2HYZA

Crystal structure of an 8 repeat consensus tpr superhelix (orthorombic crystal form)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
136
structure length
136
Chain Sequence
AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and stability of designed TPR protein superhelices: unusual crystal packing and implications for natural TPR proteins.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords SYNTHETIC CONSENSUS TPR PROTEIN
total genus 56
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2006-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2hyzA00
4G23A 2FBNA 3QDNA 2VQ2A 5D0QD 4XI0A 1TJCA 3OXLA 4I9EA 4U0UA 2HYZA 4UI9K 2XEVA 3IEGA 2BUGA 3URZA 3OXGA 1KT1A 5C1DA 1A17A 5KJNA 2ONDA 1ELWA 1QZ2A 2R5SA 4GCOA 3UQ3A 3CVLA 2JLBA 3CVPA 4EQFA 3AS5A 3NF1A 5KJKA 2OOEA 1FCHA 4IN3B 4BTBA 3LY8A 4YNDA 4N2QA 1NA3A 3ASDA 5ARGA 3ZN3A 2DBAA 4U07A 3UPVA 4UQYA 3EDTB 5EKQD 3FP3A 4YVQC 3TAXA 5BNWA 4N2SA 2KCKA 4HOTA 1IHGA 4YVOA 2GW1A 4GA0A 4KXKB 2PL2A 3CK7A 3Q49B 3LYAA 3MV3B 5DBKA 3ZGQA 2V5FA 3AS8A 4GPKA 4H7XA 4CGWA 4Y6CA 2LSUA 1ZBPA 4J8FA 2XGSA 4BWRA 5M72A 4GCNA 2I6HA 2LNIA 4GYWA 2KC7A 4J0UA 5FT9A 3Q47B 5FZRA 5HI7A 1HZ4A 2VSNA 3Q4AB 4H7YA 2XCCA 4JL0A 2HO1A 2XGMA 3RU0A 3S7JA 4CGVA 3SF4A 2UY1B 4JA9A 2J9QA 3ASGA 5FTPA 3S7FA 3S7DA 3KAEA 3CVQA 1KLXA 3JYSA 3WXXA 2PQNA 2YHCA 3RKVA 3GZ2A 4U04A 3U3WA 2C0MA 3QWVA 3VTYA 3MKRA 3CK9A 2XGOA 4J8DA 5CCMA 2P58C 3RO2A 3CKBA 2KCVA 3CEQA 1NZNA 3QWWA 2IF4A 5LCWC 3CVNA 2FF4A 4GA1A 2IFUA 1KT0A 2L6JA 2Y4TA 3MA5A 3Q5MA 4ME2A 4WNGA 5ARFA 4BT8A 4W9RA 1IYGA 4G24A 3KS2A 5D0OD 1ELRA 3GZ1A 5CHEE 3PDNA 4KYOB 3TGOA 4WNFA 5BT1A 2YQ8A 5AYWD 4N3BA 1YA0A 2VGXA 5JJ7A 3AS4A 2UWJG 5A6CA 4GZ5A 3ASFA 4HOQA 4I2WA 4N5CA 4U0SA 3MEKA 5EX0A 4ABNA 4I9CA 4WNDA 4KBQA 2WPVA 5DIZA 5KJMA 4G25A 2LSVA 5G04C 4F3VA 1WM5A 2KCLA 4XI9A 1E96B 4RG9A 4G26A 5G05J 3ZPJA 5FZQA 3N71A 4BT9A 2FO7A 2PZIA 3LY9A 4G2VA 5LCWJ 1PC2A 4NQ0A 3LPZA 2MHKA 3HYMB 3ZHEA 2XCBA 3ASHA 4AM9A 3GYZA 5JJTA 4N39A 3ESKA 3ZHEB 4XIFA 3QOUA 2VSYA 3U4TA 2VYIA 1P5QA 1HH8A 4WNEA 3KD7A 4AY5A 5CCLA 1WAO1 3CK8A 4N3CA 2C2LA 3FWVA 2Y4UA 4I1AA 3VTXA 1ZU2A 2NC9A 1Y8MA 2Q7FA 2UY1A 3QWPA 4U0ZA 5A7DB 4GZ3A 3PE4A 3E4BA 5KJLA 3QKYA 3O48A 1OUVA 1W3BA 4HOUA 2QFCA 3TG4A 3FFLA 2XPIA 4UQXA 3TG5A 4B94A 2AVPA 4GA2A 4I17A 3LCAA 4J8EA 4UI9C 1XNFA 3K9IA 3LKUA 4WUYA 4I2ZA 4A1SA 4AY6A 3ZFWA 3PE3A 3SZ7A 4JHRA 3CV0A 4CDRA 3UUXA 4HOSA 4JA7A 5G05C 4Y6WA 4GYYA 3RO3A 4N3AA 1HXIA 4NRHB 3S7BA 2E2EA 3CKCA 1QQEA 3GW4A 4GYOA 4LEUA 3RIBA 2HR2A 4RG6A 4GZ6A 1NA0A 2FI7A 2VGXB 5FJYA 3RJVA 5FZSA 5HQ8A 5EX3A 4UQZA 4HORA 3Q15A 4O6FA 3OXFA 5BW8C 4APOA 3ULQA 5JJ6A 4G1TA 4UI9J 3R9AB 1B89A 2KATA 2PQRA 4AIFA 3MV2B 4BTAA 3LY7A 2WQHA 2C0LA 5G04J 2VGYA 3BEEA 2FEZA
chains in the Genus database with same CATH superfamily
5D0QD 5LX8A 3OXLA 5J08A 3E37A 5FQ8A 1JCQA 4NIKA 4ATGA 4L9PA 1H2UA 4JW1A 2MOWA 1QBQA 4YVOA 4DUIA 3Q78A 3HDXA 4JZYA 2DWZA 1O1SA 4JL0A 2HO1A 2XGMA 5AQ7A 3S2AA 4ANXA 4BT9A 3D9PA 1RZ4A 1IYGA 4RQIA 4KZCA 2EILE 4PDXA 3Q9UC 4N5CA 4LERA 3ZXSA 4OAVB 5FZQA 2IOLA 3UXGA 2MHKA 2EIJE 3GYZA 5G2NA 3FY4A 1EF1C 4XZ4A 4FJYA 1NP7A 2GRLA 3NBNB 2CHZA 5B1BE 4DI4A 4C48B 3LXUX 4L1BA 4JHRA 3CV0A 1U2VG 3UUXA 4CCAA 2WQ6A 2EIKE 2H6IA 4B8AA 1YYHA 5JHBA 3RJVA 2IO3C 4BETA 4JPSA 1IQUA 3Q15A 2X6FA 3DPDA 3CGHA 3MZLB 3CSTA 5FQ7A 2GGFA 2EIME 4U0UA 3MCXA 2GRRB 2DZNA 2P9LG 3UQ3A 3CVLA 3DXKG 3AS5A 3NF1A 2EQXA 4I1OB 1HO8A 2DBAA 4CRWA 2WXNA 4F1PA 1TN7A 2PL2A 3PS6A 3AS8A 3AJIA 1TNYA 3FTSA 4ZFHA 4GTTA 4B0ZA 3G2TA 2A4ZA 4HS2A 3QWVA 3MKRA 3NAWA 4I43A 2XRYA 4Q96A 3BU8A 3LEWA 1JWFA 1N94A 3ABKE 3PUKA 3L22A 1YA0A 3HRAA 3L13A 2Y3AA 4TXQA 4ANVA 1QYMA 2I1KA 3UIOC 2RG8A 4RLYA 2AWIA 5AQBA 5A7DB 1S64A 3TG4A 4AEZC 2YINA 3ZNGA 4WUYA 3ASNE 4U96D 4ILHB 4EBAG 2E2EA 3FU3A 3GZSA 5ENSD 4UQZA 1HS6A 4UWHA 1B89A 3LY7A 4DK5A 5CECB 3JUEA 4A55A 1N52A 1LD7A 4BSXA 5CBOA 2XS1A 4BTBA 1N4QA 3FUEA 2IOSA 4AV7A 3E34A 2X3MA 1U3CA 1IXVA 1OCZE 2QY7A 3PZDA 1SVXA 5FT9A 3AG4E 4WAFA 4KZ0A 2PM7A 4ILIA 2P9SG 3HHMA 5FQ4A 4FHJA 1YCSB 1EPUA 3UINC 1UJJA 4PS7A 4WNFA 2OVFA 5JJ7A 3C5RA 2H6HA 2WXKA 1V54E 3MEKA 1E7UA 1DC2A 1U3DA 4A1GA 4Q69A 3HXCA 1OWNA 4U8HA 5AIJA 3FH7A 4N39A 5T8IA 3FUDA 2KZTB 3EHNA 3ASOE 1FVHA 4BX8A 3FTVA 2F37A 1DCEA 4UQXA 3ZRHA 4GZCA 1JPLA 2AVPA 2IONA 5HS0A 2WMNA 4PH4B 1LF8A 4J6IA 1XNFA 3ZFWA 4ANWA 4JA7A 1BU9A 4RG6A 3IXEA 2FI7A 3B7BA 3IHYA 3LJNA 3ULQA 4M7CA 3V2XA 3EIJA 1S0PA 3BEEA 2MYOA 2ILRA 1TEZA 1SA5A 3V31A 4EHMA 1MYOA 3PNLB 2YNQA 4GCOA 3JUIA 3NZSA 3CHQA 4N2QA 2R02A 5LP0A 3UPVA 3CHMA 3ZYKA 2GW1A 3JQ1A 4GA0A 2WXOA 3ZGQA 2OVBA 2DYRE 4BWRA 4GCNA 3LVRE 2VSNA 4I6EA 1E8XA 4LRZA 3TWSA 3B95A 2J9QA 3OAWA 3CVYA 3RKVA 2LXMA 2CFZA 3OTNA 3ZUVB 3CEQA 1KT0A 2ETBA 4YDEA 4BY6A 5BPPA 2H6FA 2V5QC 5BV0A 5BT1A 4N3BA 4DX6D 4BESA 3P2BA 4I2WA 1K1AA 3LS8A 3J5QB 1FT2A 1N0QA 2AW6A 4DX7D 4F6RD 2J09A 3RSEG 5AJLA 3LJ3A 3D9HA 2ZGDA 5FINA 2B0OE 3D9LA 2Y4UA 2NC9A 2FULA 3EHRA 3NOCD 3G2SA 3E4BA 4L23A 1ELKA 5A23A 2DIWA 2Y0BG 3FU5A 1OT8A 2NXPA 4Y6WA 1H19A 3FH8A 3ZYQA 4I1MA 5KNHD 5EX3A 2BTDA 3FUIA 3SGHA 2BUGA 5JA4D 3OXGA 3FEYA 4WWNA 3L6AA 5AN8A 3BG1B 4QQIA 3LY8A 3ASDA 3T9KA 4YVQC 2KCKA 2X6KA 4HFGA 3ONLA 1ZBPA 5KWDA 1UN9A 4G8KA 5AQ9A 3RK6A 4JXTA 4FULA 3JYSA 2YHCA 3EU9A 3SFZA 5ENTD 4FA6A 4MBGA 4MLPA 2KM4A 3SFYA 2J07A 1NZNA 5FWQA 4XKCA 2ZGGA 4QFVA 3Q5MA 4WNGA 1TNOA 4WWOA 3UKUG 2VGEA 3FUKA 5CEDB 4GTSA 5DIZA 2IQCA 1E96B 3FUNA 3ZPJA 3N71A 3TWWA 5BXUA 4FU3A 4G2VA 3PZ4A 2OCCE 3UM0A 3U4TA 4P29A 3TWQA 1FPPA 3W9GA 1IQRA 3L82A 3JXJA 3ULEG 3IHVA 2WXMA 2XPYA 1N0RA 2QC9A 1OWMA 3SHFA 2V8SE 4I17A 4G8LA 1K8KG 2WM9A 1D9SA 3ABME 3FUJA 1Z3YA 4DLQA 3IV0A 4KMOA 5C2YA 4O6FA 1MJ0A 4AIFA 1TN6A 2ONDA 1TR4A 3FTWA 2VGYA 2FEZA 1BI7B 2FBNA 4I9EA 4U8VD 2JEKA 1H6PA 5C1DA 2R5SA 3KSLA 5CRVA 4LG6A 1UOHA 5B1AE 3KEZA 3UT7A 4ACLA 3TAXA 4N2SA 2VSOE 3C3OA 3PREA 4GTMA 1SZ9A 2LSUA 1TYQG 2LNIA 1UW4B 1OWLA 2KC7A 4TXRA 3ASGA 3PZ2A 3B7RL 4K03A 2PQNA 3FUFA 1OCCE 2C0MA 1AP7A 3CVXA 1S70B 2XS8A 5LCWC 2IFUA 3Q75A 4C0EA 1JCRA 4G24A 3D3MA 5D0OD 5CHEE 2CG2A 4GZ5A 3ASFA 4MRUA 2E0IA 4A3TA 2VTBA 1IKND 3PZ1A 3QJZA 3PUJA 2BF0X 2WXPA 1PC2A 2XCBA 3ASHA 3AU4A 4PUCA 1HU3A 2VSYA 4K0RA 5CCLA 1E8WA 3CK8A 4N3CA 3EIQC 3SY2A 3DBSA 3CLJA 1UJKA 4TUMA 4KVMA 3L54A 4B94A 1PY1A 4DRXE 3MGBA 3RAUA 4CDRA 1X81A 2L6BA 1TN8A 3QAQA 4F7AA 3L9TA 5EDSA 2MRIA 3MV2B 3PNTB 1ZB1A 2HYZA 2WB2A 1KT1A 3O4ZA 1NFIE 2X6JA 3U66A 1QZ2A 3MKQB 4AOFA 4EQFA 3T5VA 1D8DA 3EDTB 3FP3A 2GRMA 1UN8A 2OEWA 3AAAC 4CGWA 2XZTG 3TL5A 1E8YA 3RU0A 4JHJA 2J8SD 4HI9A 2P9NG 3DEPA 4J8DA 3DEOA 3CKBA 3QNKA 3CQCB 4EZJA 3UM2A 3TGOA 4MKTA 1N9AA 4OVVA 2AXVA 4N5QA 4KBQA 3RRUA 2KCLA 1E90A 3UTMA 3L16A 1NI1A 3UX4A 4AM9A 4GMRA 1A5EA 3EJNA 3ZIMA 3AG1E 1HH8A 2DYSE 1WAO1 3FWVA 1XGWA 5AENA 4BEPA 2X38A 3NQPA 2WXHA 3ZXPA 2HE0A 2X6IA 4U63A 5AJDA 4XKBA 3APDA 4J7WA 4LEUA 4LNUD 1K1BA 3IBEA 5JJ6A 2F0YA 4G1TA 2IO2C 3P1UA 2AJAA 4GPMA 4IYPA 4XI0A 1TNZA 5EYPF 3B7SA 3DPYA 3SBTB 1MX4A 3PEUB 4GTOA 4EZKA 2RFAA 4XX5A 4U07A 1BI8B 1FVFA 5HI7A 5KJMA 4H7YA 5EILA 1KZPA 3AG3E 3HIZA 5CEAA 4JD2G 3FDHA 3FTUA 4NURA 5BXOA 5KCMA 4K5AB 2IF4A 4IRUA 3SD5A 5G05C 4JEHA 5ENPD 1ELRA 3PDNA 4KYOB 1SW6A 2XHEA 2I2OA 4HOQA 3CHPA 4DX5D 4RG9A 3MX3A 2H6GA 3SO8A 3VLDA 4U8YD 3L17A 4I1AA 3MJWA 4U0ZA 2J49A 5B3SE 4HOUA 3FFLA 2QZAA 2AXZA 5JMND 2V4HC 3V79K 2WXRA 3SZ7A 3V30A 4NRHB 3FULA 3BG0B 2CFUA 4PS3A 5HQ8A 4DLOA 4EBAA 4H7XA 4X8QA 2VQ2A 4OVUA 1TJCA 4M3OA 3G2VA 1X5BA 3URZA 4AVXA 2GRQB 2CHWA 1SQMA 2OOEA 3CK7A 3LYAA 2ETAA 2NSZA 4HQDA 2F8YA 3APFA 3HXFA 1Q2ZA 3S7JA 4A3VA 3G2UA 1JUQA 3S7FA 3CVQA 1QNFA 3U3WA 3X2QE 3FTYA 3PH0C 3NB2A 4BT8A 3U64A 3CIAA 3KS2A 4UWLA 4PS8A 3TWRA 5E75A 1WM5A 3TXNA 4XI9A 3B13A 2IJGX 3R9MA 5BUZA 2B6CA 2PZIA 1MHQA 3ESKA 4XIFA 4AY5A 2V4LA 4K5BA 2Q7FA 3QKYA 3CVWA 3ZKJA 4D10C 2EINE 3J5PA 3FEXA 2R03A 3ABLE 2RFMA 3W9FA 4V3IA 4F53A 3OXFA 5ENOD 4APOA 5CBNA 3KSQA 5EN5D 2WMOA 1H2VC 3DSSA 2XEVA 3DSTA 1O5MA 4GMLA 1OXJA 3CVPA 1WDYA 5KJKA 4O1OA 1N95A 5AQAA 1OY3D 3ULYA 4J8FA 4FHKA 4NACA 2KZTA 3B7TA 3Q47B 2OV8A 2LO6A 5ANLA 3HG0D 4I6GA 2KCVA 3F6QA 3TJPA 3CVNA 2XEHA 5CRUA 2Y4TA 2R59A 1BD8A 4W9RA 3GZ1A 1JWGA 4B89A 4HBDA 4L2LA 4MS6A 4G25A 1TJFA 1HFAA 5G04C 2LXLA 4BX9A 3ML8A 4GZDA 3HYMB 5FIOA 4ZHBA 2WXFA 3HXEA 3ZHEB 4KT6B 3QOUA 4LNBA 3UIPC 4C0MA 4LUNU 2X6HA 4JVSA 3R7RA 5KJLA 3UT4A 3JXIA 3FU0A 3Q9NC 3SNXA 4KVOA 5G55A 4AY6A 1Y6IA 4I2ZA 3V2OA 2QYJA 4N3AA 2HR2A 2VGXB 4UUCA 3JQ0A 4UI9J 2PQRA 1H6OA 2VJ8A 2LAHA 4UI9K 1AWCB 1TNUA 2A5UA 1FCHA 4CYMD 4BERA 4CT4A 2R17C 3UI2A 4KXKB 2XRZA 3MV3B 1SA4A 2V5FA 4GPKA 1EDUA 3PVLA 1DVPA 5EYLA 2LUHA 3MKQA 4CEMA 4LSZE 1KLXA 1N11A 3CK9A 3FHEA 4JEUA 3UMVA 2ETCA 3ENEA 3ZU7B 5ARFA 4BFRA 1Z3XA 2YHEA 3I5PA 2ZIRA 4HRNA 2WXLA 2VGXA 3TWTA 4FADA 4WNDA 4B8CB 4F3VA 1DCQA 5ENQD 1MQSA 1HX8A 3NOGD 3KEAA 2DZOA 3BUAA 4EECA 4HNAD 1BLXB 4IULA 2VYIA 1N4RA 2WXJA 5EIDA 4TXPA 1WY6A 3C3QA 1D8EA 2BKKB 4YDWA 4CZ2D 4J8EA 1E8ZA 3PE3A 4FLHA 1S63A 4AXHA 5CMYA 3S7BA 4GU5A 3RIBA 2LAIA 5FJYA 2M63A 5CERB 2J08A 4TUUA 2KATA 3SI5A 3S7DA 4YDYA 3QDNA 3ONKA 4Q94A 3Q7AA 3T8KA 2BKGA 3T8MA 1A17A 1ELWA 5ANRA 2CHXA 4HB5A 4IN3B 2WXIA 4O60A 2DVWA 4HOTA 3DWLG 1IHGA 2XEEA 3CHRA 1E7VA 2XGSA 3MYVA 4GYWA 4J8SA 4URKA 4GB9A 5AAOA 2IY0C 5IY5E 3E33A 4O1PA 5CCMA 2XGOA 2Y1LE 4LCTA 2P58C 5LOZA 4AP2A 1K3ZD 2FF4A 3PZ3A 2ZISA 1NL4A 3AS4A 5A6CA 1KPSB 3NZUA 5H7PA 3TWVA 4ABNA 3D9OA 2I1JA 5G05J 4G26A 3ZHEA 4APFA 4TV3A 3L08A 2P2CP 3D9IA 1Y8MA 3QWPA 3PE4A 4ACKA 5EIBE 2XPIA 3LDZA 1PAQA 4UI9C 4A1SA 2A5EA 4DI3A 1RW2A 4FP7A 4YDOA 3RO3A 5J90A 1HXIA 3C3RA 1NA0A 5JHAA 3D9NA 1OCRE 4E85A 1V55E 1OWOA 3PRZA 3ML9A 5D66A 3WG7E 2WVIA 3U9WA 3IEGA 3BQOA 2I9CA 5KJNA 3Q73A 1GW6A 2VTBB 5ARGA 1DNPA 3CQGB 3CVVA 4XEIG 1HF8A 2I6HA 4F1SA 5FTPA 1BPOA 3VLEA 3KAEA 3WXXA 2XPZA 2L9BA 2VSXE 3FTXA 3RRNB 2WXGA 3QWWA 5LFAA 1TNBA 2L6JA 2P9IG 3CHOA 5D2MC 3DSXA 2J4BA 1L5JA 3JCKC 2XQ0A 3I4GA 4OAUC 2WPVA 4HLLA 3T5XA 2CG3A 4UWGA 3R7QA 5JJTA 3CHSA 1VDYA 3UM1A 3FUHA 2XENA 1MX6A 4HXIA 3SBSA 1OUVA 2GRPB 4JC8A 1H6KA 3APCA 3I4RB 4C9BB 1Z5SC 3PEVB 5ITZF 2V0PA 1FT1A 2BEDA 3GW4A 3ZEFA 4U95D 3QC1A 2HM8A 3D9MA 2ZXWE 4BTAA 3VTYA 4G23A 3SQVA 2WXQA 4FC8A 4CDMA 3HXBA 3FU6A 1SZAA 1HG5A 4RSYA 4B93B 5HRYA 3ZN3A 1JCSA 4R7LA 5EKQD 1N4SA 3QARA 2P9KG 3AG2E 3Q49B 5DBKA 4DX2A 4E6HA 4I6JA 5M72A 4FLBA 4L7TA 5FZRA 4CGVA 3RRMB 1O1TA 2GROB 2KXPC 2UY1B 4GTVA 4JA9A 2WQ7A 4UWKA 3GZ2A 5KBAA 5BV1A 5KNGA 4OYSA 4U7EB 4L2YA 1G3NB 3MA5A 2FO1E 4ME2A 3E30A 3FH5A 4HRMB 4TRQA 2YQ8A 2XZDG 3DSUA 4GMJA 2F8XK 4I9CA 1N4PA 4JB8P 5E76A 5LCWJ 2ZU6B 3Q79A 1Z6TA 3HVEA 4DJAA 5AARA 3KD7A 3Q7FA 2UY1A 3HXDA 1W3BA 2IU1A 3TG5A 1OWPA 4LNGA 3ZW3A 4GTRA 4XE0A 1N54A 4J8YA 2PNNA 5ENRD 2R2LA 5FZSA 1IHBA 2R05A 2L0TB 3ISMC 4BSZB 2DCPA 3EU5A 2WQHA 5T4YA 2PM6A 4WWPA 3HVEB 4GTQA 3ZYMA 3DSWA 2JLBA 4UWFA 4YNDA 1NA3A 1O1RA 5BNWA 1MZCA 4Y6CA 4HRLA 4J0UA 5FQ6A 3C98A 4G11A 2XCCA 4Z68A 3UM3A 3IKOB 3CSFA 1UG3A 1HG2A 3E32A 3FTZA 3ESLA 5ENNA 2QYUA 5AYWD 2UWJG 4U0SA 3DSVA 2LSVA 4ILGA 4GAAA 3ZVVA 3LY9A 4NQ0A 3LPZA 3LVQE 2OEVA 2JABA 3SFXA 4WNEA 2C2LA 1ZU2A 4GZ3A 3O48A 1INZA 4HLEA 2QFCA 1H2TC 3EUVA 1H0AA 4EPZA 3LCAA 3LKUA 3ZYLA 2P9PG 4AJWA 4GZ6A 4CT0A 4HORA 4GYOA 5G04J 1WG0A 1EYHA 3VLFA 3C72A 2KBXA 3QK0A 4RVBA 3CVUA 4UQYA 3I3NA 3TWUA 1HZ4A 4CDNA 3EHMA 1LD8A 3Q4AB 3SF4A 3TWXA 4U04A 3CR3A 3RO2A 4FJZA 2IEJA 2P9UG 4GA1A 4DPRA 1OCOE 4JHKA 5EX0A 4ATZD 2GRNB 3AU5A 3D9JA 4HI8A 2AXUA 5T3RA 2FO7A 3TXMA 3UKRG 1YMPA 1P5QA 3D9KA 1LTXA 4HVBA 4K5CA 3VTXA 2NYJA 3DRAA 4ANUA 5HKPA 1KZOA 1HE8A 2J4DA 4GA2A 3G2WA 3K9IA 2Y69E 4HOSA 3B7UX 4GYYA 1MX2A 2RD0A 3CKCA 1QQEA 4EZLA 3EHQA 3UT8A 2RKKA 3FUMA 4DX1A 4GTPA 3DXMG 5BW8C 5CMWA 3QB2A 3R9AB 4A63B 2C0LA 2L0IA
chains in the Genus database with same CATH topology
2VQ2A 5D0QD 4OVUA 1TJCA 3ML9A 3OXLA 5LX8A 5J08A 2WVIA 4M3OA 3G2VA 3IEGA 2BUGA 5FQ8A 3SGHA 1X5BA 3U9WA 3URZA 4AVXA 3OXGA 3FEYA 2I9CA 4WWNA 5KJNA 2CHWA 3L6AA 4ATGA 1SQMA 3BG1B 1H2UA 2OOEA 4JW1A 1GW6A 3LY8A 2VTBB 3ASDA 5ARGA 4YVQC 2KCKA 2MOWA 1DNPA 4YVOA 2X6KA 3CQGB 3CK7A 4HFGA 3CVVA 3LYAA 3HDXA 3ONLA 2NSZA 4JZYA 1HF8A 1ZBPA 2I6HA 1UN9A 3APFA 4JL0A 2HO1A 2XGMA 3S7JA 4A3VA 3G2UA 3RK6A 4F1SA 1JUQA 5FTPA 1BPOA 3S2AA 3S7FA 4JXTA 3VLEA 3KAEA 3CVQA 4FULA 3JYSA 3WXXA 1QNFA 2XPZA 2YHCA 2L9BA 3U3WA 3SFZA 2VSXE 3D9PA 3FTXA 4FA6A 3RRNB 2WXGA 3FTYA 4MLPA 2KM4A 3QWWA 2J07A 1NZNA 3PH0C 5FWQA 5LFAA 4XKCA 2L6JA 4QFVA 3Q5MA 4WNGA 3CHOA 4BT8A 1IYGA 3U64A 3CIAA 3KS2A 4UWLA 4PS8A 2J4BA 4KZCA 4WWOA 3FUKA 4PDXA 4N5CA 1L5JA 3JCKC 4LERA 3ZXSA 2XQ0A 3I4GA 5DIZA 2WPVA 2IQCA 5E75A 1WM5A 3TXNA 4XI9A 3T5XA 2CG3A 3B13A 1E96B 2IJGX 3FUNA 3ZPJA 5FZQA 3N71A 2IOLA 4FU3A 5BUZA 2PZIA 4G2VA 4UWGA 1MHQA 3R7QA 2MHKA 3GYZA 5JJTA 3CHSA 5G2NA 3ESKA 1VDYA 1EF1C 3FY4A 4XIFA 4XZ4A 4FJYA 3U4TA 1NP7A 2GRLA 3FUHA 4P29A 4AY5A 2V4LA 1IQRA 2CHZA 2Q7FA 4HXIA 3SBSA 3QKYA 1OUVA 3IHVA 2WXMA 2XPYA 3CVWA 4JC8A 1H6KA 4DI4A 1OWMA 3SHFA 4D10C 3APCA 2V8SE 4I17A 3LXUX 3I4RB 4L1BA 4JHRA 2WM9A 3CV0A 3FEXA 3UUXA 4C9BB 4CCAA 2WQ6A 3FUJA 1Z3YA 3PEVB 4DLQA 2V0PA 3GW4A 3IV0A 4KMOA 5C2YA 4B8AA 5JHBA 3RJVA 4V3IA 4F53A 4JPSA 3ZEFA 1IQUA 3QC1A 3Q15A 2X6FA 3OXFA 4O6FA 3DPDA 4APOA 2HM8A 3CGHA 4AIFA 3D9MA 3MZLB 4BTAA 3CSTA 2ONDA 3VTYA 3FTWA 2VGYA 5FQ7A 2WMOA 2GGFA 2FEZA 4G23A 2FBNA 1H2VC 2WXQA 4FC8A 4I9EA 4U0UA 2JEKA 4CDMA 2XEVA 3FU6A 3MCXA 5C1DA 4ANXA 1SZAA 2R5SA 1HG5A 4GMLA 4RSYA 3CVLA 3CVPA 3UQ3A 3AS5A 3NF1A 5KJKA 2EQXA 4I1OB 3KEZA 3ZN3A 3UT7A 1HO8A 2DBAA 4ACLA 4R7LA 5EKQD 3TAXA 4CRWA 2WXNA 4N2SA 2VSOE 3QARA 2PL2A 3Q49B 3PS6A 3PREA 5DBKA 4E6HA 3AS8A 1SZ9A 2LSUA 4I6JA 4J8FA 4FHKA 4NACA 5M72A 2KZTA 4FLBA 2LNIA 4L7TA 1UW4B 1OWLA 2KC7A 3B7TA 3Q47B 5FZRA 3FTSA 4CGVA 3RRMB 2OV8A 2LO6A 5ANLA 3G2TA 4B0ZA 2UY1B 4JA9A 3ASGA 2A4ZA 2WQ7A 3B7RL 4K03A 4UWKA 2PQNA 3FUFA 3GZ2A 4HS2A 2C0MA 3QWVA 3MKRA 5BV1A 3CVXA 4I6GA 4I43A 2KCVA 5LCWC 2XRYA 4OYSA 4Q96A 3TJPA 3CVNA 4L2YA 2IFUA 3MA5A 2Y4TA 3LEWA 4ME2A 2R59A 4C0EA 1JWFA 4W9RA 4G24A 3D3MA 3FH5A 5D0OD 3GZ1A 5CHEE 4TRQA 3PUKA 2YQ8A 3L22A 1JWGA 1YA0A 2CG2A 3L13A 3ASFA 4GZ5A 4GMJA 4MRUA 2Y3AA 4B89A 4I9CA 2E0IA 4L2LA 4MS6A 4G25A 1TJFA 4A3TA 1HFAA 5G04C 2VTBA 4ANVA 5E76A 2I1KA 3QJZA 4BT9A 3PUJA 2BF0X 4BX9A 2WXPA 1PC2A 3ML8A 5LCWJ 4GZDA 3HYMB 2XCBA 2WXFA 3ASHA 2ZU6B 3AU4A 4PUCA 1Z6TA 3ZHEB 1HU3A 4KT6B 3QOUA 3HVEA 2VSYA 4K0RA 4C0MA 4DJAA 4LUNU 5CCLA 1E8WA 3KD7A 2X6HA 3CK8A 2RG8A 4N3CA 3EIQC 2AWIA 3DBSA 4JVSA 2UY1A 1UJKA 3CLJA 5A7DB 3R7RA 5KJLA 1W3BA 3TG4A 3FU0A 4KVMA 3UT4A 2IU1A 3L54A 4AEZC 3TG5A 4B94A 1PY1A 1OWPA 3SNXA 3MGBA 2YINA 4KVOA 5G55A 3ZW3A 4WUYA 4AY6A 1Y6IA 4I2ZA 4CDRA 4XE0A 1N54A 4ILHB 4EBAG 4N3AA 3QAQA 2E2EA 4F7AA 3FU3A 2HR2A 5EDSA 3GZSA 2VGXB 2MRIA 5FZSA 4UQZA 1HS6A 3JQ0A 2L0TB 4UWHA 4UI9J 1B89A 2PQRA 2VJ8A 2DCPA 3MV2B 3LY7A 2WQHA 3PNTB 5T4YA 2LAHA 4DK5A 2PM6A 2HYZA 4UI9K 4WWPA 3HVEB 4A55A 2WB2A 1KT1A 1N52A 3O4ZA 4BSXA 2X6JA 3U66A 3ZYMA 1QZ2A 3MKQB 2A5UA 4AOFA 2JLBA 4UWFA 4EQFA 1FCHA 4BTBA 3T5VA 4YNDA 1NA3A 3FUEA 2IOSA 3EDTB 3FP3A 2GRMA 4AV7A 1UN8A 5BNWA 4CT4A 2X3MA 2R17C 4KXKB 4EBAA 1U3CA 2XRZA 3MV3B 2V5FA 4GPKA 4CGWA 4Y6CA 1EDUA 3TL5A 3PVLA 1E8YA 2QY7A 3PZDA 4J0UA 5FQ6A 5FT9A 3C98A 1DVPA 4G11A 2XCCA 4WAFA 3RU0A 4KZ0A 3MKQA 2PM7A 4CEMA 4ILIA 4JHJA 1KLXA 3IKOB 3CSFA 1UG3A 3CK9A 4J8DA 3FHEA 1HG2A 4JEUA 3UMVA 3CKBA 3HHMA 3QNKA 5FQ4A 3CQCB 4FHJA 3FTZA 4EZJA 3ENEA 3ESLA 5ARFA 4BFRA 5ENNA 1Z3XA 1EPUA 2YHEA 3I5PA 4PS7A 1UJJA 3TGOA 4WNFA 2OVFA 4MKTA 5AYWD 2WXLA 2VGXA 5JJ7A 2UWJG 4OVVA 2WXKA 4U0SA 3MEKA 1E7UA 2AXVA 4FADA 1U3DA 4WNDA 4KBQA 4B8CB 3RRUA 2LSVA 4F3VA 4A1GA 2KCLA 1E90A 4Q69A 3L16A 4ILGA 1MQSA 1OWNA 4GAAA 3ZVVA 4U8HA 3UX4A 1HX8A 3LY9A 5AIJA 4NQ0A 3LPZA 3FH7A 4AM9A 3LVQE 4N39A 4EECA 5T8IA 3EJNA 3ZIMA 3FUDA 2KZTB 3EHNA 4IULA 2VYIA 1HH8A 4WNEA 1WAO1 1FVHA 2C2LA 4BX8A 3FWVA 3FTVA 2WXJA 1ZU2A 1XGWA 5AENA 1WY6A 4GZ3A 3O48A 1INZA 4HLEA 2QFCA 2X38A 3NQPA 4UQXA 3ZRHA 1H2TC 4GZCA 1JPLA 2WXHA 2AVPA 2IONA 2WMNA 1H0AA 4PH4B 1LF8A 4EPZA 2X6IA 3LCAA 4U63A 4J8EA 4J6IA 1XNFA 3LKUA 1E8ZA 5AJDA 3ZFWA 4ANWA 3PE3A 4FLHA 1OWOA 3ZYLA 4AXHA 4JA7A 4XKBA 3APDA 5CMYA 3S7BA 4AJWA 4GU5A 4LEUA 3RIBA 4RG6A 2LAIA 4GZ6A 2FI7A 5FJYA 4CT0A 2M63A 2J08A 3IHYA 4HORA 4TUUA 3ULQA 3IBEA 5JJ6A 4G1TA 2KATA 3EIJA 1S0PA 3P1UA 4GYOA 3SI5A 5G04J 3BEEA 3S7DA 4IYPA 3QDNA 2ILRA 3ONKA 4Q94A 4XI0A 1TEZA 1EYHA 3B7SA 3SBTB 3VLFA 3PNLB 2YNQA 3PEUB 1A17A 3T8MA 3QK0A 1ELWA 5ANRA 2CHXA 4GCOA 4EZKA 4RVBA 3JUIA 3NZSA 3CHQA 4N2QA 4IN3B 2WXIA 5LP0A 3CVUA 4XX5A 4U07A 3UPVA 3CHMA 4UQYA 4HOTA 3ZYKA 3I3NA 1IHGA 2GW1A 3JQ1A 4GA0A 2WXOA 1FVFA 3CHRA 1E7VA 3ZGQA 2OVBA 2XGSA 4BWRA 3MYVA 4GCNA 4GYWA 4J8SA 5HI7A 3LVRE 5KJMA 1HZ4A 2VSNA 3EHMA 3Q4AB 4GB9A 4H7YA 4CDNA 4I6EA 4URKA 1E8XA 3SF4A 3HIZA 4LRZA 2J9QA 3OAWA 3CVYA 3RKVA 3FDHA 4U04A 3FTUA 3CR3A 2XGOA 4NURA 2CFZA 4LCTA 5CCMA 2P58C 5LOZA 3OTNA 5KCMA 3RO2A 4FJZA 3CEQA 4AP2A 2IF4A 4IRUA 3SD5A 2FF4A 4GA1A 5G05C 1KT0A 4JEHA 4BY6A 4DPRA 5BPPA 1ELRA 3PDNA 4KYOB 5BT1A 5BV0A 2XHEA 4N3BA 2I2OA 3AS4A 5A6CA 4HOQA 3P2BA 4I2WA 3NZUA 4JHKA 5EX0A 3LS8A 4ABNA 2AW6A 3CHPA 3D9OA 2I1JA 4RG9A 3AU5A 4G26A 2J09A 3D9JA 5G05J 3MX3A 5AJLA 2AXUA 5T3RA 3LJ3A 2FO7A 3ZHEA 3TXMA 4APFA 3VLDA 4TV3A 3L08A 1P5QA 3D9KA 3D9LA 3L17A 4HVBA 2Y4UA 4I1AA 3VTXA 2FULA 2NC9A 1Y8MA 3D9IA 3MJWA 3QWPA 4U0ZA 4ANUA 2J49A 3G2SA 3E4BA 3PE4A 4L23A 4ACKA 4HOUA 1ELKA 5A23A 3FFLA 2XPIA 1HE8A 2J4DA 3LDZA 4GA2A 2DIWA 2AXZA 1PAQA 4UI9C 3G2WA 3FU5A 3K9IA 4A1SA 2WXRA 3SZ7A 4DI3A 2NXPA 4HOSA 3B7UX 4Y6WA 4FP7A 4GYYA 3RO3A 5J90A 1H19A 1HXIA 2RD0A 4NRHB 3FH8A 3CKCA 1QQEA 3FULA 3ZYQA 4I1MA 4EZLA 3BG0B 2CFUA 1NA0A 5JHAA 4PS3A 3UT8A 3D9NA 3FUMA 5EX3A 5HQ8A 5BW8C 2BTDA 3FUIA 5CMWA 3QB2A 3R9AB 4E85A 4DLOA 2C0LA 3PRZA 4H7XA 2L0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G23 A;  2FBN A;  3QDN A;  2VQ2 A;  5D0Q D;  4XI0 A;  1TJC A;  3OXL A;  4I9E A;  4U0U A;  2HYZ A;  4UI9 K;  2XEV A;  3IEG A;  2BUG A;  3URZ A;  3OXG A;  1KT1 A;  5C1D A;  1A17 A;  5KJN A;  2OND A;  1ELW A;  1QZ2 A;  2R5S A;  4GCO A;  3UQ3 A;  3CVL A;  2JLB A;  3CVP A;  4EQF A;  3AS5 A;  3NF1 A;  5KJK A;  2OOE A;  1FCH A;  4IN3 B;  4BTB A;  3LY8 A;  4YND A;  4N2Q A;  1NA3 A;  3ASD A;  5ARG A;  3ZN3 A;  2DBA A;  4U07 A;  3UPV A;  4UQY A;  3EDT B;  5EKQ D;  3FP3 A;  4YVQ C;  3TAX A;  5BNW A;  4N2S A;  2KCK A;  4HOT A;  1IHG A;  4YVO A;  2GW1 A;  4GA0 A;  4KXK B;  2PL2 A;  3CK7 A;  3Q49 B;  3LYA A;  3MV3 B;  5DBK A;  3ZGQ A;  2V5F A;  3AS8 A;  4GPK A;  4H7X A;  4CGW A;  4Y6C A;  2LSU A;  1ZBP A;  4J8F A;  2XGS A;  4BWR A;  5M72 A;  4GCN A;  2I6H A;  2LNI A;  4GYW A;  2KC7 A;  4J0U A;  5FT9 A;  3Q47 B;  5FZR A;  5HI7 A;  1HZ4 A;  2VSN A;  3Q4A B;  4H7Y A;  2XCC A;  4JL0 A;  2HO1 A;  2XGM A;  3RU0 A;  3S7J A;  4CGV A;  3SF4 A;  2UY1 B;  4JA9 A;  2J9Q A;  3ASG A;  5FTP A;  3S7F A;  3S7D A;  3KAE A;  3CVQ A;  1KLX A;  3JYS A;  3WXX A;  2PQN A;  2YHC A;  3RKV A;  3GZ2 A;  4U04 A;  3U3W A;  2C0M A;  3QWV A;  3VTY A;  3MKR A;  3CK9 A;  2XGO A;  4J8D A;  5CCM A;  2P58 C;  3RO2 A;  3CKB A;  2KCV A;  3CEQ A;  1NZN A;  3QWW A;  2IF4 A;  5LCW C;  3CVN A;  2FF4 A;  4GA1 A;  2IFU A;  1KT0 A;  2L6J A;  2Y4T A;  3MA5 A;  3Q5M A;  4ME2 A;  4WNG A;  5ARF A;  4BT8 A;  4W9R A;  1IYG A;  4G24 A;  3KS2 A;  5D0O D;  1ELR A;  3GZ1 A;  5CHE E;  3PDN A;  4KYO B;  3TGO A;  4WNF A;  5BT1 A;  2YQ8 A;  5AYW D;  4N3B A;  1YA0 A;  2VGX A;  5JJ7 A;  3AS4 A;  2UWJ G;  5A6C A;  4GZ5 A;  3ASF A;  4HOQ A;  4I2W A;  4N5C A;  4U0S A;  3MEK A;  5EX0 A;  4ABN A;  4I9C A;  4WND A;  4KBQ A;  2WPV A;  5DIZ A;  5KJM A;  4G25 A;  2LSV A;  5G04 C;  4F3V A;  1WM5 A;  2KCL A;  4XI9 A;  1E96 B;  4RG9 A;  4G26 A;  5G05 J;  3ZPJ A;  5FZQ A;  3N71 A;  4BT9 A;  2FO7 A;  2PZI A;  3LY9 A;  4G2V A;  5LCW J;  1PC2 A;  4NQ0 A;  3LPZ A;  2MHK A;  3HYM B;  3ZHE A;  2XCB A;  3ASH A;  4AM9 A;  3GYZ A;  5JJT A;  4N39 A;  3ESK A;  3ZHE B;  4XIF A;  3QOU A;  2VSY A;  3U4T A;  2VYI A;  1P5Q A;  1HH8 A;  4WNE A;  3KD7 A;  4AY5 A;  5CCL A;  1WAO 1;  3CK8 A;  4N3C A;  2C2L A;  3FWV A;  2Y4U A;  4I1A A;  3VTX A;  1ZU2 A;  2NC9 A;  1Y8M A;  2Q7F A;  2UY1 A;  3QWP A;  4U0Z A;  5A7D B;  4GZ3 A;  3PE4 A;  3E4B A;  5KJL A;  3QKY A;  3O48 A;  1OUV A;  1W3B A;  4HOU A;  2QFC A;  3TG4 A;  3FFL A;  2XPI A;  4UQX A;  3TG5 A;  4B94 A;  2AVP A;  4GA2 A;  4I17 A;  3LCA A;  4J8E A;  4UI9 C;  1XNF A;  3K9I A;  3LKU A;  4WUY A;  4I2Z A;  4A1S A;  4AY6 A;  3ZFW A;  3PE3 A;  3SZ7 A;  4JHR A;  3CV0 A;  4CDR A;  3UUX A;  4HOS A;  4JA7 A;  5G05 C;  4Y6W A;  4GYY A;  3RO3 A;  4N3A A;  1HXI A;  4NRH B;  3S7B A;  2E2E A;  3CKC A;  1QQE A;  3GW4 A;  4GYO A;  4LEU A;  3RIB A;  2HR2 A;  4RG6 A;  4GZ6 A;  1NA0 A;  2FI7 A;  2VGX B;  5FJY A;  3RJV A;  5FZS A;  5HQ8 A;  5EX3 A;  4UQZ A;  4HOR A;  3Q15 A;  4O6F A;  3OXF A;  5BW8 C;  4APO A;  3ULQ A;  5JJ6 A;  4G1T A;  4UI9 J;  3R9A B;  1B89 A;  2KAT A;  2PQR A;  4AIF A;  3MV2 B;  4BTA A;  3LY7 A;  2WQH A;  2C0L A;  5G04 J;  2VGY A;  3BEE A;  2FEZ A; 
#chains in the Genus database with same CATH topology
 5D0Q D;  5LX8 A;  3OXL A;  5J08 A;  3E37 A;  5FQ8 A;  1JCQ A;  4NIK A;  4ATG A;  4L9P A;  1H2U A;  4JW1 A;  2MOW A;  1QBQ A;  4YVO A;  4DUI A;  3Q78 A;  3HDX A;  4JZY A;  2DWZ A;  1O1S A;  4JL0 A;  2HO1 A;  2XGM A;  5AQ7 A;  3S2A A;  4ANX A;  4BT9 A;  3D9P A;  1RZ4 A;  1IYG A;  4RQI A;  4KZC A;  2EIL E;  4PDX A;  3Q9U C;  4N5C A;  4LER A;  3ZXS A;  4OAV B;  5FZQ A;  2IOL A;  3UXG A;  2MHK A;  2EIJ E;  3GYZ A;  5G2N A;  3FY4 A;  1EF1 C;  4XZ4 A;  4FJY A;  1NP7 A;  2GRL A;  3NBN B;  2CHZ A;  5B1B E;  4DI4 A;  4C48 B;  3LXU X;  4L1B A;  4JHR A;  3CV0 A;  1U2V G;  3UUX A;  4CCA A;  2WQ6 A;  2EIK E;  2H6I A;  4B8A A;  1YYH A;  5JHB A;  3RJV A;  2IO3 C;  4BET A;  4JPS A;  1IQU A;  3Q15 A;  2X6F A;  3DPD A;  3CGH A;  3MZL B;  3CST A;  5FQ7 A;  2GGF A;  2EIM E;  4U0U A;  3MCX A;  2GRR B;  2DZN A;  2P9L G;  3UQ3 A;  3CVL A;  3DXK G;  3AS5 A;  3NF1 A;  2EQX A;  4I1O B;  1HO8 A;  2DBA A;  4CRW A;  2WXN A;  4F1P A;  1TN7 A;  2PL2 A;  3PS6 A;  3AS8 A;  3AJI A;  1TNY A;  3FTS A;  4ZFH A;  4GTT A;  4B0Z A;  3G2T A;  2A4Z A;  4HS2 A;  3QWV A;  3MKR A;  3NAW A;  4I43 A;  2XRY A;  4Q96 A;  3BU8 A;  3LEW A;  1JWF A;  1N94 A;  3ABK E;  3PUK A;  3L22 A;  1YA0 A;  3HRA A;  3L13 A;  2Y3A A;  4TXQ A;  4ANV A;  1QYM A;  2I1K A;  3UIO C;  2RG8 A;  4RLY A;  2AWI A;  5AQB A;  5A7D B;  1S64 A;  3TG4 A;  4AEZ C;  2YIN A;  3ZNG A;  4WUY A;  3ASN E;  4U96 D;  4ILH B;  4EBA G;  2E2E A;  3FU3 A;  3GZS A;  5ENS D;  4UQZ A;  1HS6 A;  4UWH A;  1B89 A;  3LY7 A;  4DK5 A;  5CEC B;  3JUE A;  4A55 A;  1N52 A;  1LD7 A;  4BSX A;  5CBO A;  2XS1 A;  4BTB A;  1N4Q A;  3FUE A;  2IOS A;  4AV7 A;  3E34 A;  2X3M A;  1U3C A;  1IXV A;  1OCZ E;  2QY7 A;  3PZD A;  1SVX A;  5FT9 A;  3AG4 E;  4WAF A;  4KZ0 A;  2PM7 A;  4ILI A;  2P9S G;  3HHM A;  5FQ4 A;  4FHJ A;  1YCS B;  1EPU A;  3UIN C;  1UJJ A;  4PS7 A;  4WNF A;  2OVF A;  5JJ7 A;  3C5R A;  2H6H A;  2WXK A;  1V54 E;  3MEK A;  1E7U A;  1DC2 A;  1U3D A;  4A1G A;  4Q69 A;  3HXC A;  1OWN A;  4U8H A;  5AIJ A;  3FH7 A;  4N39 A;  5T8I A;  3FUD A;  2KZT B;  3EHN A;  3ASO E;  1FVH A;  4BX8 A;  3FTV A;  2F37 A;  1DCE A;  4UQX A;  3ZRH A;  4GZC A;  1JPL A;  2AVP A;  2ION A;  5HS0 A;  2WMN A;  4PH4 B;  1LF8 A;  4J6I A;  1XNF A;  3ZFW A;  4ANW A;  4JA7 A;  1BU9 A;  4RG6 A;  3IXE A;  2FI7 A;  3B7B A;  3IHY A;  3LJN A;  3ULQ A;  4M7C A;  3V2X A;  3EIJ A;  1S0P A;  3BEE A;  2MYO A;  2ILR A;  1TEZ A;  1SA5 A;  3V31 A;  4EHM A;  1MYO A;  3PNL B;  2YNQ A;  4GCO A;  3JUI A;  3NZS A;  3CHQ A;  4N2Q A;  2R02 A;  5LP0 A;  3UPV A;  3CHM A;  3ZYK A;  2GW1 A;  3JQ1 A;  4GA0 A;  2WXO A;  3ZGQ A;  2OVB A;  2DYR E;  4BWR A;  4GCN A;  3LVR E;  2VSN A;  4I6E A;  1E8X A;  4LRZ A;  3TWS A;  3B95 A;  2J9Q A;  3OAW A;  3CVY A;  3RKV A;  2LXM A;  2CFZ A;  3OTN A;  3ZUV B;  3CEQ A;  1KT0 A;  2ETB A;  4YDE A;  4BY6 A;  5BPP A;  2H6F A;  2V5Q C;  5BV0 A;  5BT1 A;  4N3B A;  4DX6 D;  4BES A;  3P2B A;  4I2W A;  1K1A A;  3LS8 A;  3J5Q B;  1FT2 A;  1N0Q A;  2AW6 A;  4DX7 D;  4F6R D;  2J09 A;  3RSE G;  5AJL A;  3LJ3 A;  3D9H A;  2ZGD A;  5FIN A;  2B0O E;  3D9L A;  2Y4U A;  2NC9 A;  2FUL A;  3EHR A;  3NOC D;  3G2S A;  3E4B A;  4L23 A;  1ELK A;  5A23 A;  2DIW A;  2Y0B G;  3FU5 A;  1OT8 A;  2NXP A;  4Y6W A;  1H19 A;  3FH8 A;  3ZYQ A;  4I1M A;  5KNH D;  5EX3 A;  2BTD A;  3FUI A;  3SGH A;  2BUG A;  5JA4 D;  3OXG A;  3FEY A;  4WWN A;  3L6A A;  5AN8 A;  3BG1 B;  4QQI A;  3LY8 A;  3ASD A;  3T9K A;  4YVQ C;  2KCK A;  2X6K A;  4HFG A;  3ONL A;  1ZBP A;  5KWD A;  1UN9 A;  4G8K A;  5AQ9 A;  3RK6 A;  4JXT A;  4FUL A;  3JYS A;  2YHC A;  3EU9 A;  3SFZ A;  5ENT D;  4FA6 A;  4MBG A;  4MLP A;  2KM4 A;  3SFY A;  2J07 A;  1NZN A;  5FWQ A;  4XKC A;  2ZGG A;  4QFV A;  3Q5M A;  4WNG A;  1TNO A;  4WWO A;  3UKU G;  2VGE A;  3FUK A;  5CED B;  4GTS A;  5DIZ A;  2IQC A;  1E96 B;  3FUN A;  3ZPJ A;  3N71 A;  3TWW A;  5BXU A;  4FU3 A;  4G2V A;  3PZ4 A;  2OCC E;  3UM0 A;  3U4T A;  4P29 A;  3TWQ A;  1FPP A;  3W9G A;  1IQR A;  3L82 A;  3JXJ A;  3ULE G;  3IHV A;  2WXM A;  2XPY A;  1N0R A;  2QC9 A;  1OWM A;  3SHF A;  2V8S E;  4I17 A;  4G8L A;  1K8K G;  2WM9 A;  1D9S A;  3ABM E;  3FUJ A;  1Z3Y A;  4DLQ A;  3IV0 A;  4KMO A;  5C2Y A;  4O6F A;  1MJ0 A;  4AIF A;  1TN6 A;  2OND A;  1TR4 A;  3FTW A;  2VGY A;  2FEZ A;  1BI7 B;  2FBN A;  4I9E A;  4U8V D;  2JEK A;  1H6P A;  5C1D A;  2R5S A;  3KSL A;  5CRV A;  4LG6 A;  1UOH A;  5B1A E;  3KEZ A;  3UT7 A;  4ACL A;  3TAX A;  4N2S A;  2VSO E;  3C3O A;  3PRE A;  4GTM A;  1SZ9 A;  2LSU A;  1TYQ G;  2LNI A;  1UW4 B;  1OWL A;  2KC7 A;  4TXR A;  3ASG A;  3PZ2 A;  3B7R L;  4K03 A;  2PQN A;  3FUF A;  1OCC E;  2C0M A;  1AP7 A;  3CVX A;  1S70 B;  2XS8 A;  5LCW C;  2IFU A;  3Q75 A;  4C0E A;  1JCR A;  4G24 A;  3D3M A;  5D0O D;  5CHE E;  2CG2 A;  4GZ5 A;  3ASF A;  4MRU A;  2E0I A;  4A3T A;  2VTB A;  1IKN D;  3PZ1 A;  3QJZ A;  3PUJ A;  2BF0 X;  2WXP A;  1PC2 A;  2XCB A;  3ASH A;  3AU4 A;  4PUC A;  1HU3 A;  2VSY A;  4K0R A;  5CCL A;  1E8W A;  3CK8 A;  4N3C A;  3EIQ C;  3SY2 A;  3DBS A;  3CLJ A;  1UJK A;  4TUM A;  4KVM A;  3L54 A;  4B94 A;  1PY1 A;  4DRX E;  3MGB A;  3RAU A;  4CDR A;  1X81 A;  2L6B A;  1TN8 A;  3QAQ A;  4F7A A;  3L9T A;  5EDS A;  2MRI A;  3MV2 B;  3PNT B;  1ZB1 A;  2HYZ A;  2WB2 A;  1KT1 A;  3O4Z A;  1NFI E;  2X6J A;  3U66 A;  1QZ2 A;  3MKQ B;  4AOF A;  4EQF A;  3T5V A;  1D8D A;  3EDT B;  3FP3 A;  2GRM A;  1UN8 A;  2OEW A;  3AAA C;  4CGW A;  2XZT G;  3TL5 A;  1E8Y A;  3RU0 A;  4JHJ A;  2J8S D;  4HI9 A;  2P9N G;  3DEP A;  4J8D A;  3DEO A;  3CKB A;  3QNK A;  3CQC B;  4EZJ A;  3UM2 A;  3TGO A;  4MKT A;  1N9A A;  4OVV A;  2AXV A;  4N5Q A;  4KBQ A;  3RRU A;  2KCL A;  1E90 A;  3UTM A;  3L16 A;  1NI1 A;  3UX4 A;  4AM9 A;  4GMR A;  1A5E A;  3EJN A;  3ZIM A;  3AG1 E;  1HH8 A;  2DYS E;  1WAO 1;  3FWV A;  1XGW A;  5AEN A;  4BEP A;  2X38 A;  3NQP A;  2WXH A;  3ZXP A;  2HE0 A;  2X6I A;  4U63 A;  5AJD A;  4XKB A;  3APD A;  4J7W A;  4LEU A;  4LNU D;  1K1B A;  3IBE A;  5JJ6 A;  2F0Y A;  4G1T A;  2IO2 C;  3P1U A;  2AJA A;  4GPM A;  4IYP A;  4XI0 A;  1TNZ A;  5EYP F;  3B7S A;  3DPY A;  3SBT B;  1MX4 A;  3PEU B;  4GTO A;  4EZK A;  2RFA A;  4XX5 A;  4U07 A;  1BI8 B;  1FVF A;  5HI7 A;  5KJM A;  4H7Y A;  5EIL A;  1KZP A;  3AG3 E;  3HIZ A;  5CEA A;  4JD2 G;  3FDH A;  3FTU A;  4NUR A;  5BXO A;  5KCM A;  4K5A B;  2IF4 A;  4IRU A;  3SD5 A;  5G05 C;  4JEH A;  5ENP D;  1ELR A;  3PDN A;  4KYO B;  1SW6 A;  2XHE A;  2I2O A;  4HOQ A;  3CHP A;  4DX5 D;  4RG9 A;  3MX3 A;  2H6G A;  3SO8 A;  3VLD A;  4U8Y D;  3L17 A;  4I1A A;  3MJW A;  4U0Z A;  2J49 A;  5B3S E;  4HOU A;  3FFL A;  2QZA A;  2AXZ A;  5JMN D;  2V4H C;  3V79 K;  2WXR A;  3SZ7 A;  3V30 A;  4NRH B;  3FUL A;  3BG0 B;  2CFU A;  4PS3 A;  5HQ8 A;  4DLO A;  4EBA A;  4H7X A;  4X8Q A;  2VQ2 A;  4OVU A;  1TJC A;  4M3O A;  3G2V A;  1X5B A;  3URZ A;  4AVX A;  2GRQ B;  2CHW A;  1SQM A;  2OOE A;  3CK7 A;  3LYA A;  2ETA A;  2NSZ A;  4HQD A;  2F8Y A;  3APF A;  3HXF A;  1Q2Z A;  3S7J A;  4A3V A;  3G2U A;  1JUQ A;  3S7F A;  3CVQ A;  1QNF A;  3U3W A;  3X2Q E;  3FTY A;  3PH0 C;  3NB2 A;  4BT8 A;  3U64 A;  3CIA A;  3KS2 A;  4UWL A;  4PS8 A;  3TWR A;  5E75 A;  1WM5 A;  3TXN A;  4XI9 A;  3B13 A;  2IJG X;  3R9M A;  5BUZ A;  2B6C A;  2PZI A;  1MHQ A;  3ESK A;  4XIF A;  4AY5 A;  2V4L A;  4K5B A;  2Q7F A;  3QKY A;  3CVW A;  3ZKJ A;  4D10 C;  2EIN E;  3J5P A;  3FEX A;  2R03 A;  3ABL E;  2RFM A;  3W9F A;  4V3I A;  4F53 A;  3OXF A;  5ENO D;  4APO A;  5CBN A;  3KSQ A;  5EN5 D;  2WMO A;  1H2V C;  3DSS A;  2XEV A;  3DST A;  1O5M A;  4GML A;  1OXJ A;  3CVP A;  1WDY A;  5KJK A;  4O1O A;  1N95 A;  5AQA A;  1OY3 D;  3ULY A;  4J8F A;  4FHK A;  4NAC A;  2KZT A;  3B7T A;  3Q47 B;  2OV8 A;  2LO6 A;  5ANL A;  3HG0 D;  4I6G A;  2KCV A;  3F6Q A;  3TJP A;  3CVN A;  2XEH A;  5CRU A;  2Y4T A;  2R59 A;  1BD8 A;  4W9R A;  3GZ1 A;  1JWG A;  4B89 A;  4HBD A;  4L2L A;  4MS6 A;  4G25 A;  1TJF A;  1HFA A;  5G04 C;  2LXL A;  4BX9 A;  3ML8 A;  4GZD A;  3HYM B;  5FIO A;  4ZHB A;  2WXF A;  3HXE A;  3ZHE B;  4KT6 B;  3QOU A;  4LNB A;  3UIP C;  4C0M A;  4LUN U;  2X6H A;  4JVS A;  3R7R A;  5KJL A;  3UT4 A;  3JXI A;  3FU0 A;  3Q9N C;  3SNX A;  4KVO A;  5G55 A;  4AY6 A;  1Y6I A;  4I2Z A;  3V2O A;  2QYJ A;  4N3A A;  2HR2 A;  2VGX B;  4UUC A;  3JQ0 A;  4UI9 J;  2PQR A;  1H6O A;  2VJ8 A;  2LAH A;  4UI9 K;  1AWC B;  1TNU A;  2A5U A;  1FCH A;  4CYM D;  4BER A;  4CT4 A;  2R17 C;  3UI2 A;  4KXK B;  2XRZ A;  3MV3 B;  1SA4 A;  2V5F A;  4GPK A;  1EDU A;  3PVL A;  1DVP A;  5EYL A;  2LUH A;  3MKQ A;  4CEM A;  4LSZ E;  1KLX A;  1N11 A;  3CK9 A;  3FHE A;  4JEU A;  3UMV A;  2ETC A;  3ENE A;  3ZU7 B;  5ARF A;  4BFR A;  1Z3X A;  2YHE A;  3I5P A;  2ZIR A;  4HRN A;  2WXL A;  2VGX A;  3TWT A;  4FAD A;  4WND A;  4B8C B;  4F3V A;  1DCQ A;  5ENQ D;  1MQS A;  1HX8 A;  3NOG D;  3KEA A;  2DZO A;  3BUA A;  4EEC A;  4HNA D;  1BLX B;  4IUL A;  2VYI A;  1N4R A;  2WXJ A;  5EID A;  4TXP A;  1WY6 A;  3C3Q A;  1D8E A;  2BKK B;  4YDW A;  4CZ2 D;  4J8E A;  1E8Z A;  3PE3 A;  4FLH A;  1S63 A;  4AXH A;  5CMY A;  3S7B A;  4GU5 A;  3RIB A;  2LAI A;  5FJY A;  2M63 A;  5CER B;  2J08 A;  4TUU A;  2KAT A;  3SI5 A;  3S7D A;  4YDY A;  3QDN A;  3ONK A;  4Q94 A;  3Q7A A;  3T8K A;  2BKG A;  3T8M A;  1A17 A;  1ELW A;  5ANR A;  2CHX A;  4HB5 A;  4IN3 B;  2WXI A;  4O60 A;  2DVW A;  4HOT A;  3DWL G;  1IHG A;  2XEE A;  3CHR A;  1E7V A;  2XGS A;  3MYV A;  4GYW A;  4J8S A;  4URK A;  4GB9 A;  5AAO A;  2IY0 C;  5IY5 E;  3E33 A;  4O1P A;  5CCM A;  2XGO A;  2Y1L E;  4LCT A;  2P58 C;  5LOZ A;  4AP2 A;  1K3Z D;  2FF4 A;  3PZ3 A;  2ZIS A;  1NL4 A;  3AS4 A;  5A6C A;  1KPS B;  3NZU A;  5H7P A;  3TWV A;  4ABN A;  3D9O A;  2I1J A;  5G05 J;  4G26 A;  3ZHE A;  4APF A;  4TV3 A;  3L08 A;  2P2C P;  3D9I A;  1Y8M A;  3QWP A;  3PE4 A;  4ACK A;  5EIB E;  2XPI A;  3LDZ A;  1PAQ A;  4UI9 C;  4A1S A;  2A5E A;  4DI3 A;  1RW2 A;  4FP7 A;  4YDO A;  3RO3 A;  5J90 A;  1HXI A;  3C3R A;  1NA0 A;  5JHA A;  3D9N A;  1OCR E;  4E85 A;  1V55 E;  1OWO A;  3PRZ A;  3ML9 A;  5D66 A;  3WG7 E;  2WVI A;  3U9W A;  3IEG A;  3BQO A;  2I9C A;  5KJN A;  3Q73 A;  1GW6 A;  2VTB B;  5ARG A;  1DNP A;  3CQG B;  3CVV A;  4XEI G;  1HF8 A;  2I6H A;  4F1S A;  5FTP A;  1BPO A;  3VLE A;  3KAE A;  3WXX A;  2XPZ A;  2L9B A;  2VSX E;  3FTX A;  3RRN B;  2WXG A;  3QWW A;  5LFA A;  1TNB A;  2L6J A;  2P9I G;  3CHO A;  5D2M C;  3DSX A;  2J4B A;  1L5J A;  3JCK C;  2XQ0 A;  3I4G A;  4OAU C;  2WPV A;  4HLL A;  3T5X A;  2CG3 A;  4UWG A;  3R7Q A;  5JJT A;  3CHS A;  1VDY A;  3UM1 A;  3FUH A;  2XEN A;  1MX6 A;  4HXI A;  3SBS A;  1OUV A;  2GRP B;  4JC8 A;  1H6K A;  3APC A;  3I4R B;  4C9B B;  1Z5S C;  3PEV B;  5ITZ F;  2V0P A;  1FT1 A;  2BED A;  3GW4 A;  3ZEF A;  4U95 D;  3QC1 A;  2HM8 A;  3D9M A;  2ZXW E;  4BTA A;  3VTY A;  4G23 A;  3SQV A;  2WXQ A;  4FC8 A;  4CDM A;  3HXB A;  3FU6 A;  1SZA A;  1HG5 A;  4RSY A;  4B93 B;  5HRY A;  3ZN3 A;  1JCS A;  4R7L A;  5EKQ D;  1N4S A;  3QAR A;  2P9K G;  3AG2 E;  3Q49 B;  5DBK A;  4DX2 A;  4E6H A;  4I6J A;  5M72 A;  4FLB A;  4L7T A;  5FZR A;  4CGV A;  3RRM B;  1O1T A;  2GRO B;  2KXP C;  2UY1 B;  4GTV A;  4JA9 A;  2WQ7 A;  4UWK A;  3GZ2 A;  5KBA A;  5BV1 A;  5KNG A;  4OYS A;  4U7E B;  4L2Y A;  1G3N B;  3MA5 A;  2FO1 E;  4ME2 A;  3E30 A;  3FH5 A;  4HRM B;  4TRQ A;  2YQ8 A;  2XZD G;  3DSU A;  4GMJ A;  2F8X K;  4I9C A;  1N4P A;  4JB8 P;  5E76 A;  5LCW J;  2ZU6 B;  3Q79 A;  1Z6T A;  3HVE A;  4DJA A;  5AAR A;  3KD7 A;  3Q7F A;  2UY1 A;  3HXD A;  1W3B A;  2IU1 A;  3TG5 A;  1OWP A;  4LNG A;  3ZW3 A;  4GTR A;  4XE0 A;  1N54 A;  4J8Y A;  2PNN A;  5ENR D;  2R2L A;  5FZS A;  1IHB A;  2R05 A;  2L0T B;  3ISM C;  4BSZ B;  2DCP A;  3EU5 A;  2WQH A;  5T4Y A;  2PM6 A;  4WWP A;  3HVE B;  4GTQ A;  3ZYM A;  3DSW A;  2JLB A;  4UWF A;  4YND A;  1NA3 A;  1O1R A;  5BNW A;  1MZC A;  4Y6C A;  4HRL A;  4J0U A;  5FQ6 A;  3C98 A;  4G11 A;  2XCC A;  4Z68 A;  3UM3 A;  3IKO B;  3CSF A;  1UG3 A;  1HG2 A;  3E32 A;  3FTZ A;  3ESL A;  5ENN A;  2QYU A;  5AYW D;  2UWJ G;  4U0S A;  3DSV A;  2LSV A;  4ILG A;  4GAA A;  3ZVV A;  3LY9 A;  4NQ0 A;  3LPZ A;  3LVQ E;  2OEV A;  2JAB A;  3SFX A;  4WNE A;  2C2L A;  1ZU2 A;  4GZ3 A;  3O48 A;  1INZ A;  4HLE A;  2QFC A;  1H2T C;  3EUV A;  1H0A A;  4EPZ A;  3LCA A;  3LKU A;  3ZYL A;  2P9P G;  4AJW A;  4GZ6 A;  4CT0 A;  4HOR A;  4GYO A;  5G04 J;  1WG0 A;  1EYH A;  3VLF A;  3C72 A;  2KBX A;  3QK0 A;  4RVB A;  3CVU A;  4UQY A;  3I3N A;  3TWU A;  1HZ4 A;  4CDN A;  3EHM A;  1LD8 A;  3Q4A B;  3SF4 A;  3TWX A;  4U04 A;  3CR3 A;  3RO2 A;  4FJZ A;  2IEJ A;  2P9U G;  4GA1 A;  4DPR A;  1OCO E;  4JHK A;  5EX0 A;  4ATZ D;  2GRN B;  3AU5 A;  3D9J A;  4HI8 A;  2AXU A;  5T3R A;  2FO7 A;  3TXM A;  3UKR G;  1YMP A;  1P5Q A;  3D9K A;  1LTX A;  4HVB A;  4K5C A;  3VTX A;  2NYJ A;  3DRA A;  4ANU A;  5HKP A;  1KZO A;  1HE8 A;  2J4D A;  4GA2 A;  3G2W A;  3K9I A;  2Y69 E;  4HOS A;  3B7U X;  4GYY A;  1MX2 A;  2RD0 A;  3CKC A;  1QQE A;  4EZL A;  3EHQ A;  3UT8 A;  2RKK A;  3FUM A;  4DX1 A;  4GTP A;  3DXM G;  5BW8 C;  5CMW A;  3QB2 A;  3R9A B;  4A63 B;  2C0L A;  2L0I A; 
#chains in the Genus database with same CATH homology
 2VQ2 A;  5D0Q D;  4OVU A;  1TJC A;  3ML9 A;  3OXL A;  5LX8 A;  5J08 A;  2WVI A;  4M3O A;  3G2V A;  3IEG A;  2BUG A;  5FQ8 A;  3SGH A;  1X5B A;  3U9W A;  3URZ A;  4AVX A;  3OXG A;  3FEY A;  2I9C A;  4WWN A;  5KJN A;  2CHW A;  3L6A A;  4ATG A;  1SQM A;  3BG1 B;  1H2U A;  2OOE A;  4JW1 A;  1GW6 A;  3LY8 A;  2VTB B;  3ASD A;  5ARG A;  4YVQ C;  2KCK A;  2MOW A;  1DNP A;  4YVO A;  2X6K A;  3CQG B;  3CK7 A;  4HFG A;  3CVV A;  3LYA A;  3HDX A;  3ONL A;  2NSZ A;  4JZY A;  1HF8 A;  1ZBP A;  2I6H A;  1UN9 A;  3APF A;  4JL0 A;  2HO1 A;  2XGM A;  3S7J A;  4A3V A;  3G2U A;  3RK6 A;  4F1S A;  1JUQ A;  5FTP A;  1BPO A;  3S2A A;  3S7F A;  4JXT A;  3VLE A;  3KAE A;  3CVQ A;  4FUL A;  3JYS A;  3WXX A;  1QNF A;  2XPZ A;  2YHC A;  2L9B A;  3U3W A;  3SFZ A;  2VSX E;  3D9P A;  3FTX A;  4FA6 A;  3RRN B;  2WXG A;  3FTY A;  4MLP A;  2KM4 A;  3QWW A;  2J07 A;  1NZN A;  3PH0 C;  5FWQ A;  5LFA A;  4XKC A;  2L6J A;  4QFV A;  3Q5M A;  4WNG A;  3CHO A;  4BT8 A;  1IYG A;  3U64 A;  3CIA A;  3KS2 A;  4UWL A;  4PS8 A;  2J4B A;  4KZC A;  4WWO A;  3FUK A;  4PDX A;  4N5C A;  1L5J A;  3JCK C;  4LER A;  3ZXS A;  2XQ0 A;  3I4G A;  5DIZ A;  2WPV A;  2IQC A;  5E75 A;  1WM5 A;  3TXN A;  4XI9 A;  3T5X A;  2CG3 A;  3B13 A;  1E96 B;  2IJG X;  3FUN A;  3ZPJ A;  5FZQ A;  3N71 A;  2IOL A;  4FU3 A;  5BUZ A;  2PZI A;  4G2V A;  4UWG A;  1MHQ A;  3R7Q A;  2MHK A;  3GYZ A;  5JJT A;  3CHS A;  5G2N A;  3ESK A;  1VDY A;  1EF1 C;  3FY4 A;  4XIF A;  4XZ4 A;  4FJY A;  3U4T A;  1NP7 A;  2GRL A;  3FUH A;  4P29 A;  4AY5 A;  2V4L A;  1IQR A;  2CHZ A;  2Q7F A;  4HXI A;  3SBS A;  3QKY A;  1OUV A;  3IHV A;  2WXM A;  2XPY A;  3CVW A;  4JC8 A;  1H6K A;  4DI4 A;  1OWM A;  3SHF A;  4D10 C;  3APC A;  2V8S E;  4I17 A;  3LXU X;  3I4R B;  4L1B A;  4JHR A;  2WM9 A;  3CV0 A;  3FEX A;  3UUX A;  4C9B B;  4CCA A;  2WQ6 A;  3FUJ A;  1Z3Y A;  3PEV B;  4DLQ A;  2V0P A;  3GW4 A;  3IV0 A;  4KMO A;  5C2Y A;  4B8A A;  5JHB A;  3RJV A;  4V3I A;  4F53 A;  4JPS A;  3ZEF A;  1IQU A;  3QC1 A;  3Q15 A;  2X6F A;  3OXF A;  4O6F A;  3DPD A;  4APO A;  2HM8 A;  3CGH A;  4AIF A;  3D9M A;  3MZL B;  4BTA A;  3CST A;  2OND A;  3VTY A;  3FTW A;  2VGY A;  5FQ7 A;  2WMO A;  2GGF A;  2FEZ A;  4G23 A;  2FBN A;  1H2V C;  2WXQ A;  4FC8 A;  4I9E A;  4U0U A;  2JEK A;  4CDM A;  2XEV A;  3FU6 A;  3MCX A;  5C1D A;  4ANX A;  1SZA A;  2R5S A;  1HG5 A;  4GML A;  4RSY A;  3CVL A;  3CVP A;  3UQ3 A;  3AS5 A;  3NF1 A;  5KJK A;  2EQX A;  4I1O B;  3KEZ A;  3ZN3 A;  3UT7 A;  1HO8 A;  2DBA A;  4ACL A;  4R7L A;  5EKQ D;  3TAX A;  4CRW A;  2WXN A;  4N2S A;  2VSO E;  3QAR A;  2PL2 A;  3Q49 B;  3PS6 A;  3PRE A;  5DBK A;  4E6H A;  3AS8 A;  1SZ9 A;  2LSU A;  4I6J A;  4J8F A;  4FHK A;  4NAC A;  5M72 A;  2KZT A;  4FLB A;  2LNI A;  4L7T A;  1UW4 B;  1OWL A;  2KC7 A;  3B7T A;  3Q47 B;  5FZR A;  3FTS A;  4CGV A;  3RRM B;  2OV8 A;  2LO6 A;  5ANL A;  3G2T A;  4B0Z A;  2UY1 B;  4JA9 A;  3ASG A;  2A4Z A;  2WQ7 A;  3B7R L;  4K03 A;  4UWK A;  2PQN A;  3FUF A;  3GZ2 A;  4HS2 A;  2C0M A;  3QWV A;  3MKR A;  5BV1 A;  3CVX A;  4I6G A;  4I43 A;  2KCV A;  5LCW C;  2XRY A;  4OYS A;  4Q96 A;  3TJP A;  3CVN A;  4L2Y A;  2IFU A;  3MA5 A;  2Y4T A;  3LEW A;  4ME2 A;  2R59 A;  4C0E A;  1JWF A;  4W9R A;  4G24 A;  3D3M A;  3FH5 A;  5D0O D;  3GZ1 A;  5CHE E;  4TRQ A;  3PUK A;  2YQ8 A;  3L22 A;  1JWG A;  1YA0 A;  2CG2 A;  3L13 A;  3ASF A;  4GZ5 A;  4GMJ A;  4MRU A;  2Y3A A;  4B89 A;  4I9C A;  2E0I A;  4L2L A;  4MS6 A;  4G25 A;  1TJF A;  4A3T A;  1HFA A;  5G04 C;  2VTB A;  4ANV A;  5E76 A;  2I1K A;  3QJZ A;  4BT9 A;  3PUJ A;  2BF0 X;  4BX9 A;  2WXP A;  1PC2 A;  3ML8 A;  5LCW J;  4GZD A;  3HYM B;  2XCB A;  2WXF A;  3ASH A;  2ZU6 B;  3AU4 A;  4PUC A;  1Z6T A;  3ZHE B;  1HU3 A;  4KT6 B;  3QOU A;  3HVE A;  2VSY A;  4K0R A;  4C0M A;  4DJA A;  4LUN U;  5CCL A;  1E8W A;  3KD7 A;  2X6H A;  3CK8 A;  2RG8 A;  4N3C A;  3EIQ C;  2AWI A;  3DBS A;  4JVS A;  2UY1 A;  1UJK A;  3CLJ A;  5A7D B;  3R7R A;  5KJL A;  1W3B A;  3TG4 A;  3FU0 A;  4KVM A;  3UT4 A;  2IU1 A;  3L54 A;  4AEZ C;  3TG5 A;  4B94 A;  1PY1 A;  1OWP A;  3SNX A;  3MGB A;  2YIN A;  4KVO A;  5G55 A;  3ZW3 A;  4WUY A;  4AY6 A;  1Y6I A;  4I2Z A;  4CDR A;  4XE0 A;  1N54 A;  4ILH B;  4EBA G;  4N3A A;  3QAQ A;  2E2E A;  4F7A A;  3FU3 A;  2HR2 A;  5EDS A;  3GZS A;  2VGX B;  2MRI A;  5FZS A;  4UQZ A;  1HS6 A;  3JQ0 A;  2L0T B;  4UWH A;  4UI9 J;  1B89 A;  2PQR A;  2VJ8 A;  2DCP A;  3MV2 B;  3LY7 A;  2WQH A;  3PNT B;  5T4Y A;  2LAH A;  4DK5 A;  2PM6 A;  2HYZ A;  4UI9 K;  4WWP A;  3HVE B;  4A55 A;  2WB2 A;  1KT1 A;  1N52 A;  3O4Z A;  4BSX A;  2X6J A;  3U66 A;  3ZYM A;  1QZ2 A;  3MKQ B;  2A5U A;  4AOF A;  2JLB A;  4UWF A;  4EQF A;  1FCH A;  4BTB A;  3T5V A;  4YND A;  1NA3 A;  3FUE A;  2IOS A;  3EDT B;  3FP3 A;  2GRM A;  4AV7 A;  1UN8 A;  5BNW A;  4CT4 A;  2X3M A;  2R17 C;  4KXK B;  4EBA A;  1U3C A;  2XRZ A;  3MV3 B;  2V5F A;  4GPK A;  4CGW A;  4Y6C A;  1EDU A;  3TL5 A;  3PVL A;  1E8Y A;  2QY7 A;  3PZD A;  4J0U A;  5FQ6 A;  5FT9 A;  3C98 A;  1DVP A;  4G11 A;  2XCC A;  4WAF A;  3RU0 A;  4KZ0 A;  3MKQ A;  2PM7 A;  4CEM A;  4ILI A;  4JHJ A;  1KLX A;  3IKO B;  3CSF A;  1UG3 A;  3CK9 A;  4J8D A;  3FHE A;  1HG2 A;  4JEU A;  3UMV A;  3CKB A;  3HHM A;  3QNK A;  5FQ4 A;  3CQC B;  4FHJ A;  3FTZ A;  4EZJ A;  3ENE A;  3ESL A;  5ARF A;  4BFR A;  5ENN A;  1Z3X A;  1EPU A;  2YHE A;  3I5P A;  4PS7 A;  1UJJ A;  3TGO A;  4WNF A;  2OVF A;  4MKT A;  5AYW D;  2WXL A;  2VGX A;  5JJ7 A;  2UWJ G;  4OVV A;  2WXK A;  4U0S A;  3MEK A;  1E7U A;  2AXV A;  4FAD A;  1U3D A;  4WND A;  4KBQ A;  4B8C B;  3RRU A;  2LSV A;  4F3V A;  4A1G A;  2KCL A;  1E90 A;  4Q69 A;  3L16 A;  4ILG A;  1MQS A;  1OWN A;  4GAA A;  3ZVV A;  4U8H A;  3UX4 A;  1HX8 A;  3LY9 A;  5AIJ A;  4NQ0 A;  3LPZ A;  3FH7 A;  4AM9 A;  3LVQ E;  4N39 A;  4EEC A;  5T8I A;  3EJN A;  3ZIM A;  3FUD A;  2KZT B;  3EHN A;  4IUL A;  2VYI A;  1HH8 A;  4WNE A;  1WAO 1;  1FVH A;  2C2L A;  4BX8 A;  3FWV A;  3FTV A;  2WXJ A;  1ZU2 A;  1XGW A;  5AEN A;  1WY6 A;  4GZ3 A;  3O48 A;  1INZ A;  4HLE A;  2QFC A;  2X38 A;  3NQP A;  4UQX A;  3ZRH A;  1H2T C;  4GZC A;  1JPL A;  2WXH A;  2AVP A;  2ION A;  2WMN A;  1H0A A;  4PH4 B;  1LF8 A;  4EPZ A;  2X6I A;  3LCA A;  4U63 A;  4J8E A;  4J6I A;  1XNF A;  3LKU A;  1E8Z A;  5AJD A;  3ZFW A;  4ANW A;  3PE3 A;  4FLH A;  1OWO A;  3ZYL A;  4AXH A;  4JA7 A;  4XKB A;  3APD A;  5CMY A;  3S7B A;  4AJW A;  4GU5 A;  4LEU A;  3RIB A;  4RG6 A;  2LAI A;  4GZ6 A;  2FI7 A;  5FJY A;  4CT0 A;  2M63 A;  2J08 A;  3IHY A;  4HOR A;  4TUU A;  3ULQ A;  3IBE A;  5JJ6 A;  4G1T A;  2KAT A;  3EIJ A;  1S0P A;  3P1U A;  4GYO A;  3SI5 A;  5G04 J;  3BEE A;  3S7D A;  4IYP A;  3QDN A;  2ILR A;  3ONK A;  4Q94 A;  4XI0 A;  1TEZ A;  1EYH A;  3B7S A;  3SBT B;  3VLF A;  3PNL B;  2YNQ A;  3PEU B;  1A17 A;  3T8M A;  3QK0 A;  1ELW A;  5ANR A;  2CHX A;  4GCO A;  4EZK A;  4RVB A;  3JUI A;  3NZS A;  3CHQ A;  4N2Q A;  4IN3 B;  2WXI A;  5LP0 A;  3CVU A;  4XX5 A;  4U07 A;  3UPV A;  3CHM A;  4UQY A;  4HOT A;  3ZYK A;  3I3N A;  1IHG A;  2GW1 A;  3JQ1 A;  4GA0 A;  2WXO A;  1FVF A;  3CHR A;  1E7V A;  3ZGQ A;  2OVB A;  2XGS A;  4BWR A;  3MYV A;  4GCN A;  4GYW A;  4J8S A;  5HI7 A;  3LVR E;  5KJM A;  1HZ4 A;  2VSN A;  3EHM A;  3Q4A B;  4GB9 A;  4H7Y A;  4CDN A;  4I6E A;  4URK A;  1E8X A;  3SF4 A;  3HIZ A;  4LRZ A;  2J9Q A;  3OAW A;  3CVY A;  3RKV A;  3FDH A;  4U04 A;  3FTU A;  3CR3 A;  2XGO A;  4NUR A;  2CFZ A;  4LCT A;  5CCM A;  2P58 C;  5LOZ A;  3OTN A;  5KCM A;  3RO2 A;  4FJZ A;  3CEQ A;  4AP2 A;  2IF4 A;  4IRU A;  3SD5 A;  2FF4 A;  4GA1 A;  5G05 C;  1KT0 A;  4JEH A;  4BY6 A;  4DPR A;  5BPP A;  1ELR A;  3PDN A;  4KYO B;  5BT1 A;  5BV0 A;  2XHE A;  4N3B A;  2I2O A;  3AS4 A;  5A6C A;  4HOQ A;  3P2B A;  4I2W A;  3NZU A;  4JHK A;  5EX0 A;  3LS8 A;  4ABN A;  2AW6 A;  3CHP A;  3D9O A;  2I1J A;  4RG9 A;  3AU5 A;  4G26 A;  2J09 A;  3D9J A;  5G05 J;  3MX3 A;  5AJL A;  2AXU A;  5T3R A;  3LJ3 A;  2FO7 A;  3ZHE A;  3TXM A;  4APF A;  3VLD A;  4TV3 A;  3L08 A;  1P5Q A;  3D9K A;  3D9L A;  3L17 A;  4HVB A;  2Y4U A;  4I1A A;  3VTX A;  2FUL A;  2NC9 A;  1Y8M A;  3D9I A;  3MJW A;  3QWP A;  4U0Z A;  4ANU A;  2J49 A;  3G2S A;  3E4B A;  3PE4 A;  4L23 A;  4ACK A;  4HOU A;  1ELK A;  5A23 A;  3FFL A;  2XPI A;  1HE8 A;  2J4D A;  3LDZ A;  4GA2 A;  2DIW A;  2AXZ A;  1PAQ A;  4UI9 C;  3G2W A;  3FU5 A;  3K9I A;  4A1S A;  2WXR A;  3SZ7 A;  4DI3 A;  2NXP A;  4HOS A;  3B7U X;  4Y6W A;  4FP7 A;  4GYY A;  3RO3 A;  5J90 A;  1H19 A;  1HXI A;  2RD0 A;  4NRH B;  3FH8 A;  3CKC A;  1QQE A;  3FUL A;  3ZYQ A;  4I1M A;  4EZL A;  3BG0 B;  2CFU A;  1NA0 A;  5JHA A;  4PS3 A;  3UT8 A;  3D9N A;  3FUM A;  5EX3 A;  5HQ8 A;  5BW8 C;  2BTD A;  3FUI A;  5CMW A;  3QB2 A;  3R9A B;  4E85 A;  4DLO A;  2C0L A;  3PRZ A;  4H7X A;  2L0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...