5ENOD

Mbx2319 bound structure of bacterial efflux pump.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
HHHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 50
structure length 162
sequence length 162
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enoD00
4C48B 5EN5D 4A63B 3TWRA 3DEPA 1OY3D 1N0RA 3V31A 4K5CA 5CBOA 3ZNGA 1A5EA 4K5BA 2ETAA 3AJIA 3KEAA 4G8LA 4CZ2D 5AAOA 1NFIE 4G8KA 4QFVA 5ENRD 4ATZD 5BXOA 1AWCB 4HB5A 4OAVB 4J8YA 4RLYA 3EHRA 1UOHA 4O1OA 1DCQA 3C5RA 3TWUA 5KWDA 1BI7B 3B95A 4LSZE 5AQ9A 4BERA 4DX1A 3NOGD 3UI2A 5AN8A 5AQ7A 4K5AB 5AARA 3TWWA 4BESA 3HG0D 1BI8B 4TUMA 2KXPC 2V5QC 3B7BA 4QQIA 5ENSD 3JXIA 4U8YD 5ENQD 1YCSB 1BD8A 5KNGA 3J5PA 4YDYA 2MYOA 2F8YA 1IXVA 3SO8A 2XZDG 4DUIA 2DZOA 4N5QA 5CEAA 5KBAA 2JABA 1BLXB 5EIDA 4CYMD 4HQDA 1TR4A 3Q9NC 5JA4D 3TWTA 1BU9A 3Q9UC 4HRLA 2V4HC 4U8VD 3EHQA 4O60A 3UXGA 2BKKB 4HI9A 1D9SA 2DVWA 2ZGGA 1MJ0A 2Y0BG 1MX2A 2B0OE 4U95D 2QYJA 4BSZB 4DRXE 2ETBA 4DX6D 4Z68A 5HS0A 4O1PA 4HLLA 1MYOA 2ETCA 4ZHBA 4HNAD 5EYPF 4YDWA 4F1PA 1N0QA 2KBXA 3V2OA 4BEPA 3TWSA 4UUCA 5JMND 5KNHD 2F37A 4HRMB 1YYHA 3ZKJA 4ZFHA 1DC2A 3TWVA 1SVXA 1MX6A 5BXUA 5ENPD 2RFAA 3W9FA 1YMPA 3IXEA 3NBNB 3V2XA 1IKND 4LNUD 5AQBA 3V79K 5FIOA 4GMRA 2PNNA 4HI8A 3TWQA 3NOCD 1MX4A 5CECB 3ZUVB 1AP7A 5EYLA 3F6QA 5ENOD 1G3NB 1K1AA 2XENA 4LG6A 2DWZA 2VGEA 4J7WA 5CBNA 5CERB 3TWXA 1WG0A 5CEDB 2XEEA 3LJNA 4BETA 5EILA 3ZU7B 1OT8A 2L6BA 5HKPA 2HE0A 2J8SD 3UTMA 3D9HA 2FO1E 4DX7D 5D66A 4U96D 5ENTD 3T9KA 1N11A 1K1BA 3EU9A 4F6RD 4OAUC 3JXJA 1K3ZD 1WDYA 2QC9A 1IHBA 5AQAA 4B93B 3DEOA 2F8XK 2DZNA 2AJAA 1S70B 3AAAC 4HRNA 5HRYA 3JUEA 3V30A 4GPMA 2BKGA 5ITZF 2ZGDA 2XEHA 4DX2A 5FINA 2RFMA 3W9GA 2XZTG 4DX5D 4NIKA 2NYJA 4JB8P 3HRAA 4HBDA 1QYMA 3J5QB 3T8KA 2A5EA 5EIBE 2P2CP 2Y1LE 1SW6A
chains in the Genus database with same CATH superfamily
3G2UA 1FPPA 3FTZA 2EIKE 5CBOA 3KSQA 1OWLA 4XEIG 2X6FA 4JVSA 3PE3A 2WQ6A 4HLEA 3VLEA 3B7BA 4FLHA 4C9BB 4GAAA 5ENQD 2EIJE 4HORA 4NQ0A 2MHKA 2XPIA 4GTMA 3ZHEA 3FH8A 2GRQB 2KCVA 1MX2A 4YDOA 1OWPA 1HG2A 4F53A 3DXKG 2ETBA 5HS0A 4EPZA 1N4QA 2KC7A 4ILHB 1LTXA 4LEUA 4BWRA 3FUIA 4RVBA 1EDUA 4EZKA 3HXDA 3OAWA 3GZ1A 3ASGA 4FHKA 3ZVVA 1MX6A 3RSEG 4GTOA 3G2SA 3K9IA 3RU0A 3SFXA 4HI8A 4CRWA 4BX9A 4UI9C 4N2QA 5CBNA 4G25A 4LUNU 3EHMA 3LJNA 4KZCA 1TN7A 1X5BA 4GCOA 1KZPA 5D2MC 1N11A 3S7DA 1VDYA 2QC9A 1IHBA 3R9AB 4M7CA 1P5QA 4DX2A 2L0TB 1ELRA 3W9GA 2RFMA 2VTBB 2PL2A 4NIKA 2IOSA 3Q79A 3KSLA 5EX3A 2AXZA 1FT1A 1ELWA 4JZYA 3U64A 3KEAA 2I1JA 1OWNA 3HXCA 2CG2A 2KM4A 4CEMA 4HB5A 4J8YA 1FVHA 4DX1A 2KCLA 2LAIA 2LNIA 5AARA 2HM8A 3HDXA 3UINC 2I9CA 3HVEB 4EBAA 5LOZA 3NF1A 5KBAA 5LCWC 4U8VD 4CCAA 4J8FA 4I1AA 4I9EA 4CDRA 1OCOE 3PZ1A 4A55A 2R59A 3ABKE 4BT8A 1V55E 4U04A 2IO2C 2BTDA 2YHCA 3PS6A 1HF8A 5CRVA 2RFAA 1IKND 3FULA 4LNUD 3HIZA 2GRPB 2ZIRA 2JLBA 1WG0A 3FTVA 2ZU6B 5FQ4A 1JUQA 4GTPA 3ZPJA 2OOEA 1E90A 3FUKA 4EHMA 2R2LA 3CEQA 2P2CP 1NA0A 1H2UA 4GZCA 4L2YA 5EN5D 1HO8A 3TXMA 3TG4A 3V31A 1A5EA 3UT7A 1OCZE 4GA0A 2X6IA 4W9RA 3MEKA 5ENRD 1BPOA 1S63A 2AW6A 4HOTA 5KWDA 3QB2A 3ZHEB 2VQ2A 5CHEE 3E4BA 5CMYA 4FA6A 5FWQA 4TV3A 3CGHA 3CVLA 3NAWA 1OXJA 4G26A 3ASHA 4ANVA 3CIAA 5BPPA 4FP7A 4OVVA 4A1GA 4B94A 4TRQA 3ZN3A 4UWKA 2V0PA 4XKCA 3RRMB 3MV3B 3LDZA 2I1KA 5EYPF 3UM0A 2WMOA 5JJ6A 5BT1A 5LP0A 4PS7A 4K03A 5JMND 2X6HA 4X8QA 3QNKA 3MYVA 5AQBA 3U4TA 3ENEA 2J09A 2PZIA 4JL0A 3ZU7B 3CHMA 2UWJG 2QFCA 2NXPA 3NBNB 3AAAC 1EYHA 3MGBA 4DX5D 4RG9A 3VTYA 3SI5A 5KNHD 1JCSA 3UIOC 2WXQA 2JEKA 2IFUA 3DPDA 5BUZA 4WWOA 5AYWD 4AY6A 3RO2A 3QC1A 3CLJA 1JWGA 3NZSA 4JEUA 4TXRA 4F1SA 4I6JA 3E32A 3MKRA 3SO8A 5FTPA 1BLXB 1TR4A 3ULEG 4P29A 3IHVA 4B8CB 1BU9A 3DXMG 3B7TA 4HVBA 3TL5A 1TNBA 3VLFA 4HI9A 1KT1A 3U66A 2B0OE 3RK6A 1KT0A 3FEYA 4G24A 4TUUA 2DYSE 5ANLA 3SHFA 4WAFA 3L6AA 2XPYA 3LJ3A 4JEHA 4N3BA 3FY4A 3V2XA 2AXUA 2OEWA 4YVQC 5ANRA 2QYUA 5KJLA 1MX4A 2XGSA 3I4GA 4GYWA 1MQSA 5EYLA 4PS8A 3L16A 4B89A 1E8ZA 1XGWA 5CMWA 1HG5A 1LD7A 1N54A 2C2LA 2XEVA 3R7QA 1HX8A 5T8IA 4DX7D 5FQ6A 3SGHA 3N71A 5AQAA 3UX4A 2XPZA 5AJLA 3AS4A 3DSWA 3PRZA 2YINA 3UMVA 4MS6A 3T8KA 5D0QD 1S64A 3P1UA 4C48B 1TNZA 3DSTA 3AG4E 4EZLA 1OY3D 3URZA 3G2TA 4OAVB 3FH5A 1UOHA 3TWUA 1MHQA 1Y8MA 3UPVA 4WNGA 5ENNA 4TUMA 3SNXA 3UM2A 2P9LG 3IV0A 1H19A 1TYQG 3JXIA 3CVXA 4BT9A 1SA4A 1SQMA 2IEJA 4B0ZA 3BG1B 3ISMC 4O60A 1MJ0A 2XCBA 5T3RA 2WXJA 4DRXE 4ATGA 2DYRE 2FULA 1NL4A 2CHXA 1MYOA 5JJTA 3G2VA 2WXRA 3CVVA 3JUIA 5CRUA 3RKVA 4MKTA 3PE4A 3D9NA 5BXUA 4AXHA 3I5PA 4ILGA 4EQFA 3CKCA 1OCCE 2FI7A 5CERB 2F0YA 4Q96A 4YVOA 4CT4A 5D66A 4L7TA 2R02A 4GPKA 5A6CA 2FO7A 3JUEA 1TN8A 5FINA 3EJNA 4DI3A 3KEZA 3R7RA 3RAUA 2EIME 1N9AA 3LXUX 4G8KA 2HYZA 4GTQA 3B95A 3AG2E 3CK7A 3DSUA 2KXPC 2VSYA 5EX0A 3NZUA 2VJ8A 1TNUA 2MYOA 1U3DA 5CEAA 1D8DA 5JJ7A 4A3VA 2FBNA 4Q69A 3BEEA 4XZ4A 1EF1C 1SZAA 4O1PA 3UQ3A 4HNAD 5AJDA 3CVQA 3FUFA 2J4BA 5AIJA 3ONKA 2E2EA 2MOWA 5FQ7A 3JQ1A 4IN3B 1SVXA 2WXLA 1N52A 2A5UA 3OTNA 1TNYA 1E96B 3NOCD 2ILRA 4WWNA 2UY1A 4D10C 5KCMA 4ANUA 3PUJA 5G05C 3LYAA 5J08A 5CCMA 4G11A 4GYOA 1NA3A 3QJZA 3ASOE 3LCAA 1PC2A 2V4LA 1JWFA 3PREA 5T4YA 3CHOA 3QDNA 1INZA 3HRAA 5FZSA 1HS6A 2FF4A 3Q4AB 5KJMA 1SW6A 1H0AA 3FU3A 5A23A 4DK5A 4G8LA 4XIFA 2AWIA 4QFVA 2A4ZA 5BXOA 3JYSA 2XCCA 2KCKA 4IYPA 3PUKA 3FTYA 4BERA 3PZ3A 1RW2A 2P9IG 1TJFA 4BESA 2V5QC 4A3TA 3SZ7A 5G04J 2AVPA 4GTTA 3UM3A 3Q9NC 2WQHA 3Q9UC 3CVYA 2OEVA 3AS5A 4FADA 1D9SA 2MRIA 3LY7A 2NC9A 3NQPA 2RD0A 4J0UA 2VSXE 4ZHBA 4F1PA 3UKUG 4AM9A 3B7RL 3ZKJA 3TWVA 3T5XA 3L54A 3Q49B 3WXXA 5B3SE 2X3MA 3C98A 3E34A 3O48A 2XGMA 4I43A 3D9JA 4GZ5A 2PM6A 1V54E 2XEEA 5HI7A 2CHZA 2FO1E 4XI9A 1K3ZD 3Q5MA 4DLQA 1S70B 4GPMA 2ZGDA 2ONDA 2NYJA 4JB8P 3D9LA 4F7AA 3DEPA 4KMOA 3SBTB 4CZ2D 2GRLA 3EHRA 4O1OA 3NB2A 2EILE 4JD2G 4K5AB 2R05A 4OYSA 3ZYMA 1H6PA 1TEZA 1QNFA 3J5PA 2FEZA 2CHWA 4G1TA 1WAO1 1MZCA 4HQDA 2IO3C 3MCXA 3PEUB 2L9BA 2DVWA 1OCRE 4GTSA 4DX6D 3FUHA 2UY1B 3DSSA 3AU4A 4GMJA 4H7XA 1TJCA 4GTRA 5C1DA 1D8EA 2QZAA 4CT0A 3ESKA 1YMPA 1UN8A 4KBQA 3OXFA 3FUEA 3UUXA 3D9OA 1FCHA 4LERA 3MZLB 4BTAA 1K1AA 2XGOA 4KXKB 3CVWA 4WNFA 3PNTB 1K1BA 3TGOA 2YNQA 2WXKA 3HHMA 3TXNA 2EINE 4RQIA 3ZXSA 3D9PA 3KAEA 2LUHA 1KZOA 1N0RA 4AP2A 5E76A 1KLXA 3FUJA 4GYYA 3S7JA 2H6GA 2H6HA 3VTXA 2J49A 2H6IA 1JPLA 4KZ0A 1E8YA 4N5CA 3SF4A 3CHRA 3FH7A 4F3VA 4DUIA 4JA7A 2V4HC 2LO6A 4U07A 2HR2A 3CK9A 2Y0BG 3L08A 1DVPA 3FU0A 1H6OA 3FHEA 2I2OA 4BSZB 4WUYA 3FTSA 1HU3A 4HLLA 2WXHA 3GZSA 2WXOA 4I6EA 4HOSA 3V2OA 3CV0A 3TWSA 4CDMA 4FLBA 4GU5A 2F37A 4XE0A 1YYHA 2BF0X 3W9FA 3IXEA 4HOQA 5B1AE 4URKA 2PNNA 2WXGA 4NURA 4JC8A 4PS3A 3CHPA 4AIFA 2DWZA 4UWFA 4N3AA 3MV2B 3TWXA 5CEDB 3LY8A 2NSZA 4JHJA 3G2WA 3BUAA 3ONLA 1DCEA 4U96D 3EU9A 2I6HA 4OAUC 1JCRA 1NP7A 1H2TC 3AG3E 2Y4UA 2LSUA 3SBSA 1SZ9A 1E8WA 1IYGA 2HO1A 4A63B 4BY6A 3CQGB 5AAOA 1NFIE 3LPZA 3ASNE 3QOUA 2J9QA 2EQXA 4E6HA 5KJKA 1ELKA 2RKKA 4WWPA 4AV7A 2L0IA 2Q7FA 3ABME 4BSXA 5DIZA 4QQIA 5ENSD 1FT2A 4FULA 4U8YD 5IY5E 2WM9A 3APFA 2CFZA 3PDNA 5FJYA 4KVMA 5LCWJ 3PZ4A 4J8EA 3FEXA 2WXIA 5D0OD 2XRYA 5FQ8A 4APOA 2Y3AA 4YDWA 1PY1A 1IHGA 4I17A 3ZIMA 3ZYKA 4WNDA 1EPUA 1GW6A 4HRMB 5BV1A 2PQRA 3I4RB 3WG7E 4ANXA 5CCLA 4L23A 4LCTA 3C72A 3APCA 4LG6A 4U63A 2VGEA 2C0LA 4J6IA 4XI0A 2C0MA 4ILIA 4DLOA 2GROB 1XNFA 4AVXA 2WXNA 1B89A 3DEOA 3ESLA 2VSOE 3QWVA 2XQ0A 3MX3A 4NACA 1H2VC 5ITZF 2WXPA 3QAQA 2IU1A 5C2YA 3ASDA 4ABNA 1L5JA 3FTWA 2ETAA 3GW4A 3GZ2A 4RLYA 3FU6A 2P58C 1IQUA 3UI2A 2XRZA 3ABLE 3HG0D 3QK0A 3RO3A 2X6JA 1YCSB 2WB2A 3D9MA 3AU5A 3HXBA 4LRZA 3FTXA 4N5QA 2AXVA 2J07A 4V3IA 1Z3YA 3UXGA 3S7FA 3UT8A 3UKRG 2WXFA 4Z68A 2XHEA 3B7SA 3CSTA 1WY6A 1E7VA 3PEVB 4CGVA 1KPSB 2Y69E 4H7YA 4N2SA 5E75A 1NI1A 4IRUA 3TG5A 1Y6IA 5HQ8A 5BV0A 5G2NA 2LXLA 1W3BA 3FP3A 4GA2A 4JW1A 2Y4TA 1Z6TA 2J4DA 4M3OA 4DPRA 4UWHA 5ENTD 4RSYA 4B93B 2IJGX 2F8XK 4U0SA 2X38A 4KVOA 3APDA 2ZISA 1U2VG 1O5MA 3QWPA 3CVNA 4CDNA 4K5CA 3D9KA 3JCKC 3L9TA 4XX5A 1N4PA 1DCQA 3FUNA 3SY2A 1Z3XA 5B1BE 5AN8A 1UJKA 1N94A 1SA5A 2BUGA 3CQCB 3Q7AA 4E85A 2KZTA 2WMNA 4WNEA 3Q73A 5LFAA 3ZW3A 2LSVA 2F8YA 4BTBA 4L2LA 2PQNA 3X2QE 4I2ZA 1JCQA 4HRLA 3CVUA 5J90A 1H6KA 3IBEA 1TN6A 2QYJA 4ACLA 3Q75A 3B13A 3RJVA 3LKUA 3Q15A 2VGXA 3B7UX 4GA1A 5AENA 3PZDA 4IULA 3LEWA 3C3OA 5H7PA 1DC2A 2WPVA 4I9CA 2GGFA 2IQCA 4UI9K 3UIPC 3ZXPA 3BQOA 2XENA 2OVFA 4Y6CA 4PUCA 3ULQA 5EILA 3T9KA 5FT9A 3HXFA 3Q47B 3V30A 2XS1A 2WXMA 3CHQA 3D9IA 3SFYA 3ML8A 5JHAA 5M72A 3TWRA 4MRUA 3SFZA 1Z5SC 4ATZD 4XKBA 3BG0B 2IY0C 4AJWA 4G2VA 4J8DA 1BI8B 2VSNA 3S7BA 3CR3A 3CVPA 4YDYA 3IHYA 1IQRA 4CYMD 4K0RA 3TWTA 4GCNA 3CKBA 2YQ8A 2ZGGA 3KS2A 1UW4B 2P9PG 1LD8A 3VLDA 2E0IA 3EHNA 3Q7FA 3FTUA 1QBQA 4HXIA 2KBXA 4NRHB 4HFGA 5DBKA 1HXIA 4C0EA 3EIJA 1N95A 4AY5A 3PVLA 3TWQA 4CGWA 4RG6A 5CECB 4KYOB 3RIBA 3ML9A 3F6QA 1G3NB 2P9SG 4GTVA 3CHSA 2L6BA 4LNBA 1Q2ZA 5EKQD 4N39A 1ZU2A 2VGYA 3ULYA 2PM7A 4U7EB 1OWOA 4MLPA 4C0MA 2YHEA 5BW8C 2ZXWE 4EECA 1K8KG 4KT6B 4L1BA 2GRMA 5EIBE 1WM5A 2Y1LE 1O1RA 4I2WA 2KZTB 5ARGA 3HXEA 3ZEFA 3MA5A 3JQ0A 2M63A 3MJWA 3O4ZA 4EBAG 4ME2A 3AG1E 4LSZE 3HYMB 4HOUA 2J08A 1N4SA 1O1SA 2DBAA 3EU5A 5KNGA 2DIWA 4YNDA 4OVUA 2VGXB 3L82A 2XZDG 5LX8A 2JABA 5EIDA 2GRRB 4JXTA 4TXQA 4U0UA 1YA0A 3ASFA 4GZDA 3S2AA 3SQVA 5A7DB 2GRNB 4G23A 2XS8A 2LXMA 2GW1A 4BEPA 4N3CA 1RZ4A 2L6JA 5G55A 3L22A 2LAHA 3D3MA 3RRNB 3Q78A 4TXPA 3DBSA 3L17A 1ZBPA 5ENPD 3DSVA 2RG8A 1HZ4A 3MKQA 3AS8A 4FJZA 3I3NA 3BU8A 1QZ2A 1HH8A 4FJYA 2OV8A 5ENOD 2KATA 3LVRE 1HE8A 2R17C 5G05J 4BETA 5HKPA 2HE0A 3UTMA 5KJNA 3EIQC 2R03A 3FUMA 1WDYA 1TNOA 4O6FA 4A1SA 3IKOB 3QWWA 4R7LA 4DJAA 3J5QB 2A5EA 1S0PA 3DPYA 4UI9J 2DZNA 3ZRHA 4UWLA 3ZNGA 4K5BA 3AJIA 3UT4A 1AWCB 4UQZA 4I1MA 2V8SE 4MBGA 3LY9A 1BI7B 5AQ9A 1UN9A 3NOGD 1DNPA 5AQ7A 3E33A 3T8MA 5G04C 3ZYLA 2IONA 4YDEA 4B8AA 1BD8A 3U3WA 2X6KA 1U3CA 5FZRA 4ACKA 3DRAA 2IOLA 3EHQA 2P9NG 4UQYA 4U0ZA 2WQ7A 4APFA 4PH4B 3FFLA 4U95D 2WVIA 2VYIA 3OXGA 4JHKA 1E7UA 5ARFA 2ETCA 2CG3A 3RRUA 4EZJA 2P9UG 3TAXA 4UUCA 2DCPA 3FU5A 2H6FA 2P9KG 1ZB1A 3C3QA 1A17A 4Y6WA 1N4RA 5EDSA 3KD7A 3ZUVB 4FU3A 4JPSA 4J7WA 3DSXA 3PH0C 3E37A 4GZ3A 3SD5A 1OT8A 4AOFA 4FHJA 3T5VA 5BNWA 2OVBA 4F6RD 3JXJA 1X81A 3CK8A 3P2BA 4GZ6A 3C3RA 4ANWA 2XZTG 4JHRA 4HBDA 1LF8A 4U8HA 3ZYQA 3PNLB 3FWVA 2R5SA 1PAQA 3C5RA 4L9PA 3L13A 4LNGA 4AEZC 3TWWA 3QKYA 2VTBA 3E30A 3OXLA 1NZNA 4GMLA 1HFAA 2BEDA 1IXVA 3GYZA 4DI4A 4I1OB 2DZOA 5JA4D 3EDTB 2OCCE 3LVQE 2BKKB 3CSFA 5FZQA 2CFUA 3MKQB 4GB9A 3U9WA 3HVEA 4UQXA 3DWLG 5JHBA 1N0QA 2IF4A 4JA9A 4BX8A 4ZFHA 3EUVA 3IEGA 4HS2A 4PDXA 1OUVA 4UWGA 3QARA 4J8SA 3V79K 3LS8A 5FIOA 4GMRA 4I6GA 1UJJA 4FC8A 3R9MA 1AP7A 3TJPA 2B6CA 1QQEA 4BFRA 1UG3A 3FUDA 3PZ2A 3ZGQA 3ZFWA 2J8SD 3FDHA 1FVFA 3D9HA 1OWMA 2AJAA 4HRNA 5HRYA 2BKGA 1E8XA 2XEHA 3UM1A 4Q94A 2QY7A 1O1TA 1QYMA 2V5FA
chains in the Genus database with same CATH topology
4C48B 5EN5D 4A63B 3TWRA 3DEPA 1OY3D 1N0RA 3V31A 4K5CA 5CBOA 3ZNGA 1A5EA 4K5BA 2ETAA 3AJIA 3KEAA 4G8LA 4CZ2D 5AAOA 1NFIE 4G8KA 4QFVA 5ENRD 4ATZD 5BXOA 1AWCB 4HB5A 4OAVB 4J8YA 4RLYA 3EHRA 1UOHA 4O1OA 1DCQA 3C5RA 3TWUA 5KWDA 1BI7B 3B95A 4LSZE 5AQ9A 4BERA 4DX1A 3NOGD 3UI2A 5AN8A 5AQ7A 4K5AB 5AARA 3TWWA 4BESA 3HG0D 1BI8B 4TUMA 2KXPC 2V5QC 3B7BA 4QQIA 5ENSD 3JXIA 4U8YD 5ENQD 1YCSB 1BD8A 5KNGA 3J5PA 4YDYA 2MYOA 2F8YA 1IXVA 3SO8A 2XZDG 4DUIA 2DZOA 4N5QA 5CEAA 5KBAA 2JABA 1BLXB 5EIDA 4CYMD 4HQDA 1TR4A 3Q9NC 5JA4D 3TWTA 1BU9A 3Q9UC 4HRLA 2V4HC 4U8VD 3EHQA 4O60A 3UXGA 2BKKB 4HI9A 1D9SA 2DVWA 2ZGGA 1MJ0A 2Y0BG 1MX2A 2B0OE 4U95D 2QYJA 4BSZB 4DRXE 2ETBA 4DX6D 4Z68A 5HS0A 4O1PA 4HLLA 1MYOA 2ETCA 4ZHBA 4HNAD 5EYPF 4YDWA 4F1PA 1N0QA 2KBXA 3V2OA 4BEPA 3TWSA 4UUCA 5JMND 5KNHD 2F37A 4HRMB 1YYHA 3ZKJA 4ZFHA 1DC2A 3TWVA 1SVXA 1MX6A 5BXUA 5ENPD 2RFAA 3W9FA 1YMPA 3IXEA 3NBNB 3V2XA 1IKND 4LNUD 5AQBA 3V79K 5FIOA 4GMRA 2PNNA 4HI8A 3TWQA 3NOCD 1MX4A 5CECB 3ZUVB 1AP7A 5EYLA 3F6QA 5ENOD 1G3NB 1K1AA 2XENA 4LG6A 2DWZA 2VGEA 4J7WA 5CBNA 5CERB 3TWXA 1WG0A 5CEDB 2XEEA 3LJNA 4BETA 5EILA 3ZU7B 1OT8A 2L6BA 5HKPA 2HE0A 2J8SD 3UTMA 3D9HA 2FO1E 4DX7D 5D66A 4U96D 5ENTD 3T9KA 1N11A 1K1BA 3EU9A 4F6RD 4OAUC 3JXJA 1K3ZD 1WDYA 2QC9A 1IHBA 5AQAA 4B93B 3DEOA 2F8XK 2DZNA 2AJAA 1S70B 3AAAC 4HRNA 5HRYA 3JUEA 3V30A 4GPMA 2BKGA 5ITZF 2ZGDA 2XEHA 4DX2A 5FINA 2RFMA 3W9GA 2XZTG 4DX5D 4NIKA 2NYJA 4JB8P 3HRAA 4HBDA 1QYMA 3J5QB 3T8KA 2A5EA 5EIBE 2P2CP 2Y1LE 1SW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C48 B;  5EN5 D;  4A63 B;  3TWR A;  3DEP A;  1OY3 D;  1N0R A;  3V31 A;  4K5C A;  5CBO A;  3ZNG A;  1A5E A;  4K5B A;  2ETA A;  3AJI A;  3KEA A;  4G8L A;  4CZ2 D;  5AAO A;  1NFI E;  4G8K A;  4QFV A;  5ENR D;  4ATZ D;  5BXO A;  1AWC B;  4HB5 A;  4OAV B;  4J8Y A;  4RLY A;  3EHR A;  1UOH A;  4O1O A;  1DCQ A;  3C5R A;  3TWU A;  5KWD A;  1BI7 B;  3B95 A;  4LSZ E;  5AQ9 A;  4BER A;  4DX1 A;  3NOG D;  3UI2 A;  5AN8 A;  5AQ7 A;  4K5A B;  5AAR A;  3TWW A;  4BES A;  3HG0 D;  1BI8 B;  4TUM A;  2KXP C;  2V5Q C;  3B7B A;  4QQI A;  5ENS D;  3JXI A;  4U8Y D;  5ENQ D;  1YCS B;  1BD8 A;  5KNG A;  3J5P A;  4YDY A;  2MYO A;  2F8Y A;  1IXV A;  3SO8 A;  2XZD G;  4DUI A;  2DZO A;  4N5Q A;  5CEA A;  5KBA A;  2JAB A;  1BLX B;  5EID A;  4CYM D;  4HQD A;  1TR4 A;  3Q9N C;  5JA4 D;  3TWT A;  1BU9 A;  3Q9U C;  4HRL A;  2V4H C;  4U8V D;  3EHQ A;  4O60 A;  3UXG A;  2BKK B;  4HI9 A;  1D9S A;  2DVW A;  2ZGG A;  1MJ0 A;  2Y0B G;  1MX2 A;  2B0O E;  4U95 D;  2QYJ A;  4BSZ B;  4DRX E;  2ETB A;  4DX6 D;  4Z68 A;  5HS0 A;  4O1P A;  4HLL A;  1MYO A;  2ETC A;  4ZHB A;  4HNA D;  5EYP F;  4YDW A;  4F1P A;  1N0Q A;  2KBX A;  3V2O A;  4BEP A;  3TWS A;  4UUC A;  5JMN D;  5KNH D;  2F37 A;  4HRM B;  1YYH A;  3ZKJ A;  4ZFH A;  1DC2 A;  3TWV A;  1SVX A;  1MX6 A;  5BXU A;  5ENP D;  2RFA A;  3W9F A;  1YMP A;  3IXE A;  3NBN B;  3V2X A;  1IKN D;  4LNU D;  5AQB A;  3V79 K;  5FIO A;  4GMR A;  2PNN A;  4HI8 A;  3TWQ A;  3NOC D;  1MX4 A;  5CEC B;  3ZUV B;  1AP7 A;  5EYL A;  3F6Q A;  5ENO D;  1G3N B;  1K1A A;  2XEN A;  4LG6 A;  2DWZ A;  2VGE A;  4J7W A;  5CBN A;  5CER B;  3TWX A;  1WG0 A;  5CED B;  2XEE A;  3LJN A;  4BET A;  5EIL A;  3ZU7 B;  1OT8 A;  2L6B A;  5HKP A;  2HE0 A;  2J8S D;  3UTM A;  3D9H A;  2FO1 E;  4DX7 D;  5D66 A;  4U96 D;  5ENT D;  3T9K A;  1N11 A;  1K1B A;  3EU9 A;  4F6R D;  4OAU C;  3JXJ A;  1K3Z D;  1WDY A;  2QC9 A;  1IHB A;  5AQA A;  4B93 B;  3DEO A;  2F8X K;  2DZN A;  2AJA A;  1S70 B;  3AAA C;  4HRN A;  5HRY A;  3JUE A;  3V30 A;  4GPM A;  2BKG A;  5ITZ F;  2ZGD A;  2XEH A;  4DX2 A;  5FIN A;  2RFM A;  3W9G A;  2XZT G;  4DX5 D;  4NIK A;  2NYJ A;  4JB8 P;  3HRA A;  4HBD A;  1QYM A;  3J5Q B;  3T8K A;  2A5E A;  5EIB E;  2P2C P;  2Y1L E;  1SW6 A; 
#chains in the Genus database with same CATH topology
 3G2U A;  1FPP A;  3FTZ A;  2EIK E;  5CBO A;  3KSQ A;  1OWL A;  4XEI G;  2X6F A;  4JVS A;  3PE3 A;  2WQ6 A;  4HLE A;  3VLE A;  3B7B A;  4FLH A;  4C9B B;  4GAA A;  5ENQ D;  2EIJ E;  4HOR A;  4NQ0 A;  2MHK A;  2XPI A;  4GTM A;  3ZHE A;  3FH8 A;  2GRQ B;  2KCV A;  1MX2 A;  4YDO A;  1OWP A;  1HG2 A;  4F53 A;  3DXK G;  2ETB A;  5HS0 A;  4EPZ A;  1N4Q A;  2KC7 A;  4ILH B;  1LTX A;  4LEU A;  4BWR A;  3FUI A;  4RVB A;  1EDU A;  4EZK A;  3HXD A;  3OAW A;  3GZ1 A;  3ASG A;  4FHK A;  3ZVV A;  1MX6 A;  3RSE G;  4GTO A;  3G2S A;  3K9I A;  3RU0 A;  3SFX A;  4HI8 A;  4CRW A;  4BX9 A;  4UI9 C;  4N2Q A;  5CBN A;  4G25 A;  4LUN U;  3EHM A;  3LJN A;  4KZC A;  1TN7 A;  1X5B A;  4GCO A;  1KZP A;  5D2M C;  1N11 A;  3S7D A;  1VDY A;  2QC9 A;  1IHB A;  3R9A B;  4M7C A;  1P5Q A;  4DX2 A;  2L0T B;  1ELR A;  3W9G A;  2RFM A;  2VTB B;  2PL2 A;  4NIK A;  2IOS A;  3Q79 A;  3KSL A;  5EX3 A;  2AXZ A;  1FT1 A;  1ELW A;  4JZY A;  3U64 A;  3KEA A;  2I1J A;  1OWN A;  3HXC A;  2CG2 A;  2KM4 A;  4CEM A;  4HB5 A;  4J8Y A;  1FVH A;  4DX1 A;  2KCL A;  2LAI A;  2LNI A;  5AAR A;  2HM8 A;  3HDX A;  3UIN C;  2I9C A;  3HVE B;  4EBA A;  5LOZ A;  3NF1 A;  5KBA A;  5LCW C;  4U8V D;  4CCA A;  4J8F A;  4I1A A;  4I9E A;  4CDR A;  1OCO E;  3PZ1 A;  4A55 A;  2R59 A;  3ABK E;  4BT8 A;  1V55 E;  4U04 A;  2IO2 C;  2BTD A;  2YHC A;  3PS6 A;  1HF8 A;  5CRV A;  2RFA A;  1IKN D;  3FUL A;  4LNU D;  3HIZ A;  2GRP B;  2ZIR A;  2JLB A;  1WG0 A;  3FTV A;  2ZU6 B;  5FQ4 A;  1JUQ A;  4GTP A;  3ZPJ A;  2OOE A;  1E90 A;  3FUK A;  4EHM A;  2R2L A;  3CEQ A;  2P2C P;  1NA0 A;  1H2U A;  4GZC A;  4L2Y A;  5EN5 D;  1HO8 A;  3TXM A;  3TG4 A;  3V31 A;  1A5E A;  3UT7 A;  1OCZ E;  4GA0 A;  2X6I A;  4W9R A;  3MEK A;  5ENR D;  1BPO A;  1S63 A;  2AW6 A;  4HOT A;  5KWD A;  3QB2 A;  3ZHE B;  2VQ2 A;  5CHE E;  3E4B A;  5CMY A;  4FA6 A;  5FWQ A;  4TV3 A;  3CGH A;  3CVL A;  3NAW A;  1OXJ A;  4G26 A;  3ASH A;  4ANV A;  3CIA A;  5BPP A;  4FP7 A;  4OVV A;  4A1G A;  4B94 A;  4TRQ A;  3ZN3 A;  4UWK A;  2V0P A;  4XKC A;  3RRM B;  3MV3 B;  3LDZ A;  2I1K A;  5EYP F;  3UM0 A;  2WMO A;  5JJ6 A;  5BT1 A;  5LP0 A;  4PS7 A;  4K03 A;  5JMN D;  2X6H A;  4X8Q A;  3QNK A;  3MYV A;  5AQB A;  3U4T A;  3ENE A;  2J09 A;  2PZI A;  4JL0 A;  3ZU7 B;  3CHM A;  2UWJ G;  2QFC A;  2NXP A;  3NBN B;  3AAA C;  1EYH A;  3MGB A;  4DX5 D;  4RG9 A;  3VTY A;  3SI5 A;  5KNH D;  1JCS A;  3UIO C;  2WXQ A;  2JEK A;  2IFU A;  3DPD A;  5BUZ A;  4WWO A;  5AYW D;  4AY6 A;  3RO2 A;  3QC1 A;  3CLJ A;  1JWG A;  3NZS A;  4JEU A;  4TXR A;  4F1S A;  4I6J A;  3E32 A;  3MKR A;  3SO8 A;  5FTP A;  1BLX B;  1TR4 A;  3ULE G;  4P29 A;  3IHV A;  4B8C B;  1BU9 A;  3DXM G;  3B7T A;  4HVB A;  3TL5 A;  1TNB A;  3VLF A;  4HI9 A;  1KT1 A;  3U66 A;  2B0O E;  3RK6 A;  1KT0 A;  3FEY A;  4G24 A;  4TUU A;  2DYS E;  5ANL A;  3SHF A;  4WAF A;  3L6A A;  2XPY A;  3LJ3 A;  4JEH A;  4N3B A;  3FY4 A;  3V2X A;  2AXU A;  2OEW A;  4YVQ C;  5ANR A;  2QYU A;  5KJL A;  1MX4 A;  2XGS A;  3I4G A;  4GYW A;  1MQS A;  5EYL A;  4PS8 A;  3L16 A;  4B89 A;  1E8Z A;  1XGW A;  5CMW A;  1HG5 A;  1LD7 A;  1N54 A;  2C2L A;  2XEV A;  3R7Q A;  1HX8 A;  5T8I A;  4DX7 D;  5FQ6 A;  3SGH A;  3N71 A;  5AQA A;  3UX4 A;  2XPZ A;  5AJL A;  3AS4 A;  3DSW A;  3PRZ A;  2YIN A;  3UMV A;  4MS6 A;  3T8K A;  5D0Q D;  1S64 A;  3P1U A;  4C48 B;  1TNZ A;  3DST A;  3AG4 E;  4EZL A;  1OY3 D;  3URZ A;  3G2T A;  4OAV B;  3FH5 A;  1UOH A;  3TWU A;  1MHQ A;  1Y8M A;  3UPV A;  4WNG A;  5ENN A;  4TUM A;  3SNX A;  3UM2 A;  2P9L G;  3IV0 A;  1H19 A;  1TYQ G;  3JXI A;  3CVX A;  4BT9 A;  1SA4 A;  1SQM A;  2IEJ A;  4B0Z A;  3BG1 B;  3ISM C;  4O60 A;  1MJ0 A;  2XCB A;  5T3R A;  2WXJ A;  4DRX E;  4ATG A;  2DYR E;  2FUL A;  1NL4 A;  2CHX A;  1MYO A;  5JJT A;  3G2V A;  2WXR A;  3CVV A;  3JUI A;  5CRU A;  3RKV A;  4MKT A;  3PE4 A;  3D9N A;  5BXU A;  4AXH A;  3I5P A;  4ILG A;  4EQF A;  3CKC A;  1OCC E;  2FI7 A;  5CER B;  2F0Y A;  4Q96 A;  4YVO A;  4CT4 A;  5D66 A;  4L7T A;  2R02 A;  4GPK A;  5A6C A;  2FO7 A;  3JUE A;  1TN8 A;  5FIN A;  3EJN A;  4DI3 A;  3KEZ A;  3R7R A;  3RAU A;  2EIM E;  1N9A A;  3LXU X;  4G8K A;  2HYZ A;  4GTQ A;  3B95 A;  3AG2 E;  3CK7 A;  3DSU A;  2KXP C;  2VSY A;  5EX0 A;  3NZU A;  2VJ8 A;  1TNU A;  2MYO A;  1U3D A;  5CEA A;  1D8D A;  5JJ7 A;  4A3V A;  2FBN A;  4Q69 A;  3BEE A;  4XZ4 A;  1EF1 C;  1SZA A;  4O1P A;  3UQ3 A;  4HNA D;  5AJD A;  3CVQ A;  3FUF A;  2J4B A;  5AIJ A;  3ONK A;  2E2E A;  2MOW A;  5FQ7 A;  3JQ1 A;  4IN3 B;  1SVX A;  2WXL A;  1N52 A;  2A5U A;  3OTN A;  1TNY A;  1E96 B;  3NOC D;  2ILR A;  4WWN A;  2UY1 A;  4D10 C;  5KCM A;  4ANU A;  3PUJ A;  5G05 C;  3LYA A;  5J08 A;  5CCM A;  4G11 A;  4GYO A;  1NA3 A;  3QJZ A;  3ASO E;  3LCA A;  1PC2 A;  2V4L A;  1JWF A;  3PRE A;  5T4Y A;  3CHO A;  3QDN A;  1INZ A;  3HRA A;  5FZS A;  1HS6 A;  2FF4 A;  3Q4A B;  5KJM A;  1SW6 A;  1H0A A;  3FU3 A;  5A23 A;  4DK5 A;  4G8L A;  4XIF A;  2AWI A;  4QFV A;  2A4Z A;  5BXO A;  3JYS A;  2XCC A;  2KCK A;  4IYP A;  3PUK A;  3FTY A;  4BER A;  3PZ3 A;  1RW2 A;  2P9I G;  1TJF A;  4BES A;  2V5Q C;  4A3T A;  3SZ7 A;  5G04 J;  2AVP A;  4GTT A;  3UM3 A;  3Q9N C;  2WQH A;  3Q9U C;  3CVY A;  2OEV A;  3AS5 A;  4FAD A;  1D9S A;  2MRI A;  3LY7 A;  2NC9 A;  3NQP A;  2RD0 A;  4J0U A;  2VSX E;  4ZHB A;  4F1P A;  3UKU G;  4AM9 A;  3B7R L;  3ZKJ A;  3TWV A;  3T5X A;  3L54 A;  3Q49 B;  3WXX A;  5B3S E;  2X3M A;  3C98 A;  3E34 A;  3O48 A;  2XGM A;  4I43 A;  3D9J A;  4GZ5 A;  2PM6 A;  1V54 E;  2XEE A;  5HI7 A;  2CHZ A;  2FO1 E;  4XI9 A;  1K3Z D;  3Q5M A;  4DLQ A;  1S70 B;  4GPM A;  2ZGD A;  2OND A;  2NYJ A;  4JB8 P;  3D9L A;  4F7A A;  3DEP A;  4KMO A;  3SBT B;  4CZ2 D;  2GRL A;  3EHR A;  4O1O A;  3NB2 A;  2EIL E;  4JD2 G;  4K5A B;  2R05 A;  4OYS A;  3ZYM A;  1H6P A;  1TEZ A;  1QNF A;  3J5P A;  2FEZ A;  2CHW A;  4G1T A;  1WAO 1;  1MZC A;  4HQD A;  2IO3 C;  3MCX A;  3PEU B;  2L9B A;  2DVW A;  1OCR E;  4GTS A;  4DX6 D;  3FUH A;  2UY1 B;  3DSS A;  3AU4 A;  4GMJ A;  4H7X A;  1TJC A;  4GTR A;  5C1D A;  1D8E A;  2QZA A;  4CT0 A;  3ESK A;  1YMP A;  1UN8 A;  4KBQ A;  3OXF A;  3FUE A;  3UUX A;  3D9O A;  1FCH A;  4LER A;  3MZL B;  4BTA A;  1K1A A;  2XGO A;  4KXK B;  3CVW A;  4WNF A;  3PNT B;  1K1B A;  3TGO A;  2YNQ A;  2WXK A;  3HHM A;  3TXN A;  2EIN E;  4RQI A;  3ZXS A;  3D9P A;  3KAE A;  2LUH A;  1KZO A;  1N0R A;  4AP2 A;  5E76 A;  1KLX A;  3FUJ A;  4GYY A;  3S7J A;  2H6G A;  2H6H A;  3VTX A;  2J49 A;  2H6I A;  1JPL A;  4KZ0 A;  1E8Y A;  4N5C A;  3SF4 A;  3CHR A;  3FH7 A;  4F3V A;  4DUI A;  4JA7 A;  2V4H C;  2LO6 A;  4U07 A;  2HR2 A;  3CK9 A;  2Y0B G;  3L08 A;  1DVP A;  3FU0 A;  1H6O A;  3FHE A;  2I2O A;  4BSZ B;  4WUY A;  3FTS A;  1HU3 A;  4HLL A;  2WXH A;  3GZS A;  2WXO A;  4I6E A;  4HOS A;  3V2O A;  3CV0 A;  3TWS A;  4CDM A;  4FLB A;  4GU5 A;  2F37 A;  4XE0 A;  1YYH A;  2BF0 X;  3W9F A;  3IXE A;  4HOQ A;  5B1A E;  4URK A;  2PNN A;  2WXG A;  4NUR A;  4JC8 A;  4PS3 A;  3CHP A;  4AIF A;  2DWZ A;  4UWF A;  4N3A A;  3MV2 B;  3TWX A;  5CED B;  3LY8 A;  2NSZ A;  4JHJ A;  3G2W A;  3BUA A;  3ONL A;  1DCE A;  4U96 D;  3EU9 A;  2I6H A;  4OAU C;  1JCR A;  1NP7 A;  1H2T C;  3AG3 E;  2Y4U A;  2LSU A;  3SBS A;  1SZ9 A;  1E8W A;  1IYG A;  2HO1 A;  4A63 B;  4BY6 A;  3CQG B;  5AAO A;  1NFI E;  3LPZ A;  3ASN E;  3QOU A;  2J9Q A;  2EQX A;  4E6H A;  5KJK A;  1ELK A;  2RKK A;  4WWP A;  4AV7 A;  2L0I A;  2Q7F A;  3ABM E;  4BSX A;  5DIZ A;  4QQI A;  5ENS D;  1FT2 A;  4FUL A;  4U8Y D;  5IY5 E;  2WM9 A;  3APF A;  2CFZ A;  3PDN A;  5FJY A;  4KVM A;  5LCW J;  3PZ4 A;  4J8E A;  3FEX A;  2WXI A;  5D0O D;  2XRY A;  5FQ8 A;  4APO A;  2Y3A A;  4YDW A;  1PY1 A;  1IHG A;  4I17 A;  3ZIM A;  3ZYK A;  4WND A;  1EPU A;  1GW6 A;  4HRM B;  5BV1 A;  2PQR A;  3I4R B;  3WG7 E;  4ANX A;  5CCL A;  4L23 A;  4LCT A;  3C72 A;  3APC A;  4LG6 A;  4U63 A;  2VGE A;  2C0L A;  4J6I A;  4XI0 A;  2C0M A;  4ILI A;  4DLO A;  2GRO B;  1XNF A;  4AVX A;  2WXN A;  1B89 A;  3DEO A;  3ESL A;  2VSO E;  3QWV A;  2XQ0 A;  3MX3 A;  4NAC A;  1H2V C;  5ITZ F;  2WXP A;  3QAQ A;  2IU1 A;  5C2Y A;  3ASD A;  4ABN A;  1L5J A;  3FTW A;  2ETA A;  3GW4 A;  3GZ2 A;  4RLY A;  3FU6 A;  2P58 C;  1IQU A;  3UI2 A;  2XRZ A;  3ABL E;  3HG0 D;  3QK0 A;  3RO3 A;  2X6J A;  1YCS B;  2WB2 A;  3D9M A;  3AU5 A;  3HXB A;  4LRZ A;  3FTX A;  4N5Q A;  2AXV A;  2J07 A;  4V3I A;  1Z3Y A;  3UXG A;  3S7F A;  3UT8 A;  3UKR G;  2WXF A;  4Z68 A;  2XHE A;  3B7S A;  3CST A;  1WY6 A;  1E7V A;  3PEV B;  4CGV A;  1KPS B;  2Y69 E;  4H7Y A;  4N2S A;  5E75 A;  1NI1 A;  4IRU A;  3TG5 A;  1Y6I A;  5HQ8 A;  5BV0 A;  5G2N A;  2LXL A;  1W3B A;  3FP3 A;  4GA2 A;  4JW1 A;  2Y4T A;  1Z6T A;  2J4D A;  4M3O A;  4DPR A;  4UWH A;  5ENT D;  4RSY A;  4B93 B;  2IJG X;  2F8X K;  4U0S A;  2X38 A;  4KVO A;  3APD A;  2ZIS A;  1U2V G;  1O5M A;  3QWP A;  3CVN A;  4CDN A;  4K5C A;  3D9K A;  3JCK C;  3L9T A;  4XX5 A;  1N4P A;  1DCQ A;  3FUN A;  3SY2 A;  1Z3X A;  5B1B E;  5AN8 A;  1UJK A;  1N94 A;  1SA5 A;  2BUG A;  3CQC B;  3Q7A A;  4E85 A;  2KZT A;  2WMN A;  4WNE A;  3Q73 A;  5LFA A;  3ZW3 A;  2LSV A;  2F8Y A;  4BTB A;  4L2L A;  2PQN A;  3X2Q E;  4I2Z A;  1JCQ A;  4HRL A;  3CVU A;  5J90 A;  1H6K A;  3IBE A;  1TN6 A;  2QYJ A;  4ACL A;  3Q75 A;  3B13 A;  3RJV A;  3LKU A;  3Q15 A;  2VGX A;  3B7U X;  4GA1 A;  5AEN A;  3PZD A;  4IUL A;  3LEW A;  3C3O A;  5H7P A;  1DC2 A;  2WPV A;  4I9C A;  2GGF A;  2IQC A;  4UI9 K;  3UIP C;  3ZXP A;  3BQO A;  2XEN A;  2OVF A;  4Y6C A;  4PUC A;  3ULQ A;  5EIL A;  3T9K A;  5FT9 A;  3HXF A;  3Q47 B;  3V30 A;  2XS1 A;  2WXM A;  3CHQ A;  3D9I A;  3SFY A;  3ML8 A;  5JHA A;  5M72 A;  3TWR A;  4MRU A;  3SFZ A;  1Z5S C;  4ATZ D;  4XKB A;  3BG0 B;  2IY0 C;  4AJW A;  4G2V A;  4J8D A;  1BI8 B;  2VSN A;  3S7B A;  3CR3 A;  3CVP A;  4YDY A;  3IHY A;  1IQR A;  4CYM D;  4K0R A;  3TWT A;  4GCN A;  3CKB A;  2YQ8 A;  2ZGG A;  3KS2 A;  1UW4 B;  2P9P G;  1LD8 A;  3VLD A;  2E0I A;  3EHN A;  3Q7F A;  3FTU A;  1QBQ A;  4HXI A;  2KBX A;  4NRH B;  4HFG A;  5DBK A;  1HXI A;  4C0E A;  3EIJ A;  1N95 A;  4AY5 A;  3PVL A;  3TWQ A;  4CGW A;  4RG6 A;  5CEC B;  4KYO B;  3RIB A;  3ML9 A;  3F6Q A;  1G3N B;  2P9S G;  4GTV A;  3CHS A;  2L6B A;  4LNB A;  1Q2Z A;  5EKQ D;  4N39 A;  1ZU2 A;  2VGY A;  3ULY A;  2PM7 A;  4U7E B;  1OWO A;  4MLP A;  4C0M A;  2YHE A;  5BW8 C;  2ZXW E;  4EEC A;  1K8K G;  4KT6 B;  4L1B A;  2GRM A;  5EIB E;  1WM5 A;  2Y1L E;  1O1R A;  4I2W A;  2KZT B;  5ARG A;  3HXE A;  3ZEF A;  3MA5 A;  3JQ0 A;  2M63 A;  3MJW A;  3O4Z A;  4EBA G;  4ME2 A;  3AG1 E;  4LSZ E;  3HYM B;  4HOU A;  2J08 A;  1N4S A;  1O1S A;  2DBA A;  3EU5 A;  5KNG A;  2DIW A;  4YND A;  4OVU A;  2VGX B;  3L82 A;  2XZD G;  5LX8 A;  2JAB A;  5EID A;  2GRR B;  4JXT A;  4TXQ A;  4U0U A;  1YA0 A;  3ASF A;  4GZD A;  3S2A A;  3SQV A;  5A7D B;  2GRN B;  4G23 A;  2XS8 A;  2LXM A;  2GW1 A;  4BEP A;  4N3C A;  1RZ4 A;  2L6J A;  5G55 A;  3L22 A;  2LAH A;  3D3M A;  3RRN B;  3Q78 A;  4TXP A;  3DBS A;  3L17 A;  1ZBP A;  5ENP D;  3DSV A;  2RG8 A;  1HZ4 A;  3MKQ A;  3AS8 A;  4FJZ A;  3I3N A;  3BU8 A;  1QZ2 A;  1HH8 A;  4FJY A;  2OV8 A;  5ENO D;  2KAT A;  3LVR E;  1HE8 A;  2R17 C;  5G05 J;  4BET A;  5HKP A;  2HE0 A;  3UTM A;  5KJN A;  3EIQ C;  2R03 A;  3FUM A;  1WDY A;  1TNO A;  4O6F A;  4A1S A;  3IKO B;  3QWW A;  4R7L A;  4DJA A;  3J5Q B;  2A5E A;  1S0P A;  3DPY A;  4UI9 J;  2DZN A;  3ZRH A;  4UWL A;  3ZNG A;  4K5B A;  3AJI A;  3UT4 A;  1AWC B;  4UQZ A;  4I1M A;  2V8S E;  4MBG A;  3LY9 A;  1BI7 B;  5AQ9 A;  1UN9 A;  3NOG D;  1DNP A;  5AQ7 A;  3E33 A;  3T8M A;  5G04 C;  3ZYL A;  2ION A;  4YDE A;  4B8A A;  1BD8 A;  3U3W A;  2X6K A;  1U3C A;  5FZR A;  4ACK A;  3DRA A;  2IOL A;  3EHQ A;  2P9N G;  4UQY A;  4U0Z A;  2WQ7 A;  4APF A;  4PH4 B;  3FFL A;  4U95 D;  2WVI A;  2VYI A;  3OXG A;  4JHK A;  1E7U A;  5ARF A;  2ETC A;  2CG3 A;  3RRU A;  4EZJ A;  2P9U G;  3TAX A;  4UUC A;  2DCP A;  3FU5 A;  2H6F A;  2P9K G;  1ZB1 A;  3C3Q A;  1A17 A;  4Y6W A;  1N4R A;  5EDS A;  3KD7 A;  3ZUV B;  4FU3 A;  4JPS A;  4J7W A;  3DSX A;  3PH0 C;  3E37 A;  4GZ3 A;  3SD5 A;  1OT8 A;  4AOF A;  4FHJ A;  3T5V A;  5BNW A;  2OVB A;  4F6R D;  3JXJ A;  1X81 A;  3CK8 A;  3P2B A;  4GZ6 A;  3C3R A;  4ANW A;  2XZT G;  4JHR A;  4HBD A;  1LF8 A;  4U8H A;  3ZYQ A;  3PNL B;  3FWV A;  2R5S A;  1PAQ A;  3C5R A;  4L9P A;  3L13 A;  4LNG A;  4AEZ C;  3TWW A;  3QKY A;  2VTB A;  3E30 A;  3OXL A;  1NZN A;  4GML A;  1HFA A;  2BED A;  1IXV A;  3GYZ A;  4DI4 A;  4I1O B;  2DZO A;  5JA4 D;  3EDT B;  2OCC E;  3LVQ E;  2BKK B;  3CSF A;  5FZQ A;  2CFU A;  3MKQ B;  4GB9 A;  3U9W A;  3HVE A;  4UQX A;  3DWL G;  5JHB A;  1N0Q A;  2IF4 A;  4JA9 A;  4BX8 A;  4ZFH A;  3EUV A;  3IEG A;  4HS2 A;  4PDX A;  1OUV A;  4UWG A;  3QAR A;  4J8S A;  3V79 K;  3LS8 A;  5FIO A;  4GMR A;  4I6G A;  1UJJ A;  4FC8 A;  3R9M A;  1AP7 A;  3TJP A;  2B6C A;  1QQE A;  4BFR A;  1UG3 A;  3FUD A;  3PZ2 A;  3ZGQ A;  3ZFW A;  2J8S D;  3FDH A;  1FVF A;  3D9H A;  1OWM A;  2AJA A;  4HRN A;  5HRY A;  2BKG A;  1E8X A;  2XEH A;  3UM1 A;  4Q94 A;  2QY7 A;  1O1T A;  1QYM A;  2V5F A; 
#chains in the Genus database with same CATH homology
 4C48 B;  5EN5 D;  4A63 B;  3TWR A;  3DEP A;  1OY3 D;  1N0R A;  3V31 A;  4K5C A;  5CBO A;  3ZNG A;  1A5E A;  4K5B A;  2ETA A;  3AJI A;  3KEA A;  4G8L A;  4CZ2 D;  5AAO A;  1NFI E;  4G8K A;  4QFV A;  5ENR D;  4ATZ D;  5BXO A;  1AWC B;  4HB5 A;  4OAV B;  4J8Y A;  4RLY A;  3EHR A;  1UOH A;  4O1O A;  1DCQ A;  3C5R A;  3TWU A;  5KWD A;  1BI7 B;  3B95 A;  4LSZ E;  5AQ9 A;  4BER A;  4DX1 A;  3NOG D;  3UI2 A;  5AN8 A;  5AQ7 A;  4K5A B;  5AAR A;  3TWW A;  4BES A;  3HG0 D;  1BI8 B;  4TUM A;  2KXP C;  2V5Q C;  3B7B A;  4QQI A;  5ENS D;  3JXI A;  4U8Y D;  5ENQ D;  1YCS B;  1BD8 A;  5KNG A;  3J5P A;  4YDY A;  2MYO A;  2F8Y A;  1IXV A;  3SO8 A;  2XZD G;  4DUI A;  2DZO A;  4N5Q A;  5CEA A;  5KBA A;  2JAB A;  1BLX B;  5EID A;  4CYM D;  4HQD A;  1TR4 A;  3Q9N C;  5JA4 D;  3TWT A;  1BU9 A;  3Q9U C;  4HRL A;  2V4H C;  4U8V D;  3EHQ A;  4O60 A;  3UXG A;  2BKK B;  4HI9 A;  1D9S A;  2DVW A;  2ZGG A;  1MJ0 A;  2Y0B G;  1MX2 A;  2B0O E;  4U95 D;  2QYJ A;  4BSZ B;  4DRX E;  2ETB A;  4DX6 D;  4Z68 A;  5HS0 A;  4O1P A;  4HLL A;  1MYO A;  2ETC A;  4ZHB A;  4HNA D;  5EYP F;  4YDW A;  4F1P A;  1N0Q A;  2KBX A;  3V2O A;  4BEP A;  3TWS A;  4UUC A;  5JMN D;  5KNH D;  2F37 A;  4HRM B;  1YYH A;  3ZKJ A;  4ZFH A;  1DC2 A;  3TWV A;  1SVX A;  1MX6 A;  5BXU A;  5ENP D;  2RFA A;  3W9F A;  1YMP A;  3IXE A;  3NBN B;  3V2X A;  1IKN D;  4LNU D;  5AQB A;  3V79 K;  5FIO A;  4GMR A;  2PNN A;  4HI8 A;  3TWQ A;  3NOC D;  1MX4 A;  5CEC B;  3ZUV B;  1AP7 A;  5EYL A;  3F6Q A;  5ENO D;  1G3N B;  1K1A A;  2XEN A;  4LG6 A;  2DWZ A;  2VGE A;  4J7W A;  5CBN A;  5CER B;  3TWX A;  1WG0 A;  5CED B;  2XEE A;  3LJN A;  4BET A;  5EIL A;  3ZU7 B;  1OT8 A;  2L6B A;  5HKP A;  2HE0 A;  2J8S D;  3UTM A;  3D9H A;  2FO1 E;  4DX7 D;  5D66 A;  4U96 D;  5ENT D;  3T9K A;  1N11 A;  1K1B A;  3EU9 A;  4F6R D;  4OAU C;  3JXJ A;  1K3Z D;  1WDY A;  2QC9 A;  1IHB A;  5AQA A;  4B93 B;  3DEO A;  2F8X K;  2DZN A;  2AJA A;  1S70 B;  3AAA C;  4HRN A;  5HRY A;  3JUE A;  3V30 A;  4GPM A;  2BKG A;  5ITZ F;  2ZGD A;  2XEH A;  4DX2 A;  5FIN A;  2RFM A;  3W9G A;  2XZT G;  4DX5 D;  4NIK A;  2NYJ A;  4JB8 P;  3HRA A;  4HBD A;  1QYM A;  3J5Q B;  3T8K A;  2A5E A;  5EIB E;  2P2C P;  2Y1L E;  1SW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...