5ENOD

Mbx2319 bound structure of bacterial efflux pump.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
HHHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
total genus 50
structure length 162
sequence length 162
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enoD00
4U95D 4A63B 1G3NB 4LG6A 3HRAA 3JXJA 2BKKB 4U8VD 4RLYA 5ENOD 5FINA 5KWDA 5ENQD 1WG0A 5AQAA 1BU9A 1YMPA 5CEAA 4DX7D 3EU9A 2ETBA 3AAAC 5ENRD 3UXGA 4YDWA 3V2OA 3EHRA 5AQBA 3C5RA 4TUMA 3ZU7B 4GPMA 4OAUC 4HB5A 2HE0A 4HNAD 5AN8A 5AAOA 5AQ9A 3TWRA 3TWTA 3T8KA 4DX1A 2F8XK 3IXEA 4DX2A 3EHQA 2DZNA 4K5CA 2A5EA 4Z68A 1BI7B 3AJIA 3B95A 4HRLA 1MX6A 5EN5D 1BLXB 2V5QC 1AWCB 4F1PA 3TWXA 1D9SA 2QC9A 2QYJA 1SW6A 5ENSD 2BKGA 2JABA 4DX6D 2ZGGA 3V2XA 5BXUA 3V31A 3JUEA 3JXIA 4K5BA 5HS0A 4HQDA 5AQ7A 3UTMA 5CBOA 1WDYA 1IXVA 4F6RD 1N0QA 2ZGDA 2MYOA 1N11A 3J5QB 2ETAA 4BESA 5EIDA 3DEOA 1IKND 1MX2A 4K5AB 5KNGA 4BETA 5CERB 1S70B 2P2CP 3Q9UC 4QQIA 4C48B 3LJNA 4DX5D 5ITZF 2J8SD 2Y1LE 4DUIA 4G8KA 3V30A 5CECB 3KEAA 4QFVA 3ZUVB 5JA4D 5EYPF 4YDYA 1IHBA 2PNNA 4UUCA 5EILA 2DWZA 4BEPA 1A5EA 1K1AA 4HLLA 2F8YA 5CBNA 4O60A 3D9HA 4B93B 1MX4A 4U96D 3W9GA 3TWWA 1OT8A 4O1OA 4O1PA 3V79K 4ATZD 2DVWA 1QYMA 2V4HC 1NFIE 3Q9NC 2RFMA 5ENTD 1MJ0A 1DC2A 4U8YD 1SVXA 5KBAA 5EYLA 4ZHBA 1BI8B 1AP7A 3SO8A 5ENPD 3F6QA 3NBNB 1YCSB 2NYJA 1K3ZD 2B0OE 2L6BA 3J5PA 5AARA 2XEEA 3TWVA 5JMND 1UOHA 5CEDB 2XEHA 4J8YA 4ZFHA 3T9KA 4CZ2D 3B7BA 3TWUA 3ZKJA 2KXPC 4BERA 4G8LA 4CYMD 2RFAA 1BD8A 5D66A 5FIOA 1K1BA 3W9FA 2F37A 5KNHD 3NOCD 2XZDG 2Y0BG 2DZOA 2FO1E 1MYOA 4DRXE 1YYHA 3DEPA 4HBDA 3TWQA 4BSZB 4N5QA 1OY3D 3NOGD 4LSZE 5BXOA 2XENA 2AJAA 4LNUD 1DCQA 5HKPA 2KBXA 4HRNA 4J7WA 1TR4A 3HG0D 3UI2A 5EIBE 4HI9A 3ZNGA 2ETCA 4HI8A 4GMRA 5HRYA 4OAVB 4NIKA 1N0RA 3TWSA 4JB8P 2VGEA 4HRMB 2XZTG
chains in the Genus database with same CATH superfamily
4BTAA 1KT0A 3CHPA 3GW4A 1RW2A 3DXMG 4NURA 3UM2A 4AOFA 2CG2A 3I5PA 3S7FA 2DZNA 1WAO1 1H2TC 2VSXE 2Q7FA 4BT9A 5JHAA 4AEZC 2GGFA 3FH7A 3EJNA 3UIOC 2WM9A 1FCHA 2WXJA 4HOSA 1IKND 2A4ZA 4K5AB 5KNGA 3PNLB 1ELKA 4F1SA 2F8YA 1FT1A 2HR2A 4GMJA 4N2QA 1VDYA 1N4SA 4HLEA 4I9CA 4YDEA 4B0ZA 2P9NG 4N2SA 3QK0A 2R03A 3CQGB 4BY6A 2MOWA 2P9IG 1FT2A 4G8LA 4JHRA 4U0SA 2RFAA 4AY6A 2CHXA 5G05C 2F37A 3ZW3A 4KMOA 3DSXA 2FO1E 2R59A 3ASNE 5T4YA 2V0PA 4N5QA 3UQ3A 5BXOA 2V5FA 4I9EA 4KXKB 2FI7A 4XKCA 5HRYA 2AXVA 4U95D 4A63B 2Y4TA 2BKKB 5LP0A 1WG0A 1BU9A 4IYPA 4HOQA 2VJ8A 2OEVA 4U8HA 3G2WA 1W3BA 2P9PG 1Q2ZA 3CLJA 2VSNA 4H7YA 4HXIA 3U64A 1BLXB 3TAXA 3U9WA 1E7UA 2I1JA 3MZLB 1H6OA 3LY8A 3D9LA 5HS0A 3UTMA 1WDYA 1XNFA 1TJFA 1QNFA 1S70B 2Y1LE 1OWPA 2RKKA 3V30A 4L9PA 2R2LA 3FTVA 5LCWC 4UWFA 4DI3A 2XEVA 2IFUA 2RD0A 2XQ0A 3Q9NC 5KJKA 4C0EA 3PRZA 3S7BA 2LXLA 5EKQD 4J8FA 5EDSA 2X6HA 5FWQA 4ABNA 1KZOA 4M7CA 3B7BA 2WXIA 3EIJA 2H6IA 1IHGA 3L08A 2OOEA 1QBQA 2XZDG 1HZ4A 4XI0A 2WXNA 5BT1A 4LNGA 4CT4A 3JYSA 4TRQA 4JD2G 4Q96A 3UT4A 3SGHA 4N3BA 1G3NB 3B7RL 2VSOE 4BX9A 3LY7A 4ACLA 2VGXB 2VTBB 3FUEA 2OCCE 5D2MC 3FUIA 4K5CA 4GA1A 4M3OA 3VLDA 4KVMA 4CT0A 1YA0A 1AWCB 3VTYA 2QC9A 2QYJA 3G2SA 2ZGGA 5AQ7A 5CBOA 3D9JA 3EDTB 1JWFA 3LDZA 4LCTA 3MCXA 5CECB 3HVEA 4APOA 4FJYA 4BEPA 4CEMA 3APDA 3JCKC 4CGVA 4GYWA 1MJ0A 1DC2A 3KEZA 4TXPA 4RVBA 4EZLA 5JHBA 5G55A 3PZDA 5CRUA 3LYAA 4CZ2D 4GZ6A 4FA6A 4P29A 1O1SA 2LXMA 4EZJA 3S7JA 2FBNA 3ESLA 1EPUA 3HXFA 4U0ZA 5FTPA 2C0MA 5KNHD 2EILE 4GA2A 1KPSB 2Y3AA 2IQCA 3CR3A 4LNUD 4JXTA 3N71A 1H19A 4GMRA 4UQYA 1FVFA 1Z5SC 1N0RA 4GTPA 3BU8A 4H7XA 5ENOD 5AQAA 1P5QA 2KCVA 3ZU7B 1H6PA 2OV8A 3IHVA 3EHQA 2MHKA 1UN9A 1PY1A 2P9KG 3UX4A 1JWGA 2UWJG 5EN5D 3S2AA 4GMLA 4N39A 2BKGA 4FHJA 1IYGA 3BUAA 4JZYA 1NA3A 3ONKA 4FADA 4OVVA 3Q9UC 2J8SD 1Y8MA 3FUKA 1X5BA 2GRQB 2PNNA 4UUCA 3ZYLA 4GYOA 5LOZA 1Z3YA 5AIJA 3QB2A 3Q5MA 3D9MA 5CEDB 3MKQA 4EBAA 3FU5A 4GCNA 1OWMA 5B3SE 5D66A 3SFYA 3CHQA 3NB2A 4J8DA 5FZRA 1MYOA 1YYHA 3IKOB 3ABLE 3EIQC 1OCOE 2OVBA 4UWGA 3ESKA 3PUJA 5A23A 3C98A 2XRZA 2XGMA 2CG3A 4NIKA 5BNWA 4EHMA 3K9IA 3JXJA 3FU3A 5ENQD 1HFAA 1UJJA 1HXIA 4UWHA 4BFRA 3C5RA 1KT1A 4PS8A 1SA5A 4G25A 1LD8A 1N54A 2WVIA 3GZ1A 3UPVA 1OXJA 4A1GA 4N3AA 4I2WA 3FTUA 4RSYA 1TNUA 4KZCA 1L5JA 3Q75A 3UUXA 4ANWA 1TJCA 2X38A 2UY1A 2QFCA 3PDNA 2HO1A 1OCZE 4JEHA 5A7DB 4KZ0A 1K1AA 3CVYA 2IF4A 4O1PA 1IQUA 3L82A 1TNZA 3FTXA 4FU3A 3PNTB 1BI8B 4YVOA 4JHKA 3D9KA 2VSYA 2L0IA 2E2EA 2WXRA 4YVQC 2NC9A 3CKCA 2WXHA 2PM6A 4A3VA 3SNXA 2AXUA 3MEKA 3TG4A 2H6HA 3ZEFA 5AJLA 4XX5A 2PM7A 3PE3A 2XPZA 3E37A 3ZPJA 3PZ1A 3AU5A 3CVLA 3R9AB 3G2UA 3RO2A 4HRMB 1HE8A 4A1SA 3CKBA 2A5UA 3ML8A 4YDWA 3PZ2A 2WXMA 2PL2A 4GZCA 5FZSA 3LJ3A 3ULEG 4Z68A 3APFA 5DIZA 5A6CA 1SA4A 3UKUG 4I6EA 4CDMA 3D9OA 3Q47B 3RRUA 2DCPA 5FT9A 3V2XA 4K5BA 3OAWA 1JPLA 5IY5E 3CVPA 4V3IA 3RAUA 5DBKA 1JCRA 2DWZA 3Q7FA 3FUDA 1TEZA 3SFZA 3ZHEA 4B8AA 3RU0A 2V4HC 5AYWD 3SBSA 2BF0X 3MA5A 2WQ7A 3NBNB 3QC1A 2XEEA 5JMND 1NA0A 3FUHA 3UM1A 3ZN3A 4TV3A 3U4TA 4BERA 3MV2B 4JL0A 4Y6WA 2LSVA 1UN8A 1E90A 1NI1A 4B94A 4HBDA 3DEPA 5E76A 4UWKA 3TWQA 1OY3D 2R05A 2XENA 1EDUA 1TR4A 3ASOE 2GRLA 3VLFA 4U8VD 4RLYA 2X6IA 3G2TA 3ZXPA 4WNFA 3PH0C 4U63A 3SY2A 4GPMA 2I6HA 4JVSA 5AN8A 1X81A 5C2YA 2CFUA 5JJTA 4JW1A 4K0RA 3AJIA 3D9NA 4HRLA 4J8EA 4IULA 3C3RA 3DXKG 1JCSA 1UW4B 1B89A 2VYIA 4DLOA 4ILGA 1SZAA 2EIME 3LY9A 3ZXSA 2J49A 4EZKA 4Q94A 4WNDA 1S64A 3LVRE 3PE4A 3ASHA 4BTBA 2XHEA 1E96B 3AG3E 4HVBA 4L7TA 4GTSA 4AJWA 3MJWA 2P9LG 1H2VC 3T8MA 1JUQA 4GZDA 3UIPC 1OWNA 4EQFA 3R7QA 3L54A 3FHEA 4EECA 4GTRA 4WAFA 4JC8A 3MV3B 1BPOA 3HVEB 4GTMA 2WXGA 2VQ2A 1EYHA 3D9IA 3DSUA 4PDXA 5J90A 3CK7A 2L9BA 2X6KA 1N4PA 2I2OA 3C3OA 1E8XA 3AAAC 3S7DA 3ULYA 4OAUC 4AVXA 4HNAD 3TWTA 2A5EA 3T5VA 4L23A 3EUVA 3UT7A 4UQZA 1MX6A 1FPPA 3Q7AA 3ZIMA 1U3DA 2QZAA 2Y69E 3Q49B 3TG5A 2PQNA 2AVPA 2LAIA 3QWVA 1N94A 1N0QA 3D9PA 2H6FA 4UI9J 3KSQA 1HF8A 4N3CA 5J08A 4XKBA 3TGOA 1MX2A 5CERB 2PQRA 4PUCA 3QJZA 4DJAA 3DWLG 3JQ0A 1K8KG 3B13A 3B7SA 3RIBA 1MHQA 2J07A 4ATZD 4U07A 5G04J 1AP7A 1EF1C 2L6BA 2LNIA 3TWVA 3FWVA 1HU3A 4ZFHA 3DRAA 4J8SA 1DVPA 3DSTA 2F0YA 5B1AE 4GTTA 2Y0BG 2DZOA 2R17C 2CFZA 4WWOA 3D3MA 3GZ2A 3TL5A 3AG1E 4LSZE 4MBGA 1PAQA 3FEXA 3ZRHA 3KS2A 4WWPA 2XZTG 2YINA 4G11A 4CGWA 1HG2A 3E32A 4LERA 5JJ7A 2FO7A 4NRHB 2Y4UA 4HB5A 4KT6B 2QYUA 5AQ9A 3MKQB 3DSVA 3B95A 3I4RB 4HFGA 4NQ0A 4F53A 5ENSD 1N4RA 1PC2A 2I1KA 3CHRA 4BESA 2H6GA 4AIFA 3L17A 3QAQA 3JUIA 4C48B 3LJNA 2HM8A 2BUGA 3OXLA 4R7LA 3HXEA 3KEAA 5BV1A 1TN8A 3ABKE 4LUNU 5T3RA 4GAAA 3W9GA 4O1OA 5FJYA 3LS8A 2V4LA 5ENTD 1Y6IA 1V54E 1OWLA 4G26A 2IU1A 3DPYA 2P9UG 2KM4A 3C72A 2RG8A 4FHKA 2WMNA 3T9KA 5H7PA 3FUJA 4IN3B 2IJGX 3W9FA 4LRZA 1TNBA 2WXPA 3SQVA 4FC8A 2WXFA 2UY1B 2KC7A 3TJPA 3C3QA 4ILIA 2ETCA 4GZ5A 4RQIA 3VTXA 3ZYKA 3QDNA 5D0OD 2YHCA 3Q73A 3QOUA 5FINA 3PZ3A 4LEUA 4C0MA 3L6AA 3Q78A 5T8IA 2HE0A 3O48A 2GROB 3HXDA 3PZ4A 3BEEA 3IEGA 4G24A 5CRVA 3WXXA 3TWXA 1H6KA 3RRNB 3L13A 3RO3A 2B6CA 1TN7A 2WQHA 3AS4A 1INZA 1LF8A 3OXFA 1DCEA 2ETAA 3HXCA 4A55A 4BETA 2X6JA 3LCAA 1OCCE 3EHMA 3IV0A 5E75A 4RG9A 4EPZA 2IONA 3LPZA 5CMWA 1KLXA 2BTDA 4G1TA 3G2VA 3ULQA 2XS8A 3F6QA 1YCSB 3EHNA 1K3ZD 4I2ZA 3ENEA 2C2LA 3KSLA 1O1RA 2NSZA 1ZB1A 4NACA 4WNGA 3ZKJA 1BD8A 2AW6A 3E30A 2I9CA 3FUMA 4DRXE 2VGYA 3HG0D 4EBAG 2X6FA 4ACKA 4LNBA 3ZHEB 2YQ8A 2IOSA 3HXBA 4LG6A 3FU0A 5HQ8A 3SF4A 4UI9C 1YMPA 4HORA 4DX7D 1UG3A 3EU5A 5EX3A 4I6JA 4TUUA 4XI9A 3UM0A 1D8EA 2ZISA 3FTWA 5G04C 5ARFA 3LVQE 5FZQA 4Y6CA 4L2LA 2MYOA 1N11A 2J4DA 3P2BA 2P2CP 5ANLA 4ANXA 2L0TB 4CDNA 4E6HA 3CQCB 4ME2A 1NP7A 2X3MA 4YDOA 3RSEG 3DBSA 5EYLA 1HG5A 3B7UX 3HIZA 3CEQA 5ENNA 2XCCA 3RRMB 4FLHA 5ANRA 4WNEA 2OVFA 4OYSA 2IOLA 2E0IA 2IEJA 1HO8A 1E7VA 1Z3XA 3SZ7A 3U66A 5C1DA 3L16A 3BG0B 2WXLA 2KBXA 3FH8A 3GYZA 3UI2A 3U3WA 1TNOA 4HI8A 4OAVB 5JJ6A 3Q79A 3TWSA 4XE0A 3E34A 4GZ3A 4AXHA 1N95A 4GCOA 1HH8A 5FQ4A 3ONLA 4N5CA 4XEIG 5M72A 3DSWA 3T8KA 4FLBA 3IXEA 4JA9A 1SQMA 1BI7B 4L2YA 3KAEA 4AV7A 4C9BB 2V5QC 4GU5A 5LX8A 4GTOA 3QARA 4F1PA 3HDXA 3JQ1A 5KJNA 2FEZA 3JXIA 4HQDA 1UJKA 2ZGDA 4TXQA 2DIWA 4FJZA 3CVVA 4DX5D 3L9TA 3ML9A 1KZPA 4U0UA 5EYPF 5JA4D 3CVXA 1IHBA 4KBQA 1HS6A 1RZ4A 2KZTA 2XGOA 3FU6A 3BQOA 3ASGA 1OT8A 3SD5A 5KJMA 2RFMA 4HOUA 4U8YD 4YNDA 1S0PA 4G23A 4TXRA 2NYJA 3CIAA 3QNKA 3FUFA 3R7RA 5AENA 2J4BA 2JLBA 1MQSA 2XEHA 4J8YA 3TWUA 3CV0A 2KXPC 4HS2A 2XRYA 5D0QD 3ZYMA 2HYZA 5FIOA 2EIJE 3CHOA 4I1AA 3CVUA 3ASDA 5CMYA 3NOGD 3PVLA 5HKPA 2NXPA 3RKVA 4HI9A 3ZNGA 2PZIA 1OCRE 3CK8A 3HHMA 1E8WA 2ZIRA 1O1TA 1QZ2A 4PH4B 3Q4AB 4A3TA 2F8XK 3UKRG 3NAWA 3HYMB 3CHSA 3ABME 3KD7A 4BX8A 3FULA 5FQ7A 2GRRB 3PEUB 4Q69A 1D9SA 3UMVA 2J9QA 4J6IA 5ARGA 3MGBA 3JUEA 5FQ6A 2KATA 3RK6A 2YHEA 2L6JA 5EIDA 3DEOA 4ATGA 5HI7A 5ITZF 4JPSA 2P9SG 4MS6A 3SHFA 1Z6TA 4YDYA 5CBNA 3NZUA 4GPKA 4B93B 1WM5A 1HX8A 3TWWA 1TNYA 2IY0C 3UM3A 1TYQG 5KBAA 1SVXA 4XIFA 4GTQA 3WG7E 3T5XA 2WQ6A 3ZGQA 2CHZA 4CRWA 4DPRA 5AARA 4IRUA 4GTVA 4APFA 3DPDA 3AG2E 2MRIA 3FP3A 4AP2A 1WY6A 2DYSE 2ZXWE 2XGSA 3Q15A 3I3NA 3ISMC 3PS6A 4HRNA 5KJLA 4JB8P 2EQXA 2LO6A 2ONDA 4RG6A 3AU4A 4E85A 4ANVA 3PEVB 1E8YA 2GRNB 3NZSA 3EU9A 3NQPA 1H2UA 2ETBA 5BW8C 3MX3A 5ENRD 3V2OA 1LTXA 4TUMA 2OEWA 3ZYQA 4JHJA 1IQRA 5AJDA 3SI5A 2FULA 3TWRA 5AAOA 4DX2A 2R5SA 3IHYA 5B1BE 2P58C 4AM9A 5BPPA 3L22A 2QY7A 1SW6A 4K03A 4BT8A 2EINE 3FTSA 2XPYA 3AS8A 4GA0A 4BWRA 3CGHA 5G2NA 4BSXA 3QWPA 4G8KA 4QFVA 3MKRA 3AG4E 3BG1B 5EILA 3FEYA 2XPIA 4JEUA 3GZSA 4KYOB 4JA7A 3D9HA 2GRPB 4U96D 3LEWA 3IBEA 1QYMA 4G2VA 1NFIE 3FTZA 4I1MA 1N4QA 4DLQA 1XGWA 4PS3A 4ZHBA 1E8ZA 2VGXA 4GYYA 2VTBA 3ASFA 2AWIA 1UOHA 3FFLA 4O6FA 4MLPA 1JCQA 4I17A 3SBTB 4I1OB 2BEDA 4MRUA 3ZVVA 5CCMA 4WUYA 3LKUA 4URKA 2V8SE 4J0UA 4ILHB 3CVQA 1ELWA 5EIBE 4F7AA 2VGEA 1DNPA 5KWDA 3I4GA 3FDHA 3TXMA 3CSTA 4FULA 3URZA 2ILRA 1U3CA 1GW6A 3UXGA 4W9RA 4F3VA 5G05J 3P1UA 3QKYA 5EX0A 5BUZA 3NF1A 4X8QA 3E4BA 2IO3C 5FQ8A 3FTYA 2LAHA 2KCLA 1OWOA 2JABA 3OTNA 5BXUA 2GW1A 3SFXA 3V31A 4AY5A 3J5QB 5CHEE 2XS1A 1MZCA 4DUIA 3QWWA 4KVOA 2WPVA 2KCKA 1A5EA 4O60A 3OXGA 1MX4A 3CSFA 4CDRA 4HOTA 4PS7A 4DI4A 2WXQA 1LD7A 3ZFWA 5BV0A 2C0LA 1OUVA 3CHMA 3UINC 2B0OE 3J5PA 2LSUA 3R9MA 3CVNA 2XCBA 3E33A 3B7TA 2YNQA 4CYMD 5LCWJ 2R02A 1O5MA 4I43A 4MKTA 3NOCD 1ZU2A 4FP7A 2J09A 4I6GA 4OVUA 2AJAA 1DCQA 1V55E 3VLEA 4GB9A 3FUNA 4U7EB 3MYVA 1H0AA 3HRAA 5CEAA 2M63A 3EHRA 5AQBA 5CCLA 3O4ZA 4WWNA 3DSSA 4DX1A 1ZBPA 1U2VG 4XZ4A 1QQEA 1S63A 2WB2A 4UI9K 4U04A 2WMOA 2WXOA 2DYRE 4DX6D 4CCAA 2CHWA 1IXVA 1D8DA 4F6RD 2DBAA 2J08A 3X2QE 3FH5A 1N52A 2AXZA 4QQIA 2EIKE 3AS5A 3ZUVB 1SZ9A 2JEKA 4HLLA 3LXUX 4L1BA 3FY4A 4B8CB 1NZNA 3TXNA 3V79K 2DVWA 3PREA 3SO8A 4ANUA 5ENPD 3PUKA 3APCA 1A17A 1ELRA 1N9AA 3RJVA 2ZU6B 4UQXA 2GRMA 1K1BA 5LFAA 1FVHA 4DK5A 3UT8A 1TN6A 4BSZB 4D10C 5KCMA 3CK9A 2LUHA 1NL4A 2IO2C 4B89A 4UWLA 2WXKA 4J7WA 3CVWA 2KZTB 2FF4A
chains in the Genus database with same CATH topology
4U95D 4A63B 1G3NB 4LG6A 3HRAA 3JXJA 2BKKB 4U8VD 4RLYA 5ENOD 5FINA 5KWDA 5ENQD 1WG0A 5AQAA 1BU9A 1YMPA 5CEAA 4DX7D 3EU9A 2ETBA 3AAAC 5ENRD 3UXGA 4YDWA 3V2OA 3EHRA 5AQBA 3C5RA 4TUMA 3ZU7B 4GPMA 4OAUC 4HB5A 2HE0A 4HNAD 5AN8A 5AAOA 5AQ9A 3TWRA 3TWTA 3T8KA 4DX1A 2F8XK 3IXEA 4DX2A 3EHQA 2DZNA 4K5CA 2A5EA 4Z68A 1BI7B 3AJIA 3B95A 4HRLA 1MX6A 5EN5D 1BLXB 2V5QC 1AWCB 4F1PA 3TWXA 1D9SA 2QC9A 2QYJA 1SW6A 5ENSD 2BKGA 2JABA 4DX6D 2ZGGA 3V2XA 5BXUA 3V31A 3JUEA 3JXIA 4K5BA 5HS0A 4HQDA 5AQ7A 3UTMA 5CBOA 1WDYA 1IXVA 4F6RD 1N0QA 2ZGDA 2MYOA 1N11A 3J5QB 2ETAA 4BESA 5EIDA 3DEOA 1IKND 1MX2A 4K5AB 5KNGA 4BETA 5CERB 1S70B 2P2CP 3Q9UC 4QQIA 4C48B 3LJNA 4DX5D 5ITZF 2J8SD 2Y1LE 4DUIA 4G8KA 3V30A 5CECB 3KEAA 4QFVA 3ZUVB 5JA4D 5EYPF 4YDYA 1IHBA 2PNNA 4UUCA 5EILA 2DWZA 4BEPA 1A5EA 1K1AA 4HLLA 2F8YA 5CBNA 4O60A 3D9HA 4B93B 1MX4A 4U96D 3W9GA 3TWWA 1OT8A 4O1OA 4O1PA 3V79K 4ATZD 2DVWA 1QYMA 2V4HC 1NFIE 3Q9NC 2RFMA 5ENTD 1MJ0A 1DC2A 4U8YD 1SVXA 5KBAA 5EYLA 4ZHBA 1BI8B 1AP7A 3SO8A 5ENPD 3F6QA 3NBNB 1YCSB 2NYJA 1K3ZD 2B0OE 2L6BA 3J5PA 5AARA 2XEEA 3TWVA 5JMND 1UOHA 5CEDB 2XEHA 4J8YA 4ZFHA 3T9KA 4CZ2D 3B7BA 3TWUA 3ZKJA 2KXPC 4BERA 4G8LA 4CYMD 2RFAA 1BD8A 5D66A 5FIOA 1K1BA 3W9FA 2F37A 5KNHD 3NOCD 2XZDG 2Y0BG 2DZOA 2FO1E 1MYOA 4DRXE 1YYHA 3DEPA 4HBDA 3TWQA 4BSZB 4N5QA 1OY3D 3NOGD 4LSZE 5BXOA 2XENA 2AJAA 4LNUD 1DCQA 5HKPA 2KBXA 4HRNA 4J7WA 1TR4A 3HG0D 3UI2A 5EIBE 4HI9A 3ZNGA 2ETCA 4HI8A 4GMRA 5HRYA 4OAVB 4NIKA 1N0RA 3TWSA 4JB8P 2VGEA 4HRMB 2XZTG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U95 D;  4A63 B;  1G3N B;  4LG6 A;  3HRA A;  3JXJ A;  2BKK B;  4U8V D;  4RLY A;  5ENO D;  5FIN A;  5KWD A;  5ENQ D;  1WG0 A;  5AQA A;  1BU9 A;  1YMP A;  5CEA A;  4DX7 D;  3EU9 A;  2ETB A;  3AAA C;  5ENR D;  3UXG A;  4YDW A;  3V2O A;  3EHR A;  5AQB A;  3C5R A;  4TUM A;  3ZU7 B;  4GPM A;  4OAU C;  4HB5 A;  2HE0 A;  4HNA D;  5AN8 A;  5AAO A;  5AQ9 A;  3TWR A;  3TWT A;  3T8K A;  4DX1 A;  2F8X K;  3IXE A;  4DX2 A;  3EHQ A;  2DZN A;  4K5C A;  2A5E A;  4Z68 A;  1BI7 B;  3AJI A;  3B95 A;  4HRL A;  1MX6 A;  5EN5 D;  1BLX B;  2V5Q C;  1AWC B;  4F1P A;  3TWX A;  1D9S A;  2QC9 A;  2QYJ A;  1SW6 A;  5ENS D;  2BKG A;  2JAB A;  4DX6 D;  2ZGG A;  3V2X A;  5BXU A;  3V31 A;  3JUE A;  3JXI A;  4K5B A;  5HS0 A;  4HQD A;  5AQ7 A;  3UTM A;  5CBO A;  1WDY A;  1IXV A;  4F6R D;  1N0Q A;  2ZGD A;  2MYO A;  1N11 A;  3J5Q B;  2ETA A;  4BES A;  5EID A;  3DEO A;  1IKN D;  1MX2 A;  4K5A B;  5KNG A;  4BET A;  5CER B;  1S70 B;  2P2C P;  3Q9U C;  4QQI A;  4C48 B;  3LJN A;  4DX5 D;  5ITZ F;  2J8S D;  2Y1L E;  4DUI A;  4G8K A;  3V30 A;  5CEC B;  3KEA A;  4QFV A;  3ZUV B;  5JA4 D;  5EYP F;  4YDY A;  1IHB A;  2PNN A;  4UUC A;  5EIL A;  2DWZ A;  4BEP A;  1A5E A;  1K1A A;  4HLL A;  2F8Y A;  5CBN A;  4O60 A;  3D9H A;  4B93 B;  1MX4 A;  4U96 D;  3W9G A;  3TWW A;  1OT8 A;  4O1O A;  4O1P A;  3V79 K;  4ATZ D;  2DVW A;  1QYM A;  2V4H C;  1NFI E;  3Q9N C;  2RFM A;  5ENT D;  1MJ0 A;  1DC2 A;  4U8Y D;  1SVX A;  5KBA A;  5EYL A;  4ZHB A;  1BI8 B;  1AP7 A;  3SO8 A;  5ENP D;  3F6Q A;  3NBN B;  1YCS B;  2NYJ A;  1K3Z D;  2B0O E;  2L6B A;  3J5P A;  5AAR A;  2XEE A;  3TWV A;  5JMN D;  1UOH A;  5CED B;  2XEH A;  4J8Y A;  4ZFH A;  3T9K A;  4CZ2 D;  3B7B A;  3TWU A;  3ZKJ A;  2KXP C;  4BER A;  4G8L A;  4CYM D;  2RFA A;  1BD8 A;  5D66 A;  5FIO A;  1K1B A;  3W9F A;  2F37 A;  5KNH D;  3NOC D;  2XZD G;  2Y0B G;  2DZO A;  2FO1 E;  1MYO A;  4DRX E;  1YYH A;  3DEP A;  4HBD A;  3TWQ A;  4BSZ B;  4N5Q A;  1OY3 D;  3NOG D;  4LSZ E;  5BXO A;  2XEN A;  2AJA A;  4LNU D;  1DCQ A;  5HKP A;  2KBX A;  4HRN A;  4J7W A;  1TR4 A;  3HG0 D;  3UI2 A;  5EIB E;  4HI9 A;  3ZNG A;  2ETC A;  4HI8 A;  4GMR A;  5HRY A;  4OAV B;  4NIK A;  1N0R A;  3TWS A;  4JB8 P;  2VGE A;  4HRM B;  2XZT G; 
#chains in the Genus database with same CATH topology
 4BTA A;  1KT0 A;  3CHP A;  3GW4 A;  1RW2 A;  3DXM G;  4NUR A;  3UM2 A;  4AOF A;  2CG2 A;  3I5P A;  3S7F A;  2DZN A;  1WAO 1;  1H2T C;  2VSX E;  2Q7F A;  4BT9 A;  5JHA A;  4AEZ C;  2GGF A;  3FH7 A;  3EJN A;  3UIO C;  2WM9 A;  1FCH A;  2WXJ A;  4HOS A;  1IKN D;  2A4Z A;  4K5A B;  5KNG A;  3PNL B;  1ELK A;  4F1S A;  2F8Y A;  1FT1 A;  2HR2 A;  4GMJ A;  4N2Q A;  1VDY A;  1N4S A;  4HLE A;  4I9C A;  4YDE A;  4B0Z A;  2P9N G;  4N2S A;  3QK0 A;  2R03 A;  3CQG B;  4BY6 A;  2MOW A;  2P9I G;  1FT2 A;  4G8L A;  4JHR A;  4U0S A;  2RFA A;  4AY6 A;  2CHX A;  5G05 C;  2F37 A;  3ZW3 A;  4KMO A;  3DSX A;  2FO1 E;  2R59 A;  3ASN E;  5T4Y A;  2V0P A;  4N5Q A;  3UQ3 A;  5BXO A;  2V5F A;  4I9E A;  4KXK B;  2FI7 A;  4XKC A;  5HRY A;  2AXV A;  4U95 D;  4A63 B;  2Y4T A;  2BKK B;  5LP0 A;  1WG0 A;  1BU9 A;  4IYP A;  4HOQ A;  2VJ8 A;  2OEV A;  4U8H A;  3G2W A;  1W3B A;  2P9P G;  1Q2Z A;  3CLJ A;  2VSN A;  4H7Y A;  4HXI A;  3U64 A;  1BLX B;  3TAX A;  3U9W A;  1E7U A;  2I1J A;  3MZL B;  1H6O A;  3LY8 A;  3D9L A;  5HS0 A;  3UTM A;  1WDY A;  1XNF A;  1TJF A;  1QNF A;  1S70 B;  2Y1L E;  1OWP A;  2RKK A;  3V30 A;  4L9P A;  2R2L A;  3FTV A;  5LCW C;  4UWF A;  4DI3 A;  2XEV A;  2IFU A;  2RD0 A;  2XQ0 A;  3Q9N C;  5KJK A;  4C0E A;  3PRZ A;  3S7B A;  2LXL A;  5EKQ D;  4J8F A;  5EDS A;  2X6H A;  5FWQ A;  4ABN A;  1KZO A;  4M7C A;  3B7B A;  2WXI A;  3EIJ A;  2H6I A;  1IHG A;  3L08 A;  2OOE A;  1QBQ A;  2XZD G;  1HZ4 A;  4XI0 A;  2WXN A;  5BT1 A;  4LNG A;  4CT4 A;  3JYS A;  4TRQ A;  4JD2 G;  4Q96 A;  3UT4 A;  3SGH A;  4N3B A;  1G3N B;  3B7R L;  2VSO E;  4BX9 A;  3LY7 A;  4ACL A;  2VGX B;  2VTB B;  3FUE A;  2OCC E;  5D2M C;  3FUI A;  4K5C A;  4GA1 A;  4M3O A;  3VLD A;  4KVM A;  4CT0 A;  1YA0 A;  1AWC B;  3VTY A;  2QC9 A;  2QYJ A;  3G2S A;  2ZGG A;  5AQ7 A;  5CBO A;  3D9J A;  3EDT B;  1JWF A;  3LDZ A;  4LCT A;  3MCX A;  5CEC B;  3HVE A;  4APO A;  4FJY A;  4BEP A;  4CEM A;  3APD A;  3JCK C;  4CGV A;  4GYW A;  1MJ0 A;  1DC2 A;  3KEZ A;  4TXP A;  4RVB A;  4EZL A;  5JHB A;  5G55 A;  3PZD A;  5CRU A;  3LYA A;  4CZ2 D;  4GZ6 A;  4FA6 A;  4P29 A;  1O1S A;  2LXM A;  4EZJ A;  3S7J A;  2FBN A;  3ESL A;  1EPU A;  3HXF A;  4U0Z A;  5FTP A;  2C0M A;  5KNH D;  2EIL E;  4GA2 A;  1KPS B;  2Y3A A;  2IQC A;  3CR3 A;  4LNU D;  4JXT A;  3N71 A;  1H19 A;  4GMR A;  4UQY A;  1FVF A;  1Z5S C;  1N0R A;  4GTP A;  3BU8 A;  4H7X A;  5ENO D;  5AQA A;  1P5Q A;  2KCV A;  3ZU7 B;  1H6P A;  2OV8 A;  3IHV A;  3EHQ A;  2MHK A;  1UN9 A;  1PY1 A;  2P9K G;  3UX4 A;  1JWG A;  2UWJ G;  5EN5 D;  3S2A A;  4GML A;  4N39 A;  2BKG A;  4FHJ A;  1IYG A;  3BUA A;  4JZY A;  1NA3 A;  3ONK A;  4FAD A;  4OVV A;  3Q9U C;  2J8S D;  1Y8M A;  3FUK A;  1X5B A;  2GRQ B;  2PNN A;  4UUC A;  3ZYL A;  4GYO A;  5LOZ A;  1Z3Y A;  5AIJ A;  3QB2 A;  3Q5M A;  3D9M A;  5CED B;  3MKQ A;  4EBA A;  3FU5 A;  4GCN A;  1OWM A;  5B3S E;  5D66 A;  3SFY A;  3CHQ A;  3NB2 A;  4J8D A;  5FZR A;  1MYO A;  1YYH A;  3IKO B;  3ABL E;  3EIQ C;  1OCO E;  2OVB A;  4UWG A;  3ESK A;  3PUJ A;  5A23 A;  3C98 A;  2XRZ A;  2XGM A;  2CG3 A;  4NIK A;  5BNW A;  4EHM A;  3K9I A;  3JXJ A;  3FU3 A;  5ENQ D;  1HFA A;  1UJJ A;  1HXI A;  4UWH A;  4BFR A;  3C5R A;  1KT1 A;  4PS8 A;  1SA5 A;  4G25 A;  1LD8 A;  1N54 A;  2WVI A;  3GZ1 A;  3UPV A;  1OXJ A;  4A1G A;  4N3A A;  4I2W A;  3FTU A;  4RSY A;  1TNU A;  4KZC A;  1L5J A;  3Q75 A;  3UUX A;  4ANW A;  1TJC A;  2X38 A;  2UY1 A;  2QFC A;  3PDN A;  2HO1 A;  1OCZ E;  4JEH A;  5A7D B;  4KZ0 A;  1K1A A;  3CVY A;  2IF4 A;  4O1P A;  1IQU A;  3L82 A;  1TNZ A;  3FTX A;  4FU3 A;  3PNT B;  1BI8 B;  4YVO A;  4JHK A;  3D9K A;  2VSY A;  2L0I A;  2E2E A;  2WXR A;  4YVQ C;  2NC9 A;  3CKC A;  2WXH A;  2PM6 A;  4A3V A;  3SNX A;  2AXU A;  3MEK A;  3TG4 A;  2H6H A;  3ZEF A;  5AJL A;  4XX5 A;  2PM7 A;  3PE3 A;  2XPZ A;  3E37 A;  3ZPJ A;  3PZ1 A;  3AU5 A;  3CVL A;  3R9A B;  3G2U A;  3RO2 A;  4HRM B;  1HE8 A;  4A1S A;  3CKB A;  2A5U A;  3ML8 A;  4YDW A;  3PZ2 A;  2WXM A;  2PL2 A;  4GZC A;  5FZS A;  3LJ3 A;  3ULE G;  4Z68 A;  3APF A;  5DIZ A;  5A6C A;  1SA4 A;  3UKU G;  4I6E A;  4CDM A;  3D9O A;  3Q47 B;  3RRU A;  2DCP A;  5FT9 A;  3V2X A;  4K5B A;  3OAW A;  1JPL A;  5IY5 E;  3CVP A;  4V3I A;  3RAU A;  5DBK A;  1JCR A;  2DWZ A;  3Q7F A;  3FUD A;  1TEZ A;  3SFZ A;  3ZHE A;  4B8A A;  3RU0 A;  2V4H C;  5AYW D;  3SBS A;  2BF0 X;  3MA5 A;  2WQ7 A;  3NBN B;  3QC1 A;  2XEE A;  5JMN D;  1NA0 A;  3FUH A;  3UM1 A;  3ZN3 A;  4TV3 A;  3U4T A;  4BER A;  3MV2 B;  4JL0 A;  4Y6W A;  2LSV A;  1UN8 A;  1E90 A;  1NI1 A;  4B94 A;  4HBD A;  3DEP A;  5E76 A;  4UWK A;  3TWQ A;  1OY3 D;  2R05 A;  2XEN A;  1EDU A;  1TR4 A;  3ASO E;  2GRL A;  3VLF A;  4U8V D;  4RLY A;  2X6I A;  3G2T A;  3ZXP A;  4WNF A;  3PH0 C;  4U63 A;  3SY2 A;  4GPM A;  2I6H A;  4JVS A;  5AN8 A;  1X81 A;  5C2Y A;  2CFU A;  5JJT A;  4JW1 A;  4K0R A;  3AJI A;  3D9N A;  4HRL A;  4J8E A;  4IUL A;  3C3R A;  3DXK G;  1JCS A;  1UW4 B;  1B89 A;  2VYI A;  4DLO A;  4ILG A;  1SZA A;  2EIM E;  3LY9 A;  3ZXS A;  2J49 A;  4EZK A;  4Q94 A;  4WND A;  1S64 A;  3LVR E;  3PE4 A;  3ASH A;  4BTB A;  2XHE A;  1E96 B;  3AG3 E;  4HVB A;  4L7T A;  4GTS A;  4AJW A;  3MJW A;  2P9L G;  1H2V C;  3T8M A;  1JUQ A;  4GZD A;  3UIP C;  1OWN A;  4EQF A;  3R7Q A;  3L54 A;  3FHE A;  4EEC A;  4GTR A;  4WAF A;  4JC8 A;  3MV3 B;  1BPO A;  3HVE B;  4GTM A;  2WXG A;  2VQ2 A;  1EYH A;  3D9I A;  3DSU A;  4PDX A;  5J90 A;  3CK7 A;  2L9B A;  2X6K A;  1N4P A;  2I2O A;  3C3O A;  1E8X A;  3AAA C;  3S7D A;  3ULY A;  4OAU C;  4AVX A;  4HNA D;  3TWT A;  2A5E A;  3T5V A;  4L23 A;  3EUV A;  3UT7 A;  4UQZ A;  1MX6 A;  1FPP A;  3Q7A A;  3ZIM A;  1U3D A;  2QZA A;  2Y69 E;  3Q49 B;  3TG5 A;  2PQN A;  2AVP A;  2LAI A;  3QWV A;  1N94 A;  1N0Q A;  3D9P A;  2H6F A;  4UI9 J;  3KSQ A;  1HF8 A;  4N3C A;  5J08 A;  4XKB A;  3TGO A;  1MX2 A;  5CER B;  2PQR A;  4PUC A;  3QJZ A;  4DJA A;  3DWL G;  3JQ0 A;  1K8K G;  3B13 A;  3B7S A;  3RIB A;  1MHQ A;  2J07 A;  4ATZ D;  4U07 A;  5G04 J;  1AP7 A;  1EF1 C;  2L6B A;  2LNI A;  3TWV A;  3FWV A;  1HU3 A;  4ZFH A;  3DRA A;  4J8S A;  1DVP A;  3DST A;  2F0Y A;  5B1A E;  4GTT A;  2Y0B G;  2DZO A;  2R17 C;  2CFZ A;  4WWO A;  3D3M A;  3GZ2 A;  3TL5 A;  3AG1 E;  4LSZ E;  4MBG A;  1PAQ A;  3FEX A;  3ZRH A;  3KS2 A;  4WWP A;  2XZT G;  2YIN A;  4G11 A;  4CGW A;  1HG2 A;  3E32 A;  4LER A;  5JJ7 A;  2FO7 A;  4NRH B;  2Y4U A;  4HB5 A;  4KT6 B;  2QYU A;  5AQ9 A;  3MKQ B;  3DSV A;  3B95 A;  3I4R B;  4HFG A;  4NQ0 A;  4F53 A;  5ENS D;  1N4R A;  1PC2 A;  2I1K A;  3CHR A;  4BES A;  2H6G A;  4AIF A;  3L17 A;  3QAQ A;  3JUI A;  4C48 B;  3LJN A;  2HM8 A;  2BUG A;  3OXL A;  4R7L A;  3HXE A;  3KEA A;  5BV1 A;  1TN8 A;  3ABK E;  4LUN U;  5T3R A;  4GAA A;  3W9G A;  4O1O A;  5FJY A;  3LS8 A;  2V4L A;  5ENT D;  1Y6I A;  1V54 E;  1OWL A;  4G26 A;  2IU1 A;  3DPY A;  2P9U G;  2KM4 A;  3C72 A;  2RG8 A;  4FHK A;  2WMN A;  3T9K A;  5H7P A;  3FUJ A;  4IN3 B;  2IJG X;  3W9F A;  4LRZ A;  1TNB A;  2WXP A;  3SQV A;  4FC8 A;  2WXF A;  2UY1 B;  2KC7 A;  3TJP A;  3C3Q A;  4ILI A;  2ETC A;  4GZ5 A;  4RQI A;  3VTX A;  3ZYK A;  3QDN A;  5D0O D;  2YHC A;  3Q73 A;  3QOU A;  5FIN A;  3PZ3 A;  4LEU A;  4C0M A;  3L6A A;  3Q78 A;  5T8I A;  2HE0 A;  3O48 A;  2GRO B;  3HXD A;  3PZ4 A;  3BEE A;  3IEG A;  4G24 A;  5CRV A;  3WXX A;  3TWX A;  1H6K A;  3RRN B;  3L13 A;  3RO3 A;  2B6C A;  1TN7 A;  2WQH A;  3AS4 A;  1INZ A;  1LF8 A;  3OXF A;  1DCE A;  2ETA A;  3HXC A;  4A55 A;  4BET A;  2X6J A;  3LCA A;  1OCC E;  3EHM A;  3IV0 A;  5E75 A;  4RG9 A;  4EPZ A;  2ION A;  3LPZ A;  5CMW A;  1KLX A;  2BTD A;  4G1T A;  3G2V A;  3ULQ A;  2XS8 A;  3F6Q A;  1YCS B;  3EHN A;  1K3Z D;  4I2Z A;  3ENE A;  2C2L A;  3KSL A;  1O1R A;  2NSZ A;  1ZB1 A;  4NAC A;  4WNG A;  3ZKJ A;  1BD8 A;  2AW6 A;  3E30 A;  2I9C A;  3FUM A;  4DRX E;  2VGY A;  3HG0 D;  4EBA G;  2X6F A;  4ACK A;  4LNB A;  3ZHE B;  2YQ8 A;  2IOS A;  3HXB A;  4LG6 A;  3FU0 A;  5HQ8 A;  3SF4 A;  4UI9 C;  1YMP A;  4HOR A;  4DX7 D;  1UG3 A;  3EU5 A;  5EX3 A;  4I6J A;  4TUU A;  4XI9 A;  3UM0 A;  1D8E A;  2ZIS A;  3FTW A;  5G04 C;  5ARF A;  3LVQ E;  5FZQ A;  4Y6C A;  4L2L A;  2MYO A;  1N11 A;  2J4D A;  3P2B A;  2P2C P;  5ANL A;  4ANX A;  2L0T B;  4CDN A;  4E6H A;  3CQC B;  4ME2 A;  1NP7 A;  2X3M A;  4YDO A;  3RSE G;  3DBS A;  5EYL A;  1HG5 A;  3B7U X;  3HIZ A;  3CEQ A;  5ENN A;  2XCC A;  3RRM B;  4FLH A;  5ANR A;  4WNE A;  2OVF A;  4OYS A;  2IOL A;  2E0I A;  2IEJ A;  1HO8 A;  1E7V A;  1Z3X A;  3SZ7 A;  3U66 A;  5C1D A;  3L16 A;  3BG0 B;  2WXL A;  2KBX A;  3FH8 A;  3GYZ A;  3UI2 A;  3U3W A;  1TNO A;  4HI8 A;  4OAV B;  5JJ6 A;  3Q79 A;  3TWS A;  4XE0 A;  3E34 A;  4GZ3 A;  4AXH A;  1N95 A;  4GCO A;  1HH8 A;  5FQ4 A;  3ONL A;  4N5C A;  4XEI G;  5M72 A;  3DSW A;  3T8K A;  4FLB A;  3IXE A;  4JA9 A;  1SQM A;  1BI7 B;  4L2Y A;  3KAE A;  4AV7 A;  4C9B B;  2V5Q C;  4GU5 A;  5LX8 A;  4GTO A;  3QAR A;  4F1P A;  3HDX A;  3JQ1 A;  5KJN A;  2FEZ A;  3JXI A;  4HQD A;  1UJK A;  2ZGD A;  4TXQ A;  2DIW A;  4FJZ A;  3CVV A;  4DX5 D;  3L9T A;  3ML9 A;  1KZP A;  4U0U A;  5EYP F;  5JA4 D;  3CVX A;  1IHB A;  4KBQ A;  1HS6 A;  1RZ4 A;  2KZT A;  2XGO A;  3FU6 A;  3BQO A;  3ASG A;  1OT8 A;  3SD5 A;  5KJM A;  2RFM A;  4HOU A;  4U8Y D;  4YND A;  1S0P A;  4G23 A;  4TXR A;  2NYJ A;  3CIA A;  3QNK A;  3FUF A;  3R7R A;  5AEN A;  2J4B A;  2JLB A;  1MQS A;  2XEH A;  4J8Y A;  3TWU A;  3CV0 A;  2KXP C;  4HS2 A;  2XRY A;  5D0Q D;  3ZYM A;  2HYZ A;  5FIO A;  2EIJ E;  3CHO A;  4I1A A;  3CVU A;  3ASD A;  5CMY A;  3NOG D;  3PVL A;  5HKP A;  2NXP A;  3RKV A;  4HI9 A;  3ZNG A;  2PZI A;  1OCR E;  3CK8 A;  3HHM A;  1E8W A;  2ZIR A;  1O1T A;  1QZ2 A;  4PH4 B;  3Q4A B;  4A3T A;  2F8X K;  3UKR G;  3NAW A;  3HYM B;  3CHS A;  3ABM E;  3KD7 A;  4BX8 A;  3FUL A;  5FQ7 A;  2GRR B;  3PEU B;  4Q69 A;  1D9S A;  3UMV A;  2J9Q A;  4J6I A;  5ARG A;  3MGB A;  3JUE A;  5FQ6 A;  2KAT A;  3RK6 A;  2YHE A;  2L6J A;  5EID A;  3DEO A;  4ATG A;  5HI7 A;  5ITZ F;  4JPS A;  2P9S G;  4MS6 A;  3SHF A;  1Z6T A;  4YDY A;  5CBN A;  3NZU A;  4GPK A;  4B93 B;  1WM5 A;  1HX8 A;  3TWW A;  1TNY A;  2IY0 C;  3UM3 A;  1TYQ G;  5KBA A;  1SVX A;  4XIF A;  4GTQ A;  3WG7 E;  3T5X A;  2WQ6 A;  3ZGQ A;  2CHZ A;  4CRW A;  4DPR A;  5AAR A;  4IRU A;  4GTV A;  4APF A;  3DPD A;  3AG2 E;  2MRI A;  3FP3 A;  4AP2 A;  1WY6 A;  2DYS E;  2ZXW E;  2XGS A;  3Q15 A;  3I3N A;  3ISM C;  3PS6 A;  4HRN A;  5KJL A;  4JB8 P;  2EQX A;  2LO6 A;  2OND A;  4RG6 A;  3AU4 A;  4E85 A;  4ANV A;  3PEV B;  1E8Y A;  2GRN B;  3NZS A;  3EU9 A;  3NQP A;  1H2U A;  2ETB A;  5BW8 C;  3MX3 A;  5ENR D;  3V2O A;  1LTX A;  4TUM A;  2OEW A;  3ZYQ A;  4JHJ A;  1IQR A;  5AJD A;  3SI5 A;  2FUL A;  3TWR A;  5AAO A;  4DX2 A;  2R5S A;  3IHY A;  5B1B E;  2P58 C;  4AM9 A;  5BPP A;  3L22 A;  2QY7 A;  1SW6 A;  4K03 A;  4BT8 A;  2EIN E;  3FTS A;  2XPY A;  3AS8 A;  4GA0 A;  4BWR A;  3CGH A;  5G2N A;  4BSX A;  3QWP A;  4G8K A;  4QFV A;  3MKR A;  3AG4 E;  3BG1 B;  5EIL A;  3FEY A;  2XPI A;  4JEU A;  3GZS A;  4KYO B;  4JA7 A;  3D9H A;  2GRP B;  4U96 D;  3LEW A;  3IBE A;  1QYM A;  4G2V A;  1NFI E;  3FTZ A;  4I1M A;  1N4Q A;  4DLQ A;  1XGW A;  4PS3 A;  4ZHB A;  1E8Z A;  2VGX A;  4GYY A;  2VTB A;  3ASF A;  2AWI A;  1UOH A;  3FFL A;  4O6F A;  4MLP A;  1JCQ A;  4I17 A;  3SBT B;  4I1O B;  2BED A;  4MRU A;  3ZVV A;  5CCM A;  4WUY A;  3LKU A;  4URK A;  2V8S E;  4J0U A;  4ILH B;  3CVQ A;  1ELW A;  5EIB E;  4F7A A;  2VGE A;  1DNP A;  5KWD A;  3I4G A;  3FDH A;  3TXM A;  3CST A;  4FUL A;  3URZ A;  2ILR A;  1U3C A;  1GW6 A;  3UXG A;  4W9R A;  4F3V A;  5G05 J;  3P1U A;  3QKY A;  5EX0 A;  5BUZ A;  3NF1 A;  4X8Q A;  3E4B A;  2IO3 C;  5FQ8 A;  3FTY A;  2LAH A;  2KCL A;  1OWO A;  2JAB A;  3OTN A;  5BXU A;  2GW1 A;  3SFX A;  3V31 A;  4AY5 A;  3J5Q B;  5CHE E;  2XS1 A;  1MZC A;  4DUI A;  3QWW A;  4KVO A;  2WPV A;  2KCK A;  1A5E A;  4O60 A;  3OXG A;  1MX4 A;  3CSF A;  4CDR A;  4HOT A;  4PS7 A;  4DI4 A;  2WXQ A;  1LD7 A;  3ZFW A;  5BV0 A;  2C0L A;  1OUV A;  3CHM A;  3UIN C;  2B0O E;  3J5P A;  2LSU A;  3R9M A;  3CVN A;  2XCB A;  3E33 A;  3B7T A;  2YNQ A;  4CYM D;  5LCW J;  2R02 A;  1O5M A;  4I43 A;  4MKT A;  3NOC D;  1ZU2 A;  4FP7 A;  2J09 A;  4I6G A;  4OVU A;  2AJA A;  1DCQ A;  1V55 E;  3VLE A;  4GB9 A;  3FUN A;  4U7E B;  3MYV A;  1H0A A;  3HRA A;  5CEA A;  2M63 A;  3EHR A;  5AQB A;  5CCL A;  3O4Z A;  4WWN A;  3DSS A;  4DX1 A;  1ZBP A;  1U2V G;  4XZ4 A;  1QQE A;  1S63 A;  2WB2 A;  4UI9 K;  4U04 A;  2WMO A;  2WXO A;  2DYR E;  4DX6 D;  4CCA A;  2CHW A;  1IXV A;  1D8D A;  4F6R D;  2DBA A;  2J08 A;  3X2Q E;  3FH5 A;  1N52 A;  2AXZ A;  4QQI A;  2EIK E;  3AS5 A;  3ZUV B;  1SZ9 A;  2JEK A;  4HLL A;  3LXU X;  4L1B A;  3FY4 A;  4B8C B;  1NZN A;  3TXN A;  3V79 K;  2DVW A;  3PRE A;  3SO8 A;  4ANU A;  5ENP D;  3PUK A;  3APC A;  1A17 A;  1ELR A;  1N9A A;  3RJV A;  2ZU6 B;  4UQX A;  2GRM A;  1K1B A;  5LFA A;  1FVH A;  4DK5 A;  3UT8 A;  1TN6 A;  4BSZ B;  4D10 C;  5KCM A;  3CK9 A;  2LUH A;  1NL4 A;  2IO2 C;  4B89 A;  4UWL A;  2WXK A;  4J7W A;  3CVW A;  2KZT B;  2FF4 A; 
#chains in the Genus database with same CATH homology
 4U95 D;  4A63 B;  1G3N B;  4LG6 A;  3HRA A;  3JXJ A;  2BKK B;  4U8V D;  4RLY A;  5ENO D;  5FIN A;  5KWD A;  5ENQ D;  1WG0 A;  5AQA A;  1BU9 A;  1YMP A;  5CEA A;  4DX7 D;  3EU9 A;  2ETB A;  3AAA C;  5ENR D;  3UXG A;  4YDW A;  3V2O A;  3EHR A;  5AQB A;  3C5R A;  4TUM A;  3ZU7 B;  4GPM A;  4OAU C;  4HB5 A;  2HE0 A;  4HNA D;  5AN8 A;  5AAO A;  5AQ9 A;  3TWR A;  3TWT A;  3T8K A;  4DX1 A;  2F8X K;  3IXE A;  4DX2 A;  3EHQ A;  2DZN A;  4K5C A;  2A5E A;  4Z68 A;  1BI7 B;  3AJI A;  3B95 A;  4HRL A;  1MX6 A;  5EN5 D;  1BLX B;  2V5Q C;  1AWC B;  4F1P A;  3TWX A;  1D9S A;  2QC9 A;  2QYJ A;  1SW6 A;  5ENS D;  2BKG A;  2JAB A;  4DX6 D;  2ZGG A;  3V2X A;  5BXU A;  3V31 A;  3JUE A;  3JXI A;  4K5B A;  5HS0 A;  4HQD A;  5AQ7 A;  3UTM A;  5CBO A;  1WDY A;  1IXV A;  4F6R D;  1N0Q A;  2ZGD A;  2MYO A;  1N11 A;  3J5Q B;  2ETA A;  4BES A;  5EID A;  3DEO A;  1IKN D;  1MX2 A;  4K5A B;  5KNG A;  4BET A;  5CER B;  1S70 B;  2P2C P;  3Q9U C;  4QQI A;  4C48 B;  3LJN A;  4DX5 D;  5ITZ F;  2J8S D;  2Y1L E;  4DUI A;  4G8K A;  3V30 A;  5CEC B;  3KEA A;  4QFV A;  3ZUV B;  5JA4 D;  5EYP F;  4YDY A;  1IHB A;  2PNN A;  4UUC A;  5EIL A;  2DWZ A;  4BEP A;  1A5E A;  1K1A A;  4HLL A;  2F8Y A;  5CBN A;  4O60 A;  3D9H A;  4B93 B;  1MX4 A;  4U96 D;  3W9G A;  3TWW A;  1OT8 A;  4O1O A;  4O1P A;  3V79 K;  4ATZ D;  2DVW A;  1QYM A;  2V4H C;  1NFI E;  3Q9N C;  2RFM A;  5ENT D;  1MJ0 A;  1DC2 A;  4U8Y D;  1SVX A;  5KBA A;  5EYL A;  4ZHB A;  1BI8 B;  1AP7 A;  3SO8 A;  5ENP D;  3F6Q A;  3NBN B;  1YCS B;  2NYJ A;  1K3Z D;  2B0O E;  2L6B A;  3J5P A;  5AAR A;  2XEE A;  3TWV A;  5JMN D;  1UOH A;  5CED B;  2XEH A;  4J8Y A;  4ZFH A;  3T9K A;  4CZ2 D;  3B7B A;  3TWU A;  3ZKJ A;  2KXP C;  4BER A;  4G8L A;  4CYM D;  2RFA A;  1BD8 A;  5D66 A;  5FIO A;  1K1B A;  3W9F A;  2F37 A;  5KNH D;  3NOC D;  2XZD G;  2Y0B G;  2DZO A;  2FO1 E;  1MYO A;  4DRX E;  1YYH A;  3DEP A;  4HBD A;  3TWQ A;  4BSZ B;  4N5Q A;  1OY3 D;  3NOG D;  4LSZ E;  5BXO A;  2XEN A;  2AJA A;  4LNU D;  1DCQ A;  5HKP A;  2KBX A;  4HRN A;  4J7W A;  1TR4 A;  3HG0 D;  3UI2 A;  5EIB E;  4HI9 A;  3ZNG A;  2ETC A;  4HI8 A;  4GMR A;  5HRY A;  4OAV B;  4NIK A;  1N0R A;  3TWS A;  4JB8 P;  2VGE A;  4HRM B;  2XZT G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...