2LNIA

Solution nmr structure of stress-induced-phosphoprotein 1 sti1 from homo sapiens, northeast structural genomics consortium target hr4403e
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
133
structure length
133
Chain Sequence
MGHHHHHHSHMNPDLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stress-induced-phosphoprotein 1
publication title Northeast Structural Genomics Consortium Target HR4403E
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 46
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lniA00
3RO2A 1NA0A 3TG4A 3FWVA 4N3AA 2WQHA 3QOUA 4LEUA 3R9AB 3LY8A 5FJYA 2IF4A 3GW4A 4GA0A 5FT9A 5FZRA 2V5FA 4BT9A 5EX3A 4GYYA 4UI9K 2XCCA 3UPVA 2XCBA 4NQ0A 4NRHB 3ESKA 3S7DA 4G2VA 3MA5A 5A7DB 3TG5A 5DBKA 4N2SA 4J8FA 2C0LA 5LCWJ 3S7FA 1KT1A 5G05J 5ARFA 4G25A 3RKVA 2PZIA 4EQFA 5G04J 4W9RA 4H7YA 4YVQC 4GA2A 2LSUA 3Q5MA 3Q15A 4APOA 3CK8A 4UQZA 4BT8A 4B94A 3TAXA 2IFUA 3LPZA 2UWJG 3EDTB 4N5CA 4WNGA 3WXXA 4J8EA 3LY7A 4N3BA 5A6CA 4I9EA 3LCAA 1XNFA 5JJTA 4JHRA 4UI9C 2P58C 1TJCA 3LKUA 2KATA 4WUYA 3RIBA 4XI0A 5AYWD 1KT0A 3GZ1A 4AM9A 1E96B 3QDNA 3RJVA 3LYAA 2LNIA 4RG6A 2Y4TA 4HOQA 4RG9A 5EKQD 4GA1A 2QFCA 3KD7A 4GYWA 3OXLA 2VSNA 3PDNA 1WM5A 3CKBA 4BWRA 4G24A 2KCLA 3GZ2A 1PC2A 2KCVA 2ONDA 4XI9A 4GZ3A 1ZU2A 3Q4AB 2NC9A 2XGOA 3OXFA 3TGOA 1A17A 2XGMA 4JA9A 4WNDA 3N71A 1KLXA 3SF4A 2XGSA 1ELRA 3CK9A 4CDRA 5FTPA 5CCMA 5EX0A 3UQ3A 1W3BA 2LSVA 3AS8A 2DBAA 4YVOA 3MV3B 3QWWA 3NF1A 1QQEA 5JJ6A 1IYGA 3CVQA 1ELWA 2E2EA 3CVLA 3AS4A 3CVPA 3VTYA 4U0UA 3RO3A 4GPKA 5HI7A 4U0SA 4J0UA 4XIFA 3FFLA 4O6FA 3LY9A 2UY1B 5KJNA 3U3WA 2FEZA 2L6JA 3CV0A 3KAEA 2J9QA 2XPIA 2VGYA 2KC7A 2VGXB 4U07A 2FBNA 4I2ZA 2Q7FA 4CGWA 3RU0A 2C0MA 2JLBA 4HOUA 5M72A 1B89A 2PL2A 3VTXA 4G1TA 3KS2A 1Y8MA 1YA0A 3ZHEB 2FO7A 3ZFWA 2I6HA 3S7BA 4Y6CA 3CKCA 5FZQA 4F3VA 3QKYA 3BEEA 1NA3A 4AY5A 3MKRA 4AIFA 3MEKA 2UY1A 5D0OD 1P5QA 2HYZA 4HOTA 2R5SA 1FCHA 5ARGA 3ZPJA 1HXIA 3CVNA 4N2QA 3O48A 3CK7A 4UI9J 2VGXA 2WPVA 2MHKA 2XEVA 2Y4UA 3ASGA 1WAO1 3ZGQA 4GZ5A 5DIZA 2YQ8A 4I9CA 5BT1A 4U04A 4ABNA 3IEGA 3ZHEA 3ASDA 2YHCA 4GZ6A 5LCWC 2KCKA 4GCOA 3PE3A 5G05C 5FZSA 3PE4A 5KJKA 5G04C 1HH8A 5CCLA 3E4BA 4U0ZA 4I17A 2PQNA 4HORA 4J8DA 2C2LA 4AY6A 3AS5A 2OOEA 2VYIA 3Q47B 4N39A 1ZBPA 4G26A 4I2WA 2BUGA 1HZ4A 3QWVA 2VQ2A 4A1SA 3MV2B 4KYOB 3URZA 4HOSA 4I1AA 2FI7A 1OUVA 2GW1A 4WNEA 4IN3B 3SZ7A 5KJLA 4ME2A 4Y6WA 3OXGA 5JJ7A 4UQYA 4BTBA 4GYOA 4UQXA 3QWPA 2HO1A 3ULQA 4BTAA 3ASHA 3K9IA 3Q49B 3JYSA 1IHGA 3S7JA 2PQRA 1QZ2A 5BNWA 3U4TA 4KXKB 5C1DA 3CEQA 4CGVA 1NZNA 5CHEE 5HQ8A 3GYZA 5KJMA 3ASFA 2HR2A 4JL0A 4KBQA 4YNDA 5D0QD 4H7XA 4JA7A 2FF4A 4GCNA 4G23A 5BW8C 4WNFA 3ZN3A 3UUXA 3FP3A 2AVPA 4N3CA 3HYMB 2VSYA
chains in the Genus database with same CATH superfamily
4U7EB 2WXLA 3B7SA 1NA0A 4PS3A 4LG6A 4GB9A 3TG4A 4N3AA 2EIME 2CHXA 5CEAA 2GROB 3SFZA 5B3SE 4GTPA 2IF4A 4GA0A 3UKUG 2V5FA 5ENNA 4EZKA 2BTDA 4TXRA 4J7WA 4U8VD 1OCZE 5A7DB 1TNUA 5DBKA 5EDSA 5LX8A 4TV3A 1BI7B 2IY0C 3S7FA 4BY6A 5ARFA 3C98A 3L22A 4UWHA 2OVFA 4YVQC 1TNZA 3NZSA 3CK8A 1KZOA 4BT8A 2WMNA 4JVSA 2RKKA 4EHMA 5A6CA 3P1UA 2LXMA 5JJTA 1JCRA 4UI9C 2KATA 4UWKA 2ZXWE 2WXKA 2R02A 5AENA 5AYWD 2OEWA 2P2CP 1KPSB 1H6PA 1E96B 4AM9A 3QDNA 3RJVA 3LYAA 2LO6A 3CLJA 2J49A 1UG3A 2JEKA 3QB2A 3Q75A 3OAWA 1TNBA 4HXIA 1MX4A 4ANWA 4RSYA 3C3RA 2GGFA 3TWWA 4GMLA 3APCA 4R7LA 4F53A 2WM9A 1HS6A 4HI8A 4BWRA 2KCLA 5ENQD 3FH8A 4AEZC 1EPUA 2ONDA 4XI9A 1ZU2A 2NC9A 3SI5A 2XEHA 5FQ4A 3TGOA 2OEVA 3LS8A 4JA9A 3N71A 4EBAG 3VLFA 2ZU6B 4HB5A 3NQPA 4LNGA 3ZYLA 4EECA 1LF8A 5KBAA 1HX8A 2NXPA 1L5JA 5HS0A 1FT1A 2F37A 2F8YA 4O1OA 4YVOA 4B89A 3ZXSA 3G2VA 3J5PA 3QWWA 4KVMA 3FDHA 1H0AA 5HKPA 4F1PA 2H6FA 3RAUA 4JZYA 2R2LA 2X38A 1XGWA 3UIOC 3ML8A 1UN8A 4FLBA 3CVPA 4A63B 2LXLA 3FUEA 4GPKA 2YINA 3RRUA 4J0UA 2FO1E 3B7BA 3FFLA 4UWLA 3JQ1A 3D9IA 3L9TA 5KJNA 3U3WA 3D9MA 2XPZA 5CMYA 3KAEA 2XPIA 3TXMA 3HXBA 3ZKJA 1MHQA 2P9KG 1UN9A 2VGYA 3Q79A 5CBNA 4IRUA 3JQ0A 4C9BB 3ZIMA 2KZTA 1QYMA 3L82A 2DIWA 4XX5A 2WQ6A 2JLBA 2L6BA 4K03A 2PL2A 4G1TA 3Q73A 4FHKA 2FO7A 1E8WA 2X6JA 3TWUA 1FPPA 3ZFWA 3SY2A 3JCKC 3EHMA 3BEEA 1YCSB 4JB8P 3UI2A 4AY5A 2OV8A 1N9AA 4JW1A 3LJNA 1P5QA 4ANXA 1N52A 4F7AA 1SZ9A 2HYZA 1E8ZA 2X6FA 2XQ0A 3CK7A 2BKKB 3QJZA 5ANRA 2VGXA 1EF1C 1N11A 2XEVA 1FVHA 3ZGQA 3I4RB 4BETA 3L08A 3PZ2A 3T9KA 4F6RD 3O4ZA 5BT1A 2NSZA 1NI1A 3ZHEA 1JWFA 4A1GA 3PE3A 1OWMA 2GRPB 3PE4A 1TYQG 2EQXA 2WXQA 4DI4A 3DBSA 5G04C 5AQBA 4HFGA 4I17A 2PQNA 4HORA 5JMND 5KNHD 1V54E 3DSXA 3QNKA 2DZNA 2CHZA 4N39A 4C48B 1ZBPA 4I2WA 5G2NA 2L9BA 3APFA 3SNXA 4A1SA 3KEZA 1O5MA 2QZAA 3PEVB 2V8SE 5D2MC 1OUVA 3G2WA 2GW1A 4I6EA 2EIKE 5KJLA 4ME2A 3SGHA 4FHJA 5ANLA 4BTBA 4EZLA 4UQXA 3QWPA 3ZUVB 5AARA 4BTAA 1N4PA 1A5EA 3ASHA 4AP2A 3Q78A 3Q49B 2H6IA 4PS7A 3U4TA 4FJZA 3FUMA 3FU6A 2GRRB 3HXDA 2ETCA 4CGVA 4O1PA 5CHEE 5CRUA 5ENOD 5KJMA 5CBOA 4V3IA 2HR2A 3DSUA 1BD8A 4I43A 2RFAA 3ABKE 4YNDA 2H6GA 3AG4E 1MX6A 5D0QD 1HE8A 4GCNA 2R59A 3CHRA 3DSVA 4WNFA 4EZJA 5FIOA 2XHEA 3AU4A 1YYHA 4N3CA 1JCQA 4KVOA 3QARA 4YDOA 3FU5A 5T3RA 4CT0A 3R9AB 3U9WA 2IJGX 2V0PA 3GW4A 5FZRA 4J6IA 4BT9A 3ZYQA 3ISMC 2WXOA 2B0OE 4AOFA 3SFXA 2Y69E 2Y1LE 4G2VA 3TG5A 4DX2A 3PRZA 5LCWJ 3MZLB 4TUMA 2X6IA 2VTBA 4EPZA 2ETBA 2KXPC 3TWVA 1S0PA 4GA2A 1YMPA 4ANVA 3FTWA 3Q5MA 5FQ6A 4HS2A 2ZGGA 4UQZA 3TAXA 3HG0D 2P9LG 1Z6TA 5BXUA 4N3BA 3AU5A 4DRXE 3ZXPA 3NAWA 4OYSA 2R17C 4I6GA 2F0YA 3HHMA 3LKUA 4G8KA 4WUYA 3RIBA 4XI0A 3L13A 3VLDA 1IQRA 1LD8A 1KT0A 1TN8A 2WXIA 3GZ1A 1JWGA 5IY5E 3PUKA 4QQIA 2LNIA 4HLLA 3PVLA 3I3NA 5EKQD 1TJFA 3MKQA 4FLHA 4M3OA 2QFCA 3TWXA 3DXKG 4DK5A 3PDNA 4HQDA 4HRLA 4G24A 2EINE 4LRZA 3EIQC 1LTXA 2KCVA 3Q4AB 3SFYA 4KZ0A 1S63A 1IKND 5JHBA 2XGMA 1OCCE 1WG0A 4WNDA 3V2XA 3DPDA 4K5CA 2XGSA 3JUIA 1ELRA 1FT2A 4MS6A 3T5XA 4CDRA 4APFA 3ONKA 5CCMA 3FUIA 1TNYA 4L9PA 5BV1A 2WXRA 4U8YD 4BX8A 3UQ3A 2V5QC 3QK0A 2DBAA 3Q9UC 4TRQA 5CEDB 2KZTB 4X8QA 4FULA 4GTSA 3MV3B 4BEPA 1K1AA 3ZU7B 1ELWA 2IONA 2L0TB 2E2EA 2WXNA 4YDEA 4XE0A 4CDNA 3VTYA 1RW2A 4U0UA 4QFVA 1UJJA 1TN7A 5HI7A 5HRYA 1BI8B 3HVEA 3I5PA 4XIFA 3EU9A 3ABLE 3LY9A 3CHQA 4GTQA 3FEXA 3UIPC 2FEZA 2X6HA 4P29A 3J5QB 4K5BA 3NOGD 5BXOA 2J9QA 3ABME 1WDYA 1DVPA 5D66A 4NURA 2VGXB 2Q7FA 2A5UA 2DZOA 3FTYA 3FUFA 3ENEA 2C0MA 3DXMG 5M72A 3ZHEB 1D9SA 5LFAA 1D8EA 2WXFA 3LXUX 3FU0A 3CKCA 3CGHA 5FZQA 1MX2A 3QKYA 1VDYA 1NA3A 3MKRA 4L2LA 3ULEG 3S2AA 4CYMD 4GMJA 3D9HA 3ZPJA 4B8AA 1D8DA 1HXIA 3KEAA 4UI9J 3UKRG 1IQUA 2MHKA 2EILE 1WAO1 4L23A 4GZ5A 5DIZA 1G3NB 3T8KA 2YQ8A 4DX1A 4BSXA 4ILHB 4GMRA 3IEGA 3AAAC 3ASDA 2YHCA 3CVYA 2KCKA 4PUCA 5G05C 5CRVA 3ONLA 5KJKA 3T5VA 4HBDA 2GRMA 3DSWA 2FULA 2PM7A 1HH8A 2DYSE 5B1AE 5CCLA 3RK6A 2ZGDA 3FUHA 4AY6A 4DLQA 1MQSA 3SD5A 2VYIA 4F1SA 4ZHBA 1HFAA 4DI3A 3UM0A 1HZ4A 3RRNB 4OAVB 2I2OA 3P2BA 3TXNA 3KSLA 2WXJA 4YDYA 3MV2B 3CQGB 4KMOA 4ANUA 3CHOA 3E33A 3AG2E 4PS8A 3PS6A 3SZ7A 1X5BA 3OXGA 2J07A 4JEUA 4UQYA 1Z5SC 2IU1A 2XZDG 3BG0B 2WQ7A 4HNAD 3IHVA 5AQ9A 4M7CA 3LVRE 3K9IA 1PAQA 3DEOA 4I1MA 4UWGA 1K3ZD 4HRNA 2DVWA 3D3MA 4ILGA 1RZ4A 1E90A 3DEPA 2LUHA 1E8XA 1U3CA 5EIBE 3MX3A 3D9JA 1TNOA 5FQ7A 3CHPA 5HQ8A 3GYZA 3ASFA 4JL0A 2P9IG 2IQCA 4KBQA 5EIDA 5J90A 3FY4A 2PM6A 3DWLG 2QYJA 3IXEA 3L17A 2HE0A 1IHBA 3CHMA 4Q69A 1O1RA 2AXVA 1MJ0A 2FF4A 4G23A 5BW8C 3X2QE 2Y3AA 3ZN3A 4JHJA 3LDZA 3Q7FA 2R03A 3UUXA 4CDMA 2BEDA 2AVPA 3ASOE 3DSSA 3APDA 2AXZA 3MYVA 4BSZB 3ZNGA 3V31A 2VTBB 3BG1B 2WXHA 3RO2A 3G2SA 4XKCA 4LCTA 2GRLA 4E85A 1O1SA 3FWVA 3L6AA 2XRYA 2WQHA 1SZAA 4LEUA 3LY8A 5ITZF 3FEYA 2ETAA 2P9UG 2GRNB 3BU8A 3E37A 5ENRD 3FU3A 4O60A 3UPVA 5AIJA 1H2UA 2XCBA 4HVBA 4NRHB 4HLEA 1TR4A 1KZPA 2NYJA 3ZYKA 3ESKA 1N4QA 5CECB 3F6QA 5FWQA 3MA5A 2AWIA 4OVUA 3UMVA 2PZIA 4EQFA 1OWOA 4WAFA 1JUQA 5G04J 4H7YA 1H6OA 2LAIA 2VJ8A 3UT7A 4DJAA 3MKQB 3JXJA 1E7VA 4JC8A 1H2VC 3B7UX 3EUVA 4APOA 4Q94A 1K1BA 3B7TA 4B94A 3LPZA 2PNNA 3U66A 1Y6IA 2WXMA 1HO8A 3EDTB 4N5CA 3WXXA 3LY7A 4U63A 3NB2A 1N94A 4I9EA 3LCAA 3PZ3A 2IOLA 2Y0BG 1BPOA 5BPPA 2P58C 1TJCA 1OWLA 3DRAA 4FC8A 3CVWA 2E0IA 1NFIE 2A5EA 1N0QA 5E76A 4RG6A 2Y4TA 4HOQA 4RG9A 4GA1A 3SO8A 1SA4A 2J09A 3KD7A 4XEIG 2P9NG 3CSTA 3IHYA 2VSNA 1WM5A 1UJKA 3C72A 3GZ2A 1PC2A 4CZ2D 2YHEA 3PH0C 4J8SA 3TWSA 3HVEB 3OXFA 1A17A 1U3DA 5BUZA 4L1BA 3FTVA 3R9MA 1KLXA 5AQAA 1OXJA 2CFUA 2I9CA 5AN8A 5EX0A 1MZCA 2QY7A 3AS8A 4OAUC 2XEEA 3UINC 4PH4B 1V55E 3RRMB 2V4LA 3NBNB 3AS4A 3MGBA 4XZ4A 3RO3A 3PREA 3ZW3A 4U0SA 1OCRE 3UM3A 1HU3A 2DCPA 3TWRA 4HI9A 4O6FA 3C3OA 4BESA 3CV0A 1OWNA 5AJDA 4FP7A 4DLOA 4ILIA 2MRIA 4U07A 2FBNA 2GRQB 4U96D 4I2ZA 1BLXB 2IO3C 1LD7A 4CGWA 3RU0A 4CRWA 5C2YA 4HOUA 3FHEA 1B89A 4MBGA 2J8SD 3U64A 1YA0A 4KZCA 1H19A 3V2OA 4E6HA 2WXGA 5JHAA 2I6HA 4XKBA 2QYUA 3ML9A 3CVUA 3PNLB 3PUJA 4G8LA 4AIFA 5KWDA 4AJWA 2UY1A 1PY1A 5D0OD 2H6HA 2VSOE 2ZISA 1Z3YA 4HOTA 2R5SA 5ARGA 3HIZA 1SVXA 4N2QA 1WY6A 4FJYA 1MYOA 2Y4UA 4RVBA 3FTSA 5CMWA 4LUNU 1HF8A 4ATGA 4ABNA 2B6CA 1JPLA 4GZ6A 5EYPF 2AXUA 5JA4D 3UX4A 2IEJA 2XENA 4UWFA 5FZSA 1S70B 5ENTD 2XS1A 4WWNA 4BFRA 4FU3A 3E4BA 4AXHA 2OVBA 1TN6A 4J8DA 3FH7A 4WWOA 3R7QA 3E32A 4YDWA 1SW6A 2KM4A 2BUGA 3DPYA 3QWVA 3W9FA 3VLEA 3UTMA 3I4GA 4GTVA 5AJLA 1DC2A 4B0ZA 5B1BE 5G55A 4HOSA 1NP7A 3AG1E 4I1AA 4DX5D 3CVXA 4IN3B 4JEHA 1HG5A 3C3QA 2CFZA 3IV0A 4GYOA 3CSFA 2HO1A 4CT4A 4FA6A 2MYOA 2WMOA 4LNBA 3PNTB 3JYSA 1S64A 2F8XK 2HM8A 3SHFA 4LERA 3SQVA 3ZEFA 2IOSA 3CEQA 5EYLA 3HXFA 1NZNA 3ASNE 2CG2A 3EHQA 1K8KG 3D9NA 1SA5A 5A23A 5ENSD 5CERB 1EYHA 2OCCE 4H7XA 4MKTA 2I1JA 3FULA 4CEMA 1N0RA 3V30A 3T8MA 3JXIA 4NACA 2VGEA 3HYMB 2VSYA 3EJNA 3LEWA 3Q9NC 4K0RA 3QOUA 5FJYA 3G2UA 3WG7E 3L54A 2R05A 5FT9A 1OWPA 5BV0A 5EX3A 4GYYA 4UI9K 2XCCA 4DX6D 5LOZA 2AJAA 1H6KA 1SQMA 2P9SG 4NQ0A 3FUKA 3B7RL 2WB2A 1N4SA 3S7DA 4Q96A 4N2SA 3NOCD 3HXCA 1INZA 4J8FA 4BX9A 2C0LA 2V4HC 3B13A 1KT1A 4TXPA 5G05J 4G25A 2IO2C 5AAOA 3RKVA 2J4BA 4W9RA 3NZUA 2LSUA 2EIJE 2WVIA 3MJWA 4DX7D 4A3TA 5T4YA 3DSTA 3UXGA 5FINA 3Q15A 2I1KA 1UOHA 1OT8A 3SBTB 2ZIRA 2IFUA 2UWJG 3AG3E 4FADA 4WNGA 5J08A 1DCEA 3CQCB 4J8EA 1N54A 4K5AB 1XNFA 3E30A 4JHRA 4ZFHA 3FTUA 3D9KA 2M63A 4B93B 4JXTA 3CVVA 4AV7A 1OCOE 4U8HA 4GTTA 4I6JA 4GU5A 4J8YA 3FTXA 3OTNA 3HRAA 3QC1A 1OY3D 2RG8A 5ENPD 2CHWA 1IXVA 2AW6A 4D10C 4GYWA 4ACKA 3OXLA 3LJ3A 3CR3A 3UT4A 2BF0X 4GZDA 3EHRA 4JD2G 3B95A 1ELKA 3CKBA 1E7UA 4LSZE 1GW6A 3KSQA 1ZB1A 4GZ3A 2XGOA 1QNFA 4RQIA 2XZTG 4JHKA 3D9LA 3ZRHA 5KCMA 3SF4A 4TUUA 3CK9A 3EU5A 3ZVVA 2RD0A 4L2YA 3UT8A 5FTPA 2X3MA 1W3BA 2LSVA 3TL5A 5FQ8A 4GTRA 3RSEG 4LNUD 5AQ7A 2RFMA 4B8CB 3NF1A 1QQEA 5JJ6A 4I1OB 1IYGA 3CVQA 3HDXA 2DYRE 2MOWA 3JUEA 3W9GA 3CVLA 4GTMA 3QAQA 1DCQA 3MCXA 2DWZA 4ACLA 1NL4A 4MRUA 1H2TC 3HXEA 4C0MA 2WXPA 4DUIA 2UY1B 2L6JA 3GZSA 4IYPA 3AJIA 1QBQA 3D9OA 2KC7A 3ESLA 3R7RA 4PDXA 4N5QA 4GPMA 2P9PG 1Q2ZA 4EBAA 3VTXA 1TEZA 3KS2A 2A4ZA 1N95A 1Y8MA 2JABA 3S7BA 4Y6CA 1DNPA 3ULYA 4F3VA 3CHSA 3MEKA 4KT6B 1FCHA 3IBEA 3CVNA 3O48A 4GAAA 2X6KA 2ILRA 3FUNA 2WPVA 2L0IA 3ASGA 1EDUA 2LAHA 2XRZA 4I9CA 5E75A 4U04A 4C0EA 5LCWC 4GCOA 4CCAA 3FUDA 3EHNA 3ZYMA 2KBXA 4U95D 4U0ZA 3TWQA 2C2LA 2QC9A 4HRMB 3AS5A 4MLPA 3BUAA 2OOEA 3Q47B 4UUCA 4G26A 3V79K 1UW4B 2VQ2A 5EN5D 1U2VG 3FTZA 2XS8A 4BERA 4KYOB 5EILA 3URZA 3TWTA 3Q7AA 1AP7A 5T8IA 5LP0A 3SBSA 2FI7A 1E8YA 4G11A 1Z3XA 4WNEA 1FVFA 2J4DA 4OVVA 4RLYA 4Y6WA 5JJ7A 5KNGA 2BKGA 3PEUB 3PZ1A 4URKA 3ULQA 4TXQA 1IHGA 3LVQE 3S7JA 2PQRA 1QZ2A 5BNWA 4KXKB 3FH5A 4Z68A 1O1TA 3PZ4A 2CG3A 5C1DA 1N4RA 2XPYA 1HG2A 5H7PA 3TJPA 3L16A 1JCSA 4L7TA 1X81A 4JPSA 3EIJA 4GTOA 4ATZD 3BQOA 3D9PA 4IULA 2YNQA 4DPRA 4GZCA 4JA7A 3FUJA 2J08A 3E34A 3UM1A 3CIAA 3PZDA 4A55A 3C5RA 4WWPA 3G2TA 3UM2A 4NIKA 1BU9A 3IKOB 1AWCB 4A3VA 2VSXE 4AVXA 3FP3A
chains in the Genus database with same CATH topology
2WXHA 3RO2A 3G2SA 3EJNA 4XKCA 4KVOA 2WXLA 3B7SA 1NA0A 3QARA 4LCTA 3FU5A 4PS3A 2GRLA 3LEWA 4GB9A 3TG4A 4E85A 3FWVA 4N3AA 3L6AA 4K0RA 2CHXA 2XRYA 2WQHA 1SZAA 3QOUA 5T3RA 4LEUA 4CT0A 3R9AB 3LY8A 5FJYA 3SFZA 3U9WA 3G2UA 3FEYA 2IF4A 2IJGX 3L54A 2V0PA 3GW4A 4GA0A 5FT9A 5FZRA 2V5FA 4J6IA 1OWPA 4BT9A 5BV0A 3ZYQA 2WXOA 5EX3A 3FU3A 4GYYA 4UI9K 2XCCA 5ENNA 4AOFA 5LOZA 4EZKA 1H2UA 2XCBA 5AIJA 3UPVA 1H6KA 1SQMA 4NQ0A 4NRHB 4HVBA 4HLEA 3FUKA 3B7RL 3ZYKA 2WB2A 2BTDA 3ESKA 3S7DA 5FWQA 4G2VA 3MA5A 5A7DB 3TG5A 4Q96A 5DBKA 5EDSA 4N2SA 5LX8A 4J8FA 1INZA 3PRZA 4BX9A 4TV3A 2C0LA 5LCWJ 3MZLB 2AWIA 3B13A 4OVUA 3S7FA 1KT1A 5G05J 4BY6A 5ARFA 2X6IA 3C98A 4G25A 3UMVA 3RKVA 2J4BA 2VTBA 3L22A 2PZIA 2OVFA 4UWHA 4EQFA 1OWOA 4WAFA 1JUQA 5G04J 4W9RA 4EPZA 4H7YA 2LAIA 3NZUA 4YVQC 2VJ8A 1S0PA 4GA2A 2LSUA 3UT7A 2WVIA 3MJWA 4DJAA 4A3TA 4ANVA 3FTWA 3Q5MA 5T4YA 3MKQB 3Q15A 1E7VA 4JC8A 1H2VC 2I1KA 4HS2A 5FQ6A 3B7UX 3NZSA 4APOA 3CK8A 3SBTB 4UQZA 4Q94A 4BT8A 3B7TA 2WMNA 3TAXA 2IFUA 4B94A 3LPZA 2UWJG 3U66A 4JVSA 1Y6IA 2WXMA 4FADA 1HO8A 3EDTB 4N5CA 4WNGA 5J08A 3WXXA 1Z6TA 3CQCB 4J8EA 3LY7A 4U63A 4N3BA 1N54A 5A6CA 4I9EA 3AU5A 3LCAA 3P1UA 2IOLA 1XNFA 1BPOA 5JJTA 4OYSA 5BPPA 2R17C 4JHRA 4UI9C 2P58C 1TJCA 4I6GA 3FTUA 3HHMA 3LKUA 2KATA 3D9KA 2M63A 4UWKA 1OWLA 2WXKA 4WUYA 3RIBA 4JXTA 4XI0A 5AYWD 4AV7A 3L13A 3VLDA 1IQRA 5AENA 3CVVA 4U8HA 1KT0A 2WXIA 3GZ1A 4FC8A 4GU5A 4I6JA 3CVWA 1JWGA 3FTXA 3PUKA 2E0IA 1E96B 4AM9A 3QDNA 3RJVA 3LYAA 2LNIA 3OTNA 2LO6A 3PVLA 3I3NA 3QC1A 5E76A 4RG6A 3CLJA 2Y4TA 2J49A 1UG3A 2JEKA 4HOQA 4RG9A 3QB2A 5EKQD 1TJFA 2RG8A 4GA1A 3MKQA 4FLHA 3OAWA 2J09A 4HXIA 4M3OA 2CHWA 4ANWA 4RSYA 2AW6A 2GGFA 2QFCA 3KD7A 4D10C 4GMLA 3APCA 4GYWA 4ACKA 3OXLA 3LJ3A 3CSTA 4R7LA 3CR3A 2WM9A 3UT4A 4DK5A 4F53A 3IHYA 2BF0X 2VSNA 4GZDA 1HS6A 3PDNA 1WM5A 3CKBA 1ELKA 1UJKA 4BWRA 1E7UA 4G24A 1GW6A 2KCLA 4LRZA 3EIQC 3FH8A 3GZ2A 1PC2A 4AEZC 1EPUA 2KCVA 2YHEA 2ONDA 3PH0C 4GZ3A 4XI9A 1ZU2A 3Q4AB 2NC9A 3SI5A 4J8SA 3HVEB 5FQ4A 4KZ0A 2XGOA 1QNFA 3OXFA 3TGOA 5JHBA 1A17A 3LS8A 2XGMA 1U3DA 4JA9A 5BUZA 4JHKA 4WNDA 4L1BA 3N71A 3FTVA 4EBAG 3D9LA 3DPDA 3VLFA 2ZU6B 3ZRHA 1KLXA 5KCMA 3SF4A 2XGSA 4TUUA 3NQPA 3JUIA 2CFUA 1ELRA 3CK9A 2I9CA 3ZYLA 4MS6A 3T5XA 1LF8A 4APFA 3ZVVA 3ONKA 4CDRA 2RD0A 4EECA 4L2YA 3UT8A 5FTPA 2X3MA 1HX8A 3FUIA 5CCMA 5BV1A 2WXRA 2NXPA 5EX0A 3UQ3A 4BX8A 1W3BA 1L5JA 2LSVA 3QK0A 3TL5A 5FQ8A 2QY7A 3AS8A 2DBAA 4YVOA 4TRQA 4B89A 3ZXSA 2KZTB 3G2VA 4FULA 3MV3B 3QWWA 3NF1A 4B8CB 4KVMA 1QQEA 5JJ6A 3FDHA 4I1OB 1IYGA 1H0AA 4PH4B 3CVQA 1ELWA 2IONA 2L0TB 3HDXA 2V4LA 4JZYA 2MOWA 2X38A 2E2EA 3RRMB 1XGWA 2WXNA 3CVLA 3QAQA 3ML8A 3AS4A 3MGBA 4XZ4A 1UN8A 4FLBA 3CVPA 3MCXA 4XE0A 4CDNA 3VTYA 4U0UA 4QFVA 4ACLA 3RO3A 1UJJA 3FUEA 4GPKA 2YINA 5HI7A 3PREA 3ZW3A 4U0SA 4MRUA 3RRUA 1H2TC 3HVEA 3I5PA 4J0UA 4XIFA 1HU3A 3FFLA 4C0MA 2DCPA 4UWLA 3JQ1A 3D9IA 4O6FA 2WXPA 3LY9A 3CHQA 2UY1B 3FEXA 5KJNA 3U3WA 3D9MA 2FEZA 2L6JA 2X6HA 3GZSA 4IYPA 4P29A 2XPZA 3CV0A 5CMYA 3KAEA 1OWNA 2J9QA 2XPIA 3TXMA 1MHQA 5AJDA 1UN9A 2VGYA 1DVPA 4FP7A 4IRUA 4NURA 3D9OA 2KC7A 4DLOA 2VGXB 4ILIA 2MRIA 3JQ0A 4U07A 4C9BB 3ZIMA 2FBNA 3ESLA 4I2ZA 3R7RA 2Q7FA 2A5UA 4CGWA 2KZTA 3FTYA 4PDXA 3FUFA 3RU0A 4CRWA 2DIWA 3ENEA 2C0MA 5C2YA 4XX5A 2WQ6A 2JLBA 4HOUA 5M72A 4K03A 3FHEA 1B89A 2PL2A 4EBAA 3U64A 3VTXA 4G1TA 3KS2A 1TEZA 2A4ZA 1Y8MA 1YA0A 4FHKA 3ZHEB 2FO7A 4KZCA 1E8WA 2X6JA 1H19A 4E6HA 5LFAA 3ZFWA 2WXGA 5JHAA 2I6HA 2WXFA 4XKBA 3LXUX 3S7BA 4Y6CA 3JCKC 3ML9A 3CVUA 3FU0A 3CKCA 3CGHA 5FZQA 1DNPA 3EHMA 3PNLB 4F3VA 3QKYA 1VDYA 3BEEA 1NA3A 4AY5A 3MKRA 3PUJA 4AIFA 4L2LA 2OV8A 3CHSA 3MEKA 2UY1A 1PY1A 4JW1A 5D0OD 4AJWA 3S2AA 1P5QA 4ANXA 2VSOE 1N52A 4F7AA 1SZ9A 1Z3YA 2HYZA 1E8ZA 4GMJA 4KT6B 4HOTA 2R5SA 2X6FA 1FCHA 2XQ0A 3IBEA 5ARGA 3ZPJA 4B8AA 3HIZA 1HXIA 3CVNA 4N2QA 3O48A 4GAAA 2X6KA 3CK7A 2ILRA 3QJZA 4UI9J 5ANRA 2VGXA 1WY6A 1IQUA 1EF1C 3FUNA 2WPVA 2MHKA 4FJYA 2XEVA 2Y4UA 2L0IA 3ASGA 1WAO1 4RVBA 1FVHA 3FTSA 3ZGQA 1EDUA 3I4RB 4GZ5A 4L23A 5DIZA 4LUNU 2LAHA 3L08A 5CMWA 2XRZA 2YQ8A 4I9CA 4BSXA 4ILHB 1HF8A 3O4ZA 5BT1A 2NSZA 5E75A 4U04A 4ABNA 4ATGA 3IEGA 1JPLA 3ASDA 2YHCA 3ZHEA 4C0EA 4GZ6A 5LCWC 3CVYA 2AXUA 2KCKA 4GCOA 1JWFA 3UX4A 4CCAA 4A1GA 3PE3A 4PUCA 5G05C 3FUDA 4UWFA 5FZSA 1OWMA 3PE4A 3EHNA 3ONLA 5KJKA 3T5VA 2EQXA 2WXQA 2GRMA 4WWNA 3ZYMA 4BFRA 4FU3A 4DI4A 2FULA 2PM7A 3DBSA 1HH8A 5G04C 5CCLA 3E4BA 3RK6A 4U0ZA 3FUHA 4HFGA 4I17A 2PQNA 4AXHA 2OVBA 4HORA 4J8DA 3FH7A 2C2LA 4WWOA 3R7QA 4AY6A 3AS5A 3QNKA 2CHZA 4MLPA 2OOEA 4DLQA 1MQSA 3SD5A 2VYIA 2KM4A 3Q47B 4N39A 1ZBPA 4G26A 4I2WA 4F1SA 2BUGA 1HFAA 5G2NA 4DI3A 2L9BA 1HZ4A 3RRNB 3APFA 3QWVA 2I2OA 3P2BA 1UW4B 3VLEA 3SNXA 3TXNA 2VQ2A 4A1SA 2WXJA 3KEZA 3I4GA 3FTZA 3MV2B 3PEVB 5AJLA 3CQGB 4KYOB 4B0ZA 4KMOA 4ANUA 2V8SE 3URZA 5G55A 3CHOA 5T8IA 4HOSA 1NP7A 5LP0A 3SBSA 4I1AA 2FI7A 1E8YA 1OUVA 3G2WA 3CVXA 2GW1A 3PS6A 4G11A 1Z3XA 4I6EA 4PS8A 4IN3B 4WNEA 4JEHA 1FVFA 1HG5A 2J4DA 1X5BA 3SZ7A 5KJLA 4ME2A 4OVVA 4Y6WA 3OXGA 2J07A 2CFZA 4JEUA 5JJ7A 3SGHA 3IV0A 4UQYA 4FHJA 5ANLA 4BTBA 4GYOA 3PEUB 2IU1A 4EZLA 4UQXA 3BG0B 3QWPA 2WQ7A 3CSFA 4URKA 2HO1A 4CT4A 3ULQA 3IHVA 4BTAA 3ASHA 4AP2A 4FA6A 1PAQA 3K9IA 2WMOA 3LVRE 3Q49B 3PNTB 4I1MA 3JYSA 1IHGA 3LVQE 4UWGA 2PQRA 3S7JA 4PS7A 1QZ2A 5BNWA 3U4TA 4FJZA 3FUMA 3D3MA 4ILGA 4KXKB 2HM8A 1E90A 3FU6A 3FH5A 3SHFA 4LERA 1E8XA 1U3CA 3ZEFA 2CG3A 2IOSA 5C1DA 3CEQA 4CGVA 2XPYA 1NZNA 3MX3A 5CHEE 3D9JA 1HG2A 3TJPA 3L16A 2CG2A 5FQ7A 3CHPA 5HQ8A 3GYZA 5KJMA 3ASFA 4L7TA 4V3IA 2HR2A 4JL0A 3D9NA 5A23A 2IQCA 4KBQA 5J90A 3FY4A 4JPSA 4I43A 3EIJA 2PM6A 1EYHA 4YNDA 3D9PA 3L17A 5D0QD 4H7XA 4IULA 4MKTA 2YNQA 4DPRA 1HE8A 4GZCA 4JA7A 3CHMA 3FUJA 2J08A 4Q69A 2AXVA 2I1JA 2FF4A 3CIAA 3PZDA 4GCNA 3FULA 4G23A 4CEMA 2R59A 3CHRA 5BW8C 4WNFA 4EZJA 2Y3AA 4A55A 4WWPA 3ZN3A 4JHJA 3T8MA 3LDZA 3G2TA 2XHEA 3AU4A 3UUXA 4NACA 3FP3A 4CDMA 3IKOB 2AVPA 3APDA 2AXZA 4N3CA 2VSXE 4A3VA 3MYVA 4AVXA 3HYMB 2VSYA 2VTBB 3BG1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RO2 A;  1NA0 A;  3TG4 A;  3FWV A;  4N3A A;  2WQH A;  3QOU A;  4LEU A;  3R9A B;  3LY8 A;  5FJY A;  2IF4 A;  3GW4 A;  4GA0 A;  5FT9 A;  5FZR A;  2V5F A;  4BT9 A;  5EX3 A;  4GYY A;  4UI9 K;  2XCC A;  3UPV A;  2XCB A;  4NQ0 A;  4NRH B;  3ESK A;  3S7D A;  4G2V A;  3MA5 A;  5A7D B;  3TG5 A;  5DBK A;  4N2S A;  4J8F A;  2C0L A;  5LCW J;  3S7F A;  1KT1 A;  5G05 J;  5ARF A;  4G25 A;  3RKV A;  2PZI A;  4EQF A;  5G04 J;  4W9R A;  4H7Y A;  4YVQ C;  4GA2 A;  2LSU A;  3Q5M A;  3Q15 A;  4APO A;  3CK8 A;  4UQZ A;  4BT8 A;  4B94 A;  3TAX A;  2IFU A;  3LPZ A;  2UWJ G;  3EDT B;  4N5C A;  4WNG A;  3WXX A;  4J8E A;  3LY7 A;  4N3B A;  5A6C A;  4I9E A;  3LCA A;  1XNF A;  5JJT A;  4JHR A;  4UI9 C;  2P58 C;  1TJC A;  3LKU A;  2KAT A;  4WUY A;  3RIB A;  4XI0 A;  5AYW D;  1KT0 A;  3GZ1 A;  4AM9 A;  1E96 B;  3QDN A;  3RJV A;  3LYA A;  2LNI A;  4RG6 A;  2Y4T A;  4HOQ A;  4RG9 A;  5EKQ D;  4GA1 A;  2QFC A;  3KD7 A;  4GYW A;  3OXL A;  2VSN A;  3PDN A;  1WM5 A;  3CKB A;  4BWR A;  4G24 A;  2KCL A;  3GZ2 A;  1PC2 A;  2KCV A;  2OND A;  4XI9 A;  4GZ3 A;  1ZU2 A;  3Q4A B;  2NC9 A;  2XGO A;  3OXF A;  3TGO A;  1A17 A;  2XGM A;  4JA9 A;  4WND A;  3N71 A;  1KLX A;  3SF4 A;  2XGS A;  1ELR A;  3CK9 A;  4CDR A;  5FTP A;  5CCM A;  5EX0 A;  3UQ3 A;  1W3B A;  2LSV A;  3AS8 A;  2DBA A;  4YVO A;  3MV3 B;  3QWW A;  3NF1 A;  1QQE A;  5JJ6 A;  1IYG A;  3CVQ A;  1ELW A;  2E2E A;  3CVL A;  3AS4 A;  3CVP A;  3VTY A;  4U0U A;  3RO3 A;  4GPK A;  5HI7 A;  4U0S A;  4J0U A;  4XIF A;  3FFL A;  4O6F A;  3LY9 A;  2UY1 B;  5KJN A;  3U3W A;  2FEZ A;  2L6J A;  3CV0 A;  3KAE A;  2J9Q A;  2XPI A;  2VGY A;  2KC7 A;  2VGX B;  4U07 A;  2FBN A;  4I2Z A;  2Q7F A;  4CGW A;  3RU0 A;  2C0M A;  2JLB A;  4HOU A;  5M72 A;  1B89 A;  2PL2 A;  3VTX A;  4G1T A;  3KS2 A;  1Y8M A;  1YA0 A;  3ZHE B;  2FO7 A;  3ZFW A;  2I6H A;  3S7B A;  4Y6C A;  3CKC A;  5FZQ A;  4F3V A;  3QKY A;  3BEE A;  1NA3 A;  4AY5 A;  3MKR A;  4AIF A;  3MEK A;  2UY1 A;  5D0O D;  1P5Q A;  2HYZ A;  4HOT A;  2R5S A;  1FCH A;  5ARG A;  3ZPJ A;  1HXI A;  3CVN A;  4N2Q A;  3O48 A;  3CK7 A;  4UI9 J;  2VGX A;  2WPV A;  2MHK A;  2XEV A;  2Y4U A;  3ASG A;  1WAO 1;  3ZGQ A;  4GZ5 A;  5DIZ A;  2YQ8 A;  4I9C A;  5BT1 A;  4U04 A;  4ABN A;  3IEG A;  3ZHE A;  3ASD A;  2YHC A;  4GZ6 A;  5LCW C;  2KCK A;  4GCO A;  3PE3 A;  5G05 C;  5FZS A;  3PE4 A;  5KJK A;  5G04 C;  1HH8 A;  5CCL A;  3E4B A;  4U0Z A;  4I17 A;  2PQN A;  4HOR A;  4J8D A;  2C2L A;  4AY6 A;  3AS5 A;  2OOE A;  2VYI A;  3Q47 B;  4N39 A;  1ZBP A;  4G26 A;  4I2W A;  2BUG A;  1HZ4 A;  3QWV A;  2VQ2 A;  4A1S A;  3MV2 B;  4KYO B;  3URZ A;  4HOS A;  4I1A A;  2FI7 A;  1OUV A;  2GW1 A;  4WNE A;  4IN3 B;  3SZ7 A;  5KJL A;  4ME2 A;  4Y6W A;  3OXG A;  5JJ7 A;  4UQY A;  4BTB A;  4GYO A;  4UQX A;  3QWP A;  2HO1 A;  3ULQ A;  4BTA A;  3ASH A;  3K9I A;  3Q49 B;  3JYS A;  1IHG A;  3S7J A;  2PQR A;  1QZ2 A;  5BNW A;  3U4T A;  4KXK B;  5C1D A;  3CEQ A;  4CGV A;  1NZN A;  5CHE E;  5HQ8 A;  3GYZ A;  5KJM A;  3ASF A;  2HR2 A;  4JL0 A;  4KBQ A;  4YND A;  5D0Q D;  4H7X A;  4JA7 A;  2FF4 A;  4GCN A;  4G23 A;  5BW8 C;  4WNF A;  3ZN3 A;  3UUX A;  3FP3 A;  2AVP A;  4N3C A;  3HYM B;  2VSY A; 
#chains in the Genus database with same CATH topology
 4U7E B;  2WXL A;  3B7S A;  1NA0 A;  4PS3 A;  4LG6 A;  4GB9 A;  3TG4 A;  4N3A A;  2EIM E;  2CHX A;  5CEA A;  2GRO B;  3SFZ A;  5B3S E;  4GTP A;  2IF4 A;  4GA0 A;  3UKU G;  2V5F A;  5ENN A;  4EZK A;  2BTD A;  4TXR A;  4J7W A;  4U8V D;  1OCZ E;  5A7D B;  1TNU A;  5DBK A;  5EDS A;  5LX8 A;  4TV3 A;  1BI7 B;  2IY0 C;  3S7F A;  4BY6 A;  5ARF A;  3C98 A;  3L22 A;  4UWH A;  2OVF A;  4YVQ C;  1TNZ A;  3NZS A;  3CK8 A;  1KZO A;  4BT8 A;  2WMN A;  4JVS A;  2RKK A;  4EHM A;  5A6C A;  3P1U A;  2LXM A;  5JJT A;  1JCR A;  4UI9 C;  2KAT A;  4UWK A;  2ZXW E;  2WXK A;  2R02 A;  5AEN A;  5AYW D;  2OEW A;  2P2C P;  1KPS B;  1H6P A;  1E96 B;  4AM9 A;  3QDN A;  3RJV A;  3LYA A;  2LO6 A;  3CLJ A;  2J49 A;  1UG3 A;  2JEK A;  3QB2 A;  3Q75 A;  3OAW A;  1TNB A;  4HXI A;  1MX4 A;  4ANW A;  4RSY A;  3C3R A;  2GGF A;  3TWW A;  4GML A;  3APC A;  4R7L A;  4F53 A;  2WM9 A;  1HS6 A;  4HI8 A;  4BWR A;  2KCL A;  5ENQ D;  3FH8 A;  4AEZ C;  1EPU A;  2OND A;  4XI9 A;  1ZU2 A;  2NC9 A;  3SI5 A;  2XEH A;  5FQ4 A;  3TGO A;  2OEV A;  3LS8 A;  4JA9 A;  3N71 A;  4EBA G;  3VLF A;  2ZU6 B;  4HB5 A;  3NQP A;  4LNG A;  3ZYL A;  4EEC A;  1LF8 A;  5KBA A;  1HX8 A;  2NXP A;  1L5J A;  5HS0 A;  1FT1 A;  2F37 A;  2F8Y A;  4O1O A;  4YVO A;  4B89 A;  3ZXS A;  3G2V A;  3J5P A;  3QWW A;  4KVM A;  3FDH A;  1H0A A;  5HKP A;  4F1P A;  2H6F A;  3RAU A;  4JZY A;  2R2L A;  2X38 A;  1XGW A;  3UIO C;  3ML8 A;  1UN8 A;  4FLB A;  3CVP A;  4A63 B;  2LXL A;  3FUE A;  4GPK A;  2YIN A;  3RRU A;  4J0U A;  2FO1 E;  3B7B A;  3FFL A;  4UWL A;  3JQ1 A;  3D9I A;  3L9T A;  5KJN A;  3U3W A;  3D9M A;  2XPZ A;  5CMY A;  3KAE A;  2XPI A;  3TXM A;  3HXB A;  3ZKJ A;  1MHQ A;  2P9K G;  1UN9 A;  2VGY A;  3Q79 A;  5CBN A;  4IRU A;  3JQ0 A;  4C9B B;  3ZIM A;  2KZT A;  1QYM A;  3L82 A;  2DIW A;  4XX5 A;  2WQ6 A;  2JLB A;  2L6B A;  4K03 A;  2PL2 A;  4G1T A;  3Q73 A;  4FHK A;  2FO7 A;  1E8W A;  2X6J A;  3TWU A;  1FPP A;  3ZFW A;  3SY2 A;  3JCK C;  3EHM A;  3BEE A;  1YCS B;  4JB8 P;  3UI2 A;  4AY5 A;  2OV8 A;  1N9A A;  4JW1 A;  3LJN A;  1P5Q A;  4ANX A;  1N52 A;  4F7A A;  1SZ9 A;  2HYZ A;  1E8Z A;  2X6F A;  2XQ0 A;  3CK7 A;  2BKK B;  3QJZ A;  5ANR A;  2VGX A;  1EF1 C;  1N11 A;  2XEV A;  1FVH A;  3ZGQ A;  3I4R B;  4BET A;  3L08 A;  3PZ2 A;  3T9K A;  4F6R D;  3O4Z A;  5BT1 A;  2NSZ A;  1NI1 A;  3ZHE A;  1JWF A;  4A1G A;  3PE3 A;  1OWM A;  2GRP B;  3PE4 A;  1TYQ G;  2EQX A;  2WXQ A;  4DI4 A;  3DBS A;  5G04 C;  5AQB A;  4HFG A;  4I17 A;  2PQN A;  4HOR A;  5JMN D;  5KNH D;  1V54 E;  3DSX A;  3QNK A;  2DZN A;  2CHZ A;  4N39 A;  4C48 B;  1ZBP A;  4I2W A;  5G2N A;  2L9B A;  3APF A;  3SNX A;  4A1S A;  3KEZ A;  1O5M A;  2QZA A;  3PEV B;  2V8S E;  5D2M C;  1OUV A;  3G2W A;  2GW1 A;  4I6E A;  2EIK E;  5KJL A;  4ME2 A;  3SGH A;  4FHJ A;  5ANL A;  4BTB A;  4EZL A;  4UQX A;  3QWP A;  3ZUV B;  5AAR A;  4BTA A;  1N4P A;  1A5E A;  3ASH A;  4AP2 A;  3Q78 A;  3Q49 B;  2H6I A;  4PS7 A;  3U4T A;  4FJZ A;  3FUM A;  3FU6 A;  2GRR B;  3HXD A;  2ETC A;  4CGV A;  4O1P A;  5CHE E;  5CRU A;  5ENO D;  5KJM A;  5CBO A;  4V3I A;  2HR2 A;  3DSU A;  1BD8 A;  4I43 A;  2RFA A;  3ABK E;  4YND A;  2H6G A;  3AG4 E;  1MX6 A;  5D0Q D;  1HE8 A;  4GCN A;  2R59 A;  3CHR A;  3DSV A;  4WNF A;  4EZJ A;  5FIO A;  2XHE A;  3AU4 A;  1YYH A;  4N3C A;  1JCQ A;  4KVO A;  3QAR A;  4YDO A;  3FU5 A;  5T3R A;  4CT0 A;  3R9A B;  3U9W A;  2IJG X;  2V0P A;  3GW4 A;  5FZR A;  4J6I A;  4BT9 A;  3ZYQ A;  3ISM C;  2WXO A;  2B0O E;  4AOF A;  3SFX A;  2Y69 E;  2Y1L E;  4G2V A;  3TG5 A;  4DX2 A;  3PRZ A;  5LCW J;  3MZL B;  4TUM A;  2X6I A;  2VTB A;  4EPZ A;  2ETB A;  2KXP C;  3TWV A;  1S0P A;  4GA2 A;  1YMP A;  4ANV A;  3FTW A;  3Q5M A;  5FQ6 A;  4HS2 A;  2ZGG A;  4UQZ A;  3TAX A;  3HG0 D;  2P9L G;  1Z6T A;  5BXU A;  4N3B A;  3AU5 A;  4DRX E;  3ZXP A;  3NAW A;  4OYS A;  2R17 C;  4I6G A;  2F0Y A;  3HHM A;  3LKU A;  4G8K A;  4WUY A;  3RIB A;  4XI0 A;  3L13 A;  3VLD A;  1IQR A;  1LD8 A;  1KT0 A;  1TN8 A;  2WXI A;  3GZ1 A;  1JWG A;  5IY5 E;  3PUK A;  4QQI A;  2LNI A;  4HLL A;  3PVL A;  3I3N A;  5EKQ D;  1TJF A;  3MKQ A;  4FLH A;  4M3O A;  2QFC A;  3TWX A;  3DXK G;  4DK5 A;  3PDN A;  4HQD A;  4HRL A;  4G24 A;  2EIN E;  4LRZ A;  3EIQ C;  1LTX A;  2KCV A;  3Q4A B;  3SFY A;  4KZ0 A;  1S63 A;  1IKN D;  5JHB A;  2XGM A;  1OCC E;  1WG0 A;  4WND A;  3V2X A;  3DPD A;  4K5C A;  2XGS A;  3JUI A;  1ELR A;  1FT2 A;  4MS6 A;  3T5X A;  4CDR A;  4APF A;  3ONK A;  5CCM A;  3FUI A;  1TNY A;  4L9P A;  5BV1 A;  2WXR A;  4U8Y D;  4BX8 A;  3UQ3 A;  2V5Q C;  3QK0 A;  2DBA A;  3Q9U C;  4TRQ A;  5CED B;  2KZT B;  4X8Q A;  4FUL A;  4GTS A;  3MV3 B;  4BEP A;  1K1A A;  3ZU7 B;  1ELW A;  2ION A;  2L0T B;  2E2E A;  2WXN A;  4YDE A;  4XE0 A;  4CDN A;  3VTY A;  1RW2 A;  4U0U A;  4QFV A;  1UJJ A;  1TN7 A;  5HI7 A;  5HRY A;  1BI8 B;  3HVE A;  3I5P A;  4XIF A;  3EU9 A;  3ABL E;  3LY9 A;  3CHQ A;  4GTQ A;  3FEX A;  3UIP C;  2FEZ A;  2X6H A;  4P29 A;  3J5Q B;  4K5B A;  3NOG D;  5BXO A;  2J9Q A;  3ABM E;  1WDY A;  1DVP A;  5D66 A;  4NUR A;  2VGX B;  2Q7F A;  2A5U A;  2DZO A;  3FTY A;  3FUF A;  3ENE A;  2C0M A;  3DXM G;  5M72 A;  3ZHE B;  1D9S A;  5LFA A;  1D8E A;  2WXF A;  3LXU X;  3FU0 A;  3CKC A;  3CGH A;  5FZQ A;  1MX2 A;  3QKY A;  1VDY A;  1NA3 A;  3MKR A;  4L2L A;  3ULE G;  3S2A A;  4CYM D;  4GMJ A;  3D9H A;  3ZPJ A;  4B8A A;  1D8D A;  1HXI A;  3KEA A;  4UI9 J;  3UKR G;  1IQU A;  2MHK A;  2EIL E;  1WAO 1;  4L23 A;  4GZ5 A;  5DIZ A;  1G3N B;  3T8K A;  2YQ8 A;  4DX1 A;  4BSX A;  4ILH B;  4GMR A;  3IEG A;  3AAA C;  3ASD A;  2YHC A;  3CVY A;  2KCK A;  4PUC A;  5G05 C;  5CRV A;  3ONL A;  5KJK A;  3T5V A;  4HBD A;  2GRM A;  3DSW A;  2FUL A;  2PM7 A;  1HH8 A;  2DYS E;  5B1A E;  5CCL A;  3RK6 A;  2ZGD A;  3FUH A;  4AY6 A;  4DLQ A;  1MQS A;  3SD5 A;  2VYI A;  4F1S A;  4ZHB A;  1HFA A;  4DI3 A;  3UM0 A;  1HZ4 A;  3RRN B;  4OAV B;  2I2O A;  3P2B A;  3TXN A;  3KSL A;  2WXJ A;  4YDY A;  3MV2 B;  3CQG B;  4KMO A;  4ANU A;  3CHO A;  3E33 A;  3AG2 E;  4PS8 A;  3PS6 A;  3SZ7 A;  1X5B A;  3OXG A;  2J07 A;  4JEU A;  4UQY A;  1Z5S C;  2IU1 A;  2XZD G;  3BG0 B;  2WQ7 A;  4HNA D;  3IHV A;  5AQ9 A;  4M7C A;  3LVR E;  3K9I A;  1PAQ A;  3DEO A;  4I1M A;  4UWG A;  1K3Z D;  4HRN A;  2DVW A;  3D3M A;  4ILG A;  1RZ4 A;  1E90 A;  3DEP A;  2LUH A;  1E8X A;  1U3C A;  5EIB E;  3MX3 A;  3D9J A;  1TNO A;  5FQ7 A;  3CHP A;  5HQ8 A;  3GYZ A;  3ASF A;  4JL0 A;  2P9I G;  2IQC A;  4KBQ A;  5EID A;  5J90 A;  3FY4 A;  2PM6 A;  3DWL G;  2QYJ A;  3IXE A;  3L17 A;  2HE0 A;  1IHB A;  3CHM A;  4Q69 A;  1O1R A;  2AXV A;  1MJ0 A;  2FF4 A;  4G23 A;  5BW8 C;  3X2Q E;  2Y3A A;  3ZN3 A;  4JHJ A;  3LDZ A;  3Q7F A;  2R03 A;  3UUX A;  4CDM A;  2BED A;  2AVP A;  3ASO E;  3DSS A;  3APD A;  2AXZ A;  3MYV A;  4BSZ B;  3ZNG A;  3V31 A;  2VTB B;  3BG1 B;  2WXH A;  3RO2 A;  3G2S A;  4XKC A;  4LCT A;  2GRL A;  4E85 A;  1O1S A;  3FWV A;  3L6A A;  2XRY A;  2WQH A;  1SZA A;  4LEU A;  3LY8 A;  5ITZ F;  3FEY A;  2ETA A;  2P9U G;  2GRN B;  3BU8 A;  3E37 A;  5ENR D;  3FU3 A;  4O60 A;  3UPV A;  5AIJ A;  1H2U A;  2XCB A;  4HVB A;  4NRH B;  4HLE A;  1TR4 A;  1KZP A;  2NYJ A;  3ZYK A;  3ESK A;  1N4Q A;  5CEC B;  3F6Q A;  5FWQ A;  3MA5 A;  2AWI A;  4OVU A;  3UMV A;  2PZI A;  4EQF A;  1OWO A;  4WAF A;  1JUQ A;  5G04 J;  4H7Y A;  1H6O A;  2LAI A;  2VJ8 A;  3UT7 A;  4DJA A;  3MKQ B;  3JXJ A;  1E7V A;  4JC8 A;  1H2V C;  3B7U X;  3EUV A;  4APO A;  4Q94 A;  1K1B A;  3B7T A;  4B94 A;  3LPZ A;  2PNN A;  3U66 A;  1Y6I A;  2WXM A;  1HO8 A;  3EDT B;  4N5C A;  3WXX A;  3LY7 A;  4U63 A;  3NB2 A;  1N94 A;  4I9E A;  3LCA A;  3PZ3 A;  2IOL A;  2Y0B G;  1BPO A;  5BPP A;  2P58 C;  1TJC A;  1OWL A;  3DRA A;  4FC8 A;  3CVW A;  2E0I A;  1NFI E;  2A5E A;  1N0Q A;  5E76 A;  4RG6 A;  2Y4T A;  4HOQ A;  4RG9 A;  4GA1 A;  3SO8 A;  1SA4 A;  2J09 A;  3KD7 A;  4XEI G;  2P9N G;  3CST A;  3IHY A;  2VSN A;  1WM5 A;  1UJK A;  3C72 A;  3GZ2 A;  1PC2 A;  4CZ2 D;  2YHE A;  3PH0 C;  4J8S A;  3TWS A;  3HVE B;  3OXF A;  1A17 A;  1U3D A;  5BUZ A;  4L1B A;  3FTV A;  3R9M A;  1KLX A;  5AQA A;  1OXJ A;  2CFU A;  2I9C A;  5AN8 A;  5EX0 A;  1MZC A;  2QY7 A;  3AS8 A;  4OAU C;  2XEE A;  3UIN C;  4PH4 B;  1V55 E;  3RRM B;  2V4L A;  3NBN B;  3AS4 A;  3MGB A;  4XZ4 A;  3RO3 A;  3PRE A;  3ZW3 A;  4U0S A;  1OCR E;  3UM3 A;  1HU3 A;  2DCP A;  3TWR A;  4HI9 A;  4O6F A;  3C3O A;  4BES A;  3CV0 A;  1OWN A;  5AJD A;  4FP7 A;  4DLO A;  4ILI A;  2MRI A;  4U07 A;  2FBN A;  2GRQ B;  4U96 D;  4I2Z A;  1BLX B;  2IO3 C;  1LD7 A;  4CGW A;  3RU0 A;  4CRW A;  5C2Y A;  4HOU A;  3FHE A;  1B89 A;  4MBG A;  2J8S D;  3U64 A;  1YA0 A;  4KZC A;  1H19 A;  3V2O A;  4E6H A;  2WXG A;  5JHA A;  2I6H A;  4XKB A;  2QYU A;  3ML9 A;  3CVU A;  3PNL B;  3PUJ A;  4G8L A;  4AIF A;  5KWD A;  4AJW A;  2UY1 A;  1PY1 A;  5D0O D;  2H6H A;  2VSO E;  2ZIS A;  1Z3Y A;  4HOT A;  2R5S A;  5ARG A;  3HIZ A;  1SVX A;  4N2Q A;  1WY6 A;  4FJY A;  1MYO A;  2Y4U A;  4RVB A;  3FTS A;  5CMW A;  4LUN U;  1HF8 A;  4ATG A;  4ABN A;  2B6C A;  1JPL A;  4GZ6 A;  5EYP F;  2AXU A;  5JA4 D;  3UX4 A;  2IEJ A;  2XEN A;  4UWF A;  5FZS A;  1S70 B;  5ENT D;  2XS1 A;  4WWN A;  4BFR A;  4FU3 A;  3E4B A;  4AXH A;  2OVB A;  1TN6 A;  4J8D A;  3FH7 A;  4WWO A;  3R7Q A;  3E32 A;  4YDW A;  1SW6 A;  2KM4 A;  2BUG A;  3DPY A;  3QWV A;  3W9F A;  3VLE A;  3UTM A;  3I4G A;  4GTV A;  5AJL A;  1DC2 A;  4B0Z A;  5B1B E;  5G55 A;  4HOS A;  1NP7 A;  3AG1 E;  4I1A A;  4DX5 D;  3CVX A;  4IN3 B;  4JEH A;  1HG5 A;  3C3Q A;  2CFZ A;  3IV0 A;  4GYO A;  3CSF A;  2HO1 A;  4CT4 A;  4FA6 A;  2MYO A;  2WMO A;  4LNB A;  3PNT B;  3JYS A;  1S64 A;  2F8X K;  2HM8 A;  3SHF A;  4LER A;  3SQV A;  3ZEF A;  2IOS A;  3CEQ A;  5EYL A;  3HXF A;  1NZN A;  3ASN E;  2CG2 A;  3EHQ A;  1K8K G;  3D9N A;  1SA5 A;  5A23 A;  5ENS D;  5CER B;  1EYH A;  2OCC E;  4H7X A;  4MKT A;  2I1J A;  3FUL A;  4CEM A;  1N0R A;  3V30 A;  3T8M A;  3JXI A;  4NAC A;  2VGE A;  3HYM B;  2VSY A;  3EJN A;  3LEW A;  3Q9N C;  4K0R A;  3QOU A;  5FJY A;  3G2U A;  3WG7 E;  3L54 A;  2R05 A;  5FT9 A;  1OWP A;  5BV0 A;  5EX3 A;  4GYY A;  4UI9 K;  2XCC A;  4DX6 D;  5LOZ A;  2AJA A;  1H6K A;  1SQM A;  2P9S G;  4NQ0 A;  3FUK A;  3B7R L;  2WB2 A;  1N4S A;  3S7D A;  4Q96 A;  4N2S A;  3NOC D;  3HXC A;  1INZ A;  4J8F A;  4BX9 A;  2C0L A;  2V4H C;  3B13 A;  1KT1 A;  4TXP A;  5G05 J;  4G25 A;  2IO2 C;  5AAO A;  3RKV A;  2J4B A;  4W9R A;  3NZU A;  2LSU A;  2EIJ E;  2WVI A;  3MJW A;  4DX7 D;  4A3T A;  5T4Y A;  3DST A;  3UXG A;  5FIN A;  3Q15 A;  2I1K A;  1UOH A;  1OT8 A;  3SBT B;  2ZIR A;  2IFU A;  2UWJ G;  3AG3 E;  4FAD A;  4WNG A;  5J08 A;  1DCE A;  3CQC B;  4J8E A;  1N54 A;  4K5A B;  1XNF A;  3E30 A;  4JHR A;  4ZFH A;  3FTU A;  3D9K A;  2M63 A;  4B93 B;  4JXT A;  3CVV A;  4AV7 A;  1OCO E;  4U8H A;  4GTT A;  4I6J A;  4GU5 A;  4J8Y A;  3FTX A;  3OTN A;  3HRA A;  3QC1 A;  1OY3 D;  2RG8 A;  5ENP D;  2CHW A;  1IXV A;  2AW6 A;  4D10 C;  4GYW A;  4ACK A;  3OXL A;  3LJ3 A;  3CR3 A;  3UT4 A;  2BF0 X;  4GZD A;  3EHR A;  4JD2 G;  3B95 A;  1ELK A;  3CKB A;  1E7U A;  4LSZ E;  1GW6 A;  3KSQ A;  1ZB1 A;  4GZ3 A;  2XGO A;  1QNF A;  4RQI A;  2XZT G;  4JHK A;  3D9L A;  3ZRH A;  5KCM A;  3SF4 A;  4TUU A;  3CK9 A;  3EU5 A;  3ZVV A;  2RD0 A;  4L2Y A;  3UT8 A;  5FTP A;  2X3M A;  1W3B A;  2LSV A;  3TL5 A;  5FQ8 A;  4GTR A;  3RSE G;  4LNU D;  5AQ7 A;  2RFM A;  4B8C B;  3NF1 A;  1QQE A;  5JJ6 A;  4I1O B;  1IYG A;  3CVQ A;  3HDX A;  2DYR E;  2MOW A;  3JUE A;  3W9G A;  3CVL A;  4GTM A;  3QAQ A;  1DCQ A;  3MCX A;  2DWZ A;  4ACL A;  1NL4 A;  4MRU A;  1H2T C;  3HXE A;  4C0M A;  2WXP A;  4DUI A;  2UY1 B;  2L6J A;  3GZS A;  4IYP A;  3AJI A;  1QBQ A;  3D9O A;  2KC7 A;  3ESL A;  3R7R A;  4PDX A;  4N5Q A;  4GPM A;  2P9P G;  1Q2Z A;  4EBA A;  3VTX A;  1TEZ A;  3KS2 A;  2A4Z A;  1N95 A;  1Y8M A;  2JAB A;  3S7B A;  4Y6C A;  1DNP A;  3ULY A;  4F3V A;  3CHS A;  3MEK A;  4KT6 B;  1FCH A;  3IBE A;  3CVN A;  3O48 A;  4GAA A;  2X6K A;  2ILR A;  3FUN A;  2WPV A;  2L0I A;  3ASG A;  1EDU A;  2LAH A;  2XRZ A;  4I9C A;  5E75 A;  4U04 A;  4C0E A;  5LCW C;  4GCO A;  4CCA A;  3FUD A;  3EHN A;  3ZYM A;  2KBX A;  4U95 D;  4U0Z A;  3TWQ A;  2C2L A;  2QC9 A;  4HRM B;  3AS5 A;  4MLP A;  3BUA A;  2OOE A;  3Q47 B;  4UUC A;  4G26 A;  3V79 K;  1UW4 B;  2VQ2 A;  5EN5 D;  1U2V G;  3FTZ A;  2XS8 A;  4BER A;  4KYO B;  5EIL A;  3URZ A;  3TWT A;  3Q7A A;  1AP7 A;  5T8I A;  5LP0 A;  3SBS A;  2FI7 A;  1E8Y A;  4G11 A;  1Z3X A;  4WNE A;  1FVF A;  2J4D A;  4OVV A;  4RLY A;  4Y6W A;  5JJ7 A;  5KNG A;  2BKG A;  3PEU B;  3PZ1 A;  4URK A;  3ULQ A;  4TXQ A;  1IHG A;  3LVQ E;  3S7J A;  2PQR A;  1QZ2 A;  5BNW A;  4KXK B;  3FH5 A;  4Z68 A;  1O1T A;  3PZ4 A;  2CG3 A;  5C1D A;  1N4R A;  2XPY A;  1HG2 A;  5H7P A;  3TJP A;  3L16 A;  1JCS A;  4L7T A;  1X81 A;  4JPS A;  3EIJ A;  4GTO A;  4ATZ D;  3BQO A;  3D9P A;  4IUL A;  2YNQ A;  4DPR A;  4GZC A;  4JA7 A;  3FUJ A;  2J08 A;  3E34 A;  3UM1 A;  3CIA A;  3PZD A;  4A55 A;  3C5R A;  4WWP A;  3G2T A;  3UM2 A;  4NIK A;  1BU9 A;  3IKO B;  1AWC B;  4A3V A;  2VSX E;  4AVX A;  3FP3 A; 
#chains in the Genus database with same CATH homology
 2WXH A;  3RO2 A;  3G2S A;  3EJN A;  4XKC A;  4KVO A;  2WXL A;  3B7S A;  1NA0 A;  3QAR A;  4LCT A;  3FU5 A;  4PS3 A;  2GRL A;  3LEW A;  4GB9 A;  3TG4 A;  4E85 A;  3FWV A;  4N3A A;  3L6A A;  4K0R A;  2CHX A;  2XRY A;  2WQH A;  1SZA A;  3QOU A;  5T3R A;  4LEU A;  4CT0 A;  3R9A B;  3LY8 A;  5FJY A;  3SFZ A;  3U9W A;  3G2U A;  3FEY A;  2IF4 A;  2IJG X;  3L54 A;  2V0P A;  3GW4 A;  4GA0 A;  5FT9 A;  5FZR A;  2V5F A;  4J6I A;  1OWP A;  4BT9 A;  5BV0 A;  3ZYQ A;  2WXO A;  5EX3 A;  3FU3 A;  4GYY A;  4UI9 K;  2XCC A;  5ENN A;  4AOF A;  5LOZ A;  4EZK A;  1H2U A;  2XCB A;  5AIJ A;  3UPV A;  1H6K A;  1SQM A;  4NQ0 A;  4NRH B;  4HVB A;  4HLE A;  3FUK A;  3B7R L;  3ZYK A;  2WB2 A;  2BTD A;  3ESK A;  3S7D A;  5FWQ A;  4G2V A;  3MA5 A;  5A7D B;  3TG5 A;  4Q96 A;  5DBK A;  5EDS A;  4N2S A;  5LX8 A;  4J8F A;  1INZ A;  3PRZ A;  4BX9 A;  4TV3 A;  2C0L A;  5LCW J;  3MZL B;  2AWI A;  3B13 A;  4OVU A;  3S7F A;  1KT1 A;  5G05 J;  4BY6 A;  5ARF A;  2X6I A;  3C98 A;  4G25 A;  3UMV A;  3RKV A;  2J4B A;  2VTB A;  3L22 A;  2PZI A;  2OVF A;  4UWH A;  4EQF A;  1OWO A;  4WAF A;  1JUQ A;  5G04 J;  4W9R A;  4EPZ A;  4H7Y A;  2LAI A;  3NZU A;  4YVQ C;  2VJ8 A;  1S0P A;  4GA2 A;  2LSU A;  3UT7 A;  2WVI A;  3MJW A;  4DJA A;  4A3T A;  4ANV A;  3FTW A;  3Q5M A;  5T4Y A;  3MKQ B;  3Q15 A;  1E7V A;  4JC8 A;  1H2V C;  2I1K A;  4HS2 A;  5FQ6 A;  3B7U X;  3NZS A;  4APO A;  3CK8 A;  3SBT B;  4UQZ A;  4Q94 A;  4BT8 A;  3B7T A;  2WMN A;  3TAX A;  2IFU A;  4B94 A;  3LPZ A;  2UWJ G;  3U66 A;  4JVS A;  1Y6I A;  2WXM A;  4FAD A;  1HO8 A;  3EDT B;  4N5C A;  4WNG A;  5J08 A;  3WXX A;  1Z6T A;  3CQC B;  4J8E A;  3LY7 A;  4U63 A;  4N3B A;  1N54 A;  5A6C A;  4I9E A;  3AU5 A;  3LCA A;  3P1U A;  2IOL A;  1XNF A;  1BPO A;  5JJT A;  4OYS A;  5BPP A;  2R17 C;  4JHR A;  4UI9 C;  2P58 C;  1TJC A;  4I6G A;  3FTU A;  3HHM A;  3LKU A;  2KAT A;  3D9K A;  2M63 A;  4UWK A;  1OWL A;  2WXK A;  4WUY A;  3RIB A;  4JXT A;  4XI0 A;  5AYW D;  4AV7 A;  3L13 A;  3VLD A;  1IQR A;  5AEN A;  3CVV A;  4U8H A;  1KT0 A;  2WXI A;  3GZ1 A;  4FC8 A;  4GU5 A;  4I6J A;  3CVW A;  1JWG A;  3FTX A;  3PUK A;  2E0I A;  1E96 B;  4AM9 A;  3QDN A;  3RJV A;  3LYA A;  2LNI A;  3OTN A;  2LO6 A;  3PVL A;  3I3N A;  3QC1 A;  5E76 A;  4RG6 A;  3CLJ A;  2Y4T A;  2J49 A;  1UG3 A;  2JEK A;  4HOQ A;  4RG9 A;  3QB2 A;  5EKQ D;  1TJF A;  2RG8 A;  4GA1 A;  3MKQ A;  4FLH A;  3OAW A;  2J09 A;  4HXI A;  4M3O A;  2CHW A;  4ANW A;  4RSY A;  2AW6 A;  2GGF A;  2QFC A;  3KD7 A;  4D10 C;  4GML A;  3APC A;  4GYW A;  4ACK A;  3OXL A;  3LJ3 A;  3CST A;  4R7L A;  3CR3 A;  2WM9 A;  3UT4 A;  4DK5 A;  4F53 A;  3IHY A;  2BF0 X;  2VSN A;  4GZD A;  1HS6 A;  3PDN A;  1WM5 A;  3CKB A;  1ELK A;  1UJK A;  4BWR A;  1E7U A;  4G24 A;  1GW6 A;  2KCL A;  4LRZ A;  3EIQ C;  3FH8 A;  3GZ2 A;  1PC2 A;  4AEZ C;  1EPU A;  2KCV A;  2YHE A;  2OND A;  3PH0 C;  4GZ3 A;  4XI9 A;  1ZU2 A;  3Q4A B;  2NC9 A;  3SI5 A;  4J8S A;  3HVE B;  5FQ4 A;  4KZ0 A;  2XGO A;  1QNF A;  3OXF A;  3TGO A;  5JHB A;  1A17 A;  3LS8 A;  2XGM A;  1U3D A;  4JA9 A;  5BUZ A;  4JHK A;  4WND A;  4L1B A;  3N71 A;  3FTV A;  4EBA G;  3D9L A;  3DPD A;  3VLF A;  2ZU6 B;  3ZRH A;  1KLX A;  5KCM A;  3SF4 A;  2XGS A;  4TUU A;  3NQP A;  3JUI A;  2CFU A;  1ELR A;  3CK9 A;  2I9C A;  3ZYL A;  4MS6 A;  3T5X A;  1LF8 A;  4APF A;  3ZVV A;  3ONK A;  4CDR A;  2RD0 A;  4EEC A;  4L2Y A;  3UT8 A;  5FTP A;  2X3M A;  1HX8 A;  3FUI A;  5CCM A;  5BV1 A;  2WXR A;  2NXP A;  5EX0 A;  3UQ3 A;  4BX8 A;  1W3B A;  1L5J A;  2LSV A;  3QK0 A;  3TL5 A;  5FQ8 A;  2QY7 A;  3AS8 A;  2DBA A;  4YVO A;  4TRQ A;  4B89 A;  3ZXS A;  2KZT B;  3G2V A;  4FUL A;  3MV3 B;  3QWW A;  3NF1 A;  4B8C B;  4KVM A;  1QQE A;  5JJ6 A;  3FDH A;  4I1O B;  1IYG A;  1H0A A;  4PH4 B;  3CVQ A;  1ELW A;  2ION A;  2L0T B;  3HDX A;  2V4L A;  4JZY A;  2MOW A;  2X38 A;  2E2E A;  3RRM B;  1XGW A;  2WXN A;  3CVL A;  3QAQ A;  3ML8 A;  3AS4 A;  3MGB A;  4XZ4 A;  1UN8 A;  4FLB A;  3CVP A;  3MCX A;  4XE0 A;  4CDN A;  3VTY A;  4U0U A;  4QFV A;  4ACL A;  3RO3 A;  1UJJ A;  3FUE A;  4GPK A;  2YIN A;  5HI7 A;  3PRE A;  3ZW3 A;  4U0S A;  4MRU A;  3RRU A;  1H2T C;  3HVE A;  3I5P A;  4J0U A;  4XIF A;  1HU3 A;  3FFL A;  4C0M A;  2DCP A;  4UWL A;  3JQ1 A;  3D9I A;  4O6F A;  2WXP A;  3LY9 A;  3CHQ A;  2UY1 B;  3FEX A;  5KJN A;  3U3W A;  3D9M A;  2FEZ A;  2L6J A;  2X6H A;  3GZS A;  4IYP A;  4P29 A;  2XPZ A;  3CV0 A;  5CMY A;  3KAE A;  1OWN A;  2J9Q A;  2XPI A;  3TXM A;  1MHQ A;  5AJD A;  1UN9 A;  2VGY A;  1DVP A;  4FP7 A;  4IRU A;  4NUR A;  3D9O A;  2KC7 A;  4DLO A;  2VGX B;  4ILI A;  2MRI A;  3JQ0 A;  4U07 A;  4C9B B;  3ZIM A;  2FBN A;  3ESL A;  4I2Z A;  3R7R A;  2Q7F A;  2A5U A;  4CGW A;  2KZT A;  3FTY A;  4PDX A;  3FUF A;  3RU0 A;  4CRW A;  2DIW A;  3ENE A;  2C0M A;  5C2Y A;  4XX5 A;  2WQ6 A;  2JLB A;  4HOU A;  5M72 A;  4K03 A;  3FHE A;  1B89 A;  2PL2 A;  4EBA A;  3U64 A;  3VTX A;  4G1T A;  3KS2 A;  1TEZ A;  2A4Z A;  1Y8M A;  1YA0 A;  4FHK A;  3ZHE B;  2FO7 A;  4KZC A;  1E8W A;  2X6J A;  1H19 A;  4E6H A;  5LFA A;  3ZFW A;  2WXG A;  5JHA A;  2I6H A;  2WXF A;  4XKB A;  3LXU X;  3S7B A;  4Y6C A;  3JCK C;  3ML9 A;  3CVU A;  3FU0 A;  3CKC A;  3CGH A;  5FZQ A;  1DNP A;  3EHM A;  3PNL B;  4F3V A;  3QKY A;  1VDY A;  3BEE A;  1NA3 A;  4AY5 A;  3MKR A;  3PUJ A;  4AIF A;  4L2L A;  2OV8 A;  3CHS A;  3MEK A;  2UY1 A;  1PY1 A;  4JW1 A;  5D0O D;  4AJW A;  3S2A A;  1P5Q A;  4ANX A;  2VSO E;  1N52 A;  4F7A A;  1SZ9 A;  1Z3Y A;  2HYZ A;  1E8Z A;  4GMJ A;  4KT6 B;  4HOT A;  2R5S A;  2X6F A;  1FCH A;  2XQ0 A;  3IBE A;  5ARG A;  3ZPJ A;  4B8A A;  3HIZ A;  1HXI A;  3CVN A;  4N2Q A;  3O48 A;  4GAA A;  2X6K A;  3CK7 A;  2ILR A;  3QJZ A;  4UI9 J;  5ANR A;  2VGX A;  1WY6 A;  1IQU A;  1EF1 C;  3FUN A;  2WPV A;  2MHK A;  4FJY A;  2XEV A;  2Y4U A;  2L0I A;  3ASG A;  1WAO 1;  4RVB A;  1FVH A;  3FTS A;  3ZGQ A;  1EDU A;  3I4R B;  4GZ5 A;  4L23 A;  5DIZ A;  4LUN U;  2LAH A;  3L08 A;  5CMW A;  2XRZ A;  2YQ8 A;  4I9C A;  4BSX A;  4ILH B;  1HF8 A;  3O4Z A;  5BT1 A;  2NSZ A;  5E75 A;  4U04 A;  4ABN A;  4ATG A;  3IEG A;  1JPL A;  3ASD A;  2YHC A;  3ZHE A;  4C0E A;  4GZ6 A;  5LCW C;  3CVY A;  2AXU A;  2KCK A;  4GCO A;  1JWF A;  3UX4 A;  4CCA A;  4A1G A;  3PE3 A;  4PUC A;  5G05 C;  3FUD A;  4UWF A;  5FZS A;  1OWM A;  3PE4 A;  3EHN A;  3ONL A;  5KJK A;  3T5V A;  2EQX A;  2WXQ A;  2GRM A;  4WWN A;  3ZYM A;  4BFR A;  4FU3 A;  4DI4 A;  2FUL A;  2PM7 A;  3DBS A;  1HH8 A;  5G04 C;  5CCL A;  3E4B A;  3RK6 A;  4U0Z A;  3FUH A;  4HFG A;  4I17 A;  2PQN A;  4AXH A;  2OVB A;  4HOR A;  4J8D A;  3FH7 A;  2C2L A;  4WWO A;  3R7Q A;  4AY6 A;  3AS5 A;  3QNK A;  2CHZ A;  4MLP A;  2OOE A;  4DLQ A;  1MQS A;  3SD5 A;  2VYI A;  2KM4 A;  3Q47 B;  4N39 A;  1ZBP A;  4G26 A;  4I2W A;  4F1S A;  2BUG A;  1HFA A;  5G2N A;  4DI3 A;  2L9B A;  1HZ4 A;  3RRN B;  3APF A;  3QWV A;  2I2O A;  3P2B A;  1UW4 B;  3VLE A;  3SNX A;  3TXN A;  2VQ2 A;  4A1S A;  2WXJ A;  3KEZ A;  3I4G A;  3FTZ A;  3MV2 B;  3PEV B;  5AJL A;  3CQG B;  4KYO B;  4B0Z A;  4KMO A;  4ANU A;  2V8S E;  3URZ A;  5G55 A;  3CHO A;  5T8I A;  4HOS A;  1NP7 A;  5LP0 A;  3SBS A;  4I1A A;  2FI7 A;  1E8Y A;  1OUV A;  3G2W A;  3CVX A;  2GW1 A;  3PS6 A;  4G11 A;  1Z3X A;  4I6E A;  4PS8 A;  4IN3 B;  4WNE A;  4JEH A;  1FVF A;  1HG5 A;  2J4D A;  1X5B A;  3SZ7 A;  5KJL A;  4ME2 A;  4OVV A;  4Y6W A;  3OXG A;  2J07 A;  2CFZ A;  4JEU A;  5JJ7 A;  3SGH A;  3IV0 A;  4UQY A;  4FHJ A;  5ANL A;  4BTB A;  4GYO A;  3PEU B;  2IU1 A;  4EZL A;  4UQX A;  3BG0 B;  3QWP A;  2WQ7 A;  3CSF A;  4URK A;  2HO1 A;  4CT4 A;  3ULQ A;  3IHV A;  4BTA A;  3ASH A;  4AP2 A;  4FA6 A;  1PAQ A;  3K9I A;  2WMO A;  3LVR E;  3Q49 B;  3PNT B;  4I1M A;  3JYS A;  1IHG A;  3LVQ E;  4UWG A;  2PQR A;  3S7J A;  4PS7 A;  1QZ2 A;  5BNW A;  3U4T A;  4FJZ A;  3FUM A;  3D3M A;  4ILG A;  4KXK B;  2HM8 A;  1E90 A;  3FU6 A;  3FH5 A;  3SHF A;  4LER A;  1E8X A;  1U3C A;  3ZEF A;  2CG3 A;  2IOS A;  5C1D A;  3CEQ A;  4CGV A;  2XPY A;  1NZN A;  3MX3 A;  5CHE E;  3D9J A;  1HG2 A;  3TJP A;  3L16 A;  2CG2 A;  5FQ7 A;  3CHP A;  5HQ8 A;  3GYZ A;  5KJM A;  3ASF A;  4L7T A;  4V3I A;  2HR2 A;  4JL0 A;  3D9N A;  5A23 A;  2IQC A;  4KBQ A;  5J90 A;  3FY4 A;  4JPS A;  4I43 A;  3EIJ A;  2PM6 A;  1EYH A;  4YND A;  3D9P A;  3L17 A;  5D0Q D;  4H7X A;  4IUL A;  4MKT A;  2YNQ A;  4DPR A;  1HE8 A;  4GZC A;  4JA7 A;  3CHM A;  3FUJ A;  2J08 A;  4Q69 A;  2AXV A;  2I1J A;  2FF4 A;  3CIA A;  3PZD A;  4GCN A;  3FUL A;  4G23 A;  4CEM A;  2R59 A;  3CHR A;  5BW8 C;  4WNF A;  4EZJ A;  2Y3A A;  4A55 A;  4WWP A;  3ZN3 A;  4JHJ A;  3T8M A;  3LDZ A;  3G2T A;  2XHE A;  3AU4 A;  3UUX A;  4NAC A;  3FP3 A;  4CDM A;  3IKO B;  2AVP A;  3APD A;  2AXZ A;  4N3C A;  2VSX E;  4A3V A;  3MYV A;  4AVX A;  3HYM B;  2VSY A;  2VTB B;  3BG1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...