2LNIA

Solution nmr structure of stress-induced-phosphoprotein 1 sti1 from homo sapiens, northeast structural genomics consortium target hr4403e
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
133
structure length
133
Chain Sequence
MGHHHHHHSHMNPDLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target HR4403E
rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Stress-induced-phosphoprotein 1
total genus 46
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lniA00
3Q5MA 2UWJG 3CVNA 3CKBA 4GZ5A 3WXXA 4I2ZA 3R9AB 5C1DA 4N2QA 3ZN3A 2VSYA 3AS8A 3IEGA 1HH8A 3GYZA 2E2EA 3CV0A 3Q4AB 4UI9K 3S7BA 5G04C 1HXIA 2LSUA 3MKRA 3UQ3A 4CGWA 3AS4A 5A6CA 4N3AA 1HZ4A 3CVQA 4B94A 4Y6CA 4UI9J 4J8EA 5KJMA 3LCAA 2WPVA 3EDTB 1FCHA 2VYIA 3O48A 2JLBA 4GYOA 2PQRA 1PC2A 2PL2A 1P5QA 1ZU2A 2VQ2A 3KAEA 4GA0A 1ELWA 3PE4A 4J0UA 4U07A 4Y6WA 5G05C 5AYWD 5EKQD 3RJVA 3TG4A 5BT1A 5FJYA 3HYMB 1NA0A 3ESKA 3ASFA 3MEKA 4WUYA 3LPZA 5EX0A 3QWVA 4H7XA 1B89A 4I2WA 2PZIA 3GW4A 3TG5A 4GCNA 4YVQC 4G24A 2KCLA 5CHEE 3N71A 4N3CA 4GZ6A 2VGXB 2FF4A 3KD7A 4KBQA 1NZNA 3CK9A 1WM5A 1YA0A 5ARGA 3RU0A 3SF4A 2XGMA 4NRHB 5FZRA 5LCWC 2YQ8A 3GZ2A 3LY8A 2UY1B 3UPVA 2R5SA 2Y4UA 5CCLA 3ZHEB 3PDNA 3QOUA 1QZ2A 4JL0A 3ZPJA 5KJLA 2KCVA 3ZGQA 2NC9A 3Q47B 4KYOB 4JA9A 4U0UA 4AM9A 4YNDA 4WNDA 3FFLA 2UY1A 5D0QD 3U3WA 2ONDA 2BUGA 2I6HA 3CK7A 2XEVA 3MA5A 3MV2B 3UUXA 4UQXA 5JJTA 3Q15A 2HR2A 3CVLA 1KT0A 3NF1A 5DIZA 4APOA 3PE3A 5M72A 4WNEA 4W9RA 4O6FA 3CK8A 1ZBPA 3AS5A 3ULQA 4I17A 5FZSA 3SZ7A 4CDRA 2HO1A 5D0OD 1WAO1 1Y8MA 3LYAA 3QWWA 4XI9A 3S7JA 3FP3A 4U04A 3OXGA 4G26A 4LEUA 1QQEA 1XNFA 2VGYA 4G23A 4JA7A 4YVOA 3ZFWA 3JYSA 4J8FA 2KC7A 4IN3B 3CVPA 4GYYA 5EX3A 5KJNA 4BWRA 5FT9A 3RKVA 1IYGA 2WQHA 2KATA 5BW8C 3VTYA 4BT9A 4N2SA 3ASHA 2XGOA 3VTXA 3LKUA 2XCCA 2FO7A 4G2VA 3QKYA 4N3BA 4A1SA 4WNGA 2QFCA 2XPIA 5FTPA 5BNWA 1IHGA 5A7DB 2C2LA 2C0MA 1A17A 2IFUA 2VGXA 3OXFA 5HQ8A 4F3VA 4HORA 2V5FA 3QWPA 5ARFA 4AY6A 4GA2A 2C0LA 5FZQA 1W3BA 2KCKA 3OXLA 4EQFA 5G05J 3LY9A 3Q49B 4ABNA 1TJCA 2LNIA 3FWVA 3MV3B 3BEEA 5JJ6A 2Y4TA 3RO3A 4CGVA 5JJ7A 1KLXA 3KS2A 4GPKA 4GZ3A 4XI0A 5LCWJ 4I9CA 1OUVA 4J8DA 2AVPA 4RG9A 4U0SA 3ASGA 3URZA 3TGOA 4NQ0A 2GW1A 4HOQA 2L6JA 2XGSA 2MHKA 1NA3A 3ASDA 3GZ1A 1KT1A 4GYWA 4N39A 4WNFA 4UI9C 2FEZA 3LY7A 4G25A 4GA1A 4XIFA 3E4BA 3RO2A 3ZHEA 2LSVA 2IF4A 2Q7FA 5G04J 4KXKB 4G1TA 4AY5A 5KJKA 2YHCA 2VSNA 4AIFA 3QDNA 2J9QA 1ELRA 3RIBA 4ME2A 5CCMA 4H7YA 4HOUA 4I1AA 5DBKA 2OOEA 4UQZA 4I9EA 2HYZA 3CEQA 3TAXA 3S7DA 3K9IA 2FBNA 4JHRA 2PQNA 4U0ZA 3S7FA 3CKCA 2XCBA 4BT8A 5HI7A 4BTAA 4HOSA 4HOTA 2FI7A 4RG6A 3U4TA 4N5CA 4GCOA 2P58C 4UQYA 2DBAA 4BTBA 1E96B
chains in the Genus database with same CATH superfamily
2IU1A 2B0OE 5CMYA 3ASNE 2P9IG 3AU5A 1DCQA 1HE8A 2M63A 4LCTA 3UM2A 3D9KA 5BXOA 4D10C 1ZU2A 5FJYA 1N4PA 3FUMA 3ZKJA 2P9LG 4YVQC 2QZAA 3N71A 4WWPA 2XGMA 4NRHB 3TJPA 1TNYA 3PZ1A 2L6BA 2XRZA 1OWMA 5D0QD 4G8LA 3DSVA 3KEAA 2MYOA 4TUMA 1E7VA 5HS0A 4R7LA 3FP3A 3E32A 3OXGA 1SZ9A 1EYHA 3C3QA 3CVPA 4I6JA 4CYMD 2CG3A 4V3IA 2X6KA 2L0TB 2J4DA 3MZLB 1MQSA 1N95A 5FQ8A 5HQ8A 3BQOA 3TWVA 2BF0X 4CGVA 4OAUC 3IV0A 1TNBA 3B7SA 3GZ1A 4GTRA 4XIFA 2P2CP 3FH8A 2Q7FA 5CERB 3D9NA 3IHYA 1O5MA 3I4RB 4DLQA 2VSOE 4I9EA 1DCEA 5ENRD 3CKCA 4UUCA 4ZHBA 4N2QA 4EBAG 3L54A 3ZN3A 3FUDA 4UI9K 2VTBA 2CFZA 3FTUA 4XEIG 2H6GA 3Q9NC 4N3AA 4AEZC 4J0UA 3TWRA 1ELWA 4K03A 4MS6A 1SA5A 4GU5A 4I1OB 4I2WA 4B0ZA 2IOLA 4G24A 4N3CA 1H6KA 2WXQA 5AJLA 2BTDA 3Q47B 3Q75A 4JA9A 3FTYA 4U0UA 3U64A 2A4ZA 3UXGA 1H0AA 4WNDA 3FTZA 3CK7A 4BESA 3DPDA 3QAQA 4O6FA 4CT0A 4J6IA 3T8KA 4I17A 2HO1A 2OV8A 3L9TA 4DI3A 2AXUA 4J8FA 4DLOA 4JEUA 3E30A 3LKUA 1HU3A 1OCCE 2EINE 1IHGA 3MX3A 4ILHB 4TRQA 1W3BA 2V5QC 4FLBA 3SBSA 5E75A 2XGSA 4GZDA 2FEZA 3LY7A 4GA1A 1HF8A 1LF8A 1MHQA 3WG7E 1QBQA 4LSZE 3CEQA 5ENPD 2GRNB 3K9IA 3ZU7B 2XEEA 1E96B 4GTVA 4ATGA 3IEGA 5AARA 5A6CA 1HZ4A 3CVQA 2X3MA 3AG4E 5G05C 3ZNGA 4PUCA 2VSXE 3MEKA 4TV3A 1PY1A 5J90A 1Z6TA 4JW1A 3EHRA 3EHMA 1TR4A 3QOUA 1QZ2A 1H2VC 2NC9A 4L7TA 2ONDA 2XEVA 3SHFA 2EIKE 4APOA 4HNAD 4U95D 3ZRHA 2ZXWE 4L2LA 3DPYA 3CHSA 3Q73A 4BSXA 3DSUA 3R9MA 4GTQA 4K5BA 2QY7A 1ELKA 2WQHA 1INZA 2IFUA 3EIQC 3ULEG 4EQFA 3LJNA 4CDMA 4EZKA 5LCWJ 3IHVA 4KVOA 4WNFA 1KT1A 4GYWA 5C2YA 3E4BA 5ENNA 1DNPA 1UG3A 2IY0C 4QFVA 4CCAA 2GGFA 3TAXA 2PQNA 3ESLA 2L9BA 3C3RA 1N4SA 1QYMA 3U66A 3LVQE 4DX5D 3GYZA 4KT6B 3UQ3A 4MRUA 3FU5A 2CG2A 3LCAA 1FCHA 2PL2A 3T8MA 1UJJA 3NZUA 3UM1A 2DCPA 3TG4A 3SFYA 1KZOA 4A3TA 1JUQA 3LPZA 1UW4B 3HXDA 4K0RA 3Q7FA 4Q96A 4GZ6A 4KBQA 3KD7A 4TXPA 3ZYMA 3TXMA 4F1SA 5CCLA 5JA4D 5KNHD 1BLXB 4AJWA 2P9KG 1KT0A 3PE3A 2YINA 4HB5A 3MGBA 4FJYA 1IQUA 4P29A 3G2SA 5ENQD 2VGYA 1OWOA 4J8SA 2KZTA 3VTXA 1NI1A 4YDYA 2R59A 3W9FA 2J49A 3NQPA 4LNBA 1OY3D 2WXMA 2KCKA 3LY9A 4ZFHA 2A5EA 2DYSE 1KLXA 4GPKA 2AVPA 4TUUA 4CRWA 4XKBA 4DX7D 5HKPA 2AXVA 2MRIA 2HYZA 5HI7A 4BY6A 1IXVA 4UQYA 4BTBA 2WXRA 2XCCA 4I2ZA 5CECB 3MKRA 1RW2A 4CZ2D 3ZYLA 4UI9J 2X6IA 2VYIA 2VQ2A 3TG5A 1P5QA 3TGOA 3UT7A 2I9CA 5ENOD 2P9UG 4DJAA 5EIBE 3AG3E 2KCLA 2B6CA 1N52A 2R03A 5FZRA 2R5SA 2DZNA 2Y4UA 4JVSA 1OCRE 3PVLA 1OWNA 4BERA 2ETCA 4AM9A 3L6AA 4C0EA 5AQ7A 4EPZA 2IO3C 5BUZA 3F6QA 2HR2A 3NF1A 2GRRB 3BG0B 2OEVA 1D8EA 3PZ4A 4CDRA 4B89A 4XZ4A 2P9NG 1DVPA 2EIJE 2IOSA 1WY6A 1YYHA 2KC7A 3PEUB 3ASHA 3AG2E 4A1SA 4K5CA 4Q69A 3SFXA 5A7DB 5FQ7A 3ISMC 3AAAC 3MKQB 3MYVA 4U8VD 1H2UA 1K1BA 3CLJA 4GA2A 4XX5A 2YNQA 1N0RA 2RFAA 4GMRA 2LNIA 2WVIA 3RO3A 3NOGD 3DXMG 4J8DA 2I2OA 3ASGA 4MKTA 3FTSA 4JD2G 2IO2C 1K1AA 2IQCA 3CQCB 4FULA 4E6HA 3QDNA 1BI8B 4BTAA 4BX8A 4MBGA 3RAUA 3U4TA 2BKKB 3CVNA 1FT1A 2PM7A 4I43A 4L2YA 5D66A 3ABKE 4ACKA 1TEZA 5T8IA 4A3VA 3ENEA 4J8EA 3FUHA 3TL5A 2PQRA 1MJ0A 3KAEA 3CHQA 4G11A 1JPLA 4L1BA 3B7BA 4HRMB 4H7XA 3GW4A 1FVHA 5AQBA 2WXKA 4TXQA 1NZNA 4O1OA 3LY8A 3UPVA 4K5AB 4JL0A 3SGHA 5FINA 3ZVVA 3U3WA 5AQAA 4GTSA 3HIZA 5FQ4A 2P58C 3AS5A 5IY5E 2DZOA 3SY2A 4GTOA 1HS6A 3CIAA 4U04A 4ANUA 3UM3A 1V54E 4DRXE 5ANLA 3NB2A 3QKYA 3UMVA 4J8YA 4DUIA 1YMPA 4RVBA 5FWQA 3CVVA 3QB2A 2DIWA 3FTVA 3KEZA 3OXLA 2WQ6A 3DEPA 3DBSA 3RRNB 3GZSA 3G2VA 3D9HA 3ASDA 3RO2A 2IF4A 4G1TA 3EUVA 2J09A 1ELRA 4HOUA 4E85A 3KSLA 3L08A 5AENA 5AAOA 3ZXPA 4HRLA 3APDA 2L0IA 3V30A 3CVWA 3OTNA 1XGWA 4B94A 5EDSA 3FTWA 3O48A 1E8ZA 3PRZA 5BT1A 4AOFA 3B7RL 4WUYA 4FHKA 3MCXA 5LCWC 3U9WA 4QQIA 4B8AA 4L9PA 5CEDB 4C48B 4JC8A 5D2MC 4PH4B 1N9AA 2WXFA 3FH7A 4CDNA 4IULA 3SQVA 3FUIA 4OVUA 4FU3A 5M72A 4WNEA 3R7QA 1JWFA 5EILA 3HXBA 3Q78A 5BV0A 3ZFWA 3SFZA 4BWRA 3IXEA 4IRUA 3AU4A 3FHEA 4N2SA 3UT4A 2V4HC 4G2VA 4L23A 2F8XK 1A17A 1SA4A 1U3CA 1SW6A 3NAWA 2VGEA 3R7RA 3PUKA 1OUVA 5AJDA 4HOQA 1NA3A 5FQ6A 4AY5A 1UJKA 2YHCA 4AIFA 3B7TA 3RIBA 3CVYA 3UKRG 3OAWA 2FBNA 4GTPA 4U0ZA 4EZLA 2FI7A 3ZW3A 3PNLB 3R9AB 5FIOA 1ZB1A 4U7EB 1E8WA 3FU0A 3B13A 3CGHA 4C0MA 1K8KG 3DWLG 3UM0A 2ZGGA 2PM6A 2OVBA 4AVXA 1NA0A 3QARA 3C3OA 4LG6A 4WWNA 4UWGA 1YA0A 5EYPF 1U3DA 3FUKA 3PZDA 4UWKA 4DI4A 5LP0A 3ONKA 4N5QA 2WMNA 1JCRA 5G2NA 3B7UX 2I1JA 3MV2B 5JJTA 3CVLA 4DX1A 4U63A 1HG5A 1TNOA 5CBNA 3ULQA 3SZ7A 4MLPA 4NACA 4UWFA 1RZ4A 3CHRA 2GRPB 2Y1LE 4FADA 2V4LA 2C2LA 3E37A 4AY6A 3Q49B 2RG8A 3BEEA 3HXCA 2YHEA 5AN8A 4KMOA 2OEWA 4G8KA 3HVEA 1AP7A 1OT8A 1OWPA 4I6EA 5CCMA 4HXIA 3FTXA 2OOEA 1OCZE 1N94A 4ATZD 2ZISA 3UT8A 4RG6A 2XS8A 1FPPA 4WAFA 4GZ5A 4HLEA 2WB2A 1HH8A 3CV0A 2EIME 4B8CB 1NL4A 3O4ZA 3EDTB 3JXIA 4Y6WA 3CHPA 3JUIA 1IHBA 2H6FA 3ASOE 3EU5A 2PZIA 4ANVA 4C9BB 2DYRE 2FF4A 4F6RD 1TN8A 3SF4A 5KWDA 3GZ2A 3TWUA 3ZHEB 3PDNA 1BU9A 1X81A 3ZGQA 3LDZA 4F1PA 3J5PA 4GB9A 4EECA 4GMJA 2R17C 4A55A 1QNFA 3PH0C 3QC1A 1XNFA 3AG1E 5FT9A 3L22A 3JQ1A 3I5PA 5BNWA 4OVVA 1H6OA 4UWLA 3DEOA 4JHJA 2F37A 3URZA 2OCCE 1SQMA 5LOZA 2A5UA 4FC8A 1H19A 3EHQA 1TYQG 2EQXA 1OCOE 1AWCB 5HRYA 2KBXA 4BX9A 2LUHA 1U2VG 4AV7A 4JB8P 3Q5MA 3Q4AB 4FLHA 4FHJA 3QK0A 4Y6CA 2JLBA 3TWXA 4M3OA 3PE4A 2E0IA 4Z68A 3FEYA 4U8YD 1TN7A 4GCNA 1Y6IA 5E76A 3ZPJA 3HG0D 2WXIA 4EBAA 3PEVB 3L82A 3UUXA 4ILIA 2FULA 4ACLA 5ANRA 1Z3XA 3ZYKA 3CK8A 1IKND 4B93B 4LRZA 4FP7A 3TWTA 3V79K 4G23A 3VLFA 1H2TC 1D9SA 5CRUA 3PNTB 5B1BE 4I6GA 2XRYA 4F53A 2C0MA 2JEKA 4F3VA 5ARFA 1X5BA 3RRUA 3UKUG 3CSFA 4XKCA 3TWWA 4PS8A 3FDHA 2JABA 4GPMA 4I9CA 4RG9A 4HI9A 1YCSB 1K3ZD 2L6JA 2LSVA 3CVUA 3DRAA 3T9KA 2R02A 1TNUA 1OXJA 1HG2A 4UQZA 3ONLA 1MX2A 3V2XA 2KM4A 5CBOA 2XCBA 2XHEA 4HOSA 2XPYA 4LNGA 3FUNA 3AS8A 1MYOA 4CGWA 3Q9UC 3CQGB 2ZU6B 2WPVA 4GAAA 4GA0A 1JCSA 5EKQD 3BG1B 3DSXA 4HBDA 4DK5A 3IBEA 5KCMA 4AXHA 3D9PA 2IJGX 5A23A 1LTXA 2WXGA 2KCVA 1SVXA 3BUAA 5T4YA 3HXFA 2XQ0A 3D9OA 2ZIRA 3MA5A 3DXKG 4EZJA 3HVEB 3Q15A 1MX6A 5FZSA 2VTBB 2P9SG 4LEUA 5JHBA 3J5QB 3CHOA 1N4QA 4AP2A 3FUEA 3HHMA 1UN8A 3G2UA 3C72A 3PUJA 3PZ3A 3S2AA 1V55E 5FZQA 1IQRA 5G05J 2H6IA 1VDYA 2Y4TA 1GW6A 2WQ7A 1S64A 3L13A 2GW1A 3HXEA 4RLYA 1EDUA 2HE0A 3L16A 1S0PA 3E33A 3FU3A 5AQ9A 3ZHEA 1HO8A 1O1TA 5KJKA 5J08A 2AWIA 2KZTB 3ZYQA 1NFIE 4DPRA 1WDYA 1LD7A 4NURA 4XI0A 5C1DA 3VLEA 3CKBA 3ZIMA 2CHXA 2VSYA 1N54A 3RSEG 4F7AA 2X6JA 3P1UA 1Z5SC 4KVMA 2F8YA 2LO6A 3CK9A 2GRQB 2YQ8A 2AXZA 2Y0BG 4HQDA 3FUJA 5CRVA 1BI7B 3PZ2A 3SI5A 3NBNB 2QYUA 2HM8A 5B1AE 4APFA 3D9MA 3EHNA 3S7JA 1Y8MA 4KZ0A 4G26A 3TWSA 1QQEA 4M7CA 2H6HA 5EX3A 5EIDA 2R2LA 3RKVA 2RD0A 1FVFA 3ML8A 3TWQA 2QFCA 2XPIA 5FTPA 1E8XA 2AJAA 3HDXA 2VGXA 3OXFA 3ZEFA 2OVFA 4YDWA 2IONA 3RRMB 5CMWA 5G55A 3FWVA 5JJ7A 2P9PG 4DX6D 2ETAA 4BFRA 4NQ0A 2MHKA 2BKGA 2CHZA 2VSNA 3IKOB 4I1AA 1MZCA 4ANWA 4BT8A 3FH5A 3NZSA 3D9IA 2NXPA 3Q7AA 3G2WA 3NOCD 4U07A 3D3MA 3RJVA 2I1KA 3I4GA 1KZPA 3EIJA 3QNKA 3P2BA 1S63A 3FY4A 2GRLA 2PNNA 2F0YA 2QYJA 4KYOB 4BSZB 1HFAA 1JWGA 3EJNA 1E7UA 1TJFA 2WXNA 2XZDG 1KPSB 3MJWA 3TXNA 4HFGA 3JQ0A 3UIPC 2NSZA 2KATA 2XGOA 2J8SD 3FEXA 4HS2A 2X6FA 2WM9A 3ZUVB 1BPOA 4JXTA 2NYJA 5JJ6A 3W9GA 4LNUD 2LXMA 1E8YA 1EF1C 2WXOA 4O60A 4U96D 4JZYA 4JHKA 4RQIA 2V0PA 5T3RA 2LAIA 4H7YA 4JHRA 1BD8A 1TNZA 3G2TA 4GTTA 1A5EA 3JCKC 5BV1A 2LAHA 3UTMA 2E2EA 3S7BA 1HXIA 3ML9A 1FT2A 3E34A 1N11A 2Y69E 2Y3AA 1PC2A 2BEDA 3QJZA 5AYWD 5KBAA 2WXLA 5KNGA 3ASFA 3QWVA 2WXJA 4I1MA 2X6HA 1Z3YA 4FJZA 1Q2ZA 4LUNU 3RK6A 5KJLA 4O1PA 3Q79A 5ITZF 3FU6A 3ULYA 4YNDA 2DWZA 4JPSA 2MOWA 3FFLA 4OYSA 4RSYA 2BUGA 2I6HA 3PS6A 1LD8A 5JHAA 2GROB 4PDXA 2KXPC 3C98A 5EYLA 5B3SE 4XI9A 3CVXA 5LFAA 4YVOA 3SD5A 4IN3B 3LXUX 2VJ8A 1IYGA 4BT9A 2FO7A 4WNGA 2XEHA 1TN6A 4JEHA 2R05A 1UN9A 3AJIA 4YDEA 3PREA 3SBTB 4GTMA 1TJCA 4LERA 1N4RA 3APCA 4NIKA 3T5XA 1G3NB 1H6PA 1S70B 2DVWA 2CHWA 3UINC 3L17A 4HLLA 1N0QA 4HOTA 1DC2A 2ZGDA 3BU8A 4CEMA 4OAVB 2ETBA 4GCOA 2DBAA 4BETA 5ENTD 2UWJG 3WXXA 3V31A 2XS1A 5G04C 2LSUA 1OWLA 3AS4A 4XE0A 5KJMA 2IEJA 4GYOA 3KSQA 4PS7A 3CHMA 3JXJA 2FO1E 3CSTA 1PAQA 3B95A 3HYMB 3ABME 1O1SA 4J7WA 5CHEE 2VGXB 3RU0A 5ARGA 1WM5A 3LVRE 4GZCA 4BEPA 1EPUA 3DSWA 3UX4A 1SZAA 2J4BA 1L5JA 1ZBPA 4ILGA 5D0OD 1WAO1 3QWWA 4X8QA 3D9LA 2XZTG 3SNXA 5KJNA 2V8SE 2X38A 3UIOC 5BW8C 2J07A 2RKKA 3LJ3A 4N3BA 4TXRA 4EHMA 5BPPA 5CEAA 3ZXSA 4CT4A 3QWPA 4KZCA 5ENSD 4WWOA 3MV3B 2WMOA 4GZ3A 4U0SA 4N39A 4G25A 3VLDA 2AW6A 3I3NA 2J08A 4KXKB 5LX8A 2J9QA 3S7DA 4YDOA 2EILE 4N5CA 2XENA 4PS3A 4GMLA 3X2QE 3LEWA 2ILRA 1JCQA 3HRAA 4FA6A 3ESKA 3EU9A 3LS8A 5EX0A 1B89A 3DSSA 3SO8A 3UI2A 4HORA 4UWHA 2WXHA 1HX8A 2UY1B 1UOHA 5H7PA 2LXLA 2RFMA 1MX4A 2UY1A 4ANXA 4HVBA 5AIJA 4UQXA 4URKA 1E90A 3D9JA 4W9RA 1O1RA 5JMND 4DX2A 3LYAA 3FULA 5EN5D 3C5RA 4JA7A 3JYSA 4GYYA 4A63B 3T5VA 3VTYA 3CR3A 1WG0A 5BXUA 4Q94A 2V5FA 2C0LA 1NP7A 4ABNA 4U8HA 1D8DA 3JUEA 2GRMA 3APFA 3KS2A 4IYPA 3V2OA 4UI9C 5G04J 4A1GA 2XPZA 4HI8A 2WXPA 4ME2A 5DBKA 2CFUA 4HRNA 3S7FA 3DSTA 3FUFA 3ABLE 5DIZA 3MKQA 2QC9A
chains in the Genus database with same CATH topology
4GZ5A 4HLEA 2IU1A 3D9IA 5CMYA 4I2ZA 2WB2A 1HH8A 3CV0A 3AU5A 3MKRA 1HE8A 2M63A 4B8CB 3ZYLA 4LCTA 2NXPA 3O4ZA 4UI9J 2X6IA 3G2WA 3EDTB 2VYIA 3D9KA 4D10C 2VQ2A 3TG5A 1P5QA 1ZU2A 4Y6WA 3TGOA 4U07A 3CHPA 3JUIA 3D3MA 3RJVA 3UT7A 2I1KA 5FJYA 3I4GA 2I9CA 3FUMA 2PZIA 4DJAA 4ANVA 4YVQC 2KCLA 4C9BB 3N71A 1N52A 2FF4A 4WWPA 3EIJA 3SF4A 3QNKA 2XGMA 4NRHB 5FZRA 3P2BA 3GZ2A 3TJPA 2R5SA 2Y4UA 3FY4A 4JVSA 2GRLA 3ZHEB 3PDNA 3PVLA 2XRZA 1OWNA 3ZGQA 1OWMA 4KYOB 4AM9A 3L6AA 4C0EA 3LDZA 5D0QD 4EPZA 5BUZA 1HFAA 1JWGA 3EJNA 1E7UA 2HR2A 1TJFA 2WXNA 3NF1A 3BG0B 3MJWA 4GB9A 4EECA 1E7VA 4GMJA 4CDRA 4B89A 2R17C 4XZ4A 1QNFA 4A55A 4R7LA 3TXNA 3FP3A 1DVPA 3PH0C 4HFGA 3OXGA 3QC1A 3JQ0A 1XNFA 2IOSA 1SZ9A 1WY6A 1EYHA 3PEUB 2KC7A 3CVPA 2NSZA 5FT9A 4I6JA 2KATA 3L22A 2CG3A 4V3IA 2X6KA 2XGOA 3ASHA 3JQ1A 3I5PA 3FEXA 4A1SA 4HS2A 5BNWA 2L0TB 2J4DA 2WM9A 2X6FA 1MQSA 3MZLB 5FQ7A 5A7DB 4Q69A 3MKQB 4OVVA 5FQ8A 5HQ8A 1BPOA 3MYVA 1H2UA 4JXTA 3CLJA 4GA2A 4XX5A 4UWLA 2YNQA 2BF0X 2LNIA 2WVIA 5JJ6A 3RO3A 4CGVA 4JHJA 3IV0A 4J8DA 3URZA 5LOZA 1E8YA 1SQMA 2I2OA 3ASGA 2A5UA 4FC8A 1H19A 4MKTA 3B7SA 1EF1C 2EQXA 2WXOA 3GZ1A 3FTSA 4JZYA 4JHKA 4XIFA 3FH8A 2V0PA 2Q7FA 5T3RA 2IQCA 3D9NA 2LAIA 3CQCB 3IHYA 4FULA 4BX9A 3QDNA 4E6HA 4H7YA 3I4RB 4DLQA 2VSOE 4I9EA 4JHRA 4BTAA 3CKCA 4AV7A 4BX8A 3U4TA 3G2TA 4N2QA 3Q5MA 4EBAG 3CVNA 3L54A 3JCKC 5BV1A 2PM7A 3ZN3A 3Q4AB 2LAHA 3FUDA 4I43A 2E2EA 4FHJA 4FLHA 4L2YA 4UI9K 3S7BA 2VTBA 1HXIA 2CFZA 3FTUA 3ML9A 3QK0A 4ACKA 4N3AA 1TEZA 5T8IA 4Y6CA 4A3VA 3ENEA 4J8EA 3FUHA 2Y3AA 4AEZC 3TL5A 2JLBA 1PC2A 2PQRA 3KAEA 4J0UA 3CHQA 3QJZA 1ELWA 3PE4A 4G11A 2E0IA 4K03A 4M3OA 5AYWD 3FEYA 4MS6A 1JPLA 2WXLA 4L1BA 4GU5A 3ASFA 4I1OB 3QWVA 4H7XA 4I2WA 4B0ZA 3GW4A 1FVHA 2IOLA 4GCNA 1Y6IA 2WXJA 4G24A 4I1MA 2WXKA 4N3CA 5E76A 1NZNA 2X6HA 1Z3YA 4FJZA 1H6KA 2WXQA 3LY8A 4LUNU 3UPVA 3RK6A 5AJLA 5KJLA 4JL0A 3ZPJA 2WXIA 4EBAA 3PEVB 2BTDA 3SGHA 3Q47B 3ZVVA 4JA9A 3FTYA 4U0UA 3FU6A 2A4ZA 3U64A 4YNDA 1H0AA 2MOWA 3FFLA 4JPSA 4OYSA 4RSYA 3FTZA 2BUGA 2I6HA 4WNDA 3U3WA 3PS6A 3CK7A 3UUXA 4ILIA 2FULA 3HIZA 5FQ4A 3DPDA 4ACLA 3QAQA 5JHAA 4PDXA 5ANRA 1Z3XA 3ZYKA 3C98A 4O6FA 3CK8A 3AS5A 4J6IA 4CT0A 4I17A 2HO1A 4LRZA 4XI9A 3CVXA 4FP7A 1HS6A 3CIAA 4U04A 5LFAA 4ANUA 2OV8A 4DI3A 4G23A 4YVOA 3VLFA 2AXUA 3SD5A 4J8FA 4IN3B 4DLOA 4JEUA 1H2TC 3LXUX 2VJ8A 5ANLA 3PNTB 1IYGA 4BT9A 3LKUA 1HU3A 2FO7A 3QKYA 4I6GA 2XRYA 4WNGA 4JEHA 3UMVA 1IHGA 1UN9A 3MX3A 4F53A 2C0MA 2JEKA 4ILHB 4RVBA 5FWQA 4F3VA 3CVVA 3PREA 3QB2A 4TRQA 5ARFA 1X5BA 2DIWA 3FTVA 3KEZA 1W3BA 3CSFA 3OXLA 4XKCA 3RRUA 2WQ6A 3SBTB 1TJCA 4PS8A 4LERA 3DBSA 3FDHA 3RRNB 3GZSA 4FLBA 3SBSA 3G2VA 4I9CA 4RG9A 3APCA 5E75A 2L6JA 2XGSA 3ASDA 4GZDA 2FEZA 3LY7A 4GA1A 3RO2A 3T5XA 2LSVA 1HF8A 2IF4A 3CVUA 1LF8A 4G1TA 1MHQA 2J09A 2CHWA 1ELRA 3L17A 4HOUA 4E85A 1HG2A 4UQZA 3L08A 3ONLA 3CEQA 5AENA 2KM4A 3K9IA 4HOTA 2XCBA 2XHEA 4HOSA 4CEMA 2XPYA 4GCOA 2DBAA 1E96B 3APDA 2UWJG 3WXXA 3FUNA 2L0IA 3AS8A 3IEGA 4ATGA 3CVWA 5G04C 2LSUA 4CGWA 1OWLA 3AS4A 3CQGB 5A6CA 3OTNA 1HZ4A 1XGWA 3CVQA 4B94A 2X3MA 2ZU6B 5EDSA 4XE0A 5KJMA 2WPVA 3FTWA 3O48A 4GYOA 1E8ZA 4GAAA 3CHMA 4PS7A 5G05C 4GA0A 3PRZA 4PUCA 5EKQD 3CSTA 1PAQA 5BT1A 2VSXE 4AOFA 3BG1B 3B7RL 3HYMB 4WUYA 3MEKA 4TV3A 1PY1A 4DK5A 4FHKA 5J90A 1Z6TA 3IBEA 5CHEE 5KCMA 2VGXB 4JW1A 3RU0A 5ARGA 4AXHA 3EHMA 1WM5A 3D9PA 2IJGX 3MCXA 5LCWC 5A23A 3U9WA 4B8AA 3LVRE 4GZCA 4JC8A 3QOUA 1QZ2A 1H2VC 2WXGA 2KCVA 2NC9A 5T4YA 2XQ0A 1EPUA 4L7TA 3D9OA 4PH4B 2WXFA 2ONDA 3FH7A 4CDNA 2XEVA 3MA5A 4IULA 3SHFA 3HVEB 4EZJA 3Q15A 3UX4A 1SZAA 3FUIA 4OVUA 2J4BA 1L5JA 4FU3A 4WNEA 4APOA 5M72A 1ZBPA 4ILGA 5FZSA 3R7QA 1JWFA 3ZRHA 4L2LA 5D0OD 3CHSA 1WAO1 4BSXA 3QWWA 2VTBB 3D9LA 4LEUA 5BV0A 5JHBA 3SNXA 3ZFWA 3CHOA 3SFZA 5KJNA 2QY7A 2V8SE 4AP2A 2X38A 1ELKA 3FUEA 4BWRA 4IRUA 3AU4A 2WQHA 3FHEA 5BW8C 4N2SA 3UT4A 2J07A 3LJ3A 3HHMA 4G2VA 4N3BA 4L23A 1UN8A 3G2UA 1INZA 2IFUA 1A17A 3PUJA 5BPPA 1U3CA 3ZXSA 4CT4A 3QWPA 3S2AA 3EIQC 5FZQA 4EQFA 1IQRA 5G05J 4KZCA 4WWOA 3MV3B 3R7RA 4CDMA 1VDYA 2WMOA 2Y4TA 3PUKA 4EZKA 1GW6A 4GZ3A 2WQ7A 5LCWJ 1OUVA 4U0SA 5AJDA 3IHVA 3L13A 4KVOA 2GW1A 4HOQA 1EDUA 1NA3A 4WNFA 1KT1A 4GYWA 3L16A 4N39A 1S0PA 3FU3A 5C2YA 4G25A 3E4BA 5FQ6A 1HO8A 3ZHEA 3VLDA 2AW6A 5ENNA 1DNPA 3I3NA 2J08A 4KXKB 4AY5A 1UG3A 1UJKA 5KJKA 4QFVA 2YHCA 4AIFA 3B7TA 5LX8A 2J9QA 3RIBA 5J08A 3CVYA 2AWIA 4CCAA 2KZTB 2GGFA 3TAXA 3S7DA 3OAWA 2FBNA 3ZYQA 2PQNA 4U0ZA 4DPRA 3ESLA 4EZLA 2FI7A 2L9BA 4N5CA 4NURA 4XI0A 3ZW3A 3U66A 5C1DA 3PNLB 3VLEA 3CKBA 4PS3A 2CHXA 3R9AB 3LVQE 3ZIMA 1E8WA 2VSYA 3GYZA 4KT6B 1N54A 3B13A 3FU0A 4GMLA 3UQ3A 3LEWA 3CGHA 4MRUA 3FU5A 2ILRA 4F7AA 4C0MA 2X6JA 2CG2A 3LCAA 3P1UA 1FCHA 2PL2A 3T8MA 1UJJA 3NZUA 2PM6A 4KVMA 4FA6A 2OVBA 2DCPA 3TG4A 4AVXA 4A3TA 1NA0A 3ESKA 3QARA 1JUQA 3LS8A 3LPZA 5EX0A 1B89A 1UW4B 2LO6A 4K0RA 4Q96A 4WWNA 4GZ6A 4KBQA 4UWGA 3KD7A 4HORA 3CK9A 1YA0A 4UWHA 3ZYMA 3TXMA 2WXHA 4F1SA 1U3DA 2YQ8A 1HX8A 2UY1B 3FUKA 2AXZA 5CCLA 3PZDA 4UWKA 3FUJA 4DI4A 5LP0A 3ONKA 2WMNA 5G2NA 4AJWA 2UY1A 3SI5A 4ANXA 4HVBA 3B7UX 2I1JA 3MV2B 5AIJA 4UQXA 4URKA 5JJTA 2HM8A 3CVLA 1KT0A 1E90A 4U63A 3PE3A 2YINA 3D9JA 4APFA 1HG5A 4W9RA 3MGBA 4FJYA 1IQUA 4P29A 3ULQA 3SZ7A 4MLPA 3D9MA 3G2SA 3EHNA 4NACA 3S7JA 1Y8MA 3FULA 3LYAA 4KZ0A 4G26A 4UWFA 1QQEA 2VGYA 4JA7A 3JYSA 5EX3A 4GYYA 3CHRA 1OWOA 3RKVA 2RD0A 4BTBA 4J8SA 1FVFA 3VTYA 2KZTA 3T5VA 3ML8A 3VTXA 3CR3A 2R59A 4FADA 2J49A 2XPIA 2QFCA 3NQPA 5FTPA 2V4LA 1E8XA 3HDXA 2C2LA 2VGXA 3OXFA 4Q94A 3ZEFA 2OVFA 2V5FA 4AY6A 2WXMA 3RRMB 2C0LA 2IONA 5CMWA 2KCKA 3LY9A 1NP7A 3Q49B 4U8HA 2RG8A 3FWVA 5G55A 4ABNA 2GRMA 3BEEA 5JJ7A 1KLXA 2YHEA 3APFA 3KS2A 4GPKA 4KMOA 2AVPA 4TUUA 4BFRA 4NQ0A 4CRWA 2MHKA 4IYPA 4XKBA 4UI9C 3HVEA 2CHZA 5G04J 4A1GA 2XPZA 1OWPA 2AXVA 2VSNA 3IKOB 4I6EA 2MRIA 2WXPA 4HXIA 4ME2A 5CCMA 3FTXA 4I1AA 5DBKA 2OOEA 2CFUA 4ANWA 2HYZA 4BT8A 3S7FA 5HI7A 3FH5A 4BY6A 3FUFA 3UT8A 4RG6A 2P58C 4UQYA 5DIZA 3MKQA 4WAFA 2WXRA 2XCCA 3NZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5M A;  2UWJ G;  3CVN A;  3CKB A;  4GZ5 A;  3WXX A;  4I2Z A;  3R9A B;  5C1D A;  4N2Q A;  3ZN3 A;  2VSY A;  3AS8 A;  3IEG A;  1HH8 A;  3GYZ A;  2E2E A;  3CV0 A;  3Q4A B;  4UI9 K;  3S7B A;  5G04 C;  1HXI A;  2LSU A;  3MKR A;  3UQ3 A;  4CGW A;  3AS4 A;  5A6C A;  4N3A A;  1HZ4 A;  3CVQ A;  4B94 A;  4Y6C A;  4UI9 J;  4J8E A;  5KJM A;  3LCA A;  2WPV A;  3EDT B;  1FCH A;  2VYI A;  3O48 A;  2JLB A;  4GYO A;  2PQR A;  1PC2 A;  2PL2 A;  1P5Q A;  1ZU2 A;  2VQ2 A;  3KAE A;  4GA0 A;  1ELW A;  3PE4 A;  4J0U A;  4U07 A;  4Y6W A;  5G05 C;  5AYW D;  5EKQ D;  3RJV A;  3TG4 A;  5BT1 A;  5FJY A;  3HYM B;  1NA0 A;  3ESK A;  3ASF A;  3MEK A;  4WUY A;  3LPZ A;  5EX0 A;  3QWV A;  4H7X A;  1B89 A;  4I2W A;  2PZI A;  3GW4 A;  3TG5 A;  4GCN A;  4YVQ C;  4G24 A;  2KCL A;  5CHE E;  3N71 A;  4N3C A;  4GZ6 A;  2VGX B;  2FF4 A;  3KD7 A;  4KBQ A;  1NZN A;  3CK9 A;  1WM5 A;  1YA0 A;  5ARG A;  3RU0 A;  3SF4 A;  2XGM A;  4NRH B;  5FZR A;  5LCW C;  2YQ8 A;  3GZ2 A;  3LY8 A;  2UY1 B;  3UPV A;  2R5S A;  2Y4U A;  5CCL A;  3ZHE B;  3PDN A;  3QOU A;  1QZ2 A;  4JL0 A;  3ZPJ A;  5KJL A;  2KCV A;  3ZGQ A;  2NC9 A;  3Q47 B;  4KYO B;  4JA9 A;  4U0U A;  4AM9 A;  4YND A;  4WND A;  3FFL A;  2UY1 A;  5D0Q D;  3U3W A;  2OND A;  2BUG A;  2I6H A;  3CK7 A;  2XEV A;  3MA5 A;  3MV2 B;  3UUX A;  4UQX A;  5JJT A;  3Q15 A;  2HR2 A;  3CVL A;  1KT0 A;  3NF1 A;  5DIZ A;  4APO A;  3PE3 A;  5M72 A;  4WNE A;  4W9R A;  4O6F A;  3CK8 A;  1ZBP A;  3AS5 A;  3ULQ A;  4I17 A;  5FZS A;  3SZ7 A;  4CDR A;  2HO1 A;  5D0O D;  1WAO 1;  1Y8M A;  3LYA A;  3QWW A;  4XI9 A;  3S7J A;  3FP3 A;  4U04 A;  3OXG A;  4G26 A;  4LEU A;  1QQE A;  1XNF A;  2VGY A;  4G23 A;  4JA7 A;  4YVO A;  3ZFW A;  3JYS A;  4J8F A;  2KC7 A;  4IN3 B;  3CVP A;  4GYY A;  5EX3 A;  5KJN A;  4BWR A;  5FT9 A;  3RKV A;  1IYG A;  2WQH A;  2KAT A;  5BW8 C;  3VTY A;  4BT9 A;  4N2S A;  3ASH A;  2XGO A;  3VTX A;  3LKU A;  2XCC A;  2FO7 A;  4G2V A;  3QKY A;  4N3B A;  4A1S A;  4WNG A;  2QFC A;  2XPI A;  5FTP A;  5BNW A;  1IHG A;  5A7D B;  2C2L A;  2C0M A;  1A17 A;  2IFU A;  2VGX A;  3OXF A;  5HQ8 A;  4F3V A;  4HOR A;  2V5F A;  3QWP A;  5ARF A;  4AY6 A;  4GA2 A;  2C0L A;  5FZQ A;  1W3B A;  2KCK A;  3OXL A;  4EQF A;  5G05 J;  3LY9 A;  3Q49 B;  4ABN A;  1TJC A;  2LNI A;  3FWV A;  3MV3 B;  3BEE A;  5JJ6 A;  2Y4T A;  3RO3 A;  4CGV A;  5JJ7 A;  1KLX A;  3KS2 A;  4GPK A;  4GZ3 A;  4XI0 A;  5LCW J;  4I9C A;  1OUV A;  4J8D A;  2AVP A;  4RG9 A;  4U0S A;  3ASG A;  3URZ A;  3TGO A;  4NQ0 A;  2GW1 A;  4HOQ A;  2L6J A;  2XGS A;  2MHK A;  1NA3 A;  3ASD A;  3GZ1 A;  1KT1 A;  4GYW A;  4N39 A;  4WNF A;  4UI9 C;  2FEZ A;  3LY7 A;  4G25 A;  4GA1 A;  4XIF A;  3E4B A;  3RO2 A;  3ZHE A;  2LSV A;  2IF4 A;  2Q7F A;  5G04 J;  4KXK B;  4G1T A;  4AY5 A;  5KJK A;  2YHC A;  2VSN A;  4AIF A;  3QDN A;  2J9Q A;  1ELR A;  3RIB A;  4ME2 A;  5CCM A;  4H7Y A;  4HOU A;  4I1A A;  5DBK A;  2OOE A;  4UQZ A;  4I9E A;  2HYZ A;  3CEQ A;  3TAX A;  3S7D A;  3K9I A;  2FBN A;  4JHR A;  2PQN A;  4U0Z A;  3S7F A;  3CKC A;  2XCB A;  4BT8 A;  5HI7 A;  4BTA A;  4HOS A;  4HOT A;  2FI7 A;  4RG6 A;  3U4T A;  4N5C A;  4GCO A;  2P58 C;  4UQY A;  2DBA A;  4BTB A;  1E96 B; 
#chains in the Genus database with same CATH topology
 2IU1 A;  2B0O E;  5CMY A;  3ASN E;  2P9I G;  3AU5 A;  1DCQ A;  1HE8 A;  2M63 A;  4LCT A;  3UM2 A;  3D9K A;  5BXO A;  4D10 C;  1ZU2 A;  5FJY A;  1N4P A;  3FUM A;  3ZKJ A;  2P9L G;  4YVQ C;  2QZA A;  3N71 A;  4WWP A;  2XGM A;  4NRH B;  3TJP A;  1TNY A;  3PZ1 A;  2L6B A;  2XRZ A;  1OWM A;  5D0Q D;  4G8L A;  3DSV A;  3KEA A;  2MYO A;  4TUM A;  1E7V A;  5HS0 A;  4R7L A;  3FP3 A;  3E32 A;  3OXG A;  1SZ9 A;  1EYH A;  3C3Q A;  3CVP A;  4I6J A;  4CYM D;  2CG3 A;  4V3I A;  2X6K A;  2L0T B;  2J4D A;  3MZL B;  1MQS A;  1N95 A;  5FQ8 A;  5HQ8 A;  3BQO A;  3TWV A;  2BF0 X;  4CGV A;  4OAU C;  3IV0 A;  1TNB A;  3B7S A;  3GZ1 A;  4GTR A;  4XIF A;  2P2C P;  3FH8 A;  2Q7F A;  5CER B;  3D9N A;  3IHY A;  1O5M A;  3I4R B;  4DLQ A;  2VSO E;  4I9E A;  1DCE A;  5ENR D;  3CKC A;  4UUC A;  4ZHB A;  4N2Q A;  4EBA G;  3L54 A;  3ZN3 A;  3FUD A;  4UI9 K;  2VTB A;  2CFZ A;  3FTU A;  4XEI G;  2H6G A;  3Q9N C;  4N3A A;  4AEZ C;  4J0U A;  3TWR A;  1ELW A;  4K03 A;  4MS6 A;  1SA5 A;  4GU5 A;  4I1O B;  4I2W A;  4B0Z A;  2IOL A;  4G24 A;  4N3C A;  1H6K A;  2WXQ A;  5AJL A;  2BTD A;  3Q47 B;  3Q75 A;  4JA9 A;  3FTY A;  4U0U A;  3U64 A;  2A4Z A;  3UXG A;  1H0A A;  4WND A;  3FTZ A;  3CK7 A;  4BES A;  3DPD A;  3QAQ A;  4O6F A;  4CT0 A;  4J6I A;  3T8K A;  4I17 A;  2HO1 A;  2OV8 A;  3L9T A;  4DI3 A;  2AXU A;  4J8F A;  4DLO A;  4JEU A;  3E30 A;  3LKU A;  1HU3 A;  1OCC E;  2EIN E;  1IHG A;  3MX3 A;  4ILH B;  4TRQ A;  1W3B A;  2V5Q C;  4FLB A;  3SBS A;  5E75 A;  2XGS A;  4GZD A;  2FEZ A;  3LY7 A;  4GA1 A;  1HF8 A;  1LF8 A;  1MHQ A;  3WG7 E;  1QBQ A;  4LSZ E;  3CEQ A;  5ENP D;  2GRN B;  3K9I A;  3ZU7 B;  2XEE A;  1E96 B;  4GTV A;  4ATG A;  3IEG A;  5AAR A;  5A6C A;  1HZ4 A;  3CVQ A;  2X3M A;  3AG4 E;  5G05 C;  3ZNG A;  4PUC A;  2VSX E;  3MEK A;  4TV3 A;  1PY1 A;  5J90 A;  1Z6T A;  4JW1 A;  3EHR A;  3EHM A;  1TR4 A;  3QOU A;  1QZ2 A;  1H2V C;  2NC9 A;  4L7T A;  2OND A;  2XEV A;  3SHF A;  2EIK E;  4APO A;  4HNA D;  4U95 D;  3ZRH A;  2ZXW E;  4L2L A;  3DPY A;  3CHS A;  3Q73 A;  4BSX A;  3DSU A;  3R9M A;  4GTQ A;  4K5B A;  2QY7 A;  1ELK A;  2WQH A;  1INZ A;  2IFU A;  3EIQ C;  3ULE G;  4EQF A;  3LJN A;  4CDM A;  4EZK A;  5LCW J;  3IHV A;  4KVO A;  4WNF A;  1KT1 A;  4GYW A;  5C2Y A;  3E4B A;  5ENN A;  1DNP A;  1UG3 A;  2IY0 C;  4QFV A;  4CCA A;  2GGF A;  3TAX A;  2PQN A;  3ESL A;  2L9B A;  3C3R A;  1N4S A;  1QYM A;  3U66 A;  3LVQ E;  4DX5 D;  3GYZ A;  4KT6 B;  3UQ3 A;  4MRU A;  3FU5 A;  2CG2 A;  3LCA A;  1FCH A;  2PL2 A;  3T8M A;  1UJJ A;  3NZU A;  3UM1 A;  2DCP A;  3TG4 A;  3SFY A;  1KZO A;  4A3T A;  1JUQ A;  3LPZ A;  1UW4 B;  3HXD A;  4K0R A;  3Q7F A;  4Q96 A;  4GZ6 A;  4KBQ A;  3KD7 A;  4TXP A;  3ZYM A;  3TXM A;  4F1S A;  5CCL A;  5JA4 D;  5KNH D;  1BLX B;  4AJW A;  2P9K G;  1KT0 A;  3PE3 A;  2YIN A;  4HB5 A;  3MGB A;  4FJY A;  1IQU A;  4P29 A;  3G2S A;  5ENQ D;  2VGY A;  1OWO A;  4J8S A;  2KZT A;  3VTX A;  1NI1 A;  4YDY A;  2R59 A;  3W9F A;  2J49 A;  3NQP A;  4LNB A;  1OY3 D;  2WXM A;  2KCK A;  3LY9 A;  4ZFH A;  2A5E A;  2DYS E;  1KLX A;  4GPK A;  2AVP A;  4TUU A;  4CRW A;  4XKB A;  4DX7 D;  5HKP A;  2AXV A;  2MRI A;  2HYZ A;  5HI7 A;  4BY6 A;  1IXV A;  4UQY A;  4BTB A;  2WXR A;  2XCC A;  4I2Z A;  5CEC B;  3MKR A;  1RW2 A;  4CZ2 D;  3ZYL A;  4UI9 J;  2X6I A;  2VYI A;  2VQ2 A;  3TG5 A;  1P5Q A;  3TGO A;  3UT7 A;  2I9C A;  5ENO D;  2P9U G;  4DJA A;  5EIB E;  3AG3 E;  2KCL A;  2B6C A;  1N52 A;  2R03 A;  5FZR A;  2R5S A;  2DZN A;  2Y4U A;  4JVS A;  1OCR E;  3PVL A;  1OWN A;  4BER A;  2ETC A;  4AM9 A;  3L6A A;  4C0E A;  5AQ7 A;  4EPZ A;  2IO3 C;  5BUZ A;  3F6Q A;  2HR2 A;  3NF1 A;  2GRR B;  3BG0 B;  2OEV A;  1D8E A;  3PZ4 A;  4CDR A;  4B89 A;  4XZ4 A;  2P9N G;  1DVP A;  2EIJ E;  2IOS A;  1WY6 A;  1YYH A;  2KC7 A;  3PEU B;  3ASH A;  3AG2 E;  4A1S A;  4K5C A;  4Q69 A;  3SFX A;  5A7D B;  5FQ7 A;  3ISM C;  3AAA C;  3MKQ B;  3MYV A;  4U8V D;  1H2U A;  1K1B A;  3CLJ A;  4GA2 A;  4XX5 A;  2YNQ A;  1N0R A;  2RFA A;  4GMR A;  2LNI A;  2WVI A;  3RO3 A;  3NOG D;  3DXM G;  4J8D A;  2I2O A;  3ASG A;  4MKT A;  3FTS A;  4JD2 G;  2IO2 C;  1K1A A;  2IQC A;  3CQC B;  4FUL A;  4E6H A;  3QDN A;  1BI8 B;  4BTA A;  4BX8 A;  4MBG A;  3RAU A;  3U4T A;  2BKK B;  3CVN A;  1FT1 A;  2PM7 A;  4I43 A;  4L2Y A;  5D66 A;  3ABK E;  4ACK A;  1TEZ A;  5T8I A;  4A3V A;  3ENE A;  4J8E A;  3FUH A;  3TL5 A;  2PQR A;  1MJ0 A;  3KAE A;  3CHQ A;  4G11 A;  1JPL A;  4L1B A;  3B7B A;  4HRM B;  4H7X A;  3GW4 A;  1FVH A;  5AQB A;  2WXK A;  4TXQ A;  1NZN A;  4O1O A;  3LY8 A;  3UPV A;  4K5A B;  4JL0 A;  3SGH A;  5FIN A;  3ZVV A;  3U3W A;  5AQA A;  4GTS A;  3HIZ A;  5FQ4 A;  2P58 C;  3AS5 A;  5IY5 E;  2DZO A;  3SY2 A;  4GTO A;  1HS6 A;  3CIA A;  4U04 A;  4ANU A;  3UM3 A;  1V54 E;  4DRX E;  5ANL A;  3NB2 A;  3QKY A;  3UMV A;  4J8Y A;  4DUI A;  1YMP A;  4RVB A;  5FWQ A;  3CVV A;  3QB2 A;  2DIW A;  3FTV A;  3KEZ A;  3OXL A;  2WQ6 A;  3DEP A;  3DBS A;  3RRN B;  3GZS A;  3G2V A;  3D9H A;  3ASD A;  3RO2 A;  2IF4 A;  4G1T A;  3EUV A;  2J09 A;  1ELR A;  4HOU A;  4E85 A;  3KSL A;  3L08 A;  5AEN A;  5AAO A;  3ZXP A;  4HRL A;  3APD A;  2L0I A;  3V30 A;  3CVW A;  3OTN A;  1XGW A;  4B94 A;  5EDS A;  3FTW A;  3O48 A;  1E8Z A;  3PRZ A;  5BT1 A;  4AOF A;  3B7R L;  4WUY A;  4FHK A;  3MCX A;  5LCW C;  3U9W A;  4QQI A;  4B8A A;  4L9P A;  5CED B;  4C48 B;  4JC8 A;  5D2M C;  4PH4 B;  1N9A A;  2WXF A;  3FH7 A;  4CDN A;  4IUL A;  3SQV A;  3FUI A;  4OVU A;  4FU3 A;  5M72 A;  4WNE A;  3R7Q A;  1JWF A;  5EIL A;  3HXB A;  3Q78 A;  5BV0 A;  3ZFW A;  3SFZ A;  4BWR A;  3IXE A;  4IRU A;  3AU4 A;  3FHE A;  4N2S A;  3UT4 A;  2V4H C;  4G2V A;  4L23 A;  2F8X K;  1A17 A;  1SA4 A;  1U3C A;  1SW6 A;  3NAW A;  2VGE A;  3R7R A;  3PUK A;  1OUV A;  5AJD A;  4HOQ A;  1NA3 A;  5FQ6 A;  4AY5 A;  1UJK A;  2YHC A;  4AIF A;  3B7T A;  3RIB A;  3CVY A;  3UKR G;  3OAW A;  2FBN A;  4GTP A;  4U0Z A;  4EZL A;  2FI7 A;  3ZW3 A;  3PNL B;  3R9A B;  5FIO A;  1ZB1 A;  4U7E B;  1E8W A;  3FU0 A;  3B13 A;  3CGH A;  4C0M A;  1K8K G;  3DWL G;  3UM0 A;  2ZGG A;  2PM6 A;  2OVB A;  4AVX A;  1NA0 A;  3QAR A;  3C3O A;  4LG6 A;  4WWN A;  4UWG A;  1YA0 A;  5EYP F;  1U3D A;  3FUK A;  3PZD A;  4UWK A;  4DI4 A;  5LP0 A;  3ONK A;  4N5Q A;  2WMN A;  1JCR A;  5G2N A;  3B7U X;  2I1J A;  3MV2 B;  5JJT A;  3CVL A;  4DX1 A;  4U63 A;  1HG5 A;  1TNO A;  5CBN A;  3ULQ A;  3SZ7 A;  4MLP A;  4NAC A;  4UWF A;  1RZ4 A;  3CHR A;  2GRP B;  2Y1L E;  4FAD A;  2V4L A;  2C2L A;  3E37 A;  4AY6 A;  3Q49 B;  2RG8 A;  3BEE A;  3HXC A;  2YHE A;  5AN8 A;  4KMO A;  2OEW A;  4G8K A;  3HVE A;  1AP7 A;  1OT8 A;  1OWP A;  4I6E A;  5CCM A;  4HXI A;  3FTX A;  2OOE A;  1OCZ E;  1N94 A;  4ATZ D;  2ZIS A;  3UT8 A;  4RG6 A;  2XS8 A;  1FPP A;  4WAF A;  4GZ5 A;  4HLE A;  2WB2 A;  1HH8 A;  3CV0 A;  2EIM E;  4B8C B;  1NL4 A;  3O4Z A;  3EDT B;  3JXI A;  4Y6W A;  3CHP A;  3JUI A;  1IHB A;  2H6F A;  3ASO E;  3EU5 A;  2PZI A;  4ANV A;  4C9B B;  2DYR E;  2FF4 A;  4F6R D;  1TN8 A;  3SF4 A;  5KWD A;  3GZ2 A;  3TWU A;  3ZHE B;  3PDN A;  1BU9 A;  1X81 A;  3ZGQ A;  3LDZ A;  4F1P A;  3J5P A;  4GB9 A;  4EEC A;  4GMJ A;  2R17 C;  4A55 A;  1QNF A;  3PH0 C;  3QC1 A;  1XNF A;  3AG1 E;  5FT9 A;  3L22 A;  3JQ1 A;  3I5P A;  5BNW A;  4OVV A;  1H6O A;  4UWL A;  3DEO A;  4JHJ A;  2F37 A;  3URZ A;  2OCC E;  1SQM A;  5LOZ A;  2A5U A;  4FC8 A;  1H19 A;  3EHQ A;  1TYQ G;  2EQX A;  1OCO E;  1AWC B;  5HRY A;  2KBX A;  4BX9 A;  2LUH A;  1U2V G;  4AV7 A;  4JB8 P;  3Q5M A;  3Q4A B;  4FLH A;  4FHJ A;  3QK0 A;  4Y6C A;  2JLB A;  3TWX A;  4M3O A;  3PE4 A;  2E0I A;  4Z68 A;  3FEY A;  4U8Y D;  1TN7 A;  4GCN A;  1Y6I A;  5E76 A;  3ZPJ A;  3HG0 D;  2WXI A;  4EBA A;  3PEV B;  3L82 A;  3UUX A;  4ILI A;  2FUL A;  4ACL A;  5ANR A;  1Z3X A;  3ZYK A;  3CK8 A;  1IKN D;  4B93 B;  4LRZ A;  4FP7 A;  3TWT A;  3V79 K;  4G23 A;  3VLF A;  1H2T C;  1D9S A;  5CRU A;  3PNT B;  5B1B E;  4I6G A;  2XRY A;  4F53 A;  2C0M A;  2JEK A;  4F3V A;  5ARF A;  1X5B A;  3RRU A;  3UKU G;  3CSF A;  4XKC A;  3TWW A;  4PS8 A;  3FDH A;  2JAB A;  4GPM A;  4I9C A;  4RG9 A;  4HI9 A;  1YCS B;  1K3Z D;  2L6J A;  2LSV A;  3CVU A;  3DRA A;  3T9K A;  2R02 A;  1TNU A;  1OXJ A;  1HG2 A;  4UQZ A;  3ONL A;  1MX2 A;  3V2X A;  2KM4 A;  5CBO A;  2XCB A;  2XHE A;  4HOS A;  2XPY A;  4LNG A;  3FUN A;  3AS8 A;  1MYO A;  4CGW A;  3Q9U C;  3CQG B;  2ZU6 B;  2WPV A;  4GAA A;  4GA0 A;  1JCS A;  5EKQ D;  3BG1 B;  3DSX A;  4HBD A;  4DK5 A;  3IBE A;  5KCM A;  4AXH A;  3D9P A;  2IJG X;  5A23 A;  1LTX A;  2WXG A;  2KCV A;  1SVX A;  3BUA A;  5T4Y A;  3HXF A;  2XQ0 A;  3D9O A;  2ZIR A;  3MA5 A;  3DXK G;  4EZJ A;  3HVE B;  3Q15 A;  1MX6 A;  5FZS A;  2VTB B;  2P9S G;  4LEU A;  5JHB A;  3J5Q B;  3CHO A;  1N4Q A;  4AP2 A;  3FUE A;  3HHM A;  1UN8 A;  3G2U A;  3C72 A;  3PUJ A;  3PZ3 A;  3S2A A;  1V55 E;  5FZQ A;  1IQR A;  5G05 J;  2H6I A;  1VDY A;  2Y4T A;  1GW6 A;  2WQ7 A;  1S64 A;  3L13 A;  2GW1 A;  3HXE A;  4RLY A;  1EDU A;  2HE0 A;  3L16 A;  1S0P A;  3E33 A;  3FU3 A;  5AQ9 A;  3ZHE A;  1HO8 A;  1O1T A;  5KJK A;  5J08 A;  2AWI A;  2KZT B;  3ZYQ A;  1NFI E;  4DPR A;  1WDY A;  1LD7 A;  4NUR A;  4XI0 A;  5C1D A;  3VLE A;  3CKB A;  3ZIM A;  2CHX A;  2VSY A;  1N54 A;  3RSE G;  4F7A A;  2X6J A;  3P1U A;  1Z5S C;  4KVM A;  2F8Y A;  2LO6 A;  3CK9 A;  2GRQ B;  2YQ8 A;  2AXZ A;  2Y0B G;  4HQD A;  3FUJ A;  5CRV A;  1BI7 B;  3PZ2 A;  3SI5 A;  3NBN B;  2QYU A;  2HM8 A;  5B1A E;  4APF A;  3D9M A;  3EHN A;  3S7J A;  1Y8M A;  4KZ0 A;  4G26 A;  3TWS A;  1QQE A;  4M7C A;  2H6H A;  5EX3 A;  5EID A;  2R2L A;  3RKV A;  2RD0 A;  1FVF A;  3ML8 A;  3TWQ A;  2QFC A;  2XPI A;  5FTP A;  1E8X A;  2AJA A;  3HDX A;  2VGX A;  3OXF A;  3ZEF A;  2OVF A;  4YDW A;  2ION A;  3RRM B;  5CMW A;  5G55 A;  3FWV A;  5JJ7 A;  2P9P G;  4DX6 D;  2ETA A;  4BFR A;  4NQ0 A;  2MHK A;  2BKG A;  2CHZ A;  2VSN A;  3IKO B;  4I1A A;  1MZC A;  4ANW A;  4BT8 A;  3FH5 A;  3NZS A;  3D9I A;  2NXP A;  3Q7A A;  3G2W A;  3NOC D;  4U07 A;  3D3M A;  3RJV A;  2I1K A;  3I4G A;  1KZP A;  3EIJ A;  3QNK A;  3P2B A;  1S63 A;  3FY4 A;  2GRL A;  2PNN A;  2F0Y A;  2QYJ A;  4KYO B;  4BSZ B;  1HFA A;  1JWG A;  3EJN A;  1E7U A;  1TJF A;  2WXN A;  2XZD G;  1KPS B;  3MJW A;  3TXN A;  4HFG A;  3JQ0 A;  3UIP C;  2NSZ A;  2KAT A;  2XGO A;  2J8S D;  3FEX A;  4HS2 A;  2X6F A;  2WM9 A;  3ZUV B;  1BPO A;  4JXT A;  2NYJ A;  5JJ6 A;  3W9G A;  4LNU D;  2LXM A;  1E8Y A;  1EF1 C;  2WXO A;  4O60 A;  4U96 D;  4JZY A;  4JHK A;  4RQI A;  2V0P A;  5T3R A;  2LAI A;  4H7Y A;  4JHR A;  1BD8 A;  1TNZ A;  3G2T A;  4GTT A;  1A5E A;  3JCK C;  5BV1 A;  2LAH A;  3UTM A;  2E2E A;  3S7B A;  1HXI A;  3ML9 A;  1FT2 A;  3E34 A;  1N11 A;  2Y69 E;  2Y3A A;  1PC2 A;  2BED A;  3QJZ A;  5AYW D;  5KBA A;  2WXL A;  5KNG A;  3ASF A;  3QWV A;  2WXJ A;  4I1M A;  2X6H A;  1Z3Y A;  4FJZ A;  1Q2Z A;  4LUN U;  3RK6 A;  5KJL A;  4O1P A;  3Q79 A;  5ITZ F;  3FU6 A;  3ULY A;  4YND A;  2DWZ A;  4JPS A;  2MOW A;  3FFL A;  4OYS A;  4RSY A;  2BUG A;  2I6H A;  3PS6 A;  1LD8 A;  5JHA A;  2GRO B;  4PDX A;  2KXP C;  3C98 A;  5EYL A;  5B3S E;  4XI9 A;  3CVX A;  5LFA A;  4YVO A;  3SD5 A;  4IN3 B;  3LXU X;  2VJ8 A;  1IYG A;  4BT9 A;  2FO7 A;  4WNG A;  2XEH A;  1TN6 A;  4JEH A;  2R05 A;  1UN9 A;  3AJI A;  4YDE A;  3PRE A;  3SBT B;  4GTM A;  1TJC A;  4LER A;  1N4R A;  3APC A;  4NIK A;  3T5X A;  1G3N B;  1H6P A;  1S70 B;  2DVW A;  2CHW A;  3UIN C;  3L17 A;  4HLL A;  1N0Q A;  4HOT A;  1DC2 A;  2ZGD A;  3BU8 A;  4CEM A;  4OAV B;  2ETB A;  4GCO A;  2DBA A;  4BET A;  5ENT D;  2UWJ G;  3WXX A;  3V31 A;  2XS1 A;  5G04 C;  2LSU A;  1OWL A;  3AS4 A;  4XE0 A;  5KJM A;  2IEJ A;  4GYO A;  3KSQ A;  4PS7 A;  3CHM A;  3JXJ A;  2FO1 E;  3CST A;  1PAQ A;  3B95 A;  3HYM B;  3ABM E;  1O1S A;  4J7W A;  5CHE E;  2VGX B;  3RU0 A;  5ARG A;  1WM5 A;  3LVR E;  4GZC A;  4BEP A;  1EPU A;  3DSW A;  3UX4 A;  1SZA A;  2J4B A;  1L5J A;  1ZBP A;  4ILG A;  5D0O D;  1WAO 1;  3QWW A;  4X8Q A;  3D9L A;  2XZT G;  3SNX A;  5KJN A;  2V8S E;  2X38 A;  3UIO C;  5BW8 C;  2J07 A;  2RKK A;  3LJ3 A;  4N3B A;  4TXR A;  4EHM A;  5BPP A;  5CEA A;  3ZXS A;  4CT4 A;  3QWP A;  4KZC A;  5ENS D;  4WWO A;  3MV3 B;  2WMO A;  4GZ3 A;  4U0S A;  4N39 A;  4G25 A;  3VLD A;  2AW6 A;  3I3N A;  2J08 A;  4KXK B;  5LX8 A;  2J9Q A;  3S7D A;  4YDO A;  2EIL E;  4N5C A;  2XEN A;  4PS3 A;  4GML A;  3X2Q E;  3LEW A;  2ILR A;  1JCQ A;  3HRA A;  4FA6 A;  3ESK A;  3EU9 A;  3LS8 A;  5EX0 A;  1B89 A;  3DSS A;  3SO8 A;  3UI2 A;  4HOR A;  4UWH A;  2WXH A;  1HX8 A;  2UY1 B;  1UOH A;  5H7P A;  2LXL A;  2RFM A;  1MX4 A;  2UY1 A;  4ANX A;  4HVB A;  5AIJ A;  4UQX A;  4URK A;  1E90 A;  3D9J A;  4W9R A;  1O1R A;  5JMN D;  4DX2 A;  3LYA A;  3FUL A;  5EN5 D;  3C5R A;  4JA7 A;  3JYS A;  4GYY A;  4A63 B;  3T5V A;  3VTY A;  3CR3 A;  1WG0 A;  5BXU A;  4Q94 A;  2V5F A;  2C0L A;  1NP7 A;  4ABN A;  4U8H A;  1D8D A;  3JUE A;  2GRM A;  3APF A;  3KS2 A;  4IYP A;  3V2O A;  4UI9 C;  5G04 J;  4A1G A;  2XPZ A;  4HI8 A;  2WXP A;  4ME2 A;  5DBK A;  2CFU A;  4HRN A;  3S7F A;  3DST A;  3FUF A;  3ABL E;  5DIZ A;  3MKQ A;  2QC9 A; 
#chains in the Genus database with same CATH homology
 4GZ5 A;  4HLE A;  2IU1 A;  3D9I A;  5CMY A;  4I2Z A;  2WB2 A;  1HH8 A;  3CV0 A;  3AU5 A;  3MKR A;  1HE8 A;  2M63 A;  4B8C B;  3ZYL A;  4LCT A;  2NXP A;  3O4Z A;  4UI9 J;  2X6I A;  3G2W A;  3EDT B;  2VYI A;  3D9K A;  4D10 C;  2VQ2 A;  3TG5 A;  1P5Q A;  1ZU2 A;  4Y6W A;  3TGO A;  4U07 A;  3CHP A;  3JUI A;  3D3M A;  3RJV A;  3UT7 A;  2I1K A;  5FJY A;  3I4G A;  2I9C A;  3FUM A;  2PZI A;  4DJA A;  4ANV A;  4YVQ C;  2KCL A;  4C9B B;  3N71 A;  1N52 A;  2FF4 A;  4WWP A;  3EIJ A;  3SF4 A;  3QNK A;  2XGM A;  4NRH B;  5FZR A;  3P2B A;  3GZ2 A;  3TJP A;  2R5S A;  2Y4U A;  3FY4 A;  4JVS A;  2GRL A;  3ZHE B;  3PDN A;  3PVL A;  2XRZ A;  1OWN A;  3ZGQ A;  1OWM A;  4KYO B;  4AM9 A;  3L6A A;  4C0E A;  3LDZ A;  5D0Q D;  4EPZ A;  5BUZ A;  1HFA A;  1JWG A;  3EJN A;  1E7U A;  2HR2 A;  1TJF A;  2WXN A;  3NF1 A;  3BG0 B;  3MJW A;  4GB9 A;  4EEC A;  1E7V A;  4GMJ A;  4CDR A;  4B89 A;  2R17 C;  4XZ4 A;  1QNF A;  4A55 A;  4R7L A;  3TXN A;  3FP3 A;  1DVP A;  3PH0 C;  4HFG A;  3OXG A;  3QC1 A;  3JQ0 A;  1XNF A;  2IOS A;  1SZ9 A;  1WY6 A;  1EYH A;  3PEU B;  2KC7 A;  3CVP A;  2NSZ A;  5FT9 A;  4I6J A;  2KAT A;  3L22 A;  2CG3 A;  4V3I A;  2X6K A;  2XGO A;  3ASH A;  3JQ1 A;  3I5P A;  3FEX A;  4A1S A;  4HS2 A;  5BNW A;  2L0T B;  2J4D A;  2WM9 A;  2X6F A;  1MQS A;  3MZL B;  5FQ7 A;  5A7D B;  4Q69 A;  3MKQ B;  4OVV A;  5FQ8 A;  5HQ8 A;  1BPO A;  3MYV A;  1H2U A;  4JXT A;  3CLJ A;  4GA2 A;  4XX5 A;  4UWL A;  2YNQ A;  2BF0 X;  2LNI A;  2WVI A;  5JJ6 A;  3RO3 A;  4CGV A;  4JHJ A;  3IV0 A;  4J8D A;  3URZ A;  5LOZ A;  1E8Y A;  1SQM A;  2I2O A;  3ASG A;  2A5U A;  4FC8 A;  1H19 A;  4MKT A;  3B7S A;  1EF1 C;  2EQX A;  2WXO A;  3GZ1 A;  3FTS A;  4JZY A;  4JHK A;  4XIF A;  3FH8 A;  2V0P A;  2Q7F A;  5T3R A;  2IQC A;  3D9N A;  2LAI A;  3CQC B;  3IHY A;  4FUL A;  4BX9 A;  3QDN A;  4E6H A;  4H7Y A;  3I4R B;  4DLQ A;  2VSO E;  4I9E A;  4JHR A;  4BTA A;  3CKC A;  4AV7 A;  4BX8 A;  3U4T A;  3G2T A;  4N2Q A;  3Q5M A;  4EBA G;  3CVN A;  3L54 A;  3JCK C;  5BV1 A;  2PM7 A;  3ZN3 A;  3Q4A B;  2LAH A;  3FUD A;  4I43 A;  2E2E A;  4FHJ A;  4FLH A;  4L2Y A;  4UI9 K;  3S7B A;  2VTB A;  1HXI A;  2CFZ A;  3FTU A;  3ML9 A;  3QK0 A;  4ACK A;  4N3A A;  1TEZ A;  5T8I A;  4Y6C A;  4A3V A;  3ENE A;  4J8E A;  3FUH A;  2Y3A A;  4AEZ C;  3TL5 A;  2JLB A;  1PC2 A;  2PQR A;  3KAE A;  4J0U A;  3CHQ A;  3QJZ A;  1ELW A;  3PE4 A;  4G11 A;  2E0I A;  4K03 A;  4M3O A;  5AYW D;  3FEY A;  4MS6 A;  1JPL A;  2WXL A;  4L1B A;  4GU5 A;  3ASF A;  4I1O B;  3QWV A;  4H7X A;  4I2W A;  4B0Z A;  3GW4 A;  1FVH A;  2IOL A;  4GCN A;  1Y6I A;  2WXJ A;  4G24 A;  4I1M A;  2WXK A;  4N3C A;  5E76 A;  1NZN A;  2X6H A;  1Z3Y A;  4FJZ A;  1H6K A;  2WXQ A;  3LY8 A;  4LUN U;  3UPV A;  3RK6 A;  5AJL A;  5KJL A;  4JL0 A;  3ZPJ A;  2WXI A;  4EBA A;  3PEV B;  2BTD A;  3SGH A;  3Q47 B;  3ZVV A;  4JA9 A;  3FTY A;  4U0U A;  3FU6 A;  2A4Z A;  3U64 A;  4YND A;  1H0A A;  2MOW A;  3FFL A;  4JPS A;  4OYS A;  4RSY A;  3FTZ A;  2BUG A;  2I6H A;  4WND A;  3U3W A;  3PS6 A;  3CK7 A;  3UUX A;  4ILI A;  2FUL A;  3HIZ A;  5FQ4 A;  3DPD A;  4ACL A;  3QAQ A;  5JHA A;  4PDX A;  5ANR A;  1Z3X A;  3ZYK A;  3C98 A;  4O6F A;  3CK8 A;  3AS5 A;  4J6I A;  4CT0 A;  4I17 A;  2HO1 A;  4LRZ A;  4XI9 A;  3CVX A;  4FP7 A;  1HS6 A;  3CIA A;  4U04 A;  5LFA A;  4ANU A;  2OV8 A;  4DI3 A;  4G23 A;  4YVO A;  3VLF A;  2AXU A;  3SD5 A;  4J8F A;  4IN3 B;  4DLO A;  4JEU A;  1H2T C;  3LXU X;  2VJ8 A;  5ANL A;  3PNT B;  1IYG A;  4BT9 A;  3LKU A;  1HU3 A;  2FO7 A;  3QKY A;  4I6G A;  2XRY A;  4WNG A;  4JEH A;  3UMV A;  1IHG A;  1UN9 A;  3MX3 A;  4F53 A;  2C0M A;  2JEK A;  4ILH B;  4RVB A;  5FWQ A;  4F3V A;  3CVV A;  3PRE A;  3QB2 A;  4TRQ A;  5ARF A;  1X5B A;  2DIW A;  3FTV A;  3KEZ A;  1W3B A;  3CSF A;  3OXL A;  4XKC A;  3RRU A;  2WQ6 A;  3SBT B;  1TJC A;  4PS8 A;  4LER A;  3DBS A;  3FDH A;  3RRN B;  3GZS A;  4FLB A;  3SBS A;  3G2V A;  4I9C A;  4RG9 A;  3APC A;  5E75 A;  2L6J A;  2XGS A;  3ASD A;  4GZD A;  2FEZ A;  3LY7 A;  4GA1 A;  3RO2 A;  3T5X A;  2LSV A;  1HF8 A;  2IF4 A;  3CVU A;  1LF8 A;  4G1T A;  1MHQ A;  2J09 A;  2CHW A;  1ELR A;  3L17 A;  4HOU A;  4E85 A;  1HG2 A;  4UQZ A;  3L08 A;  3ONL A;  3CEQ A;  5AEN A;  2KM4 A;  3K9I A;  4HOT A;  2XCB A;  2XHE A;  4HOS A;  4CEM A;  2XPY A;  4GCO A;  2DBA A;  1E96 B;  3APD A;  2UWJ G;  3WXX A;  3FUN A;  2L0I A;  3AS8 A;  3IEG A;  4ATG A;  3CVW A;  5G04 C;  2LSU A;  4CGW A;  1OWL A;  3AS4 A;  3CQG B;  5A6C A;  3OTN A;  1HZ4 A;  1XGW A;  3CVQ A;  4B94 A;  2X3M A;  2ZU6 B;  5EDS A;  4XE0 A;  5KJM A;  2WPV A;  3FTW A;  3O48 A;  4GYO A;  1E8Z A;  4GAA A;  3CHM A;  4PS7 A;  5G05 C;  4GA0 A;  3PRZ A;  4PUC A;  5EKQ D;  3CST A;  1PAQ A;  5BT1 A;  2VSX E;  4AOF A;  3BG1 B;  3B7R L;  3HYM B;  4WUY A;  3MEK A;  4TV3 A;  1PY1 A;  4DK5 A;  4FHK A;  5J90 A;  1Z6T A;  3IBE A;  5CHE E;  5KCM A;  2VGX B;  4JW1 A;  3RU0 A;  5ARG A;  4AXH A;  3EHM A;  1WM5 A;  3D9P A;  2IJG X;  3MCX A;  5LCW C;  5A23 A;  3U9W A;  4B8A A;  3LVR E;  4GZC A;  4JC8 A;  3QOU A;  1QZ2 A;  1H2V C;  2WXG A;  2KCV A;  2NC9 A;  5T4Y A;  2XQ0 A;  1EPU A;  4L7T A;  3D9O A;  4PH4 B;  2WXF A;  2OND A;  3FH7 A;  4CDN A;  2XEV A;  3MA5 A;  4IUL A;  3SHF A;  3HVE B;  4EZJ A;  3Q15 A;  3UX4 A;  1SZA A;  3FUI A;  4OVU A;  2J4B A;  1L5J A;  4FU3 A;  4WNE A;  4APO A;  5M72 A;  1ZBP A;  4ILG A;  5FZS A;  3R7Q A;  1JWF A;  3ZRH A;  4L2L A;  5D0O D;  3CHS A;  1WAO 1;  4BSX A;  3QWW A;  2VTB B;  3D9L A;  4LEU A;  5BV0 A;  5JHB A;  3SNX A;  3ZFW A;  3CHO A;  3SFZ A;  5KJN A;  2QY7 A;  2V8S E;  4AP2 A;  2X38 A;  1ELK A;  3FUE A;  4BWR A;  4IRU A;  3AU4 A;  2WQH A;  3FHE A;  5BW8 C;  4N2S A;  3UT4 A;  2J07 A;  3LJ3 A;  3HHM A;  4G2V A;  4N3B A;  4L23 A;  1UN8 A;  3G2U A;  1INZ A;  2IFU A;  1A17 A;  3PUJ A;  5BPP A;  1U3C A;  3ZXS A;  4CT4 A;  3QWP A;  3S2A A;  3EIQ C;  5FZQ A;  4EQF A;  1IQR A;  5G05 J;  4KZC A;  4WWO A;  3MV3 B;  3R7R A;  4CDM A;  1VDY A;  2WMO A;  2Y4T A;  3PUK A;  4EZK A;  1GW6 A;  4GZ3 A;  2WQ7 A;  5LCW J;  1OUV A;  4U0S A;  5AJD A;  3IHV A;  3L13 A;  4KVO A;  2GW1 A;  4HOQ A;  1EDU A;  1NA3 A;  4WNF A;  1KT1 A;  4GYW A;  3L16 A;  4N39 A;  1S0P A;  3FU3 A;  5C2Y A;  4G25 A;  3E4B A;  5FQ6 A;  1HO8 A;  3ZHE A;  3VLD A;  2AW6 A;  5ENN A;  1DNP A;  3I3N A;  2J08 A;  4KXK B;  4AY5 A;  1UG3 A;  1UJK A;  5KJK A;  4QFV A;  2YHC A;  4AIF A;  3B7T A;  5LX8 A;  2J9Q A;  3RIB A;  5J08 A;  3CVY A;  2AWI A;  4CCA A;  2KZT B;  2GGF A;  3TAX A;  3S7D A;  3OAW A;  2FBN A;  3ZYQ A;  2PQN A;  4U0Z A;  4DPR A;  3ESL A;  4EZL A;  2FI7 A;  2L9B A;  4N5C A;  4NUR A;  4XI0 A;  3ZW3 A;  3U66 A;  5C1D A;  3PNL B;  3VLE A;  3CKB A;  4PS3 A;  2CHX A;  3R9A B;  3LVQ E;  3ZIM A;  1E8W A;  2VSY A;  3GYZ A;  4KT6 B;  1N54 A;  3B13 A;  3FU0 A;  4GML A;  3UQ3 A;  3LEW A;  3CGH A;  4MRU A;  3FU5 A;  2ILR A;  4F7A A;  4C0M A;  2X6J A;  2CG2 A;  3LCA A;  3P1U A;  1FCH A;  2PL2 A;  3T8M A;  1UJJ A;  3NZU A;  2PM6 A;  4KVM A;  4FA6 A;  2OVB A;  2DCP A;  3TG4 A;  4AVX A;  4A3T A;  1NA0 A;  3ESK A;  3QAR A;  1JUQ A;  3LS8 A;  3LPZ A;  5EX0 A;  1B89 A;  1UW4 B;  2LO6 A;  4K0R A;  4Q96 A;  4WWN A;  4GZ6 A;  4KBQ A;  4UWG A;  3KD7 A;  4HOR A;  3CK9 A;  1YA0 A;  4UWH A;  3ZYM A;  3TXM A;  2WXH A;  4F1S A;  1U3D A;  2YQ8 A;  1HX8 A;  2UY1 B;  3FUK A;  2AXZ A;  5CCL A;  3PZD A;  4UWK A;  3FUJ A;  4DI4 A;  5LP0 A;  3ONK A;  2WMN A;  5G2N A;  4AJW A;  2UY1 A;  3SI5 A;  4ANX A;  4HVB A;  3B7U X;  2I1J A;  3MV2 B;  5AIJ A;  4UQX A;  4URK A;  5JJT A;  2HM8 A;  3CVL A;  1KT0 A;  1E90 A;  4U63 A;  3PE3 A;  2YIN A;  3D9J A;  4APF A;  1HG5 A;  4W9R A;  3MGB A;  4FJY A;  1IQU A;  4P29 A;  3ULQ A;  3SZ7 A;  4MLP A;  3D9M A;  3G2S A;  3EHN A;  4NAC A;  3S7J A;  1Y8M A;  3FUL A;  3LYA A;  4KZ0 A;  4G26 A;  4UWF A;  1QQE A;  2VGY A;  4JA7 A;  3JYS A;  5EX3 A;  4GYY A;  3CHR A;  1OWO A;  3RKV A;  2RD0 A;  4BTB A;  4J8S A;  1FVF A;  3VTY A;  2KZT A;  3T5V A;  3ML8 A;  3VTX A;  3CR3 A;  2R59 A;  4FAD A;  2J49 A;  2XPI A;  2QFC A;  3NQP A;  5FTP A;  2V4L A;  1E8X A;  3HDX A;  2C2L A;  2VGX A;  3OXF A;  4Q94 A;  3ZEF A;  2OVF A;  2V5F A;  4AY6 A;  2WXM A;  3RRM B;  2C0L A;  2ION A;  5CMW A;  2KCK A;  3LY9 A;  1NP7 A;  3Q49 B;  4U8H A;  2RG8 A;  3FWV A;  5G55 A;  4ABN A;  2GRM A;  3BEE A;  5JJ7 A;  1KLX A;  2YHE A;  3APF A;  3KS2 A;  4GPK A;  4KMO A;  2AVP A;  4TUU A;  4BFR A;  4NQ0 A;  4CRW A;  2MHK A;  4IYP A;  4XKB A;  4UI9 C;  3HVE A;  2CHZ A;  5G04 J;  4A1G A;  2XPZ A;  1OWP A;  2AXV A;  2VSN A;  3IKO B;  4I6E A;  2MRI A;  2WXP A;  4HXI A;  4ME2 A;  5CCM A;  3FTX A;  4I1A A;  5DBK A;  2OOE A;  2CFU A;  4ANW A;  2HYZ A;  4BT8 A;  3S7F A;  5HI7 A;  3FH5 A;  4BY6 A;  3FUF A;  3UT8 A;  4RG6 A;  2P58 C;  4UQY A;  5DIZ A;  3MKQ A;  4WAF A;  2WXR A;  2XCC A;  3NZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...