2HYZA

Crystal structure of an 8 repeat consensus tpr superhelix (orthorombic crystal form)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
136
structure length
136
Chain Sequence
b'AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNTHETIC CONSENSUS TPR PROTEIN
molecule tags De novo protein
publication title Structure and stability of designed TPR protein superhelices: unusual crystal packing and implications for natural TPR proteins.
pubmed doi rcsb
total genus 56
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2006-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2hyzA00
5HQ8A 4U04A 4UI9C 4YVOA 5CHEE 2KCKA 4G23A 5A7DB 4JA7A 2HO1A 4N5CA 4G26A 3FFLA 3CVQA 3QOUA 3UQ3A 1WAO1 2OOEA 2WPVA 2XCBA 4G25A 2KCLA 4GCOA 4HOQA 2LSUA 4LEUA 4N3BA 4UQYA 4Y6CA 5FZSA 1NA3A 4KXKB 3S7DA 4AY6A 3CKBA 4H7YA 3CVNA 4GZ6A 4GA2A 5G05J 4AM9A 4WNFA 3SZ7A 3Q47B 4BWRA 2PQRA 3PDNA 3MKRA 5ARGA 5FT9A 3R9AB 1HXIA 2HYZA 2KC7A 5LCWJ 3PE3A 3ZHEA 3QKYA 2ONDA 1PC2A 5M72A 1YA0A 4IN3B 4U0ZA 4HOUA 3LY8A 3ASDA 3KD7A 4KBQA 3ZN3A 3LY7A 1B89A 2R5SA 4RG9A 4I9CA 4Y6WA 3RO2A 1WM5A 4APOA 5AYWD 3VTYA 3KAEA 2AVPA 2XGOA 3NF1A 2PQNA 4WNEA 3WXXA 2LSVA 1W3BA 2Y4TA 4XIFA 3N71A 3RU0A 3TGOA 3OXFA 3VTXA 2UY1B 4HORA 3IEGA 3GYZA 4G24A 5EX0A 4N3AA 1NZNA 2UWJG 2XGMA 4RG6A 1ZU2A 3ZFWA 3UPVA 3AS5A 4G2VA 1NA0A 2C0MA 3CVPA 2KATA 2XGSA 2VQ2A 2FI7A 3KS2A 2VYIA 4O6FA 3RO3A 3ULQA 3U3WA 3QWVA 2VSNA 4I2WA 1E96B 2IF4A 1TJCA 3Q49B 5BNWA 3ASHA 3CK8A 1QZ2A 3MA5A 3LYAA 4GZ5A 4U07A 4W9RA 4WNDA 2L6JA 5DIZA 3S7FA 5EKQD 4AY5A 4U0SA 3Q4AB 3QDNA 3ZPJA 1ELWA 2DBAA 3LY9A 4WUYA 5FZQA 2JLBA 4N39A 5FTPA 4GYYA 5KJNA 4GPKA 4GA1A 1KT1A 5EX3A 1ZBPA 3GZ2A 4N3CA 2UY1A 2WQHA 3CVLA 4GYWA 4AIFA 4BTAA 3OXLA 4EQFA 2BUGA 4B94A 5JJTA 3HYMB 3ASGA 3K9IA 2Q7FA 2Y4UA 4XI9A 3GZ1A 1IYGA 4GCNA 5KJMA 2HR2A 4UQZA 3MEKA 1XNFA 5JJ6A 3SF4A 2NC9A 2VGXB 3QWPA 3RJVA 2MHKA 5G05C 4JL0A 2XCCA 3O48A 4WNGA 5D0OD 5LCWC 3QWWA 3ZHEB 4JHRA 2FEZA 2V5FA 5G04C 3URZA 4I1AA 4H7XA 4A1SA 3FP3A 3Q5MA 3MV2B 4I9EA 3PE4A 2FO7A 4F3VA 4N2SA 3OXGA 4UQXA 1A17A 4J8FA 2J9QA 2P58C 3U4TA 5JJ7A 3JYSA 2FF4A 3Q15A 1ELRA 1KT0A 4GYOA 3FWVA 2LNIA 4U0UA 3CV0A 3UUXA 2YHCA 4KYOB 4UI9J 4HOSA 2E2EA 1P5QA 2FBNA 5FZRA 1OUVA 4BTBA 3S7BA 1HZ4A 3CK7A 4N2QA 4I2ZA 2QFCA 5D0QD 5A6CA 3CK9A 3BEEA 3TG5A 1HH8A 5DBKA 4J8EA 5KJLA 5G04J 3S7JA 1Y8MA 5CCLA 4HOTA 4J8DA 3AS4A 3MV3B 3RKVA 2C2LA 4G1TA 2VGYA 2IFUA 4BT9A 2PL2A 5CCMA 4ME2A 3GW4A 4YVQC 5FJYA 3ASFA 3AS8A 2VGXA 2XPIA 4J0UA 5HI7A 4CDRA 2VSYA 2C0LA 4BT8A 1FCHA 3LKUA 4JA9A 3EDTB 4NRHB 4YNDA 2XEVA 4CGWA 4UI9K 4NQ0A 3ZGQA 2PZIA 1IHGA 4GA0A 5KJKA 5BW8C 3CKCA 3TAXA 2I6HA 4XI0A 5BT1A 2KCVA 2GW1A 4ABNA 5C1DA 4GZ3A 1KLXA 3E4BA 3LPZA 5ARFA 3CEQA 3ESKA 1QQEA 3LCAA 4I17A 2YQ8A 4CGVA 3RIBA 3TG4A
chains in the Genus database with same CATH superfamily
4YVOA 2WXPA 1LF8A 3Q73A 3FFLA 3S7DA 1H2UA 4WWOA 2KC7A 3ZKJA 4GTVA 4U0ZA 3CLJA 4UWGA 3X2QE 1E7VA 1OWPA 4EZJA 3L22A 3FTYA 2R03A 3IEGA 3GYZA 4ACLA 2F8XK 2DYSE 4M3OA 2M63A 2XGSA 3J5QB 3PVLA 3CK8A 1QZ2A 3LYAA 2ZISA 5FIOA 2DBAA 4GA1A 1ZBPA 2BUGA 4U8VD 3UT7A 3HYMB 1IYGA 1SW6A 1Q2ZA 4UQZA 4LUNU 5JJ6A 5G05C 1AP7A 4JL0A 3ZUVB 3UT8A 5JMND 3PUKA 3Q5MA 4UQXA 3U4TA 3ABKE 1EDUA 1LTXA 5HRYA 4UI9J 3D9HA 3TWVA 3B7RL 3RRMB 1BI7B 3MJWA 2ETCA 3MV3B 3QNKA 3ZIMA 4YVQC 4XKBA 3ULEG 4HXIA 4UI9K 3CHOA 3EJNA 5BT1A 2XPYA 3LCAA 1WG0A 3CQGB 4GMJA 3NQPA 4HRMB 2WPVA 3R7RA 3DSTA 3ZEFA 4CRWA 3SQVA 3KD7A 3FEYA 1SZ9A 1N4RA 4X8QA 3CSTA 1ZU2A 3ZFWA 2GRLA 2WXOA 3AG3E 4JB8P 2P9LG 2VYIA 4XE0A 2VSNA 2Y0BG 3Q49B 5BXUA 4LRZA 4FULA 4ANVA 1QYMA 3PNLB 1PY1A 3TJPA 5LFAA 3Q75A 3ASNE 5ENNA 4EPZA 4IYPA 2BTDA 4FA6A 2GGFA 2X6HA 3MCXA 1A17A 3RAUA 3P2BA 5IY5E 4RQIA 4A63B 3CSFA 5CBNA 2WXHA 3S7BA 4N2QA 2XEEA 3HVEB 4KZ0A 4J8DA 1TN6A 1IKND 2VGYA 5CCMA 4TXPA 3BG0B 4J0UA 1FVFA 1U3DA 3UXGA 4K5BA 4GA0A 4PUCA 3CKCA 3UT4A 2KCVA 4G8KA 2BEDA 3FEXA 4LERA 1QQEA 1N9AA 3PZ1A 3FUNA 2I2OA 5EIBE 4JHJA 2WXMA 4EECA 2EIJE 4I1OB 4AM9A 1BI8B 5FT9A 1FPPA 3ZU7B 2HE0A 4IN3B 4MRUA 1FT2A 3LY7A 1B89A 2AWIA 4DUIA 1OCOE 4L2LA 5ENRD 3DBSA 3ZYKA 5ENOD 3UTMA 3PZ4A 5ENTD 3HXBA 3DXKG 1E8WA 3ESLA 2MYOA 2C0MA 3CVPA 3SI5A 3TL5A 4WAFA 1UN8A 3PH0C 4WNDA 4P29A 2GRNB 5EKQD 3L82A 3LY9A 4LNBA 4YDYA 4GYYA 3GZ2A 5G2NA 2XS1A 3AG1E 3NZUA 3PEVB 3MKQB 1GW6A 5EYPF 4OAUC 1UOHA 2MOWA 3SFXA 2IO2C 4ZHBA 3GZSA 4J8FA 4HBDA 2KZTB 4GYOA 5CMWA 2J4BA 1NI1A 3APDA 2EINE 1ELKA 2QFCA 3OAWA 4NURA 5AQ7A 3D3MA 2WXIA 4A3TA 2LXMA 3LJNA 5E76A 2C0LA 5CECB 2B6CA 2OV8A 1NL4A 4DX7D 1D8EA 2JABA 4JZYA 4ABNA 5C1DA 4ILGA 4L9PA 4L2YA 1OY3D 5HKPA 5CBOA 3QOUA 4AEZC 4DLOA 4GPKA 2LAIA 4LNUD 4DX5D 3MKRA 4L7TA 1HF8A 3LY8A 3ZN3A 3PUJA 4Y6WA 4N5QA 3TXMA 1IQRA 4HRNA 3FTXA 3AAAC 5BV0A 1TJCA 4YDOA 2L6JA 2P9NG 2RKKA 2L9BA 2B0OE 3Q9UC 4GTRA 4F6RD 1KT1A 2R17C 2BF0X 5KJMA 1LD7A 3L17A 3O48A 4ANWA 2QYJA 2V5FA 4H7XA 4I9EA 3DPYA 3FWVA 2X38A 4GTPA 2R05A 3UM0A 3B13A 1Z3YA 2KXPC 2FULA 3ASOE 2CG2A 3EDTB 4NRHB 2OEVA 2H6FA 4F1PA 5KJKA 4A1GA 4C9BB 4ANXA 3Q7FA 4KVMA 1QNFA 5CHEE 4MLPA 3FTVA 5ENSD 3RK6A 4JA7A 3WG7E 3DSVA 5T8IA 3L08A 2IO3C 4A55A 2LSUA 5B1AE 4AXHA 4EBAG 3AU5A 5T3RA 4WNFA 4KZCA 3FTUA 1H0AA 1WDYA 3FY4A 4HOUA 2XENA 4RG9A 2R02A 2H6GA 4I6JA 5CRUA 4F53A 2EQXA 3L9TA 3JUIA 3ISMC 4HI8A 3NZSA 3N71A 5CRVA 4DJAA 4U63A 3ABME 3RO3A 4EHMA 4W9RA 1INZA 1H6OA 2I1KA 3I4GA 3V31A 3QDNA 2LUHA 2XZTG 1JCSA 4ATZD 3PREA 3HIZA 2WXKA 3SBTB 2NC9A 4GU5A 1K1AA 3C98A 3D9IA 2F0YA 4I1AA 3PE4A 5ANLA 1KT0A 4OAVB 3CR3A 5AN8A 1TEZA 5FZRA 2EIME 4BT9A 3QK0A 4BT8A 3LKUA 4YNDA 1N0RA 4O1PA 4JW1A 1WY6A 4PS8A 3R9MA 3MZLB 5ITZF 3UX4A 3V2OA 3C3QA 3SHFA 4DX6D 1KZOA 1SQMA 2VSOE 4BY6A 3MYVA 3DRAA 3MX3A 2CHWA 4GA2A 4O1OA 3Q47B 4LNGA 5FWQA 1TN8A 3FU5A 5T4YA 4KBQA 3SY2A 3BUAA 3MKQA 3QB2A 3CVUA 2PQNA 1Y6IA 3TGOA 3RU0A 4HS2A 4O60A 2Y1LE 4GTMA 2VQ2A 1Z5SC 1N4PA 1MX6A 4U07A 3FUKA 3T8MA 3FTZA 4U0SA 3D9JA 5EILA 1TNZA 4BFRA 4AIFA 4EQFA 1HS6A 1IXVA 3B7BA 3FUEA 1G3NB 2FEZA 4M7CA 2XS8A 2P58C 2WMOA 2PNNA 4LG6A 3Q15A 3E32A 4KYOB 4WWPA 2FBNA 5A6CA 4DX1A 1NFIE 1O1TA 4G1TA 2ETAA 2IFUA 4ME2A 2AXVA 2WB2A 4CDRA 3E33A 4K03A 1MQSA 3W9GA 3UI2A 1OWOA 5ARFA 5LOZA 4CYMD 1X81A 3UQ3A 1WAO1 2OOEA 2P9UG 3Q78A 3W9FA 4GZ6A 2PQRA 5LCWJ 4NIKA 4ILHB 2PM7A 4HI9A 3AU4A 3VLEA 1OCCE 4WNEA 3WXXA 3FU0A 5KBAA 2WXFA 2CFUA 1OXJA 1MYOA 2ILRA 4QFVA 2YHEA 3EIJA 4WUYA 2X3MA 4XZ4A 4N3CA 2Q7FA 1U2VG 3DWLG 3QJZA 2MHKA 3D9PA 2XCCA 5D2MC 5LCWC 5G04C 2WXQA 2J8SD 4OVVA 4HVBA 3OXGA 1JPLA 4URKA 4U0UA 3EHMA 5HS0A 3HXFA 2P9IG 3BEEA 4MBGA 4HLEA 2IOSA 2PL2A 5H7PA 5J90A 2XPIA 4JEHA 2LO6A 4C0MA 4CGWA 3ZGQA 4XI0A 2IONA 3UM3A 4A3VA 4GTTA 2OEWA 1JCRA 1O5MA 3D9MA 2HM8A 1FVHA 4U95D 3CVQA 3G2UA 1E90A 1V55E 2V4HC 4GCOA 4N3BA 1JUQA 4ATGA 4I1MA 3FULA 3PDNA 5ARGA 1HXIA 3T8KA 4MKTA 2R5SA 5BPPA 3SGHA 4FP7A 2XGOA 5FQ6A 5AQAA 2LSVA 3NOCD 4G24A 1DNPA 2J49A 2XZDG 4F1SA 1TNBA 5JHBA 3SFZA 3G2VA 2BKGA 3D9KA 2JLBA 5AAOA 4GYWA 3OXLA 2WXJA 3B7SA 3FTSA 4BX8A 1XNFA 3SF4A 4WNGA 2DCPA 1DCEA 4JHRA 3EHRA 5CEAA 5KCMA 3ZNGA 2Y3AA 3LVQE 1OWNA 3LEWA 2WM9A 4GPMA 3C72A 3L13A 3TWXA 5KWDA 2NXPA 3ASFA 3AS8A 3EUVA 1D9SA 1YYHA 1XGWA 1E8ZA 3SNXA 4KMOA 3V2XA 4BX9A 3TG4A 3FDHA 2KCKA 4AV7A 2HO1A 2L0IA 4G26A 1N0QA 2WXLA 3E34A 5EN5D 5G05J 3HG0D 3AJIA 2IQCA 2R59A 3ZHEA 1E8XA 2WVIA 4CEMA 1WM5A 3QC1A 3KAEA 3U9WA 2IY0C 3CVWA 5JA4D 1PAQA 1UG3A 2UWJG 2KZTA 2DYRE 3AS5A 1NA0A 2AJAA 4B8AA 4I2WA 2GRPB 4FC8A 3EHNA 4GZ5A 3FUFA 1HO8A 3ZPJA 4RVBA 3ONKA 5EX3A 3CVXA 3FUMA 3FTWA 1E8YA 4GCNA 2OVFA 3EU9A 4BESA 4PH4B 3U66A 1SZAA 3QWWA 3URZA 2F37A 2X6FA 4V3IA 3CHRA 2YHCA 2AW6A 4DK5A 4UUCA 2QC9A 4QQIA 3HHMA 2I9CA 5ANRA 3JQ0A 3J5PA 1MZCA 4JA9A 5FQ7A 3F6QA 4NQ0A 3NOGD 3IHVA 4B93B 3B95A 4GAAA 1EYHA 1U3CA 4YDEA 3ZXSA 3V79K 1RW2A 3CVVA 5HQ8A 4U04A 3JQ1A 4PDXA 2KCLA 4TXQA 4DI3A 3CKBA 2R2LA 3C3RA 3SBSA 4B8CB 3C5RA 2J07A 1MJ0A 4I9CA 1LD8A 3HXEA 3AG2E 1HG5A 2VJ8A 3FUDA 4IRUA 4E6HA 3VTXA 1S64A 2J4DA 4FHKA 5BUZA 3CHSA 1NZNA 1OT8A 2XGMA 3R7QA 1H6PA 1O1SA 2CHZA 3NBNB 3IKOB 3QWVA 3LDZA 3S7FA 1JCQA 1N54A 5JHAA 2YNQA 3PZ3A 4I6GA 1VDYA 4N39A 2LXLA 2WQHA 4AJWA 2XRZA 5AJLA 4XI9A 1DCQA 1KZPA 2V0PA 3BQOA 3ZYQA 3KSLA 3ZW3A 3APFA 4J6IA 2V4LA 1DVPA 2L6BA 3Q9NC 4ACKA 3ZRHA 1E7UA 1HZ4A 1A5EA 5EIDA 2X6IA 3KSQA 4DRXE 3U64A 4D10C 1TNOA 3FUHA 2RG8A 1FCHA 2WMNA 2BKKB 4JC8A 1K8KG 2H6HA 3UINC 3TWUA 1HU3A 3TAXA 3ONLA 4FU3A 4YDWA 1KLXA 5J08A 2X6KA 2YQ8A 1UJJA 2P9KG 3CHMA 2EILE 4N5CA 3FUIA 3I3NA 3DEPA 1IQUA 3IHYA 5AIJA 4H7YA 4BWRA 4GTQA 1OCRE 2HYZA 3L6AA 4F7AA 1EPUA 2NSZA 2KM4A 4UWKA 4U8HA 2I1JA 1TNUA 4U96D 1HX8A 3UPVA 2KATA 3DSWA 3FU6A 1K1BA 1N52A 5BNWA 4DX2A 4HLLA 4WWNA 2J09A 4Z68A 5FTPA 1TN7A 3CIAA 3TXNA 4B94A 2JEKA 3GZ1A 5B1BE 3FUJA 4G11A 1JWGA 4BETA 4ILIA 2ETBA 3APCA 3QAQA 4N2SA 2IEJA 1Z3XA 2GRQB 4KT6B 1OUVA 5FQ4A 2GRMA 2A4ZA 4J7WA 4XEIG 1HH8A 5G04J 3D9OA 5ENPD 3HXDA 4HNAD 1EF1C 5A23A 3JXJA 4CDNA 2VSYA 3EU5A 3B7TA 3CVYA 4GZCA 4K0RA 2ZXWE 3AG4E 3IBEA 1AWCB 5AENA 4CGVA 1S70B 3RIBA 5D66A 4RSYA 2WQ6A 1OWLA 2X6JA 4Y6CA 4K5CA 2KBXA 4CT4A 4C48B 3SZ7A 4E85A 3PS6A 4DI4A 5KNGA 5M72A 4APOA 5AYWD 5BXOA 2VTBA 1W3BA 2Y4TA 3LVRE 4RG6A 1FT1A 4G2VA 5G55A 4OYSA 4ANUA 3KS2A 4O6FA 3E37A 3FH5A 3G2TA 1E96B 1JWFA 5DIZA 3UM1A 3RRNB 1Z6TA 3DSXA 2UY1A 3RRUA 5JJTA 2ZIRA 3Q79A 3JXIA 3QWPA 4RLYA 3TWSA 2GROB 4G8LA 2XPZA 3V30A 1D8DA 3HRAA 2MRIA 3PRZA 2IOLA 4R7LA 5JJ7A 3LXUX 2FF4A 1N94A 5CMYA 2LNIA 2P9PG 2DVWA 4GZDA 2ZGGA 4BTBA 4XKCA 3MGBA 1Y8MA 2OVBA 3PZDA 2VGXA 3T5XA 3EIQC 5LP0A 4IULA 3TWQA 3NB2A 3O4ZA 5BW8C 4FADA 2I6HA 4JVSA 3UIOC 1S0PA 3HVEA 5KNHD 1BD8A 4UI9C 2DZOA 4G23A 3VLDA 3CHQA 5FZSA 4L1BA 1SA5A 1TNYA 4J8YA 5BV1A 2VTBB 2YINA 1YA0A 3CQCB 4U8YD 3BG1B 3UM2A 3VTYA 2AVPA 4DPRA 3ZYLA 3OXFA 2RFMA 4N3AA 3TWTA 3FH7A 1V54E 4PS7A 4CDMA 1H6KA 3BU8A 1MHQA 1HFAA 3Q4AB 4FJZA 2WXNA 4UWHA 2EIKE 4GMRA 3ASGA 2VGXB 2QZAA 5E75A 2Y69E 4AVXA 4EZLA 2V8SE 3ABLE 4JPSA 3DSUA 4GB9A 3ZVVA 4U7EB 1QBQA 3ML9A 1OWMA 4FJYA 4HFGA 3CK7A 3TG5A 1UN9A 5B3SE 4HOTA 3T5VA 3I5PA 4BEPA 3UKRG 3GW4A 5FJYA 5C2YA 2OCCE 4PS3A 2XEVA 2QYUA 5FQ8A 2GW1A 1BU9A 4GZ3A 3UUXA 2A5EA 1L5JA 4FHJA 1X5BA 3ESKA 2CFZA 3HXCA 3L54A 1N4SA 4G25A 3SFYA 4KXKB 2A5UA 5AQBA 3R9AB 3PE3A 2ONDA 1PC2A 1N4QA 1H2VC 4BSXA 3NF1A 4I43A 3ENEA 2QY7A 2F8YA 3SD5A 2LAHA 5EX0A 2IU1A 4J8SA 5LX8A 2DZNA 4AOFA 2J08A 1NP7A 5AJDA 1KPSB 1N95A 3MA5A 3DPDA 3RSEG 4TXRA 2RFAA 2IJGX 4EZKA 4TV3A 3CVLA 2E0IA 2P2CP 2HR2A 3RJVA 2P9SG 4C0EA 2XQ0A 2AXUA 4FLBA 2XRYA 3FP3A 3L16A 2FO7A 1ELRA 2AXZA 3G2WA 3CV0A 2E2EA 1P5QA 5KJLA 4J8EA 5CCLA 3AS4A 1S63A 2C2LA 3D9NA 2V5QC 1RZ4A 4XX5A 1K3ZD 3Q7AA 4FLHA 2PZIA 1IHGA 1UW4B 3S2AA 3FH8A 5AARA 4LCTA 4I17A 3UIPC 4KVOA 2XEHA 3P1UA 2ZGDA 1YMPA 5A7DB 3TWRA 4HQDA 1BLXB 4HOQA 4LEUA 4UQYA 3IV0A 4BSZB 4CT0A 4AY6A 3CHPA 3EHQA 3JUEA 3CVNA 3T9KA 3KEZA 1TJFA 3LS8A 5CEDB 2VSXE 5EDSA 5CERB 4XIFA 3D9LA 4HORA 3PNTB 1BPOA 4TUMA 4OVUA 1MX4A 2GRRB 2FO1E 1H19A 4TRQA 3ULQA 2IF4A 2DIWA 3ASHA 4APFA 3LJ3A 3PEUB 1ELWA 3QARA 3DXMG 3ULYA 5KJNA 2WXGA 3PZ2A 3UKUG 2Y4UA 3ZXPA 3JCKC 3ZHEB 3MV2B 4UWLA 1O1RA 3C3OA 3KEAA 1HG2A 4GMLA 2DWZA 3SO8A 4JHKA 5DBKA 3S7JA 3IXEA 3RKVA 4UWFA 5ENQD 4JD2G 2CHXA 2H6IA 1H2TC 4GTSA 4GTOA 3E4BA 4EBAA 1SVXA 2XCBA 2WQ7A 3OTNA 4NACA 4B0ZA 1NA3A 2CG3A 2L0TB 1TYQG 3HDXA 3FU3A 3QKYA 2PM6A 2VGEA 3ASDA 4ZFHA 3RO2A 1UJKA 3DSSA 4Q69A 1IHBA 3NAWA 2UY1B 4JEUA 4HB5A 4B89A 2FI7A 3U3WA 3I4RB 4CCAA 4AY5A 3DEOA 4L23A 4HRLA 5FZQA 1N11A 1ZB1A 4BTAA 4LSZE 3K9IA 4DLQA 5AQ9A 3MEKA 5FINA 2NYJA 3ML8A 5D0OD 4TUUA 2RD0A 4A1SA 4F3VA 3B7UX 3FHEA 3ZYMA 1TR4A 1HE8A 2J9QA 4BERA 3JYSA 2ZU6B 3VLFA 4HOSA 3G2SA 4K5AB 4I2ZA 1DC2A 5D0QD 3CK9A 1OCZE 4MS6A 2WXRA 3TWWA 2XHEA 4AP2A 4CZ2D 3UMVA 1YCSB 4Q96A 5HI7A 3E30A 4Q94A 1MX2A 4JXTA 3CGHA 5EYLA 3LPZA 1SA4A 3CEQA 4I6EA
chains in the Genus database with same CATH topology
4UI9C 4YVOA 5CHEE 2KCKA 2WXPA 3FTVA 1LF8A 4G23A 4JA7A 4MLPA 3RK6A 2HO1A 4AV7A 2L0IA 4G26A 5T8IA 3FFLA 3L08A 3VLDA 2WXLA 4A55A 3CHQA 2LSUA 5FZSA 4L1BA 3S7DA 4AXHA 4EBAG 3AU5A 5G05J 5T3RA 1H2UA 4WWOA 5BV1A 4WNFA 4KZCA 3FTUA 2VTBB 2KC7A 2IQCA 1H0AA 2R59A 3ZHEA 1E8XA 2WVIA 2YINA 1YA0A 3CQCB 3FY4A 4HOUA 3CLJA 4U0ZA 4UWGA 4CEMA 4RG9A 1E7VA 1OWPA 1WM5A 3BG1B 4I6JA 4F53A 3QC1A 3KAEA 3VTYA 4EZJA 2AVPA 2EQXA 3U9WA 3JUIA 3CVWA 3NZSA 3L22A 3N71A 3ZYLA 3OXFA 1PAQA 3FTYA 4DPRA 3IEGA 3GYZA 4ACLA 1UG3A 4N3AA 2UWJG 2KZTA 3AS5A 3FH7A 4DJAA 1NA0A 4M3OA 2M63A 4U63A 2XGSA 4B8AA 3RO3A 4PS7A 4I2WA 4CDMA 3PVLA 1H6KA 3CK8A 3EHNA 1QZ2A 4FC8A 3LYAA 4GZ5A 4W9RA 1MHQA 1HFAA 1INZA 2I1KA 3Q4AB 3I4GA 3FUFA 1HO8A 3QDNA 3ZPJA 4FJZA 2DBAA 4RVBA 2WXNA 3ONKA 4GA1A 5EX3A 3CVXA 1ZBPA 4UWHA 3FUMA 3FTWA 2BUGA 3UT7A 1E8YA 3ASGA 3HYMB 1IYGA 3PREA 3HIZA 4GCNA 2WXKA 4UQZA 3SBTB 4LUNU 5JJ6A 2NC9A 2VGXB 5E75A 4GU5A 2OVFA 3C98A 5G05C 3D9IA 4JL0A 4PH4B 4AVXA 1SZAA 4EZLA 3U66A 2V8SE 3QWWA 3UT8A 3URZA 4JPSA 3PUKA 4I1AA 2X6FA 3Q5MA 4GB9A 3PE4A 3ZVVA 5ANLA 4UQXA 3U4TA 4V3IA 1EDUA 3CHRA 3ML9A 1KT0A 2YHCA 1OWMA 4UI9J 4FJYA 3CR3A 1TEZA 2AW6A 4HFGA 5FZRA 3B7RL 3RRMB 4DK5A 3CK7A 3TG5A 1UN9A 3HHMA 3MJWA 2I9CA 5ANRA 3JQ0A 3I5PA 3MV3B 3T5VA 3QNKA 4HOTA 4BT9A 3ZIMA 4YVQC 3GW4A 5FJYA 3QK0A 5C2YA 4PS3A 4XKBA 4BT8A 3LKUA 4JA9A 4YNDA 5FQ7A 4HXIA 2XEVA 4UI9K 4NQ0A 3IHVA 3CHOA 4GAAA 1EYHA 3EJNA 1U3CA 4JW1A 5BT1A 1WY6A 5FQ8A 3ZXSA 2GW1A 4PS8A 2XPYA 4GZ3A 3UUXA 1L5JA 4FHJA 1X5BA 3ESKA 3LCAA 3MZLB 2CFZA 3UX4A 3CVVA 5HQ8A 4U04A 3JQ1A 3SHFA 3L54A 3CQGB 1SQMA 2VSOE 4BY6A 4GMJA 3MYVA 3NQPA 3MX3A 2CHWA 2WPVA 4PDXA 4G25A 2KCLA 4KXKB 4DI3A 3CKBA 4GA2A 2A5UA 3Q47B 3R7RA 5FWQA 3R9AB 3FU5A 3SBSA 3PE3A 4B8CB 2ONDA 1PC2A 3ZEFA 2J07A 5T4YA 4CRWA 3KD7A 4KBQA 3FEYA 4I9CA 1H2VC 1HG5A 3MKQA 4BSXA 3QB2A 3CVUA 3NF1A 2VJ8A 3FUDA 2PQNA 4I43A 4IRUA 1SZ9A 1Y6IA 3ENEA 2QY7A 4HS2A 3RU0A 3VTXA 3SD5A 2J4DA 4E6HA 3TGOA 2LAHA 4FHKA 5BUZA 3CHSA 3CSTA 5EX0A 1NZNA 2IU1A 2XGMA 4J8SA 3R7QA 1ZU2A 3ZFWA 2GRLA 5LX8A 2WXOA 4AOFA 2CHZA 2J08A 2VQ2A 2VYIA 3IKOB 1NP7A 4XE0A 5AJDA 3QWVA 2VSNA 3LDZA 3Q49B 3MA5A 3DPDA 4U07A 3FUKA 3S7FA 4LRZA 1N54A 3T8MA 3FTZA 4U0SA 4FULA 5JHAA 2YNQA 3D9JA 2IJGX 4I6GA 4ANVA 4EZKA 1VDYA 4N39A 4TV3A 3PNLB 1PY1A 4BFRA 2WQHA 3CVLA 4AIFA 4AJWA 4EQFA 2XRZA 5AJLA 2E0IA 3TJPA 4XI9A 1HS6A 2HR2A 2V0PA 5LFAA 3FUEA 3RJVA 5ENNA 3ZYQA 4C0EA 3ZW3A 2XQ0A 2AXUA 3APFA 4EPZA 4FLBA 4IYPA 4J6IA 2BTDA 2FEZA 2V4LA 4FA6A 2XRYA 3FP3A 1DVPA 3L16A 2FO7A 2GGFA 2X6HA 3MCXA 1A17A 2P58C 2WMOA 3P2BA 4ACKA 3ZRHA 3Q15A 1ELRA 2AXZA 3G2WA 1E7UA 3CV0A 4KYOB 3CSFA 2E2EA 4WWPA 1P5QA 2FBNA 2WXHA 3S7BA 1HZ4A 4N2QA 5A6CA 5KJLA 3HVEB 2X6IA 4J8EA 4KZ0A 5CCLA 4J8DA 3AS4A 2C2LA 4G1TA 3D9NA 2VGYA 2IFUA 5CCMA 3U64A 4ME2A 2AXVA 4D10C 3BG0B 4J0UA 4XX5A 1FVFA 3FUHA 2WB2A 1U3DA 4CDRA 2RG8A 1FCHA 2WMNA 4JC8A 4FLHA 4K03A 2PZIA 1IHGA 4GA0A 1MQSA 1HU3A 4PUCA 3CKCA 3TAXA 3UT4A 3ONLA 1UW4B 2KCVA 4FU3A 3S2AA 1OWOA 3FH8A 4LCTA 1KLXA 3FEXA 4LERA 5ARFA 4I17A 1QQEA 2X6KA 5J08A 2YQ8A 5LOZA 1UJJA 4KVOA 3CHMA 3P1UA 3FUNA 5A7DB 4N5CA 2I2OA 3FUIA 4JHJA 3UQ3A 1WAO1 2OOEA 3I3NA 1IQUA 2WXMA 4HOQA 4LEUA 3IV0A 4UQYA 3IHYA 4CT0A 4EECA 5AIJA 4AY6A 3CHPA 4I1OB 4H7YA 3CVNA 4GZ6A 4AM9A 4BWRA 2PQRA 5FT9A 5LCWJ 2HYZA 3L6AA 3KEZA 4F7AA 1TJFA 4IN3B 4MRUA 1EPUA 2NSZA 3LS8A 4ILHB 2KM4A 2PM7A 3LY7A 1B89A 2AWIA 3AU4A 4UWKA 3VLEA 2VSXE 4L2LA 3DBSA 3ZYKA 4WNEA 4U8HA 3WXXA 5EDSA 4XIFA 3FU0A 2I1JA 3D9LA 4HORA 3PNTB 1E8WA 1HX8A 3ESLA 3UPVA 1BPOA 2WXFA 2CFUA 4OVUA 2C0MA 3CVPA 3SI5A 2KATA 1H19A 3FU6A 4TRQA 3ULQA 3TL5A 1N52A 4WAFA 2DIWA 1UN8A 2IF4A 2ILRA 3PH0C 3ASHA 4QFVA 5BNWA 4WNDA 4P29A 4APFA 3LJ3A 5EKQD 4WWNA 2J09A 3PEUB 1ELWA 2YHEA 3EIJA 3LY9A 2X3MA 3QARA 4WUYA 5KJNA 5FTPA 4GYYA 4XZ4A 3GZ2A 4N3CA 5G2NA 2WXGA 3CIAA 3TXNA 4B94A 3NZUA 2JEKA 2Q7FA 2Y4UA 3GZ1A 3FUJA 3PEVB 3MKQB 1GW6A 3QJZA 2MHKA 3D9PA 2XCCA 4G11A 1JWGA 3JCKC 5LCWC 4ILIA 3ZHEB 3APCA 3QAQA 5G04C 2MOWA 2WXQA 3MV2B 4N2SA 4UWLA 4OVVA 1Z3XA 4HVBA 3OXGA 3GZSA 4J8FA 2KZTB 1JPLA 4GYOA 4URKA 5CMWA 4U0UA 2J4BA 3EHMA 3APDA 4KT6B 1HG2A 1ELKA 1OUVA 4GMLA 5FQ4A 2QFCA 2GRMA 2A4ZA 3OAWA 3BEEA 1HH8A 4JHKA 5DBKA 4NURA 5G04J 3S7JA 3D9OA 3RKVA 3D3MA 4HLEA 1EF1C 4UWFA 2IOSA 2WXIA 2PL2A 5A23A 5J90A 4CDNA 2XPIA 4A3TA 4JEHA 5E76A 2VSYA 2C0LA 2LO6A 4C0MA 2CHXA 3B7TA 4CGWA 3CVYA 1H2TC 3ZGQA 2OV8A 4GZCA 4K0RA 4XI0A 2IONA 3IBEA 4JZYA 4A3VA 4ABNA 5C1DA 3E4BA 5AENA 4CGVA 4ILGA 4L2YA 3RIBA 4EBAA 3D9MA 2HM8A 1FVHA 4RSYA 2WQ6A 3CVQA 3G2UA 3QOUA 1E90A 1OWLA 2XCBA 4AEZC 2X6JA 4KVMA 4Y6CA 4GCOA 3OTNA 4N3BA 4DLOA 1JUQA 4NACA 2WQ7A 4B0ZA 4ATGA 1NA3A 2LAIA 2CG3A 2L0TB 4I1MA 4CT4A 3HDXA 3SZ7A 3FULA 4E85A 3PS6A 3PDNA 3MKRA 4L7TA 5ARGA 1HXIA 3FU3A 4DI4A 3QKYA 5M72A 2PM6A 4MKTA 1HF8A 3LY8A 3ASDA 3ZN3A 2R5SA 3PUJA 4Y6WA 3RO2A 1UJKA 4APOA 5BPPA 5AYWD 4Q69A 3SGHA 4FP7A 2XGOA 2VTBA 5FQ6A 2LSVA 1W3BA 2Y4TA 3TXMA 1IQRA 3LVRE 2UY1B 4G24A 1DNPA 2J49A 4RG6A 4JEUA 4F1SA 3FTXA 4G2VA 5G55A 5JHBA 4OYSA 3SFZA 4B89A 3G2VA 4ANUA 3KS2A 2FI7A 4O6FA 3U3WA 5BV0A 3FH5A 3G2TA 1E96B 1JWFA 1TJCA 3I4RB 4CCAA 4AY5A 2L6JA 5DIZA 3D9KA 2L9BA 4L23A 3RRNB 1Z6TA 5FZQA 4GPKA 2JLBA 1KT1A 2R17C 2UY1A 4GYWA 4BTAA 2BF0X 3OXLA 3RRUA 2WXJA 3B7SA 5JJTA 3K9IA 4DLQA 5KJMA 3FTSA 4BX8A 3MEKA 1XNFA 3SF4A 3L17A 3QWPA 3ML8A 3O48A 4ANWA 4WNGA 5D0OD 2DCPA 2XPZA 4JHRA 4TUUA 2V5FA 2MRIA 2RD0A 2IOLA 3PRZA 4H7XA 3B7UX 4I9EA 4A1SA 4F3VA 3FHEA 3ZYMA 1HE8A 2J9QA 4R7LA 5JJ7A 3JYSA 3LXUX 2FF4A 2ZU6B 5CMYA 3VLFA 3FWVA 2LNIA 2X38A 4HOSA 4GZDA 5KCMA 3B13A 3G2SA 4BTBA 4XKCA 4I2ZA 5D0QD 1Z3YA 3MGBA 2Y3AA 3CK9A 3LVQE 1OWNA 3LEWA 2WM9A 1Y8MA 4MS6A 2WXRA 3L13A 2FULA 2XHEA 2OVBA 3PZDA 2NXPA 3ASFA 3AS8A 2VGXA 4AP2A 3T5XA 3UMVA 4Q96A 5HI7A 4Q94A 2CG2A 3EDTB 3EIQC 4NRHB 5LP0A 4IULA 4JXTA 3CGHA 5KJKA 1XGWA 3O4ZA 5BW8C 2I6HA 4FADA 4JVSA 1E8ZA 4A1GA 4C9BB 3SNXA 4ANXA 4KMOA 4BX9A 1S0PA 3LPZA 3CEQA 3HVEA 3TG4A 4I6EA 3FDHA 1QNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HQ8 A;  4U04 A;  4UI9 C;  4YVO A;  5CHE E;  2KCK A;  4G23 A;  5A7D B;  4JA7 A;  2HO1 A;  4N5C A;  4G26 A;  3FFL A;  3CVQ A;  3QOU A;  3UQ3 A;  1WAO 1;  2OOE A;  2WPV A;  2XCB A;  4G25 A;  2KCL A;  4GCO A;  4HOQ A;  2LSU A;  4LEU A;  4N3B A;  4UQY A;  4Y6C A;  5FZS A;  1NA3 A;  4KXK B;  3S7D A;  4AY6 A;  3CKB A;  4H7Y A;  3CVN A;  4GZ6 A;  4GA2 A;  5G05 J;  4AM9 A;  4WNF A;  3SZ7 A;  3Q47 B;  4BWR A;  2PQR A;  3PDN A;  3MKR A;  5ARG A;  5FT9 A;  3R9A B;  1HXI A;  2HYZ A;  2KC7 A;  5LCW J;  3PE3 A;  3ZHE A;  3QKY A;  2OND A;  1PC2 A;  5M72 A;  1YA0 A;  4IN3 B;  4U0Z A;  4HOU A;  3LY8 A;  3ASD A;  3KD7 A;  4KBQ A;  3ZN3 A;  3LY7 A;  1B89 A;  2R5S A;  4RG9 A;  4I9C A;  4Y6W A;  3RO2 A;  1WM5 A;  4APO A;  5AYW D;  3VTY A;  3KAE A;  2AVP A;  2XGO A;  3NF1 A;  2PQN A;  4WNE A;  3WXX A;  2LSV A;  1W3B A;  2Y4T A;  4XIF A;  3N71 A;  3RU0 A;  3TGO A;  3OXF A;  3VTX A;  2UY1 B;  4HOR A;  3IEG A;  3GYZ A;  4G24 A;  5EX0 A;  4N3A A;  1NZN A;  2UWJ G;  2XGM A;  4RG6 A;  1ZU2 A;  3ZFW A;  3UPV A;  3AS5 A;  4G2V A;  1NA0 A;  2C0M A;  3CVP A;  2KAT A;  2XGS A;  2VQ2 A;  2FI7 A;  3KS2 A;  2VYI A;  4O6F A;  3RO3 A;  3ULQ A;  3U3W A;  3QWV A;  2VSN A;  4I2W A;  1E96 B;  2IF4 A;  1TJC A;  3Q49 B;  5BNW A;  3ASH A;  3CK8 A;  1QZ2 A;  3MA5 A;  3LYA A;  4GZ5 A;  4U07 A;  4W9R A;  4WND A;  2L6J A;  5DIZ A;  3S7F A;  5EKQ D;  4AY5 A;  4U0S A;  3Q4A B;  3QDN A;  3ZPJ A;  1ELW A;  2DBA A;  3LY9 A;  4WUY A;  5FZQ A;  2JLB A;  4N39 A;  5FTP A;  4GYY A;  5KJN A;  4GPK A;  4GA1 A;  1KT1 A;  5EX3 A;  1ZBP A;  3GZ2 A;  4N3C A;  2UY1 A;  2WQH A;  3CVL A;  4GYW A;  4AIF A;  4BTA A;  3OXL A;  4EQF A;  2BUG A;  4B94 A;  5JJT A;  3HYM B;  3ASG A;  3K9I A;  2Q7F A;  2Y4U A;  4XI9 A;  3GZ1 A;  1IYG A;  4GCN A;  5KJM A;  2HR2 A;  4UQZ A;  3MEK A;  1XNF A;  5JJ6 A;  3SF4 A;  2NC9 A;  2VGX B;  3QWP A;  3RJV A;  2MHK A;  5G05 C;  4JL0 A;  2XCC A;  3O48 A;  4WNG A;  5D0O D;  5LCW C;  3QWW A;  3ZHE B;  4JHR A;  2FEZ A;  2V5F A;  5G04 C;  3URZ A;  4I1A A;  4H7X A;  4A1S A;  3FP3 A;  3Q5M A;  3MV2 B;  4I9E A;  3PE4 A;  2FO7 A;  4F3V A;  4N2S A;  3OXG A;  4UQX A;  1A17 A;  4J8F A;  2J9Q A;  2P58 C;  3U4T A;  5JJ7 A;  3JYS A;  2FF4 A;  3Q15 A;  1ELR A;  1KT0 A;  4GYO A;  3FWV A;  2LNI A;  4U0U A;  3CV0 A;  3UUX A;  2YHC A;  4KYO B;  4UI9 J;  4HOS A;  2E2E A;  1P5Q A;  2FBN A;  5FZR A;  1OUV A;  4BTB A;  3S7B A;  1HZ4 A;  3CK7 A;  4N2Q A;  4I2Z A;  2QFC A;  5D0Q D;  5A6C A;  3CK9 A;  3BEE A;  3TG5 A;  1HH8 A;  5DBK A;  4J8E A;  5KJL A;  5G04 J;  3S7J A;  1Y8M A;  5CCL A;  4HOT A;  4J8D A;  3AS4 A;  3MV3 B;  3RKV A;  2C2L A;  4G1T A;  2VGY A;  2IFU A;  4BT9 A;  2PL2 A;  5CCM A;  4ME2 A;  3GW4 A;  4YVQ C;  5FJY A;  3ASF A;  3AS8 A;  2VGX A;  2XPI A;  4J0U A;  5HI7 A;  4CDR A;  2VSY A;  2C0L A;  4BT8 A;  1FCH A;  3LKU A;  4JA9 A;  3EDT B;  4NRH B;  4YND A;  2XEV A;  4CGW A;  4UI9 K;  4NQ0 A;  3ZGQ A;  2PZI A;  1IHG A;  4GA0 A;  5KJK A;  5BW8 C;  3CKC A;  3TAX A;  2I6H A;  4XI0 A;  5BT1 A;  2KCV A;  2GW1 A;  4ABN A;  5C1D A;  4GZ3 A;  1KLX A;  3E4B A;  3LPZ A;  5ARF A;  3CEQ A;  3ESK A;  1QQE A;  3LCA A;  4I17 A;  2YQ8 A;  4CGV A;  3RIB A;  3TG4 A; 
#chains in the Genus database with same CATH topology
 4YVO A;  2WXP A;  1LF8 A;  3Q73 A;  3FFL A;  3S7D A;  1H2U A;  4WWO A;  2KC7 A;  3ZKJ A;  4GTV A;  4U0Z A;  3CLJ A;  4UWG A;  3X2Q E;  1E7V A;  1OWP A;  4EZJ A;  3L22 A;  3FTY A;  2R03 A;  3IEG A;  3GYZ A;  4ACL A;  2F8X K;  2DYS E;  4M3O A;  2M63 A;  2XGS A;  3J5Q B;  3PVL A;  3CK8 A;  1QZ2 A;  3LYA A;  2ZIS A;  5FIO A;  2DBA A;  4GA1 A;  1ZBP A;  2BUG A;  4U8V D;  3UT7 A;  3HYM B;  1IYG A;  1SW6 A;  1Q2Z A;  4UQZ A;  4LUN U;  5JJ6 A;  5G05 C;  1AP7 A;  4JL0 A;  3ZUV B;  3UT8 A;  5JMN D;  3PUK A;  3Q5M A;  4UQX A;  3U4T A;  3ABK E;  1EDU A;  1LTX A;  5HRY A;  4UI9 J;  3D9H A;  3TWV A;  3B7R L;  3RRM B;  1BI7 B;  3MJW A;  2ETC A;  3MV3 B;  3QNK A;  3ZIM A;  4YVQ C;  4XKB A;  3ULE G;  4HXI A;  4UI9 K;  3CHO A;  3EJN A;  5BT1 A;  2XPY A;  3LCA A;  1WG0 A;  3CQG B;  4GMJ A;  3NQP A;  4HRM B;  2WPV A;  3R7R A;  3DST A;  3ZEF A;  4CRW A;  3SQV A;  3KD7 A;  3FEY A;  1SZ9 A;  1N4R A;  4X8Q A;  3CST A;  1ZU2 A;  3ZFW A;  2GRL A;  2WXO A;  3AG3 E;  4JB8 P;  2P9L G;  2VYI A;  4XE0 A;  2VSN A;  2Y0B G;  3Q49 B;  5BXU A;  4LRZ A;  4FUL A;  4ANV A;  1QYM A;  3PNL B;  1PY1 A;  3TJP A;  5LFA A;  3Q75 A;  3ASN E;  5ENN A;  4EPZ A;  4IYP A;  2BTD A;  4FA6 A;  2GGF A;  2X6H A;  3MCX A;  1A17 A;  3RAU A;  3P2B A;  5IY5 E;  4RQI A;  4A63 B;  3CSF A;  5CBN A;  2WXH A;  3S7B A;  4N2Q A;  2XEE A;  3HVE B;  4KZ0 A;  4J8D A;  1TN6 A;  1IKN D;  2VGY A;  5CCM A;  4TXP A;  3BG0 B;  4J0U A;  1FVF A;  1U3D A;  3UXG A;  4K5B A;  4GA0 A;  4PUC A;  3CKC A;  3UT4 A;  2KCV A;  4G8K A;  2BED A;  3FEX A;  4LER A;  1QQE A;  1N9A A;  3PZ1 A;  3FUN A;  2I2O A;  5EIB E;  4JHJ A;  2WXM A;  4EEC A;  2EIJ E;  4I1O B;  4AM9 A;  1BI8 B;  5FT9 A;  1FPP A;  3ZU7 B;  2HE0 A;  4IN3 B;  4MRU A;  1FT2 A;  3LY7 A;  1B89 A;  2AWI A;  4DUI A;  1OCO E;  4L2L A;  5ENR D;  3DBS A;  3ZYK A;  5ENO D;  3UTM A;  3PZ4 A;  5ENT D;  3HXB A;  3DXK G;  1E8W A;  3ESL A;  2MYO A;  2C0M A;  3CVP A;  3SI5 A;  3TL5 A;  4WAF A;  1UN8 A;  3PH0 C;  4WND A;  4P29 A;  2GRN B;  5EKQ D;  3L82 A;  3LY9 A;  4LNB A;  4YDY A;  4GYY A;  3GZ2 A;  5G2N A;  2XS1 A;  3AG1 E;  3NZU A;  3PEV B;  3MKQ B;  1GW6 A;  5EYP F;  4OAU C;  1UOH A;  2MOW A;  3SFX A;  2IO2 C;  4ZHB A;  3GZS A;  4J8F A;  4HBD A;  2KZT B;  4GYO A;  5CMW A;  2J4B A;  1NI1 A;  3APD A;  2EIN E;  1ELK A;  2QFC A;  3OAW A;  4NUR A;  5AQ7 A;  3D3M A;  2WXI A;  4A3T A;  2LXM A;  3LJN A;  5E76 A;  2C0L A;  5CEC B;  2B6C A;  2OV8 A;  1NL4 A;  4DX7 D;  1D8E A;  2JAB A;  4JZY A;  4ABN A;  5C1D A;  4ILG A;  4L9P A;  4L2Y A;  1OY3 D;  5HKP A;  5CBO A;  3QOU A;  4AEZ C;  4DLO A;  4GPK A;  2LAI A;  4LNU D;  4DX5 D;  3MKR A;  4L7T A;  1HF8 A;  3LY8 A;  3ZN3 A;  3PUJ A;  4Y6W A;  4N5Q A;  3TXM A;  1IQR A;  4HRN A;  3FTX A;  3AAA C;  5BV0 A;  1TJC A;  4YDO A;  2L6J A;  2P9N G;  2RKK A;  2L9B A;  2B0O E;  3Q9U C;  4GTR A;  4F6R D;  1KT1 A;  2R17 C;  2BF0 X;  5KJM A;  1LD7 A;  3L17 A;  3O48 A;  4ANW A;  2QYJ A;  2V5F A;  4H7X A;  4I9E A;  3DPY A;  3FWV A;  2X38 A;  4GTP A;  2R05 A;  3UM0 A;  3B13 A;  1Z3Y A;  2KXP C;  2FUL A;  3ASO E;  2CG2 A;  3EDT B;  4NRH B;  2OEV A;  2H6F A;  4F1P A;  5KJK A;  4A1G A;  4C9B B;  4ANX A;  3Q7F A;  4KVM A;  1QNF A;  5CHE E;  4MLP A;  3FTV A;  5ENS D;  3RK6 A;  4JA7 A;  3WG7 E;  3DSV A;  5T8I A;  3L08 A;  2IO3 C;  4A55 A;  2LSU A;  5B1A E;  4AXH A;  4EBA G;  3AU5 A;  5T3R A;  4WNF A;  4KZC A;  3FTU A;  1H0A A;  1WDY A;  3FY4 A;  4HOU A;  2XEN A;  4RG9 A;  2R02 A;  2H6G A;  4I6J A;  5CRU A;  4F53 A;  2EQX A;  3L9T A;  3JUI A;  3ISM C;  4HI8 A;  3NZS A;  3N71 A;  5CRV A;  4DJA A;  4U63 A;  3ABM E;  3RO3 A;  4EHM A;  4W9R A;  1INZ A;  1H6O A;  2I1K A;  3I4G A;  3V31 A;  3QDN A;  2LUH A;  2XZT G;  1JCS A;  4ATZ D;  3PRE A;  3HIZ A;  2WXK A;  3SBT B;  2NC9 A;  4GU5 A;  1K1A A;  3C98 A;  3D9I A;  2F0Y A;  4I1A A;  3PE4 A;  5ANL A;  1KT0 A;  4OAV B;  3CR3 A;  5AN8 A;  1TEZ A;  5FZR A;  2EIM E;  4BT9 A;  3QK0 A;  4BT8 A;  3LKU A;  4YND A;  1N0R A;  4O1P A;  4JW1 A;  1WY6 A;  4PS8 A;  3R9M A;  3MZL B;  5ITZ F;  3UX4 A;  3V2O A;  3C3Q A;  3SHF A;  4DX6 D;  1KZO A;  1SQM A;  2VSO E;  4BY6 A;  3MYV A;  3DRA A;  3MX3 A;  2CHW A;  4GA2 A;  4O1O A;  3Q47 B;  4LNG A;  5FWQ A;  1TN8 A;  3FU5 A;  5T4Y A;  4KBQ A;  3SY2 A;  3BUA A;  3MKQ A;  3QB2 A;  3CVU A;  2PQN A;  1Y6I A;  3TGO A;  3RU0 A;  4HS2 A;  4O60 A;  2Y1L E;  4GTM A;  2VQ2 A;  1Z5S C;  1N4P A;  1MX6 A;  4U07 A;  3FUK A;  3T8M A;  3FTZ A;  4U0S A;  3D9J A;  5EIL A;  1TNZ A;  4BFR A;  4AIF A;  4EQF A;  1HS6 A;  1IXV A;  3B7B A;  3FUE A;  1G3N B;  2FEZ A;  4M7C A;  2XS8 A;  2P58 C;  2WMO A;  2PNN A;  4LG6 A;  3Q15 A;  3E32 A;  4KYO B;  4WWP A;  2FBN A;  5A6C A;  4DX1 A;  1NFI E;  1O1T A;  4G1T A;  2ETA A;  2IFU A;  4ME2 A;  2AXV A;  2WB2 A;  4CDR A;  3E33 A;  4K03 A;  1MQS A;  3W9G A;  3UI2 A;  1OWO A;  5ARF A;  5LOZ A;  4CYM D;  1X81 A;  3UQ3 A;  1WAO 1;  2OOE A;  2P9U G;  3Q78 A;  3W9F A;  4GZ6 A;  2PQR A;  5LCW J;  4NIK A;  4ILH B;  2PM7 A;  4HI9 A;  3AU4 A;  3VLE A;  1OCC E;  4WNE A;  3WXX A;  3FU0 A;  5KBA A;  2WXF A;  2CFU A;  1OXJ A;  1MYO A;  2ILR A;  4QFV A;  2YHE A;  3EIJ A;  4WUY A;  2X3M A;  4XZ4 A;  4N3C A;  2Q7F A;  1U2V G;  3DWL G;  3QJZ A;  2MHK A;  3D9P A;  2XCC A;  5D2M C;  5LCW C;  5G04 C;  2WXQ A;  2J8S D;  4OVV A;  4HVB A;  3OXG A;  1JPL A;  4URK A;  4U0U A;  3EHM A;  5HS0 A;  3HXF A;  2P9I G;  3BEE A;  4MBG A;  4HLE A;  2IOS A;  2PL2 A;  5H7P A;  5J90 A;  2XPI A;  4JEH A;  2LO6 A;  4C0M A;  4CGW A;  3ZGQ A;  4XI0 A;  2ION A;  3UM3 A;  4A3V A;  4GTT A;  2OEW A;  1JCR A;  1O5M A;  3D9M A;  2HM8 A;  1FVH A;  4U95 D;  3CVQ A;  3G2U A;  1E90 A;  1V55 E;  2V4H C;  4GCO A;  4N3B A;  1JUQ A;  4ATG A;  4I1M A;  3FUL A;  3PDN A;  5ARG A;  1HXI A;  3T8K A;  4MKT A;  2R5S A;  5BPP A;  3SGH A;  4FP7 A;  2XGO A;  5FQ6 A;  5AQA A;  2LSV A;  3NOC D;  4G24 A;  1DNP A;  2J49 A;  2XZD G;  4F1S A;  1TNB A;  5JHB A;  3SFZ A;  3G2V A;  2BKG A;  3D9K A;  2JLB A;  5AAO A;  4GYW A;  3OXL A;  2WXJ A;  3B7S A;  3FTS A;  4BX8 A;  1XNF A;  3SF4 A;  4WNG A;  2DCP A;  1DCE A;  4JHR A;  3EHR A;  5CEA A;  5KCM A;  3ZNG A;  2Y3A A;  3LVQ E;  1OWN A;  3LEW A;  2WM9 A;  4GPM A;  3C72 A;  3L13 A;  3TWX A;  5KWD A;  2NXP A;  3ASF A;  3AS8 A;  3EUV A;  1D9S A;  1YYH A;  1XGW A;  1E8Z A;  3SNX A;  4KMO A;  3V2X A;  4BX9 A;  3TG4 A;  3FDH A;  2KCK A;  4AV7 A;  2HO1 A;  2L0I A;  4G26 A;  1N0Q A;  2WXL A;  3E34 A;  5EN5 D;  5G05 J;  3HG0 D;  3AJI A;  2IQC A;  2R59 A;  3ZHE A;  1E8X A;  2WVI A;  4CEM A;  1WM5 A;  3QC1 A;  3KAE A;  3U9W A;  2IY0 C;  3CVW A;  5JA4 D;  1PAQ A;  1UG3 A;  2UWJ G;  2KZT A;  2DYR E;  3AS5 A;  1NA0 A;  2AJA A;  4B8A A;  4I2W A;  2GRP B;  4FC8 A;  3EHN A;  4GZ5 A;  3FUF A;  1HO8 A;  3ZPJ A;  4RVB A;  3ONK A;  5EX3 A;  3CVX A;  3FUM A;  3FTW A;  1E8Y A;  4GCN A;  2OVF A;  3EU9 A;  4BES A;  4PH4 B;  3U66 A;  1SZA A;  3QWW A;  3URZ A;  2F37 A;  2X6F A;  4V3I A;  3CHR A;  2YHC A;  2AW6 A;  4DK5 A;  4UUC A;  2QC9 A;  4QQI A;  3HHM A;  2I9C A;  5ANR A;  3JQ0 A;  3J5P A;  1MZC A;  4JA9 A;  5FQ7 A;  3F6Q A;  4NQ0 A;  3NOG D;  3IHV A;  4B93 B;  3B95 A;  4GAA A;  1EYH A;  1U3C A;  4YDE A;  3ZXS A;  3V79 K;  1RW2 A;  3CVV A;  5HQ8 A;  4U04 A;  3JQ1 A;  4PDX A;  2KCL A;  4TXQ A;  4DI3 A;  3CKB A;  2R2L A;  3C3R A;  3SBS A;  4B8C B;  3C5R A;  2J07 A;  1MJ0 A;  4I9C A;  1LD8 A;  3HXE A;  3AG2 E;  1HG5 A;  2VJ8 A;  3FUD A;  4IRU A;  4E6H A;  3VTX A;  1S64 A;  2J4D A;  4FHK A;  5BUZ A;  3CHS A;  1NZN A;  1OT8 A;  2XGM A;  3R7Q A;  1H6P A;  1O1S A;  2CHZ A;  3NBN B;  3IKO B;  3QWV A;  3LDZ A;  3S7F A;  1JCQ A;  1N54 A;  5JHA A;  2YNQ A;  3PZ3 A;  4I6G A;  1VDY A;  4N39 A;  2LXL A;  2WQH A;  4AJW A;  2XRZ A;  5AJL A;  4XI9 A;  1DCQ A;  1KZP A;  2V0P A;  3BQO A;  3ZYQ A;  3KSL A;  3ZW3 A;  3APF A;  4J6I A;  2V4L A;  1DVP A;  2L6B A;  3Q9N C;  4ACK A;  3ZRH A;  1E7U A;  1HZ4 A;  1A5E A;  5EID A;  2X6I A;  3KSQ A;  4DRX E;  3U64 A;  4D10 C;  1TNO A;  3FUH A;  2RG8 A;  1FCH A;  2WMN A;  2BKK B;  4JC8 A;  1K8K G;  2H6H A;  3UIN C;  3TWU A;  1HU3 A;  3TAX A;  3ONL A;  4FU3 A;  4YDW A;  1KLX A;  5J08 A;  2X6K A;  2YQ8 A;  1UJJ A;  2P9K G;  3CHM A;  2EIL E;  4N5C A;  3FUI A;  3I3N A;  3DEP A;  1IQU A;  3IHY A;  5AIJ A;  4H7Y A;  4BWR A;  4GTQ A;  1OCR E;  2HYZ A;  3L6A A;  4F7A A;  1EPU A;  2NSZ A;  2KM4 A;  4UWK A;  4U8H A;  2I1J A;  1TNU A;  4U96 D;  1HX8 A;  3UPV A;  2KAT A;  3DSW A;  3FU6 A;  1K1B A;  1N52 A;  5BNW A;  4DX2 A;  4HLL A;  4WWN A;  2J09 A;  4Z68 A;  5FTP A;  1TN7 A;  3CIA A;  3TXN A;  4B94 A;  2JEK A;  3GZ1 A;  5B1B E;  3FUJ A;  4G11 A;  1JWG A;  4BET A;  4ILI A;  2ETB A;  3APC A;  3QAQ A;  4N2S A;  2IEJ A;  1Z3X A;  2GRQ B;  4KT6 B;  1OUV A;  5FQ4 A;  2GRM A;  2A4Z A;  4J7W A;  4XEI G;  1HH8 A;  5G04 J;  3D9O A;  5ENP D;  3HXD A;  4HNA D;  1EF1 C;  5A23 A;  3JXJ A;  4CDN A;  2VSY A;  3EU5 A;  3B7T A;  3CVY A;  4GZC A;  4K0R A;  2ZXW E;  3AG4 E;  3IBE A;  1AWC B;  5AEN A;  4CGV A;  1S70 B;  3RIB A;  5D66 A;  4RSY A;  2WQ6 A;  1OWL A;  2X6J A;  4Y6C A;  4K5C A;  2KBX A;  4CT4 A;  4C48 B;  3SZ7 A;  4E85 A;  3PS6 A;  4DI4 A;  5KNG A;  5M72 A;  4APO A;  5AYW D;  5BXO A;  2VTB A;  1W3B A;  2Y4T A;  3LVR E;  4RG6 A;  1FT1 A;  4G2V A;  5G55 A;  4OYS A;  4ANU A;  3KS2 A;  4O6F A;  3E37 A;  3FH5 A;  3G2T A;  1E96 B;  1JWF A;  5DIZ A;  3UM1 A;  3RRN B;  1Z6T A;  3DSX A;  2UY1 A;  3RRU A;  5JJT A;  2ZIR A;  3Q79 A;  3JXI A;  3QWP A;  4RLY A;  3TWS A;  2GRO B;  4G8L A;  2XPZ A;  3V30 A;  1D8D A;  3HRA A;  2MRI A;  3PRZ A;  2IOL A;  4R7L A;  5JJ7 A;  3LXU X;  2FF4 A;  1N94 A;  5CMY A;  2LNI A;  2P9P G;  2DVW A;  4GZD A;  2ZGG A;  4BTB A;  4XKC A;  3MGB A;  1Y8M A;  2OVB A;  3PZD A;  2VGX A;  3T5X A;  3EIQ C;  5LP0 A;  4IUL A;  3TWQ A;  3NB2 A;  3O4Z A;  5BW8 C;  4FAD A;  2I6H A;  4JVS A;  3UIO C;  1S0P A;  3HVE A;  5KNH D;  1BD8 A;  4UI9 C;  2DZO A;  4G23 A;  3VLD A;  3CHQ A;  5FZS A;  4L1B A;  1SA5 A;  1TNY A;  4J8Y A;  5BV1 A;  2VTB B;  2YIN A;  1YA0 A;  3CQC B;  4U8Y D;  3BG1 B;  3UM2 A;  3VTY A;  2AVP A;  4DPR A;  3ZYL A;  3OXF A;  2RFM A;  4N3A A;  3TWT A;  3FH7 A;  1V54 E;  4PS7 A;  4CDM A;  1H6K A;  3BU8 A;  1MHQ A;  1HFA A;  3Q4A B;  4FJZ A;  2WXN A;  4UWH A;  2EIK E;  4GMR A;  3ASG A;  2VGX B;  2QZA A;  5E75 A;  2Y69 E;  4AVX A;  4EZL A;  2V8S E;  3ABL E;  4JPS A;  3DSU A;  4GB9 A;  3ZVV A;  4U7E B;  1QBQ A;  3ML9 A;  1OWM A;  4FJY A;  4HFG A;  3CK7 A;  3TG5 A;  1UN9 A;  5B3S E;  4HOT A;  3T5V A;  3I5P A;  4BEP A;  3UKR G;  3GW4 A;  5FJY A;  5C2Y A;  2OCC E;  4PS3 A;  2XEV A;  2QYU A;  5FQ8 A;  2GW1 A;  1BU9 A;  4GZ3 A;  3UUX A;  2A5E A;  1L5J A;  4FHJ A;  1X5B A;  3ESK A;  2CFZ A;  3HXC A;  3L54 A;  1N4S A;  4G25 A;  3SFY A;  4KXK B;  2A5U A;  5AQB A;  3R9A B;  3PE3 A;  2OND A;  1PC2 A;  1N4Q A;  1H2V C;  4BSX A;  3NF1 A;  4I43 A;  3ENE A;  2QY7 A;  2F8Y A;  3SD5 A;  2LAH A;  5EX0 A;  2IU1 A;  4J8S A;  5LX8 A;  2DZN A;  4AOF A;  2J08 A;  1NP7 A;  5AJD A;  1KPS B;  1N95 A;  3MA5 A;  3DPD A;  3RSE G;  4TXR A;  2RFA A;  2IJG X;  4EZK A;  4TV3 A;  3CVL A;  2E0I A;  2P2C P;  2HR2 A;  3RJV A;  2P9S G;  4C0E A;  2XQ0 A;  2AXU A;  4FLB A;  2XRY A;  3FP3 A;  3L16 A;  2FO7 A;  1ELR A;  2AXZ A;  3G2W A;  3CV0 A;  2E2E A;  1P5Q A;  5KJL A;  4J8E A;  5CCL A;  3AS4 A;  1S63 A;  2C2L A;  3D9N A;  2V5Q C;  1RZ4 A;  4XX5 A;  1K3Z D;  3Q7A A;  4FLH A;  2PZI A;  1IHG A;  1UW4 B;  3S2A A;  3FH8 A;  5AAR A;  4LCT A;  4I17 A;  3UIP C;  4KVO A;  2XEH A;  3P1U A;  2ZGD A;  1YMP A;  5A7D B;  3TWR A;  4HQD A;  1BLX B;  4HOQ A;  4LEU A;  4UQY A;  3IV0 A;  4BSZ B;  4CT0 A;  4AY6 A;  3CHP A;  3EHQ A;  3JUE A;  3CVN A;  3T9K A;  3KEZ A;  1TJF A;  3LS8 A;  5CED B;  2VSX E;  5EDS A;  5CER B;  4XIF A;  3D9L A;  4HOR A;  3PNT B;  1BPO A;  4TUM A;  4OVU A;  1MX4 A;  2GRR B;  2FO1 E;  1H19 A;  4TRQ A;  3ULQ A;  2IF4 A;  2DIW A;  3ASH A;  4APF A;  3LJ3 A;  3PEU B;  1ELW A;  3QAR A;  3DXM G;  3ULY A;  5KJN A;  2WXG A;  3PZ2 A;  3UKU G;  2Y4U A;  3ZXP A;  3JCK C;  3ZHE B;  3MV2 B;  4UWL A;  1O1R A;  3C3O A;  3KEA A;  1HG2 A;  4GML A;  2DWZ A;  3SO8 A;  4JHK A;  5DBK A;  3S7J A;  3IXE A;  3RKV A;  4UWF A;  5ENQ D;  4JD2 G;  2CHX A;  2H6I A;  1H2T C;  4GTS A;  4GTO A;  3E4B A;  4EBA A;  1SVX A;  2XCB A;  2WQ7 A;  3OTN A;  4NAC A;  4B0Z A;  1NA3 A;  2CG3 A;  2L0T B;  1TYQ G;  3HDX A;  3FU3 A;  3QKY A;  2PM6 A;  2VGE A;  3ASD A;  4ZFH A;  3RO2 A;  1UJK A;  3DSS A;  4Q69 A;  1IHB A;  3NAW A;  2UY1 B;  4JEU A;  4HB5 A;  4B89 A;  2FI7 A;  3U3W A;  3I4R B;  4CCA A;  4AY5 A;  3DEO A;  4L23 A;  4HRL A;  5FZQ A;  1N11 A;  1ZB1 A;  4BTA A;  4LSZ E;  3K9I A;  4DLQ A;  5AQ9 A;  3MEK A;  5FIN A;  2NYJ A;  3ML8 A;  5D0O D;  4TUU A;  2RD0 A;  4A1S A;  4F3V A;  3B7U X;  3FHE A;  3ZYM A;  1TR4 A;  1HE8 A;  2J9Q A;  4BER A;  3JYS A;  2ZU6 B;  3VLF A;  4HOS A;  3G2S A;  4K5A B;  4I2Z A;  1DC2 A;  5D0Q D;  3CK9 A;  1OCZ E;  4MS6 A;  2WXR A;  3TWW A;  2XHE A;  4AP2 A;  4CZ2 D;  3UMV A;  1YCS B;  4Q96 A;  5HI7 A;  3E30 A;  4Q94 A;  1MX2 A;  4JXT A;  3CGH A;  5EYL A;  3LPZ A;  1SA4 A;  3CEQ A;  4I6E A; 
#chains in the Genus database with same CATH homology
 4UI9 C;  4YVO A;  5CHE E;  2KCK A;  2WXP A;  3FTV A;  1LF8 A;  4G23 A;  4JA7 A;  4MLP A;  3RK6 A;  2HO1 A;  4AV7 A;  2L0I A;  4G26 A;  5T8I A;  3FFL A;  3L08 A;  3VLD A;  2WXL A;  4A55 A;  3CHQ A;  2LSU A;  5FZS A;  4L1B A;  3S7D A;  4AXH A;  4EBA G;  3AU5 A;  5G05 J;  5T3R A;  1H2U A;  4WWO A;  5BV1 A;  4WNF A;  4KZC A;  3FTU A;  2VTB B;  2KC7 A;  2IQC A;  1H0A A;  2R59 A;  3ZHE A;  1E8X A;  2WVI A;  2YIN A;  1YA0 A;  3CQC B;  3FY4 A;  4HOU A;  3CLJ A;  4U0Z A;  4UWG A;  4CEM A;  4RG9 A;  1E7V A;  1OWP A;  1WM5 A;  3BG1 B;  4I6J A;  4F53 A;  3QC1 A;  3KAE A;  3VTY A;  4EZJ A;  2AVP A;  2EQX A;  3U9W A;  3JUI A;  3CVW A;  3NZS A;  3L22 A;  3N71 A;  3ZYL A;  3OXF A;  1PAQ A;  3FTY A;  4DPR A;  3IEG A;  3GYZ A;  4ACL A;  1UG3 A;  4N3A A;  2UWJ G;  2KZT A;  3AS5 A;  3FH7 A;  4DJA A;  1NA0 A;  4M3O A;  2M63 A;  4U63 A;  2XGS A;  4B8A A;  3RO3 A;  4PS7 A;  4I2W A;  4CDM A;  3PVL A;  1H6K A;  3CK8 A;  3EHN A;  1QZ2 A;  4FC8 A;  3LYA A;  4GZ5 A;  4W9R A;  1MHQ A;  1HFA A;  1INZ A;  2I1K A;  3Q4A B;  3I4G A;  3FUF A;  1HO8 A;  3QDN A;  3ZPJ A;  4FJZ A;  2DBA A;  4RVB A;  2WXN A;  3ONK A;  4GA1 A;  5EX3 A;  3CVX A;  1ZBP A;  4UWH A;  3FUM A;  3FTW A;  2BUG A;  3UT7 A;  1E8Y A;  3ASG A;  3HYM B;  1IYG A;  3PRE A;  3HIZ A;  4GCN A;  2WXK A;  4UQZ A;  3SBT B;  4LUN U;  5JJ6 A;  2NC9 A;  2VGX B;  5E75 A;  4GU5 A;  2OVF A;  3C98 A;  5G05 C;  3D9I A;  4JL0 A;  4PH4 B;  4AVX A;  1SZA A;  4EZL A;  3U66 A;  2V8S E;  3QWW A;  3UT8 A;  3URZ A;  4JPS A;  3PUK A;  4I1A A;  2X6F A;  3Q5M A;  4GB9 A;  3PE4 A;  3ZVV A;  5ANL A;  4UQX A;  3U4T A;  4V3I A;  1EDU A;  3CHR A;  3ML9 A;  1KT0 A;  2YHC A;  1OWM A;  4UI9 J;  4FJY A;  3CR3 A;  1TEZ A;  2AW6 A;  4HFG A;  5FZR A;  3B7R L;  3RRM B;  4DK5 A;  3CK7 A;  3TG5 A;  1UN9 A;  3HHM A;  3MJW A;  2I9C A;  5ANR A;  3JQ0 A;  3I5P A;  3MV3 B;  3T5V A;  3QNK A;  4HOT A;  4BT9 A;  3ZIM A;  4YVQ C;  3GW4 A;  5FJY A;  3QK0 A;  5C2Y A;  4PS3 A;  4XKB A;  4BT8 A;  3LKU A;  4JA9 A;  4YND A;  5FQ7 A;  4HXI A;  2XEV A;  4UI9 K;  4NQ0 A;  3IHV A;  3CHO A;  4GAA A;  1EYH A;  3EJN A;  1U3C A;  4JW1 A;  5BT1 A;  1WY6 A;  5FQ8 A;  3ZXS A;  2GW1 A;  4PS8 A;  2XPY A;  4GZ3 A;  3UUX A;  1L5J A;  4FHJ A;  1X5B A;  3ESK A;  3LCA A;  3MZL B;  2CFZ A;  3UX4 A;  3CVV A;  5HQ8 A;  4U04 A;  3JQ1 A;  3SHF A;  3L54 A;  3CQG B;  1SQM A;  2VSO E;  4BY6 A;  4GMJ A;  3MYV A;  3NQP A;  3MX3 A;  2CHW A;  2WPV A;  4PDX A;  4G25 A;  2KCL A;  4KXK B;  4DI3 A;  3CKB A;  4GA2 A;  2A5U A;  3Q47 B;  3R7R A;  5FWQ A;  3R9A B;  3FU5 A;  3SBS A;  3PE3 A;  4B8C B;  2OND A;  1PC2 A;  3ZEF A;  2J07 A;  5T4Y A;  4CRW A;  3KD7 A;  4KBQ A;  3FEY A;  4I9C A;  1H2V C;  1HG5 A;  3MKQ A;  4BSX A;  3QB2 A;  3CVU A;  3NF1 A;  2VJ8 A;  3FUD A;  2PQN A;  4I43 A;  4IRU A;  1SZ9 A;  1Y6I A;  3ENE A;  2QY7 A;  4HS2 A;  3RU0 A;  3VTX A;  3SD5 A;  2J4D A;  4E6H A;  3TGO A;  2LAH A;  4FHK A;  5BUZ A;  3CHS A;  3CST A;  5EX0 A;  1NZN A;  2IU1 A;  2XGM A;  4J8S A;  3R7Q A;  1ZU2 A;  3ZFW A;  2GRL A;  5LX8 A;  2WXO A;  4AOF A;  2CHZ A;  2J08 A;  2VQ2 A;  2VYI A;  3IKO B;  1NP7 A;  4XE0 A;  5AJD A;  3QWV A;  2VSN A;  3LDZ A;  3Q49 B;  3MA5 A;  3DPD A;  4U07 A;  3FUK A;  3S7F A;  4LRZ A;  1N54 A;  3T8M A;  3FTZ A;  4U0S A;  4FUL A;  5JHA A;  2YNQ A;  3D9J A;  2IJG X;  4I6G A;  4ANV A;  4EZK A;  1VDY A;  4N39 A;  4TV3 A;  3PNL B;  1PY1 A;  4BFR A;  2WQH A;  3CVL A;  4AIF A;  4AJW A;  4EQF A;  2XRZ A;  5AJL A;  2E0I A;  3TJP A;  4XI9 A;  1HS6 A;  2HR2 A;  2V0P A;  5LFA A;  3FUE A;  3RJV A;  5ENN A;  3ZYQ A;  4C0E A;  3ZW3 A;  2XQ0 A;  2AXU A;  3APF A;  4EPZ A;  4FLB A;  4IYP A;  4J6I A;  2BTD A;  2FEZ A;  2V4L A;  4FA6 A;  2XRY A;  3FP3 A;  1DVP A;  3L16 A;  2FO7 A;  2GGF A;  2X6H A;  3MCX A;  1A17 A;  2P58 C;  2WMO A;  3P2B A;  4ACK A;  3ZRH A;  3Q15 A;  1ELR A;  2AXZ A;  3G2W A;  1E7U A;  3CV0 A;  4KYO B;  3CSF A;  2E2E A;  4WWP A;  1P5Q A;  2FBN A;  2WXH A;  3S7B A;  1HZ4 A;  4N2Q A;  5A6C A;  5KJL A;  3HVE B;  2X6I A;  4J8E A;  4KZ0 A;  5CCL A;  4J8D A;  3AS4 A;  2C2L A;  4G1T A;  3D9N A;  2VGY A;  2IFU A;  5CCM A;  3U64 A;  4ME2 A;  2AXV A;  4D10 C;  3BG0 B;  4J0U A;  4XX5 A;  1FVF A;  3FUH A;  2WB2 A;  1U3D A;  4CDR A;  2RG8 A;  1FCH A;  2WMN A;  4JC8 A;  4FLH A;  4K03 A;  2PZI A;  1IHG A;  4GA0 A;  1MQS A;  1HU3 A;  4PUC A;  3CKC A;  3TAX A;  3UT4 A;  3ONL A;  1UW4 B;  2KCV A;  4FU3 A;  3S2A A;  1OWO A;  3FH8 A;  4LCT A;  1KLX A;  3FEX A;  4LER A;  5ARF A;  4I17 A;  1QQE A;  2X6K A;  5J08 A;  2YQ8 A;  5LOZ A;  1UJJ A;  4KVO A;  3CHM A;  3P1U A;  3FUN A;  5A7D B;  4N5C A;  2I2O A;  3FUI A;  4JHJ A;  3UQ3 A;  1WAO 1;  2OOE A;  3I3N A;  1IQU A;  2WXM A;  4HOQ A;  4LEU A;  3IV0 A;  4UQY A;  3IHY A;  4CT0 A;  4EEC A;  5AIJ A;  4AY6 A;  3CHP A;  4I1O B;  4H7Y A;  3CVN A;  4GZ6 A;  4AM9 A;  4BWR A;  2PQR A;  5FT9 A;  5LCW J;  2HYZ A;  3L6A A;  3KEZ A;  4F7A A;  1TJF A;  4IN3 B;  4MRU A;  1EPU A;  2NSZ A;  3LS8 A;  4ILH B;  2KM4 A;  2PM7 A;  3LY7 A;  1B89 A;  2AWI A;  3AU4 A;  4UWK A;  3VLE A;  2VSX E;  4L2L A;  3DBS A;  3ZYK A;  4WNE A;  4U8H A;  3WXX A;  5EDS A;  4XIF A;  3FU0 A;  2I1J A;  3D9L A;  4HOR A;  3PNT B;  1E8W A;  1HX8 A;  3ESL A;  3UPV A;  1BPO A;  2WXF A;  2CFU A;  4OVU A;  2C0M A;  3CVP A;  3SI5 A;  2KAT A;  1H19 A;  3FU6 A;  4TRQ A;  3ULQ A;  3TL5 A;  1N52 A;  4WAF A;  2DIW A;  1UN8 A;  2IF4 A;  2ILR A;  3PH0 C;  3ASH A;  4QFV A;  5BNW A;  4WND A;  4P29 A;  4APF A;  3LJ3 A;  5EKQ D;  4WWN A;  2J09 A;  3PEU B;  1ELW A;  2YHE A;  3EIJ A;  3LY9 A;  2X3M A;  3QAR A;  4WUY A;  5KJN A;  5FTP A;  4GYY A;  4XZ4 A;  3GZ2 A;  4N3C A;  5G2N A;  2WXG A;  3CIA A;  3TXN A;  4B94 A;  3NZU A;  2JEK A;  2Q7F A;  2Y4U A;  3GZ1 A;  3FUJ A;  3PEV B;  3MKQ B;  1GW6 A;  3QJZ A;  2MHK A;  3D9P A;  2XCC A;  4G11 A;  1JWG A;  3JCK C;  5LCW C;  4ILI A;  3ZHE B;  3APC A;  3QAQ A;  5G04 C;  2MOW A;  2WXQ A;  3MV2 B;  4N2S A;  4UWL A;  4OVV A;  1Z3X A;  4HVB A;  3OXG A;  3GZS A;  4J8F A;  2KZT B;  1JPL A;  4GYO A;  4URK A;  5CMW A;  4U0U A;  2J4B A;  3EHM A;  3APD A;  4KT6 B;  1HG2 A;  1ELK A;  1OUV A;  4GML A;  5FQ4 A;  2QFC A;  2GRM A;  2A4Z A;  3OAW A;  3BEE A;  1HH8 A;  4JHK A;  5DBK A;  4NUR A;  5G04 J;  3S7J A;  3D9O A;  3RKV A;  3D3M A;  4HLE A;  1EF1 C;  4UWF A;  2IOS A;  2WXI A;  2PL2 A;  5A23 A;  5J90 A;  4CDN A;  2XPI A;  4A3T A;  4JEH A;  5E76 A;  2VSY A;  2C0L A;  2LO6 A;  4C0M A;  2CHX A;  3B7T A;  4CGW A;  3CVY A;  1H2T C;  3ZGQ A;  2OV8 A;  4GZC A;  4K0R A;  4XI0 A;  2ION A;  3IBE A;  4JZY A;  4A3V A;  4ABN A;  5C1D A;  3E4B A;  5AEN A;  4CGV A;  4ILG A;  4L2Y A;  3RIB A;  4EBA A;  3D9M A;  2HM8 A;  1FVH A;  4RSY A;  2WQ6 A;  3CVQ A;  3G2U A;  3QOU A;  1E90 A;  1OWL A;  2XCB A;  4AEZ C;  2X6J A;  4KVM A;  4Y6C A;  4GCO A;  3OTN A;  4N3B A;  4DLO A;  1JUQ A;  4NAC A;  2WQ7 A;  4B0Z A;  4ATG A;  1NA3 A;  2LAI A;  2CG3 A;  2L0T B;  4I1M A;  4CT4 A;  3HDX A;  3SZ7 A;  3FUL A;  4E85 A;  3PS6 A;  3PDN A;  3MKR A;  4L7T A;  5ARG A;  1HXI A;  3FU3 A;  4DI4 A;  3QKY A;  5M72 A;  2PM6 A;  4MKT A;  1HF8 A;  3LY8 A;  3ASD A;  3ZN3 A;  2R5S A;  3PUJ A;  4Y6W A;  3RO2 A;  1UJK A;  4APO A;  5BPP A;  5AYW D;  4Q69 A;  3SGH A;  4FP7 A;  2XGO A;  2VTB A;  5FQ6 A;  2LSV A;  1W3B A;  2Y4T A;  3TXM A;  1IQR A;  3LVR E;  2UY1 B;  4G24 A;  1DNP A;  2J49 A;  4RG6 A;  4JEU A;  4F1S A;  3FTX A;  4G2V A;  5G55 A;  5JHB A;  4OYS A;  3SFZ A;  4B89 A;  3G2V A;  4ANU A;  3KS2 A;  2FI7 A;  4O6F A;  3U3W A;  5BV0 A;  3FH5 A;  3G2T A;  1E96 B;  1JWF A;  1TJC A;  3I4R B;  4CCA A;  4AY5 A;  2L6J A;  5DIZ A;  3D9K A;  2L9B A;  4L23 A;  3RRN B;  1Z6T A;  5FZQ A;  4GPK A;  2JLB A;  1KT1 A;  2R17 C;  2UY1 A;  4GYW A;  4BTA A;  2BF0 X;  3OXL A;  3RRU A;  2WXJ A;  3B7S A;  5JJT A;  3K9I A;  4DLQ A;  5KJM A;  3FTS A;  4BX8 A;  3MEK A;  1XNF A;  3SF4 A;  3L17 A;  3QWP A;  3ML8 A;  3O48 A;  4ANW A;  4WNG A;  5D0O D;  2DCP A;  2XPZ A;  4JHR A;  4TUU A;  2V5F A;  2MRI A;  2RD0 A;  2IOL A;  3PRZ A;  4H7X A;  3B7U X;  4I9E A;  4A1S A;  4F3V A;  3FHE A;  3ZYM A;  1HE8 A;  2J9Q A;  4R7L A;  5JJ7 A;  3JYS A;  3LXU X;  2FF4 A;  2ZU6 B;  5CMY A;  3VLF A;  3FWV A;  2LNI A;  2X38 A;  4HOS A;  4GZD A;  5KCM A;  3B13 A;  3G2S A;  4BTB A;  4XKC A;  4I2Z A;  5D0Q D;  1Z3Y A;  3MGB A;  2Y3A A;  3CK9 A;  3LVQ E;  1OWN A;  3LEW A;  2WM9 A;  1Y8M A;  4MS6 A;  2WXR A;  3L13 A;  2FUL A;  2XHE A;  2OVB A;  3PZD A;  2NXP A;  3ASF A;  3AS8 A;  2VGX A;  4AP2 A;  3T5X A;  3UMV A;  4Q96 A;  5HI7 A;  4Q94 A;  2CG2 A;  3EDT B;  3EIQ C;  4NRH B;  5LP0 A;  4IUL A;  4JXT A;  3CGH A;  5KJK A;  1XGW A;  3O4Z A;  5BW8 C;  2I6H A;  4FAD A;  4JVS A;  1E8Z A;  4A1G A;  4C9B B;  3SNX A;  4ANX A;  4KMO A;  4BX9 A;  1S0P A;  3LPZ A;  3CEQ A;  3HVE A;  3TG4 A;  4I6E A;  3FDH A;  1QNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...