  2XEV A;  3SZ7 A;  3CKB A;  4CGV A;  4NQ0 A;  3KAE A;  4GA1 A;  4CDR A;  2AVP A;  4HOT A;  4UQZ A;  4G2V A;  5FTP A;  3ZN3 A;  1IYG A;  3MV3 B;  1W3B A;  4I2Z A;  2KAT A;  4G1T A;  5EKQ D;  3ZPJ A;  5JJ7 A;  3VTY A;  4AIF A;  1P5Q A;  4APO A;  4UQX A;  4KXK B;  3KS2 A;  4N3C A;  5FT9 A;  2OND A;  4XIF A;  1PC2 A;  3ZFW A;  2Y4U A;  4BTB A;  4G25 A;  1E96 B;  4U04 A;  5EX0 A;  5M72 A;  2HO1 A;  3RJV A;  2YHC A;  4KBQ A;  5BNW A;  2XCB A;  4I2W A;  4G24 A;  1XNF A;  2GW1 A;  3EDT B;  2VYI A;  4J8D A;  4BWR A;  2LNI A;  3QWV A;  4UQY A;  5FJY A;  2DBA A;  3RU0 A;  4GA0 A;  4UI9 K;  2PL2 A;  5CCM A;  3N71 A;  4A1S A;  1B89 A;  2NC9 A;  3FP3 A;  4XI9 A;  3UPV A;  4ME2 A;  2FI7 A;  1HZ4 A;  3ZHE B;  3JYS A;  2I6H A;  3BEE A;  4WNE A;  1Y8M A;  4NRH B;  4GYW A;  3AS4 A;  3GW4 A;  3K9I A;  2HYZ A;  5A7D B;  3TG4 A;  2C0L A;  2KC7 A;  4I9E A;  3CVN A;  3Q15 A;  4Y6W A;  4U07 A;  3LY9 A;  4GZ3 A;  1QQE A;  3AS8 A;  2R5S A;  4UI9 C;  3ESK A;  3LYA A;  4I1A A;  4WNF A;  2MHK A;  1NZN A;  3S7B A;  3SF4 A;  1WM5 A;  4WND A;  5LCW J;  2XCC A;  4N3B A;  4JHR A;  4J8F A;  2LSU A;  2VGX A;  1FCH A;  5BW8 C;  5C1D A;  3LY7 A;  4BTA A;  4GYO A;  2PQN A;  3RKV A;  4N39 A;  4JA7 A;  4BT8 A;  4Y6C A;  3E4B A;  2WPV A;  4I17 A;  5KJL A;  1OUV A;  3IEG A;  3MA5 A;  2XGO A;  4XI0 A;  1IHG A;  5EX3 A;  2PQR A;  5AYW D;  2FO7 A;  5JJT A;  2UY1 B;  3LPZ A;  5G05 C;  2E2E A;  3QWP A;  2L6J A;  4H7Y A;  3O48 A;  2VSN A;  4W9R A;  5KJN A;  3QWW A;  4H7X A;  2WQH A;  4J8E A;  4GZ6 A;  4JA9 A;  1ZU2 A;  2XPI A;  4HOU A;  4LEU A;  2UWJ G;  4YND A;  5ARF A;  3WXX A;  3TAX A;  4ABN A;  2FEZ A;  3RO3 A;  4GCN A;  4HOS A;  3CV0 A;  3CK8 A;  5FZS A;  3CK9 A;  5G04 C;  3RO2 A;  5HQ8 A;  3LCA A;  4AY6 A;  2Y4T A;  4G26 A;  4O6F A;  4KYO B;  4N5C A;  1NA3 A;  3OXF A;  4RG9 A;  4WUY A;  2P58 C;  4G23 A;  3ZHE A;  3VTX A;  3GZ2 A;  4U0U A;  4B94 A;  2IF4 A;  2VQ2 A;  2XGM A;  1QZ2 A;  5DBK A;  4BT9 A;  4N2S A;  3CKC A;  1KT0 A;  1YA0 A;  1ZBP A;  2KCK A;  3NF1 A;  2FF4 A;  3Q4A B;  4YVQ C;  3CVQ A;  4U0S A;  4N2Q A;  1TJC A;  2LSV A;  3LY8 A;  2KCL A;  4UI9 J;  3QOU A;  5LCW C;  3QDN A;  4AM9 A;  3ASG A;  3FWV A;  3UUX A;  3OXL A;  4EQF A;  2V5F A;  1ELR A;  2KCV A;  3Q49 B;  2IFU A; 
#chains in the Genus database with same CATH topology
 3S7J A;  5HI7 A;  2F37 A;  3QKY A;  3CST A;  4J0U A;  1N4Q A;  5JHA A;  2EIJ E;  3PUJ A;  4DI4 A;  3PRZ A;  3C3Q A;  3J5Q B;  3DSW A;  3PNL B;  2ETA A;  2I1J A;  1ELW A;  3TJP A;  2XPY A;  2IY0 C;  4KMO A;  2BED A;  4JL0 A;  4FA6 A;  5AIJ A;  4NQ0 A;  1U3C A;  3SFX A;  4CDR A;  4GML A;  3ZN3 A;  1W3B A;  3ZPJ A;  3APC A;  3I4G A;  4NUR A;  5M72 A;  2HO1 A;  1E8Y A;  2ZGD A;  2V4L A;  4A1S A;  3FP3 A;  2ZGG A;  2FI7 A;  4C0E A;  2C0L A;  2A5E A;  4MRU A;  5LP0 A;  5KNG A;  4RSY A;  2CG2 A;  4BTA A;  5E76 A;  4GTS A;  2WPV A;  3UIO C;  3QNK A;  3U9W A;  2IO2 C;  2XEN A;  5JJT A;  4Q94 A;  3VLE A;  3MX3 A;  3WXX A;  3CK8 A;  1TNZ A;  3KSQ A;  3CK9 A;  2IU1 A;  4FU3 A;  3I3N A;  3E32 A;  3VTX A;  5CED B;  4N2S A;  3MJW A;  3FU0 A;  4CZ2 D;  2J49 A;  4DLO A;  3DSV A;  3ASG A;  3LS8 A;  3OXL A;  4CT4 A;  3HXE A;  3DXK G;  4DX5 D;  3UT4 A;  4V3I A;  2LAI A;  5KCM A;  3GZ1 A;  2EQX A;  3GZS A;  3ZYK A;  1FVF A;  3RRU A;  4A63 B;  5AQB A;  3ZXP A;  2DZO A;  3CR3 A;  1DC2 A;  1MX6 A;  1QYM A;  4YVO A;  1N11 A;  3E30 A;  5FTP A;  1NL4 A;  4CDN A;  5CRU A;  4AIF A;  1P5Q A;  4G8L A;  4APO A;  3ISM C;  3Q9N C;  1XNF A;  2GW1 A;  3T5V A;  3I5P A;  2I6H A;  1RW2 A;  1JWG A;  3TL5 A;  3AG2 E;  3D9P A;  4PS7 A;  3ZUV B;  1HO8 A;  3EHM A;  4OVV A;  1EPU A;  1JUQ A;  1H0A A;  2GRO B;  4UWF A;  4JPS A;  4Y6C A;  3RAU A;  2XGO A;  3QWP A;  4GTR A;  4U95 D;  4GZ6 A;  4JA9 A;  1AWC B;  4O6F A;  4N5C A;  4U0U A;  2DWZ A;  2RFM A;  4ATZ D;  3JUE A;  2GRN B;  4U0S A;  4HXI A;  1S0P A;  3SI5 A;  2IFU A;  3JCK C;  2BTD A;  3PZ4 A;  4LNB A;  4TUM A;  3DPY A;  3DRA A;  3AG1 E;  3IKO B;  3SFZ A;  2NYJ A;  2E0I A;  4HRM B;  4ACK A;  3MKQ A;  3UM3 A;  2KXP C;  2XQ0 A;  2WXF A;  1BLX B;  3FU6 A;  4PS3 A;  5EDS A;  4GCO A;  5D0O D;  3C72 A;  2AVP A;  4GB9 A;  4DX1 A;  3FUF A;  5EIL A;  1BPO A;  4EZL A;  5FT9 A;  2ION A;  3FTY A;  3FTV A;  2DYR E;  4I2W A;  3EDT B;  1MJ0 A;  1PY1 A;  2V8S E;  4K5C A;  4UWH A;  3PH0 C;  3CVW A;  3HXD A;  4DX7 D;  3BQO A;  3BU8 A;  2VGX A;  2HM8 A;  5CRV A;  4KVM A;  1TNU A;  3E4B A;  3MGB A;  2EIN E;  1IHG A;  3NZS A;  1SZA A;  2XPI A;  4ABN A;  1OCC E;  5ENN A;  4U8Y D;  1SA5 A;  4AY6 A;  1JCQ A;  3OXF A;  4B94 A;  1DVP A;  4G23 A;  3LDZ A;  4JC8 A;  4CDM A;  1FPP A;  3Q49 B;  2I9C A;  4TV3 A;  3E33 A;  4OAU C;  1QNF A;  1S63 A;  3D3M A;  4BER A;  3FUM A;  4HNA D;  3FUN A;  5BV1 A;  1NP7 A;  3U66 A;  3FFL A;  3R7Q A;  3ZXS A;  1SZ9 A;  1KZO A;  3AS5 A;  3PE4 A;  1EF1 C;  2ZXW E;  2IOS A;  4MKT A;  1BD8 A;  3IV0 A;  5EKQ D;  2F0Y A;  1MX2 A;  3EU9 A;  3ZYL A;  3B7B A;  2X6K A;  3CQG B;  5FIN A;  2WXK A;  2OVB A;  3HXF A;  4FC8 A;  4EPZ A;  1OWN A;  4NRH B;  3AS4 A;  3TG4 A;  5A7D B;  4YDE A;  1H19 A;  3UKR G;  2VTB B;  4XE0 A;  4BY6 A;  5BT1 A;  3S7B A;  1SA4 A;  3SF4 A;  2P9L G;  3C98 A;  4L7T A;  3T5X A;  4G11 A;  1BI8 B;  3D9K A;  2ZU6 B;  5KJL A;  2H6I A;  3MA5 A;  4JHK A;  2PQR A;  4HBD A;  4PUC A;  3LPZ A;  3JXI A;  1YYH A;  3AAA C;  2WXL A;  1EYH A;  3JQ1 A;  4MBG A;  5CEA A;  4ANW A;  1HS6 A;  1KT0 A;  3NF1 A;  2ETB A;  3UM1 A;  3FTU A;  3LEW A;  3SBS A;  2MYO A;  5LCW C;  5KBA A;  2V5F A;  1OWO A;  3RRM B;  3HG0 D;  4LRZ A;  4APF A;  2RKK A;  2RFA A;  4DUI A;  5FZR A;  1V54 E;  4LSZ E;  4RG6 A;  3CQC B;  3S7F A;  3DWL G;  1H6O A;  4YDO A;  4B8A A;  1SW6 A;  4I9C A;  4EBA G;  3TWU A;  2R02 A;  3UIP C;  3EHN A;  3J5P A;  2KAT A;  4G1T A;  1TNO A;  5E75 A;  3VTY A;  5EN5 D;  2GRM A;  5AQ7 A;  3D9M A;  4KXK B;  3KS2 A;  4GU5 A;  4G25 A;  2XCB A;  3PZD A;  3LXU X;  2KZT B;  5JMN D;  4E85 A;  4BES A;  4GTQ A;  3AU4 A;  3F6Q A;  3PEV B;  1TN6 A;  3IBE A;  4XKC A;  3FUE A;  3LYA A;  5CBO A;  1MZC A;  1E8W A;  3APD A;  1DCQ A;  3ZNG A;  5C1D A;  1FCH A;  4JB8 P;  4I6G A;  3LY7 A;  2L9B A;  4GYO A;  2PQN A;  4JVS A;  4HRN A;  2RD0 A;  3CLJ A;  4AOF A;  4HOS A;  4ILI A;  4HQD A;  2J4D A;  1E8X A;  1UN9 A;  4RG9 A;  5LX8 A;  3D9H A;  1QZ2 A;  4BT9 A;  2QY7 A;  1N95 A;  3ASO E;  2WXH A;  3DSU A;  1ELR A;  3B95 A;  3SGH A;  3U3W A;  1UJJ A;  2WQ6 A;  3BG1 B;  4WNG A;  5KJK A;  3W9G A;  4JXT A;  5G05 J;  4BX8 A;  1Z3Y A;  1HXI A;  3EU5 A;  5ENQ D;  4M7C A;  1E8Z A;  3OTN A;  5KWD A;  5G04 J;  1FT2 A;  3S7D A;  5C2Y A;  2Y1L E;  1RZ4 A;  1MQS A;  3FUI A;  3EIQ C;  4UQZ A;  1FT1 A;  3HRA A;  1BI7 B;  4JW1 A;  3HXB A;  1PAQ A;  5ENS D;  4TRQ A;  4ILH B;  4IYP A;  1PC2 A;  4A3V A;  2Y4U A;  4G24 A;  3SQV A;  1HFA A;  2L6B A;  3EUV A;  1U3D A;  2WXR A;  4GA0 A;  3ZEF A;  4GYW A;  2HYZ A;  2A5U A;  4LER A;  2P9N G;  1OXJ A;  2A4Z A;  2R5S A;  4O1P A;  1WY6 A;  5JHB A;  4JEH A;  4JHJ A;  5FWQ A;  1IQR A;  3JUI A;  3C3R A;  3PVL A;  3SO8 A;  2V5Q C;  1H2T C;  5G55 A;  3E34 A;  2B0O E;  3TWQ A;  3U64 A;  2MOW A;  3RO3 A;  1Y6I A;  3MCX A;  3TWV A;  1NA3 A;  2L0I A;  2ETC A;  3TWS A;  2J8S D;  2VQ2 A;  1ZBP A;  3PUK A;  3LY8 A;  3APF A;  4GPM A;  1IHB A;  2F8Y A;  1JPL A;  5AN8 A;  4X8Q A;  3UXG A;  3C3O A;  4J8Y A;  3KEA A;  2UY1 A;  5B1A E;  2ILR A;  2YHE A;  1WAO 1;  2ZIR A;  2DVW A;  3KSL A;  4GA2 A;  3PDN A;  2FBN A;  5A6C A;  4B0Z A;  3UTM A;  3KAE A;  4G2V A;  2LO6 A;  4UQX A;  3HDX A;  4N3C A;  1SQM A;  4L1B A;  4FHJ A;  1MX4 A;  4FLH A;  3TWX A;  3HXC A;  5BXU A;  4KBQ A;  4OAV B;  5IY5 E;  5EIB E;  2LNI A;  3QWV A;  4UQY A;  3DST A;  1K1B A;  1B89 A;  4ME2 A;  4B8C B;  5G2N A;  4DX6 D;  4U07 A;  3URZ A;  4WND A;  2I1K A;  4I6J A;  1ZB1 A;  2EIK E;  5CEC B;  4L9P A;  4A55 A;  2OVF A;  3G2U A;  5AQA A;  4H7Y A;  3T8M A;  3CIA A;  4Q96 A;  5ARF A;  2FEZ A;  3V30 A;  1OCO E;  3ZHE A;  3ESL A;  1VDY A;  3FUJ A;  3P1U A;  1S70 B;  2LAH A;  3ONK A;  2X6F A;  4EBA A;  4AM9 A;  3ML8 A;  1HU3 A;  2WMO A;  3FEY A;  2VGX B;  2P9S G;  2R03 A;  3RIB A;  5CBN A;  3C5R A;  3R9A B;  4GPK A;  4F6R D;  2BUG A;  4LNG A;  3QC1 A;  3CVY A;  2QYJ A;  3S2A A;  1A17 A;  1TNY A;  3TGO A;  4AY5 A;  1MYO A;  1Z5S C;  3ZIM A;  2DZN A;  2PZI A;  2OV8 A;  4GA1 A;  2PM6 A;  4R7L A;  1FVH A;  2CFZ A;  3FUH A;  3OAW A;  4TXR A;  4C0M A;  2KM4 A;  1E96 B;  2XPZ A;  2YHC A;  5BNW A;  2VJ8 A;  2J07 A;  4BWR A;  1TN7 A;  4E6H A;  4WNE A;  1HX8 A;  2KC7 A;  3V2O A;  3CVX A;  1QQE A;  4DX2 A;  4GZC A;  3ESK A;  2BF0 X;  2MHK A;  2OEW A;  3CGH A;  1U2V G;  3CHP A;  3HIZ A;  4WAF A;  2XZD G;  4AJW A;  3FTX A;  3Q7F A;  3QJZ A;  4H7X A;  3G2T A;  4U8H A;  4Z68 A;  4BSZ B;  3LCA A;  4FJY A;  4ZFH A;  2VSX E;  1N54 A;  2GRL A;  2AXZ A;  4I6E A;  3Q79 A;  1KT1 A;  2C2L A;  2FUL A;  2Q7F A;  3B7T A;  2R2L A;  3MKQ B;  1HH8 A;  2VGY A;  5FZQ A;  4HOQ A;  4DLQ A;  4CGW A;  3Q5M A;  3Q47 B;  4JEU A;  4URK A;  4J6I A;  3ULY A;  2XEV A;  3FUK A;  2WXG A;  4J8S A;  4I2Z A;  3FUD A;  2AWI A;  3NAW A;  2XHE A;  3EJN A;  5EX0 A;  3HVE A;  3ULE G;  1N4P A;  4DPR A;  4CEM A;  2CHZ A;  1V55 E;  1O1R A;  3Q15 A;  3R7R A;  3G2W A;  4HLE A;  5D66 A;  1L5J A;  4K03 A;  3AS8 A;  2Y69 E;  1OCZ E;  1WM5 A;  2WXM A;  4L23 A;  5BW8 C;  3EIJ A;  1LD8 A;  2KBX A;  3IEG A;  1IYG A;  5AYW D;  3T9K A;  2Y3A A;  4GTV A;  2V0P A;  4GTM A;  1AP7 A;  3TAX A;  2R17 C;  3UMV A;  1KZP A;  2WMN A;  5A23 A;  2P9I G;  2MRI A;  3PEU B;  3D9I A;  4A3T A;  5T8I A;  3ABK E;  3NB2 A;  3FWV A;  4EQF A;  1E90 A;  3PZ2 A;  1K3Z D;  3CVP A;  4F3V A;  1QBQ A;  3UT8 A;  3ASH A;  3LVR E;  3L82 A;  3CSF A;  1HG5 A;  5JJ6 A;  4WWN A;  4I43 A;  3ASF A;  1Q2Z A;  3ML9 A;  5D2M C;  2EIM E;  4U0Z A;  4LNU D;  1WG0 A;  3WG7 E;  3BG0 B;  4F7A A;  4IN3 B;  1H6P A;  2DCP A;  4JZY A;  3SNX A;  4PDX A;  3DXM G;  3SHF A;  4BTB A;  2R59 A;  5ENR D;  2GGF A;  3ZKJ A;  2HE0 A;  5ANR A;  4GMJ A;  4I9E A;  3FHE A;  1H2V C;  4WWP A;  4LUN U;  4UI9 C;  1NZN A;  1KPS B;  1UOH A;  2LXL A;  4HS2 A;  2H6G A;  2AXU A;  2YNQ A;  1E7V A;  4CCA A;  2P9U G;  2UY1 B;  4OYS A;  1H2U A;  4D10 C;  5KJN A;  3QWW A;  3ZYM A;  2PNN A;  4OVU A;  3VLD A;  2UWJ G;  4CRW A;  2XEH A;  5ENO D;  4GTO A;  2Y0B G;  4GTP A;  4HFG A;  2H6F A;  5DBK A;  3CVU A;  2AW6 A;  3FU3 A;  4I1M A;  3Q4A B;  1TR4 A;  4AP2 A;  4UI9 J;  4HVB A;  5ENP D;  3AG3 E;  4ANV A;  3L9T A;  1NA0 A;  3JQ0 A;  3CEQ A;  5ARG A;  4GZ5 A;  4HOR A;  4K0R A;  3TWW A;  5CHE E;  2OCC E;  3PE3 A;  1D9S A;  2VSY A;  3FH7 A;  2QZA A;  3G2S A;  3FUL A;  4HI9 A;  3D9L A;  4MLP A;  4G8K A;  5AAR A;  5AEN A;  3ZU7 B;  3FTS A;  1OY3 D;  2WXQ A;  2X3M A;  4J8D A;  3D9J A;  2PL2 A;  4GMR A;  2NC9 A;  4XI9 A;  4XKB A;  2P9P G;  4IUL A;  1INZ A;  3CVN A;  3LY9 A;  4GZ3 A;  4UWK A;  5FQ6 A;  4B89 A;  4XEI G;  4N3B A;  4JHR A;  3AG4 E;  3B7U X;  4QFV A;  2IJG X;  1YMP A;  4JA7 A;  2WXO A;  5B3S E;  1E7U A;  2XRZ A;  2FO7 A;  4NIK A;  5BPP A;  3O48 A;  3O4Z A;  3ENE A;  4CT0 A;  3ABL E;  4GCN A;  1N0R A;  1YCS B;  3VLF A;  3RK6 A;  2M63 A;  3T8K A;  2QC9 A;  3DEO A;  4G26 A;  2P9K G;  3PZ1 A;  4EEC A;  4DI3 A;  1SVX A;  1K1A A;  4GAA A;  5T4Y A;  3X2Q E;  2LSV A;  1O1T A;  1O5M A;  2IO3 C;  5CCL A;  2JEK A;  5AAO A;  1G3N B;  5D0Q D;  2J08 A;  4Q69 A;  3HHM A;  1LTX A;  5HRY A;  1LF8 A;  3MV2 B;  2XS1 A;  3CHO A;  3ZW3 A;  3NOG D;  4M3O A;  1BU9 A;  3E37 A;  2NSZ A;  4AXH A;  1JWF A;  3CKB A;  3Q75 A;  2XS8 A;  3IHY A;  3DSS A;  3MV3 B;  4XIF A;  3UX4 A;  3QK0 A;  4U04 A;  2WQ7 A;  3TWT A;  5J08 A;  2R05 A;  5AQ9 A;  1N4R A;  3JYS A;  4EZK A;  4TUU A;  4HB5 A;  2F8X K;  4Y6W A;  1X81 A;  1N94 A;  4WNF A;  4PS8 A;  4XX5 A;  2AXV A;  4J8F A;  1TEZ A;  4U8V D;  4F1P A;  2GRR B;  1NFI E;  1MHQ A;  4ANU A;  2WB2 A;  1A5E A;  2CG3 A;  5ENT D;  3L54 A;  3FH8 A;  3Q73 A;  3DBS A;  4YND A;  3R9M A;  3LJN A;  1S64 A;  4AVX A;  1D8E A;  3GZ2 A;  3UT7 A;  2IOL A;  3FDH A;  2KCK A;  2FF4 A;  3ABM E;  4BEP A;  5KNH D;  2BKG A;  2ZIS A;  2KCV A;  3CVL A;  1OWM A;  3JXJ A;  3MKR A;  4L2Y A;  2XGS A;  2J09 A;  2WM9 A;  5KJM A;  3L17 A;  3V31 A;  2FO1 E;  3ZGQ A;  1IXV A;  5DIZ A;  3MZL B;  4J7W A;  3EHQ A;  3LKU A;  3SBT B;  3AJI A;  4XZ4 A;  4KZ0 A;  1JCR A;  3L08 A;  2QFC A;  2GRP B;  3NQP A;  3SZ7 A;  4HOT A;  3LVQ E;  1UJK A;  2X6I A;  3L22 A;  1OT8 A;  3LJ3 A;  3RJV A;  1Z3X A;  5FJY A;  2DIW A;  4BET A;  2DBA A;  3RU0 A;  4LCT A;  3SFY A;  1IQU A;  4KZC A;  2RG8 A;  3PS6 A;  3RRN B;  4ANX A;  4QQI A;  1DCE A;  2AJA A;  3ZVV A;  4XI0 A;  5G05 C;  1HF8 A;  2IQC A;  4K5B A;  2L6J A;  3TXN A;  3G2V A;  2LUH A;  2WQH A;  4J8E A;  4LEU A;  5FIO A;  3QAQ A;  1Z6T A;  5HQ8 A;  5EYL A;  4UWL A;  4WUY A;  3UM0 A;  3CKC A;  4AV7 A;  3UIN C;  3CVV A;  4RLY A;  3QDN A;  3UUX A;  4O60 A;  4FAD A;  4ACL A;  4N2Q A;  1KLX A;  1HE8 A;  1TYQ G;  3QAR A;  3CK7 A;  2X38 A;  1H6K A;  2J4B A;  2XZT G;  3L16 A;  4KVO A;  3ASD A;  4DK5 A;  1NI1 A;  2VSO E;  3SD5 A;  3TWR A;  3ULQ A;  4GYY A;  3UQ3 A;  1OCR E;  4HI8 A;  3AU5 A;  5ANL A;  4TXP A;  4FLB A;  2WVI A;  3TXM A;  3CHR A;  4JD2 G;  2I2O A;  4RVB A;  3CHQ A;  5JJ7 A;  4IRU A;  3FEX A;  3ZFW A;  5FQ4 A;  2OEV A;  4UUC A;  2VYI A;  2B6C A;  4YDY A;  4L2L A;  2VTB A;  1O1S A;  4UI9 K;  5BV0 A;  2DYS E;  5HKP A;  3MYV A;  3UPV A;  1N9A A;  1HZ4 A;  3ZHE B;  3K9I A;  4WWO A;  4U63 A;  2XEE A;  2VGE A;  2V4H C;  4I1A A;  5LCW J;  2H6H A;  4A1G A;  4I1O B;  1WDY A;  3RKV A;  4BT8 A;  4I17 A;  2CHX A;  2E2E A;  4B93 B;  4W9R A;  3ZRH A;  4GZD A;  4HLL A;  3D9N A;  5LOZ A;  3RO2 A;  1DNP A;  1TN8 A;  2YIN A;  5BXO A;  4YDW A;  2IF4 A;  3W9F A;  1N4S A;  4YVQ C;  2QYU A;  3BUA A;  2X6J A;  3SY2 A;  3B7R L;  3EHR A;  3UI2 A;  3B7S A;  3NZU A;  1JCS A;  3Q7A A;  3KD7 A;  3DSX A;  3L6A A;  3P2B A;  1OWP A;  1XGW A;  2C0M A;  3DEP A;  3TG5 A;  4K5A B;  2GRQ B;  3GYZ A;  2OOE A;  2JAB A;  5H7P A;  5CER B;  2HR2 A;  3NOC D;  4FHK A;  2L0T B;  3MEK A;  2WXI A;  4CGV A;  1D8D A;  1UN8 A;  4DRX E;  1N52 A;  4BFR A;  3FH5 A;  5FQ7 A;  1UW4 B;  4U7E B;  4KT6 B;  2KZT A;  5FQ8 A;  1IKN D;  3BEE A;  3GW4 A;  2XRY A;  2WXN A;  3FU5 A;  4P29 A;  4MS6 A;  3IXE A;  2XCC A;  4BX9 A;  5CMW A;  4DJA A;  3D9O A;  3PNT B;  3CHS A;  4N39 A;  1OUV A;  5EX3 A;  4HRL A;  4BSX A;  5BUZ A;  3FTW A;  4HOU A;  3B13 A;  3CV0 A;  5G04 C;  2Y4T A;  2P58 C;  2IEJ A;  2XGM A;  1N0Q A;  1YA0 A;  4UWG A;  3NBN B;  3CVQ A;  3PRE A;  4N5Q A;  2KCL A;  3QOU A;  2X6H A;  5JA4 D;  2WXJ A;  3RSE G;  3FY4 A;  3I4R B;  2WXP A;  1EDU A;  3V2X A;  2YQ8 A;  4U96 D;  3OXG A;  1K8K G;  5HS0 A;  3Q78 A;  4C9B B;  5T3R A;  1OWL A;  1HG2 A;  4GTT A;  2J9Q A;  2CFU A;  3U4T A;  3UM2 A;  5ITZ F;  3CHM A;  5B1B E;  5LFA A;  3KEZ A;  3ASN E;  4LG6 A;  4ATG A;  4CYM D;  2JLB A;  4N3A A;  3HYM B;  5CMY A;  5AJD A;  3PZ3 A;  2P2C P;  1TJF A;  5J90 A;  4C48 B;  2LXM A;  2PM7 A;  3FTZ A;  2BKK B;  4FUL A;  2OND A;  3DPD A;  5EYP F;  4O1O A;  3V79 K;  2CHW A;  1TNB A;  4NAC A;  5CCM A;  3N71 A;  1Y8M A;  2EIL E;  3QB2 A;  4TXQ A;  1LD7 A;  1X5B A;  3ZYQ A;  1ELK A;  2LSU A;  2NXP A;  4FJZ A;  5AJL A;  5EID A;  3HVE B;  3L13 A;  3ONL A;  4ZHB A;  3Q9U C;  3UKU G;  2VSN A;  4ILG A;  4F53 A;  1ZU2 A;  5FZS A;  4F1S A;  4KYO B;  4AEZ C;  1UG3 A;  4RQI A;  3IHV A;  4EHM A;  4FP7 A;  4EZJ A;  1GW6 A;  1TJC A;  4PH4 B; 
#chains in the Genus database with same CATH homology
 3CVL A;  3S7J A;  1OWM A;  1OWO A;  2C2L A;  3MKR A;  4L2Y A;  3RRM B;  2XGS A;  2FUL A;  2J09 A;  2Q7F A;  2WM9 A;  3B7T A;  3L17 A;  5HI7 A;  5KJM A;  4LRZ A;  4APF A;  3MKQ B;  3QKY A;  5FZR A;  3ZGQ A;  3CST A;  1HH8 A;  2VGY A;  4J0U A;  5DIZ A;  4RG6 A;  3MZL B;  5JHA A;  3PUJ A;  5FZQ A;  3CQC B;  3S7F A;  4DI4 A;  4HOQ A;  4DLQ A;  3LKU A;  3PRZ A;  3SBT B;  4CGW A;  4XZ4 A;  3Q5M A;  4B8A A;  4KZ0 A;  3PNL B;  3Q47 B;  4I9C A;  4JEU A;  4EBA G;  2I1J A;  4URK A;  1ELW A;  3TJP A;  2XPY A;  3L08 A;  4J6I A;  2QFC A;  4KMO A;  4JL0 A;  3NQP A;  2XEV A;  3SZ7 A;  4FA6 A;  5AIJ A;  4NQ0 A;  1U3C A;  3FUK A;  4CDR A;  4HOT A;  2WXG A;  3EHN A;  4GML A;  4J8S A;  3ZN3 A;  1W3B A;  4I2Z A;  2KAT A;  4G1T A;  3ZPJ A;  5E75 A;  3LVQ E;  1UJK A;  3FUD A;  3VTY A;  2X6I A;  2GRM A;  3APC A;  3D9M A;  3L22 A;  4KXK B;  3KS2 A;  2AWI A;  3LJ3 A;  3I4G A;  4GU5 A;  2XHE A;  4G25 A;  3EJN A;  5EX0 A;  4NUR A;  5M72 A;  2HO1 A;  3RJV A;  3HVE A;  2XCB A;  3PZD A;  3LXU X;  2KZT B;  1E8Y A;  1Z3X A;  5FJY A;  2DIW A;  2V4L A;  2DBA A;  3RU0 A;  4LCT A;  4E85 A;  4A1S A;  3FP3 A;  2FI7 A;  4DPR A;  4CEM A;  1IQU A;  4KZC A;  2CHZ A;  2C0L A;  4C0E A;  3AU4 A;  3Q15 A;  3R7R A;  2RG8 A;  3G2W A;  3PS6 A;  3RRN B;  4ANX A;  4HLE A;  1L5J A;  4K03 A;  3AS8 A;  3PEV B;  3IBE A;  4XKC A;  4MRU A;  3FUE A;  3LYA A;  1E8W A;  1WM5 A;  3APD A;  2WXM A;  4L23 A;  5LP0 A;  5BW8 C;  5C1D A;  4RSY A;  1FCH A;  4I6G A;  3LY7 A;  2L9B A;  2CG2 A;  3ZVV A;  4BTA A;  4GYO A;  3EIJ A;  2PQN A;  5E76 A;  4JVS A;  2WPV A;  3QNK A;  3U9W A;  3IEG A;  1IYG A;  4XI0 A;  5AYW D;  2Y3A A;  5JJT A;  2RD0 A;  1HF8 A;  2IQC A;  2V0P A;  5G05 C;  2L6J A;  3CLJ A;  3G2V A;  3TXN A;  4Q94 A;  3VLE A;  3MX3 A;  2WQH A;  4J8E A;  4LEU A;  3WXX A;  3QAQ A;  4AOF A;  3TAX A;  4HOS A;  4ILI A;  2R17 C;  3CK8 A;  3CK9 A;  1Z6T A;  2IU1 A;  2J4D A;  2WMN A;  3UMV A;  4FU3 A;  5HQ8 A;  1E8X A;  5A23 A;  1UN9 A;  4UWL A;  2MRI A;  3I3N A;  4RG9 A;  4WUY A;  5LX8 A;  3VTX A;  1QZ2 A;  4BT9 A;  4AV7 A;  2QY7 A;  3CKC A;  4N2S A;  3PEU B;  3MJW A;  3FU0 A;  3D9I A;  4A3T A;  2J49 A;  4DLO A;  5T8I A;  3CVV A;  3QDN A;  2WXH A;  3ASG A;  3FWV A;  3LS8 A;  1E90 A;  3OXL A;  3UUX A;  1ELR A;  4EQF A;  3SGH A;  4FAD A;  3U3W A;  4ACL A;  3CVP A;  4CT4 A;  4N2Q A;  1KLX A;  1HE8 A;  1UJJ A;  3QAR A;  3BG1 B;  4WNG A;  3CK7 A;  2X38 A;  4F3V A;  5KJK A;  2WQ6 A;  3UT8 A;  3ASH A;  3UT4 A;  4V3I A;  1H6K A;  2J4B A;  3LVR E;  4JXT A;  3CSF A;  2LAI A;  5G05 J;  4BX8 A;  5KCM A;  1HG5 A;  5JJ6 A;  3L16 A;  1Z3Y A;  4WWN A;  3GZ1 A;  4I43 A;  1HXI A;  2EQX A;  3ASF A;  4KVO A;  3GZS A;  3ZYK A;  1FVF A;  3RRU A;  3ASD A;  4DK5 A;  3ML9 A;  1E8Z A;  2VSO E;  3OTN A;  3SD5 A;  3CR3 A;  5G04 J;  3S7D A;  3ULQ A;  4GYY A;  5C2Y A;  4U0Z A;  4YVO A;  3UQ3 A;  3BG0 B;  4F7A A;  4IN3 B;  3AU5 A;  5ANL A;  2DCP A;  4JZY A;  1MQS A;  3FUI A;  3SNX A;  4FLB A;  2WVI A;  3TXM A;  3CHR A;  4PDX A;  3EIQ C;  4UQZ A;  5FTP A;  4CDN A;  4RVB A;  2I2O A;  3CHQ A;  5JJ7 A;  4JW1 A;  1P5Q A;  4IRU A;  4AIF A;  4APO A;  1PAQ A;  3FEX A;  4TRQ A;  4ILH B;  4IYP A;  1PC2 A;  3ZFW A;  2Y4U A;  3SHF A;  5FQ4 A;  4A3V A;  4BTB A;  2R59 A;  2GGF A;  4G24 A;  1XNF A;  2GW1 A;  2VYI A;  2VTB A;  4L2L A;  1HFA A;  1U3D A;  2WXR A;  4GA0 A;  4UI9 K;  3T5V A;  5BV0 A;  5ANR A;  3MYV A;  3UPV A;  3I5P A;  4GMJ A;  1HZ4 A;  3ZEF A;  3ZHE B;  2I6H A;  1JWG A;  4GYW A;  3K9I A;  4WWO A;  4U63 A;  2HYZ A;  3TL5 A;  2A5U A;  4I9E A;  4LER A;  3FHE A;  3D9P A;  1H2V C;  4WWP A;  4PS7 A;  4LUN U;  2A4Z A;  2R5S A;  4UI9 C;  4I1A A;  1HO8 A;  1WY6 A;  1NZN A;  3EHM A;  5JHB A;  5LCW J;  4OVV A;  4JEH A;  4JHJ A;  1EPU A;  5FWQ A;  4HS2 A;  1JUQ A;  1IQR A;  1H0A A;  2AXU A;  4A1G A;  4I1O B;  2YNQ A;  4UWF A;  4JPS A;  3RKV A;  4BT8 A;  3JUI A;  1E7V A;  4Y6C A;  4I17 A;  3PVL A;  4CCA A;  1H2T C;  2XGO A;  2CHX A;  2UY1 B;  4OYS A;  2E2E A;  3QWP A;  1H2U A;  4W9R A;  4D10 C;  3ZRH A;  5KJN A;  3QWW A;  5G55 A;  3ZYM A;  4OVU A;  4GZD A;  4GZ6 A;  4JA9 A;  3U64 A;  3VLD A;  2UWJ G;  2MOW A;  3RO3 A;  3D9N A;  4CRW A;  1Y6I A;  5LOZ A;  3RO2 A;  3MCX A;  1DNP A;  4O6F A;  4N5C A;  1NA3 A;  2L0I A;  2YIN A;  4HFG A;  4U0U A;  2IF4 A;  2VQ2 A;  5DBK A;  3CVU A;  2AW6 A;  1ZBP A;  3FU3 A;  4I1M A;  4YVQ C;  3Q4A B;  3PUK A;  4U0S A;  4AP2 A;  4HXI A;  2X6J A;  3LY8 A;  4UI9 J;  3B7R L;  3APF A;  4HVB A;  4ANV A;  3B7S A;  1S0P A;  3SI5 A;  3NZU A;  2IFU A;  3JCK C;  3KD7 A;  3L6A A;  1NA0 A;  3P2B A;  1JPL A;  2BTD A;  3JQ0 A;  1OWP A;  1XGW A;  2C0M A;  3CEQ A;  5ARG A;  2UY1 A;  4GZ5 A;  3IKO B;  3TG5 A;  3GYZ A;  2ILR A;  2OOE A;  3SFZ A;  2YHE A;  1WAO 1;  4K0R A;  4HOR A;  2E0I A;  2HR2 A;  5CHE E;  4ACK A;  3MKQ A;  3PE3 A;  4GA2 A;  3PDN A;  4FHK A;  2XQ0 A;  2L0T B;  2WXF A;  2FBN A;  3MEK A;  2WXI A;  3FU6 A;  4PS3 A;  2VSY A;  3FH7 A;  5A6C A;  4B0Z A;  5EDS A;  4GCO A;  5D0O D;  4CGV A;  3KAE A;  1UN8 A;  2AVP A;  3G2S A;  4GB9 A;  4G2V A;  3FUF A;  1BPO A;  3FUL A;  4EZL A;  2LO6 A;  3D9L A;  4MLP A;  4UQX A;  3HDX A;  5AEN A;  4N3C A;  5FT9 A;  1N52 A;  2ION A;  4BFR A;  1SQM A;  3FTY A;  3FH5 A;  4L1B A;  4FHJ A;  3FTV A;  4FLH A;  3FTS A;  4KBQ A;  2WXQ A;  5FQ7 A;  1UW4 B;  2X3M A;  4I2W A;  3EDT B;  4J8D A;  1PY1 A;  2LNI A;  3D9J A;  3QWV A;  2KZT A;  4KT6 B;  4UQY A;  5FQ8 A;  2V8S E;  2PL2 A;  1B89 A;  2NC9 A;  4XI9 A;  4ME2 A;  4XKB A;  3BEE A;  4B8C B;  4IUL A;  3GW4 A;  5G2N A;  1INZ A;  4UWH A;  3CVN A;  2XRY A;  2WXN A;  3PH0 C;  4U07 A;  3CVW A;  3FU5 A;  4P29 A;  3LY9 A;  4GZ3 A;  4UWK A;  5FQ6 A;  4B89 A;  3URZ A;  4MS6 A;  4WND A;  2XCC A;  4BX9 A;  5CMW A;  4N3B A;  4JHR A;  2I1K A;  4DJA A;  2VGX A;  3D9O A;  4I6J A;  3PNT B;  3CHS A;  3B7U X;  2HM8 A;  4QFV A;  2IJG X;  4N39 A;  4JA7 A;  2WXO A;  4KVM A;  3E4B A;  4A55 A;  3MGB A;  1E7U A;  1OUV A;  2OVF A;  5EX3 A;  2XRZ A;  1IHG A;  2FO7 A;  3G2U A;  5BPP A;  4H7Y A;  3O48 A;  3O4Z A;  3CIA A;  3T8M A;  4BSX A;  5BUZ A;  3ENE A;  3NZS A;  3FTW A;  4Q96 A;  5ARF A;  1SZA A;  4CT0 A;  2XPI A;  4HOU A;  4ABN A;  3B13 A;  2FEZ A;  4GCN A;  3CV0 A;  3VLF A;  3RK6 A;  5ENN A;  5G04 C;  2M63 A;  4AY6 A;  2Y4T A;  4G26 A;  3OXF A;  3ZHE A;  1DVP A;  3ESL A;  2P58 C;  4G23 A;  4B94 A;  1VDY A;  2XGM A;  3FUJ A;  3LDZ A;  4EEC A;  3P1U A;  4DI3 A;  1YA0 A;  2LAH A;  3ONK A;  4GAA A;  4UWG A;  5T4Y A;  3CVQ A;  3PRE A;  2X6F A;  2LSV A;  2KCL A;  4JC8 A;  4EBA A;  3QOU A;  2X6H A;  4CDM A;  4AM9 A;  3ML8 A;  1HU3 A;  2WXJ A;  2WMO A;  3FEY A;  3Q49 B;  2VGX B;  2I9C A;  3FY4 A;  4TV3 A;  3RIB A;  3I4R B;  5CCL A;  2JEK A;  2WXP A;  1QNF A;  1EDU A;  3D3M A;  2YQ8 A;  5D0Q D;  3R9A B;  2J08 A;  3FUM A;  4Q69 A;  3OXG A;  4GPK A;  3HHM A;  2BUG A;  3FUN A;  4C9B B;  3QC1 A;  5BV1 A;  1NP7 A;  3U66 A;  5T3R A;  1OWL A;  3CVY A;  1HG2 A;  3FFL A;  3R7Q A;  1LF8 A;  3S2A A;  1A17 A;  3MV2 B;  3TGO A;  2J9Q A;  2CFU A;  3U4T A;  3ZXS A;  3CHM A;  4AY5 A;  5LFA A;  3KEZ A;  1SZ9 A;  3ZIM A;  3CHO A;  3ZW3 A;  4M3O A;  4ATG A;  3AS5 A;  3PE4 A;  2JLB A;  1EF1 C;  4N3A A;  2NSZ A;  2PZI A;  3HYM B;  1JWF A;  4AXH A;  3CKB A;  2OV8 A;  5CMY A;  2IOS A;  4GA1 A;  5AJD A;  1TJF A;  2PM6 A;  3IHY A;  4R7L A;  5J90 A;  4MKT A;  3IV0 A;  3MV3 B;  1FVH A;  2PM7 A;  2CFZ A;  5EKQ D;  3FTZ A;  3FUH A;  3OAW A;  4C0M A;  4FUL A;  2OND A;  4XIF A;  2KM4 A;  3UX4 A;  3QK0 A;  3ZYL A;  1E96 B;  4U04 A;  2WQ7 A;  2XPZ A;  2YHC A;  5BNW A;  2VJ8 A;  2J07 A;  2X6K A;  4BWR A;  3CQG B;  5J08 A;  2WXK A;  3DPD A;  2OVB A;  2CHW A;  4NAC A;  5CCM A;  3N71 A;  4FC8 A;  4E6H A;  4EPZ A;  1OWN A;  3JYS A;  4WNE A;  4EZK A;  1Y8M A;  4NRH B;  4TUU A;  3AS4 A;  3QB2 A;  3TG4 A;  5A7D B;  1HX8 A;  2KC7 A;  1H19 A;  4Y6W A;  3CVX A;  2VTB B;  1QQE A;  4XE0 A;  4BY6 A;  4GZC A;  5BT1 A;  3ESK A;  4WNF A;  2BF0 X;  1X5B A;  2MHK A;  4PS8 A;  3S7B A;  3SF4 A;  3ZYQ A;  3C98 A;  4L7T A;  4XX5 A;  2AXV A;  3T5X A;  3CGH A;  1ELK A;  2LSU A;  4G11 A;  4J8F A;  1TEZ A;  3CHP A;  2NXP A;  3HIZ A;  4FJZ A;  5AJL A;  3D9K A;  2ZU6 B;  3HVE B;  5KJL A;  1MHQ A;  4WAF A;  3L13 A;  3MA5 A;  3ONL A;  4AJW A;  4JHK A;  2PQR A;  4PUC A;  3LPZ A;  4ANU A;  2WB2 A;  3FTX A;  2VSN A;  3QJZ A;  4ILG A;  4H7X A;  2CG3 A;  3G2T A;  4U8H A;  3L54 A;  4F53 A;  3FH8 A;  1ZU2 A;  3DBS A;  4YND A;  5FZS A;  2WXL A;  1EYH A;  3LCA A;  4FJY A;  4F1S A;  3JQ1 A;  4KYO B;  4AVX A;  3GZ2 A;  1UG3 A;  3UT7 A;  4AEZ C;  4ANW A;  2VSX E;  1HS6 A;  3IHV A;  2IOL A;  1N54 A;  4FP7 A;  1KT0 A;  3FDH A;  2KCK A;  3NF1 A;  2FF4 A;  4EZJ A;  3FTU A;  1GW6 A;  1TJC A;  3LEW A;  3SBS A;  5LCW C;  2GRL A;  4PH4 B;  2AXZ A;  4I6E A;  2V5F A;  2KCV A;  1KT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...