2HYZA

Crystal structure of an 8 repeat consensus tpr superhelix (orthorombic crystal form)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
136
structure length
136
Chain Sequence
AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords SYNTHETIC CONSENSUS TPR PROTEIN
publication title Structure and stability of designed TPR protein superhelices: unusual crystal packing and implications for natural TPR proteins.
pubmed doi rcsb
total genus 56
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2006-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2hyzA00
3AS5A 2C2LA 3Q49B 3ZFWA 3S7DA 5LCWJ 5G04J 5CCMA 5ARFA 3OXFA 3FFLA 5EKQD 2YQ8A 4BTBA 2PQNA 4WNGA 4Y6WA 3U3WA 3GW4A 4WNFA 1IHGA 5HQ8A 4G23A 4I9CA 2LNIA 4J0UA 3ULQA 1B89A 3ASHA 4GZ3A 4AY5A 3EDTB 4GA1A 4KXKB 4N3BA 5BW8C 3TGOA 1KLXA 3ZN3A 1HZ4A 2VGYA 2VYIA 2PL2A 1ZBPA 5DIZA 4GYWA 3ESKA 3N71A 2VGXA 3ZGQA 5HI7A 5FT9A 4N5CA 4U07A 3AS8A 4XIFA 5G05C 1A17A 3CVPA 2WQHA 2AVPA 4N3AA 4J8EA 4BT8A 5KJMA 1KT0A 4WNEA 5G04C 3SZ7A 3CKBA 2FEZA 5BNWA 3GYZA 3Q5MA 4G26A 3IEGA 4GPKA 3MKRA 2WPVA 3S7FA 4YNDA 2XCCA 4IN3B 3KS2A 2R5SA 2UWJG 5ARGA 4LEUA 4AM9A 4HOUA 2VQ2A 2HYZA 3CV0A 2FO7A 4I9EA 3QWPA 4G1TA 3UPVA 3BEEA 5G05J 3FWVA 4RG9A 5CCLA 3AS4A 1KT1A 3KAEA 3MV3B 3GZ1A 4I17A 3MEKA 4U0SA 2IFUA 1QZ2A 2C0MA 2XCBA 3ASDA 5FJYA 3CEQA 3TG4A 5FZQA 5D0OD 4NQ0A 2YHCA 2BUGA 2KC7A 3OXLA 3CKCA 4GCNA 4NRHB 4JA7A 3QWVA 4ME2A 5EX3A 3CK8A 4AIFA 1HXIA 5BT1A 5JJ7A 2KCVA 2P58C 3SF4A 1Y8MA 2V5FA 4F3VA 3CVQA 2LSVA 4I1AA 3MA5A 4KBQA 3K9IA 2FF4A 2UY1A 3TG5A 2UY1B 4BTAA 3QDNA 3LY9A 4UQXA 3RIBA 3VTXA 2VSYA 2VGXB 1E96B 3PE4A 4WUYA 3LY7A 4EQFA 3ZPJA 1ZU2A 4GYYA 4N39A 4YVOA 3LCAA 2VSNA 3URZA 2Q7FA 3UUXA 5JJ6A 4GCOA 5A7DB 1NZNA 2Y4TA 4A1SA 5C1DA 4WNDA 3CK7A 4B94A 4BT9A 1IYGA 4RG6A 4GA0A 3Q15A 3R9AB 4YVQC 1ELWA 3RU0A 4G25A 4KYOB 2E2EA 3S7BA 3PE3A 3QKYA 2DBAA 3VTYA 4HORA 5D0QD 3CVNA 2C0LA 4HOTA 4GZ5A 5A6CA 3ASFA 1PC2A 5DBKA 4HOQA 1W3BA 2ONDA 3U4TA 5FZRA 4U04A 4CGWA 2FBNA 1NA0A 2FI7A 3RKVA 3S7JA 5M72A 2HO1A 3QOUA 4GYOA 2GW1A 2XGSA 2IF4A 4BWRA 3LPZA 1NA3A 5AYWD 3TAXA 1FCHA 2OOEA 2XPIA 4UQYA 4H7XA 4W9RA 2QFCA 3QWWA 5CHEE 1OUVA 1ELRA 3MV2B 4JHRA 4I2ZA 2KCKA 1HH8A 2L6JA 3PDNA 4UQZA 3LY8A 4J8FA 3O48A 4N2QA 1YA0A 3E4BA 1TJCA 4U0ZA 3ZHEA 5FTPA 1XNFA 3ZHEB 5KJKA 3GZ2A 3JYSA 3OXGA 1QQEA 4J8DA 1WM5A 5EX0A 4CDRA 2XGOA 2KCLA 4UI9C 4HOSA 5FZSA 4N2SA 4XI0A 4Y6CA 4GZ6A 4APOA 3CVLA 3LKUA 2KATA 4AY6A 3ASGA 2MHKA 4G2VA 4I2WA 5KJLA 2Y4UA 2I6HA 5LCWC 3RJVA 4G24A 3Q47B 4H7YA 3RO2A 3HYMB 3RO3A 4CGVA 2PQRA 2J9QA 4GA2A 2JLBA 4N3CA 3FP3A 2HR2A 1WAO1 3Q4AB 4UI9K 2XEVA 2XGMA 2PZIA 4UI9J 4JA9A 3KD7A 4JL0A 3UQ3A 3WXXA 2NC9A 3LYAA 3NF1A 5JJTA 2LSUA 4XI9A 5KJNA 4O6FA 4U0UA 3CK9A 1P5QA 4ABNA
chains in the Genus database with same CATH superfamily
1N94A 3ZFWA 5LCWJ 2V5QC 5AQ7A 4BERA 2LUHA 2LXMA 3BG1B 4JW1A 4BTBA 2F37A 5ENOD 2WXKA 4WNGA 3SBTB 4CRWA 3O4ZA 2VJ8A 2RKKA 4G23A 4I6GA 4LNBA 4HXIA 2LNIA 2P9IG 2ETAA 3ULQA 1UN9A 3FUFA 2XRYA 3PVLA 1SVXA 4GTQA 4GZ3A 2H6FA 4GA1A 1MX2A 2X6HA 4N3BA 3TGOA 3ZN3A 1ZBPA 3T9KA 4FP7A 3N71A 5HI7A 1H6OA 4FHJA 3TWVA 5LFAA 1A17A 2AWIA 3ZYKA 4URKA 4DX2A 1TN7A 4IRUA 1OXJA 4WNEA 3B13A 4K5AB 1UN8A 3CR3A 4DPRA 4NIKA 3UIOC 4Z68A 5BNWA 1OCRE 4M3OA 3IEGA 5AAOA 3NOGD 3UM0A 2WPVA 3FUMA 3DSSA 4IN3B 3UMVA 5HKPA 4PDXA 1TN6A 5CERB 3KS2A 2R5SA 2WXOA 1E8ZA 4XZ4A 4LEUA 3U9WA 1X81A 3QWPA 3UPVA 4O1PA 4RG9A 5CCLA 3PRZA 3B7UX 3CIAA 4RVBA 1S63A 4EHMA 2J07A 1N0QA 5CBNA 1D9SA 5IY5E 5AQBA 1KZPA 2IJGX 3MEKA 1G3NB 1UJJA 5AQ9A 4Q94A 2IFUA 3APDA 4GTVA 2Y0BG 3ASDA 3RSEG 5FJYA 4I6EA 1UW4B 4LERA 3T5VA 1HX8A 3OXLA 1ZB1A 3DPYA 3MCXA 2F8YA 3HXFA 4JA7A 3UT7A 3W9FA 1YMPA 1EF1C 3QWVA 4U63A 2Y1LE 2NYJA 5EX3A 4XKBA 3SO8A 5CMYA 4WAFA 2XPZA 5AENA 2P58C 4CEMA 3CHQA 2J09A 3F6QA 4DLQA 4F3VA 3AJIA 2LXLA 4PS8A 3K9IA 1KZOA 2UY1A 1UJKA 1OY3D 3TG5A 3DSXA 2UY1B 4BTAA 4MBGA 1Z6TA 1DCQA 4ACLA 3DPDA 3FTYA 5EYLA 4E6HA 2NXPA 3RRMB 4XKCA 2CHXA 4WUYA 3DWLG 4GTOA 4EQFA 2WXNA 3UKRG 3ZVVA 4GAAA 4DX7D 3AU4A 4TRQA 3CLJA 4ILIA 3FHEA 2WQ7A 2Y4TA 2MYOA 5C1DA 3JQ1A 4WNDA 3CK7A 4LUNU 2P9PG 3AU5A 4BT9A 1IYGA 3G2SA 3Q15A 3NZUA 4BSXA 4JEHA 2X6KA 3ZYQA 4G25A 2E2EA 3TWTA 4GU5A 3S7BA 3PE3A 4PH4B 3SNXA 3DSWA 2MOWA 5FINA 2AW6A 1OCCE 5LX8A 1HS6A 4RSYA 4HOTA 4UWFA 1PC2A 1NL4A 3UXGA 1W3BA 5ENNA 3ZXSA 2KM4A 1INZA 1N52A 4CGWA 3FEXA 2YHEA 2FBNA 3G2WA 2FI7A 3U64A 1OWOA 4DI3A 3QOUA 5CRUA 1YCSB 3LS8A 5BPPA 4C0EA 1H0AA 5AYWD 3AG1E 3TAXA 4H7XA 3BG0B 1OUVA 2I9CA 1H6PA 1BLXB 4JEUA 3MV2B 4JHRA 3FTXA 4DUIA 5HRYA 4UQZA 4YDEA 4ANWA 3ULYA 3EHRA 3O48A 2WXGA 2R59A 1XGWA 2Y3AA 3EIJA 4N2QA 3FH5A 3SHFA 4JHKA 3DXKG 3ASOE 1MZCA 3KEZA 2R05A 5KJKA 1SA5A 2L0TB 1S0PA 1FT2A 2BF0X 3JYSA 2AXZA 2GRLA 1IKND 2L6BA 1DNPA 3P1UA 4C48B 3BU8A 4TV3A 3C3QA 5ANRA 4N2SA 3TWRA 5AARA 3MKQA 3MGBA 5EIDA 3MKQB 4ILHB 3I5PA 3Q7FA 3C5RA 1MYOA 3LKUA 4DX6D 4AY6A 2DYRE 4I2WA 3G2UA 3D9JA 3ZXPA 3RJVA 4M7CA 4RQIA 2PQRA 2V0PA 3QAQA 2JLBA 1N54A 1MX6A 3DBSA 3SY2A 1E8WA 3FP3A 2HR2A 5C2YA 4JHJA 4R7LA 2QYUA 4JD2G 2XEVA 2PZIA 4UI9J 3KD7A 3WXXA 4U8YD 4XI9A 5KJNA 2H6HA 1P5QA 1DVPA 1LF8A 4GTPA 3FUNA 1MHQA 1JCRA 3S7DA 3LXUX 2B0OE 1BU9A 2GRPB 3Q78A 5CMWA 4UUCA 1OWNA 5CCMA 3ZIMA 2XEHA 4ATZD 2PQNA 4Y6WA 3VLFA 3Q73A 4A63B 2KXPC 4F7AA 4GTRA 2BEDA 1Z3XA 5ITZF 5FIOA 2IONA 1H2VC 2ZGDA 1HZ4A 2PL2A 4LSZE 2IOLA 3EHNA 2RD0A 5DIZA 4AXHA 2B6CA 3ESKA 2CG2A 2P9UG 2QC9A 3ZGQA 5FT9A 5D66A 3NZSA 2WQ6A 4N5CA 5FQ8A 3E34A 3AS8A 5G05C 1QBQA 4GZCA 3W9GA 3CQGB 2WQHA 5KJMA 4J7WA 4P29A 4CDNA 3SZ7A 1U3DA 5KCMA 2X38A 4XX5A 2A5EA 5D2MC 3Q5MA 3ABLE 3I4RB 2BKKB 4F53A 3L82A 2CHZA 3B7TA 1WG0A 1BD8A 4F1SA 2DIWA 1Z5SC 1ELKA 3D9OA 2X6JA 4B93B 2WXFA 3MJWA 2VQ2A 3CV0A 5B1BE 2YINA 4G1TA 2R2LA 3BEEA 2WMNA 3FWVA 3EHMA 4MLPA 2P9LG 4PS3A 4MS6A 4HFGA 1JWGA 2DCPA 3CQCB 3IXEA 1Y6IA 4JC8A 4PS7A 4U0SA 3CVUA 3UM1A 3EJNA 3AG2E 5ANLA 3FTVA 5J08A 3CHRA 5FZQA 4NQ0A 3HXDA 2YHCA 3V31A 5CEDB 4CZ2D 3ONKA 4DX1A 4BFRA 4NRHB 3L13A 3HVEA 4ME2A 3JQ0A 4AIFA 3ENEA 3HVEB 3D3MA 1N0RA 1D8EA 2WXIA 5JJ7A 1Y8MA 4TXPA 4HLEA 3MA5A 1TNZA 3UKUG 3P2BA 4OYSA 1UG3A 3FUKA 4AEZC 3QDNA 4UQXA 4TXQA 1QYMA 2EIME 4JXTA 3VTXA 4FA6A 3SFXA 3LY7A 2ZU6B 3C98A 3C72A 1ZU2A 5A23A 4N39A 3L17A 3HG0D 4DK5A 3ONLA 1SZAA 1BI8B 1O1RA 1S64A 5A7DB 1WDYA 4A1SA 4DI4A 4B94A 2EILE 3UM2A 3UM3A 4D10C 4YVQC 4FHKA 3ABKE 3FTZA 3RU0A 3QKYA 5ENTD 4FADA 4WWOA 2JEKA 4QFVA 4X8QA 3SFZA 5E75A 2C0LA 1RW2A 3CGHA 5A6CA 5DBKA 2ONDA 4EZLA 3PEVB 4KVOA 3Q9NC 3IBEA 1H2TC 1MX4A 3RKVA 3CHOA 3LJNA 2HO1A 4KMOA 3PH0C 4A1GA 2XS1A 1Z3YA 3CVXA 4BWRA 1FCHA 1GW6A 4UQYA 2WXPA 1NI1A 3ESLA 4LNGA 1ELRA 3FTUA 3NAWA 2ZISA 2KCKA 1HH8A 3ZYMA 1LD8A 3AAAC 3QK0A 4J8YA 2I1KA 4BETA 1IHBA 3CVWA 4J6IA 2PM6A 4BESA 5BXUA 2DZOA 1JCSA 3D9PA 3FUIA 3E4BA 1TJCA 3QC1A 4U0ZA 5JHBA 4Q69A 3FU0A 4K03A 2XPYA 4AJWA 4FJYA 2CG3A 3RAUA 3PZ4A 4GMRA 3ZUVB 2DZNA 1QQEA 1WM5A 3E33A 4KZ0A 4C9BB 4KZCA 3MYVA 2P9NG 2XGOA 3UINC 4DX5D 3BQOA 3EU5A 2IU1A 1OWLA 5EDSA 5B3SE 4Y6CA 5BV0A 2DWZA 5AQAA 2KATA 3PREA 3ASGA 3CSFA 1TR4A 3NB2A 3T8MA 3ML9A 4LRZA 2I6HA 2YNQA 4ANXA 1OCOE 2OEVA 5H7PA 3ZYLA 3LVQE 5AIJA 3ZEFA 2J9QA 2F0YA 4IULA 2I1JA 3RRUA 1WAO1 3DEOA 3JXIA 2RFMA 3Q4AB 2A4ZA 4HB5A 1MQSA 4JL0A 3J5PA 3UQ3A 2NC9A 2PM7A 3G2VA 5T8IA 4BY6A 3APCA 3CK9A 2EQXA 4EECA 4ZHBA 3ZKJA 4A55A 4HRMB 5FQ7A 3TWSA 1N4RA 1H19A 5FWQA 3FY4A 4CT0A 4KT6B 2C2LA 3Q49B 2V4LA 3B7SA 1TYQG 3MX3A 2OV8A 5G04J 2V4HC 4QQIA 3D9HA 5ARFA 3OXFA 3FFLA 4G8KA 2GROB 1SZ9A 3GZSA 5CECB 1IHGA 5HQ8A 2P9KG 4ZFHA 3UTMA 3UT4A 1S70B 3R7QA 3ASHA 2WM9A 1NFIE 4AY5A 4JPSA 2H6GA 2J49A 4I6JA 5ENQD 1KLXA 2IO2C 1E8XA 1SW6A 4I1OB 3BUAA 4GPMA 2VGXA 1X5BA 2L0IA 4ANUA 4CYMD 4FJZA 3ZU7B 4OVUA 2AVPA 2Y69E 4N3AA 3L22A 4NURA 3SGHA 3PZ2A 3CVVA 1KT0A 5CBOA 3FU3A 4FLBA 5G04C 4EZKA 3DSUA 3QARA 2XENA 2J08A 3MKRA 1IXVA 4YNDA 3S7FA 2XCCA 3LEWA 1JUQA 2I2OA 3CHSA 2ETCA 5ENRD 2BTDA 2P9SG 3D9KA 2DVWA 2QZAA 2UWJG 1K1AA 4GTTA 5ARGA 5CRVA 2XQ0A 3TJPA 4JB8P 3QNKA 5G55A 3ZNGA 4APFA 5BV1A 4I9EA 5G05J 3KSLA 3L54A 4GB9A 2M63A 5LOZA 4XEIG 4LNUD 2CFZA 1KT1A 3MV3B 3UI2A 3T8KA 3GZ1A 4I17A 2IQCA 5LP0A 1HE8A 5E76A 2C0MA 1O1TA 5KNGA 2WXMA 3U66A 3TG4A 5D0OD 4YDOA 5FQ6A 1Q2ZA 3CKCA 1IQUA 4GCNA 3R9MA 4WWPA 1V54E 5BT1A 2XHEA 4HRNA 5JMND 4DLOA 3SF4A 2OVFA 3HHMA 2V5FA 1E8YA 3EU9A 3CVQA 2LO6A 2LSVA 3L6AA 4KBQA 2ETBA 2FF4A 3FUEA 2R17C 4BX9A 4AP2A 3LY9A 1N4SA 2QY7A 3D9IA 3RIBA 4I43A 3PE4A 1DC2A 2OCCE 3PNTB 1N4PA 4EZJA 1HF8A 4GYYA 2WXJA 3I4GA 4YVOA 5HS0A 3HXCA 2WMOA 4YDWA 4PUCA 2KBXA 2PNNA 4OAVB 5AJDA 4TUUA 3ABME 3UUXA 4UWLA 3S2AA 5JJ6A 4GCOA 3IHVA 4MKTA 4G8LA 2X3MA 3OTNA 3R9AB 3R7RA 4HI9A 1K3ZD 4N5QA 3JCKC 2DBAA 3CSTA 3FUDA 3VTYA 4HORA 2XZDG 4LCTA 1SA4A 1SQMA 5JHAA 3Q79A 1OCZE 4HQDA 3ASFA 3FTSA 2WVIA 3Q7AA 4UWHA 2XEEA 5FZRA 4EPZA 3Q9UC 4U04A 4FC8A 3L08A 4U96D 1NA0A 3HRAA 1D8DA 5M72A 4GYOA 2GW1A 2IF4A 1FT1A 1PY1A 4DRXE 3L9TA 3L16A 4W9RA 2QFCA 3QWWA 3OAWA 5EIBE 4CT4A 3FH7A 2AXVA 3HDXA 2J8SD 3KEAA 3IV0A 4I2ZA 3PDNA 4UWGA 2GRNB 3PS6A 4FLHA 1OWMA 2R02A 3CVYA 4U7EB 3JUEA 1YA0A 4K5CA 3TXMA 3APFA 3PZ1A 5EILA 2HE0A 3ZHEA 5FTPA 1XNFA 3I3NA 3ZHEB 3C3RA 3GZ2A 3DEPA 5B1AE 1KPSB 2ZGGA 2EINE 5FQ4A 4CDRA 4L2YA 4EBAG 2EIJE 2FO1E 4HOSA 3VLEA 1E90A 1N4QA 4XI0A 4G11A 1YYHA 3MZLB 3AG4E 1HG5A 2E0IA 1H2UA 5G2NA 2KZTA 3FDHA 2GRMA 4EBAA 4G2VA 3V79K 1TNOA 2KZTB 2Y4UA 3FUHA 2P2CP 5LCWC 4HS2A 3Q47B 2WXQA 3RO2A 1DCEA 3RO3A 4J8SA 4O60A 2V8SE 4BSZB 3E30A 4GA2A 3TWQA 1TJFA 2JABA 4B89A 3NOCD 3QJZA 4UI9K 3NBNB 2AXUA 3WG7E 2VTBA 3LYAA 4A3TA 1TNYA 3C3OA 2LSUA 5KBAA 2VTBB 1TNUA 3TXNA 3IKOB 3UIPC 4ABNA 1N95A 3IHYA 3AS5A 2RFAA 4IYPA 3CHMA 3LJ3A 1HG2A 2EIKE 4I1MA 3SFYA 2GGFA 5AN8A 4U8VD 3QB2A 5EKQD 2YQ8A 3U3WA 3GW4A 2X6FA 1AWCB 4WNFA 3EUVA 3AG3E 4GTSA 4BEPA 5BXOA 4I9CA 5T3RA 4JZYA 4J0UA 4L2LA 1E7VA 2LAHA 3D9NA 1WY6A 1B89A 2VSOE 3FUJA 1RZ4A 4HI8A 1TNBA 3PEUB 4FU3A 1N11A 3EDTB 4B0ZA 5JA4D 4KXKB 4K5BA 1E7UA 5BW8C 3VLDA 3UX4A 1K8KG 2VGYA 2VYIA 4GYWA 3ZRHA 3EHQA 4HVBA 2X6IA 4U07A 3ML8A 1MJ0A 4XIFA 1BPOA 3CVPA 3TWXA 4J8EA 4BT8A 3LDZA 4HBDA 3G2TA 1PAQA 2RG8A 3CKBA 2FEZA 3GYZA 2J4BA 4G26A 3HXBA 4HNAD 1FPPA 3TL5A 4GPKA 3SD5A 2CFUA 4B8AA 4WWNA 4BX8A 1VDYA 2VGEA 4TUMA 4AM9A 3DXMG 4HOUA 2HYZA 4L7TA 2FO7A 4TXRA 3Q75A 4HLLA 4L9PA 3LVRE 4Q96A 3AS4A 3CHPA 5J90A 4F6RD 3KAEA 2R03A 5CEAA 2L9BA 1N9AA 4YDYA 1QZ2A 2GRQB 2XCBA 4GMJA 3CEQA 1H6KA 2KC7A 2BUGA 2IO3C 3TWUA 2A5UA 1O1SA 2LAIA 5EN5D 2XZTG 2XS8A 3CK8A 1HO8A 1OWPA 3DSTA 2WXLA 1HXIA 4AV7A 5AJLA 2KCVA 3ZW3A 4CDMA 3FEYA 4OVVA 4F1PA 4I1AA 3V2OA 3NQPA 2ZIRA 1IQRA 5T4YA 4OAUC 1JCQA 4DJAA 2BKGA 3B7RL 3SI5A 3FULA 2QYJA 2VSYA 2VGXB 1E96B 3PZ3A 4UWKA 3FU5A 3ZPJA 4B8CB 1JWFA 3KSQA 2MRIA 4C0MA 4O1OA 1O5MA 3T5XA 3LCAA 2VSNA 3URZA 1UOHA 2Q7FA 1TEZA 4ANVA 1NZNA 5BUZA 1TN8A 3ISMC 2IY0C 1JPLA 4RG6A 4GA0A 3HIZA 2DYSE 3B95A 1ELWA 4MRUA 4KYOB 3SQVA 4U8HA 2VSXE 1L5JA 4GMLA 2GRRB 1K1BA 3UT8A 2FULA 5D0QD 2NSZA 3CVNA 4A3VA 3PZDA 4ACKA 5KNHD 4GZ5A 1V55E 2IOSA 3RRNB 4HOQA 2XRZA 3U4TA 4LG6A 4JVSA 3S7JA 2WXHA 1HU3A 3X2QE 4K0RA 3B7BA 4RLYA 3RK6A 1U2VG 5ENPD 5KWDA 4XE0A 2XGSA 3LPZA 1NA3A 2OOEA 2XPIA 3DSVA 4FULA 1EDUA 5CHEE 1EPUA 2L6JA 4E85A 3LY8A 4J8FA 5EYPF 2J4DA 4HRLA 2H6IA 3E37A 3FU6A 1HFAA 4U95D 4CCAA 3JXJA 2ZXWE 1A5EA 3TWWA 2F8XK 4ILGA 3E32A 4GZDA 2ILRA 4GTMA 3HXEA 3V2XA 3OXGA 1OT8A 1FVHA 4J8DA 5EX0A 3DRAA 3PNLB 2KCLA 1BI7B 4UI9C 5FZSA 2CHWA 4GZ6A 1EYHA 4APOA 3EIQC 3PUKA 3CVLA 2HM8A 1LD7A 4AVXA 3FTWA 3FH8A 2MHKA 5KJLA 2AJAA 4L1BA 1LTXA 4G24A 2OEWA 4H7YA 3HYMB 4CGVA 3D9MA 4AOFA 1U3CA 3J5QB 4NACA 2WXRA 4L23A 1FVFA 3JUIA 5ENSD 3SBSA 4N3CA 3D9LA 2IEJA 3PUJA 2XGMA 1QNFA 3ULEG 4JA9A 3V30A 1AP7A 4KVMA 3NF1A 5JJTA 4ATGA 4V3IA 4O6FA 4U0UA 2OVBA 3ASNE 2WB2A 1NP7A
chains in the Genus database with same CATH topology
3IHYA 1H19A 1MHQA 3AS5A 3FY4A 5FWQA 4CT0A 4KT6B 4IYPA 2C2LA 3CHMA 3Q49B 3LJ3A 2V4LA 3B7SA 3S7DA 1HG2A 3ZFWA 5LCWJ 3LXUX 3MX3A 2OV8A 5G04J 4I1MA 2GGFA 5CMWA 1OWNA 3QB2A 5CCMA 5ARFA 3BG1B 4JW1A 3ZIMA 3OXFA 3FFLA 5EKQD 2YQ8A 4BTBA 2WXKA 2PQNA 4WNGA 1SZ9A 4Y6WA 3SBTB 3GZSA 3GW4A 3U3WA 3VLFA 2X6FA 4CRWA 4WNFA 1IHGA 3O4ZA 2VJ8A 5HQ8A 4G23A 4F7AA 4I6GA 4I9CA 5T3RA 4JZYA 4HXIA 2LNIA 1Z3XA 4J0UA 4L2LA 3ULQA 1UN9A 1E7VA 3FUFA 2XRYA 3PVLA 3UT4A 2LAHA 3D9NA 1WY6A 1B89A 3R7QA 2VSOE 3ASHA 3FUJA 2WM9A 3PEUB 4FU3A 2IONA 4GZ3A 4AY5A 3EDTB 4JPSA 4GA1A 4B0ZA 4KXKB 2X6HA 1H2VC 1E7UA 4N3BA 5BW8C 2J49A 3TGOA 4I6JA 3VLDA 1KLXA 3UX4A 3ZN3A 1E8XA 1HZ4A 2VGYA 2VYIA 2PL2A 1ZBPA 2IOLA 3EHNA 2RD0A 5DIZA 4AXHA 4FP7A 4I1OB 4GYWA 3ESKA 3N71A 3ZRHA 2CG2A 2VGXA 3ZGQA 5HI7A 5FT9A 1X5BA 4FHJA 4HVBA 2L0IA 3NZSA 5LFAA 4N5CA 2WQ6A 5FQ8A 2X6IA 4ANUA 4U07A 3ML8A 3AS8A 4XIFA 5G05C 4FJZA 1A17A 1BPOA 4OVUA 2AWIA 3ZYKA 3CVPA 4GZCA 4URKA 3CQGB 2WQHA 2AVPA 4N3AA 3L22A 4NURA 4J8EA 4BT8A 3SGHA 4IRUA 3LDZA 3CVVA 5KJMA 3G2TA 1KT0A 1PAQA 4WNEA 3B13A 1UN8A 3FU3A 2RG8A 3CR3A 4P29A 4CDNA 4DPRA 4FLBA 5G04C 3SZ7A 4EZKA 1U3DA 5KCMA 3CKBA 2X38A 2FEZA 4XX5A 3QARA 5BNWA 3GYZA 4M3OA 2J4BA 3Q5MA 4G26A 3I4RB 3IEGA 3TL5A 4F53A 2CHZA 4GPKA 2J08A 3B7TA 3MKRA 2WPVA 4YNDA 3S7FA 3FUMA 2XCCA 4F1SA 4IN3B 2DIWA 3SD5A 3LEWA 2CFUA 4B8AA 3UMVA 1JUQA 4PDXA 2I2OA 3CHSA 1ELKA 2BTDA 3D9KA 3D9OA 3KS2A 4WWNA 2R5SA 4BX8A 2X6JA 1VDYA 2UWJG 2WXOA 5ARGA 2WXFA 1E8ZA 2XQ0A 4XZ4A 3TJPA 4LEUA 3U9WA 4AM9A 3QNKA 3MJWA 5G55A 4APFA 5BV1A 4HOUA 2VQ2A 2HYZA 3CV0A 4L7TA 2FO7A 4I9EA 3QWPA 2YINA 4G1TA 3UPVA 3BEEA 2WMNA 5G05J 3L54A 3FWVA 3EHMA 2M63A 4GB9A 3LVRE 4MLPA 4RG9A 5CCLA 3PRZA 3B7UX 3CIAA 4Q96A 4RVBA 3AS4A 3CHPA 5LOZA 5J90A 2CFZA 4PS3A 1KT1A 3KAEA 2J07A 3MV3B 4MS6A 4HFGA 3GZ1A 1JWGA 2DCPA 2L9BA 3CQCB 2IJGX 4I17A 1Y6IA 3MEKA 4JC8A 4PS7A 2IQCA 1UJJA 4U0SA 5LP0A 3CVUA 4Q94A 1HE8A 3EJNA 2IFUA 3APDA 1QZ2A 5ANLA 5E76A 3FTVA 2C0MA 5J08A 2XCBA 2WXMA 3ASDA 5FJYA 3CHRA 4GMJA 3CEQA 4I6EA 5FZQA 3TG4A 3U66A 1UW4B 4LERA 4NQ0A 5D0OD 3T5VA 1H6KA 2YHCA 1HX8A 5FQ6A 2BUGA 2KC7A 3ONKA 3OXLA 3MCXA 3CKCA 1IQUA 2A5UA 4BFRA 4GCNA 4NRHB 4JA7A 3UT7A 4WWPA 3L13A 2LAIA 1EF1C 3HVEA 3QWVA 4ME2A 4U63A 3JQ0A 3CK8A 1HO8A 1OWPA 4XKBA 5EX3A 2WXLA 5CMYA 4WAFA 1HXIA 4AIFA 3ENEA 3HVEB 4AV7A 3D3MA 5BT1A 2XHEA 2XPZA 5AENA 2WXIA 5JJ7A 5AJLA 2KCVA 2P58C 4CEMA 3CHQA 2J09A 3ZW3A 4DLOA 3SF4A 2OVFA 1Y8MA 3HHMA 4CDMA 4DLQA 3FEYA 2V5FA 4OVVA 4F3VA 1E8YA 4HLEA 3CVQA 2LO6A 2LSVA 3L6AA 3MA5A 4I1AA 4PS8A 4KBQA 3K9IA 2FF4A 2UY1A 3FUEA 1UJKA 2R17C 4BX9A 3NQPA 3TG5A 3P2BA 2UY1B 4BTAA 4OYSA 1UG3A 3FUKA 4AEZC 1Z6TA 4AP2A 3QDNA 3LY9A 4ACLA 3DPDA 1IQRA 3FTYA 4UQXA 5T4YA 4E6HA 2QY7A 3D9IA 4DJAA 2NXPA 3RRMB 3RIBA 3B7RL 3SI5A 3FULA 4I43A 4JXTA 2VSYA 2VGXB 3VTXA 4FA6A 1E96B 3PE4A 2CHXA 4WUYA 4XKCA 4UWKA 3LY7A 2ZU6B 3C98A 4EQFA 3PNTB 2WXNA 3FU5A 3ZPJA 1ZU2A 4EZJA 5A23A 3ZVVA 4GAAA 1HF8A 3AU4A 4GYYA 2WXJA 4N39A 4TRQA 3L17A 4B8CB 3I4GA 1JWFA 2MRIA 4C0MA 4YVOA 2WMOA 4PUCA 4DK5A 3CLJA 3T5XA 3ONLA 3LCAA 2VSNA 3URZA 4ILIA 1SZAA 2Q7FA 5AJDA 4TUUA 3UUXA 1TEZA 4UWLA 3FHEA 3S2AA 5JJ6A 4GCOA 5A7DB 4ANVA 1NZNA 2Y4TA 3IHVA 5BUZA 2WQ7A 4A1SA 3JQ1A 4DI4A 5C1DA 4WNDA 3CK7A 4LUNU 4MKTA 4B94A 3AU5A 2X3MA 1JPLA 3OTNA 4BT9A 1IYGA 4RG6A 3G2SA 4GA0A 3HIZA 3Q15A 3NZUA 4D10C 3R9AB 4YVQC 1ELWA 4BSXA 4FHKA 3R7RA 3FTZA 4JEHA 4MRUA 3RU0A 2X6KA 3ZYQA 4G25A 4KYOB 4U8HA 2E2EA 2VSXE 3JCKC 4GU5A 3S7BA 3PE3A 3QKYA 1L5JA 4GMLA 2DBAA 4PH4B 4FADA 3CSTA 4WWOA 3FUDA 3UT8A 2FULA 3VTYA 4HORA 5D0QD 3SNXA 2NSZA 2JEKA 3CVNA 4LCTA 2MOWA 4QFVA 3SFZA 1SQMA 2AW6A 5JHAA 5E75A 2C0LA 4A3VA 3PZDA 5LX8A 4ACKA 1HS6A 4RSYA 3CGHA 4HOTA 4GZ5A 5A6CA 4UWFA 3ASFA 2IOSA 1PC2A 3RRNB 3FTSA 2WVIA 5DBKA 4HOQA 1W3BA 4UWHA 5ENNA 2XRZA 2ONDA 3U4TA 4EZLA 3ZXSA 3PEVB 5FZRA 2KM4A 4EPZA 4KVOA 1INZA 4U04A 1N52A 3IBEA 4CGWA 1H2TC 3FEXA 4FC8A 2YHEA 2FBNA 3G2WA 3L08A 1NA0A 2FI7A 3CHOA 4JVSA 3RKVA 3S7JA 1OWOA 3U64A 5M72A 4DI3A 2HO1A 2WXHA 3QOUA 1HU3A 4GYOA 2GW1A 4KMOA 3PH0C 3LS8A 4K0RA 4A1GA 5BPPA 3RK6A 4C0EA 4XE0A 2XGSA 1Z3YA 3CVXA 2IF4A 3LPZA 4BWRA 1NA3A 1H0AA 5AYWD 3TAXA 1FCHA 1PY1A 2OOEA 3L16A 1GW6A 2XPIA 2WXPA 4H7XA 4UQYA 4FULA 4W9RA 1EDUA 2QFCA 3BG0B 3ESLA 3QWWA 5CHEE 3OAWA 4CT4A 1OUVA 2I9CA 1ELRA 3FH7A 2AXVA 3FTUA 3HDXA 4JEUA 3MV2B 3IV0A 1EPUA 3FTXA 4JHRA 2KCKA 1HH8A 2L6JA 3PDNA 4I2ZA 4UWGA 4E85A 4UQZA 3PS6A 4FLHA 4ANWA 3LY8A 3ZYMA 3QK0A 4J8FA 1OWMA 2I1KA 3O48A 3CVWA 2WXGA 2R59A 4J6IA 2J4DA 3CVYA 1XGWA 2Y3AA 3EIJA 4N2QA 2PM6A 3FH5A 1YA0A 3SHFA 3FU6A 1HFAA 4CCAA 4JHKA 3D9PA 3TXMA 3APFA 3E4BA 3FUIA 1TJCA 3QC1A 4U0ZA 3ZHEA 5JHBA 5FTPA 3KEZA 1XNFA 4Q69A 3FU0A 4ILGA 3I3NA 4K03A 2XPYA 3ZHEB 5KJKA 3GZ2A 2L0TB 4AJWA 4GZDA 2ILRA 4FJYA 1S0PA 2CG3A 2BF0X 3JYSA 3OXGA 2AXZA 2GRLA 1FVHA 1QQEA 4J8DA 1WM5A 5EX0A 4KZ0A 4C9BB 4KZCA 1DNPA 3MYVA 5FQ4A 4CDRA 3P1UA 4L2YA 4EBAG 2XGOA 3PNLB 4TV3A 2KCLA 4UI9C 4HOSA 5ANRA 3VLEA 2IU1A 1E90A 1OWLA 2CHWA 5FZSA 4N2SA 4XI0A 4G11A 5EDSA 3MKQA 3MGBA 3MZLB 4Y6CA 1HG5A 4GZ6A 1EYHA 3MKQB 2E0IA 4APOA 3EIQC 4ILHB 5BV0A 3I5PA 3PUKA 3CVLA 1H2UA 2HM8A 2KZTA 3FDHA 3LKUA 5G2NA 2KATA 3PREA 3FTWA 2GRMA 3ASGA 4AVXA 4AY6A 4EBAA 3FH8A 2MHKA 3CSFA 4G2VA 3G2UA 4I2WA 5KJLA 2KZTB 4L1BA 3D9JA 3T8MA 3ML9A 2Y4UA 4LRZA 3FUHA 2I6HA 2YNQA 4HS2A 5LCWC 3RJVA 4G24A 4ANXA 3Q47B 2WXQA 4H7YA 3RO2A 3HYMB 3ZYLA 3RO3A 4CGVA 3D9MA 2PQRA 2V0PA 3QAQA 3LVQE 4J8SA 4AOFA 5AIJA 3ZEFA 2V8SE 1U3CA 4NACA 2J9QA 4GA2A 2JLBA 2WXRA 4L23A 1N54A 3DBSA 1FVFA 3JUIA 3SBSA 1TJFA 3D9LA 1E8WA 3PUJA 4N3CA 3FP3A 2HR2A 2I1JA 4IULA 1WAO1 5C2YA 3RRUA 4B89A 4JHJA 3Q4AB 3QJZA 4UI9K 4R7LA 2A4ZA 2AXUA 2XEVA 1MQSA 2XGMA 2PZIA 4UI9J 1QNFA 4JA9A 3KD7A 4JL0A 3UQ3A 4KVMA 3WXXA 2NC9A 2PM7A 2VTBA 3LYAA 3NF1A 5JJTA 4A3TA 2LSUA 4XI9A 4ATGA 3G2VA 5KJNA 5T8IA 4V3IA 3APCA 4O6FA 4BY6A 2VTBB 4U0UA 2OVBA 3CK9A 2EQXA 4EECA 1P5QA 1DVPA 1LF8A 3TXNA 4A55A 3IKOB 2WB2A 5FQ7A 1NP7A 4ABNA 3FUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AS5 A;  2C2L A;  3Q49 B;  3ZFW A;  3S7D A;  5LCW J;  5G04 J;  5CCM A;  5ARF A;  3OXF A;  3FFL A;  5EKQ D;  2YQ8 A;  4BTB A;  2PQN A;  4WNG A;  4Y6W A;  3U3W A;  3GW4 A;  4WNF A;  1IHG A;  5HQ8 A;  4G23 A;  4I9C A;  2LNI A;  4J0U A;  3ULQ A;  1B89 A;  3ASH A;  4GZ3 A;  4AY5 A;  3EDT B;  4GA1 A;  4KXK B;  4N3B A;  5BW8 C;  3TGO A;  1KLX A;  3ZN3 A;  1HZ4 A;  2VGY A;  2VYI A;  2PL2 A;  1ZBP A;  5DIZ A;  4GYW A;  3ESK A;  3N71 A;  2VGX A;  3ZGQ A;  5HI7 A;  5FT9 A;  4N5C A;  4U07 A;  3AS8 A;  4XIF A;  5G05 C;  1A17 A;  3CVP A;  2WQH A;  2AVP A;  4N3A A;  4J8E A;  4BT8 A;  5KJM A;  1KT0 A;  4WNE A;  5G04 C;  3SZ7 A;  3CKB A;  2FEZ A;  5BNW A;  3GYZ A;  3Q5M A;  4G26 A;  3IEG A;  4GPK A;  3MKR A;  2WPV A;  3S7F A;  4YND A;  2XCC A;  4IN3 B;  3KS2 A;  2R5S A;  2UWJ G;  5ARG A;  4LEU A;  4AM9 A;  4HOU A;  2VQ2 A;  2HYZ A;  3CV0 A;  2FO7 A;  4I9E A;  3QWP A;  4G1T A;  3UPV A;  3BEE A;  5G05 J;  3FWV A;  4RG9 A;  5CCL A;  3AS4 A;  1KT1 A;  3KAE A;  3MV3 B;  3GZ1 A;  4I17 A;  3MEK A;  4U0S A;  2IFU A;  1QZ2 A;  2C0M A;  2XCB A;  3ASD A;  5FJY A;  3CEQ A;  3TG4 A;  5FZQ A;  5D0O D;  4NQ0 A;  2YHC A;  2BUG A;  2KC7 A;  3OXL A;  3CKC A;  4GCN A;  4NRH B;  4JA7 A;  3QWV A;  4ME2 A;  5EX3 A;  3CK8 A;  4AIF A;  1HXI A;  5BT1 A;  5JJ7 A;  2KCV A;  2P58 C;  3SF4 A;  1Y8M A;  2V5F A;  4F3V A;  3CVQ A;  2LSV A;  4I1A A;  3MA5 A;  4KBQ A;  3K9I A;  2FF4 A;  2UY1 A;  3TG5 A;  2UY1 B;  4BTA A;  3QDN A;  3LY9 A;  4UQX A;  3RIB A;  3VTX A;  2VSY A;  2VGX B;  1E96 B;  3PE4 A;  4WUY A;  3LY7 A;  4EQF A;  3ZPJ A;  1ZU2 A;  4GYY A;  4N39 A;  4YVO A;  3LCA A;  2VSN A;  3URZ A;  2Q7F A;  3UUX A;  5JJ6 A;  4GCO A;  5A7D B;  1NZN A;  2Y4T A;  4A1S A;  5C1D A;  4WND A;  3CK7 A;  4B94 A;  4BT9 A;  1IYG A;  4RG6 A;  4GA0 A;  3Q15 A;  3R9A B;  4YVQ C;  1ELW A;  3RU0 A;  4G25 A;  4KYO B;  2E2E A;  3S7B A;  3PE3 A;  3QKY A;  2DBA A;  3VTY A;  4HOR A;  5D0Q D;  3CVN A;  2C0L A;  4HOT A;  4GZ5 A;  5A6C A;  3ASF A;  1PC2 A;  5DBK A;  4HOQ A;  1W3B A;  2OND A;  3U4T A;  5FZR A;  4U04 A;  4CGW A;  2FBN A;  1NA0 A;  2FI7 A;  3RKV A;  3S7J A;  5M72 A;  2HO1 A;  3QOU A;  4GYO A;  2GW1 A;  2XGS A;  2IF4 A;  4BWR A;  3LPZ A;  1NA3 A;  5AYW D;  3TAX A;  1FCH A;  2OOE A;  2XPI A;  4UQY A;  4H7X A;  4W9R A;  2QFC A;  3QWW A;  5CHE E;  1OUV A;  1ELR A;  3MV2 B;  4JHR A;  4I2Z A;  2KCK A;  1HH8 A;  2L6J A;  3PDN A;  4UQZ A;  3LY8 A;  4J8F A;  3O48 A;  4N2Q A;  1YA0 A;  3E4B A;  1TJC A;  4U0Z A;  3ZHE A;  5FTP A;  1XNF A;  3ZHE B;  5KJK A;  3GZ2 A;  3JYS A;  3OXG A;  1QQE A;  4J8D A;  1WM5 A;  5EX0 A;  4CDR A;  2XGO A;  2KCL A;  4UI9 C;  4HOS A;  5FZS A;  4N2S A;  4XI0 A;  4Y6C A;  4GZ6 A;  4APO A;  3CVL A;  3LKU A;  2KAT A;  4AY6 A;  3ASG A;  2MHK A;  4G2V A;  4I2W A;  5KJL A;  2Y4U A;  2I6H A;  5LCW C;  3RJV A;  4G24 A;  3Q47 B;  4H7Y A;  3RO2 A;  3HYM B;  3RO3 A;  4CGV A;  2PQR A;  2J9Q A;  4GA2 A;  2JLB A;  4N3C A;  3FP3 A;  2HR2 A;  1WAO 1;  3Q4A B;  4UI9 K;  2XEV A;  2XGM A;  2PZI A;  4UI9 J;  4JA9 A;  3KD7 A;  4JL0 A;  3UQ3 A;  3WXX A;  2NC9 A;  3LYA A;  3NF1 A;  5JJT A;  2LSU A;  4XI9 A;  5KJN A;  4O6F A;  4U0U A;  3CK9 A;  1P5Q A;  4ABN A; 
#chains in the Genus database with same CATH topology
 1N94 A;  3ZFW A;  5LCW J;  2V5Q C;  5AQ7 A;  4BER A;  2LUH A;  2LXM A;  3BG1 B;  4JW1 A;  4BTB A;  2F37 A;  5ENO D;  2WXK A;  4WNG A;  3SBT B;  4CRW A;  3O4Z A;  2VJ8 A;  2RKK A;  4G23 A;  4I6G A;  4LNB A;  4HXI A;  2LNI A;  2P9I G;  2ETA A;  3ULQ A;  1UN9 A;  3FUF A;  2XRY A;  3PVL A;  1SVX A;  4GTQ A;  4GZ3 A;  2H6F A;  4GA1 A;  1MX2 A;  2X6H A;  4N3B A;  3TGO A;  3ZN3 A;  1ZBP A;  3T9K A;  4FP7 A;  3N71 A;  5HI7 A;  1H6O A;  4FHJ A;  3TWV A;  5LFA A;  1A17 A;  2AWI A;  3ZYK A;  4URK A;  4DX2 A;  1TN7 A;  4IRU A;  1OXJ A;  4WNE A;  3B13 A;  4K5A B;  1UN8 A;  3CR3 A;  4DPR A;  4NIK A;  3UIO C;  4Z68 A;  5BNW A;  1OCR E;  4M3O A;  3IEG A;  5AAO A;  3NOG D;  3UM0 A;  2WPV A;  3FUM A;  3DSS A;  4IN3 B;  3UMV A;  5HKP A;  4PDX A;  1TN6 A;  5CER B;  3KS2 A;  2R5S A;  2WXO A;  1E8Z A;  4XZ4 A;  4LEU A;  3U9W A;  1X81 A;  3QWP A;  3UPV A;  4O1P A;  4RG9 A;  5CCL A;  3PRZ A;  3B7U X;  3CIA A;  4RVB A;  1S63 A;  4EHM A;  2J07 A;  1N0Q A;  5CBN A;  1D9S A;  5IY5 E;  5AQB A;  1KZP A;  2IJG X;  3MEK A;  1G3N B;  1UJJ A;  5AQ9 A;  4Q94 A;  2IFU A;  3APD A;  4GTV A;  2Y0B G;  3ASD A;  3RSE G;  5FJY A;  4I6E A;  1UW4 B;  4LER A;  3T5V A;  1HX8 A;  3OXL A;  1ZB1 A;  3DPY A;  3MCX A;  2F8Y A;  3HXF A;  4JA7 A;  3UT7 A;  3W9F A;  1YMP A;  1EF1 C;  3QWV A;  4U63 A;  2Y1L E;  2NYJ A;  5EX3 A;  4XKB A;  3SO8 A;  5CMY A;  4WAF A;  2XPZ A;  5AEN A;  2P58 C;  4CEM A;  3CHQ A;  2J09 A;  3F6Q A;  4DLQ A;  4F3V A;  3AJI A;  2LXL A;  4PS8 A;  3K9I A;  1KZO A;  2UY1 A;  1UJK A;  1OY3 D;  3TG5 A;  3DSX A;  2UY1 B;  4BTA A;  4MBG A;  1Z6T A;  1DCQ A;  4ACL A;  3DPD A;  3FTY A;  5EYL A;  4E6H A;  2NXP A;  3RRM B;  4XKC A;  2CHX A;  4WUY A;  3DWL G;  4GTO A;  4EQF A;  2WXN A;  3UKR G;  3ZVV A;  4GAA A;  4DX7 D;  3AU4 A;  4TRQ A;  3CLJ A;  4ILI A;  3FHE A;  2WQ7 A;  2Y4T A;  2MYO A;  5C1D A;  3JQ1 A;  4WND A;  3CK7 A;  4LUN U;  2P9P G;  3AU5 A;  4BT9 A;  1IYG A;  3G2S A;  3Q15 A;  3NZU A;  4BSX A;  4JEH A;  2X6K A;  3ZYQ A;  4G25 A;  2E2E A;  3TWT A;  4GU5 A;  3S7B A;  3PE3 A;  4PH4 B;  3SNX A;  3DSW A;  2MOW A;  5FIN A;  2AW6 A;  1OCC E;  5LX8 A;  1HS6 A;  4RSY A;  4HOT A;  4UWF A;  1PC2 A;  1NL4 A;  3UXG A;  1W3B A;  5ENN A;  3ZXS A;  2KM4 A;  1INZ A;  1N52 A;  4CGW A;  3FEX A;  2YHE A;  2FBN A;  3G2W A;  2FI7 A;  3U64 A;  1OWO A;  4DI3 A;  3QOU A;  5CRU A;  1YCS B;  3LS8 A;  5BPP A;  4C0E A;  1H0A A;  5AYW D;  3AG1 E;  3TAX A;  4H7X A;  3BG0 B;  1OUV A;  2I9C A;  1H6P A;  1BLX B;  4JEU A;  3MV2 B;  4JHR A;  3FTX A;  4DUI A;  5HRY A;  4UQZ A;  4YDE A;  4ANW A;  3ULY A;  3EHR A;  3O48 A;  2WXG A;  2R59 A;  1XGW A;  2Y3A A;  3EIJ A;  4N2Q A;  3FH5 A;  3SHF A;  4JHK A;  3DXK G;  3ASO E;  1MZC A;  3KEZ A;  2R05 A;  5KJK A;  1SA5 A;  2L0T B;  1S0P A;  1FT2 A;  2BF0 X;  3JYS A;  2AXZ A;  2GRL A;  1IKN D;  2L6B A;  1DNP A;  3P1U A;  4C48 B;  3BU8 A;  4TV3 A;  3C3Q A;  5ANR A;  4N2S A;  3TWR A;  5AAR A;  3MKQ A;  3MGB A;  5EID A;  3MKQ B;  4ILH B;  3I5P A;  3Q7F A;  3C5R A;  1MYO A;  3LKU A;  4DX6 D;  4AY6 A;  2DYR E;  4I2W A;  3G2U A;  3D9J A;  3ZXP A;  3RJV A;  4M7C A;  4RQI A;  2PQR A;  2V0P A;  3QAQ A;  2JLB A;  1N54 A;  1MX6 A;  3DBS A;  3SY2 A;  1E8W A;  3FP3 A;  2HR2 A;  5C2Y A;  4JHJ A;  4R7L A;  2QYU A;  4JD2 G;  2XEV A;  2PZI A;  4UI9 J;  3KD7 A;  3WXX A;  4U8Y D;  4XI9 A;  5KJN A;  2H6H A;  1P5Q A;  1DVP A;  1LF8 A;  4GTP A;  3FUN A;  1MHQ A;  1JCR A;  3S7D A;  3LXU X;  2B0O E;  1BU9 A;  2GRP B;  3Q78 A;  5CMW A;  4UUC A;  1OWN A;  5CCM A;  3ZIM A;  2XEH A;  4ATZ D;  2PQN A;  4Y6W A;  3VLF A;  3Q73 A;  4A63 B;  2KXP C;  4F7A A;  4GTR A;  2BED A;  1Z3X A;  5ITZ F;  5FIO A;  2ION A;  1H2V C;  2ZGD A;  1HZ4 A;  2PL2 A;  4LSZ E;  2IOL A;  3EHN A;  2RD0 A;  5DIZ A;  4AXH A;  2B6C A;  3ESK A;  2CG2 A;  2P9U G;  2QC9 A;  3ZGQ A;  5FT9 A;  5D66 A;  3NZS A;  2WQ6 A;  4N5C A;  5FQ8 A;  3E34 A;  3AS8 A;  5G05 C;  1QBQ A;  4GZC A;  3W9G A;  3CQG B;  2WQH A;  5KJM A;  4J7W A;  4P29 A;  4CDN A;  3SZ7 A;  1U3D A;  5KCM A;  2X38 A;  4XX5 A;  2A5E A;  5D2M C;  3Q5M A;  3ABL E;  3I4R B;  2BKK B;  4F53 A;  3L82 A;  2CHZ A;  3B7T A;  1WG0 A;  1BD8 A;  4F1S A;  2DIW A;  1Z5S C;  1ELK A;  3D9O A;  2X6J A;  4B93 B;  2WXF A;  3MJW A;  2VQ2 A;  3CV0 A;  5B1B E;  2YIN A;  4G1T A;  2R2L A;  3BEE A;  2WMN A;  3FWV A;  3EHM A;  4MLP A;  2P9L G;  4PS3 A;  4MS6 A;  4HFG A;  1JWG A;  2DCP A;  3CQC B;  3IXE A;  1Y6I A;  4JC8 A;  4PS7 A;  4U0S A;  3CVU A;  3UM1 A;  3EJN A;  3AG2 E;  5ANL A;  3FTV A;  5J08 A;  3CHR A;  5FZQ A;  4NQ0 A;  3HXD A;  2YHC A;  3V31 A;  5CED B;  4CZ2 D;  3ONK A;  4DX1 A;  4BFR A;  4NRH B;  3L13 A;  3HVE A;  4ME2 A;  3JQ0 A;  4AIF A;  3ENE A;  3HVE B;  3D3M A;  1N0R A;  1D8E A;  2WXI A;  5JJ7 A;  1Y8M A;  4TXP A;  4HLE A;  3MA5 A;  1TNZ A;  3UKU G;  3P2B A;  4OYS A;  1UG3 A;  3FUK A;  4AEZ C;  3QDN A;  4UQX A;  4TXQ A;  1QYM A;  2EIM E;  4JXT A;  3VTX A;  4FA6 A;  3SFX A;  3LY7 A;  2ZU6 B;  3C98 A;  3C72 A;  1ZU2 A;  5A23 A;  4N39 A;  3L17 A;  3HG0 D;  4DK5 A;  3ONL A;  1SZA A;  1BI8 B;  1O1R A;  1S64 A;  5A7D B;  1WDY A;  4A1S A;  4DI4 A;  4B94 A;  2EIL E;  3UM2 A;  3UM3 A;  4D10 C;  4YVQ C;  4FHK A;  3ABK E;  3FTZ A;  3RU0 A;  3QKY A;  5ENT D;  4FAD A;  4WWO A;  2JEK A;  4QFV A;  4X8Q A;  3SFZ A;  5E75 A;  2C0L A;  1RW2 A;  3CGH A;  5A6C A;  5DBK A;  2OND A;  4EZL A;  3PEV B;  4KVO A;  3Q9N C;  3IBE A;  1H2T C;  1MX4 A;  3RKV A;  3CHO A;  3LJN A;  2HO1 A;  4KMO A;  3PH0 C;  4A1G A;  2XS1 A;  1Z3Y A;  3CVX A;  4BWR A;  1FCH A;  1GW6 A;  4UQY A;  2WXP A;  1NI1 A;  3ESL A;  4LNG A;  1ELR A;  3FTU A;  3NAW A;  2ZIS A;  2KCK A;  1HH8 A;  3ZYM A;  1LD8 A;  3AAA C;  3QK0 A;  4J8Y A;  2I1K A;  4BET A;  1IHB A;  3CVW A;  4J6I A;  2PM6 A;  4BES A;  5BXU A;  2DZO A;  1JCS A;  3D9P A;  3FUI A;  3E4B A;  1TJC A;  3QC1 A;  4U0Z A;  5JHB A;  4Q69 A;  3FU0 A;  4K03 A;  2XPY A;  4AJW A;  4FJY A;  2CG3 A;  3RAU A;  3PZ4 A;  4GMR A;  3ZUV B;  2DZN A;  1QQE A;  1WM5 A;  3E33 A;  4KZ0 A;  4C9B B;  4KZC A;  3MYV A;  2P9N G;  2XGO A;  3UIN C;  4DX5 D;  3BQO A;  3EU5 A;  2IU1 A;  1OWL A;  5EDS A;  5B3S E;  4Y6C A;  5BV0 A;  2DWZ A;  5AQA A;  2KAT A;  3PRE A;  3ASG A;  3CSF A;  1TR4 A;  3NB2 A;  3T8M A;  3ML9 A;  4LRZ A;  2I6H A;  2YNQ A;  4ANX A;  1OCO E;  2OEV A;  5H7P A;  3ZYL A;  3LVQ E;  5AIJ A;  3ZEF A;  2J9Q A;  2F0Y A;  4IUL A;  2I1J A;  3RRU A;  1WAO 1;  3DEO A;  3JXI A;  2RFM A;  3Q4A B;  2A4Z A;  4HB5 A;  1MQS A;  4JL0 A;  3J5P A;  3UQ3 A;  2NC9 A;  2PM7 A;  3G2V A;  5T8I A;  4BY6 A;  3APC A;  3CK9 A;  2EQX A;  4EEC A;  4ZHB A;  3ZKJ A;  4A55 A;  4HRM B;  5FQ7 A;  3TWS A;  1N4R A;  1H19 A;  5FWQ A;  3FY4 A;  4CT0 A;  4KT6 B;  2C2L A;  3Q49 B;  2V4L A;  3B7S A;  1TYQ G;  3MX3 A;  2OV8 A;  5G04 J;  2V4H C;  4QQI A;  3D9H A;  5ARF A;  3OXF A;  3FFL A;  4G8K A;  2GRO B;  1SZ9 A;  3GZS A;  5CEC B;  1IHG A;  5HQ8 A;  2P9K G;  4ZFH A;  3UTM A;  3UT4 A;  1S70 B;  3R7Q A;  3ASH A;  2WM9 A;  1NFI E;  4AY5 A;  4JPS A;  2H6G A;  2J49 A;  4I6J A;  5ENQ D;  1KLX A;  2IO2 C;  1E8X A;  1SW6 A;  4I1O B;  3BUA A;  4GPM A;  2VGX A;  1X5B A;  2L0I A;  4ANU A;  4CYM D;  4FJZ A;  3ZU7 B;  4OVU A;  2AVP A;  2Y69 E;  4N3A A;  3L22 A;  4NUR A;  3SGH A;  3PZ2 A;  3CVV A;  1KT0 A;  5CBO A;  3FU3 A;  4FLB A;  5G04 C;  4EZK A;  3DSU A;  3QAR A;  2XEN A;  2J08 A;  3MKR A;  1IXV A;  4YND A;  3S7F A;  2XCC A;  3LEW A;  1JUQ A;  2I2O A;  3CHS A;  2ETC A;  5ENR D;  2BTD A;  2P9S G;  3D9K A;  2DVW A;  2QZA A;  2UWJ G;  1K1A A;  4GTT A;  5ARG A;  5CRV A;  2XQ0 A;  3TJP A;  4JB8 P;  3QNK A;  5G55 A;  3ZNG A;  4APF A;  5BV1 A;  4I9E A;  5G05 J;  3KSL A;  3L54 A;  4GB9 A;  2M63 A;  5LOZ A;  4XEI G;  4LNU D;  2CFZ A;  1KT1 A;  3MV3 B;  3UI2 A;  3T8K A;  3GZ1 A;  4I17 A;  2IQC A;  5LP0 A;  1HE8 A;  5E76 A;  2C0M A;  1O1T A;  5KNG A;  2WXM A;  3U66 A;  3TG4 A;  5D0O D;  4YDO A;  5FQ6 A;  1Q2Z A;  3CKC A;  1IQU A;  4GCN A;  3R9M A;  4WWP A;  1V54 E;  5BT1 A;  2XHE A;  4HRN A;  5JMN D;  4DLO A;  3SF4 A;  2OVF A;  3HHM A;  2V5F A;  1E8Y A;  3EU9 A;  3CVQ A;  2LO6 A;  2LSV A;  3L6A A;  4KBQ A;  2ETB A;  2FF4 A;  3FUE A;  2R17 C;  4BX9 A;  4AP2 A;  3LY9 A;  1N4S A;  2QY7 A;  3D9I A;  3RIB A;  4I43 A;  3PE4 A;  1DC2 A;  2OCC E;  3PNT B;  1N4P A;  4EZJ A;  1HF8 A;  4GYY A;  2WXJ A;  3I4G A;  4YVO A;  5HS0 A;  3HXC A;  2WMO A;  4YDW A;  4PUC A;  2KBX A;  2PNN A;  4OAV B;  5AJD A;  4TUU A;  3ABM E;  3UUX A;  4UWL A;  3S2A A;  5JJ6 A;  4GCO A;  3IHV A;  4MKT A;  4G8L A;  2X3M A;  3OTN A;  3R9A B;  3R7R A;  4HI9 A;  1K3Z D;  4N5Q A;  3JCK C;  2DBA A;  3CST A;  3FUD A;  3VTY A;  4HOR A;  2XZD G;  4LCT A;  1SA4 A;  1SQM A;  5JHA A;  3Q79 A;  1OCZ E;  4HQD A;  3ASF A;  3FTS A;  2WVI A;  3Q7A A;  4UWH A;  2XEE A;  5FZR A;  4EPZ A;  3Q9U C;  4U04 A;  4FC8 A;  3L08 A;  4U96 D;  1NA0 A;  3HRA A;  1D8D A;  5M72 A;  4GYO A;  2GW1 A;  2IF4 A;  1FT1 A;  1PY1 A;  4DRX E;  3L9T A;  3L16 A;  4W9R A;  2QFC A;  3QWW A;  3OAW A;  5EIB E;  4CT4 A;  3FH7 A;  2AXV A;  3HDX A;  2J8S D;  3KEA A;  3IV0 A;  4I2Z A;  3PDN A;  4UWG A;  2GRN B;  3PS6 A;  4FLH A;  1OWM A;  2R02 A;  3CVY A;  4U7E B;  3JUE A;  1YA0 A;  4K5C A;  3TXM A;  3APF A;  3PZ1 A;  5EIL A;  2HE0 A;  3ZHE A;  5FTP A;  1XNF A;  3I3N A;  3ZHE B;  3C3R A;  3GZ2 A;  3DEP A;  5B1A E;  1KPS B;  2ZGG A;  2EIN E;  5FQ4 A;  4CDR A;  4L2Y A;  4EBA G;  2EIJ E;  2FO1 E;  4HOS A;  3VLE A;  1E90 A;  1N4Q A;  4XI0 A;  4G11 A;  1YYH A;  3MZL B;  3AG4 E;  1HG5 A;  2E0I A;  1H2U A;  5G2N A;  2KZT A;  3FDH A;  2GRM A;  4EBA A;  4G2V A;  3V79 K;  1TNO A;  2KZT B;  2Y4U A;  3FUH A;  2P2C P;  5LCW C;  4HS2 A;  3Q47 B;  2WXQ A;  3RO2 A;  1DCE A;  3RO3 A;  4J8S A;  4O60 A;  2V8S E;  4BSZ B;  3E30 A;  4GA2 A;  3TWQ A;  1TJF A;  2JAB A;  4B89 A;  3NOC D;  3QJZ A;  4UI9 K;  3NBN B;  2AXU A;  3WG7 E;  2VTB A;  3LYA A;  4A3T A;  1TNY A;  3C3O A;  2LSU A;  5KBA A;  2VTB B;  1TNU A;  3TXN A;  3IKO B;  3UIP C;  4ABN A;  1N95 A;  3IHY A;  3AS5 A;  2RFA A;  4IYP A;  3CHM A;  3LJ3 A;  1HG2 A;  2EIK E;  4I1M A;  3SFY A;  2GGF A;  5AN8 A;  4U8V D;  3QB2 A;  5EKQ D;  2YQ8 A;  3U3W A;  3GW4 A;  2X6F A;  1AWC B;  4WNF A;  3EUV A;  3AG3 E;  4GTS A;  4BEP A;  5BXO A;  4I9C A;  5T3R A;  4JZY A;  4J0U A;  4L2L A;  1E7V A;  2LAH A;  3D9N A;  1WY6 A;  1B89 A;  2VSO E;  3FUJ A;  1RZ4 A;  4HI8 A;  1TNB A;  3PEU B;  4FU3 A;  1N11 A;  3EDT B;  4B0Z A;  5JA4 D;  4KXK B;  4K5B A;  1E7U A;  5BW8 C;  3VLD A;  3UX4 A;  1K8K G;  2VGY A;  2VYI A;  4GYW A;  3ZRH A;  3EHQ A;  4HVB A;  2X6I A;  4U07 A;  3ML8 A;  1MJ0 A;  4XIF A;  1BPO A;  3CVP A;  3TWX A;  4J8E A;  4BT8 A;  3LDZ A;  4HBD A;  3G2T A;  1PAQ A;  2RG8 A;  3CKB A;  2FEZ A;  3GYZ A;  2J4B A;  4G26 A;  3HXB A;  4HNA D;  1FPP A;  3TL5 A;  4GPK A;  3SD5 A;  2CFU A;  4B8A A;  4WWN A;  4BX8 A;  1VDY A;  2VGE A;  4TUM A;  4AM9 A;  3DXM G;  4HOU A;  2HYZ A;  4L7T A;  2FO7 A;  4TXR A;  3Q75 A;  4HLL A;  4L9P A;  3LVR E;  4Q96 A;  3AS4 A;  3CHP A;  5J90 A;  4F6R D;  3KAE A;  2R03 A;  5CEA A;  2L9B A;  1N9A A;  4YDY A;  1QZ2 A;  2GRQ B;  2XCB A;  4GMJ A;  3CEQ A;  1H6K A;  2KC7 A;  2BUG A;  2IO3 C;  3TWU A;  2A5U A;  1O1S A;  2LAI A;  5EN5 D;  2XZT G;  2XS8 A;  3CK8 A;  1HO8 A;  1OWP A;  3DST A;  2WXL A;  1HXI A;  4AV7 A;  5AJL A;  2KCV A;  3ZW3 A;  4CDM A;  3FEY A;  4OVV A;  4F1P A;  4I1A A;  3V2O A;  3NQP A;  2ZIR A;  1IQR A;  5T4Y A;  4OAU C;  1JCQ A;  4DJA A;  2BKG A;  3B7R L;  3SI5 A;  3FUL A;  2QYJ A;  2VSY A;  2VGX B;  1E96 B;  3PZ3 A;  4UWK A;  3FU5 A;  3ZPJ A;  4B8C B;  1JWF A;  3KSQ A;  2MRI A;  4C0M A;  4O1O A;  1O5M A;  3T5X A;  3LCA A;  2VSN A;  3URZ A;  1UOH A;  2Q7F A;  1TEZ A;  4ANV A;  1NZN A;  5BUZ A;  1TN8 A;  3ISM C;  2IY0 C;  1JPL A;  4RG6 A;  4GA0 A;  3HIZ A;  2DYS E;  3B95 A;  1ELW A;  4MRU A;  4KYO B;  3SQV A;  4U8H A;  2VSX E;  1L5J A;  4GML A;  2GRR B;  1K1B A;  3UT8 A;  2FUL A;  5D0Q D;  2NSZ A;  3CVN A;  4A3V A;  3PZD A;  4ACK A;  5KNH D;  4GZ5 A;  1V55 E;  2IOS A;  3RRN B;  4HOQ A;  2XRZ A;  3U4T A;  4LG6 A;  4JVS A;  3S7J A;  2WXH A;  1HU3 A;  3X2Q E;  4K0R A;  3B7B A;  4RLY A;  3RK6 A;  1U2V G;  5ENP D;  5KWD A;  4XE0 A;  2XGS A;  3LPZ A;  1NA3 A;  2OOE A;  2XPI A;  3DSV A;  4FUL A;  1EDU A;  5CHE E;  1EPU A;  2L6J A;  4E85 A;  3LY8 A;  4J8F A;  5EYP F;  2J4D A;  4HRL A;  2H6I A;  3E37 A;  3FU6 A;  1HFA A;  4U95 D;  4CCA A;  3JXJ A;  2ZXW E;  1A5E A;  3TWW A;  2F8X K;  4ILG A;  3E32 A;  4GZD A;  2ILR A;  4GTM A;  3HXE A;  3V2X A;  3OXG A;  1OT8 A;  1FVH A;  4J8D A;  5EX0 A;  3DRA A;  3PNL B;  2KCL A;  1BI7 B;  4UI9 C;  5FZS A;  2CHW A;  4GZ6 A;  1EYH A;  4APO A;  3EIQ C;  3PUK A;  3CVL A;  2HM8 A;  1LD7 A;  4AVX A;  3FTW A;  3FH8 A;  2MHK A;  5KJL A;  2AJA A;  4L1B A;  1LTX A;  4G24 A;  2OEW A;  4H7Y A;  3HYM B;  4CGV A;  3D9M A;  4AOF A;  1U3C A;  3J5Q B;  4NAC A;  2WXR A;  4L23 A;  1FVF A;  3JUI A;  5ENS D;  3SBS A;  4N3C A;  3D9L A;  2IEJ A;  3PUJ A;  2XGM A;  1QNF A;  3ULE G;  4JA9 A;  3V30 A;  1AP7 A;  4KVM A;  3NF1 A;  5JJT A;  4ATG A;  4V3I A;  4O6F A;  4U0U A;  2OVB A;  3ASN E;  2WB2 A;  1NP7 A; 
#chains in the Genus database with same CATH homology
 3IHY A;  1H19 A;  1MHQ A;  3AS5 A;  3FY4 A;  5FWQ A;  4CT0 A;  4KT6 B;  4IYP A;  2C2L A;  3CHM A;  3Q49 B;  3LJ3 A;  2V4L A;  3B7S A;  3S7D A;  1HG2 A;  3ZFW A;  5LCW J;  3LXU X;  3MX3 A;  2OV8 A;  5G04 J;  4I1M A;  2GGF A;  5CMW A;  1OWN A;  3QB2 A;  5CCM A;  5ARF A;  3BG1 B;  4JW1 A;  3ZIM A;  3OXF A;  3FFL A;  5EKQ D;  2YQ8 A;  4BTB A;  2WXK A;  2PQN A;  4WNG A;  1SZ9 A;  4Y6W A;  3SBT B;  3GZS A;  3GW4 A;  3U3W A;  3VLF A;  2X6F A;  4CRW A;  4WNF A;  1IHG A;  3O4Z A;  2VJ8 A;  5HQ8 A;  4G23 A;  4F7A A;  4I6G A;  4I9C A;  5T3R A;  4JZY A;  4HXI A;  2LNI A;  1Z3X A;  4J0U A;  4L2L A;  3ULQ A;  1UN9 A;  1E7V A;  3FUF A;  2XRY A;  3PVL A;  3UT4 A;  2LAH A;  3D9N A;  1WY6 A;  1B89 A;  3R7Q A;  2VSO E;  3ASH A;  3FUJ A;  2WM9 A;  3PEU B;  4FU3 A;  2ION A;  4GZ3 A;  4AY5 A;  3EDT B;  4JPS A;  4GA1 A;  4B0Z A;  4KXK B;  2X6H A;  1H2V C;  1E7U A;  4N3B A;  5BW8 C;  2J49 A;  3TGO A;  4I6J A;  3VLD A;  1KLX A;  3UX4 A;  3ZN3 A;  1E8X A;  1HZ4 A;  2VGY A;  2VYI A;  2PL2 A;  1ZBP A;  2IOL A;  3EHN A;  2RD0 A;  5DIZ A;  4AXH A;  4FP7 A;  4I1O B;  4GYW A;  3ESK A;  3N71 A;  3ZRH A;  2CG2 A;  2VGX A;  3ZGQ A;  5HI7 A;  5FT9 A;  1X5B A;  4FHJ A;  4HVB A;  2L0I A;  3NZS A;  5LFA A;  4N5C A;  2WQ6 A;  5FQ8 A;  2X6I A;  4ANU A;  4U07 A;  3ML8 A;  3AS8 A;  4XIF A;  5G05 C;  4FJZ A;  1A17 A;  1BPO A;  4OVU A;  2AWI A;  3ZYK A;  3CVP A;  4GZC A;  4URK A;  3CQG B;  2WQH A;  2AVP A;  4N3A A;  3L22 A;  4NUR A;  4J8E A;  4BT8 A;  3SGH A;  4IRU A;  3LDZ A;  3CVV A;  5KJM A;  3G2T A;  1KT0 A;  1PAQ A;  4WNE A;  3B13 A;  1UN8 A;  3FU3 A;  2RG8 A;  3CR3 A;  4P29 A;  4CDN A;  4DPR A;  4FLB A;  5G04 C;  3SZ7 A;  4EZK A;  1U3D A;  5KCM A;  3CKB A;  2X38 A;  2FEZ A;  4XX5 A;  3QAR A;  5BNW A;  3GYZ A;  4M3O A;  2J4B A;  3Q5M A;  4G26 A;  3I4R B;  3IEG A;  3TL5 A;  4F53 A;  2CHZ A;  4GPK A;  2J08 A;  3B7T A;  3MKR A;  2WPV A;  4YND A;  3S7F A;  3FUM A;  2XCC A;  4F1S A;  4IN3 B;  2DIW A;  3SD5 A;  3LEW A;  2CFU A;  4B8A A;  3UMV A;  1JUQ A;  4PDX A;  2I2O A;  3CHS A;  1ELK A;  2BTD A;  3D9K A;  3D9O A;  3KS2 A;  4WWN A;  2R5S A;  4BX8 A;  2X6J A;  1VDY A;  2UWJ G;  2WXO A;  5ARG A;  2WXF A;  1E8Z A;  2XQ0 A;  4XZ4 A;  3TJP A;  4LEU A;  3U9W A;  4AM9 A;  3QNK A;  3MJW A;  5G55 A;  4APF A;  5BV1 A;  4HOU A;  2VQ2 A;  2HYZ A;  3CV0 A;  4L7T A;  2FO7 A;  4I9E A;  3QWP A;  2YIN A;  4G1T A;  3UPV A;  3BEE A;  2WMN A;  5G05 J;  3L54 A;  3FWV A;  3EHM A;  2M63 A;  4GB9 A;  3LVR E;  4MLP A;  4RG9 A;  5CCL A;  3PRZ A;  3B7U X;  3CIA A;  4Q96 A;  4RVB A;  3AS4 A;  3CHP A;  5LOZ A;  5J90 A;  2CFZ A;  4PS3 A;  1KT1 A;  3KAE A;  2J07 A;  3MV3 B;  4MS6 A;  4HFG A;  3GZ1 A;  1JWG A;  2DCP A;  2L9B A;  3CQC B;  2IJG X;  4I17 A;  1Y6I A;  3MEK A;  4JC8 A;  4PS7 A;  2IQC A;  1UJJ A;  4U0S A;  5LP0 A;  3CVU A;  4Q94 A;  1HE8 A;  3EJN A;  2IFU A;  3APD A;  1QZ2 A;  5ANL A;  5E76 A;  3FTV A;  2C0M A;  5J08 A;  2XCB A;  2WXM A;  3ASD A;  5FJY A;  3CHR A;  4GMJ A;  3CEQ A;  4I6E A;  5FZQ A;  3TG4 A;  3U66 A;  1UW4 B;  4LER A;  4NQ0 A;  5D0O D;  3T5V A;  1H6K A;  2YHC A;  1HX8 A;  5FQ6 A;  2BUG A;  2KC7 A;  3ONK A;  3OXL A;  3MCX A;  3CKC A;  1IQU A;  2A5U A;  4BFR A;  4GCN A;  4NRH B;  4JA7 A;  3UT7 A;  4WWP A;  3L13 A;  2LAI A;  1EF1 C;  3HVE A;  3QWV A;  4ME2 A;  4U63 A;  3JQ0 A;  3CK8 A;  1HO8 A;  1OWP A;  4XKB A;  5EX3 A;  2WXL A;  5CMY A;  4WAF A;  1HXI A;  4AIF A;  3ENE A;  3HVE B;  4AV7 A;  3D3M A;  5BT1 A;  2XHE A;  2XPZ A;  5AEN A;  2WXI A;  5JJ7 A;  5AJL A;  2KCV A;  2P58 C;  4CEM A;  3CHQ A;  2J09 A;  3ZW3 A;  4DLO A;  3SF4 A;  2OVF A;  1Y8M A;  3HHM A;  4CDM A;  4DLQ A;  3FEY A;  2V5F A;  4OVV A;  4F3V A;  1E8Y A;  4HLE A;  3CVQ A;  2LO6 A;  2LSV A;  3L6A A;  3MA5 A;  4I1A A;  4PS8 A;  4KBQ A;  3K9I A;  2FF4 A;  2UY1 A;  3FUE A;  1UJK A;  2R17 C;  4BX9 A;  3NQP A;  3TG5 A;  3P2B A;  2UY1 B;  4BTA A;  4OYS A;  1UG3 A;  3FUK A;  4AEZ C;  1Z6T A;  4AP2 A;  3QDN A;  3LY9 A;  4ACL A;  3DPD A;  1IQR A;  3FTY A;  4UQX A;  5T4Y A;  4E6H A;  2QY7 A;  3D9I A;  4DJA A;  2NXP A;  3RRM B;  3RIB A;  3B7R L;  3SI5 A;  3FUL A;  4I43 A;  4JXT A;  2VSY A;  2VGX B;  3VTX A;  4FA6 A;  1E96 B;  3PE4 A;  2CHX A;  4WUY A;  4XKC A;  4UWK A;  3LY7 A;  2ZU6 B;  3C98 A;  4EQF A;  3PNT B;  2WXN A;  3FU5 A;  3ZPJ A;  1ZU2 A;  4EZJ A;  5A23 A;  3ZVV A;  4GAA A;  1HF8 A;  3AU4 A;  4GYY A;  2WXJ A;  4N39 A;  4TRQ A;  3L17 A;  4B8C B;  3I4G A;  1JWF A;  2MRI A;  4C0M A;  4YVO A;  2WMO A;  4PUC A;  4DK5 A;  3CLJ A;  3T5X A;  3ONL A;  3LCA A;  2VSN A;  3URZ A;  4ILI A;  1SZA A;  2Q7F A;  5AJD A;  4TUU A;  3UUX A;  1TEZ A;  4UWL A;  3FHE A;  3S2A A;  5JJ6 A;  4GCO A;  5A7D B;  4ANV A;  1NZN A;  2Y4T A;  3IHV A;  5BUZ A;  2WQ7 A;  4A1S A;  3JQ1 A;  4DI4 A;  5C1D A;  4WND A;  3CK7 A;  4LUN U;  4MKT A;  4B94 A;  3AU5 A;  2X3M A;  1JPL A;  3OTN A;  4BT9 A;  1IYG A;  4RG6 A;  3G2S A;  4GA0 A;  3HIZ A;  3Q15 A;  3NZU A;  4D10 C;  3R9A B;  4YVQ C;  1ELW A;  4BSX A;  4FHK A;  3R7R A;  3FTZ A;  4JEH A;  4MRU A;  3RU0 A;  2X6K A;  3ZYQ A;  4G25 A;  4KYO B;  4U8H A;  2E2E A;  2VSX E;  3JCK C;  4GU5 A;  3S7B A;  3PE3 A;  3QKY A;  1L5J A;  4GML A;  2DBA A;  4PH4 B;  4FAD A;  3CST A;  4WWO A;  3FUD A;  3UT8 A;  2FUL A;  3VTY A;  4HOR A;  5D0Q D;  3SNX A;  2NSZ A;  2JEK A;  3CVN A;  4LCT A;  2MOW A;  4QFV A;  3SFZ A;  1SQM A;  2AW6 A;  5JHA A;  5E75 A;  2C0L A;  4A3V A;  3PZD A;  5LX8 A;  4ACK A;  1HS6 A;  4RSY A;  3CGH A;  4HOT A;  4GZ5 A;  5A6C A;  4UWF A;  3ASF A;  2IOS A;  1PC2 A;  3RRN B;  3FTS A;  2WVI A;  5DBK A;  4HOQ A;  1W3B A;  4UWH A;  5ENN A;  2XRZ A;  2OND A;  3U4T A;  4EZL A;  3ZXS A;  3PEV B;  5FZR A;  2KM4 A;  4EPZ A;  4KVO A;  1INZ A;  4U04 A;  1N52 A;  3IBE A;  4CGW A;  1H2T C;  3FEX A;  4FC8 A;  2YHE A;  2FBN A;  3G2W A;  3L08 A;  1NA0 A;  2FI7 A;  3CHO A;  4JVS A;  3RKV A;  3S7J A;  1OWO A;  3U64 A;  5M72 A;  4DI3 A;  2HO1 A;  2WXH A;  3QOU A;  1HU3 A;  4GYO A;  2GW1 A;  4KMO A;  3PH0 C;  3LS8 A;  4K0R A;  4A1G A;  5BPP A;  3RK6 A;  4C0E A;  4XE0 A;  2XGS A;  1Z3Y A;  3CVX A;  2IF4 A;  3LPZ A;  4BWR A;  1NA3 A;  1H0A A;  5AYW D;  3TAX A;  1FCH A;  1PY1 A;  2OOE A;  3L16 A;  1GW6 A;  2XPI A;  2WXP A;  4H7X A;  4UQY A;  4FUL A;  4W9R A;  1EDU A;  2QFC A;  3BG0 B;  3ESL A;  3QWW A;  5CHE E;  3OAW A;  4CT4 A;  1OUV A;  2I9C A;  1ELR A;  3FH7 A;  2AXV A;  3FTU A;  3HDX A;  4JEU A;  3MV2 B;  3IV0 A;  1EPU A;  3FTX A;  4JHR A;  2KCK A;  1HH8 A;  2L6J A;  3PDN A;  4I2Z A;  4UWG A;  4E85 A;  4UQZ A;  3PS6 A;  4FLH A;  4ANW A;  3LY8 A;  3ZYM A;  3QK0 A;  4J8F A;  1OWM A;  2I1K A;  3O48 A;  3CVW A;  2WXG A;  2R59 A;  4J6I A;  2J4D A;  3CVY A;  1XGW A;  2Y3A A;  3EIJ A;  4N2Q A;  2PM6 A;  3FH5 A;  1YA0 A;  3SHF A;  3FU6 A;  1HFA A;  4CCA A;  4JHK A;  3D9P A;  3TXM A;  3APF A;  3E4B A;  3FUI A;  1TJC A;  3QC1 A;  4U0Z A;  3ZHE A;  5JHB A;  5FTP A;  3KEZ A;  1XNF A;  4Q69 A;  3FU0 A;  4ILG A;  3I3N A;  4K03 A;  2XPY A;  3ZHE B;  5KJK A;  3GZ2 A;  2L0T B;  4AJW A;  4GZD A;  2ILR A;  4FJY A;  1S0P A;  2CG3 A;  2BF0 X;  3JYS A;  3OXG A;  2AXZ A;  2GRL A;  1FVH A;  1QQE A;  4J8D A;  1WM5 A;  5EX0 A;  4KZ0 A;  4C9B B;  4KZC A;  1DNP A;  3MYV A;  5FQ4 A;  4CDR A;  3P1U A;  4L2Y A;  4EBA G;  2XGO A;  3PNL B;  4TV3 A;  2KCL A;  4UI9 C;  4HOS A;  5ANR A;  3VLE A;  2IU1 A;  1E90 A;  1OWL A;  2CHW A;  5FZS A;  4N2S A;  4XI0 A;  4G11 A;  5EDS A;  3MKQ A;  3MGB A;  3MZL B;  4Y6C A;  1HG5 A;  4GZ6 A;  1EYH A;  3MKQ B;  2E0I A;  4APO A;  3EIQ C;  4ILH B;  5BV0 A;  3I5P A;  3PUK A;  3CVL A;  1H2U A;  2HM8 A;  2KZT A;  3FDH A;  3LKU A;  5G2N A;  2KAT A;  3PRE A;  3FTW A;  2GRM A;  3ASG A;  4AVX A;  4AY6 A;  4EBA A;  3FH8 A;  2MHK A;  3CSF A;  4G2V A;  3G2U A;  4I2W A;  5KJL A;  2KZT B;  4L1B A;  3D9J A;  3T8M A;  3ML9 A;  2Y4U A;  4LRZ A;  3FUH A;  2I6H A;  2YNQ A;  4HS2 A;  5LCW C;  3RJV A;  4G24 A;  4ANX A;  3Q47 B;  2WXQ A;  4H7Y A;  3RO2 A;  3HYM B;  3ZYL A;  3RO3 A;  4CGV A;  3D9M A;  2PQR A;  2V0P A;  3QAQ A;  3LVQ E;  4J8S A;  4AOF A;  5AIJ A;  3ZEF A;  2V8S E;  1U3C A;  4NAC A;  2J9Q A;  4GA2 A;  2JLB A;  2WXR A;  4L23 A;  1N54 A;  3DBS A;  1FVF A;  3JUI A;  3SBS A;  1TJF A;  3D9L A;  1E8W A;  3PUJ A;  4N3C A;  3FP3 A;  2HR2 A;  2I1J A;  4IUL A;  1WAO 1;  5C2Y A;  3RRU A;  4B89 A;  4JHJ A;  3Q4A B;  3QJZ A;  4UI9 K;  4R7L A;  2A4Z A;  2AXU A;  2XEV A;  1MQS A;  2XGM A;  2PZI A;  4UI9 J;  1QNF A;  4JA9 A;  3KD7 A;  4JL0 A;  3UQ3 A;  4KVM A;  3WXX A;  2NC9 A;  2PM7 A;  2VTB A;  3LYA A;  3NF1 A;  5JJT A;  4A3T A;  2LSU A;  4XI9 A;  4ATG A;  3G2V A;  5KJN A;  5T8I A;  4V3I A;  3APC A;  4O6F A;  4BY6 A;  2VTB B;  4U0U A;  2OVB A;  3CK9 A;  2EQX A;  4EEC A;  1P5Q A;  1DVP A;  1LF8 A;  3TXN A;  4A55 A;  3IKO B;  2WB2 A;  5FQ7 A;  1NP7 A;  4ABN A;  3FUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...