2HYZA

Crystal structure of an 8 repeat consensus tpr superhelix (orthorombic crystal form)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
136
structure length
136
Chain Sequence
AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNTHETIC CONSENSUS TPR PROTEIN
publication title Structure and stability of designed TPR protein superhelices: unusual crystal packing and implications for natural TPR proteins.
pubmed doi rcsb
molecule tags De novo protein
total genus 56
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2006-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2hyzA00
4KBQA 5FZSA 3GZ1A 4GZ5A 3UUXA 3U3WA 1PC2A 5LCWJ 5G05J 4N3AA 3AS8A 3WXXA 2IF4A 2OOEA 4AY6A 3NF1A 3S7FA 2KC7A 4WNEA 3PE3A 1WAO1 4UQYA 2VGYA 1ZU2A 2VSNA 4H7YA 3PE4A 3JYSA 3ASDA 4I17A 5KJLA 4U0UA 3S7JA 2LNIA 3ZN3A 2NC9A 4BTBA 5ARGA 4I1AA 5BW8C 5G04J 3CVQA 5HQ8A 3LPZA 4HOQA 3N71A 2J9QA 3LYAA 4HOTA 1B89A 4GCOA 1HXIA 2GW1A 4UI9K 3CK9A 4J0UA 5BT1A 5CHEE 4G1TA 5JJ6A 3GYZA 3RIBA 3MV3B 3U4TA 4GA2A 4GZ6A 2V5FA 2XEVA 1W3BA 4N5CA 3CKCA 3KD7A 1YA0A 3CEQA 4UQZA 4J8DA 4YVQC 4J8EA 3O48A 2YHCA 2R5SA 2WPVA 3CK8A 3LCAA 3Q15A 1QZ2A 5CCMA 3HYMB 4YNDA 3RKVA 2XCBA 3R9AB 3RO3A 4U0ZA 3ZFWA 4GYOA 3K9IA 5ARFA 3CVNA 4GPKA 4N3CA 3CV0A 2FBNA 3PDNA 1ELWA 3GW4A 2HO1A 4APOA 1ZBPA 4UI9C 2KATA 3FP3A 4BT8A 1Y8MA 1WM5A 3OXFA 4RG9A 4AM9A 3MKRA 4W9RA 2FI7A 4NRHB 3VTXA 4KYOB 2XGSA 5BNWA 2Y4TA 4ABNA 2PQRA 4N39A 3UQ3A 4N3BA 2JLBA 3S7BA 5JJ7A 2YQ8A 2L6JA 2E2EA 3QWWA 2XGOA 4AY5A 1OUVA 2UWJG 4A1SA 2WQHA 3QDNA 5EX3A 4GA0A 5HI7A 1XNFA 1HZ4A 3ZGQA 4BWRA 4WNDA 4AIFA 4ME2A 3LKUA 4I9CA 3GZ2A 3SF4A 1QQEA 5A7DB 3TG5A 4RG6A 4JL0A 4U04A 3EDTB 5C1DA 4GYYA 5G04C 4EQFA 3CKBA 3ZPJA 3E4BA 4B94A 1NZNA 5FT9A 1NA0A 2AVPA 3RJVA 2BUGA 5FZRA 3CK7A 5DBKA 4GA1A 3QWVA 2IFUA 3TGOA 4IN3B 4XI0A 4JA7A 1TJCA 2FO7A 3Q5MA 5KJNA 2FF4A 3Q49B 3LY8A 4G2VA 5KJKA 3QWPA 4NQ0A 3AS4A 2XCCA 5M72A 3MEKA 4UI9J 1ELRA 4XIFA 4BTAA 4WNGA 2VGXA 3ZHEB 3ZHEA 4GZ3A 4N2QA 3TAXA 3LY9A 4HOUA 3RO2A 4G24A 1FCHA 4G23A 4XI9A 1IYGA 5A6CA 2KCKA 2MHKA 3ULQA 4HORA 3OXGA 3ASGA 3ASFA 3QKYA 5EX0A 4N2SA 4G26A 5EKQD 5LCWC 5G05C 1A17A 5KJMA 4CGWA 3OXLA 2PL2A 4BT9A 2DBAA 3ESKA 3FFLA 4I2ZA 4GYWA 3CVLA 5FTPA 4I9EA 2KCLA 3Q47B 4Y6WA 2FEZA 4HOSA 4WUYA 4GCNA 4J8FA 1KT0A 3Q4AB 2HR2A 3RU0A 2VSYA 5CCLA 2P58C 1IHGA 5DIZA 3BEEA 2VYIA 1KLXA 2XGMA 3MA5A 5AYWD 1P5QA 2C0LA 3MV2B 2VQ2A 2Y4UA 3AS5A 1HH8A 2Q7FA 4G25A 1E96B 2C0MA 4F3VA 4Y6CA 3LY7A 4I2WA 1KT1A 2LSVA 2C2LA 4JA9A 3UPVA 3ASHA 4H7XA 4U07A 2PQNA 4WNFA 3VTYA 1NA3A 2KCVA 4U0SA 3IEGA 4UQXA 3SZ7A 2PZIA 3CVPA 2QFCA 4CDRA 3KS2A 4KXKB 4O6FA 4JHRA 3S7DA 2XPIA 2VGXB 3URZA 5D0QD 3QOUA 4YVOA 2HYZA 5JJTA 4CGVA 2I6HA 2UY1B 4LEUA 3TG4A 3FWVA 2UY1A 5FJYA 2ONDA 3KAEA 5D0OD 2LSUA 5FZQA
chains in the Genus database with same CATH superfamily
2CHZA 5IY5E 4HLLA 3ZYLA 4DX2A 4GZ5A 1PY1A 2V0PA 3Q73A 4JEUA 3WXXA 3DBSA 2R17C 1JCSA 3QARA 4WNEA 4UQYA 3C3QA 3BG1B 3DEPA 1IQRA 3UX4A 2H6FA 2BEDA 1JUQA 1YMPA 3DPDA 3UT7A 2LNIA 3ZN3A 4MS6A 5ARGA 4I1AA 5HQ8A 4L23A 1OCZE 5AIJA 4GCOA 2V4HC 1HXIA 5A23A 4UWFA 4UWLA 2WXIA 1NP7A 1DVPA 5CHEE 4G1TA 3GYZA 4BERA 3D9MA 4XEIG 4V3IA 3UIOC 3QB2A 3TJPA 2VTBA 3CKCA 1YA0A 3CEQA 2PNNA 2ZISA 4G8LA 4XKCA 3Q15A 4YNDA 5EIDA 3R9AB 2LXMA 4YDEA 3RO3A 4U0ZA 3APCA 1QYMA 4Z68A 1O1RA 1OCOE 5ARFA 1SW6A 4I1MA 1E8WA 3I4GA 2J49A 3FH8A 3ONKA 5JHBA 3PZ1A 1KZPA 1YYHA 1ZBPA 3ZW3A 2X6FA 1H6OA 5ANRA 1H0AA 4HXIA 5JMND 2AXZA 5KNGA 4HI9A 4RG9A 1OY3D 4AEZC 2CHXA 3R9MA 2XGSA 3FTSA 4ABNA 4AVXA 4ATGA 2WXGA 3TWWA 4DLQA 2JLBA 3CVUA 2OV8A 2YQ8A 5FIOA 2E2EA 3QWWA 5EX3A 5HI7A 1BLXB 2QYUA 2XEEA 4FLHA 3RSEG 2ZIRA 4B93B 3ESLA 3ZU7B 3MCXA 3LKUA 3EJNA 4I9CA 1LD8A 2WXRA 5A7DB 3TG5A 4B89A 3EHQA 2X3MA 2WXJA 2L9BA 5EN5D 2P9SG 4WWPA 2B0OE 3CKBA 1Z3YA 4F53A 1N4SA 1OWMA 3E4BA 5CMYA 1H19A 4B94A 2XZDG 2Y69E 1NZNA 4J8SA 2ZGDA 3PZ4A 3UT4A 4JB8P 3MKQB 5DBKA 4GA1A 3ZKJA 4PS3A 4O1PA 1MX4A 3Q5MA 3ASOE 3T5XA 4I1OB 5LFAA 2XPYA 3G2SA 2IU1A 2I9CA 4GTRA 2WXKA 4NQ0A 3F6QA 1OT8A 4EECA 5M72A 4XKBA 4PDXA 4BTAA 3EUVA 3LXUX 3NB2A 3FU6A 3FTXA 3FTYA 4DK5A 2WQ7A 3TAXA 1N54A 3FUNA 4XI9A 1OXJA 2R03A 3PREA 2KCKA 4RVBA 3ML8A 3FH7A 3ASGA 4URKA 5EX0A 5G55A 4GZCA 2BTDA 3BQOA 3TL5A 3SO8A 1BPOA 3AG1E 1A17A 1XGWA 5KJMA 4CGWA 1U2VG 2IO2C 2PL2A 4GYWA 2AW6A 1GW6A 5FTPA 1AWCB 3PUKA 2ZU6B 4ACLA 1SVXA 4UUCA 2ETAA 4WUYA 4C48B 1HO8A 2QZAA 4J8FA 2ZGGA 1KT0A 1RZ4A 3RU0A 3QC1A 2P58C 1UJKA 3T8KA 5AAOA 4RQIA 2XPZA 3L9TA 2VJ8A 3I3NA 1P5QA 3B95A 4HB5A 4G25A 2XHEA 4G8KA 3ZYKA 1KT1A 4M3OA 4DUIA 4CRWA 3PZDA 2C2LA 2NYJA 3HXCA 4EBAA 5FQ4A 3SQVA 1NA3A 2KCVA 3L6AA 2CG2A 3IEGA 2IO3C 4UQXA 1Z5SC 4IYPA 3NOCD 3L17A 3G2UA 3CSFA 3TWRA 1D9SA 1K1AA 2A5EA 3U9WA 3URZA 4U95D 1H6PA 3ULEG 3FTWA 1INZA 3MJWA 2OEVA 4FC8A 3ZNGA 4YVOA 1LF8A 3CGHA 5CBNA 1EPUA 4K5AB 1N52A 2I6HA 2UY1B 1ZB1A 1SA4A 2I1JA 2P9LG 5AJLA 5D0OD 2KBXA 1K3ZD 2YHEA 2DWZA 3EHMA 3BG0B 2IQCA 3U3WA 1PC2A 4N3AA 2IF4A 3I5PA 5T4YA 3ISMC 5J90A 1NI1A 3IHVA 4U8VD 3ULYA 1WDYA 1H2UA 2EIKE 1JCRA 3FULA 3J5PA 2J8SD 1N9AA 4J7WA 5C2YA 4U0UA 3CQCB 4AV7A 2Y3AA 2XQ0A 3SY2A 4WAFA 5FQ6A 5BW8C 1FT1A 5G04J 2WM9A 1B89A 2I1KA 3D9KA 4GZDA 2V4LA 4N5QA 3FUMA 4UI9K 4HRLA 4J0UA 3DXKG 4I6GA 4YDWA 3SBTB 3MV3B 3U4TA 4GA2A 2VGEA 4GZ6A 2VTBB 2GROB 4ILGA 3CVWA 2MRIA 4EHMA 1W3BA 1SQMA 4N5CA 1FT2A 3NBNB 5AARA 3IKOB 4YVQC 4J8EA 2YHCA 1OCRE 2JEKA 5EDSA 4L1BA 3CK8A 1TNOA 1Z6TA 3FUKA 3RKVA 3R7RA 3UM2A 4GMLA 1SA5A 3G2VA 1S70B 3UINC 1TNZA 4CYMD 3IHYA 3KEAA 2F37A 3CVNA 4GPKA 3MZLB 4MRUA 4O60A 3PDNA 3VLEA 1TJFA 1HF8A 5HKPA 3UXGA 4APOA 5KBAA 3Q75A 4DLOA 4I43A 4JPSA 3FUIA 3U64A 1Y8MA 4IRUA 1N4QA 3D9NA 2ILRA 2OEWA 2FI7A 4JHJA 4ATZD 4ANWA 4HI8A 5D66A 3CVVA 4TXQA 3JQ1A 2MOWA 3Q9UC 4P29A 3HXBA 3PS6A 2KZTA 3UQ3A 2ETBA 1E90A 1N4RA 4TV3A 3C3OA 3QNKA 2IJGX 2L6JA 5KCMA 4GU5A 4B0ZA 1MZCA 4A1SA 3QDNA 5ENQD 2XRZA 3UMVA 4EZLA 3B7UX 4J6IA 4WNDA 4FJYA 2L6BA 3JQ0A 5ENOD 4F1SA 1QQEA 4RG6A 4BSZB 4E6HA 2B6CA 2IONA 5C1DA 5D2MC 2BKKB 2WXNA 3FU0A 4EQFA 1OWOA 5AQ7A 1N4PA 4HVBA 1HG2A 3PVLA 3V2OA 2EIME 5FT9A 2AVPA 4PUCA 2P9KG 2WXOA 1TR4A 3UM0A 1D8DA 5FQ7A 4CZ2D 3UM1A 2V8SE 1V54E 1TJCA 4LERA 3B7BA 2FF4A 4FHJA 3LY8A 5CERB 3FUHA 1E7UA 4APFA 3AG4E 3TWQA 3AS4A 2LO6A 5ITZF 4RSYA 4XIFA 4Q69A 4CT4A 2JABA 5BUZA 4A1GA 3UTMA 4GTTA 3FH5A 4ANUA 4N2QA 1AP7A 2GRRB 4XX5A 3RO2A 1E8XA 2LAIA 3UI2A 3QK0A 2MHKA 2ETCA 2EILE 5AN8A 3ASFA 4FLBA 1V55E 4ZFHA 3P1UA 3CSTA 5LOZA 3CVYA 3ZUVB 2HE0A 1BD8A 5EYLA 1EYHA 4BT9A 3ESKA 1N94A 3V31A 1OCCE 4FP7A 3CVLA 2DYSE 1MX6A 2Y1LE 4QQIA 4I9EA 5ENRD 4Y6WA 4GTOA 3AU4A 3DSSA 2AXUA 4OVVA 4A55A 2RFMA 3PUJA 3MX3A 3WG7E 5CCLA 1SZ9A 2YINA 2OCCE 3UIPC 5DIZA 3FUJA 3BEEA 2VYIA 3MA5A 1KLXA 5AYWD 2XGMA 2H6GA 2CG3A 1FVFA 1L5JA 4DRXE 1WY6A 1X81A 3PRZA 2OVFA 3E34A 4L2YA 2Y4UA 4DI3A 3CVXA 3CHRA 2C0MA 4F3VA 2P9PG 4A63B 4GMJA 2LSVA 3UPVA 3LS8A 2J4BA 4ZHBA 4WNFA 4U0SA 3ONLA 3SGHA 4C0EA 3SZ7A 1RW2A 3CQGB 4KXKB 5T3RA 3HHMA 3ZRHA 1DCQA 3PZ3A 1BI8B 2VGXB 4GAAA 1LTXA 3EIJA 4GTQA 3QOUA 2VSOE 5B3SE 2IY0C 5E76A 4BX9A 5AQ9A 4LEUA 3I4RB 3P2BA 3E32A 5CEAA 4HNAD 5FJYA 4EZKA 3RAUA 3DSXA 2LSUA 4KVMA 5FZQA 2H6HA 3FY4A 4KBQA 4F7AA 4TXRA 4TXPA 2P2CP 2J09A 3GZ1A 2XS8A 4MBGA 3KEZA 3AS8A 1OWLA 3NF1A 3S7FA 2Y0BG 2KC7A 2GRMA 4ANXA 3PE3A 3KSQA 2VGYA 3SBSA 3ZIMA 1ZU2A 4H7YA 1K1BA 3PE4A 2GGFA 1H6KA 1IKND 3LJ3A 3ZXPA 3S7JA 1H2VC 2NC9A 2QY7A 1BI7B 1S63A 3CVQA 4HLEA 1TYQG 4HOQA 2QC9A 4HOTA 5HS0A 2GW1A 2CHWA 3U66A 1DNPA 1UOHA 4OVUA 4KZ0A 1S0PA 3E37A 3KD7A 3PEUB 3RRMB 2PM6A 3MGBA 4UQZA 1H2TC 4J8DA 3EU9A 2RD0A 5LP0A 2R5SA 4G11A 3LCAA 1QZ2A 5CCMA 3HVEA 5KWDA 3FUFA 4UWKA 1U3CA 3IXEA 1UG3A 4U7EB 3K9IA 3PZ2A 2J08A 3C3RA 4JC8A 3DSVA 3HXDA 2DIWA 2FBNA 4GTSA 3FTUA 4JHKA 3B7TA 3PNLB 2L0TB 3J5QB 4L9PA 2EIJE 4UI9C 2AJAA 5FQ8A 2KATA 4BT8A 4EZJA 3AG3E 3Q9NC 2X6KA 5JA4D 3OXFA 4LCTA 3MKRA 3NZSA 2XENA 3ZYMA 1VDYA 3VTXA 5AJDA 3BU8A 4LNBA 5BNWA 5ENPD 3T5VA 1TNYA 3L22A 3L13A 4N39A 3GZSA 3HIZA 5FWQA 4WWOA 1FVHA 1JCQA 1QNFA 2DVWA 3RRNB 1OUVA 2UWJG 2WQHA 4GA0A 1LD7A 1UJJA 2WVIA 3E30A 1XNFA 2WMOA 4OAUC 2DZOA 3SFZA 2LUHA 3FEYA 3Q7FA 3ZGQA 5G2NA 4B8AA 4FJZA 4CT0A 1N11A 2WXLA 3TWUA 4LRZA 3SF4A 3G2TA 4MLPA 3CLJA 2GRQB 2IOLA 4U04A 2J07A 5CMWA 1O1SA 4TUUA 3DXMG 4JD2G 3DSWA 4FHKA 4XZ4A 4LG6A 1HG5A 4A3TA 2EQXA 1TNUA 4M7CA 1NA0A 3DPYA 3DSTA 4U8HA 4C9BB 4BESA 2WXFA 2BUGA 2RFAA 4JEHA 1MQSA 3T9KA 4O1OA 5FZRA 1HX8A 3QWVA 3LEWA 4IN3B 3R7QA 4GMRA 3TWTA 4JA7A 2FO7A 3TXNA 3Q49B 3HXEA 1TN7A 4G2VA 3NZUA 4FADA 3QWPA 2ZXWE 3JXIA 2XCCA 4WWNA 4DX7D 1N0RA 4UI9J 3Q78A 5BXOA 4WNGA 1MJ0A 1N95A 4GPMA 3UKUG 3ZHEA 4GZ3A 3X2QE 1HE8A 1FCHA 4G23A 2FO1E 3PNTB 4X8QA 1OWPA 1IYGA 2OVBA 5A6CA 3ULQA 1HU3A 3IBEA 3UM3A 1Y6IA 3HDXA 3ZVVA 4N2SA 2MYOA 1TNBA 4G26A 5EKQD 1NL4A 5E75A 5LCWC 5G05C 5BXUA 5T8IA 3OAWA 4U63A 2DBAA 3ABLE 5AQBA 3FFLA 1IHBA 3JUEA 3D9IA 4HFGA 3Q7AA 3UKRG 4BFRA 2L0IA 4LUNU 2FEZA 2WQ6A 4GCNA 3L54A 3LDZA 2F8XK 4DPRA 2HR2A 2VSYA 3NQPA 2AXVA 2DCPA 3DSUA 4R7LA 3CR3A 3SHFA 2C0LA 3MV2B 2VQ2A 3AS5A 1HH8A 3D9HA 1IQUA 3D9OA 3D9JA 4I2WA 4GB9A 3C5RA 4JA9A 1SZAA 3TXMA 3CHSA 3ASHA 5BPPA 1N0QA 4HS2A 2XZTG 4Q96A 1TN8A 5CBOA 5LX8A 4KMOA 1KZOA 2WXQA 3CVPA 2FULA 4PS8A 4CDRA 3JCKC 2X6IA 4O6FA 2R2LA 4XE0A 3S7DA 2XPIA 4FULA 4I6EA 2E0IA 3BUAA 2F0YA 3EU5A 4PS7A 3L16A 5CRVA 4J8YA 2HYZA 5JJTA 3V2XA 1DCEA 2CFZA 4U8YD 4JXTA 4Q94A 2HM8A 4BY6A 3TG4A 3FWVA 3ASNE 3AG2E 2GRPB 3T8MA 2ONDA 3KAEA 4K5BA 1MHQA 1TN6A 5FZSA 2X6JA 2CFUA 1O1TA 2M63A 4DX5D 2WMNA 3LJNA 2NSZA 3UUXA 5LCWJ 4B8CB 5G05J 3RRUA 2VSXE 2OOEA 4AY6A 3FEXA 4NACA 3CHPA 4GTPA 1WAO1 3HG0D 1K8KG 3C72A 4AOFA 2PM7A 2VSNA 4DX6D 2X6HA 3CIAA 3FU5A 3JYSA 3TWVA 3G2WA 3ASDA 2R02A 4I17A 5KJLA 3FUEA 4KVOA 4K0RA 1Q2ZA 1PAQA 5EIBE 1WG0A 5B1AE 4BTBA 2P9UG 3FDHA 3QAQA 2WXPA 2R59A 2I2OA 3LPZA 4CEMA 3N71A 2J9QA 3LYAA 4BX8A 4L2LA 2BKGA 2J4DA 1TEZA 2A4ZA 3CK9A 2YNQA 5BT1A 5JJ6A 3RIBA 2P9NG 3EIQC 5EYPF 2V5FA 2XEVA 5ENNA 2QYJA 1FPPA 3O48A 3HVEB 2WPVA 3SNXA 4L7TA 3HYMB 3W9GA 1MX2A 4HRNA 2XCBA 4MKTA 3FTVA 3ZFWA 1HFAA 4GYOA 2XEHA 3B13A 2LXLA 4N3CA 3O4ZA 4LNGA 2DZNA 3CV0A 1ELWA 3C98A 3GW4A 3PH0C 2HO1A 3FUDA 4RLYA 1NFIE 2H6IA 4DI4A 1E8ZA 3FTZA 3AAAC 3FP3A 5B1BE 4AJWA 3NOGD 1WM5A 3FHEA 3SI5A 4AM9A 1MYOA 4W9RA 1E8YA 3ZYQA 4NRHB 4D10C 3ABME 1JWGA 1S64A 4KYOB 2BF0X 3B7RL 4ILHB 3EHNA 4EPZA 3SFXA 4CDMA 4GTMA 2Y4TA 4OAVB 1KPSB 2PQRA 3E33A 4TUMA 5HRYA 4UWHA 4N3BA 2R05A 3S7BA 5JJ7A 3APDA 4UWGA 3ZXSA 2XGOA 4AY5A 3KSLA 2LAHA 3LVQE 1HZ4A 4FU3A 1UN9A 2XS1A 4BWRA 4AIFA 4ME2A 4CCAA 3GZ2A 1O5MA 4JL0A 5CEDB 2XRYA 3TWXA 3EDTB 4EBAG 4JZYA 3OTNA 3ENEA 2AWIA 4GYYA 5G04C 5AENA 2V5QC 3ZPJA 3W9FA 3D3MA 4QFVA 3RJVA 1ELKA 4HQDA 2NXPA 5BV1A 3CK7A 2GRLA 3MYVA 3QJZA 4YDYA 5J08A 2IFUA 3MKQA 3TGOA 3APFA 4U96D 4XI0A 4I6JA 3EHRA 3DEOA 5KJNA 4HRMB 1X5BA 4TRQA 4JW1A 2EINE 5KJKA 2WXMA 3JUIA 4NURA 3HXFA 5BV0A 4F6RD 3ML9A 3B7SA 3MEKA 1ELRA 4K5CA 3S2AA 3FU3A 3SD5A 4AP2A 4BETA 4LNUD 2VGXA 4HBDA 3ZHEB 2IEJA 4FA6A 4BSXA 1DC2A 3LY9A 4HOUA 4G24A 3VLDA 4YDOA 2DYRE 2KZTB 1QBQA 4HORA 3OXGA 1OWNA 4CDNA 2A5UA 3QKYA 5ANLA 4A3VA 4DX1A 4KT6B 3AU5A 2F8YA 3L82A 3Q79A 4JVSA 5KNHD 3PEVB 3OXLA 3AJIA 1JWFA 3D9LA 4I2ZA 1BU9A 5CRUA 5CECB 2KCLA 3Q47B 3ZEFA 4AXHA 4BEPA 3CHQA 3CHMA 1G3NB 4HOSA 5H7PA 3Q4AB 4PH4B 3V79K 3VLFA 4F1PA 2KM4A 3D9PA 1IHGA 5EILA 1UW4B 4KZCA 2RG8A 4OYSA 3CHOA 3V30A 2X38A 2Q7FA 4E85A 1E96B 4Y6CA 4IULA 1EDUA 1IXVA 3LY7A 4ANVA 4C0MA 5JHAA 1Z3XA 4H7XA 4U07A 1EF1C 2PQNA 3VTYA 2WB2A 5ENTD 1YCSB 2KXPC 4ACKA 3L08A 3ABKE 5FINA 2WXHA 2PZIA 3SFYA 3UT8A 1JPLA 2QFCA 4NIKA 4DJAA 3KS2A 3LVRE 1D8EA 1UN8A 2IOSA 4ILIA 4JHRA 3JXJA 3DWLG 4GTVA 4LSZE 4K03A 2P9IG 5D0QD 1E7VA 5ENSD 2GRNB 5AQAA 3RK6A 1A5EA 1HS6A 4CGVA 2RKKA 3DRAA 3IV0A 3TWSA 2UY1A 3NAWA 1U3DA 3HRAA
chains in the Genus database with same CATH topology
4KBQA 5FZSA 2CHZA 2X6JA 4F7AA 3EHMA 2CFUA 2M63A 3ZYLA 2WMNA 2J09A 3BG0B 3GZ1A 1PY1A 2IQCA 2NSZA 4GZ5A 3UUXA 2V0PA 3U3WA 1PC2A 5LCWJ 4B8CB 3KEZA 4JEUA 4N3AA 5G05J 3RRUA 3AS8A 2VSXE 3WXXA 2IF4A 2OOEA 3DBSA 3I5PA 5T4YA 2R17C 4AY6A 3QARA 1OWLA 3FEXA 3NF1A 3S7FA 2KC7A 4NACA 5J90A 2GRMA 3CHPA 4WNEA 3IHVA 4ANXA 3PE3A 1WAO1 4UQYA 2VGYA 3SBSA 3ZIMA 1ZU2A 3BG1B 4AOFA 1H2UA 2PM7A 2VSNA 4H7YA 3FULA 3PE4A 2X6HA 3CIAA 1IQRA 2GGFA 3FU5A 3UX4A 3JYSA 1H6KA 3G2WA 3ASDA 4I17A 5KJLA 5C2YA 4U0UA 1JUQA 3CQCB 3LJ3A 2Y3AA 3FUEA 4AV7A 2XQ0A 4KVOA 3S7JA 3DPDA 2LNIA 4K0RA 1H2VC 1PAQA 2NC9A 4WAFA 3UT7A 4MS6A 5ARGA 3ZN3A 2QY7A 3FDHA 4I1AA 4BTBA 3QAQA 5FQ6A 5BW8C 2WXPA 2R59A 5G04J 3CVQA 2I2OA 4HLEA 2WM9A 3LPZA 4HOQA 3N71A 4CEMA 2J9QA 4L23A 5HQ8A 3LYAA 4BX8A 4HOTA 1B89A 5AIJA 2I1KA 3D9KA 4GZDA 4GCOA 4L2LA 2V4LA 1HXIA 2GW1A 2J4DA 1TEZA 5A23A 3FUMA 4UWFA 2A4ZA 4UI9K 3CK9A 4UWLA 2CHWA 1NP7A 2WXIA 2YNQA 4J0UA 5BT1A 3U66A 1DNPA 1DVPA 5CHEE 4G1TA 5JJ6A 3GYZA 4I6GA 3SBTB 3D9MA 3RIBA 4OVUA 3MV3B 3U4TA 4GA2A 4GZ6A 3EIQC 2VTBB 4KZ0A 4ILGA 3CVWA 2V5FA 2MRIA 4V3IA 1S0PA 3QB2A 2XEVA 1W3BA 1SQMA 4N5CA 5ENNA 3TJPA 3CKCA 3KD7A 3PEUB 3RRMB 2VTBA 1YA0A 2PM6A 3CEQA 3MGBA 3IKOB 4UQZA 1H2TC 4J8DA 4YVQC 4J8EA 3O48A 2RD0A 2YHCA 3HVEB 2JEKA 2R5SA 4XKCA 5EDSA 5LP0A 4G11A 2WPVA 4L1BA 3CK8A 3LCAA 3Q15A 1QZ2A 3SNXA 4L7TA 3HVEA 1Z6TA 3HYMB 5CCMA 3FUKA 3FUFA 4YNDA 3RKVA 3R7RA 4UWKA 2XCBA 4GMLA 3R9AB 4MKTA 1U3CA 3FTVA 3G2VA 3RO3A 4U0ZA 3ZFWA 1HFAA 3APCA 1UG3A 4GYOA 3IHYA 3B13A 3K9IA 5ARFA 3CVNA 4I1MA 4GPKA 3MZLB 3O4ZA 4MRUA 2J08A 4N3CA 1E8WA 3I4GA 2J49A 4JC8A 2DIWA 2FBNA 3CV0A 3FH8A 3ONKA 1ELWA 3FTUA 3PDNA 4JHKA 3C98A 3VLEA 5JHBA 3B7TA 3PNLB 3GW4A 3PH0C 2HO1A 1TJFA 2L0TB 3FUDA 1HF8A 4APOA 4DLOA 4DI4A 1E8ZA 4I43A 1ZBPA 4UI9C 2X6FA 5FQ8A 3FTZA 3ZW3A 2KATA 4JPSA 3FP3A 4AJWA 4BT8A 3FUIA 3U64A 1Y8MA 4IRUA 5ANRA 4EZJA 1H0AA 4HXIA 2AXZA 2X6KA 2ILRA 3D9NA 1WM5A 3FHEA 3OXFA 4RG9A 4LCTA 3SI5A 4AM9A 3MKRA 3NZSA 4W9RA 2FI7A 4JHJA 1E8YA 4ANWA 3CVVA 3ZYQA 3ZYMA 4NRHB 3JQ1A 4D10C 4AEZC 2CHXA 1JWGA 1VDYA 3VTXA 4KYOB 2BF0X 5AJDA 2MOWA 3B7RL 2XGSA 4ILHB 3EHNA 4EPZA 5BNWA 4P29A 4CDMA 2Y4TA 3FTSA 4ABNA 3T5VA 4AVXA 4ATGA 3PS6A 2KZTA 2PQRA 3L22A 3L13A 4N39A 4UWHA 2WXGA 3GZSA 3HIZA 3UQ3A 4N3BA 2JLBA 4DLQA 5FWQA 4WWOA 1E90A 1FVHA 3S7BA 3CVUA 2OV8A 5JJ7A 2YQ8A 3APDA 4TV3A 4UWGA 3QNKA 2IJGX 3ZXSA 2L6JA 5KCMA 1QNFA 2E2EA 3QWWA 3RRNB 2XGOA 4AY5A 4GU5A 4B0ZA 1OUVA 2UWJG 4A1SA 2WQHA 2LAHA 3QDNA 4GA0A 5EX3A 5HI7A 1UJJA 2WVIA 1XNFA 2WMOA 2XRZA 3LVQE 1HZ4A 3UMVA 4EZLA 4FU3A 3SFZA 3B7UX 4FLHA 1UN9A 3FEYA 3ESLA 3ZGQA 4J6IA 5G2NA 4BWRA 4B8AA 4FJZA 4WNDA 3MCXA 4FJYA 4AIFA 4CT0A 4ME2A 3LKUA 3EJNA 4CCAA 3JQ0A 2WXLA 4I9CA 3GZ2A 4F1SA 4LRZA 3SF4A 2WXRA 3G2TA 1QQEA 4MLPA 3CLJA 5A7DB 3TG5A 4B89A 4RG6A 4JL0A 5AYWD 4E6HA 2IOLA 2X3MA 2WXJA 4U04A 2XRYA 2J07A 2L9BA 3EDTB 4EBAG 4JZYA 3OTNA 3ENEA 5CMWA 2IONA 5C1DA 2AWIA 4TUUA 4WWPA 4GYYA 2WXNA 5G04C 3FU0A 4EQFA 5AENA 1OWOA 3CKBA 1Z3YA 4FHKA 4XZ4A 1OWMA 3E4BA 5CMYA 3ZPJA 1H19A 4B94A 4F53A 4HVBA 3D3MA 1HG5A 1HG2A 4A3TA 3PVLA 2EQXA 1NZNA 5FT9A 1NA0A 4J8SA 2AVPA 4QFVA 3RJVA 4U8HA 4PUCA 4C9BB 2WXFA 1ELKA 2BUGA 4JEHA 1MQSA 2WXOA 5FZRA 3UT4A 2NXPA 5BV1A 3CK7A 3MKQB 5DBKA 2GRLA 4GA1A 3MYVA 3QJZA 1HX8A 5J08A 3QWVA 4PS3A 2IFUA 3LEWA 3MKQA 5FQ7A 3TGOA 4IN3B 3R7QA 3APFA 4XI0A 2V8SE 4I6JA 4JA7A 1TJCA 2FO7A 3Q5MA 4LERA 4I1OB 3T5XA 5KJNA 2FF4A 1X5BA 3TXNA 5LFAA 3Q49B 4TRQA 2XPYA 4FHJA 3LY8A 3G2SA 4JW1A 4G2VA 3FUHA 1E7UA 4APFA 2IU1A 3NZUA 4FADA 5KJKA 2I9CA 3QWPA 2WXKA 4NQ0A 2WXMA 3JUIA 4NURA 4EECA 3AS4A 5BV0A 2LO6A 2XCCA 4WWNA 3ML9A 5M72A 4XKBA 3B7SA 3MEKA 4UI9J 4PDXA 1ELRA 4RSYA 4XIFA 4BTAA 3S2AA 4WNGA 4Q69A 3FU3A 3SD5A 4AP2A 3LXUX 4CT4A 5BUZA 4A1GA 2VGXA 3ZHEB 3FU6A 4FA6A 3FH5A 3ZHEA 3FTXA 3FTYA 4GZ3A 4ANUA 4DK5A 4N2QA 4BSXA 2WQ7A 4XX5A 3TAXA 3LY9A 4HOUA 1N54A 3FUNA 1HE8A 4G24A 1E8XA 1FCHA 4G23A 3PNTB 3RO2A 4XI9A 2LAIA 1OWPA 3VLDA 3PREA 1IYGA 2OVBA 5A6CA 2KCKA 2MHKA 3QK0A 3ULQA 4RVBA 2KZTB 3ML8A 1HU3A 4HORA 3OXGA 3IBEA 3FH7A 3ASGA 1OWNA 3ASFA 4URKA 4CDNA 1Y6IA 2A5UA 3QKYA 5EX0A 5ANLA 4A3VA 4KT6B 3AU5A 3HDXA 4FLBA 3ZVVA 5G55A 4N2SA 4GZCA 2BTDA 3TL5A 3P1UA 4G26A 3CSTA 5EKQD 5E75A 1BPOA 5LOZA 5LCWC 3CVYA 5G05C 1A17A 1XGWA 4JVSA 5KJMA 4CGWA 5T8IA 3OAWA 3PEVB 3OXLA 1EYHA 2PL2A 4BT9A 4U63A 2DBAA 3ESKA 1JWFA 3D9LA 3FFLA 4I2ZA 4GYWA 4FP7A 3CVLA 1GW6A 5FTPA 4I9EA 3D9IA 2KCLA 3Q47B 3PUKA 4HFGA 4Y6WA 2ZU6B 4ACLA 3ZEFA 4AXHA 3CHQA 3AU4A 4BFRA 2L0IA 3CHMA 4LUNU 2FEZA 2WQ6A 4HOSA 4WUYA 4GCNA 3L54A 1HO8A 2AXUA 3LDZA 4J8FA 4OVVA 4DPRA 1KT0A 3Q4AB 4A55A 2HR2A 4PH4B 3PUJA 3MX3A 3RU0A 2VSYA 5CCLA 1SZ9A 3NQPA 3QC1A 2AXVA 2YINA 2DCPA 3VLFA 2P58C 4R7LA 1UJKA 2KM4A 1IHGA 3D9PA 5DIZA 3FUJA 3BEEA 2VYIA 1UW4B 1KLXA 2XGMA 2XPZA 3CR3A 2VJ8A 3I3NA 3MA5A 4KZCA 2CG3A 1P5QA 2RG8A 4OYSA 2C0LA 1FVFA 1L5JA 3CHOA 3MV2B 1WY6A 3PRZA 2OVFA 2VQ2A 4L2YA 2X38A 2Y4UA 3AS5A 1HH8A 2Q7FA 4G25A 4DI3A 4E85A 1IQUA 2XHEA 3CVXA 1E96B 3CHRA 2C0MA 4F3VA 4Y6CA 4IULA 1EDUA 3D9OA 3D9JA 3LY7A 4I2WA 3ZYKA 4GB9A 1KT1A 4GMJA 2LSVA 4M3OA 3PZDA 4CRWA 4ANVA 2C2LA 4JA9A 3UPVA 4C0MA 1SZAA 3TXMA 3CHSA 3LS8A 5JHAA 2J4BA 3ASHA 1Z3XA 4EBAA 4H7XA 5FQ4A 5BPPA 4U07A 1EF1C 2PQNA 4WNFA 4HS2A 3VTYA 1NA3A 4Q96A 2KCVA 2WB2A 4U0SA 3L6AA 2CG2A 3ONLA 4KMOA 5LX8A 3IEGA 4ACKA 4UQXA 3SGHA 3L08A 4IYPA 4C0EA 2WXQA 2WXHA 3SZ7A 2PZIA 3CVPA 3L17A 2FULA 1JPLA 2QFCA 3CSFA 3G2UA 4PS8A 3UT8A 4CDRA 4DJAA 3KS2A 3LVRE 3CQGB 3JCKC 4KXKB 1UN8A 2IOSA 2X6IA 5T3RA 3HHMA 4ILIA 3ZRHA 4O6FA 4XE0A 4JHRA 3S7DA 2XPIA 2VGXB 4FULA 3U9WA 4K03A 3URZA 4I6EA 2E0IA 4GAAA 3FTWA 5D0QD 1INZA 3MJWA 4PS7A 3EIJA 3L16A 4FC8A 3QOUA 1E7VA 2VSOE 4YVOA 1LF8A 1MHQA 3CGHA 5E76A 2HYZA 3RK6A 4BX9A 1EPUA 5JJTA 1N52A 1HS6A 4CGVA 2CFZA 2I6HA 4JXTA 2UY1B 4Q94A 4LEUA 3I4RB 3IV0A 2HM8A 3P2BA 4BY6A 3TG4A 3FWVA 2UY1A 1U3DA 3SHFA 3T8MA 2I1JA 5FJYA 5AJLA 4EZKA 2ONDA 3KAEA 5D0OD 2LSUA 4KVMA 2YHEA 5FZQA 2AW6A 3FY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KBQ A;  5FZS A;  3GZ1 A;  4GZ5 A;  3UUX A;  3U3W A;  1PC2 A;  5LCW J;  5G05 J;  4N3A A;  3AS8 A;  3WXX A;  2IF4 A;  2OOE A;  4AY6 A;  3NF1 A;  3S7F A;  2KC7 A;  4WNE A;  3PE3 A;  1WAO 1;  4UQY A;  2VGY A;  1ZU2 A;  2VSN A;  4H7Y A;  3PE4 A;  3JYS A;  3ASD A;  4I17 A;  5KJL A;  4U0U A;  3S7J A;  2LNI A;  3ZN3 A;  2NC9 A;  4BTB A;  5ARG A;  4I1A A;  5BW8 C;  5G04 J;  3CVQ A;  5HQ8 A;  3LPZ A;  4HOQ A;  3N71 A;  2J9Q A;  3LYA A;  4HOT A;  1B89 A;  4GCO A;  1HXI A;  2GW1 A;  4UI9 K;  3CK9 A;  4J0U A;  5BT1 A;  5CHE E;  4G1T A;  5JJ6 A;  3GYZ A;  3RIB A;  3MV3 B;  3U4T A;  4GA2 A;  4GZ6 A;  2V5F A;  2XEV A;  1W3B A;  4N5C A;  3CKC A;  3KD7 A;  1YA0 A;  3CEQ A;  4UQZ A;  4J8D A;  4YVQ C;  4J8E A;  3O48 A;  2YHC A;  2R5S A;  2WPV A;  3CK8 A;  3LCA A;  3Q15 A;  1QZ2 A;  5CCM A;  3HYM B;  4YND A;  3RKV A;  2XCB A;  3R9A B;  3RO3 A;  4U0Z A;  3ZFW A;  4GYO A;  3K9I A;  5ARF A;  3CVN A;  4GPK A;  4N3C A;  3CV0 A;  2FBN A;  3PDN A;  1ELW A;  3GW4 A;  2HO1 A;  4APO A;  1ZBP A;  4UI9 C;  2KAT A;  3FP3 A;  4BT8 A;  1Y8M A;  1WM5 A;  3OXF A;  4RG9 A;  4AM9 A;  3MKR A;  4W9R A;  2FI7 A;  4NRH B;  3VTX A;  4KYO B;  2XGS A;  5BNW A;  2Y4T A;  4ABN A;  2PQR A;  4N39 A;  3UQ3 A;  4N3B A;  2JLB A;  3S7B A;  5JJ7 A;  2YQ8 A;  2L6J A;  2E2E A;  3QWW A;  2XGO A;  4AY5 A;  1OUV A;  2UWJ G;  4A1S A;  2WQH A;  3QDN A;  5EX3 A;  4GA0 A;  5HI7 A;  1XNF A;  1HZ4 A;  3ZGQ A;  4BWR A;  4WND A;  4AIF A;  4ME2 A;  3LKU A;  4I9C A;  3GZ2 A;  3SF4 A;  1QQE A;  5A7D B;  3TG5 A;  4RG6 A;  4JL0 A;  4U04 A;  3EDT B;  5C1D A;  4GYY A;  5G04 C;  4EQF A;  3CKB A;  3ZPJ A;  3E4B A;  4B94 A;  1NZN A;  5FT9 A;  1NA0 A;  2AVP A;  3RJV A;  2BUG A;  5FZR A;  3CK7 A;  5DBK A;  4GA1 A;  3QWV A;  2IFU A;  3TGO A;  4IN3 B;  4XI0 A;  4JA7 A;  1TJC A;  2FO7 A;  3Q5M A;  5KJN A;  2FF4 A;  3Q49 B;  3LY8 A;  4G2V A;  5KJK A;  3QWP A;  4NQ0 A;  3AS4 A;  2XCC A;  5M72 A;  3MEK A;  4UI9 J;  1ELR A;  4XIF A;  4BTA A;  4WNG A;  2VGX A;  3ZHE B;  3ZHE A;  4GZ3 A;  4N2Q A;  3TAX A;  3LY9 A;  4HOU A;  3RO2 A;  4G24 A;  1FCH A;  4G23 A;  4XI9 A;  1IYG A;  5A6C A;  2KCK A;  2MHK A;  3ULQ A;  4HOR A;  3OXG A;  3ASG A;  3ASF A;  3QKY A;  5EX0 A;  4N2S A;  4G26 A;  5EKQ D;  5LCW C;  5G05 C;  1A17 A;  5KJM A;  4CGW A;  3OXL A;  2PL2 A;  4BT9 A;  2DBA A;  3ESK A;  3FFL A;  4I2Z A;  4GYW A;  3CVL A;  5FTP A;  4I9E A;  2KCL A;  3Q47 B;  4Y6W A;  2FEZ A;  4HOS A;  4WUY A;  4GCN A;  4J8F A;  1KT0 A;  3Q4A B;  2HR2 A;  3RU0 A;  2VSY A;  5CCL A;  2P58 C;  1IHG A;  5DIZ A;  3BEE A;  2VYI A;  1KLX A;  2XGM A;  3MA5 A;  5AYW D;  1P5Q A;  2C0L A;  3MV2 B;  2VQ2 A;  2Y4U A;  3AS5 A;  1HH8 A;  2Q7F A;  4G25 A;  1E96 B;  2C0M A;  4F3V A;  4Y6C A;  3LY7 A;  4I2W A;  1KT1 A;  2LSV A;  2C2L A;  4JA9 A;  3UPV A;  3ASH A;  4H7X A;  4U07 A;  2PQN A;  4WNF A;  3VTY A;  1NA3 A;  2KCV A;  4U0S A;  3IEG A;  4UQX A;  3SZ7 A;  2PZI A;  3CVP A;  2QFC A;  4CDR A;  3KS2 A;  4KXK B;  4O6F A;  4JHR A;  3S7D A;  2XPI A;  2VGX B;  3URZ A;  5D0Q D;  3QOU A;  4YVO A;  2HYZ A;  5JJT A;  4CGV A;  2I6H A;  2UY1 B;  4LEU A;  3TG4 A;  3FWV A;  2UY1 A;  5FJY A;  2OND A;  3KAE A;  5D0O D;  2LSU A;  5FZQ A; 
#chains in the Genus database with same CATH topology
 2CHZ A;  5IY5 E;  4HLL A;  3ZYL A;  4DX2 A;  4GZ5 A;  1PY1 A;  2V0P A;  3Q73 A;  4JEU A;  3WXX A;  3DBS A;  2R17 C;  1JCS A;  3QAR A;  4WNE A;  4UQY A;  3C3Q A;  3BG1 B;  3DEP A;  1IQR A;  3UX4 A;  2H6F A;  2BED A;  1JUQ A;  1YMP A;  3DPD A;  3UT7 A;  2LNI A;  3ZN3 A;  4MS6 A;  5ARG A;  4I1A A;  5HQ8 A;  4L23 A;  1OCZ E;  5AIJ A;  4GCO A;  2V4H C;  1HXI A;  5A23 A;  4UWF A;  4UWL A;  2WXI A;  1NP7 A;  1DVP A;  5CHE E;  4G1T A;  3GYZ A;  4BER A;  3D9M A;  4XEI G;  4V3I A;  3UIO C;  3QB2 A;  3TJP A;  2VTB A;  3CKC A;  1YA0 A;  3CEQ A;  2PNN A;  2ZIS A;  4G8L A;  4XKC A;  3Q15 A;  4YND A;  5EID A;  3R9A B;  2LXM A;  4YDE A;  3RO3 A;  4U0Z A;  3APC A;  1QYM A;  4Z68 A;  1O1R A;  1OCO E;  5ARF A;  1SW6 A;  4I1M A;  1E8W A;  3I4G A;  2J49 A;  3FH8 A;  3ONK A;  5JHB A;  3PZ1 A;  1KZP A;  1YYH A;  1ZBP A;  3ZW3 A;  2X6F A;  1H6O A;  5ANR A;  1H0A A;  4HXI A;  5JMN D;  2AXZ A;  5KNG A;  4HI9 A;  4RG9 A;  1OY3 D;  4AEZ C;  2CHX A;  3R9M A;  2XGS A;  3FTS A;  4ABN A;  4AVX A;  4ATG A;  2WXG A;  3TWW A;  4DLQ A;  2JLB A;  3CVU A;  2OV8 A;  2YQ8 A;  5FIO A;  2E2E A;  3QWW A;  5EX3 A;  5HI7 A;  1BLX B;  2QYU A;  2XEE A;  4FLH A;  3RSE G;  2ZIR A;  4B93 B;  3ESL A;  3ZU7 B;  3MCX A;  3LKU A;  3EJN A;  4I9C A;  1LD8 A;  2WXR A;  5A7D B;  3TG5 A;  4B89 A;  3EHQ A;  2X3M A;  2WXJ A;  2L9B A;  5EN5 D;  2P9S G;  4WWP A;  2B0O E;  3CKB A;  1Z3Y A;  4F53 A;  1N4S A;  1OWM A;  3E4B A;  5CMY A;  1H19 A;  4B94 A;  2XZD G;  2Y69 E;  1NZN A;  4J8S A;  2ZGD A;  3PZ4 A;  3UT4 A;  4JB8 P;  3MKQ B;  5DBK A;  4GA1 A;  3ZKJ A;  4PS3 A;  4O1P A;  1MX4 A;  3Q5M A;  3ASO E;  3T5X A;  4I1O B;  5LFA A;  2XPY A;  3G2S A;  2IU1 A;  2I9C A;  4GTR A;  2WXK A;  4NQ0 A;  3F6Q A;  1OT8 A;  4EEC A;  5M72 A;  4XKB A;  4PDX A;  4BTA A;  3EUV A;  3LXU X;  3NB2 A;  3FU6 A;  3FTX A;  3FTY A;  4DK5 A;  2WQ7 A;  3TAX A;  1N54 A;  3FUN A;  4XI9 A;  1OXJ A;  2R03 A;  3PRE A;  2KCK A;  4RVB A;  3ML8 A;  3FH7 A;  3ASG A;  4URK A;  5EX0 A;  5G55 A;  4GZC A;  2BTD A;  3BQO A;  3TL5 A;  3SO8 A;  1BPO A;  3AG1 E;  1A17 A;  1XGW A;  5KJM A;  4CGW A;  1U2V G;  2IO2 C;  2PL2 A;  4GYW A;  2AW6 A;  1GW6 A;  5FTP A;  1AWC B;  3PUK A;  2ZU6 B;  4ACL A;  1SVX A;  4UUC A;  2ETA A;  4WUY A;  4C48 B;  1HO8 A;  2QZA A;  4J8F A;  2ZGG A;  1KT0 A;  1RZ4 A;  3RU0 A;  3QC1 A;  2P58 C;  1UJK A;  3T8K A;  5AAO A;  4RQI A;  2XPZ A;  3L9T A;  2VJ8 A;  3I3N A;  1P5Q A;  3B95 A;  4HB5 A;  4G25 A;  2XHE A;  4G8K A;  3ZYK A;  1KT1 A;  4M3O A;  4DUI A;  4CRW A;  3PZD A;  2C2L A;  2NYJ A;  3HXC A;  4EBA A;  5FQ4 A;  3SQV A;  1NA3 A;  2KCV A;  3L6A A;  2CG2 A;  3IEG A;  2IO3 C;  4UQX A;  1Z5S C;  4IYP A;  3NOC D;  3L17 A;  3G2U A;  3CSF A;  3TWR A;  1D9S A;  1K1A A;  2A5E A;  3U9W A;  3URZ A;  4U95 D;  1H6P A;  3ULE G;  3FTW A;  1INZ A;  3MJW A;  2OEV A;  4FC8 A;  3ZNG A;  4YVO A;  1LF8 A;  3CGH A;  5CBN A;  1EPU A;  4K5A B;  1N52 A;  2I6H A;  2UY1 B;  1ZB1 A;  1SA4 A;  2I1J A;  2P9L G;  5AJL A;  5D0O D;  2KBX A;  1K3Z D;  2YHE A;  2DWZ A;  3EHM A;  3BG0 B;  2IQC A;  3U3W A;  1PC2 A;  4N3A A;  2IF4 A;  3I5P A;  5T4Y A;  3ISM C;  5J90 A;  1NI1 A;  3IHV A;  4U8V D;  3ULY A;  1WDY A;  1H2U A;  2EIK E;  1JCR A;  3FUL A;  3J5P A;  2J8S D;  1N9A A;  4J7W A;  5C2Y A;  4U0U A;  3CQC B;  4AV7 A;  2Y3A A;  2XQ0 A;  3SY2 A;  4WAF A;  5FQ6 A;  5BW8 C;  1FT1 A;  5G04 J;  2WM9 A;  1B89 A;  2I1K A;  3D9K A;  4GZD A;  2V4L A;  4N5Q A;  3FUM A;  4UI9 K;  4HRL A;  4J0U A;  3DXK G;  4I6G A;  4YDW A;  3SBT B;  3MV3 B;  3U4T A;  4GA2 A;  2VGE A;  4GZ6 A;  2VTB B;  2GRO B;  4ILG A;  3CVW A;  2MRI A;  4EHM A;  1W3B A;  1SQM A;  4N5C A;  1FT2 A;  3NBN B;  5AAR A;  3IKO B;  4YVQ C;  4J8E A;  2YHC A;  1OCR E;  2JEK A;  5EDS A;  4L1B A;  3CK8 A;  1TNO A;  1Z6T A;  3FUK A;  3RKV A;  3R7R A;  3UM2 A;  4GML A;  1SA5 A;  3G2V A;  1S70 B;  3UIN C;  1TNZ A;  4CYM D;  3IHY A;  3KEA A;  2F37 A;  3CVN A;  4GPK A;  3MZL B;  4MRU A;  4O60 A;  3PDN A;  3VLE A;  1TJF A;  1HF8 A;  5HKP A;  3UXG A;  4APO A;  5KBA A;  3Q75 A;  4DLO A;  4I43 A;  4JPS A;  3FUI A;  3U64 A;  1Y8M A;  4IRU A;  1N4Q A;  3D9N A;  2ILR A;  2OEW A;  2FI7 A;  4JHJ A;  4ATZ D;  4ANW A;  4HI8 A;  5D66 A;  3CVV A;  4TXQ A;  3JQ1 A;  2MOW A;  3Q9U C;  4P29 A;  3HXB A;  3PS6 A;  2KZT A;  3UQ3 A;  2ETB A;  1E90 A;  1N4R A;  4TV3 A;  3C3O A;  3QNK A;  2IJG X;  2L6J A;  5KCM A;  4GU5 A;  4B0Z A;  1MZC A;  4A1S A;  3QDN A;  5ENQ D;  2XRZ A;  3UMV A;  4EZL A;  3B7U X;  4J6I A;  4WND A;  4FJY A;  2L6B A;  3JQ0 A;  5ENO D;  4F1S A;  1QQE A;  4RG6 A;  4BSZ B;  4E6H A;  2B6C A;  2ION A;  5C1D A;  5D2M C;  2BKK B;  2WXN A;  3FU0 A;  4EQF A;  1OWO A;  5AQ7 A;  1N4P A;  4HVB A;  1HG2 A;  3PVL A;  3V2O A;  2EIM E;  5FT9 A;  2AVP A;  4PUC A;  2P9K G;  2WXO A;  1TR4 A;  3UM0 A;  1D8D A;  5FQ7 A;  4CZ2 D;  3UM1 A;  2V8S E;  1V54 E;  1TJC A;  4LER A;  3B7B A;  2FF4 A;  4FHJ A;  3LY8 A;  5CER B;  3FUH A;  1E7U A;  4APF A;  3AG4 E;  3TWQ A;  3AS4 A;  2LO6 A;  5ITZ F;  4RSY A;  4XIF A;  4Q69 A;  4CT4 A;  2JAB A;  5BUZ A;  4A1G A;  3UTM A;  4GTT A;  3FH5 A;  4ANU A;  4N2Q A;  1AP7 A;  2GRR B;  4XX5 A;  3RO2 A;  1E8X A;  2LAI A;  3UI2 A;  3QK0 A;  2MHK A;  2ETC A;  2EIL E;  5AN8 A;  3ASF A;  4FLB A;  1V55 E;  4ZFH A;  3P1U A;  3CST A;  5LOZ A;  3CVY A;  3ZUV B;  2HE0 A;  1BD8 A;  5EYL A;  1EYH A;  4BT9 A;  3ESK A;  1N94 A;  3V31 A;  1OCC E;  4FP7 A;  3CVL A;  2DYS E;  1MX6 A;  2Y1L E;  4QQI A;  4I9E A;  5ENR D;  4Y6W A;  4GTO A;  3AU4 A;  3DSS A;  2AXU A;  4OVV A;  4A55 A;  2RFM A;  3PUJ A;  3MX3 A;  3WG7 E;  5CCL A;  1SZ9 A;  2YIN A;  2OCC E;  3UIP C;  5DIZ A;  3FUJ A;  3BEE A;  2VYI A;  3MA5 A;  1KLX A;  5AYW D;  2XGM A;  2H6G A;  2CG3 A;  1FVF A;  1L5J A;  4DRX E;  1WY6 A;  1X81 A;  3PRZ A;  2OVF A;  3E34 A;  4L2Y A;  2Y4U A;  4DI3 A;  3CVX A;  3CHR A;  2C0M A;  4F3V A;  2P9P G;  4A63 B;  4GMJ A;  2LSV A;  3UPV A;  3LS8 A;  2J4B A;  4ZHB A;  4WNF A;  4U0S A;  3ONL A;  3SGH A;  4C0E A;  3SZ7 A;  1RW2 A;  3CQG B;  4KXK B;  5T3R A;  3HHM A;  3ZRH A;  1DCQ A;  3PZ3 A;  1BI8 B;  2VGX B;  4GAA A;  1LTX A;  3EIJ A;  4GTQ A;  3QOU A;  2VSO E;  5B3S E;  2IY0 C;  5E76 A;  4BX9 A;  5AQ9 A;  4LEU A;  3I4R B;  3P2B A;  3E32 A;  5CEA A;  4HNA D;  5FJY A;  4EZK A;  3RAU A;  3DSX A;  2LSU A;  4KVM A;  5FZQ A;  2H6H A;  3FY4 A;  4KBQ A;  4F7A A;  4TXR A;  4TXP A;  2P2C P;  2J09 A;  3GZ1 A;  2XS8 A;  4MBG A;  3KEZ A;  3AS8 A;  1OWL A;  3NF1 A;  3S7F A;  2Y0B G;  2KC7 A;  2GRM A;  4ANX A;  3PE3 A;  3KSQ A;  2VGY A;  3SBS A;  3ZIM A;  1ZU2 A;  4H7Y A;  1K1B A;  3PE4 A;  2GGF A;  1H6K A;  1IKN D;  3LJ3 A;  3ZXP A;  3S7J A;  1H2V C;  2NC9 A;  2QY7 A;  1BI7 B;  1S63 A;  3CVQ A;  4HLE A;  1TYQ G;  4HOQ A;  2QC9 A;  4HOT A;  5HS0 A;  2GW1 A;  2CHW A;  3U66 A;  1DNP A;  1UOH A;  4OVU A;  4KZ0 A;  1S0P A;  3E37 A;  3KD7 A;  3PEU B;  3RRM B;  2PM6 A;  3MGB A;  4UQZ A;  1H2T C;  4J8D A;  3EU9 A;  2RD0 A;  5LP0 A;  2R5S A;  4G11 A;  3LCA A;  1QZ2 A;  5CCM A;  3HVE A;  5KWD A;  3FUF A;  4UWK A;  1U3C A;  3IXE A;  1UG3 A;  4U7E B;  3K9I A;  3PZ2 A;  2J08 A;  3C3R A;  4JC8 A;  3DSV A;  3HXD A;  2DIW A;  2FBN A;  4GTS A;  3FTU A;  4JHK A;  3B7T A;  3PNL B;  2L0T B;  3J5Q B;  4L9P A;  2EIJ E;  4UI9 C;  2AJA A;  5FQ8 A;  2KAT A;  4BT8 A;  4EZJ A;  3AG3 E;  3Q9N C;  2X6K A;  5JA4 D;  3OXF A;  4LCT A;  3MKR A;  3NZS A;  2XEN A;  3ZYM A;  1VDY A;  3VTX A;  5AJD A;  3BU8 A;  4LNB A;  5BNW A;  5ENP D;  3T5V A;  1TNY A;  3L22 A;  3L13 A;  4N39 A;  3GZS A;  3HIZ A;  5FWQ A;  4WWO A;  1FVH A;  1JCQ A;  1QNF A;  2DVW A;  3RRN B;  1OUV A;  2UWJ G;  2WQH A;  4GA0 A;  1LD7 A;  1UJJ A;  2WVI A;  3E30 A;  1XNF A;  2WMO A;  4OAU C;  2DZO A;  3SFZ A;  2LUH A;  3FEY A;  3Q7F A;  3ZGQ A;  5G2N A;  4B8A A;  4FJZ A;  4CT0 A;  1N11 A;  2WXL A;  3TWU A;  4LRZ A;  3SF4 A;  3G2T A;  4MLP A;  3CLJ A;  2GRQ B;  2IOL A;  4U04 A;  2J07 A;  5CMW A;  1O1S A;  4TUU A;  3DXM G;  4JD2 G;  3DSW A;  4FHK A;  4XZ4 A;  4LG6 A;  1HG5 A;  4A3T A;  2EQX A;  1TNU A;  4M7C A;  1NA0 A;  3DPY A;  3DST A;  4U8H A;  4C9B B;  4BES A;  2WXF A;  2BUG A;  2RFA A;  4JEH A;  1MQS A;  3T9K A;  4O1O A;  5FZR A;  1HX8 A;  3QWV A;  3LEW A;  4IN3 B;  3R7Q A;  4GMR A;  3TWT A;  4JA7 A;  2FO7 A;  3TXN A;  3Q49 B;  3HXE A;  1TN7 A;  4G2V A;  3NZU A;  4FAD A;  3QWP A;  2ZXW E;  3JXI A;  2XCC A;  4WWN A;  4DX7 D;  1N0R A;  4UI9 J;  3Q78 A;  5BXO A;  4WNG A;  1MJ0 A;  1N95 A;  4GPM A;  3UKU G;  3ZHE A;  4GZ3 A;  3X2Q E;  1HE8 A;  1FCH A;  4G23 A;  2FO1 E;  3PNT B;  4X8Q A;  1OWP A;  1IYG A;  2OVB A;  5A6C A;  3ULQ A;  1HU3 A;  3IBE A;  3UM3 A;  1Y6I A;  3HDX A;  3ZVV A;  4N2S A;  2MYO A;  1TNB A;  4G26 A;  5EKQ D;  1NL4 A;  5E75 A;  5LCW C;  5G05 C;  5BXU A;  5T8I A;  3OAW A;  4U63 A;  2DBA A;  3ABL E;  5AQB A;  3FFL A;  1IHB A;  3JUE A;  3D9I A;  4HFG A;  3Q7A A;  3UKR G;  4BFR A;  2L0I A;  4LUN U;  2FEZ A;  2WQ6 A;  4GCN A;  3L54 A;  3LDZ A;  2F8X K;  4DPR A;  2HR2 A;  2VSY A;  3NQP A;  2AXV A;  2DCP A;  3DSU A;  4R7L A;  3CR3 A;  3SHF A;  2C0L A;  3MV2 B;  2VQ2 A;  3AS5 A;  1HH8 A;  3D9H A;  1IQU A;  3D9O A;  3D9J A;  4I2W A;  4GB9 A;  3C5R A;  4JA9 A;  1SZA A;  3TXM A;  3CHS A;  3ASH A;  5BPP A;  1N0Q A;  4HS2 A;  2XZT G;  4Q96 A;  1TN8 A;  5CBO A;  5LX8 A;  4KMO A;  1KZO A;  2WXQ A;  3CVP A;  2FUL A;  4PS8 A;  4CDR A;  3JCK C;  2X6I A;  4O6F A;  2R2L A;  4XE0 A;  3S7D A;  2XPI A;  4FUL A;  4I6E A;  2E0I A;  3BUA A;  2F0Y A;  3EU5 A;  4PS7 A;  3L16 A;  5CRV A;  4J8Y A;  2HYZ A;  5JJT A;  3V2X A;  1DCE A;  2CFZ A;  4U8Y D;  4JXT A;  4Q94 A;  2HM8 A;  4BY6 A;  3TG4 A;  3FWV A;  3ASN E;  3AG2 E;  2GRP B;  3T8M A;  2OND A;  3KAE A;  4K5B A;  1MHQ A;  1TN6 A;  5FZS A;  2X6J A;  2CFU A;  1O1T A;  2M63 A;  4DX5 D;  2WMN A;  3LJN A;  2NSZ A;  3UUX A;  5LCW J;  4B8C B;  5G05 J;  3RRU A;  2VSX E;  2OOE A;  4AY6 A;  3FEX A;  4NAC A;  3CHP A;  4GTP A;  1WAO 1;  3HG0 D;  1K8K G;  3C72 A;  4AOF A;  2PM7 A;  2VSN A;  4DX6 D;  2X6H A;  3CIA A;  3FU5 A;  3JYS A;  3TWV A;  3G2W A;  3ASD A;  2R02 A;  4I17 A;  5KJL A;  3FUE A;  4KVO A;  4K0R A;  1Q2Z A;  1PAQ A;  5EIB E;  1WG0 A;  5B1A E;  4BTB A;  2P9U G;  3FDH A;  3QAQ A;  2WXP A;  2R59 A;  2I2O A;  3LPZ A;  4CEM A;  3N71 A;  2J9Q A;  3LYA A;  4BX8 A;  4L2L A;  2BKG A;  2J4D A;  1TEZ A;  2A4Z A;  3CK9 A;  2YNQ A;  5BT1 A;  5JJ6 A;  3RIB A;  2P9N G;  3EIQ C;  5EYP F;  2V5F A;  2XEV A;  5ENN A;  2QYJ A;  1FPP A;  3O48 A;  3HVE B;  2WPV A;  3SNX A;  4L7T A;  3HYM B;  3W9G A;  1MX2 A;  4HRN A;  2XCB A;  4MKT A;  3FTV A;  3ZFW A;  1HFA A;  4GYO A;  2XEH A;  3B13 A;  2LXL A;  4N3C A;  3O4Z A;  4LNG A;  2DZN A;  3CV0 A;  1ELW A;  3C98 A;  3GW4 A;  3PH0 C;  2HO1 A;  3FUD A;  4RLY A;  1NFI E;  2H6I A;  4DI4 A;  1E8Z A;  3FTZ A;  3AAA C;  3FP3 A;  5B1B E;  4AJW A;  3NOG D;  1WM5 A;  3FHE A;  3SI5 A;  4AM9 A;  1MYO A;  4W9R A;  1E8Y A;  3ZYQ A;  4NRH B;  4D10 C;  3ABM E;  1JWG A;  1S64 A;  4KYO B;  2BF0 X;  3B7R L;  4ILH B;  3EHN A;  4EPZ A;  3SFX A;  4CDM A;  4GTM A;  2Y4T A;  4OAV B;  1KPS B;  2PQR A;  3E33 A;  4TUM A;  5HRY A;  4UWH A;  4N3B A;  2R05 A;  3S7B A;  5JJ7 A;  3APD A;  4UWG A;  3ZXS A;  2XGO A;  4AY5 A;  3KSL A;  2LAH A;  3LVQ E;  1HZ4 A;  4FU3 A;  1UN9 A;  2XS1 A;  4BWR A;  4AIF A;  4ME2 A;  4CCA A;  3GZ2 A;  1O5M A;  4JL0 A;  5CED B;  2XRY A;  3TWX A;  3EDT B;  4EBA G;  4JZY A;  3OTN A;  3ENE A;  2AWI A;  4GYY A;  5G04 C;  5AEN A;  2V5Q C;  3ZPJ A;  3W9F A;  3D3M A;  4QFV A;  3RJV A;  1ELK A;  4HQD A;  2NXP A;  5BV1 A;  3CK7 A;  2GRL A;  3MYV A;  3QJZ A;  4YDY A;  5J08 A;  2IFU A;  3MKQ A;  3TGO A;  3APF A;  4U96 D;  4XI0 A;  4I6J A;  3EHR A;  3DEO A;  5KJN A;  4HRM B;  1X5B A;  4TRQ A;  4JW1 A;  2EIN E;  5KJK A;  2WXM A;  3JUI A;  4NUR A;  3HXF A;  5BV0 A;  4F6R D;  3ML9 A;  3B7S A;  3MEK A;  1ELR A;  4K5C A;  3S2A A;  3FU3 A;  3SD5 A;  4AP2 A;  4BET A;  4LNU D;  2VGX A;  4HBD A;  3ZHE B;  2IEJ A;  4FA6 A;  4BSX A;  1DC2 A;  3LY9 A;  4HOU A;  4G24 A;  3VLD A;  4YDO A;  2DYR E;  2KZT B;  1QBQ A;  4HOR A;  3OXG A;  1OWN A;  4CDN A;  2A5U A;  3QKY A;  5ANL A;  4A3V A;  4DX1 A;  4KT6 B;  3AU5 A;  2F8Y A;  3L82 A;  3Q79 A;  4JVS A;  5KNH D;  3PEV B;  3OXL A;  3AJI A;  1JWF A;  3D9L A;  4I2Z A;  1BU9 A;  5CRU A;  5CEC B;  2KCL A;  3Q47 B;  3ZEF A;  4AXH A;  4BEP A;  3CHQ A;  3CHM A;  1G3N B;  4HOS A;  5H7P A;  3Q4A B;  4PH4 B;  3V79 K;  3VLF A;  4F1P A;  2KM4 A;  3D9P A;  1IHG A;  5EIL A;  1UW4 B;  4KZC A;  2RG8 A;  4OYS A;  3CHO A;  3V30 A;  2X38 A;  2Q7F A;  4E85 A;  1E96 B;  4Y6C A;  4IUL A;  1EDU A;  1IXV A;  3LY7 A;  4ANV A;  4C0M A;  5JHA A;  1Z3X A;  4H7X A;  4U07 A;  1EF1 C;  2PQN A;  3VTY A;  2WB2 A;  5ENT D;  1YCS B;  2KXP C;  4ACK A;  3L08 A;  3ABK E;  5FIN A;  2WXH A;  2PZI A;  3SFY A;  3UT8 A;  1JPL A;  2QFC A;  4NIK A;  4DJA A;  3KS2 A;  3LVR E;  1D8E A;  1UN8 A;  2IOS A;  4ILI A;  4JHR A;  3JXJ A;  3DWL G;  4GTV A;  4LSZ E;  4K03 A;  2P9I G;  5D0Q D;  1E7V A;  5ENS D;  2GRN B;  5AQA A;  3RK6 A;  1A5E A;  1HS6 A;  4CGV A;  2RKK A;  3DRA A;  3IV0 A;  3TWS A;  2UY1 A;  3NAW A;  1U3D A;  3HRA A; 
#chains in the Genus database with same CATH homology
 4KBQ A;  5FZS A;  2CHZ A;  2X6J A;  4F7A A;  3EHM A;  2CFU A;  2M63 A;  3ZYL A;  2WMN A;  2J09 A;  3BG0 B;  3GZ1 A;  1PY1 A;  2IQC A;  2NSZ A;  4GZ5 A;  3UUX A;  2V0P A;  3U3W A;  1PC2 A;  5LCW J;  4B8C B;  3KEZ A;  4JEU A;  4N3A A;  5G05 J;  3RRU A;  3AS8 A;  2VSX E;  3WXX A;  2IF4 A;  2OOE A;  3DBS A;  3I5P A;  5T4Y A;  2R17 C;  4AY6 A;  3QAR A;  1OWL A;  3FEX A;  3NF1 A;  3S7F A;  2KC7 A;  4NAC A;  5J90 A;  2GRM A;  3CHP A;  4WNE A;  3IHV A;  4ANX A;  3PE3 A;  1WAO 1;  4UQY A;  2VGY A;  3SBS A;  3ZIM A;  1ZU2 A;  3BG1 B;  4AOF A;  1H2U A;  2PM7 A;  2VSN A;  4H7Y A;  3FUL A;  3PE4 A;  2X6H A;  3CIA A;  1IQR A;  2GGF A;  3FU5 A;  3UX4 A;  3JYS A;  1H6K A;  3G2W A;  3ASD A;  4I17 A;  5KJL A;  5C2Y A;  4U0U A;  1JUQ A;  3CQC B;  3LJ3 A;  2Y3A A;  3FUE A;  4AV7 A;  2XQ0 A;  4KVO A;  3S7J A;  3DPD A;  2LNI A;  4K0R A;  1H2V C;  1PAQ A;  2NC9 A;  4WAF A;  3UT7 A;  4MS6 A;  5ARG A;  3ZN3 A;  2QY7 A;  3FDH A;  4I1A A;  4BTB A;  3QAQ A;  5FQ6 A;  5BW8 C;  2WXP A;  2R59 A;  5G04 J;  3CVQ A;  2I2O A;  4HLE A;  2WM9 A;  3LPZ A;  4HOQ A;  3N71 A;  4CEM A;  2J9Q A;  4L23 A;  5HQ8 A;  3LYA A;  4BX8 A;  4HOT A;  1B89 A;  5AIJ A;  2I1K A;  3D9K A;  4GZD A;  4GCO A;  4L2L A;  2V4L A;  1HXI A;  2GW1 A;  2J4D A;  1TEZ A;  5A23 A;  3FUM A;  4UWF A;  2A4Z A;  4UI9 K;  3CK9 A;  4UWL A;  2CHW A;  1NP7 A;  2WXI A;  2YNQ A;  4J0U A;  5BT1 A;  3U66 A;  1DNP A;  1DVP A;  5CHE E;  4G1T A;  5JJ6 A;  3GYZ A;  4I6G A;  3SBT B;  3D9M A;  3RIB A;  4OVU A;  3MV3 B;  3U4T A;  4GA2 A;  4GZ6 A;  3EIQ C;  2VTB B;  4KZ0 A;  4ILG A;  3CVW A;  2V5F A;  2MRI A;  4V3I A;  1S0P A;  3QB2 A;  2XEV A;  1W3B A;  1SQM A;  4N5C A;  5ENN A;  3TJP A;  3CKC A;  3KD7 A;  3PEU B;  3RRM B;  2VTB A;  1YA0 A;  2PM6 A;  3CEQ A;  3MGB A;  3IKO B;  4UQZ A;  1H2T C;  4J8D A;  4YVQ C;  4J8E A;  3O48 A;  2RD0 A;  2YHC A;  3HVE B;  2JEK A;  2R5S A;  4XKC A;  5EDS A;  5LP0 A;  4G11 A;  2WPV A;  4L1B A;  3CK8 A;  3LCA A;  3Q15 A;  1QZ2 A;  3SNX A;  4L7T A;  3HVE A;  1Z6T A;  3HYM B;  5CCM A;  3FUK A;  3FUF A;  4YND A;  3RKV A;  3R7R A;  4UWK A;  2XCB A;  4GML A;  3R9A B;  4MKT A;  1U3C A;  3FTV A;  3G2V A;  3RO3 A;  4U0Z A;  3ZFW A;  1HFA A;  3APC A;  1UG3 A;  4GYO A;  3IHY A;  3B13 A;  3K9I A;  5ARF A;  3CVN A;  4I1M A;  4GPK A;  3MZL B;  3O4Z A;  4MRU A;  2J08 A;  4N3C A;  1E8W A;  3I4G A;  2J49 A;  4JC8 A;  2DIW A;  2FBN A;  3CV0 A;  3FH8 A;  3ONK A;  1ELW A;  3FTU A;  3PDN A;  4JHK A;  3C98 A;  3VLE A;  5JHB A;  3B7T A;  3PNL B;  3GW4 A;  3PH0 C;  2HO1 A;  1TJF A;  2L0T B;  3FUD A;  1HF8 A;  4APO A;  4DLO A;  4DI4 A;  1E8Z A;  4I43 A;  1ZBP A;  4UI9 C;  2X6F A;  5FQ8 A;  3FTZ A;  3ZW3 A;  2KAT A;  4JPS A;  3FP3 A;  4AJW A;  4BT8 A;  3FUI A;  3U64 A;  1Y8M A;  4IRU A;  5ANR A;  4EZJ A;  1H0A A;  4HXI A;  2AXZ A;  2X6K A;  2ILR A;  3D9N A;  1WM5 A;  3FHE A;  3OXF A;  4RG9 A;  4LCT A;  3SI5 A;  4AM9 A;  3MKR A;  3NZS A;  4W9R A;  2FI7 A;  4JHJ A;  1E8Y A;  4ANW A;  3CVV A;  3ZYQ A;  3ZYM A;  4NRH B;  3JQ1 A;  4D10 C;  4AEZ C;  2CHX A;  1JWG A;  1VDY A;  3VTX A;  4KYO B;  2BF0 X;  5AJD A;  2MOW A;  3B7R L;  2XGS A;  4ILH B;  3EHN A;  4EPZ A;  5BNW A;  4P29 A;  4CDM A;  2Y4T A;  3FTS A;  4ABN A;  3T5V A;  4AVX A;  4ATG A;  3PS6 A;  2KZT A;  2PQR A;  3L22 A;  3L13 A;  4N39 A;  4UWH A;  2WXG A;  3GZS A;  3HIZ A;  3UQ3 A;  4N3B A;  2JLB A;  4DLQ A;  5FWQ A;  4WWO A;  1E90 A;  1FVH A;  3S7B A;  3CVU A;  2OV8 A;  5JJ7 A;  2YQ8 A;  3APD A;  4TV3 A;  4UWG A;  3QNK A;  2IJG X;  3ZXS A;  2L6J A;  5KCM A;  1QNF A;  2E2E A;  3QWW A;  3RRN B;  2XGO A;  4AY5 A;  4GU5 A;  4B0Z A;  1OUV A;  2UWJ G;  4A1S A;  2WQH A;  2LAH A;  3QDN A;  4GA0 A;  5EX3 A;  5HI7 A;  1UJJ A;  2WVI A;  1XNF A;  2WMO A;  2XRZ A;  3LVQ E;  1HZ4 A;  3UMV A;  4EZL A;  4FU3 A;  3SFZ A;  3B7U X;  4FLH A;  1UN9 A;  3FEY A;  3ESL A;  3ZGQ A;  4J6I A;  5G2N A;  4BWR A;  4B8A A;  4FJZ A;  4WND A;  3MCX A;  4FJY A;  4AIF A;  4CT0 A;  4ME2 A;  3LKU A;  3EJN A;  4CCA A;  3JQ0 A;  2WXL A;  4I9C A;  3GZ2 A;  4F1S A;  4LRZ A;  3SF4 A;  2WXR A;  3G2T A;  1QQE A;  4MLP A;  3CLJ A;  5A7D B;  3TG5 A;  4B89 A;  4RG6 A;  4JL0 A;  5AYW D;  4E6H A;  2IOL A;  2X3M A;  2WXJ A;  4U04 A;  2XRY A;  2J07 A;  2L9B A;  3EDT B;  4EBA G;  4JZY A;  3OTN A;  3ENE A;  5CMW A;  2ION A;  5C1D A;  2AWI A;  4TUU A;  4WWP A;  4GYY A;  2WXN A;  5G04 C;  3FU0 A;  4EQF A;  5AEN A;  1OWO A;  3CKB A;  1Z3Y A;  4FHK A;  4XZ4 A;  1OWM A;  3E4B A;  5CMY A;  3ZPJ A;  1H19 A;  4B94 A;  4F53 A;  4HVB A;  3D3M A;  1HG5 A;  1HG2 A;  4A3T A;  3PVL A;  2EQX A;  1NZN A;  5FT9 A;  1NA0 A;  4J8S A;  2AVP A;  4QFV A;  3RJV A;  4U8H A;  4PUC A;  4C9B B;  2WXF A;  1ELK A;  2BUG A;  4JEH A;  1MQS A;  2WXO A;  5FZR A;  3UT4 A;  2NXP A;  5BV1 A;  3CK7 A;  3MKQ B;  5DBK A;  2GRL A;  4GA1 A;  3MYV A;  3QJZ A;  1HX8 A;  5J08 A;  3QWV A;  4PS3 A;  2IFU A;  3LEW A;  3MKQ A;  5FQ7 A;  3TGO A;  4IN3 B;  3R7Q A;  3APF A;  4XI0 A;  2V8S E;  4I6J A;  4JA7 A;  1TJC A;  2FO7 A;  3Q5M A;  4LER A;  4I1O B;  3T5X A;  5KJN A;  2FF4 A;  1X5B A;  3TXN A;  5LFA A;  3Q49 B;  4TRQ A;  2XPY A;  4FHJ A;  3LY8 A;  3G2S A;  4JW1 A;  4G2V A;  3FUH A;  1E7U A;  4APF A;  2IU1 A;  3NZU A;  4FAD A;  5KJK A;  2I9C A;  3QWP A;  2WXK A;  4NQ0 A;  2WXM A;  3JUI A;  4NUR A;  4EEC A;  3AS4 A;  5BV0 A;  2LO6 A;  2XCC A;  4WWN A;  3ML9 A;  5M72 A;  4XKB A;  3B7S A;  3MEK A;  4UI9 J;  4PDX A;  1ELR A;  4RSY A;  4XIF A;  4BTA A;  3S2A A;  4WNG A;  4Q69 A;  3FU3 A;  3SD5 A;  4AP2 A;  3LXU X;  4CT4 A;  5BUZ A;  4A1G A;  2VGX A;  3ZHE B;  3FU6 A;  4FA6 A;  3FH5 A;  3ZHE A;  3FTX A;  3FTY A;  4GZ3 A;  4ANU A;  4DK5 A;  4N2Q A;  4BSX A;  2WQ7 A;  4XX5 A;  3TAX A;  3LY9 A;  4HOU A;  1N54 A;  3FUN A;  1HE8 A;  4G24 A;  1E8X A;  1FCH A;  4G23 A;  3PNT B;  3RO2 A;  4XI9 A;  2LAI A;  1OWP A;  3VLD A;  3PRE A;  1IYG A;  2OVB A;  5A6C A;  2KCK A;  2MHK A;  3QK0 A;  3ULQ A;  4RVB A;  2KZT B;  3ML8 A;  1HU3 A;  4HOR A;  3OXG A;  3IBE A;  3FH7 A;  3ASG A;  1OWN A;  3ASF A;  4URK A;  4CDN A;  1Y6I A;  2A5U A;  3QKY A;  5EX0 A;  5ANL A;  4A3V A;  4KT6 B;  3AU5 A;  3HDX A;  4FLB A;  3ZVV A;  5G55 A;  4N2S A;  4GZC A;  2BTD A;  3TL5 A;  3P1U A;  4G26 A;  3CST A;  5EKQ D;  5E75 A;  1BPO A;  5LOZ A;  5LCW C;  3CVY A;  5G05 C;  1A17 A;  1XGW A;  4JVS A;  5KJM A;  4CGW A;  5T8I A;  3OAW A;  3PEV B;  3OXL A;  1EYH A;  2PL2 A;  4BT9 A;  4U63 A;  2DBA A;  3ESK A;  1JWF A;  3D9L A;  3FFL A;  4I2Z A;  4GYW A;  4FP7 A;  3CVL A;  1GW6 A;  5FTP A;  4I9E A;  3D9I A;  2KCL A;  3Q47 B;  3PUK A;  4HFG A;  4Y6W A;  2ZU6 B;  4ACL A;  3ZEF A;  4AXH A;  3CHQ A;  3AU4 A;  4BFR A;  2L0I A;  3CHM A;  4LUN U;  2FEZ A;  2WQ6 A;  4HOS A;  4WUY A;  4GCN A;  3L54 A;  1HO8 A;  2AXU A;  3LDZ A;  4J8F A;  4OVV A;  4DPR A;  1KT0 A;  3Q4A B;  4A55 A;  2HR2 A;  4PH4 B;  3PUJ A;  3MX3 A;  3RU0 A;  2VSY A;  5CCL A;  1SZ9 A;  3NQP A;  3QC1 A;  2AXV A;  2YIN A;  2DCP A;  3VLF A;  2P58 C;  4R7L A;  1UJK A;  2KM4 A;  1IHG A;  3D9P A;  5DIZ A;  3FUJ A;  3BEE A;  2VYI A;  1UW4 B;  1KLX A;  2XGM A;  2XPZ A;  3CR3 A;  2VJ8 A;  3I3N A;  3MA5 A;  4KZC A;  2CG3 A;  1P5Q A;  2RG8 A;  4OYS A;  2C0L A;  1FVF A;  1L5J A;  3CHO A;  3MV2 B;  1WY6 A;  3PRZ A;  2OVF A;  2VQ2 A;  4L2Y A;  2X38 A;  2Y4U A;  3AS5 A;  1HH8 A;  2Q7F A;  4G25 A;  4DI3 A;  4E85 A;  1IQU A;  2XHE A;  3CVX A;  1E96 B;  3CHR A;  2C0M A;  4F3V A;  4Y6C A;  4IUL A;  1EDU A;  3D9O A;  3D9J A;  3LY7 A;  4I2W A;  3ZYK A;  4GB9 A;  1KT1 A;  4GMJ A;  2LSV A;  4M3O A;  3PZD A;  4CRW A;  4ANV A;  2C2L A;  4JA9 A;  3UPV A;  4C0M A;  1SZA A;  3TXM A;  3CHS A;  3LS8 A;  5JHA A;  2J4B A;  3ASH A;  1Z3X A;  4EBA A;  4H7X A;  5FQ4 A;  5BPP A;  4U07 A;  1EF1 C;  2PQN A;  4WNF A;  4HS2 A;  3VTY A;  1NA3 A;  4Q96 A;  2KCV A;  2WB2 A;  4U0S A;  3L6A A;  2CG2 A;  3ONL A;  4KMO A;  5LX8 A;  3IEG A;  4ACK A;  4UQX A;  3SGH A;  3L08 A;  4IYP A;  4C0E A;  2WXQ A;  2WXH A;  3SZ7 A;  2PZI A;  3CVP A;  3L17 A;  2FUL A;  1JPL A;  2QFC A;  3CSF A;  3G2U A;  4PS8 A;  3UT8 A;  4CDR A;  4DJA A;  3KS2 A;  3LVR E;  3CQG B;  3JCK C;  4KXK B;  1UN8 A;  2IOS A;  2X6I A;  5T3R A;  3HHM A;  4ILI A;  3ZRH A;  4O6F A;  4XE0 A;  4JHR A;  3S7D A;  2XPI A;  2VGX B;  4FUL A;  3U9W A;  4K03 A;  3URZ A;  4I6E A;  2E0I A;  4GAA A;  3FTW A;  5D0Q D;  1INZ A;  3MJW A;  4PS7 A;  3EIJ A;  3L16 A;  4FC8 A;  3QOU A;  1E7V A;  2VSO E;  4YVO A;  1LF8 A;  1MHQ A;  3CGH A;  5E76 A;  2HYZ A;  3RK6 A;  4BX9 A;  1EPU A;  5JJT A;  1N52 A;  1HS6 A;  4CGV A;  2CFZ A;  2I6H A;  4JXT A;  2UY1 B;  4Q94 A;  4LEU A;  3I4R B;  3IV0 A;  2HM8 A;  3P2B A;  4BY6 A;  3TG4 A;  3FWV A;  2UY1 A;  1U3D A;  3SHF A;  3T8M A;  2I1J A;  5FJY A;  5AJL A;  4EZK A;  2OND A;  3KAE A;  5D0O D;  2LSU A;  4KVM A;  2YHE A;  5FZQ A;  2AW6 A;  3FY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...