2HYZA

Crystal structure of an 8 repeat consensus tpr superhelix (orthorombic crystal form)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
136
structure length
136
Chain Sequence
AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and stability of designed TPR protein superhelices: unusual crystal packing and implications for natural TPR proteins.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords SYNTHETIC CONSENSUS TPR PROTEIN
total genus 56
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2006-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2hyzA00
4NQ0A 2FO7A 4GA1A 4ME2A 3QDNA 1A17A 2JLBA 5CCMA 2L6JA 4IN3B 3RO3A 2HO1A 2J9QA 2KC7A 3CVLA 3ZN3A 4HOSA 1NZNA 2Q7FA 3FFLA 3TGOA 5JJ7A 1E96B 3URZA 3ZHEB 3AS4A 3CKCA 3ASDA 4G1TA 4GYYA 3OXGA 4NRHB 5DBKA 5G05J 3ZGQA 1NA0A 3JYSA 2UY1B 4H7XA 1KT1A 3FWVA 4RG9A 2FEZA 2IF4A 3LKUA 5EKQD 3ASFA 3LY7A 3QWPA 5G04J 3VTXA 3RKVA 1ELWA 2Y4TA 3LYAA 4GZ6A 2VYIA 4UI9C 5G05C 2XCCA 2LSUA 3MA5A 5CHEE 4Y6WA 3S7BA 3ULQA 4CGWA 3KD7A 2KCVA 3RIBA 3CVQA 4YVOA 1W3BA 2YQ8A 5EX3A 4BTBA 3CK9A 2DBAA 4Y6CA 5FJYA 5BT1A 4WNFA 4J8DA 3VTYA 1YA0A 4G24A 3QKYA 4AIFA 4U0ZA 4U04A 3GYZA 4H7YA 4N2SA 4GA0A 4N3CA 4KXKB 3OXFA 4BT9A 5FZRA 4I2ZA 4WUYA 4YNDA 5LCWC 1HH8A 3CV0A 1KT0A 3PE3A 2FF4A 2I6HA 2Y4UA 3CK8A 2VQ2A 3OXLA 4G25A 2VSYA 3ASHA 2R5SA 3RU0A 4G23A 1KLXA 3ZHEA 4N3AA 3S7JA 5A6CA 5FZSA 4GPKA 2XCBA 3Q49B 4O6FA 4WNEA 3R9AB 5LCWJ 1ZBPA 4GYOA 5HI7A 4I9CA 4G2VA 5ARFA 3HYMB 5KJLA 5KJNA 3CKBA 3QOUA 4GZ3A 4YVQC 4XI9A 4UI9J 2FI7A 3FP3A 1P5QA 2LNIA 4AY5A 4N3BA 1OUVA 4I17A 2HYZA 2E2EA 3Q5MA 4N39A 5D0QD 2V5FA 2IFUA 3TG4A 4GA2A 3MV2B 4ABNA 4GCNA 2QFCA 1ELRA 4JHRA 4U0SA 3Q47B 5CCLA 5FT9A 5JJ6A 5ARGA 1NA3A 2C2LA 2VSNA 3ASGA 4I1AA 4B94A 5BNWA 3BEEA 4CDRA 2BUGA 2FBNA 4N5CA 4A1SA 3GZ1A 3CEQA 3RJVA 3MKRA 4JL0A 3AS8A 2UWJG 3GZ2A 4HORA 2VGXB 4KBQA 3ESKA 5JJTA 1QZ2A 4W9RA 2C0MA 5KJMA 3KS2A 4HOTA 2WPVA 1TJCA 2XEVA 3TAXA 4N2QA 2XGOA 2YHCA 4GYWA 4U0UA 4EQFA 3ZFWA 3SF4A 2PZIA 4U07A 1IYGA 3SZ7A 1PC2A 5C1DA 4G26A 4AM9A 4BWRA 3PE4A 2XGSA 4J8EA 4RG6A 3QWWA 3S7FA 3WXXA 3Q15A 2KCLA 3LY9A 3QWVA 4BT8A 3UPVA 1IHGA 4APOA 4UQXA 3UQ3A 2KCKA 5A7DB 3UUXA 3ZPJA 5EX0A 4CGVA 4WNGA 5KJKA 5DIZA 2KATA 3IEGA 2LSVA 4UI9K 2P58C 4HOQA 3CVNA 4LEUA 4AY6A 1XNFA 4KYOB 3MV3B 2WQHA 5BW8C 3LPZA 5AYWD 1Y8MA 3EDTB 2PQNA 2UY1A 3PDNA 3RO2A 1WAO1 2NC9A 3CVPA 3S7DA 2XPIA 2AVPA 3K9IA 3MEKA 2XGMA 2OOEA 1HZ4A 2GW1A 2PQRA 1ZU2A 3AS5A 4I9EA 5G04C 1FCHA 4UQZA 3LCAA 3E4BA 2C0LA 3CK7A 3NF1A 2VGYA 4JA7A 5D0OD 2VGXA 3U3WA 4JA9A 3O48A 3Q4AB 4UQYA 4J8FA 4GCOA 3LY8A 1WM5A 4J0UA 4XI0A 4I2WA 4WNDA 3GW4A 4XIFA 3U4TA 2MHKA 3TG5A 4BTAA 2ONDA 5HQ8A 4HOUA 1QQEA 4GZ5A 5M72A 2HR2A 3KAEA 5FZQA 2PL2A 4F3VA 5FTPA 1HXIA 1B89A 3N71A
chains in the Genus database with same CATH superfamily
2FO7A 3QDNA 1N4SA 3RO3A 1BD8A 1UW4B 5LOZA 4FU3A 3AS4A 3OXGA 1SQMA 4GTOA 3CSTA 3QWPA 3LYAA 4U8YD 3CGHA 4CT4A 3DEOA 3BU8A 1JPLA 4KVMA 1YA0A 4AIFA 4U0ZA 2JEKA 2A5EA 3QB2A 4GZDA 3HXEA 2QYJA 4G25A 2VQ2A 5LCWJ 3BUAA 1WDYA 4QQIA 3D9JA 3D9IA 2E2EA 3TG4A 4JPSA 1TN7A 5FT9A 4I1AA 5FIOA 3KEAA 3AS8A 3KSLA 4GYWA 2XHEA 4TUMA 4LUNU 2V8SE 5AAOA 2ZU6B 3GZSA 4BSXA 3ML9A 1PY1A 2BKKB 2GRRB 2NC9A 3NOCD 4U8VD 2OOEA 2DWZA 1UOHA 2H6GA 2C0LA 3FUJA 3C98A 1LF8A 4JEHA 3BQOA 2OVBA 3T8MA 1NL4A 3EIJA 2Y3AA 4XKCA 1OY3D 1SZ9A 3O4ZA 1N0QA 3CKCA 4GYYA 1SA4A 1HE8A 1NI1A 5CMWA 5AQ7A 4TV3A 3TXNA 3FTXA 3CQGB 3B95A 5BT1A 4WNFA 4DI4A 4ILHB 3I4GA 3UKRG 1NFIE 3OXFA 4BT9A 3TWTA 3ABLE 3HXBA 3ZHEA 1Y6IA 4GPKA 4D10C 3FTUA 5ARFA 5IY5E 3DWLG 1K3ZD 4GA2A 1SA5A 4U0SA 5ARGA 4O60A 2WMNA 4L7TA 4LG6A 4A1SA 1INZA 4KZ0A 2DIWA 4U96D 2XQ0A 2WPVA 1WY6A 2XGOA 4K03A 4RG6A 2RFMA 4L23A 2QYUA 3UQ3A 2LSVA 4RVBA 3FTWA 2CHXA 4F1SA 3D9NA 4GMLA 2XEEA 4Q96A 3AS5A 4EHMA 1OXJA 3LJNA 3PZ1A 1EF1C 2VGEA 3FDHA 3CVUA 1DCQA 5AQ9A 4J0UA 3C3OA 2E0IA 3IKOB 2KC7A 4CRWA 1IHBA 3MKQA 2Q7FA 4RLYA 3W9FA 2J49A 5AN8A 4I1OB 1BPOA 3Q7FA 1UN8A 3EHNA 1NA0A 4XX5A 3DPDA 3SFZA 4XKBA 3G2SA 4MRUA 4K0RA 4U8HA 5G2NA 4I43A 3UI2A 3DSTA 5FQ7A 3ZXPA 4GTMA 2DYRE 5LX8A 1FPPA 3PRZA 4JZYA 1OWOA 2DCPA 4FHJA 5B1AE 3HXDA 1ZBPA 2RKKA 4U7EB 5KJNA 4I6JA 4UI9J 5HRYA 1H2TC 3B13A 5CCLA 3L17A 1VDYA 4W9RA 4C0MA 1HO8A 4V3IA 4F1PA 5EYLA 4BETA 3JXIA 5A7DB 2LAIA 2EIME 3JCKC 5DIZA 5CEDB 2P9LG 2WQHA 4GMJA 4ANVA 5FQ6A 1U3DA 2GRQB 3PH0C 2WXMA 4JA9A 1DCEA 3FU0A 2QZAA 4ZFHA 3U4TA 4U63A 3FY4A 5HQ8A 3C3RA 4JL0A 2I1JA 4CCAA 2L6JA 4L9PA 4HOSA 3TWVA 3SY2A 3HG0D 2EINE 2GGFA 3ASDA 4G1TA 5G05J 4H7XA 2VTBA 3FH7A 4RG9A 3LY7A 4HVBA 2L6BA 2VYIA 4ATZD 5CHEE 4KZCA 3DSVA 1D9SA 4A3TA 1EDUA 3LS8A 3PVLA 4EBAA 4GA0A 3PE3A 1DVPA 1AP7A 2AJAA 1HFAA 4ZHBA 5FZSA 1O5MA 4I9CA 5KJLA 4DRXE 4XI9A 1BU9A 2R59A 4UWLA 4ABNA 3FTZA 4GCNA 3SGHA 1X5BA 2XS1A 1MX4A 5AENA 2BTDA 1QZ2A 2OEWA 2V4HC 1IYGA 1S63A 3QWWA 3WXXA 3LY9A 4PH4B 3CHRA 4ANUA 3CVNA 3B7SA 5JMND 3K9IA 4I9EA 3QARA 3TL5A 2WMOA 2WXJA 3HXCA 3NF1A 3TWWA 3TWXA 3KEZA 1MJ0A 2WQ6A 4XI0A 3TG5A 3VLDA 1E8YA 4JHJA 4DUIA 1E8ZA 3NB2A 4NRHB 3ZIMA 3VTXA 5G04J 3Q7AA 5BXUA 4FP7A 3FUKA 2IEJA 2XCCA 2X6IA 4M3OA 5E75A 1UG3A 2YQ8A 3FU5A 2MRIA 3DSXA 4Y6CA 4MLPA 5FJYA 4ACKA 4LNUD 1IQUA 1JWGA 2GRMA 4N2SA 2ETCA 2VSXE 3AG4E 4HFGA 4YNDA 5HKPA 5JHAA 1KZOA 4P29A 3QOUA 3PZ4A 3JUIA 3C72A 3MZLB 4J6IA 1NA3A 2WXOA 2AWIA 2F0YA 2LAHA 3ESKA 5ENNA 4HS2A 3SZ7A 1OWMA 3FUIA 2X6HA 4BSZB 4UWHA 1MZCA 2ILRA 2ZGDA 5BW8C 3CVPA 2XPIA 3JQ1A 1U2VG 2V4LA 3LVQE 3UX4A 3ZW3A 4DJAA 2VGXA 1TNYA 3U3WA 3O48A 3Q4AB 4J8FA 3LY8A 4HOUA 4NIKA 4TXPA 4AXHA 1HXIA 3PREA 4WWPA 3E30A 2V5QC 4O1PA 4IN3B 3ZVVA 2ETBA 1NZNA 3DSUA 4UWKA 3CVXA 3DBSA 1L5JA 3FHEA 3ASFA 3UT8A 2Y4TA 2JABA 3MA5A 3KD7A 2KCVA 2I2OA 3PNTB 5ENTD 1BLXB 2FULA 3HHMA 1N11A 3ZXSA 2LO6A 3L82A 4L1BA 3GYZA 4HRMB 3NBNB 3CIAA 3FEYA 2LXMA 3ASHA 3RU0A 2ZIRA 4WWNA 1SVXA 4O6FA 2IO3C 4GYOA 3FP3A 1D8DA 3L54A 4AJWA 1ELRA 5BNWA 4B94A 2VSNA 4B93B 1O1TA 2FBNA 3GZ2A 5JJTA 4HOTA 1V55E 3FULA 2PZIA 3NZUA 2IOSA 2WXLA 3RRNB 2P9SG 3HVEB 5J08A 4KYOB 2UY1A 5FINA 2AVPA 2AXZA 4I6EA 3MEKA 5ITZF 4G11A 2RG8A 2VSOE 3HXFA 5G04C 3G2WA 4HNAD 4UQZA 5BV0A 5AQBA 2GRPB 2CHWA 4GZ5A 2A5UA 5KBAA 2IO2C 5ANLA 3U64A 2JLBA 3IBEA 3QAQA 4GZCA 3CVLA 3E33A 4K5AB 4FHKA 3TGOA 2XZTG 4UWFA 3Q73A 3FWVA 5EN5D 4EZKA 3S7BA 1N4QA 5BUZA 4HXIA 3QNKA 3CK9A 4B0ZA 1ELKA 4J8DA 4CZ2D 4TXQA 1FT1A 2XENA 3L6AA 2CG2A 3UM1A 1OCOE 3UM0A 3EU5A 4C0EA 3MYVA 3C3QA 5ENOD 1QYMA 3L22A 3QC1A 3AU4A 5KCMA 2QFCA 3Q78A 1BI8B 2H6IA 1DNPA 3LDZA 2XPZA 2YHCA 2FO1E 1IKND 1PC2A 5ENSD 3PE4A 3RRMB 1H6KA 3JQ0A 4E85A 4FLBA 3MCXA 3UUXA 1N54A 2P58C 4AY6A 1XNFA 3Q9UC 2ZXWE 3EDTB 4BX8A 4FADA 4OVVA 1WAO1 5CMYA 3L9TA 5JHBA 4YDWA 3CSFA 2WXKA 5EIBE 4JA7A 4HLEA 1IQRA 5B3SE 3HIZA 5FZQA 4F3VA 2WXRA 5CCMA 2VTBB 3PEVB 1EPUA 4ANXA 2X6KA 3W9GA 2YNQA 1WG0A 3Q75A 3CVQA 4APFA 1EYHA 2XPYA 2KZTB 3B7UX 3E32A 4BFRA 3TWSA 4N3CA 1Z6TA 5CERB 5LCWC 3CV0A 3DSWA 2Y4UA 3CK8A 3ASOE 5A6CA 3AG2E 1TNOA 3TJPA 3SBTB 3HYMB 4L2LA 5ENPD 3V30A 3V2OA 5JJ6A 3UKUG 2GROB 4J7WA 2H6HA 2CFUA 3DXMG 2UWJG 4G8LA 5FWQA 5E76A 2ETAA 3CVWA 2XEHA 1N9AA 1HF8A 4HLLA 4AM9A 2ZISA 3QWVA 2X6JA 4BESA 1OWNA 2AW6A 5EX0A 4R7LA 2P9IG 4L2YA 5AYWD 1HG2A 3ZYKA 5H7PA 1Z3XA 1HG5A 3APCA 3OAWA 1FT2A 2H6FA 2HR2A 3LVRE 3B7BA 2P2CP 3EHQA 3ASNE 1QBQA 3ZN3A 2WB2A 1KPSB 1N4RA 3NZSA 5JJ7A 1S70B 2F8YA 3URZA 1O1SA 3T8KA 2FEZA 2EIJE 3B7RL 4UI9C 4B8AA 2BF0X 4BX9A 1K8KG 3IV0A 5EX3A 3ONLA 1G3NB 1TR4A 1MHQA 3R7QA 4F6RD 4N39A 3PZ2A 2I6HA 2MYOA 4LCTA 1E90A 3FH5A 5ENRD 2HE0A 2XCBA 2WXQA 2LXLA 4PS8A 5CRVA 4LRZA 2DYSE 2LNIA 1OUVA 3TAXA 5T4YA 3E37A 5EIDA 5CRUA 4WAFA 3I3NA 2BUGA 4FULA 4F7AA 2F37A 5KJMA 4PS7A 3JUEA 4U0UA 2WQ7A 1E7VA 4YDYA 4U07A 5C1DA 3Q15A 4BT8A 5KWDA 2WXPA 2J07A 3C5RA 2PQNA 2OVFA 5CBOA 3RO2A 1AWCB 1TN8A 3TXMA 3SI5A 4AEZC 3LCAA 3E4BA 4NURA 5FQ4A 4A1GA 3CHSA 4GCOA 3V2XA 3HDXA 4J8YA 2MHKA 5M72A 1JWFA 3V79K 4KMOA 5CECB 3BG0B 3ZNGA 3ZHEB 3V31A 4PS3A 3CQCB 3P2BA 5D66A 1D8EA 2IF4A 4Y6WA 4HRNA 3RIBA 2WXFA 1LTXA 4DLQA 1E7UA 3G2TA 3E34A 3QKYA 2OEVA 4U04A 4H7YA 1N0RA 2XS8A 3FUNA 1N52A 3PZ3A 4AOFA 2VSYA 1S64A 4U95D 3NQPA 3Q49B 5HI7A 4G2VA 2FI7A 3L13A 2R03A 5D0QD 2IFUA 3EJNA 3MV2B 3JXJA 1H19A 2X38A 3KSQA 1RZ4A 4BEPA 2M63A 1NP7A 4XE0A 4DX6D 1PAQA 1JCQA 2IQCA 3ISMC 3EU9A 3SNXA 3SFXA 3FTVA 5BPPA 3CVVA 3ZYLA 3SBSA 4OVUA 4C9BB 3D9OA 3D9LA 3APDA 1SZAA 2P9KG 2WVIA 3PEUB 3PUJA 2Y0BG 4C48B 1JUQA 5G55A 3CHQA 3FUFA 3KAEA 5FTPA 3DRAA 5HS0A 4CT0A 3FFLA 4CDMA 4CEMA 4ANWA 5T3RA 4YDEA 4RSYA 3CHOA 4BERA 2NXPA 1SW6A 4DX7D 2J09A 5EILA 3T5VA 2DBAA 3G2UA 3U9WA 3D9KA 5ANRA 2BEDA 1X81A 4GU5A 1DC2A 4DLOA 3MJWA 3S7JA 4YDOA 4GB9A 2Y1LE 4BY6A 4IRUA 3S2AA 4AY5A 4XEIG 2I9CA 1LD8A 3FEXA 1TNUA 3UTMA 3RRUA 3RJVA 3LXUX 2J4DA 2C0MA 3D9MA 4JEUA 4MS6A 2KBXA 3EUVA 3ULEG 4N2QA 2WXNA 1KZPA 3UMVA 3PNLB 2L0IA 3ABKE 3MV3B 4EPZA 3NAWA 2QY7A 3AG1E 3R7RA 1HX8A 2X3MA 4IYPA 3FUMA 1FCHA 1H2VC 5BV1A 3J5PA 2VGYA 3T9KA 5D0OD 4O1OA 3DXKG 4EZLA 4GPMA 4WNDA 4HRLA 1QQEA 3FU3A 4ME2A 4K5BA 2HM8A 4GTVA 1N4PA 4ATGA 2HO1A 2J9QA 2PNNA 2AXVA 2EILE 1E96B 1QNFA 1HS6A 3DEPA 3D3MA 2LSUA 4I1MA 2CHZA 2J08A 4JC8A 5AJDA 1S0PA 3BG1B 4LSZE 4J8SA 5AARA 2CG3A 2V0PA 4I2ZA 1ZB1A 2P9NG 3I5PA 3CHPA 3OXLA 4G23A 1KLXA 1GW6A 2OV8A 4WNEA 3UM2A 3CKBA 1XGWA 4OAVB 3U66A 1JCRA 3Q47B 3L16A 4CDRA 2XRYA 3CEQA 1K1AA 2DVWA 4JB8P 3AU5A 2F8XK 2A4ZA 2CFZA 3LEWA 4E6HA 4Q69A 3UXGA 2LUHA 4PUCA 2RFAA 1IHGA 4ILGA 4UQXA 5ENQD 1K1BA 5KJKA 3IEGA 2GRLA 5CEAA 1FVHA 1N95A 1Z3YA 4HI9A 3LPZA 3TWQA 3QJZA 2R17C 2QC9A 3ZYMA 3FTSA 2XGMA 4OYSA 1HZ4A 5AJLA 1O1RA 1OCRE 3SHFA 4UQYA 3P1UA 3AG3E 3VLFA 4A3VA 2XZDG 4GTTA 4BTAA 2ONDA 5JA4D 1OCZE 3ZKJA 3CHMA 4LNBA 4A55A 5KNGA 1HU3A 3ULYA 3J5QB 2MOWA 3ZGQA 2YINA 3JYSA 3LKUA 1OT8A 5G05C 4GTPA 4MBGA 3X2QE 3G2VA 1MX6A 4YVOA 1W3BA 4EECA 4CYMD 2BKGA 3AJIA 4JD2G 4G24A 3AAAC 5FZRA 5BXOA 4B8CB 5J90A 4Q94A 3RAUA 4FJYA 2NSZA 5AIJA 2HYZA 3I4RB 3ASGA 3MGBA 1TNBA 3ESLA 2Y69E 4B89A 2X6FA 4EQFA 1MQSA 4OAUC 4GAAA 3Q79A 1MX2A 4ILIA 4I6GA 3S7FA 2KCLA 1A5EA 3UIOC 4HOQA 3L08A 3HRAA 4ACLA 1Y8MA 3CR3A 2PQRA 2GW1A 5C2YA 3RK6A 2ZGGA 3ZEFA 1U3CA 3CLJA 4QFVA 4GTQA 4M7CA 2L9BA 2P9PG 3N71A 3OTNA 4DPRA 1A17A 4G8KA 4A63B 4AVXA 1E8WA 4AV7A 1KT1A 5D2MC 4CGWA 4AP2A 2IOLA 4GMRA 2IY0C 5A23A 3ZUVB 5KNHD 4FA6A 3UINC 1KT0A 4UUCA 2FF4A 4N3AA 4DX2A 2WXHA 1N94A 2OCCE 1Q2ZA 2V5FA 4JHRA 4TRQA 1MYOA 2C2LA 5T8IA 2IONA 3BEEA 4XZ4A 2R2LA 3GZ1A 3FU6A 2VGXB 3IHVA 3KS2A 3SO8A 3MX3A 1JCSA 4N5QA 2KZTA 1OWLA 4EBAG 4FLHA 2J4BA 2IU1A 3EIQC 2PM6A 1E8XA 4F53A 1H0AA 2KATA 3ENEA 4JHKA 1BI7B 2J8SD 3S7DA 3D9HA 3PS6A 3CK7A 4JXTA 4XIFA 3UT4A 4I2WA 4DX5D 5LFAA 1OWPA 3APFA 4Z68A 4NQ0A 4GA1A 4GTRA 3FUDA 1H6PA 2L0TB 2WM9A 2DZNA 3FUHA 2KXPC 4NACA 5CBNA 2VJ8A 4PDXA 5AQAA 5DBKA 3FTYA 1LD7A 4JW1A 1TN6A 3RKVA 4DK5A 1ELWA 3T5XA 3UM3A 3ZRHA 1UN9A 3ULQA 4X8QA 3DSSA 5B1BE 4TXRA 3DPYA 4BTBA 3VTYA 5FQ8A 3UT7A 2P9UG 4KXKB 2GRNB 4GZ6A 3IXEA 3MKQB 3UIPC 2AXUA 1FVFA 3R9AB 5EDSA 3Q9NC 4GZ3A 4YVQC 2R02A 4FC8A 4I17A 4EZJA 4HBDA 3Q5MA 2B6CA 4WWOA 3SD5A 1Z5SC 3B7TA 3SFYA 2R05A 3D9PA 2DZOA 4N5CA 4HORA 3PUKA 1V54E 2XEVA 1OCCE 4HI8A 2B0OE 3SF4A 4LERA 3UPVA 2KM4A 2KCKA 3EHRA 3HVEA 3IHYA 4WNGA 4LEUA 1ZU2A 4TUUA 3F6QA 4IULA 1WM5A 4KT6B 4JVSA 1RW2A 3SQVA 1B89A 1IXVA 4FJZA 2RD0A 3ONKA 4UWGA 4CDNA 3LJ3A 2UY1B 5EKQD 1UJJA 4KVOA 3RSEG 1YMPA 3WG7E 4URKA 2NYJA 4HB5A 4DX1A 1H6OA 4RQIA 3TWUA 3ABME 5LP0A 1TNZA 2PM7A 4WUYA 1HH8A 1H2UA 2XRZA 2R5SA 2WXGA 3EHMA 3QK0A 3VLEA 1UJKA 2WXIA 4HQDA 3CVYA 1P5QA 3TWRA 4N3BA 4K5CA 1YCSB 3ZYQA 3ML8A 4DI3A 3MKRA 4KBQA 1TJCA 4LNGA 3FH8A 3ZFWA 2YHEA 4G26A 4BWRA 2XGSA 4J8EA 1YYHA 3NOGD 4APOA 3FUEA 3ZPJA 4CGVA 1TJFA 4UI9K 5EYPF 3PDNA 4GTSA 1TEZA 2I1KA 2IJGX 3R9MA 2EIKE 3PZDA 1TYQG 4MKTA 2EQXA 3GW4A 3ZU7B 2PL2A
chains in the Genus database with same CATH topology
2FO7A 3QDNA 3RO3A 4JHJA 1HU3A 3ZN3A 2WB2A 1E8ZA 3NZSA 1UW4B 5LOZA 5JJ7A 4FU3A 3URZA 3AS4A 2MOWA 3OXGA 4NRHB 3ZGQA 2YINA 1SQMA 3JYSA 2FEZA 3ZIMA 3LKUA 3VTXA 5G04J 3CSTA 3QWPA 3B7RL 4UI9C 3LYAA 5G05C 4FP7A 3FUKA 2XCCA 3CGHA 2X6IA 4M3OA 4CT4A 4B8AA 2BF0X 3G2VA 5E75A 4BX9A 4YVOA 1W3BA 4EECA 1UG3A 1JPLA 2YQ8A 3FU5A 3IV0A 5EX3A 3ONLA 2MRIA 4Y6CA 5FJYA 4KVMA 4MLPA 4ACKA 1YA0A 4G24A 4AIFA 1IQUA 4U0ZA 1JWGA 2GRMA 2JEKA 4N2SA 3QB2A 4GZDA 5FZRA 1MHQA 2VSXE 4HFGA 4YNDA 3R7QA 4N39A 4G25A 2I6HA 2VQ2A 4LCTA 1E90A 4B8CB 5J90A 3FH5A 2XCBA 5JHAA 5LCWJ 2WXQA 4Q94A 4P29A 4PS8A 4FJYA 3D9JA 2NSZA 3QOUA 4LRZA 3D9IA 2LNIA 1OUVA 3JUIA 2HYZA 2E2EA 3TAXA 3TG4A 5AIJA 3MZLB 4JPSA 5T4YA 4J6IA 4WAFA 3I3NA 3I4RB 5FT9A 1NA3A 3ASGA 3MGBA 4I1AA 2WXOA 3ESLA 2BUGA 4FULA 4F7AA 3AS8A 4B89A 2AWIA 2LAHA 3ESKA 5KJMA 4PS7A 2X6FA 5ENNA 1MQSA 4GYWA 4U0UA 4GAAA 1E7VA 4EQFA 2WQ7A 4HS2A 4U07A 3SZ7A 5C1DA 1OWMA 2XHEA 4ILIA 4I6GA 3S7FA 3FUIA 3Q15A 2KCLA 4BT8A 2X6HA 2WXPA 4LUNU 4UWHA 2ILRA 2J07A 2V8SE 4HOQA 3L08A 4ACLA 2ZU6B 3GZSA 5BW8C 3ML9A 4BSXA 1PY1A 1Y8MA 2PQNA 3CR3A 2OVFA 3RO2A 2NC9A 3CVPA 2XPIA 3JQ1A 2OOEA 2PQRA 2GW1A 5C2YA 2V4LA 3RK6A 3SI5A 3TXMA 4AEZC 3LVQE 3LCAA 3E4BA 2C0LA 3UX4A 3FUJA 3C98A 3ZW3A 4NURA 2VGXA 3ZEFA 4DJAA 3U3WA 5FQ4A 1U3CA 3O48A 3CLJA 3Q4AB 4A1GA 4J8FA 3CHSA 4GCOA 1LF8A 4JEHA 3LY8A 3HDXA 4QFVA 2MHKA 2OVBA 4HOUA 3T8MA 3EIJA 5M72A 4AXHA 1HXIA 2L9BA 3PREA 3N71A 2Y3AA 3OTNA 4WWPA 4DPRA 1A17A 1JWFA 4XKCA 4IN3B 3ZVVA 1SZ9A 4KMOA 1NZNA 3O4ZA 4AVXA 3BG0B 1E8WA 3ZHEB 3CKCA 4GYYA 4PS3A 3CQCB 1HE8A 3P2BA 4UWKA 4AV7A 3CVXA 3DBSA 5CMWA 1KT1A 1L5JA 3FHEA 2IF4A 3ASFA 3UT8A 2Y4TA 4TV3A 3MA5A 4CGWA 4Y6WA 3TXNA 3FTXA 3KD7A 2IOLA 2KCVA 4AP2A 3RIBA 2WXFA 2I2OA 5A23A 3CQGB 3PNTB 4DLQA 2FULA 3HHMA 5BT1A 1E7UA 4WNFA 4ILHB 4DI4A 3G2TA 3I4GA 3ZXSA 2LO6A 3QKYA 4L1BA 4U04A 4FA6A 3GYZA 4H7YA 3OXFA 4BT9A 3FUNA 3CIAA 1N52A 3FEYA 1KT0A 2FF4A 4AOFA 2VSYA 3ASHA 3RU0A 3ZHEA 4N3AA 1Y6IA 3NQPA 4WWNA 4GPKA 2WXHA 3FTUA 4D10C 4O6FA 3Q49B 4GYOA 5HI7A 4G2VA 5ARFA 2FI7A 3FP3A 3L13A 3L54A 5D0QD 2V5FA 2IFUA 3EJNA 4GA2A 3MV2B 4AJWA 1ELRA 4U0SA 4JHRA 4TRQA 1H19A 5BNWA 5ARGA 2C2LA 2VSNA 2X38A 5T8IA 2IONA 4B94A 2WMNA 3BEEA 4L7TA 2FBNA 4XZ4A 4A1SA 1INZA 3GZ1A 2DIWA 4KZ0A 2XQ0A 3FU6A 3GZ2A 2M63A 2VGXB 1NP7A 4XE0A 1PAQA 5JJTA 4HOTA 3IHVA 3KS2A 2IQCA 2WPVA 3MX3A 1WY6A 2XGOA 3FULA 2PZIA 3SNXA 2KZTA 1OWLA 3NZUA 2IOSA 4K03A 3FTVA 4EBAG 5BPPA 4RG6A 4FLHA 3CVVA 2J4BA 2IU1A 2WXLA 3EIQC 2PM6A 4L23A 3RRNB 3UQ3A 1E8XA 3ZYLA 4F53A 3HVEB 1H0AA 5J08A 2KATA 3ENEA 2LSVA 4KYOB 3SBSA 4JHKA 4OVUA 4C9BB 4RVBA 3D9OA 3FTWA 3D9LA 2UY1A 2CHXA 3APDA 3D9NA 3S7DA 4F1SA 2AVPA 2AXZA 4GMLA 4I6EA 3MEKA 4Q96A 1SZAA 2RG8A 3AS5A 4G11A 2WVIA 2VSOE 3PEUB 3PUJA 5G04C 3G2WA 3PS6A 4UQZA 1EF1C 3CK7A 3FDHA 1JUQA 4JXTA 5G55A 5BV0A 3CVUA 4XIFA 4J0UA 3UT4A 4I2WA 2CHWA 5LFAA 4GZ5A 1OWPA 3CHQA 2A5UA 3FUFA 3KAEA 3APFA 5FTPA 4NQ0A 2E0IA 3IKOB 4GA1A 5ANLA 3FUDA 2JLBA 2L0TB 3IBEA 3U64A 3QAQA 4GZCA 3CVLA 2KC7A 2WM9A 4CRWA 3FUHA 4CT0A 3MKQA 2Q7FA 2J49A 3FFLA 4FHKA 4NACA 3TGOA 2VJ8A 4I1OB 4PDXA 4CEMA 4CDMA 4ANWA 1BPOA 5DBKA 1UN8A 3FTYA 3EHNA 4RSYA 5T3RA 1NA0A 4JW1A 4UWFA 3CHOA 3FWVA 4XX5A 3DPDA 3SFZA 4XKBA 4EZKA 2NXPA 3RKVA 4DK5A 1ELWA 3T5XA 3G2SA 3S7BA 3ZRHA 1UN9A 3ULQA 4MRUA 4K0RA 2J09A 4U8HA 5BUZA 3T5VA 5G2NA 4HXIA 3QNKA 4BTBA 3CK9A 2DBAA 4B0ZA 3G2UA 4I43A 1ELKA 4J8DA 3U9WA 5FQ8A 3VTYA 3UT7A 4E85A 5FQ7A 3D9KA 5ANRA 4KXKB 4GU5A 5LX8A 3L6AA 4GZ6A 4DLOA 3PRZA 2CG2A 3MJWA 4JZYA 1OWOA 3MKQB 3S7JA 2DCPA 4FHJA 2AXUA 1FVFA 3R9AB 1ZBPA 4C0EA 4GB9A 5EDSA 5KJNA 3MYVA 4GZ3A 4I6JA 4YVQC 4UI9J 4BY6A 4FC8A 4IRUA 3S2AA 4AY5A 3L22A 3QC1A 4I17A 3Q5MA 4EZJA 1H2TC 3B13A 4WWOA 3AU4A 3SD5A 5KCMA 2QFCA 5CCLA 3B7TA 2I9CA 3FEXA 3D9PA 3L17A 4N5CA 3RRUA 3RJVA 3LXUX 4HORA 1DNPA 3PUKA 2J4DA 1VDYA 2C0MA 3LDZA 3D9MA 4JEUA 4MS6A 4W9RA 2XPZA 4C0MA 2XEVA 4N2QA 1HO8A 2YHCA 4V3IA 2WXNA 3SF4A 4LERA 3UMVA 1PC2A 3PE4A 3RRMB 1H6KA 3JQ0A 3UPVA 2KM4A 2KCKA 3HVEA 3PNLB 4FLBA 3MCXA 2L0IA 5A7DB 1N54A 3UUXA 2LAIA 3IHYA 4WNGA 3JCKC 5DIZA 2P58C 4LEUA 4AY6A 1XNFA 3MV3B 2WQHA 4EPZA 3EDTB 2QY7A 4GMJA 4BX8A 4FADA 4ANVA 4OVVA 1WAO1 5CMYA 3R7RA 1HX8A 5JHBA 2X3MA 1ZU2A 4IYPA 3CSFA 3FUMA 4TUUA 2WXKA 1FCHA 1H2VC 5FQ6A 5BV1A 1U3DA 2VGYA 3PH0C 4JA7A 2WXMA 5D0OD 4HLEA 4IULA 4JA9A 4EZLA 1IQRA 3FU0A 1WM5A 4KT6B 4WNDA 3U4TA 4U63A 3FY4A 3HIZA 4JVSA 5HQ8A 1QQEA 3FU3A 5FZQA 4F3VA 2WXRA 1B89A 4JL0A 4FJZA 2I1JA 2RD0A 4ME2A 5CCMA 2VTBB 4CCAA 2HM8A 2L6JA 4ATGA 3PEVB 2HO1A 2J9QA 1EPUA 3ONKA 4HOSA 4UWGA 4ANXA 4CDNA 2AXVA 1E96B 3LJ3A 2X6KA 2GGFA 3ASDA 4G1TA 5G05J 1QNFA 1HS6A 2UY1B 4H7XA 5EKQD 1UJJA 3FH7A 4RG9A 2VTBA 3LY7A 4KVOA 2YNQA 4HVBA 3D3MA 2VYIA 2LSUA 4URKA 4I1MA 5CHEE 2CHZA 4KZCA 2J08A 4JC8A 3CVQA 4APFA 4A3TA 5AJDA 1S0PA 1EYHA 1EDUA 2XPYA 3LS8A 3BG1B 2KZTB 3B7UX 4J8SA 3PVLA 4EBAA 4BFRA 4GA0A 4N3CA 5LP0A 2CG3A 1Z6TA 2PM7A 2V0PA 4I2ZA 4WUYA 5LCWC 1HH8A 3CV0A 3I5PA 1H2UA 3PE3A 2Y4UA 3CK8A 3CHPA 3OXLA 2XRZA 1DVPA 2R5SA 2WXGA 3EHMA 1KLXA 3QK0A 4G23A 1HFAA 3VLEA 5A6CA 5FZSA 1GW6A 1UJKA 2OV8A 4WNEA 3TJPA 4I9CA 2WXIA 3SBTB 3HYMB 5KJLA 3CKBA 3CVYA 4XI9A 4L2LA 1XGWA 2R59A 1P5QA 4N3BA 4UWLA 4ABNA 3U66A 3FTZA 4GCNA 3Q47B 3L16A 5JJ6A 3ZYQA 3ML8A 2XRYA 3SGHA 1X5BA 4CDRA 4DI3A 5AENA 3CEQA 2CFUA 3MKRA 2BTDA 2UWJG 4KBQA 3AU5A 1QZ2A 5FWQA 1TJCA 5E76A 2A4ZA 2CFZA 3LEWA 4E6HA 3FH8A 3ZFWA 4Q69A 3CVWA 1IYGA 1HF8A 2YHEA 4G26A 4AM9A 4BWRA 2XGSA 4J8EA 4PUCA 3QWWA 3WXXA 3LY9A 3QWVA 4PH4B 2X6JA 1IHGA 4APOA 3CHRA 4ILGA 4UQXA 3FUEA 3ZPJA 1OWNA 2AW6A 5EX0A 4CGVA 4R7LA 5KJKA 4ANUA 1TJFA 3IEGA 2GRLA 4UI9K 1FVHA 3CVNA 3B7SA 1Z3YA 4L2YA 3LPZA 5AYWD 3QJZA 3PDNA 2R17C 1HG2A 3K9IA 3ZYMA 3FTSA 2XGMA 4I9EA 1HZ4A 4OYSA 1TEZA 3QARA 5AJLA 3TL5A 2I1KA 3ZYKA 2IJGX 2WMOA 2WXJA 1Z3XA 3NF1A 3SHFA 1HG5A 3APCA 4UQYA 3P1UA 3PZDA 3KEZA 3OAWA 3VLFA 4MKTA 4A3VA 2WQ6A 2EQXA 4XI0A 3GW4A 3TG5A 4BTAA 2ONDA 3VLDA 2HR2A 1E8YA 2PL2A 3LVRE 3CHMA 4A55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQ0 A;  2FO7 A;  4GA1 A;  4ME2 A;  3QDN A;  1A17 A;  2JLB A;  5CCM A;  2L6J A;  4IN3 B;  3RO3 A;  2HO1 A;  2J9Q A;  2KC7 A;  3CVL A;  3ZN3 A;  4HOS A;  1NZN A;  2Q7F A;  3FFL A;  3TGO A;  5JJ7 A;  1E96 B;  3URZ A;  3ZHE B;  3AS4 A;  3CKC A;  3ASD A;  4G1T A;  4GYY A;  3OXG A;  4NRH B;  5DBK A;  5G05 J;  3ZGQ A;  1NA0 A;  3JYS A;  2UY1 B;  4H7X A;  1KT1 A;  3FWV A;  4RG9 A;  2FEZ A;  2IF4 A;  3LKU A;  5EKQ D;  3ASF A;  3LY7 A;  3QWP A;  5G04 J;  3VTX A;  3RKV A;  1ELW A;  2Y4T A;  3LYA A;  4GZ6 A;  2VYI A;  4UI9 C;  5G05 C;  2XCC A;  2LSU A;  3MA5 A;  5CHE E;  4Y6W A;  3S7B A;  3ULQ A;  4CGW A;  3KD7 A;  2KCV A;  3RIB A;  3CVQ A;  4YVO A;  1W3B A;  2YQ8 A;  5EX3 A;  4BTB A;  3CK9 A;  2DBA A;  4Y6C A;  5FJY A;  5BT1 A;  4WNF A;  4J8D A;  3VTY A;  1YA0 A;  4G24 A;  3QKY A;  4AIF A;  4U0Z A;  4U04 A;  3GYZ A;  4H7Y A;  4N2S A;  4GA0 A;  4N3C A;  4KXK B;  3OXF A;  4BT9 A;  5FZR A;  4I2Z A;  4WUY A;  4YND A;  5LCW C;  1HH8 A;  3CV0 A;  1KT0 A;  3PE3 A;  2FF4 A;  2I6H A;  2Y4U A;  3CK8 A;  2VQ2 A;  3OXL A;  4G25 A;  2VSY A;  3ASH A;  2R5S A;  3RU0 A;  4G23 A;  1KLX A;  3ZHE A;  4N3A A;  3S7J A;  5A6C A;  5FZS A;  4GPK A;  2XCB A;  3Q49 B;  4O6F A;  4WNE A;  3R9A B;  5LCW J;  1ZBP A;  4GYO A;  5HI7 A;  4I9C A;  4G2V A;  5ARF A;  3HYM B;  5KJL A;  5KJN A;  3CKB A;  3QOU A;  4GZ3 A;  4YVQ C;  4XI9 A;  4UI9 J;  2FI7 A;  3FP3 A;  1P5Q A;  2LNI A;  4AY5 A;  4N3B A;  1OUV A;  4I17 A;  2HYZ A;  2E2E A;  3Q5M A;  4N39 A;  5D0Q D;  2V5F A;  2IFU A;  3TG4 A;  4GA2 A;  3MV2 B;  4ABN A;  4GCN A;  2QFC A;  1ELR A;  4JHR A;  4U0S A;  3Q47 B;  5CCL A;  5FT9 A;  5JJ6 A;  5ARG A;  1NA3 A;  2C2L A;  2VSN A;  3ASG A;  4I1A A;  4B94 A;  5BNW A;  3BEE A;  4CDR A;  2BUG A;  2FBN A;  4N5C A;  4A1S A;  3GZ1 A;  3CEQ A;  3RJV A;  3MKR A;  4JL0 A;  3AS8 A;  2UWJ G;  3GZ2 A;  4HOR A;  2VGX B;  4KBQ A;  3ESK A;  5JJT A;  1QZ2 A;  4W9R A;  2C0M A;  5KJM A;  3KS2 A;  4HOT A;  2WPV A;  1TJC A;  2XEV A;  3TAX A;  4N2Q A;  2XGO A;  2YHC A;  4GYW A;  4U0U A;  4EQF A;  3ZFW A;  3SF4 A;  2PZI A;  4U07 A;  1IYG A;  3SZ7 A;  1PC2 A;  5C1D A;  4G26 A;  4AM9 A;  4BWR A;  3PE4 A;  2XGS A;  4J8E A;  4RG6 A;  3QWW A;  3S7F A;  3WXX A;  3Q15 A;  2KCL A;  3LY9 A;  3QWV A;  4BT8 A;  3UPV A;  1IHG A;  4APO A;  4UQX A;  3UQ3 A;  2KCK A;  5A7D B;  3UUX A;  3ZPJ A;  5EX0 A;  4CGV A;  4WNG A;  5KJK A;  5DIZ A;  2KAT A;  3IEG A;  2LSV A;  4UI9 K;  2P58 C;  4HOQ A;  3CVN A;  4LEU A;  4AY6 A;  1XNF A;  4KYO B;  3MV3 B;  2WQH A;  5BW8 C;  3LPZ A;  5AYW D;  1Y8M A;  3EDT B;  2PQN A;  2UY1 A;  3PDN A;  3RO2 A;  1WAO 1;  2NC9 A;  3CVP A;  3S7D A;  2XPI A;  2AVP A;  3K9I A;  3MEK A;  2XGM A;  2OOE A;  1HZ4 A;  2GW1 A;  2PQR A;  1ZU2 A;  3AS5 A;  4I9E A;  5G04 C;  1FCH A;  4UQZ A;  3LCA A;  3E4B A;  2C0L A;  3CK7 A;  3NF1 A;  2VGY A;  4JA7 A;  5D0O D;  2VGX A;  3U3W A;  4JA9 A;  3O48 A;  3Q4A B;  4UQY A;  4J8F A;  4GCO A;  3LY8 A;  1WM5 A;  4J0U A;  4XI0 A;  4I2W A;  4WND A;  3GW4 A;  4XIF A;  3U4T A;  2MHK A;  3TG5 A;  4BTA A;  2OND A;  5HQ8 A;  4HOU A;  1QQE A;  4GZ5 A;  5M72 A;  2HR2 A;  3KAE A;  5FZQ A;  2PL2 A;  4F3V A;  5FTP A;  1HXI A;  1B89 A;  3N71 A; 
#chains in the Genus database with same CATH topology
 2FO7 A;  3QDN A;  1N4S A;  3RO3 A;  1BD8 A;  1UW4 B;  5LOZ A;  4FU3 A;  3AS4 A;  3OXG A;  1SQM A;  4GTO A;  3CST A;  3QWP A;  3LYA A;  4U8Y D;  3CGH A;  4CT4 A;  3DEO A;  3BU8 A;  1JPL A;  4KVM A;  1YA0 A;  4AIF A;  4U0Z A;  2JEK A;  2A5E A;  3QB2 A;  4GZD A;  3HXE A;  2QYJ A;  4G25 A;  2VQ2 A;  5LCW J;  3BUA A;  1WDY A;  4QQI A;  3D9J A;  3D9I A;  2E2E A;  3TG4 A;  4JPS A;  1TN7 A;  5FT9 A;  4I1A A;  5FIO A;  3KEA A;  3AS8 A;  3KSL A;  4GYW A;  2XHE A;  4TUM A;  4LUN U;  2V8S E;  5AAO A;  2ZU6 B;  3GZS A;  4BSX A;  3ML9 A;  1PY1 A;  2BKK B;  2GRR B;  2NC9 A;  3NOC D;  4U8V D;  2OOE A;  2DWZ A;  1UOH A;  2H6G A;  2C0L A;  3FUJ A;  3C98 A;  1LF8 A;  4JEH A;  3BQO A;  2OVB A;  3T8M A;  1NL4 A;  3EIJ A;  2Y3A A;  4XKC A;  1OY3 D;  1SZ9 A;  3O4Z A;  1N0Q A;  3CKC A;  4GYY A;  1SA4 A;  1HE8 A;  1NI1 A;  5CMW A;  5AQ7 A;  4TV3 A;  3TXN A;  3FTX A;  3CQG B;  3B95 A;  5BT1 A;  4WNF A;  4DI4 A;  4ILH B;  3I4G A;  3UKR G;  1NFI E;  3OXF A;  4BT9 A;  3TWT A;  3ABL E;  3HXB A;  3ZHE A;  1Y6I A;  4GPK A;  4D10 C;  3FTU A;  5ARF A;  5IY5 E;  3DWL G;  1K3Z D;  4GA2 A;  1SA5 A;  4U0S A;  5ARG A;  4O60 A;  2WMN A;  4L7T A;  4LG6 A;  4A1S A;  1INZ A;  4KZ0 A;  2DIW A;  4U96 D;  2XQ0 A;  2WPV A;  1WY6 A;  2XGO A;  4K03 A;  4RG6 A;  2RFM A;  4L23 A;  2QYU A;  3UQ3 A;  2LSV A;  4RVB A;  3FTW A;  2CHX A;  4F1S A;  3D9N A;  4GML A;  2XEE A;  4Q96 A;  3AS5 A;  4EHM A;  1OXJ A;  3LJN A;  3PZ1 A;  1EF1 C;  2VGE A;  3FDH A;  3CVU A;  1DCQ A;  5AQ9 A;  4J0U A;  3C3O A;  2E0I A;  3IKO B;  2KC7 A;  4CRW A;  1IHB A;  3MKQ A;  2Q7F A;  4RLY A;  3W9F A;  2J49 A;  5AN8 A;  4I1O B;  1BPO A;  3Q7F A;  1UN8 A;  3EHN A;  1NA0 A;  4XX5 A;  3DPD A;  3SFZ A;  4XKB A;  3G2S A;  4MRU A;  4K0R A;  4U8H A;  5G2N A;  4I43 A;  3UI2 A;  3DST A;  5FQ7 A;  3ZXP A;  4GTM A;  2DYR E;  5LX8 A;  1FPP A;  3PRZ A;  4JZY A;  1OWO A;  2DCP A;  4FHJ A;  5B1A E;  3HXD A;  1ZBP A;  2RKK A;  4U7E B;  5KJN A;  4I6J A;  4UI9 J;  5HRY A;  1H2T C;  3B13 A;  5CCL A;  3L17 A;  1VDY A;  4W9R A;  4C0M A;  1HO8 A;  4V3I A;  4F1P A;  5EYL A;  4BET A;  3JXI A;  5A7D B;  2LAI A;  2EIM E;  3JCK C;  5DIZ A;  5CED B;  2P9L G;  2WQH A;  4GMJ A;  4ANV A;  5FQ6 A;  1U3D A;  2GRQ B;  3PH0 C;  2WXM A;  4JA9 A;  1DCE A;  3FU0 A;  2QZA A;  4ZFH A;  3U4T A;  4U63 A;  3FY4 A;  5HQ8 A;  3C3R A;  4JL0 A;  2I1J A;  4CCA A;  2L6J A;  4L9P A;  4HOS A;  3TWV A;  3SY2 A;  3HG0 D;  2EIN E;  2GGF A;  3ASD A;  4G1T A;  5G05 J;  4H7X A;  2VTB A;  3FH7 A;  4RG9 A;  3LY7 A;  4HVB A;  2L6B A;  2VYI A;  4ATZ D;  5CHE E;  4KZC A;  3DSV A;  1D9S A;  4A3T A;  1EDU A;  3LS8 A;  3PVL A;  4EBA A;  4GA0 A;  3PE3 A;  1DVP A;  1AP7 A;  2AJA A;  1HFA A;  4ZHB A;  5FZS A;  1O5M A;  4I9C A;  5KJL A;  4DRX E;  4XI9 A;  1BU9 A;  2R59 A;  4UWL A;  4ABN A;  3FTZ A;  4GCN A;  3SGH A;  1X5B A;  2XS1 A;  1MX4 A;  5AEN A;  2BTD A;  1QZ2 A;  2OEW A;  2V4H C;  1IYG A;  1S63 A;  3QWW A;  3WXX A;  3LY9 A;  4PH4 B;  3CHR A;  4ANU A;  3CVN A;  3B7S A;  5JMN D;  3K9I A;  4I9E A;  3QAR A;  3TL5 A;  2WMO A;  2WXJ A;  3HXC A;  3NF1 A;  3TWW A;  3TWX A;  3KEZ A;  1MJ0 A;  2WQ6 A;  4XI0 A;  3TG5 A;  3VLD A;  1E8Y A;  4JHJ A;  4DUI A;  1E8Z A;  3NB2 A;  4NRH B;  3ZIM A;  3VTX A;  5G04 J;  3Q7A A;  5BXU A;  4FP7 A;  3FUK A;  2IEJ A;  2XCC A;  2X6I A;  4M3O A;  5E75 A;  1UG3 A;  2YQ8 A;  3FU5 A;  2MRI A;  3DSX A;  4Y6C A;  4MLP A;  5FJY A;  4ACK A;  4LNU D;  1IQU A;  1JWG A;  2GRM A;  4N2S A;  2ETC A;  2VSX E;  3AG4 E;  4HFG A;  4YND A;  5HKP A;  5JHA A;  1KZO A;  4P29 A;  3QOU A;  3PZ4 A;  3JUI A;  3C72 A;  3MZL B;  4J6I A;  1NA3 A;  2WXO A;  2AWI A;  2F0Y A;  2LAH A;  3ESK A;  5ENN A;  4HS2 A;  3SZ7 A;  1OWM A;  3FUI A;  2X6H A;  4BSZ B;  4UWH A;  1MZC A;  2ILR A;  2ZGD A;  5BW8 C;  3CVP A;  2XPI A;  3JQ1 A;  1U2V G;  2V4L A;  3LVQ E;  3UX4 A;  3ZW3 A;  4DJA A;  2VGX A;  1TNY A;  3U3W A;  3O48 A;  3Q4A B;  4J8F A;  3LY8 A;  4HOU A;  4NIK A;  4TXP A;  4AXH A;  1HXI A;  3PRE A;  4WWP A;  3E30 A;  2V5Q C;  4O1P A;  4IN3 B;  3ZVV A;  2ETB A;  1NZN A;  3DSU A;  4UWK A;  3CVX A;  3DBS A;  1L5J A;  3FHE A;  3ASF A;  3UT8 A;  2Y4T A;  2JAB A;  3MA5 A;  3KD7 A;  2KCV A;  2I2O A;  3PNT B;  5ENT D;  1BLX B;  2FUL A;  3HHM A;  1N11 A;  3ZXS A;  2LO6 A;  3L82 A;  4L1B A;  3GYZ A;  4HRM B;  3NBN B;  3CIA A;  3FEY A;  2LXM A;  3ASH A;  3RU0 A;  2ZIR A;  4WWN A;  1SVX A;  4O6F A;  2IO3 C;  4GYO A;  3FP3 A;  1D8D A;  3L54 A;  4AJW A;  1ELR A;  5BNW A;  4B94 A;  2VSN A;  4B93 B;  1O1T A;  2FBN A;  3GZ2 A;  5JJT A;  4HOT A;  1V55 E;  3FUL A;  2PZI A;  3NZU A;  2IOS A;  2WXL A;  3RRN B;  2P9S G;  3HVE B;  5J08 A;  4KYO B;  2UY1 A;  5FIN A;  2AVP A;  2AXZ A;  4I6E A;  3MEK A;  5ITZ F;  4G11 A;  2RG8 A;  2VSO E;  3HXF A;  5G04 C;  3G2W A;  4HNA D;  4UQZ A;  5BV0 A;  5AQB A;  2GRP B;  2CHW A;  4GZ5 A;  2A5U A;  5KBA A;  2IO2 C;  5ANL A;  3U64 A;  2JLB A;  3IBE A;  3QAQ A;  4GZC A;  3CVL A;  3E33 A;  4K5A B;  4FHK A;  3TGO A;  2XZT G;  4UWF A;  3Q73 A;  3FWV A;  5EN5 D;  4EZK A;  3S7B A;  1N4Q A;  5BUZ A;  4HXI A;  3QNK A;  3CK9 A;  4B0Z A;  1ELK A;  4J8D A;  4CZ2 D;  4TXQ A;  1FT1 A;  2XEN A;  3L6A A;  2CG2 A;  3UM1 A;  1OCO E;  3UM0 A;  3EU5 A;  4C0E A;  3MYV A;  3C3Q A;  5ENO D;  1QYM A;  3L22 A;  3QC1 A;  3AU4 A;  5KCM A;  2QFC A;  3Q78 A;  1BI8 B;  2H6I A;  1DNP A;  3LDZ A;  2XPZ A;  2YHC A;  2FO1 E;  1IKN D;  1PC2 A;  5ENS D;  3PE4 A;  3RRM B;  1H6K A;  3JQ0 A;  4E85 A;  4FLB A;  3MCX A;  3UUX A;  1N54 A;  2P58 C;  4AY6 A;  1XNF A;  3Q9U C;  2ZXW E;  3EDT B;  4BX8 A;  4FAD A;  4OVV A;  1WAO 1;  5CMY A;  3L9T A;  5JHB A;  4YDW A;  3CSF A;  2WXK A;  5EIB E;  4JA7 A;  4HLE A;  1IQR A;  5B3S E;  3HIZ A;  5FZQ A;  4F3V A;  2WXR A;  5CCM A;  2VTB B;  3PEV B;  1EPU A;  4ANX A;  2X6K A;  3W9G A;  2YNQ A;  1WG0 A;  3Q75 A;  3CVQ A;  4APF A;  1EYH A;  2XPY A;  2KZT B;  3B7U X;  3E32 A;  4BFR A;  3TWS A;  4N3C A;  1Z6T A;  5CER B;  5LCW C;  3CV0 A;  3DSW A;  2Y4U A;  3CK8 A;  3ASO E;  5A6C A;  3AG2 E;  1TNO A;  3TJP A;  3SBT B;  3HYM B;  4L2L A;  5ENP D;  3V30 A;  3V2O A;  5JJ6 A;  3UKU G;  2GRO B;  4J7W A;  2H6H A;  2CFU A;  3DXM G;  2UWJ G;  4G8L A;  5FWQ A;  5E76 A;  2ETA A;  3CVW A;  2XEH A;  1N9A A;  1HF8 A;  4HLL A;  4AM9 A;  2ZIS A;  3QWV A;  2X6J A;  4BES A;  1OWN A;  2AW6 A;  5EX0 A;  4R7L A;  2P9I G;  4L2Y A;  5AYW D;  1HG2 A;  3ZYK A;  5H7P A;  1Z3X A;  1HG5 A;  3APC A;  3OAW A;  1FT2 A;  2H6F A;  2HR2 A;  3LVR E;  3B7B A;  2P2C P;  3EHQ A;  3ASN E;  1QBQ A;  3ZN3 A;  2WB2 A;  1KPS B;  1N4R A;  3NZS A;  5JJ7 A;  1S70 B;  2F8Y A;  3URZ A;  1O1S A;  3T8K A;  2FEZ A;  2EIJ E;  3B7R L;  4UI9 C;  4B8A A;  2BF0 X;  4BX9 A;  1K8K G;  3IV0 A;  5EX3 A;  3ONL A;  1G3N B;  1TR4 A;  1MHQ A;  3R7Q A;  4F6R D;  4N39 A;  3PZ2 A;  2I6H A;  2MYO A;  4LCT A;  1E90 A;  3FH5 A;  5ENR D;  2HE0 A;  2XCB A;  2WXQ A;  2LXL A;  4PS8 A;  5CRV A;  4LRZ A;  2DYS E;  2LNI A;  1OUV A;  3TAX A;  5T4Y A;  3E37 A;  5EID A;  5CRU A;  4WAF A;  3I3N A;  2BUG A;  4FUL A;  4F7A A;  2F37 A;  5KJM A;  4PS7 A;  3JUE A;  4U0U A;  2WQ7 A;  1E7V A;  4YDY A;  4U07 A;  5C1D A;  3Q15 A;  4BT8 A;  5KWD A;  2WXP A;  2J07 A;  3C5R A;  2PQN A;  2OVF A;  5CBO A;  3RO2 A;  1AWC B;  1TN8 A;  3TXM A;  3SI5 A;  4AEZ C;  3LCA A;  3E4B A;  4NUR A;  5FQ4 A;  4A1G A;  3CHS A;  4GCO A;  3V2X A;  3HDX A;  4J8Y A;  2MHK A;  5M72 A;  1JWF A;  3V79 K;  4KMO A;  5CEC B;  3BG0 B;  3ZNG A;  3ZHE B;  3V31 A;  4PS3 A;  3CQC B;  3P2B A;  5D66 A;  1D8E A;  2IF4 A;  4Y6W A;  4HRN A;  3RIB A;  2WXF A;  1LTX A;  4DLQ A;  1E7U A;  3G2T A;  3E34 A;  3QKY A;  2OEV A;  4U04 A;  4H7Y A;  1N0R A;  2XS8 A;  3FUN A;  1N52 A;  3PZ3 A;  4AOF A;  2VSY A;  1S64 A;  4U95 D;  3NQP A;  3Q49 B;  5HI7 A;  4G2V A;  2FI7 A;  3L13 A;  2R03 A;  5D0Q D;  2IFU A;  3EJN A;  3MV2 B;  3JXJ A;  1H19 A;  2X38 A;  3KSQ A;  1RZ4 A;  4BEP A;  2M63 A;  1NP7 A;  4XE0 A;  4DX6 D;  1PAQ A;  1JCQ A;  2IQC A;  3ISM C;  3EU9 A;  3SNX A;  3SFX A;  3FTV A;  5BPP A;  3CVV A;  3ZYL A;  3SBS A;  4OVU A;  4C9B B;  3D9O A;  3D9L A;  3APD A;  1SZA A;  2P9K G;  2WVI A;  3PEU B;  3PUJ A;  2Y0B G;  4C48 B;  1JUQ A;  5G55 A;  3CHQ A;  3FUF A;  3KAE A;  5FTP A;  3DRA A;  5HS0 A;  4CT0 A;  3FFL A;  4CDM A;  4CEM A;  4ANW A;  5T3R A;  4YDE A;  4RSY A;  3CHO A;  4BER A;  2NXP A;  1SW6 A;  4DX7 D;  2J09 A;  5EIL A;  3T5V A;  2DBA A;  3G2U A;  3U9W A;  3D9K A;  5ANR A;  2BED A;  1X81 A;  4GU5 A;  1DC2 A;  4DLO A;  3MJW A;  3S7J A;  4YDO A;  4GB9 A;  2Y1L E;  4BY6 A;  4IRU A;  3S2A A;  4AY5 A;  4XEI G;  2I9C A;  1LD8 A;  3FEX A;  1TNU A;  3UTM A;  3RRU A;  3RJV A;  3LXU X;  2J4D A;  2C0M A;  3D9M A;  4JEU A;  4MS6 A;  2KBX A;  3EUV A;  3ULE G;  4N2Q A;  2WXN A;  1KZP A;  3UMV A;  3PNL B;  2L0I A;  3ABK E;  3MV3 B;  4EPZ A;  3NAW A;  2QY7 A;  3AG1 E;  3R7R A;  1HX8 A;  2X3M A;  4IYP A;  3FUM A;  1FCH A;  1H2V C;  5BV1 A;  3J5P A;  2VGY A;  3T9K A;  5D0O D;  4O1O A;  3DXK G;  4EZL A;  4GPM A;  4WND A;  4HRL A;  1QQE A;  3FU3 A;  4ME2 A;  4K5B A;  2HM8 A;  4GTV A;  1N4P A;  4ATG A;  2HO1 A;  2J9Q A;  2PNN A;  2AXV A;  2EIL E;  1E96 B;  1QNF A;  1HS6 A;  3DEP A;  3D3M A;  2LSU A;  4I1M A;  2CHZ A;  2J08 A;  4JC8 A;  5AJD A;  1S0P A;  3BG1 B;  4LSZ E;  4J8S A;  5AAR A;  2CG3 A;  2V0P A;  4I2Z A;  1ZB1 A;  2P9N G;  3I5P A;  3CHP A;  3OXL A;  4G23 A;  1KLX A;  1GW6 A;  2OV8 A;  4WNE A;  3UM2 A;  3CKB A;  1XGW A;  4OAV B;  3U66 A;  1JCR A;  3Q47 B;  3L16 A;  4CDR A;  2XRY A;  3CEQ A;  1K1A A;  2DVW A;  4JB8 P;  3AU5 A;  2F8X K;  2A4Z A;  2CFZ A;  3LEW A;  4E6H A;  4Q69 A;  3UXG A;  2LUH A;  4PUC A;  2RFA A;  1IHG A;  4ILG A;  4UQX A;  5ENQ D;  1K1B A;  5KJK A;  3IEG A;  2GRL A;  5CEA A;  1FVH A;  1N95 A;  1Z3Y A;  4HI9 A;  3LPZ A;  3TWQ A;  3QJZ A;  2R17 C;  2QC9 A;  3ZYM A;  3FTS A;  2XGM A;  4OYS A;  1HZ4 A;  5AJL A;  1O1R A;  1OCR E;  3SHF A;  4UQY A;  3P1U A;  3AG3 E;  3VLF A;  4A3V A;  2XZD G;  4GTT A;  4BTA A;  2OND A;  5JA4 D;  1OCZ E;  3ZKJ A;  3CHM A;  4LNB A;  4A55 A;  5KNG A;  1HU3 A;  3ULY A;  3J5Q B;  2MOW A;  3ZGQ A;  2YIN A;  3JYS A;  3LKU A;  1OT8 A;  5G05 C;  4GTP A;  4MBG A;  3X2Q E;  3G2V A;  1MX6 A;  4YVO A;  1W3B A;  4EEC A;  4CYM D;  2BKG A;  3AJI A;  4JD2 G;  4G24 A;  3AAA C;  5FZR A;  5BXO A;  4B8C B;  5J90 A;  4Q94 A;  3RAU A;  4FJY A;  2NSZ A;  5AIJ A;  2HYZ A;  3I4R B;  3ASG A;  3MGB A;  1TNB A;  3ESL A;  2Y69 E;  4B89 A;  2X6F A;  4EQF A;  1MQS A;  4OAU C;  4GAA A;  3Q79 A;  1MX2 A;  4ILI A;  4I6G A;  3S7F A;  2KCL A;  1A5E A;  3UIO C;  4HOQ A;  3L08 A;  3HRA A;  4ACL A;  1Y8M A;  3CR3 A;  2PQR A;  2GW1 A;  5C2Y A;  3RK6 A;  2ZGG A;  3ZEF A;  1U3C A;  3CLJ A;  4QFV A;  4GTQ A;  4M7C A;  2L9B A;  2P9P G;  3N71 A;  3OTN A;  4DPR A;  1A17 A;  4G8K A;  4A63 B;  4AVX A;  1E8W A;  4AV7 A;  1KT1 A;  5D2M C;  4CGW A;  4AP2 A;  2IOL A;  4GMR A;  2IY0 C;  5A23 A;  3ZUV B;  5KNH D;  4FA6 A;  3UIN C;  1KT0 A;  4UUC A;  2FF4 A;  4N3A A;  4DX2 A;  2WXH A;  1N94 A;  2OCC E;  1Q2Z A;  2V5F A;  4JHR A;  4TRQ A;  1MYO A;  2C2L A;  5T8I A;  2ION A;  3BEE A;  4XZ4 A;  2R2L A;  3GZ1 A;  3FU6 A;  2VGX B;  3IHV A;  3KS2 A;  3SO8 A;  3MX3 A;  1JCS A;  4N5Q A;  2KZT A;  1OWL A;  4EBA G;  4FLH A;  2J4B A;  2IU1 A;  3EIQ C;  2PM6 A;  1E8X A;  4F53 A;  1H0A A;  2KAT A;  3ENE A;  4JHK A;  1BI7 B;  2J8S D;  3S7D A;  3D9H A;  3PS6 A;  3CK7 A;  4JXT A;  4XIF A;  3UT4 A;  4I2W A;  4DX5 D;  5LFA A;  1OWP A;  3APF A;  4Z68 A;  4NQ0 A;  4GA1 A;  4GTR A;  3FUD A;  1H6P A;  2L0T B;  2WM9 A;  2DZN A;  3FUH A;  2KXP C;  4NAC A;  5CBN A;  2VJ8 A;  4PDX A;  5AQA A;  5DBK A;  3FTY A;  1LD7 A;  4JW1 A;  1TN6 A;  3RKV A;  4DK5 A;  1ELW A;  3T5X A;  3UM3 A;  3ZRH A;  1UN9 A;  3ULQ A;  4X8Q A;  3DSS A;  5B1B E;  4TXR A;  3DPY A;  4BTB A;  3VTY A;  5FQ8 A;  3UT7 A;  2P9U G;  4KXK B;  2GRN B;  4GZ6 A;  3IXE A;  3MKQ B;  3UIP C;  2AXU A;  1FVF A;  3R9A B;  5EDS A;  3Q9N C;  4GZ3 A;  4YVQ C;  2R02 A;  4FC8 A;  4I17 A;  4EZJ A;  4HBD A;  3Q5M A;  2B6C A;  4WWO A;  3SD5 A;  1Z5S C;  3B7T A;  3SFY A;  2R05 A;  3D9P A;  2DZO A;  4N5C A;  4HOR A;  3PUK A;  1V54 E;  2XEV A;  1OCC E;  4HI8 A;  2B0O E;  3SF4 A;  4LER A;  3UPV A;  2KM4 A;  2KCK A;  3EHR A;  3HVE A;  3IHY A;  4WNG A;  4LEU A;  1ZU2 A;  4TUU A;  3F6Q A;  4IUL A;  1WM5 A;  4KT6 B;  4JVS A;  1RW2 A;  3SQV A;  1B89 A;  1IXV A;  4FJZ A;  2RD0 A;  3ONK A;  4UWG A;  4CDN A;  3LJ3 A;  2UY1 B;  5EKQ D;  1UJJ A;  4KVO A;  3RSE G;  1YMP A;  3WG7 E;  4URK A;  2NYJ A;  4HB5 A;  4DX1 A;  1H6O A;  4RQI A;  3TWU A;  3ABM E;  5LP0 A;  1TNZ A;  2PM7 A;  4WUY A;  1HH8 A;  1H2U A;  2XRZ A;  2R5S A;  2WXG A;  3EHM A;  3QK0 A;  3VLE A;  1UJK A;  2WXI A;  4HQD A;  3CVY A;  1P5Q A;  3TWR A;  4N3B A;  4K5C A;  1YCS B;  3ZYQ A;  3ML8 A;  4DI3 A;  3MKR A;  4KBQ A;  1TJC A;  4LNG A;  3FH8 A;  3ZFW A;  2YHE A;  4G26 A;  4BWR A;  2XGS A;  4J8E A;  1YYH A;  3NOG D;  4APO A;  3FUE A;  3ZPJ A;  4CGV A;  1TJF A;  4UI9 K;  5EYP F;  3PDN A;  4GTS A;  1TEZ A;  2I1K A;  2IJG X;  3R9M A;  2EIK E;  3PZD A;  1TYQ G;  4MKT A;  2EQX A;  3GW4 A;  3ZU7 B;  2PL2 A; 
#chains in the Genus database with same CATH homology
 2FO7 A;  3QDN A;  3RO3 A;  4JHJ A;  1HU3 A;  3ZN3 A;  2WB2 A;  1E8Z A;  3NZS A;  1UW4 B;  5LOZ A;  5JJ7 A;  4FU3 A;  3URZ A;  3AS4 A;  2MOW A;  3OXG A;  4NRH B;  3ZGQ A;  2YIN A;  1SQM A;  3JYS A;  2FEZ A;  3ZIM A;  3LKU A;  3VTX A;  5G04 J;  3CST A;  3QWP A;  3B7R L;  4UI9 C;  3LYA A;  5G05 C;  4FP7 A;  3FUK A;  2XCC A;  3CGH A;  2X6I A;  4M3O A;  4CT4 A;  4B8A A;  2BF0 X;  3G2V A;  5E75 A;  4BX9 A;  4YVO A;  1W3B A;  4EEC A;  1UG3 A;  1JPL A;  2YQ8 A;  3FU5 A;  3IV0 A;  5EX3 A;  3ONL A;  2MRI A;  4Y6C A;  5FJY A;  4KVM A;  4MLP A;  4ACK A;  1YA0 A;  4G24 A;  4AIF A;  1IQU A;  4U0Z A;  1JWG A;  2GRM A;  2JEK A;  4N2S A;  3QB2 A;  4GZD A;  5FZR A;  1MHQ A;  2VSX E;  4HFG A;  4YND A;  3R7Q A;  4N39 A;  4G25 A;  2I6H A;  2VQ2 A;  4LCT A;  1E90 A;  4B8C B;  5J90 A;  3FH5 A;  2XCB A;  5JHA A;  5LCW J;  2WXQ A;  4Q94 A;  4P29 A;  4PS8 A;  4FJY A;  3D9J A;  2NSZ A;  3QOU A;  4LRZ A;  3D9I A;  2LNI A;  1OUV A;  3JUI A;  2HYZ A;  2E2E A;  3TAX A;  3TG4 A;  5AIJ A;  3MZL B;  4JPS A;  5T4Y A;  4J6I A;  4WAF A;  3I3N A;  3I4R B;  5FT9 A;  1NA3 A;  3ASG A;  3MGB A;  4I1A A;  2WXO A;  3ESL A;  2BUG A;  4FUL A;  4F7A A;  3AS8 A;  4B89 A;  2AWI A;  2LAH A;  3ESK A;  5KJM A;  4PS7 A;  2X6F A;  5ENN A;  1MQS A;  4GYW A;  4U0U A;  4GAA A;  1E7V A;  4EQF A;  2WQ7 A;  4HS2 A;  4U07 A;  3SZ7 A;  5C1D A;  1OWM A;  2XHE A;  4ILI A;  4I6G A;  3S7F A;  3FUI A;  3Q15 A;  2KCL A;  4BT8 A;  2X6H A;  2WXP A;  4LUN U;  4UWH A;  2ILR A;  2J07 A;  2V8S E;  4HOQ A;  3L08 A;  4ACL A;  2ZU6 B;  3GZS A;  5BW8 C;  3ML9 A;  4BSX A;  1PY1 A;  1Y8M A;  2PQN A;  3CR3 A;  2OVF A;  3RO2 A;  2NC9 A;  3CVP A;  2XPI A;  3JQ1 A;  2OOE A;  2PQR A;  2GW1 A;  5C2Y A;  2V4L A;  3RK6 A;  3SI5 A;  3TXM A;  4AEZ C;  3LVQ E;  3LCA A;  3E4B A;  2C0L A;  3UX4 A;  3FUJ A;  3C98 A;  3ZW3 A;  4NUR A;  2VGX A;  3ZEF A;  4DJA A;  3U3W A;  5FQ4 A;  1U3C A;  3O48 A;  3CLJ A;  3Q4A B;  4A1G A;  4J8F A;  3CHS A;  4GCO A;  1LF8 A;  4JEH A;  3LY8 A;  3HDX A;  4QFV A;  2MHK A;  2OVB A;  4HOU A;  3T8M A;  3EIJ A;  5M72 A;  4AXH A;  1HXI A;  2L9B A;  3PRE A;  3N71 A;  2Y3A A;  3OTN A;  4WWP A;  4DPR A;  1A17 A;  1JWF A;  4XKC A;  4IN3 B;  3ZVV A;  1SZ9 A;  4KMO A;  1NZN A;  3O4Z A;  4AVX A;  3BG0 B;  1E8W A;  3ZHE B;  3CKC A;  4GYY A;  4PS3 A;  3CQC B;  1HE8 A;  3P2B A;  4UWK A;  4AV7 A;  3CVX A;  3DBS A;  5CMW A;  1KT1 A;  1L5J A;  3FHE A;  2IF4 A;  3ASF A;  3UT8 A;  2Y4T A;  4TV3 A;  3MA5 A;  4CGW A;  4Y6W A;  3TXN A;  3FTX A;  3KD7 A;  2IOL A;  2KCV A;  4AP2 A;  3RIB A;  2WXF A;  2I2O A;  5A23 A;  3CQG B;  3PNT B;  4DLQ A;  2FUL A;  3HHM A;  5BT1 A;  1E7U A;  4WNF A;  4ILH B;  4DI4 A;  3G2T A;  3I4G A;  3ZXS A;  2LO6 A;  3QKY A;  4L1B A;  4U04 A;  4FA6 A;  3GYZ A;  4H7Y A;  3OXF A;  4BT9 A;  3FUN A;  3CIA A;  1N52 A;  3FEY A;  1KT0 A;  2FF4 A;  4AOF A;  2VSY A;  3ASH A;  3RU0 A;  3ZHE A;  4N3A A;  1Y6I A;  3NQP A;  4WWN A;  4GPK A;  2WXH A;  3FTU A;  4D10 C;  4O6F A;  3Q49 B;  4GYO A;  5HI7 A;  4G2V A;  5ARF A;  2FI7 A;  3FP3 A;  3L13 A;  3L54 A;  5D0Q D;  2V5F A;  2IFU A;  3EJN A;  4GA2 A;  3MV2 B;  4AJW A;  1ELR A;  4U0S A;  4JHR A;  4TRQ A;  1H19 A;  5BNW A;  5ARG A;  2C2L A;  2VSN A;  2X38 A;  5T8I A;  2ION A;  4B94 A;  2WMN A;  3BEE A;  4L7T A;  2FBN A;  4XZ4 A;  4A1S A;  1INZ A;  3GZ1 A;  2DIW A;  4KZ0 A;  2XQ0 A;  3FU6 A;  3GZ2 A;  2M63 A;  2VGX B;  1NP7 A;  4XE0 A;  1PAQ A;  5JJT A;  4HOT A;  3IHV A;  3KS2 A;  2IQC A;  2WPV A;  3MX3 A;  1WY6 A;  2XGO A;  3FUL A;  2PZI A;  3SNX A;  2KZT A;  1OWL A;  3NZU A;  2IOS A;  4K03 A;  3FTV A;  4EBA G;  5BPP A;  4RG6 A;  4FLH A;  3CVV A;  2J4B A;  2IU1 A;  2WXL A;  3EIQ C;  2PM6 A;  4L23 A;  3RRN B;  3UQ3 A;  1E8X A;  3ZYL A;  4F53 A;  3HVE B;  1H0A A;  5J08 A;  2KAT A;  3ENE A;  2LSV A;  4KYO B;  3SBS A;  4JHK A;  4OVU A;  4C9B B;  4RVB A;  3D9O A;  3FTW A;  3D9L A;  2UY1 A;  2CHX A;  3APD A;  3D9N A;  3S7D A;  4F1S A;  2AVP A;  2AXZ A;  4GML A;  4I6E A;  3MEK A;  4Q96 A;  1SZA A;  2RG8 A;  3AS5 A;  4G11 A;  2WVI A;  2VSO E;  3PEU B;  3PUJ A;  5G04 C;  3G2W A;  3PS6 A;  4UQZ A;  1EF1 C;  3CK7 A;  3FDH A;  1JUQ A;  4JXT A;  5G55 A;  5BV0 A;  3CVU A;  4XIF A;  4J0U A;  3UT4 A;  4I2W A;  2CHW A;  5LFA A;  4GZ5 A;  1OWP A;  3CHQ A;  2A5U A;  3FUF A;  3KAE A;  3APF A;  5FTP A;  4NQ0 A;  2E0I A;  3IKO B;  4GA1 A;  5ANL A;  3FUD A;  2JLB A;  2L0T B;  3IBE A;  3U64 A;  3QAQ A;  4GZC A;  3CVL A;  2KC7 A;  2WM9 A;  4CRW A;  3FUH A;  4CT0 A;  3MKQ A;  2Q7F A;  2J49 A;  3FFL A;  4FHK A;  4NAC A;  3TGO A;  2VJ8 A;  4I1O B;  4PDX A;  4CEM A;  4CDM A;  4ANW A;  1BPO A;  5DBK A;  1UN8 A;  3FTY A;  3EHN A;  4RSY A;  5T3R A;  1NA0 A;  4JW1 A;  4UWF A;  3CHO A;  3FWV A;  4XX5 A;  3DPD A;  3SFZ A;  4XKB A;  4EZK A;  2NXP A;  3RKV A;  4DK5 A;  1ELW A;  3T5X A;  3G2S A;  3S7B A;  3ZRH A;  1UN9 A;  3ULQ A;  4MRU A;  4K0R A;  2J09 A;  4U8H A;  5BUZ A;  3T5V A;  5G2N A;  4HXI A;  3QNK A;  4BTB A;  3CK9 A;  2DBA A;  4B0Z A;  3G2U A;  4I43 A;  1ELK A;  4J8D A;  3U9W A;  5FQ8 A;  3VTY A;  3UT7 A;  4E85 A;  5FQ7 A;  3D9K A;  5ANR A;  4KXK B;  4GU5 A;  5LX8 A;  3L6A A;  4GZ6 A;  4DLO A;  3PRZ A;  2CG2 A;  3MJW A;  4JZY A;  1OWO A;  3MKQ B;  3S7J A;  2DCP A;  4FHJ A;  2AXU A;  1FVF A;  3R9A B;  1ZBP A;  4C0E A;  4GB9 A;  5EDS A;  5KJN A;  3MYV A;  4GZ3 A;  4I6J A;  4YVQ C;  4UI9 J;  4BY6 A;  4FC8 A;  4IRU A;  3S2A A;  4AY5 A;  3L22 A;  3QC1 A;  4I17 A;  3Q5M A;  4EZJ A;  1H2T C;  3B13 A;  4WWO A;  3AU4 A;  3SD5 A;  5KCM A;  2QFC A;  5CCL A;  3B7T A;  2I9C A;  3FEX A;  3D9P A;  3L17 A;  4N5C A;  3RRU A;  3RJV A;  3LXU X;  4HOR A;  1DNP A;  3PUK A;  2J4D A;  1VDY A;  2C0M A;  3LDZ A;  3D9M A;  4JEU A;  4MS6 A;  4W9R A;  2XPZ A;  4C0M A;  2XEV A;  4N2Q A;  1HO8 A;  2YHC A;  4V3I A;  2WXN A;  3SF4 A;  4LER A;  3UMV A;  1PC2 A;  3PE4 A;  3RRM B;  1H6K A;  3JQ0 A;  3UPV A;  2KM4 A;  2KCK A;  3HVE A;  3PNL B;  4FLB A;  3MCX A;  2L0I A;  5A7D B;  1N54 A;  3UUX A;  2LAI A;  3IHY A;  4WNG A;  3JCK C;  5DIZ A;  2P58 C;  4LEU A;  4AY6 A;  1XNF A;  3MV3 B;  2WQH A;  4EPZ A;  3EDT B;  2QY7 A;  4GMJ A;  4BX8 A;  4FAD A;  4ANV A;  4OVV A;  1WAO 1;  5CMY A;  3R7R A;  1HX8 A;  5JHB A;  2X3M A;  1ZU2 A;  4IYP A;  3CSF A;  3FUM A;  4TUU A;  2WXK A;  1FCH A;  1H2V C;  5FQ6 A;  5BV1 A;  1U3D A;  2VGY A;  3PH0 C;  4JA7 A;  2WXM A;  5D0O D;  4HLE A;  4IUL A;  4JA9 A;  4EZL A;  1IQR A;  3FU0 A;  1WM5 A;  4KT6 B;  4WND A;  3U4T A;  4U63 A;  3FY4 A;  3HIZ A;  4JVS A;  5HQ8 A;  1QQE A;  3FU3 A;  5FZQ A;  4F3V A;  2WXR A;  1B89 A;  4JL0 A;  4FJZ A;  2I1J A;  2RD0 A;  4ME2 A;  5CCM A;  2VTB B;  4CCA A;  2HM8 A;  2L6J A;  4ATG A;  3PEV B;  2HO1 A;  2J9Q A;  1EPU A;  3ONK A;  4HOS A;  4UWG A;  4ANX A;  4CDN A;  2AXV A;  1E96 B;  3LJ3 A;  2X6K A;  2GGF A;  3ASD A;  4G1T A;  5G05 J;  1QNF A;  1HS6 A;  2UY1 B;  4H7X A;  5EKQ D;  1UJJ A;  3FH7 A;  4RG9 A;  2VTB A;  3LY7 A;  4KVO A;  2YNQ A;  4HVB A;  3D3M A;  2VYI A;  2LSU A;  4URK A;  4I1M A;  5CHE E;  2CHZ A;  4KZC A;  2J08 A;  4JC8 A;  3CVQ A;  4APF A;  4A3T A;  5AJD A;  1S0P A;  1EYH A;  1EDU A;  2XPY A;  3LS8 A;  3BG1 B;  2KZT B;  3B7U X;  4J8S A;  3PVL A;  4EBA A;  4BFR A;  4GA0 A;  4N3C A;  5LP0 A;  2CG3 A;  1Z6T A;  2PM7 A;  2V0P A;  4I2Z A;  4WUY A;  5LCW C;  1HH8 A;  3CV0 A;  3I5P A;  1H2U A;  3PE3 A;  2Y4U A;  3CK8 A;  3CHP A;  3OXL A;  2XRZ A;  1DVP A;  2R5S A;  2WXG A;  3EHM A;  1KLX A;  3QK0 A;  4G23 A;  1HFA A;  3VLE A;  5A6C A;  5FZS A;  1GW6 A;  1UJK A;  2OV8 A;  4WNE A;  3TJP A;  4I9C A;  2WXI A;  3SBT B;  3HYM B;  5KJL A;  3CKB A;  3CVY A;  4XI9 A;  4L2L A;  1XGW A;  2R59 A;  1P5Q A;  4N3B A;  4UWL A;  4ABN A;  3U66 A;  3FTZ A;  4GCN A;  3Q47 B;  3L16 A;  5JJ6 A;  3ZYQ A;  3ML8 A;  2XRY A;  3SGH A;  1X5B A;  4CDR A;  4DI3 A;  5AEN A;  3CEQ A;  2CFU A;  3MKR A;  2BTD A;  2UWJ G;  4KBQ A;  3AU5 A;  1QZ2 A;  5FWQ A;  1TJC A;  5E76 A;  2A4Z A;  2CFZ A;  3LEW A;  4E6H A;  3FH8 A;  3ZFW A;  4Q69 A;  3CVW A;  1IYG A;  1HF8 A;  2YHE A;  4G26 A;  4AM9 A;  4BWR A;  2XGS A;  4J8E A;  4PUC A;  3QWW A;  3WXX A;  3LY9 A;  3QWV A;  4PH4 B;  2X6J A;  1IHG A;  4APO A;  3CHR A;  4ILG A;  4UQX A;  3FUE A;  3ZPJ A;  1OWN A;  2AW6 A;  5EX0 A;  4CGV A;  4R7L A;  5KJK A;  4ANU A;  1TJF A;  3IEG A;  2GRL A;  4UI9 K;  1FVH A;  3CVN A;  3B7S A;  1Z3Y A;  4L2Y A;  3LPZ A;  5AYW D;  3QJZ A;  3PDN A;  2R17 C;  1HG2 A;  3K9I A;  3ZYM A;  3FTS A;  2XGM A;  4I9E A;  1HZ4 A;  4OYS A;  1TEZ A;  3QAR A;  5AJL A;  3TL5 A;  2I1K A;  3ZYK A;  2IJG X;  2WMO A;  2WXJ A;  1Z3X A;  3NF1 A;  3SHF A;  1HG5 A;  3APC A;  4UQY A;  3P1U A;  3PZD A;  3KEZ A;  3OAW A;  3VLF A;  4MKT A;  4A3V A;  2WQ6 A;  2EQX A;  4XI0 A;  3GW4 A;  3TG5 A;  4BTA A;  2OND A;  3VLD A;  2HR2 A;  1E8Y A;  2PL2 A;  3LVR E;  3CHM A;  4A55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...