2LNIA

Solution nmr structure of stress-induced-phosphoprotein 1 sti1 from homo sapiens, northeast structural genomics consortium target hr4403e
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
133
structure length
133
Chain Sequence
b'MGHHHHHHSHMNPDLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stress-induced-phosphoprotein 1
publication title Northeast Structural Genomics Consortium Target HR4403E
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 46
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lniA00
5G05C 2PQRA 2VYIA 3URZA 2IF4A 5M72A 4NRHB 5FT9A 3PE3A 5A6CA 2P58C 4O6FA 3CVPA 4GZ3A 4WUYA 3KAEA 4RG9A 2FI7A 1QZ2A 1YA0A 3PDNA 4GA1A 4UI9K 3ZPJA 2XEVA 3QWWA 2GW1A 2KCLA 3OXFA 2ONDA 4J8DA 2XCBA 3ZGQA 4BT9A 1ZU2A 3HYMB 4U07A 3QWVA 4RG6A 3NF1A 4WNGA 5CHEE 2XCCA 4GYOA 4GA2A 3QKYA 5A7DB 3QOUA 3ZN3A 1TJCA 1PC2A 4F3VA 3GZ2A 3CVQA 4I9EA 4GPKA 5EKQD 3ZFWA 5D0QD 3CV0A 4H7YA 3KS2A 2WQHA 3S7JA 2IFUA 2YHCA 4JL0A 4WNEA 3R9AB 5ARGA 2VSNA 1A17A 2V5FA 4BTAA 4G2VA 4AM9A 4GYYA 4N2SA 3LPZA 2FEZA 2LNIA 5EX0A 4GCOA 3QDNA 2PL2A 1NZNA 3ASDA 3U3WA 2PQNA 2OOEA 4CGVA 4ABNA 4UI9J 4YNDA 4GYWA 1KT0A 1Y8MA 4I9CA 3LY9A 4HOSA 5BW8C 2HYZA 2PZIA 5FJYA 2XPIA 3ESKA 3BEEA 2WPVA 5D0OD 2KATA 4KYOB 2FF4A 3LKUA 4U04A 3AS4A 3ASGA 3CEQA 3S7DA 2Y4UA 5JJ6A 4UI9C 5LCWC 4G23A 4EQFA 4XI9A 3RO3A 3N71A 4G1TA 4GCNA 2KCVA 4Y6WA 5C1DA 2HR2A 3ASFA 2XGOA 4G24A 4BTBA 3JYSA 4U0SA 3ZHEB 3RU0A 1IYGA 3VTYA 5DIZA 4BWRA 4G26A 4I17A 4HOUA 4W9RA 3O48A 1NA3A 1KLXA 1WM5A 2LSVA 3S7BA 4ME2A 3CK9A 2VGYA 2FBNA 3FP3A 1WAO1 2KCKA 3Q15A 4J8EA 3TG4A 3PE4A 1W3BA 3MEKA 1IHGA 5AYWD 3ZHEA 3AS8A 4APOA 1B89A 3WXXA 3QWPA 3MA5A 3E4BA 2L6JA 4XIFA 4JA9A 5KJKA 2UY1B 3MV3B 1E96B 1OUVA 2VGXA 2KC7A 2MHKA 5CCLA 2R5SA 5FZRA 3LYAA 4J0UA 4GA0A 4IN3B 5G04J 4I1AA 4CGWA 3TGOA 3IEGA 5HQ8A 4UQYA 4I2WA 3CK7A 2C2LA 5KJLA 4KBQA 2UWJG 1KT1A 3LCAA 4BT8A 5BNWA 3RIBA 4N39A 3LY8A 5FZQA 3CKBA 2UY1A 3LY7A 4N3AA 1QQEA 4AY5A 2XGMA 5HI7A 4CDRA 3RJVA 4HORA 4JA7A 4GZ5A 3SF4A 3Q47B 1ELRA 3OXGA 3CVNA 3RO2A 3UPVA 5EX3A 1HZ4A 3FWVA 2VQ2A 1FCHA 2YQ8A 2QFCA 3UQ3A 5FTPA 2Y4TA 4B94A 4N2QA 2HO1A 4AY6A 1HH8A 3RKVA 5DBKA 3U4TA 2FO7A 4N3BA 1NA0A 3UUXA 2NC9A 4G25A 4H7XA 2VGXB 4LEUA 4WNFA 1ELWA 3VTXA 1HXIA 2VSYA 4J8FA 2XGSA 1XNFA 2BUGA 3SZ7A 3MV2B 2C0MA 5KJNA 3Q4AB 5BT1A 4NQ0A 4UQXA 4Y6CA 5FZSA 2J9QA 5JJTA 5JJ7A 4XI0A 4U0ZA 3MKRA 4JHRA 4UQZA 2AVPA 2JLBA 4GZ6A 4HOTA 3TG5A 3CK8A 3EDTB 4A1SA 5KJMA 3OXLA 3GW4A 3Q49B 4I2ZA 4YVQC 4HOQA 2C0LA 1ZBPA 3FFLA 5G05J 3AS5A 3CKCA 3ULQA 4WNDA 3GYZA 2Q7FA 4YVOA 3ASHA 3KD7A 4AIFA 2DBAA 5CCMA 5ARFA 1P5QA 5G04C 3S7FA 3K9IA 3GZ1A 5LCWJ 3CVLA 4KXKB 3TAXA 2E2EA 4N5CA 4U0UA 3Q5MA 4N3CA 2I6HA 2LSUA
chains in the Genus database with same CATH superfamily
3ABKE 1IXVA 4NRHB 5FT9A 4L2YA 3NOCD 5A6CA 4F7AA 3NZSA 1Z6TA 2KZTB 3CVPA 1QNFA 4RQIA 4WUYA 4RG9A 4XKCA 2GRPB 1QZ2A 4FADA 2IQCA 4EZJA 4IYPA 3JUIA 4DPRA 4EBAA 3QWWA 3B13A 4KT6B 3D9LA 4ZFHA 1OWPA 4GTQA 3TJPA 2PM6A 2XRYA 1TNOA 3ZGQA 2P9IG 4OAVB 1Q2ZA 4CEMA 4RG6A 1H19A 4LCTA 2KZTA 1O1TA 2V0PA 4DX2A 2XCCA 4DLOA 3FTZA 3CSTA 5LP0A 4QFVA 5A7DB 3JQ0A 3QOUA 3ZEFA 3FUMA 4GTPA 4GMJA 2F0YA 1TJCA 5AQAA 3UM3A 2GRNB 4K03A 4I9EA 4GZDA 3ZFWA 5FWQA 1RZ4A 3FHEA 3S7JA 2YHCA 3LJ3A 5ARGA 2PM7A 2V5FA 4BTAA 2ETBA 5EYPF 3L08A 2BKKB 3BQOA 4RLYA 5EX0A 4GCOA 3RAUA 2OV8A 3HHMA 4WAFA 2PL2A 2PQNA 2OOEA 5AIJA 4YNDA 4GYWA 2YINA 3BU8A 1SW6A 4HFGA 1QYMA 1EYHA 2NYJA 5FJYA 2XPIA 3FTVA 1U3DA 2L6BA 3B7SA 3ESKA 3DSVA 5D0OD 3RRMB 3EHNA 2CFZA 5KNHD 4YDEA 3G2WA 4DRXE 5E76A 3LKUA 1MX4A 3ASGA 3CEQA 3S7DA 2H6HA 5JJ6A 4G23A 2KXPC 4WWPA 2XENA 4HLEA 3QB2A 4J8YA 3PH0C 3DSXA 2IEJA 3ASFA 5D66A 3C3QA 3UKRG 3EIJA 4U0SA 4DLQA 1IYGA 3VTYA 5DIZA 4UWFA 3SFZA 4HXIA 3G2UA 4TV3A 3PREA 5CBNA 4O1PA 3FU6A 2R05A 1H6PA 2LSVA 2WQ7A 2LAHA 1N54A 4BEPA 4F6RD 3Q15A 2RKKA 4BSXA 3CGHA 4EECA 2IU1A 2KM4A 4RSYA 1H2VC 3AS8A 3PNLB 3G2VA 3JQ1A 1B89A 2R59A 3FULA 4MKTA 4ANVA 3QWPA 3QNKA 3LXUX 3FEXA 5KJKA 2WB2A 4BSZB 2FO1E 1SA5A 5ENNA 2R5SA 3FY4A 5T4YA 3TWQA 3LYAA 1ELKA 4GA0A 2P9SG 1S63A 4IN3B 3UIPC 4I1AA 3PUKA 2PNNA 3ONKA 1JCRA 2AWIA 4B8CB 2UWJG 1KT1A 1TN8A 4TXPA 2IO3C 3TXMA 4LNGA 3ABLE 4CZ2D 3LY7A 4J7WA 4N3AA 3AG2E 3APFA 1D8EA 2AXUA 3RJVA 4JA7A 4F1SA 3FH8A 4G8KA 2A5UA 2X6IA 4MS6A 3RO2A 2NXPA 4LRZA 3UQ3A 3ASOE 1H6OA 3MCXA 3CHPA 1XGWA 1DCEA 3ENEA 4HBDA 3LEWA 4B94A 3FU3A 5DBKA 5E75A 3U4TA 3PZ1A 3VLFA 1OCZE 4N3BA 3C3OA 3UUXA 3LS8A 4G25A 4H7XA 1ZB1A 4IULA 4GTRA 1K1AA 4C0EA 1HXIA 3TWVA 2HM8A 2F37A 5ENSD 2XGSA 3SHFA 3D9HA 3FEYA 2C0MA 4KZ0A 4NQ0A 4R7LA 4UQXA 3JXJA 2BTDA 2P2CP 5CECB 2IONA 3GZSA 3ML9A 1O1RA 3HXCA 4DX7D 4I1MA 3Q7FA 5EIDA 1D8DA 2JLBA 3CK8A 5J90A 3Q49B 3HG0D 4JHJA 2C0LA 1WDYA 4I43A 2LUHA 3FFLA 3FUEA 4AOFA 1Z3XA 3AS5A 2XQ0A 2Q7FA 2ZXWE 4FU3A 3UT4A 5KNGA 3ASHA 4U96D 3D9KA 1UN9A 4AIFA 5ENQD 5CCMA 1P5QA 1KZPA 3S7FA 1UOHA 4U0UA 4GTVA 4N3CA 1SZ9A 2LSUA 1WG0A 3QK0A 2X6FA 3L13A 2KBXA 2EQXA 4O1OA 3EU5A 2IF4A 5M72A 2ZISA 3MYVA 3BUAA 2H6IA 4C48B 3B7TA 3B7RL 4K5CA 1TNZA 1OWNA 2AJAA 3KAEA 1TNUA 4ACLA 2FI7A 2RFAA 3AG3E 3PDNA 5B1AE 3C98A 4GA1A 3ZPJA 4HNAD 2GW1A 2KCLA 4LERA 4EZKA 3L82A 4DX6D 3AG1E 2ONDA 3U66A 4JEUA 4KVMA 4ILHB 1LTXA 1ZU2A 3SI5A 4GMRA 4PUCA 2CHWA 1UJJA 3SFXA 4ANXA 2V4HC 1UG3A 5FINA 1UW4B 2J09A 2DIWA 5BXUA 1TNYA 3G2TA 1FT1A 3ZW3A 4GA2A 5CMYA 1IQRA 3ZN3A 1AP7A 1EPUA 1S0PA 3EU9A 3PUJA 1E7UA 4HB5A 1PC2A 3B7BA 3IXEA 4CCAA 3CVQA 5HKPA 4GPKA 5EKQD 5D0QD 3FTUA 3CV0A 4HVBA 2WQHA 2X6HA 2IFUA 4EZLA 4JL0A 4WNEA 2WXQA 2VSNA 4G2VA 4AM9A 5FQ6A 4YDOA 1FT2A 4GTTA 2JABA 3LPZA 4NURA 4UWLA 4FJZA 3T5VA 2B0OE 2EIJE 4CGVA 3CLJA 4BY6A 1K1BA 2WM9A 3V2XA 1KT0A 4I9CA 3LY9A 3Q9NC 2J4DA 2DYRE 1SZAA 1MX2A 2QC9A 3I5PA 3KSQA 3TWWA 3HXEA 1N4PA 4ACKA 3BEEA 3DEOA 4KYOB 1HO8A 2BKGA 3PEUB 3ZYLA 2A4ZA 3HDXA 4U04A 5G2NA 1Z3YA 3C72A 3UKUG 4WWNA 4XI9A 5B1BE 3N71A 2I1KA 3SBTB 4G1TA 3FTWA 4LUNU 3ZNGA 3KSLA 3CVUA 5C1DA 2HR2A 4G24A 4BTBA 3JYSA 4U95D 4D10C 4GZCA 3RU0A 4BWRA 1MJ0A 3EHQA 4CDNA 5G55A 4HOUA 4W9RA 2CFUA 3O48A 2Y69E 2IY0C 2OEVA 4A63B 4FHKA 1AWCB 2ZGDA 2J07A 4C9BB 5C2YA 2VGYA 3FP3A 3TWTA 4AEZC 5AJLA 3MEKA 1TNBA 1Z5SC 4URKA 1IHGA 2Y3AA 2LO6A 5JHAA 2ZGGA 3IHYA 3APDA 4RVBA 1JCQA 2RG8A 1E8WA 3UM1A 4XIFA 5HRYA 2UY1B 3MV3B 1PY1A 3FUDA 5CRUA 5CCLA 4J0UA 4JVSA 3CSFA 4L23A 3TGOA 1EDUA 5HQ8A 4OVUA 4UQYA 3CK7A 5AN8A 3UTMA 4CYMD 2OVFA 3L6AA 2FULA 1N9AA 3UM0A 5AQ7A 2VJ8A 4AXHA 1YMPA 3T8KA 1N95A 4PDXA 3RIBA 2DCPA 4N39A 3FUFA 5FZQA 2IOSA 4E85A 4M7CA 1SA4A 3APCA 2XZTG 2QYUA 4ZHBA 1N94A 3QC1A 1NP7A 2UY1A 1INZA 3ZUVB 3KEAA 3SO8A 1MQSA 3AAAC 2YNQA 1OCOE 2ZIRA 1V55E 3Q47B 1H2UA 2XEHA 4DX1A 3J5PA 3JCKC 5KCMA 2GRMA 4L2LA 5FIOA 4HRNA 4GAAA 4FULA 5BV0A 1HZ4A 1TR4A 2VQ2A 1FCHA 2YQ8A 2QFCA 3CVYA 2Y4TA 2HO1A 1HH8A 3CR3A 4DI3A 3MJWA 3ZRHA 1NA0A 2NC9A 4YDYA 1TJFA 3NZUA 1IHBA 5ENRD 1KZOA 1N4QA 1ELWA 3Q7AA 4U7EB 3NBNB 1IKND 4UWKA 3JUEA 4PH4B 1QBQA 5D2MC 3FU0A 5BT1A 5LOZA 5JA4D 5JJTA 3FH7A 4CDMA 1S70B 4Q96A 1A5EA 1HFAA 2WXLA 1U3CA 3PRZA 4UQZA 4APFA 3L9TA 2WVIA 1L5JA 5EIBE 1O1SA 4BERA 5AQBA 1RW2A 5T3RA 2P9NG 4LSZE 1X5BA 2WXJA 4HOQA 5JHBA 2L0TB 1K3ZD 5G05J 4Z68A 3ML8A 2IJGX 1K8KG 3HXFA 4YVOA 2WXHA 3CHMA 3PNTB 1SVXA 3DXKG 4I1OB 3ULYA 3CHQA 4G11A 3FUNA 2H6GA 5G04C 2HE0A 3K9IA 3GZ1A 1JWGA 3CVLA 2X3MA 3TAXA 4M3OA 2XHEA 4FA6A 3E34A 3ZIMA 3W9GA 1N0RA 2GRLA 3PZ3A 3SFYA 1TYQG 4ATGA 3OTNA 3RSEG 3ZXPA 2PQRA 4TXRA 5CBOA 2VYIA 2GGFA 3URZA 3NOGD 3UM2A 1YCSB 3AG4E 4XKBA 2P58C 4O6FA 4LNUD 4V3IA 2OEWA 1OXJA 3EHRA 4GZ3A 1OWOA 3DSTA 4F53A 3AU5A 3QARA 2WXKA 1BI7B 5FQ4A 1OT8A 1GW6A 3Q73A 3TWXA 4J8DA 4BT9A 2F8YA 2WXMA 3FUKA 1YYHA 4U07A 2J49A 3U64A 4WNGA 5AJDA 2H6FA 1BLXB 4GYOA 3LVQE 1TEZA 4OVVA 3C3RA 3UX4A 4B8AA 3E37A 5CRVA 4F3VA 4J6IA 3UXGA 3V31A 4B93B 3DSSA 4JZYA 2Y1LE 3VLEA 4OYSA 3KS2A 3QAQA 1NI1A 3R9AB 5CERB 1E8XA 1A17A 3R7RA 1N4SA 4FJYA 2P9KG 3Q75A 4GB9A 4GTSA 3U3WA 1NZNA 3ASDA 4UI9J 5BW8C 4P29A 3CVXA 4UWHA 2PZIA 2AXVA 1JWFA 2XZDG 2WMOA 3J5QB 4EBAG 4IRUA 2WPVA 3ZU7B 1HE8A 3L22A 3Q78A 2FF4A 4K0RA 1DCQA 3D3MA 2GRRB 4AV7A 4U8VD 3CHRA 3AS4A 4UUCA 2Y4UA 3PS6A 3L17A 4EQFA 5LCWC 4HRMB 1KPSB 2KCVA 1H2TC 3UINC 4FHJA 3ONLA 3JXIA 5LX8A 1D9SA 4PS3A 5ANRA 2R02A 3DBSA 2GRQB 2E0IA 3D9NA 1NA3A 3FTYA 5BV1A 3D9MA 1EF1C 2VTBB 2WXFA 2R17C 4ME2A 3CK9A 1BD8A 3QJZA 5T8IA 2JEKA 2V8SE 3HVEB 3FH5A 2FBNA 1DVPA 4J8EA 2VGEA 5B3SE 4GMLA 4I6EA 3D9OA 2QZAA 3DPDA 1O5MA 4WWOA 1H6KA 4APOA 2EILE 2CG3A 3MA5A 4XX5A 3E4BA 4K5AB 2WXGA 2BEDA 2VTBA 1OUVA 2VGXA 2KC7A 5ITZF 5FZRA 3TWUA 3HVEA 3R9MA 1PAQA 2WQ6A 3IEGA 5ANLA 2RD0A 2BF0X 4I2WA 2C2LA 2V5QC 5KJLA 4KBQA 4ANUA 2I2OA 3X2QE 3DPYA 1Y6IA 3LCAA 4BT8A 2EIKE 5CEAA 1N52A 3LY8A 1OY3D 3CKBA 1V54E 4UWGA 1HG5A 1BPOA 4HS2A 4B0ZA 1U2VG 2XGMA 4CDRA 2X38A 3AJIA 4J8SA 2DZOA 4GZ5A 3ABME 3SF4A 3LVRE 4JPSA 4TXQA 1ELRA 2Y0BG 3OXGA 2EINE 3B95A 4A55A 4HRLA 1NFIE 5EX3A 4Q69A 2CHZA 4ANWA 4XZ4A 5FTPA 4CT4A 4K5BA 4DX5D 3AU4A 2NSZA 4L9PA 3CQGB 3F6QA 1JUQA 2RFMA 2P9UG 4LEUA 2WXIA 2B6CA 3VTXA 1FVFA 2VSYA 4J8FA 2P9LG 2MOWA 2BUGA 3MV2B 2LXLA 4NIKA 5KJNA 3Q4AB 3EHMA 3E30A 4Y6CA 5FZSA 3KEZA 3T9KA 2J9QA 3ULEG 4G8LA 4U0ZA 3MKRA 3SY2A 3V2OA 2OVBA 2AVPA 4GZ6A 4HOTA 4AVXA 3V79K 3TG5A 3EDTB 2F8XK 2VSOE 4EPZA 4U63A 2XRZA 3GW4A 1HU3A 4FP7A 3NAWA 2MRIA 4L1BA 3ZKJA 4KMOA 3ISMC 3TWRA 4I2ZA 5ENPD 1X81A 3ZXSA 4KVOA 3CKCA 2WXOA 2CHXA 5J08A 3FUHA 3CQCB 4O60A 3UT7A 4TUUA 1OWMA 2DBAA 2J08A 2IOLA 1G3NB 5CMWA 1SQMA 2DYSE 5ARFA 1UJKA 4PS8A 3IV0A 5IY5E 4L7TA 2V4LA 1JPLA 4KXKB 2E2EA 4N5CA 4I6GA 2R03A 4BX9A 3Q5MA 2CG2A 5G05C 3V30A 3PEVB 3Q79A 3PE3A 3PZ2A 2DWZA 3SQVA 3UT8A 4BX8A 4HI9A 3PZ4A 3RK6A 4KZCA 1OWLA 3UMVA 1DNPA 4NACA 1YA0A 4UI9K 3P2BA 3CHOA 1NL4A 2XEVA 1FPPA 4FLBA 3EIQC 3OXFA 2EIME 2XCBA 3FTSA 3B7UX 3D9IA 3BG1B 4MRUA 2I9CA 3HYMB 3I4RB 3QWVA 1JCSA 3NF1A 1MZCA 2WXPA 5EYLA 5CHEE 3TL5A 4YDWA 2QY7A 4JC8A 4XEIG 2ETAA 2LXMA 5ENOD 3QKYA 3W9FA 3L16A 3TWSA 3ASNE 1OCRE 3GZ2A 2XEEA 4H7YA 1HS6A 3I4GA 5H7PA 3MZLB 2L9BA 5CEDB 3DEPA 4GYYA 4N2SA 4HI8A 4DUIA 2AW6A 4JD2G 2FEZA 2LNIA 4LG6A 3UI2A 4F1PA 1BI8B 3DRAA 5ENTD 3ZVVA 3D9JA 3QDNA 2J4BA 2WXRA 4U8YD 4ABNA 4GTMA 3PVLA 5KWDA 5AAOA 1E7VA 1Y8MA 4HOSA 1LD7A 5AQ9A 2HYZA 2R2LA 3NB2A 3EUVA 5AENA 3SD5A 5AARA 4ILGA 1E8ZA 3RRUA 2KATA 3VLDA 4GTOA 4BESA 4BETA 4JB8P 3Q9UC 1HG2A 4UI9C 3RRNB 3RO3A 3SBSA 2XPYA 3U9WA 4GCNA 3TXNA 4Y6WA 1FVHA 3HRAA 1N0QA 2XGOA 3IKOB 4LNBA 4EHMA 3ZHEB 3C5RA 4JXTA 5FQ7A 4G26A 2P9PG 4I17A 3DXMG 2YHEA 4ATZD 1KLXA 1WM5A 2XS8A 4CT0A 3S7BA 1MHQA 3DSUA 2DVWA 3EJNA 5EN5D 3E32A 5JMND 1WAO1 2KCKA 3TG4A 3PE4A 1W3BA 1TN7A 5AYWD 1H0AA 3ZHEA 1E8YA 3WXXA 3OAWA 3MX3A 2L6JA 1VDYA 1LF8A 3UIOC 4JA9A 3P1UA 2LAIA 1E96B 3ZYQA 2MHKA 5EILA 3WG7E 5G04J 4DK5A 4CGWA 4XE0A 3I3NA 2VSXE 3HIZA 2A5EA 3G2SA 5A23A 4FC8A 4MLPA 3LJNA 5BNWA 1BU9A 3FTXA 1IQUA 2M63A 1QQEA 4AY5A 3CHSA 4DI4A 2I1JA 5HI7A 4Q94A 2DZNA 4HORA 1LD8A 1E90A 1S64A 3DSWA 1OCCE 4JEHA 2XPZA 3CVNA 3DWLG 1WY6A 4ILIA 2XS1A 3CVWA 4OAUC 1UN8A 1MYOA 1TN6A 2AXZA 3UPVA 3FWVA 4C0MA 3MGBA 4JW1A 5BPPA 5FQ8A 4N2QA 3CVVA 4AY6A 2ILRA 3ZYMA 3RKVA 3SNXA 5LFAA 4B89A 5BUZA 2FO7A 3ESLA 3FUJA 4AP2A 2J8SD 3IBEA 3R7QA 1HF8A 2VGXB 4JHKA 4WNFA 3S2AA 4I6JA 4FLHA 3CIAA 3D9PA 1XNFA 3SZ7A 2ZU6B 3BG0B 2ETCA 3O4ZA 3T8MA 2X6KA 3LDZA 4U8HA 4AJWA 5JJ7A 4HLLA 4XI0A 4A3TA 3MKQB 4GPMA 3FUIA 4JHRA 2X6JA 2IO2C 1N11A 4A1GA 2OCCE 3IHVA 3T5XA 1MX6A 4A1SA 3PZDA 5KJMA 3OXLA 4E6HA 3NQPA 2L0IA 5EDSA 2MYOA 2QYJA 4A3VA 4YVQC 2WXNA 4N5QA 1ZBPA 4TUMA 3HXBA 3FDHA 4HQDA 4PS7A 4QQIA 4CRWA 3ULQA 4WNDA 3GYZA 3SGHA 3HXDA 4MBGA 3E33A 4X8QA 4BFRA 2WMNA 3MKQA 3KD7A 3ZYKA 4DJAA 2GROB 1DC2A 4TRQA 3L54A 5LCWJ 1HX8A 1N4RA 5KBAA 3FU5A 4GU5A 2I6HA 5BXOA 5HS0A
chains in the Genus database with same CATH topology
3QK0A 5G05C 2X6FA 3L13A 3OTNA 2EQXA 2PQRA 3PEVB 2VYIA 2GGFA 3URZA 2IF4A 5M72A 3MYVA 4NRHB 5FT9A 3B7TA 3B7RL 3PE3A 4L2YA 5A6CA 4F7AA 4XKBA 2P58C 4O6FA 3NZSA 4V3IA 3UT8A 1Z6TA 4BX8A 2KZTB 3CVPA 1OWNA 4GZ3A 1QNFA 3KAEA 4WUYA 1OWOA 4ACLA 3RK6A 4RG9A 4KZCA 2FI7A 1OWLA 3UMVA 4XKCA 1QZ2A 4F53A 1DNPA 4NACA 2IQCA 3AU5A 1YA0A 3PDNA 3QARA 4EZJA 4FADA 4IYPA 2WXKA 3C98A 4GA1A 4UI9K 3ZPJA 3P2BA 3CHOA 3JUIA 4DPRA 2XEVA 4EBAA 3QWWA 2GW1A 2KCLA 4LERA 4EZKA 3B13A 4FLBA 3EIQC 4KT6B 3D9LA 3OXFA 5FQ4A 1OWPA 3TJPA 1GW6A 2PM6A 2ONDA 3U66A 4JEUA 4J8DA 2XRYA 2XCBA 3ZGQA 4KVMA 4BT9A 4ILHB 1ZU2A 3FTSA 3B7UX 2WXMA 3D9IA 3BG1B 3FUKA 3SI5A 4PUCA 2CHWA 4MRUA 2I9CA 3HYMB 1UJJA 3I4RB 4U07A 3QWVA 4CEMA 4ANXA 4RG6A 1UG3A 1H19A 3NF1A 2J49A 4LCTA 2KZTA 4WNGA 2V0PA 2WXPA 3U64A 5CHEE 2XCCA 4DLOA 1UW4B 5AJDA 3FTZA 4GYOA 2J09A 3LVQE 2DIWA 3TL5A 4OVVA 1TEZA 2QY7A 4JC8A 3G2TA 3CSTA 5LP0A 3ZW3A 4GA2A 5CMYA 3QKYA 4QFVA 5A7DB 1IQRA 3JQ0A 3QOUA 3ZEFA 3FUMA 3L16A 4GMJA 3ZN3A 1EPUA 1S0PA 1TJCA 3PUJA 1E7UA 3UX4A 4B8AA 1PC2A 4F3VA 4K03A 4J6IA 3GZ2A 4CCAA 3CVQA 4I9EA 4GPKA 4GZDA 5EKQD 3ZFWA 5FWQA 4JZYA 5D0QD 3VLEA 3FTUA 3CV0A 4H7YA 1HS6A 4OYSA 3KS2A 4HVBA 2WQHA 3I4GA 3FHEA 3S7JA 2X6HA 3QAQA 3MZLB 2IFUA 2YHCA 3LJ3A 4JL0A 4EZLA 4WNEA 2WXQA 3R9AB 2L9BA 5ARGA 2PM7A 2VSNA 1E8XA 1A17A 2V5FA 4BTAA 4G2VA 4AM9A 4GYYA 5FQ6A 4N2SA 3R7RA 3L08A 2AW6A 3LPZA 2FEZA 2LNIA 4FJYA 4NURA 4UWLA 5EX0A 4GCOA 4FJZA 4GB9A 3ZVVA 2OV8A 3HHMA 3T5VA 3D9JA 4Q69A 3QDNA 2J4BA 4WAFA 2PL2A 1NZNA 3ASDA 2WXRA 3U3WA 2PQNA 2OOEA 4CGVA 3CLJA 4ABNA 5AIJA 4UI9J 4BY6A 3PVLA 4YNDA 2WM9A 4GYWA 1E7VA 1KT0A 1Y8MA 2YINA 3LY9A 4I9CA 4HOSA 5BW8C 4P29A 2HYZA 3CVXA 4HFGA 4UWHA 2J4DA 2PZIA 1EYHA 5FJYA 2AXVA 1JWFA 2WMOA 1SZAA 4EBAG 2XPIA 3FTVA 5AENA 3I5PA 3SD5A 1U3DA 3B7SA 3ESKA 1E8ZA 4ILGA 4IRUA 3RRUA 4ACKA 3BEEA 2WPVA 5D0OD 2KATA 3VLDA 3RRMB 4KYOB 1HO8A 3EHNA 1HE8A 2CFZA 3PEUB 3L22A 3ZYLA 2FF4A 3G2WA 4K0RA 5E76A 2A4ZA 3LKUA 3D3MA 3HDXA 4AV7A 4U04A 3CHRA 3AS4A 5G2NA 3ASGA 3CEQA 3S7DA 1Z3YA 1HG2A 2Y4UA 3PS6A 5JJ6A 4UI9C 3L17A 4G23A 4WWNA 4EQFA 5LCWC 4XI9A 3RRNB 3RO3A 2XPYA 2I1KA 3N71A 4G1TA 4WWPA 3SBTB 3FTWA 4GCNA 3SBSA 2KCVA 4Y6WA 4LUNU 3TXNA 1FVHA 4HLEA 1H2TC 5C1DA 2HR2A 3CVUA 3QB2A 4FHJA 3PH0C 3ASFA 3ONLA 2XGOA 3IKOB 4G24A 4BTBA 3JYSA 5LX8A 4D10C 3EIJA 4GZCA 4PS3A 4U0SA 3ZHEB 5ANRA 3RU0A 4DLQA 1IYGA 3DBSA 3VTYA 5DIZA 4BWRA 4JXTA 4UWFA 5FQ7A 4G26A 4CDNA 3SFZA 4HXIA 2E0IA 4I17A 3G2UA 5G55A 4HOUA 4W9RA 3D9NA 2CFUA 4TV3A 3PREA 3O48A 1NA3A 2YHEA 3FU6A 1KLXA 1WM5A 3FTYA 5BV1A 3D9MA 4CT0A 1EF1C 2LSVA 3S7BA 2WQ7A 2VTBB 2WXFA 2R17C 4ME2A 3CK9A 4FHKA 1MHQA 2LAHA 1N54A 3QJZA 5T8IA 3EJNA 2JEKA 2J07A 4C9BB 2V8SE 5C2YA 2VGYA 3HVEB 3FH5A 2FBNA 3FP3A 1WAO1 1DVPA 2KCKA 3Q15A 4BSXA 3CGHA 4J8EA 4AEZC 3TG4A 3PE4A 5AJLA 4EECA 1W3BA 3MEKA 2IU1A 4GMLA 4I6EA 3D9OA 4URKA 2KM4A 4RSYA 1IHGA 5AYWD 1H0AA 3ZHEA 1H2VC 1E8YA 2Y3AA 2LO6A 5JHAA 3DPDA 3IHYA 3AS8A 4WWOA 3PNLB 1H6KA 3G2VA 3JQ1A 4APOA 1B89A 2R59A 3APDA 3FULA 3OAWA 4MKTA 3WXXA 4ANVA 3MX3A 4RVBA 3QWPA 2CG3A 3MA5A 4XX5A 3E4BA 2RG8A 1E8WA 3U9WA 2L6JA 3QNKA 1VDYA 1LF8A 3LXUX 4XIFA 3FEXA 4JA9A 5KJKA 2WXGA 2UY1B 3MV3B 3P1UA 1PY1A 2VTBA 2LAIA 2WB2A 1E96B 1OUVA 2VGXA 3ZYQA 2KC7A 2MHKA 3FUDA 5ENNA 5CCLA 2R5SA 3FY4A 5T4YA 5FZRA 3LYAA 1ELKA 4J0UA 4GA0A 4IN3B 4JVSA 3CSFA 3HVEA 5G04J 4DK5A 1PAQA 4I1AA 4XE0A 4CGWA 3PUKA 4L23A 3I3NA 3ONKA 3TGOA 2WQ6A 1EDUA 2VSXE 3IEGA 3HIZA 4OVUA 4UQYA 5ANLA 5HQ8A 2RD0A 2BF0X 4I2WA 3CK7A 3G2SA 2C2LA 2OVFA 2AWIA 5A23A 4KBQA 5KJLA 4ANUA 3L6AA 2I2OA 4B8CB 2UWJG 1KT1A 2FULA 4FC8A 4MLPA 2VJ8A 4AXHA 1Y6IA 3LCAA 3TXMA 4PDXA 4BT8A 5BNWA 3RIBA 2DCPA 4N39A 3FUFA 3FTXA 1N52A 3LY8A 5FZQA 2IOSA 4E85A 1IQUA 3APCA 3CKBA 4UWGA 1HG5A 3QC1A 1BPOA 1NP7A 2UY1A 3LY7A 4HS2A 1INZA 2M63A 4B0ZA 4N3AA 1QQEA 4AY5A 3CHSA 4DI4A 3APFA 1MQSA 2XGMA 2AXUA 2I1JA 5HI7A 4CDRA 2X38A 4Q94A 2YNQA 4J8SA 3RJVA 4HORA 4JA7A 1E90A 4F1SA 4GZ5A 3FH8A 3SF4A 3Q47B 1H2UA 3LVRE 2A5UA 4JPSA 1ELRA 3OXGA 4JEHA 2XPZA 2X6IA 4A55A 3CVNA 3JCKC 4MS6A 2GRMA 5KCMA 3RO2A 4L2LA 1WY6A 4ILIA 4GAAA 4FULA 3CVWA 1UN8A 5BV0A 2AXZA 3UPVA 5EX3A 1HZ4A 3FWVA 2VQ2A 4C0MA 1FCHA 2NXPA 2CHZA 2QFCA 2YQ8A 3MGBA 4LRZA 4XZ4A 5FTPA 3UQ3A 4JW1A 4ANWA 4CT4A 3CVYA 3MCXA 3CHPA 5BPPA 5FQ8A 2Y4TA 1XGWA 3ENEA 3LEWA 4B94A 4N2QA 3AU4A 3CVVA 2HO1A 2NSZA 3FU3A 4AY6A 2ILRA 3ZYMA 1HH8A 3RKVA 3CR3A 3SNXA 4DI3A 5LFAA 4B89A 5DBKA 3CQGB 5E75A 5BUZA 3U4TA 2FO7A 3VLFA 4N3BA 3MJWA 1JUQA 3ZRHA 3ESLA 1NA0A 3FUJA 2NC9A 3UUXA 1TJFA 3LS8A 4AP2A 3NZUA 4G25A 4H7XA 4IULA 3IBEA 3R7QA 1HF8A 2VGXB 4LEUA 4JHKA 4WNFA 2WXIA 3S2AA 4C0EA 1ELWA 3VTXA 1HXIA 1FVFA 2VSYA 2HM8A 4I6JA 4FLHA 3CIAA 2MOWA 2XGSA 3D9PA 4J8FA 4UWKA 3SHFA 1XNFA 4PH4B 2BUGA 3SZ7A 3FEYA 3MV2B 2C0MA 2ZU6B 4KZ0A 3Q4AB 3EHMA 5KJNA 3FU0A 3BG0B 3O4ZA 4NQ0A 4R7LA 4UQXA 5LOZA 5BT1A 3T8MA 2X6KA 3LDZA 4Y6CA 2BTDA 5FZSA 3KEZA 4U8HA 2J9QA 2IONA 5JJTA 3GZSA 3ML9A 4AJWA 3FH7A 5JJ7A 4CDMA 4XI0A 4Q96A 4U0ZA 4A3TA 3MKQB 3MKRA 4I1MA 1HFAA 2WXLA 3FUIA 1U3CA 3PRZA 2OVBA 4JHRA 4UQZA 2AVPA 4APFA 2X6JA 2WVIA 1L5JA 2JLBA 4GZ6A 4HOTA 4AVXA 3TG5A 3CK8A 4A1GA 3IHVA 3T5XA 3EDTB 4A1SA 3PZDA 5T3RA 5KJMA 2VSOE 4EPZA 4U63A 3OXLA 3GW4A 4E6HA 2XRZA 3NQPA 2L0IA 1HU3A 4FP7A 5EDSA 2MRIA 4L1BA 4KMOA 5J90A 3Q49B 4A3VA 4I2ZA 4YVQC 1X5BA 2WXNA 2WXJA 4JHJA 4HOQA 2C0LA 4I43A 1ZBPA 5JHBA 2L0TB 3FDHA 3FFLA 4PS7A 3FUEA 4AOFA 5G05J 3ZXSA 4KVOA 1Z3XA 3AS5A 3CKCA 4CRWA 3ULQA 4WNDA 3GYZA 2WXOA 2CHXA 2IJGX 3ML8A 2XQ0A 2Q7FA 5J08A 3FUHA 4YVOA 2WXHA 3SGHA 3CQCB 4FU3A 3CHMA 3UT4A 3PNTB 3UT7A 3ASHA 4BFRA 2WMNA 3D9KA 3MKQA 3KD7A 1UN9A 1OWMA 4TUUA 3ZYKA 4AIFA 2DBAA 2J08A 2IOLA 4I1OB 3CHQA 5CCMA 5CMWA 1SQMA 3FUNA 4G11A 5ARFA 1P5QA 4DJAA 1UJKA 4PS8A 5G04C 3S7FA 4TRQA 3K9IA 3IV0A 3L54A 3GZ1A 4L7TA 1JWGA 2V4LA 5LCWJ 3CVLA 1HX8A 1JPLA 2X3MA 4KXKB 2E2EA 4N5CA 4I6GA 4M3OA 3TAXA 2XHEA 4FA6A 3FU5A 4U0UA 3ZIMA 4GU5A 4BX9A 3Q5MA 2GRLA 4N3CA 2CG2A 2I6HA 4ATGA 1SZ9A 2LSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G05 C;  2PQR A;  2VYI A;  3URZ A;  2IF4 A;  5M72 A;  4NRH B;  5FT9 A;  3PE3 A;  5A6C A;  2P58 C;  4O6F A;  3CVP A;  4GZ3 A;  4WUY A;  3KAE A;  4RG9 A;  2FI7 A;  1QZ2 A;  1YA0 A;  3PDN A;  4GA1 A;  4UI9 K;  3ZPJ A;  2XEV A;  3QWW A;  2GW1 A;  2KCL A;  3OXF A;  2OND A;  4J8D A;  2XCB A;  3ZGQ A;  4BT9 A;  1ZU2 A;  3HYM B;  4U07 A;  3QWV A;  4RG6 A;  3NF1 A;  4WNG A;  5CHE E;  2XCC A;  4GYO A;  4GA2 A;  3QKY A;  5A7D B;  3QOU A;  3ZN3 A;  1TJC A;  1PC2 A;  4F3V A;  3GZ2 A;  3CVQ A;  4I9E A;  4GPK A;  5EKQ D;  3ZFW A;  5D0Q D;  3CV0 A;  4H7Y A;  3KS2 A;  2WQH A;  3S7J A;  2IFU A;  2YHC A;  4JL0 A;  4WNE A;  3R9A B;  5ARG A;  2VSN A;  1A17 A;  2V5F A;  4BTA A;  4G2V A;  4AM9 A;  4GYY A;  4N2S A;  3LPZ A;  2FEZ A;  2LNI A;  5EX0 A;  4GCO A;  3QDN A;  2PL2 A;  1NZN A;  3ASD A;  3U3W A;  2PQN A;  2OOE A;  4CGV A;  4ABN A;  4UI9 J;  4YND A;  4GYW A;  1KT0 A;  1Y8M A;  4I9C A;  3LY9 A;  4HOS A;  5BW8 C;  2HYZ A;  2PZI A;  5FJY A;  2XPI A;  3ESK A;  3BEE A;  2WPV A;  5D0O D;  2KAT A;  4KYO B;  2FF4 A;  3LKU A;  4U04 A;  3AS4 A;  3ASG A;  3CEQ A;  3S7D A;  2Y4U A;  5JJ6 A;  4UI9 C;  5LCW C;  4G23 A;  4EQF A;  4XI9 A;  3RO3 A;  3N71 A;  4G1T A;  4GCN A;  2KCV A;  4Y6W A;  5C1D A;  2HR2 A;  3ASF A;  2XGO A;  4G24 A;  4BTB A;  3JYS A;  4U0S A;  3ZHE B;  3RU0 A;  1IYG A;  3VTY A;  5DIZ A;  4BWR A;  4G26 A;  4I17 A;  4HOU A;  4W9R A;  3O48 A;  1NA3 A;  1KLX A;  1WM5 A;  2LSV A;  3S7B A;  4ME2 A;  3CK9 A;  2VGY A;  2FBN A;  3FP3 A;  1WAO 1;  2KCK A;  3Q15 A;  4J8E A;  3TG4 A;  3PE4 A;  1W3B A;  3MEK A;  1IHG A;  5AYW D;  3ZHE A;  3AS8 A;  4APO A;  1B89 A;  3WXX A;  3QWP A;  3MA5 A;  3E4B A;  2L6J A;  4XIF A;  4JA9 A;  5KJK A;  2UY1 B;  3MV3 B;  1E96 B;  1OUV A;  2VGX A;  2KC7 A;  2MHK A;  5CCL A;  2R5S A;  5FZR A;  3LYA A;  4J0U A;  4GA0 A;  4IN3 B;  5G04 J;  4I1A A;  4CGW A;  3TGO A;  3IEG A;  5HQ8 A;  4UQY A;  4I2W A;  3CK7 A;  2C2L A;  5KJL A;  4KBQ A;  2UWJ G;  1KT1 A;  3LCA A;  4BT8 A;  5BNW A;  3RIB A;  4N39 A;  3LY8 A;  5FZQ A;  3CKB A;  2UY1 A;  3LY7 A;  4N3A A;  1QQE A;  4AY5 A;  2XGM A;  5HI7 A;  4CDR A;  3RJV A;  4HOR A;  4JA7 A;  4GZ5 A;  3SF4 A;  3Q47 B;  1ELR A;  3OXG A;  3CVN A;  3RO2 A;  3UPV A;  5EX3 A;  1HZ4 A;  3FWV A;  2VQ2 A;  1FCH A;  2YQ8 A;  2QFC A;  3UQ3 A;  5FTP A;  2Y4T A;  4B94 A;  4N2Q A;  2HO1 A;  4AY6 A;  1HH8 A;  3RKV A;  5DBK A;  3U4T A;  2FO7 A;  4N3B A;  1NA0 A;  3UUX A;  2NC9 A;  4G25 A;  4H7X A;  2VGX B;  4LEU A;  4WNF A;  1ELW A;  3VTX A;  1HXI A;  2VSY A;  4J8F A;  2XGS A;  1XNF A;  2BUG A;  3SZ7 A;  3MV2 B;  2C0M A;  5KJN A;  3Q4A B;  5BT1 A;  4NQ0 A;  4UQX A;  4Y6C A;  5FZS A;  2J9Q A;  5JJT A;  5JJ7 A;  4XI0 A;  4U0Z A;  3MKR A;  4JHR A;  4UQZ A;  2AVP A;  2JLB A;  4GZ6 A;  4HOT A;  3TG5 A;  3CK8 A;  3EDT B;  4A1S A;  5KJM A;  3OXL A;  3GW4 A;  3Q49 B;  4I2Z A;  4YVQ C;  4HOQ A;  2C0L A;  1ZBP A;  3FFL A;  5G05 J;  3AS5 A;  3CKC A;  3ULQ A;  4WND A;  3GYZ A;  2Q7F A;  4YVO A;  3ASH A;  3KD7 A;  4AIF A;  2DBA A;  5CCM A;  5ARF A;  1P5Q A;  5G04 C;  3S7F A;  3K9I A;  3GZ1 A;  5LCW J;  3CVL A;  4KXK B;  3TAX A;  2E2E A;  4N5C A;  4U0U A;  3Q5M A;  4N3C A;  2I6H A;  2LSU A; 
#chains in the Genus database with same CATH topology
 3ABK E;  1IXV A;  4NRH B;  5FT9 A;  4L2Y A;  3NOC D;  5A6C A;  4F7A A;  3NZS A;  1Z6T A;  2KZT B;  3CVP A;  1QNF A;  4RQI A;  4WUY A;  4RG9 A;  4XKC A;  2GRP B;  1QZ2 A;  4FAD A;  2IQC A;  4EZJ A;  4IYP A;  3JUI A;  4DPR A;  4EBA A;  3QWW A;  3B13 A;  4KT6 B;  3D9L A;  4ZFH A;  1OWP A;  4GTQ A;  3TJP A;  2PM6 A;  2XRY A;  1TNO A;  3ZGQ A;  2P9I G;  4OAV B;  1Q2Z A;  4CEM A;  4RG6 A;  1H19 A;  4LCT A;  2KZT A;  1O1T A;  2V0P A;  4DX2 A;  2XCC A;  4DLO A;  3FTZ A;  3CST A;  5LP0 A;  4QFV A;  5A7D B;  3JQ0 A;  3QOU A;  3ZEF A;  3FUM A;  4GTP A;  4GMJ A;  2F0Y A;  1TJC A;  5AQA A;  3UM3 A;  2GRN B;  4K03 A;  4I9E A;  4GZD A;  3ZFW A;  5FWQ A;  1RZ4 A;  3FHE A;  3S7J A;  2YHC A;  3LJ3 A;  5ARG A;  2PM7 A;  2V5F A;  4BTA A;  2ETB A;  5EYP F;  3L08 A;  2BKK B;  3BQO A;  4RLY A;  5EX0 A;  4GCO A;  3RAU A;  2OV8 A;  3HHM A;  4WAF A;  2PL2 A;  2PQN A;  2OOE A;  5AIJ A;  4YND A;  4GYW A;  2YIN A;  3BU8 A;  1SW6 A;  4HFG A;  1QYM A;  1EYH A;  2NYJ A;  5FJY A;  2XPI A;  3FTV A;  1U3D A;  2L6B A;  3B7S A;  3ESK A;  3DSV A;  5D0O D;  3RRM B;  3EHN A;  2CFZ A;  5KNH D;  4YDE A;  3G2W A;  4DRX E;  5E76 A;  3LKU A;  1MX4 A;  3ASG A;  3CEQ A;  3S7D A;  2H6H A;  5JJ6 A;  4G23 A;  2KXP C;  4WWP A;  2XEN A;  4HLE A;  3QB2 A;  4J8Y A;  3PH0 C;  3DSX A;  2IEJ A;  3ASF A;  5D66 A;  3C3Q A;  3UKR G;  3EIJ A;  4U0S A;  4DLQ A;  1IYG A;  3VTY A;  5DIZ A;  4UWF A;  3SFZ A;  4HXI A;  3G2U A;  4TV3 A;  3PRE A;  5CBN A;  4O1P A;  3FU6 A;  2R05 A;  1H6P A;  2LSV A;  2WQ7 A;  2LAH A;  1N54 A;  4BEP A;  4F6R D;  3Q15 A;  2RKK A;  4BSX A;  3CGH A;  4EEC A;  2IU1 A;  2KM4 A;  4RSY A;  1H2V C;  3AS8 A;  3PNL B;  3G2V A;  3JQ1 A;  1B89 A;  2R59 A;  3FUL A;  4MKT A;  4ANV A;  3QWP A;  3QNK A;  3LXU X;  3FEX A;  5KJK A;  2WB2 A;  4BSZ B;  2FO1 E;  1SA5 A;  5ENN A;  2R5S A;  3FY4 A;  5T4Y A;  3TWQ A;  3LYA A;  1ELK A;  4GA0 A;  2P9S G;  1S63 A;  4IN3 B;  3UIP C;  4I1A A;  3PUK A;  2PNN A;  3ONK A;  1JCR A;  2AWI A;  4B8C B;  2UWJ G;  1KT1 A;  1TN8 A;  4TXP A;  2IO3 C;  3TXM A;  4LNG A;  3ABL E;  4CZ2 D;  3LY7 A;  4J7W A;  4N3A A;  3AG2 E;  3APF A;  1D8E A;  2AXU A;  3RJV A;  4JA7 A;  4F1S A;  3FH8 A;  4G8K A;  2A5U A;  2X6I A;  4MS6 A;  3RO2 A;  2NXP A;  4LRZ A;  3UQ3 A;  3ASO E;  1H6O A;  3MCX A;  3CHP A;  1XGW A;  1DCE A;  3ENE A;  4HBD A;  3LEW A;  4B94 A;  3FU3 A;  5DBK A;  5E75 A;  3U4T A;  3PZ1 A;  3VLF A;  1OCZ E;  4N3B A;  3C3O A;  3UUX A;  3LS8 A;  4G25 A;  4H7X A;  1ZB1 A;  4IUL A;  4GTR A;  1K1A A;  4C0E A;  1HXI A;  3TWV A;  2HM8 A;  2F37 A;  5ENS D;  2XGS A;  3SHF A;  3D9H A;  3FEY A;  2C0M A;  4KZ0 A;  4NQ0 A;  4R7L A;  4UQX A;  3JXJ A;  2BTD A;  2P2C P;  5CEC B;  2ION A;  3GZS A;  3ML9 A;  1O1R A;  3HXC A;  4DX7 D;  4I1M A;  3Q7F A;  5EID A;  1D8D A;  2JLB A;  3CK8 A;  5J90 A;  3Q49 B;  3HG0 D;  4JHJ A;  2C0L A;  1WDY A;  4I43 A;  2LUH A;  3FFL A;  3FUE A;  4AOF A;  1Z3X A;  3AS5 A;  2XQ0 A;  2Q7F A;  2ZXW E;  4FU3 A;  3UT4 A;  5KNG A;  3ASH A;  4U96 D;  3D9K A;  1UN9 A;  4AIF A;  5ENQ D;  5CCM A;  1P5Q A;  1KZP A;  3S7F A;  1UOH A;  4U0U A;  4GTV A;  4N3C A;  1SZ9 A;  2LSU A;  1WG0 A;  3QK0 A;  2X6F A;  3L13 A;  2KBX A;  2EQX A;  4O1O A;  3EU5 A;  2IF4 A;  5M72 A;  2ZIS A;  3MYV A;  3BUA A;  2H6I A;  4C48 B;  3B7T A;  3B7R L;  4K5C A;  1TNZ A;  1OWN A;  2AJA A;  3KAE A;  1TNU A;  4ACL A;  2FI7 A;  2RFA A;  3AG3 E;  3PDN A;  5B1A E;  3C98 A;  4GA1 A;  3ZPJ A;  4HNA D;  2GW1 A;  2KCL A;  4LER A;  4EZK A;  3L82 A;  4DX6 D;  3AG1 E;  2OND A;  3U66 A;  4JEU A;  4KVM A;  4ILH B;  1LTX A;  1ZU2 A;  3SI5 A;  4GMR A;  4PUC A;  2CHW A;  1UJJ A;  3SFX A;  4ANX A;  2V4H C;  1UG3 A;  5FIN A;  1UW4 B;  2J09 A;  2DIW A;  5BXU A;  1TNY A;  3G2T A;  1FT1 A;  3ZW3 A;  4GA2 A;  5CMY A;  1IQR A;  3ZN3 A;  1AP7 A;  1EPU A;  1S0P A;  3EU9 A;  3PUJ A;  1E7U A;  4HB5 A;  1PC2 A;  3B7B A;  3IXE A;  4CCA A;  3CVQ A;  5HKP A;  4GPK A;  5EKQ D;  5D0Q D;  3FTU A;  3CV0 A;  4HVB A;  2WQH A;  2X6H A;  2IFU A;  4EZL A;  4JL0 A;  4WNE A;  2WXQ A;  2VSN A;  4G2V A;  4AM9 A;  5FQ6 A;  4YDO A;  1FT2 A;  4GTT A;  2JAB A;  3LPZ A;  4NUR A;  4UWL A;  4FJZ A;  3T5V A;  2B0O E;  2EIJ E;  4CGV A;  3CLJ A;  4BY6 A;  1K1B A;  2WM9 A;  3V2X A;  1KT0 A;  4I9C A;  3LY9 A;  3Q9N C;  2J4D A;  2DYR E;  1SZA A;  1MX2 A;  2QC9 A;  3I5P A;  3KSQ A;  3TWW A;  3HXE A;  1N4P A;  4ACK A;  3BEE A;  3DEO A;  4KYO B;  1HO8 A;  2BKG A;  3PEU B;  3ZYL A;  2A4Z A;  3HDX A;  4U04 A;  5G2N A;  1Z3Y A;  3C72 A;  3UKU G;  4WWN A;  4XI9 A;  5B1B E;  3N71 A;  2I1K A;  3SBT B;  4G1T A;  3FTW A;  4LUN U;  3ZNG A;  3KSL A;  3CVU A;  5C1D A;  2HR2 A;  4G24 A;  4BTB A;  3JYS A;  4U95 D;  4D10 C;  4GZC A;  3RU0 A;  4BWR A;  1MJ0 A;  3EHQ A;  4CDN A;  5G55 A;  4HOU A;  4W9R A;  2CFU A;  3O48 A;  2Y69 E;  2IY0 C;  2OEV A;  4A63 B;  4FHK A;  1AWC B;  2ZGD A;  2J07 A;  4C9B B;  5C2Y A;  2VGY A;  3FP3 A;  3TWT A;  4AEZ C;  5AJL A;  3MEK A;  1TNB A;  1Z5S C;  4URK A;  1IHG A;  2Y3A A;  2LO6 A;  5JHA A;  2ZGG A;  3IHY A;  3APD A;  4RVB A;  1JCQ A;  2RG8 A;  1E8W A;  3UM1 A;  4XIF A;  5HRY A;  2UY1 B;  3MV3 B;  1PY1 A;  3FUD A;  5CRU A;  5CCL A;  4J0U A;  4JVS A;  3CSF A;  4L23 A;  3TGO A;  1EDU A;  5HQ8 A;  4OVU A;  4UQY A;  3CK7 A;  5AN8 A;  3UTM A;  4CYM D;  2OVF A;  3L6A A;  2FUL A;  1N9A A;  3UM0 A;  5AQ7 A;  2VJ8 A;  4AXH A;  1YMP A;  3T8K A;  1N95 A;  4PDX A;  3RIB A;  2DCP A;  4N39 A;  3FUF A;  5FZQ A;  2IOS A;  4E85 A;  4M7C A;  1SA4 A;  3APC A;  2XZT G;  2QYU A;  4ZHB A;  1N94 A;  3QC1 A;  1NP7 A;  2UY1 A;  1INZ A;  3ZUV B;  3KEA A;  3SO8 A;  1MQS A;  3AAA C;  2YNQ A;  1OCO E;  2ZIR A;  1V55 E;  3Q47 B;  1H2U A;  2XEH A;  4DX1 A;  3J5P A;  3JCK C;  5KCM A;  2GRM A;  4L2L A;  5FIO A;  4HRN A;  4GAA A;  4FUL A;  5BV0 A;  1HZ4 A;  1TR4 A;  2VQ2 A;  1FCH A;  2YQ8 A;  2QFC A;  3CVY A;  2Y4T A;  2HO1 A;  1HH8 A;  3CR3 A;  4DI3 A;  3MJW A;  3ZRH A;  1NA0 A;  2NC9 A;  4YDY A;  1TJF A;  3NZU A;  1IHB A;  5ENR D;  1KZO A;  1N4Q A;  1ELW A;  3Q7A A;  4U7E B;  3NBN B;  1IKN D;  4UWK A;  3JUE A;  4PH4 B;  1QBQ A;  5D2M C;  3FU0 A;  5BT1 A;  5LOZ A;  5JA4 D;  5JJT A;  3FH7 A;  4CDM A;  1S70 B;  4Q96 A;  1A5E A;  1HFA A;  2WXL A;  1U3C A;  3PRZ A;  4UQZ A;  4APF A;  3L9T A;  2WVI A;  1L5J A;  5EIB E;  1O1S A;  4BER A;  5AQB A;  1RW2 A;  5T3R A;  2P9N G;  4LSZ E;  1X5B A;  2WXJ A;  4HOQ A;  5JHB A;  2L0T B;  1K3Z D;  5G05 J;  4Z68 A;  3ML8 A;  2IJG X;  1K8K G;  3HXF A;  4YVO A;  2WXH A;  3CHM A;  3PNT B;  1SVX A;  3DXK G;  4I1O B;  3ULY A;  3CHQ A;  4G11 A;  3FUN A;  2H6G A;  5G04 C;  2HE0 A;  3K9I A;  3GZ1 A;  1JWG A;  3CVL A;  2X3M A;  3TAX A;  4M3O A;  2XHE A;  4FA6 A;  3E34 A;  3ZIM A;  3W9G A;  1N0R A;  2GRL A;  3PZ3 A;  3SFY A;  1TYQ G;  4ATG A;  3OTN A;  3RSE G;  3ZXP A;  2PQR A;  4TXR A;  5CBO A;  2VYI A;  2GGF A;  3URZ A;  3NOG D;  3UM2 A;  1YCS B;  3AG4 E;  4XKB A;  2P58 C;  4O6F A;  4LNU D;  4V3I A;  2OEW A;  1OXJ A;  3EHR A;  4GZ3 A;  1OWO A;  3DST A;  4F53 A;  3AU5 A;  3QAR A;  2WXK A;  1BI7 B;  5FQ4 A;  1OT8 A;  1GW6 A;  3Q73 A;  3TWX A;  4J8D A;  4BT9 A;  2F8Y A;  2WXM A;  3FUK A;  1YYH A;  4U07 A;  2J49 A;  3U64 A;  4WNG A;  5AJD A;  2H6F A;  1BLX B;  4GYO A;  3LVQ E;  1TEZ A;  4OVV A;  3C3R A;  3UX4 A;  4B8A A;  3E37 A;  5CRV A;  4F3V A;  4J6I A;  3UXG A;  3V31 A;  4B93 B;  3DSS A;  4JZY A;  2Y1L E;  3VLE A;  4OYS A;  3KS2 A;  3QAQ A;  1NI1 A;  3R9A B;  5CER B;  1E8X A;  1A17 A;  3R7R A;  1N4S A;  4FJY A;  2P9K G;  3Q75 A;  4GB9 A;  4GTS A;  3U3W A;  1NZN A;  3ASD A;  4UI9 J;  5BW8 C;  4P29 A;  3CVX A;  4UWH A;  2PZI A;  2AXV A;  1JWF A;  2XZD G;  2WMO A;  3J5Q B;  4EBA G;  4IRU A;  2WPV A;  3ZU7 B;  1HE8 A;  3L22 A;  3Q78 A;  2FF4 A;  4K0R A;  1DCQ A;  3D3M A;  2GRR B;  4AV7 A;  4U8V D;  3CHR A;  3AS4 A;  4UUC A;  2Y4U A;  3PS6 A;  3L17 A;  4EQF A;  5LCW C;  4HRM B;  1KPS B;  2KCV A;  1H2T C;  3UIN C;  4FHJ A;  3ONL A;  3JXI A;  5LX8 A;  1D9S A;  4PS3 A;  5ANR A;  2R02 A;  3DBS A;  2GRQ B;  2E0I A;  3D9N A;  1NA3 A;  3FTY A;  5BV1 A;  3D9M A;  1EF1 C;  2VTB B;  2WXF A;  2R17 C;  4ME2 A;  3CK9 A;  1BD8 A;  3QJZ A;  5T8I A;  2JEK A;  2V8S E;  3HVE B;  3FH5 A;  2FBN A;  1DVP A;  4J8E A;  2VGE A;  5B3S E;  4GML A;  4I6E A;  3D9O A;  2QZA A;  3DPD A;  1O5M A;  4WWO A;  1H6K A;  4APO A;  2EIL E;  2CG3 A;  3MA5 A;  4XX5 A;  3E4B A;  4K5A B;  2WXG A;  2BED A;  2VTB A;  1OUV A;  2VGX A;  2KC7 A;  5ITZ F;  5FZR A;  3TWU A;  3HVE A;  3R9M A;  1PAQ A;  2WQ6 A;  3IEG A;  5ANL A;  2RD0 A;  2BF0 X;  4I2W A;  2C2L A;  2V5Q C;  5KJL A;  4KBQ A;  4ANU A;  2I2O A;  3X2Q E;  3DPY A;  1Y6I A;  3LCA A;  4BT8 A;  2EIK E;  5CEA A;  1N52 A;  3LY8 A;  1OY3 D;  3CKB A;  1V54 E;  4UWG A;  1HG5 A;  1BPO A;  4HS2 A;  4B0Z A;  1U2V G;  2XGM A;  4CDR A;  2X38 A;  3AJI A;  4J8S A;  2DZO A;  4GZ5 A;  3ABM E;  3SF4 A;  3LVR E;  4JPS A;  4TXQ A;  1ELR A;  2Y0B G;  3OXG A;  2EIN E;  3B95 A;  4A55 A;  4HRL A;  1NFI E;  5EX3 A;  4Q69 A;  2CHZ A;  4ANW A;  4XZ4 A;  5FTP A;  4CT4 A;  4K5B A;  4DX5 D;  3AU4 A;  2NSZ A;  4L9P A;  3CQG B;  3F6Q A;  1JUQ A;  2RFM A;  2P9U G;  4LEU A;  2WXI A;  2B6C A;  3VTX A;  1FVF A;  2VSY A;  4J8F A;  2P9L G;  2MOW A;  2BUG A;  3MV2 B;  2LXL A;  4NIK A;  5KJN A;  3Q4A B;  3EHM A;  3E30 A;  4Y6C A;  5FZS A;  3KEZ A;  3T9K A;  2J9Q A;  3ULE G;  4G8L A;  4U0Z A;  3MKR A;  3SY2 A;  3V2O A;  2OVB A;  2AVP A;  4GZ6 A;  4HOT A;  4AVX A;  3V79 K;  3TG5 A;  3EDT B;  2F8X K;  2VSO E;  4EPZ A;  4U63 A;  2XRZ A;  3GW4 A;  1HU3 A;  4FP7 A;  3NAW A;  2MRI A;  4L1B A;  3ZKJ A;  4KMO A;  3ISM C;  3TWR A;  4I2Z A;  5ENP D;  1X81 A;  3ZXS A;  4KVO A;  3CKC A;  2WXO A;  2CHX A;  5J08 A;  3FUH A;  3CQC B;  4O60 A;  3UT7 A;  4TUU A;  1OWM A;  2DBA A;  2J08 A;  2IOL A;  1G3N B;  5CMW A;  1SQM A;  2DYS E;  5ARF A;  1UJK A;  4PS8 A;  3IV0 A;  5IY5 E;  4L7T A;  2V4L A;  1JPL A;  4KXK B;  2E2E A;  4N5C A;  4I6G A;  2R03 A;  4BX9 A;  3Q5M A;  2CG2 A;  5G05 C;  3V30 A;  3PEV B;  3Q79 A;  3PE3 A;  3PZ2 A;  2DWZ A;  3SQV A;  3UT8 A;  4BX8 A;  4HI9 A;  3PZ4 A;  3RK6 A;  4KZC A;  1OWL A;  3UMV A;  1DNP A;  4NAC A;  1YA0 A;  4UI9 K;  3P2B A;  3CHO A;  1NL4 A;  2XEV A;  1FPP A;  4FLB A;  3EIQ C;  3OXF A;  2EIM E;  2XCB A;  3FTS A;  3B7U X;  3D9I A;  3BG1 B;  4MRU A;  2I9C A;  3HYM B;  3I4R B;  3QWV A;  1JCS A;  3NF1 A;  1MZC A;  2WXP A;  5EYL A;  5CHE E;  3TL5 A;  4YDW A;  2QY7 A;  4JC8 A;  4XEI G;  2ETA A;  2LXM A;  5ENO D;  3QKY A;  3W9F A;  3L16 A;  3TWS A;  3ASN E;  1OCR E;  3GZ2 A;  2XEE A;  4H7Y A;  1HS6 A;  3I4G A;  5H7P A;  3MZL B;  2L9B A;  5CED B;  3DEP A;  4GYY A;  4N2S A;  4HI8 A;  4DUI A;  2AW6 A;  4JD2 G;  2FEZ A;  2LNI A;  4LG6 A;  3UI2 A;  4F1P A;  1BI8 B;  3DRA A;  5ENT D;  3ZVV A;  3D9J A;  3QDN A;  2J4B A;  2WXR A;  4U8Y D;  4ABN A;  4GTM A;  3PVL A;  5KWD A;  5AAO A;  1E7V A;  1Y8M A;  4HOS A;  1LD7 A;  5AQ9 A;  2HYZ A;  2R2L A;  3NB2 A;  3EUV A;  5AEN A;  3SD5 A;  5AAR A;  4ILG A;  1E8Z A;  3RRU A;  2KAT A;  3VLD A;  4GTO A;  4BES A;  4BET A;  4JB8 P;  3Q9U C;  1HG2 A;  4UI9 C;  3RRN B;  3RO3 A;  3SBS A;  2XPY A;  3U9W A;  4GCN A;  3TXN A;  4Y6W A;  1FVH A;  3HRA A;  1N0Q A;  2XGO A;  3IKO B;  4LNB A;  4EHM A;  3ZHE B;  3C5R A;  4JXT A;  5FQ7 A;  4G26 A;  2P9P G;  4I17 A;  3DXM G;  2YHE A;  4ATZ D;  1KLX A;  1WM5 A;  2XS8 A;  4CT0 A;  3S7B A;  1MHQ A;  3DSU A;  2DVW A;  3EJN A;  5EN5 D;  3E32 A;  5JMN D;  1WAO 1;  2KCK A;  3TG4 A;  3PE4 A;  1W3B A;  1TN7 A;  5AYW D;  1H0A A;  3ZHE A;  1E8Y A;  3WXX A;  3OAW A;  3MX3 A;  2L6J A;  1VDY A;  1LF8 A;  3UIO C;  4JA9 A;  3P1U A;  2LAI A;  1E96 B;  3ZYQ A;  2MHK A;  5EIL A;  3WG7 E;  5G04 J;  4DK5 A;  4CGW A;  4XE0 A;  3I3N A;  2VSX E;  3HIZ A;  2A5E A;  3G2S A;  5A23 A;  4FC8 A;  4MLP A;  3LJN A;  5BNW A;  1BU9 A;  3FTX A;  1IQU A;  2M63 A;  1QQE A;  4AY5 A;  3CHS A;  4DI4 A;  2I1J A;  5HI7 A;  4Q94 A;  2DZN A;  4HOR A;  1LD8 A;  1E90 A;  1S64 A;  3DSW A;  1OCC E;  4JEH A;  2XPZ A;  3CVN A;  3DWL G;  1WY6 A;  4ILI A;  2XS1 A;  3CVW A;  4OAU C;  1UN8 A;  1MYO A;  1TN6 A;  2AXZ A;  3UPV A;  3FWV A;  4C0M A;  3MGB A;  4JW1 A;  5BPP A;  5FQ8 A;  4N2Q A;  3CVV A;  4AY6 A;  2ILR A;  3ZYM A;  3RKV A;  3SNX A;  5LFA A;  4B89 A;  5BUZ A;  2FO7 A;  3ESL A;  3FUJ A;  4AP2 A;  2J8S D;  3IBE A;  3R7Q A;  1HF8 A;  2VGX B;  4JHK A;  4WNF A;  3S2A A;  4I6J A;  4FLH A;  3CIA A;  3D9P A;  1XNF A;  3SZ7 A;  2ZU6 B;  3BG0 B;  2ETC A;  3O4Z A;  3T8M A;  2X6K A;  3LDZ A;  4U8H A;  4AJW A;  5JJ7 A;  4HLL A;  4XI0 A;  4A3T A;  3MKQ B;  4GPM A;  3FUI A;  4JHR A;  2X6J A;  2IO2 C;  1N11 A;  4A1G A;  2OCC E;  3IHV A;  3T5X A;  1MX6 A;  4A1S A;  3PZD A;  5KJM A;  3OXL A;  4E6H A;  3NQP A;  2L0I A;  5EDS A;  2MYO A;  2QYJ A;  4A3V A;  4YVQ C;  2WXN A;  4N5Q A;  1ZBP A;  4TUM A;  3HXB A;  3FDH A;  4HQD A;  4PS7 A;  4QQI A;  4CRW A;  3ULQ A;  4WND A;  3GYZ A;  3SGH A;  3HXD A;  4MBG A;  3E33 A;  4X8Q A;  4BFR A;  2WMN A;  3MKQ A;  3KD7 A;  3ZYK A;  4DJA A;  2GRO B;  1DC2 A;  4TRQ A;  3L54 A;  5LCW J;  1HX8 A;  1N4R A;  5KBA A;  3FU5 A;  4GU5 A;  2I6H A;  5BXO A;  5HS0 A; 
#chains in the Genus database with same CATH homology
 3QK0 A;  5G05 C;  2X6F A;  3L13 A;  3OTN A;  2EQX A;  2PQR A;  3PEV B;  2VYI A;  2GGF A;  3URZ A;  2IF4 A;  5M72 A;  3MYV A;  4NRH B;  5FT9 A;  3B7T A;  3B7R L;  3PE3 A;  4L2Y A;  5A6C A;  4F7A A;  4XKB A;  2P58 C;  4O6F A;  3NZS A;  4V3I A;  3UT8 A;  1Z6T A;  4BX8 A;  2KZT B;  3CVP A;  1OWN A;  4GZ3 A;  1QNF A;  3KAE A;  4WUY A;  1OWO A;  4ACL A;  3RK6 A;  4RG9 A;  4KZC A;  2FI7 A;  1OWL A;  3UMV A;  4XKC A;  1QZ2 A;  4F53 A;  1DNP A;  4NAC A;  2IQC A;  3AU5 A;  1YA0 A;  3PDN A;  3QAR A;  4EZJ A;  4FAD A;  4IYP A;  2WXK A;  3C98 A;  4GA1 A;  4UI9 K;  3ZPJ A;  3P2B A;  3CHO A;  3JUI A;  4DPR A;  2XEV A;  4EBA A;  3QWW A;  2GW1 A;  2KCL A;  4LER A;  4EZK A;  3B13 A;  4FLB A;  3EIQ C;  4KT6 B;  3D9L A;  3OXF A;  5FQ4 A;  1OWP A;  3TJP A;  1GW6 A;  2PM6 A;  2OND A;  3U66 A;  4JEU A;  4J8D A;  2XRY A;  2XCB A;  3ZGQ A;  4KVM A;  4BT9 A;  4ILH B;  1ZU2 A;  3FTS A;  3B7U X;  2WXM A;  3D9I A;  3BG1 B;  3FUK A;  3SI5 A;  4PUC A;  2CHW A;  4MRU A;  2I9C A;  3HYM B;  1UJJ A;  3I4R B;  4U07 A;  3QWV A;  4CEM A;  4ANX A;  4RG6 A;  1UG3 A;  1H19 A;  3NF1 A;  2J49 A;  4LCT A;  2KZT A;  4WNG A;  2V0P A;  2WXP A;  3U64 A;  5CHE E;  2XCC A;  4DLO A;  1UW4 B;  5AJD A;  3FTZ A;  4GYO A;  2J09 A;  3LVQ E;  2DIW A;  3TL5 A;  4OVV A;  1TEZ A;  2QY7 A;  4JC8 A;  3G2T A;  3CST A;  5LP0 A;  3ZW3 A;  4GA2 A;  5CMY A;  3QKY A;  4QFV A;  5A7D B;  1IQR A;  3JQ0 A;  3QOU A;  3ZEF A;  3FUM A;  3L16 A;  4GMJ A;  3ZN3 A;  1EPU A;  1S0P A;  1TJC A;  3PUJ A;  1E7U A;  3UX4 A;  4B8A A;  1PC2 A;  4F3V A;  4K03 A;  4J6I A;  3GZ2 A;  4CCA A;  3CVQ A;  4I9E A;  4GPK A;  4GZD A;  5EKQ D;  3ZFW A;  5FWQ A;  4JZY A;  5D0Q D;  3VLE A;  3FTU A;  3CV0 A;  4H7Y A;  1HS6 A;  4OYS A;  3KS2 A;  4HVB A;  2WQH A;  3I4G A;  3FHE A;  3S7J A;  2X6H A;  3QAQ A;  3MZL B;  2IFU A;  2YHC A;  3LJ3 A;  4JL0 A;  4EZL A;  4WNE A;  2WXQ A;  3R9A B;  2L9B A;  5ARG A;  2PM7 A;  2VSN A;  1E8X A;  1A17 A;  2V5F A;  4BTA A;  4G2V A;  4AM9 A;  4GYY A;  5FQ6 A;  4N2S A;  3R7R A;  3L08 A;  2AW6 A;  3LPZ A;  2FEZ A;  2LNI A;  4FJY A;  4NUR A;  4UWL A;  5EX0 A;  4GCO A;  4FJZ A;  4GB9 A;  3ZVV A;  2OV8 A;  3HHM A;  3T5V A;  3D9J A;  4Q69 A;  3QDN A;  2J4B A;  4WAF A;  2PL2 A;  1NZN A;  3ASD A;  2WXR A;  3U3W A;  2PQN A;  2OOE A;  4CGV A;  3CLJ A;  4ABN A;  5AIJ A;  4UI9 J;  4BY6 A;  3PVL A;  4YND A;  2WM9 A;  4GYW A;  1E7V A;  1KT0 A;  1Y8M A;  2YIN A;  3LY9 A;  4I9C A;  4HOS A;  5BW8 C;  4P29 A;  2HYZ A;  3CVX A;  4HFG A;  4UWH A;  2J4D A;  2PZI A;  1EYH A;  5FJY A;  2AXV A;  1JWF A;  2WMO A;  1SZA A;  4EBA G;  2XPI A;  3FTV A;  5AEN A;  3I5P A;  3SD5 A;  1U3D A;  3B7S A;  3ESK A;  1E8Z A;  4ILG A;  4IRU A;  3RRU A;  4ACK A;  3BEE A;  2WPV A;  5D0O D;  2KAT A;  3VLD A;  3RRM B;  4KYO B;  1HO8 A;  3EHN A;  1HE8 A;  2CFZ A;  3PEU B;  3L22 A;  3ZYL A;  2FF4 A;  3G2W A;  4K0R A;  5E76 A;  2A4Z A;  3LKU A;  3D3M A;  3HDX A;  4AV7 A;  4U04 A;  3CHR A;  3AS4 A;  5G2N A;  3ASG A;  3CEQ A;  3S7D A;  1Z3Y A;  1HG2 A;  2Y4U A;  3PS6 A;  5JJ6 A;  4UI9 C;  3L17 A;  4G23 A;  4WWN A;  4EQF A;  5LCW C;  4XI9 A;  3RRN B;  3RO3 A;  2XPY A;  2I1K A;  3N71 A;  4G1T A;  4WWP A;  3SBT B;  3FTW A;  4GCN A;  3SBS A;  2KCV A;  4Y6W A;  4LUN U;  3TXN A;  1FVH A;  4HLE A;  1H2T C;  5C1D A;  2HR2 A;  3CVU A;  3QB2 A;  4FHJ A;  3PH0 C;  3ASF A;  3ONL A;  2XGO A;  3IKO B;  4G24 A;  4BTB A;  3JYS A;  5LX8 A;  4D10 C;  3EIJ A;  4GZC A;  4PS3 A;  4U0S A;  3ZHE B;  5ANR A;  3RU0 A;  4DLQ A;  1IYG A;  3DBS A;  3VTY A;  5DIZ A;  4BWR A;  4JXT A;  4UWF A;  5FQ7 A;  4G26 A;  4CDN A;  3SFZ A;  4HXI A;  2E0I A;  4I17 A;  3G2U A;  5G55 A;  4HOU A;  4W9R A;  3D9N A;  2CFU A;  4TV3 A;  3PRE A;  3O48 A;  1NA3 A;  2YHE A;  3FU6 A;  1KLX A;  1WM5 A;  3FTY A;  5BV1 A;  3D9M A;  4CT0 A;  1EF1 C;  2LSV A;  3S7B A;  2WQ7 A;  2VTB B;  2WXF A;  2R17 C;  4ME2 A;  3CK9 A;  4FHK A;  1MHQ A;  2LAH A;  1N54 A;  3QJZ A;  5T8I A;  3EJN A;  2JEK A;  2J07 A;  4C9B B;  2V8S E;  5C2Y A;  2VGY A;  3HVE B;  3FH5 A;  2FBN A;  3FP3 A;  1WAO 1;  1DVP A;  2KCK A;  3Q15 A;  4BSX A;  3CGH A;  4J8E A;  4AEZ C;  3TG4 A;  3PE4 A;  5AJL A;  4EEC A;  1W3B A;  3MEK A;  2IU1 A;  4GML A;  4I6E A;  3D9O A;  4URK A;  2KM4 A;  4RSY A;  1IHG A;  5AYW D;  1H0A A;  3ZHE A;  1H2V C;  1E8Y A;  2Y3A A;  2LO6 A;  5JHA A;  3DPD A;  3IHY A;  3AS8 A;  4WWO A;  3PNL B;  1H6K A;  3G2V A;  3JQ1 A;  4APO A;  1B89 A;  2R59 A;  3APD A;  3FUL A;  3OAW A;  4MKT A;  3WXX A;  4ANV A;  3MX3 A;  4RVB A;  3QWP A;  2CG3 A;  3MA5 A;  4XX5 A;  3E4B A;  2RG8 A;  1E8W A;  3U9W A;  2L6J A;  3QNK A;  1VDY A;  1LF8 A;  3LXU X;  4XIF A;  3FEX A;  4JA9 A;  5KJK A;  2WXG A;  2UY1 B;  3MV3 B;  3P1U A;  1PY1 A;  2VTB A;  2LAI A;  2WB2 A;  1E96 B;  1OUV A;  2VGX A;  3ZYQ A;  2KC7 A;  2MHK A;  3FUD A;  5ENN A;  5CCL A;  2R5S A;  3FY4 A;  5T4Y A;  5FZR A;  3LYA A;  1ELK A;  4J0U A;  4GA0 A;  4IN3 B;  4JVS A;  3CSF A;  3HVE A;  5G04 J;  4DK5 A;  1PAQ A;  4I1A A;  4XE0 A;  4CGW A;  3PUK A;  4L23 A;  3I3N A;  3ONK A;  3TGO A;  2WQ6 A;  1EDU A;  2VSX E;  3IEG A;  3HIZ A;  4OVU A;  4UQY A;  5ANL A;  5HQ8 A;  2RD0 A;  2BF0 X;  4I2W A;  3CK7 A;  3G2S A;  2C2L A;  2OVF A;  2AWI A;  5A23 A;  4KBQ A;  5KJL A;  4ANU A;  3L6A A;  2I2O A;  4B8C B;  2UWJ G;  1KT1 A;  2FUL A;  4FC8 A;  4MLP A;  2VJ8 A;  4AXH A;  1Y6I A;  3LCA A;  3TXM A;  4PDX A;  4BT8 A;  5BNW A;  3RIB A;  2DCP A;  4N39 A;  3FUF A;  3FTX A;  1N52 A;  3LY8 A;  5FZQ A;  2IOS A;  4E85 A;  1IQU A;  3APC A;  3CKB A;  4UWG A;  1HG5 A;  3QC1 A;  1BPO A;  1NP7 A;  2UY1 A;  3LY7 A;  4HS2 A;  1INZ A;  2M63 A;  4B0Z A;  4N3A A;  1QQE A;  4AY5 A;  3CHS A;  4DI4 A;  3APF A;  1MQS A;  2XGM A;  2AXU A;  2I1J A;  5HI7 A;  4CDR A;  2X38 A;  4Q94 A;  2YNQ A;  4J8S A;  3RJV A;  4HOR A;  4JA7 A;  1E90 A;  4F1S A;  4GZ5 A;  3FH8 A;  3SF4 A;  3Q47 B;  1H2U A;  3LVR E;  2A5U A;  4JPS A;  1ELR A;  3OXG A;  4JEH A;  2XPZ A;  2X6I A;  4A55 A;  3CVN A;  3JCK C;  4MS6 A;  2GRM A;  5KCM A;  3RO2 A;  4L2L A;  1WY6 A;  4ILI A;  4GAA A;  4FUL A;  3CVW A;  1UN8 A;  5BV0 A;  2AXZ A;  3UPV A;  5EX3 A;  1HZ4 A;  3FWV A;  2VQ2 A;  4C0M A;  1FCH A;  2NXP A;  2CHZ A;  2QFC A;  2YQ8 A;  3MGB A;  4LRZ A;  4XZ4 A;  5FTP A;  3UQ3 A;  4JW1 A;  4ANW A;  4CT4 A;  3CVY A;  3MCX A;  3CHP A;  5BPP A;  5FQ8 A;  2Y4T A;  1XGW A;  3ENE A;  3LEW A;  4B94 A;  4N2Q A;  3AU4 A;  3CVV A;  2HO1 A;  2NSZ A;  3FU3 A;  4AY6 A;  2ILR A;  3ZYM A;  1HH8 A;  3RKV A;  3CR3 A;  3SNX A;  4DI3 A;  5LFA A;  4B89 A;  5DBK A;  3CQG B;  5E75 A;  5BUZ A;  3U4T A;  2FO7 A;  3VLF A;  4N3B A;  3MJW A;  1JUQ A;  3ZRH A;  3ESL A;  1NA0 A;  3FUJ A;  2NC9 A;  3UUX A;  1TJF A;  3LS8 A;  4AP2 A;  3NZU A;  4G25 A;  4H7X A;  4IUL A;  3IBE A;  3R7Q A;  1HF8 A;  2VGX B;  4LEU A;  4JHK A;  4WNF A;  2WXI A;  3S2A A;  4C0E A;  1ELW A;  3VTX A;  1HXI A;  1FVF A;  2VSY A;  2HM8 A;  4I6J A;  4FLH A;  3CIA A;  2MOW A;  2XGS A;  3D9P A;  4J8F A;  4UWK A;  3SHF A;  1XNF A;  4PH4 B;  2BUG A;  3SZ7 A;  3FEY A;  3MV2 B;  2C0M A;  2ZU6 B;  4KZ0 A;  3Q4A B;  3EHM A;  5KJN A;  3FU0 A;  3BG0 B;  3O4Z A;  4NQ0 A;  4R7L A;  4UQX A;  5LOZ A;  5BT1 A;  3T8M A;  2X6K A;  3LDZ A;  4Y6C A;  2BTD A;  5FZS A;  3KEZ A;  4U8H A;  2J9Q A;  2ION A;  5JJT A;  3GZS A;  3ML9 A;  4AJW A;  3FH7 A;  5JJ7 A;  4CDM A;  4XI0 A;  4Q96 A;  4U0Z A;  4A3T A;  3MKQ B;  3MKR A;  4I1M A;  1HFA A;  2WXL A;  3FUI A;  1U3C A;  3PRZ A;  2OVB A;  4JHR A;  4UQZ A;  2AVP A;  4APF A;  2X6J A;  2WVI A;  1L5J A;  2JLB A;  4GZ6 A;  4HOT A;  4AVX A;  3TG5 A;  3CK8 A;  4A1G A;  3IHV A;  3T5X A;  3EDT B;  4A1S A;  3PZD A;  5T3R A;  5KJM A;  2VSO E;  4EPZ A;  4U63 A;  3OXL A;  3GW4 A;  4E6H A;  2XRZ A;  3NQP A;  2L0I A;  1HU3 A;  4FP7 A;  5EDS A;  2MRI A;  4L1B A;  4KMO A;  5J90 A;  3Q49 B;  4A3V A;  4I2Z A;  4YVQ C;  1X5B A;  2WXN A;  2WXJ A;  4JHJ A;  4HOQ A;  2C0L A;  4I43 A;  1ZBP A;  5JHB A;  2L0T B;  3FDH A;  3FFL A;  4PS7 A;  3FUE A;  4AOF A;  5G05 J;  3ZXS A;  4KVO A;  1Z3X A;  3AS5 A;  3CKC A;  4CRW A;  3ULQ A;  4WND A;  3GYZ A;  2WXO A;  2CHX A;  2IJG X;  3ML8 A;  2XQ0 A;  2Q7F A;  5J08 A;  3FUH A;  4YVO A;  2WXH A;  3SGH A;  3CQC B;  4FU3 A;  3CHM A;  3UT4 A;  3PNT B;  3UT7 A;  3ASH A;  4BFR A;  2WMN A;  3D9K A;  3MKQ A;  3KD7 A;  1UN9 A;  1OWM A;  4TUU A;  3ZYK A;  4AIF A;  2DBA A;  2J08 A;  2IOL A;  4I1O B;  3CHQ A;  5CCM A;  5CMW A;  1SQM A;  3FUN A;  4G11 A;  5ARF A;  1P5Q A;  4DJA A;  1UJK A;  4PS8 A;  5G04 C;  3S7F A;  4TRQ A;  3K9I A;  3IV0 A;  3L54 A;  3GZ1 A;  4L7T A;  1JWG A;  2V4L A;  5LCW J;  3CVL A;  1HX8 A;  1JPL A;  2X3M A;  4KXK B;  2E2E A;  4N5C A;  4I6G A;  4M3O A;  3TAX A;  2XHE A;  4FA6 A;  3FU5 A;  4U0U A;  3ZIM A;  4GU5 A;  4BX9 A;  3Q5M A;  2GRL A;  4N3C A;  2CG2 A;  2I6H A;  4ATG A;  1SZ9 A;  2LSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...