1N4QA

Protein geranylgeranyltransferase type-i complexed with a ggpp analog and a kkksktkcvil peptide
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Structure of mammalian protein geranylgeranyltransferase type-I
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 124
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n4qA00
1KZOA 1TNYA 1TN7A 2IEJA 3DRAA 3SFXA 2F0YA 2BEDA 1TN8A 4GTPA 4YDOA 3E34A 3DPYA 3PZ3A 1QBQA 1N4PA 3HXDA 1O1SA 2H6GA 4GTTA 3EU5A 4GTMA 3E32A 3HXCA 1SA5A 4GTVA 1D8DA 1JCSA 3Q7AA 2R2LA 3PZ1A 4GTRA 1N4QA 3DSWA 1O5MA 1S63A 1X81A 1TNBA 1D8EA 1KZPA 3Q79A 4GTSA 3EUVA 3PZ2A 1TN6A 1NI1A 3KSQA 1S64A 3DSXA 4GTOA 3DSTA 1O1TA 1DCEA 1FPPA 1TNUA 4LNBA 1JCQA 2H6IA 1FT2A 1JCRA 1N9AA 3DSSA 3E30A 1FT1A 1SA4A 3Q73A 4YDEA 1NL4A 3HXEA 4EHMA 3C72A 3HXFA 2ZISA 3E37A 2ZIRA 4LNGA 1N94A 1N4SA 3DSVA 4MBGA 2H6FA 1LD7A 3KSLA 1N95A 1TNOA 2H6HA 1MZCA 3Q75A 1LTXA 1TNZA 1O1RA 3HXBA 3SFYA 3Q7FA 1LD8A 3Q78A 1N4RA 4L9PA 3E33A 3PZ4A 4GTQA 3DSUA
chains in the Genus database with same CATH superfamily
3HG0D 4CZ2D 2B6CA 3NAWA 2HE0A 3ZYKA 4CCAA 2XPZA 2WXFA 4A3VA 4I6EA 3ZYMA 3CKCA 4HVBA 1L5JA 3SNXA 3APDA 1D8EA 3R9MA 3IKOB 1MHQA 1JUQA 3FTXA 5CHEE 4AVXA 4IULA 4WNGA 4JC8A 4PS7A 2A4ZA 4LCTA 1DCEA 3FTSA 3QNKA 3DEPA 1UN8A 4MS6A 3CK9A 3UM0A 2LAIA 4DLOA 5CRVA 2ZISA 2LSVA 2CG2A 4MKTA 3V30A 4HXIA 3TWTA 4MBGA 2WXIA 4LEUA 3S7FA 1HH8A 1TR4A 3L6AA 5BNWA 5BV0A 3ZFWA 3MKRA 3KEAA 2C0LA 5AAOA 2IQCA 4C0MA 4AM9A 4DX6D 1MX2A 3FU3A 5AJLA 2YQ8A 3OXFA 4UQZA 3QKYA 5ENQD 4BWRA 2L6JA 2X6JA 3E34A 1QBQA 3SZ7A 3LDZA 4YVQC 1E90A 2P9SG 2QYUA 4UI9K 3ISMC 4UQXA 3RRNB 5HS0A 3MA5A 3JXJA 4I2ZA 3PDNA 3QAQA 3L22A 1WY6A 1EDUA 2CHZA 4ANWA 1Z6TA 4I1AA 3PNLB 4GCOA 2XEHA 2OOEA 2GW1A 1YCSB 1V54E 2H6IA 5ENTD 4AY6A 3PUJA 3TJPA 3NZUA 1MJ0A 1H19A 1E7UA 4J6IA 2KBXA 5HRYA 2LXMA 2XRYA 2XEEA 3E37A 1A5EA 1N4SA 3DSVA 3AS5A 3ONKA 3EHRA 3IEGA 5G05J 1N95A 5J90A 3Q47B 3LVRE 2OV8A 2AXZA 2J07A 2WXKA 3D9NA 3Q7FA 2I2OA 1UG3A 3B7RL 5JJ7A 2DCPA 2WXRA 1HU3A 2P9KG 2NXPA 3CQGB 1KZOA 3V79K 1RZ4A 3CVUA 4UI9J 5EILA 1IXVA 5KJLA 2EQXA 1KT1A 2R02A 5CCMA 2HR2A 5CECB 4LRZA 1IYGA 5G2NA 3RRMB 2AWIA 3RK6A 3BQOA 1SA5A 2DYSE 2P9UG 4TUMA 4KBQA 3PUKA 4U95D 2VYIA 2KM4A 5D0QD 4FLHA 4FHJA 2NC9A 3SI5A 1X81A 1GW6A 2WM9A 3OXLA 3ZIMA 3TL5A 3CHPA 3PZ2A 2XGMA 2IJGX 1O1TA 2ILRA 3HVEA 3UMVA 2VGEA 4RQIA 5CMYA 3Q4AB 4B94A 2DZOA 2WXOA 2VGXA 5ENOD 2IO2C 2RKKA 3TXMA 3PNTB 4G8LA 4ILHB 4A1GA 3FP3A 2EIKE 3SHFA 4FJYA 4HI9A 2E2EA 4ANVA 1LD7A 4BERA 2C0MA 4EBAG 3G2VA 2OCCE 2WB2A 1U3DA 5BXUA 4BEPA 4DK5A 2CG3A 3PREA 1Q2ZA 3U9WA 4MLPA 3CGHA 1N52A 5CEAA 1E8WA 3ZEFA 2V0PA 2PL2A 2XGSA 1KLXA 3L17A 5CBNA 4GTPA 4YDOA 1QQEA 4K5CA 4YDYA 1N4PA 2KCVA 1HE8A 4NACA 3B95A 3EU5A 4BESA 3L13A 2ETAA 1JPLA 4XE0A 1K3ZD 2JLBA 4XIFA 1JWGA 4HOUA 4CT0A 3R7QA 4WNEA 1HG5A 3ESKA 3QWVA 3B13A 1EYHA 4U8HA 2XS8A 4U07A 3D9OA 3AS8A 2VTBB 4WWNA 1JCQA 1NFIE 3AJIA 3CHMA 2DWZA 4P29A 2YHEA 1N9AA 1FT1A 3U66A 3ABME 1K8KG 5AQ7A 3LS8A 2Q7FA 2FF4A 5FZSA 2EIME 1OXJA 2CHWA 5BPPA 3D9LA 3FH5A 3X2QE 2WPVA 4DI3A 2H6FA 3CIAA 2CFZA 3RKVA 2A5UA 3E4BA 1BLXB 4BT9A 5KWDA 3PVLA 2IU1A 2WXQA 4TXRA 2UY1B 1LTXA 3O4ZA 4B89A 4JHRA 5LX8A 4U0ZA 1BU9A 4GZ6A 4HB5A 1NA3A 3FY4A 4EQFA 3FEYA 3LY9A 2XPIA 3I4RB 4F3VA 2KCKA 4E85A 4ILGA 3ML9A 2BEDA 3D9PA 4N5CA 4EPZA 3ULQA 1WM5A 2ZGDA 5JMND 3FTYA 2AXUA 4GPKA 4UQYA 4JEHA 2XZTG 1D8DA 3LVQE 4J8FA 3MJWA 4JHJA 2VJ8A 4GB9A 3FH8A 1QNFA 4HBDA 3PS6A 2R17C 4NIKA 2AXVA 3NOGD 2X38A 2L6BA 4A63B 5LCWC 1S64A 4J8YA 3CVVA 1MYOA 3ML8A 2WQ7A 4UWLA 3AAAC 2P9LG 3DSSA 5BXOA 4AEZC 1SVXA 4ATGA 3HXEA 3MEKA 4I2WA 5CRUA 3EJNA 2KXPC 4BETA 3P1UA 1EF1C 2F37A 3CHOA 3FTWA 5T8IA 2ZIRA 1N94A 4FULA 3PRZA 2HO1A 2H6HA 2WQ6A 4PDXA 2FO7A 2PM6A 4TRQA 3AU4A 3TXNA 1N54A 3C3OA 2QC9A 3DPDA 3VTYA 3CK7A 3UXGA 1S70B 4GMLA 4I1MA 1IKND 3AS4A 4CDNA 4J8SA 3CVXA 4BY6A 1MX6A 3PEUB 1IHBA 1BD8A 4EZJA 4GYYA 4ANUA 3CHRA 5C1DA 2OVBA 4L2YA 1HO8A 3MV2B 3OTNA 3LJNA 5EN5D 5JHAA 3VTXA 1JCSA 4XI0A 3ONLA 2M63A 3EHMA 4J8DA 3FTVA 4GZ3A 4LSZE 3L08A 3TWXA 3CSFA 4PUCA 3EUVA 3ASNE 1P5QA 3LY8A 4KT6B 4LERA 3BU8A 4I6GA 2VTBA 3J5QB 3TWUA 3HRAA 3UQ3A 3QWPA 3JQ1A 4G24A 3TWQA 4CEMA 3T5XA 5BV1A 3EHQA 3CVWA 4A1SA 5CERB 3HVEB 3C3QA 3APFA 4CDRA 2ONDA 3UT4A 3UINC 2VGXB 2KCLA 2QY7A 2UY1A 3UKUG 4ME2A 3Q78A 1N4RA 4G8KA 4L9PA 3RAUA 1OY3D 3ULYA 1NZNA 3L16A 3CHQA 3EIJA 3EDTB 5G04C 5D2MC 2XHEA 3T8MA 3AU5A 5FZRA 3QOUA 3HXDA 2KC7A 1H6PA 2GRQB 4LG6A 2XGOA 2DVWA 2Y4UA 3ZVVA 2GRPB 3BUAA 2EIJE 3URZA 3PH0C 5B1AE 2F8YA 3W9FA 4EECA 3UT7A 3G2TA 2R05A 4ZFHA 3SGHA 3IV0A 4ILIA 2NSZA 3NB2A 2YINA 3L9TA 4PH4B 2BF0X 4U8VD 3DSTA 2I9CA 2L9BA 4BSZB 4HS2A 2MRIA 3QWWA 1X5BA 1TJFA 4RLYA 4URKA 2CHXA 3QDNA 3DEOA 5AQ9A 4BT8A 5ENPD 1OWPA 4GU5A 4KMOA 4I43A 4HLEA 4Q69A 1YMPA 3FULA 2V5FA 4F53A 2LO6A 3JCKC 1HXIA 2RD0A 5KNGA 3FUEA 2PZIA 4CGVA 4J0UA 4M7CA 1W3BA 3SQVA 4M3OA 5M72A 3ZNGA 1ZU2A 1OUVA 5AQBA 4U0SA 2R59A 1PY1A 2Y3AA 2UWJG 3SD5A 4Q96A 3UPVA 3ZRHA 2J09A 2F0YA 3UM1A 3FUFA 4O6FA 3FTZA 4KVOA 4FC8A 2DZNA 3I3NA 3QJZA 3W9GA 2H6GA 4B93B 3E32A 4F6RD 4GA1A 1MX4A 4FJZA 3CVLA 3FU0A 5EKQD 4ACKA 4OAUC 1A17A 2YHCA 3LPZA 4TUUA 1HF8A 3Q5MA 4JB8P 3ULEG 4J8EA 3ZHEA 3DSXA 4HRMB 4CRWA 5BT1A 1OWMA 4F1SA 5AYWD 4B8CB 1DVPA 4AV7A 4UWFA 3AG2E 1E7VA 4EZKA 3NF1A 4C48B 4L1BA 2B0OE 1SW6A 1U3CA 3CR3A 2HM8A 3CQCB 3ENEA 2ETBA 1V55E 5LFAA 5AENA 3C5RA 2OEWA 1OWOA 4U96D 1TYQG 3TWVA 3U3WA 2VGYA 4B0ZA 2IO3C 3QARA 3JUIA 1TNYA 2MOWA 5BW8C 2IEJA 3DRAA 2Y4TA 2FULA 3V31A 5LCWJ 4U7EB 5ENNA 3HHMA 2QFCA 2XS1A 1HX8A 4GTMA 2IONA 4WWOA 1UW4B 2PNNA 4JA7A 3S7DA 4APFA 1UJKA 4GZCA 4D10C 4I17A 5FZQA 4DPRA 1N11A 5CBOA 5LP0A 1WDYA 5KJNA 3CLJA 1N0RA 4BX8A 2FI7A 4KYOB 4RVBA 2VSNA 3KSQA 4ACLA 1TNUA 1WAO1 3IBEA 3Q9UC 3UX4A 3BG1B 4IN3B 3MKQA 2WXJA 3ZGQA 3D9IA 2ZU6B 4IYPA 4NURA 1E96B 4HOQA 4U0UA 2EINE 4YDEA 3HDXA 4KVMA 3RRUA 3B7TA 3C72A 2LAHA 3HXFA 2XCCA 2FBNA 2JEKA 3LYAA 2VSXE 3NBNB 3ZYQA 4JZYA 3Q15A 4GZDA 5FINA 3APCA 2WMOA 3KSLA 5JJTA 5FQ8A 3DXMG 4DX1A 5B1BE 4FADA 2R03A 4C0EA 4I9CA 2PM7A 2PQNA 3OAWA 3TWRA 3DSUA 1ZBPA 3EHNA 5FT9A 3UTMA 1MQSA 4DX5D 5H7PA 3VLFA 3SFXA 4JL0A 3CSTA 2P9PG 2RG8A 1HG2A 3DPYA 4E6HA 4DX7D 3V2XA 4HI8A 2VQ2A 3S7JA 1NA0A 3EU9A 4WUYA 5HQ8A 2V5QC 2WMNA 2J9QA 1EPUA 3QK0A 3FUKA 4GZ5A 3K9IA 2I1KA 1OWNA 3UKRG 4O1OA 4UWGA 1JWFA 5FQ6A 5E76A 4L7TA 1NP7A 4L23A 4JHKA 4K03A 1E8YA 3KEZA 3TAXA 5ANLA 3MGBA 1BI8B 2KZTB 4N3AA 2AJAA 4APOA 3UUXA 3SO8A 4GAAA 2LXLA 5G04J 4GA0A 4PS8A 2QZAA 3FFLA 4FP7A 4AXHA 4J7WA 1E8ZA 5G55A 4N39A 4NQ0A 5AIJA 1KPSB 4G26A 2EILE 2GGFA 1LD8A 3FDHA 1SZAA 3R7RA 3MCXA 3Q49B 3RO3A 5EYPF 4AIFA 2MYOA 4G25A 3ASDA 2GRRB 3HYMB 4N3CA 4V3IA 2XZDG 2R5SA 1OCOE 4XKBA 3QB2A 4JD2G 1B89A 3J5PA 1YYHA 1RW2A 1U2VG 2XEVA 3T9KA 4OVVA 3P2BA 5CMWA 4TXQA 1BI7B 3GW4A 1N4QA 3ESLA 3FUJA 3CKBA 4PS3A 2VSYA 1OCCE 4TV3A 4B8AA 3Q79A 4FLBA 4GA2A 3PE3A 3DWLG 5EDSA 1TN6A 2XRZA 1DC2A 4U04A 3U4TA 3JXIA 4CGWA 3UIOC 5CEDB 3V2OA 5B3SE 1H2UA 2WXNA 4G1TA 3E30A 1K1AA 2BUGA 5A7DB 1HFAA 3TWSA 2V8SE 1FCHA 3TG4A 4AY5A 2GROB 3GYZA 4X8QA 3ZHEB 4WWPA 3D3MA 3T5VA 4OVUA 4GYOA 1MZCA 2IFUA 3LJ3A 2WXGA 1XGWA 3Q9NC 2FO1E 4HRNA 3D9KA 1H2VC 2ZXWE 2WXMA 2BTDA 3FUHA 4HORA 3RO2A 4YDWA 1OCZE 4OAVB 1TN7A 1S0PA 3AG3E 5AJDA 4CT4A 3ZKJA 2PQRA 4OYSA 3UT8A 2RFMA 3SFZA 4H7YA 1FVFA 4O1PA 2OVFA 2IF4A 4GTTA 4K0RA 2JABA 3I5PA 4GTVA 2WXLA 1O5MA 4ZHBA 4RG9A 3CEQA 2X6KA 1H2TC 1Y6IA 5FIOA 1KZPA 4EZLA 3OXGA 3D9JA 3VLDA 3FUIA 2E0IA 3AG1E 4Y6CA 2Y0BG 3FEXA 2L0IA 3R9AB 1Z3XA 1NI1A 3C3RA 3LEWA 4HFGA 4N2QA 4G2VA 2J4BA 4I9EA 5EIBE 2BKGA 4HNAD 4YVOA 2P9NG 4KXKB 2X6HA 4MRUA 3PZDA 1JCRA 4GMJA 2KZTA 1PAQA 5KJMA 2WQHA 4UUCA 4GPMA 4GMRA 2V4HC 4YNDA 3MKQB 3BG0B 3LCAA 1OWLA 4GYWA 1TNZA 4DJAA 3EIQC 5C2YA 2XCBA 5ITZF 3IHVA 5ENRD 3WG7E 2LUHA 1H6OA 3LXUX 2J08A 3IXEA 4JEUA 3G2WA 3UM2A 4BFRA 1HS6A 2ETCA 4F1PA 5T4YA 4DUIA 3UM3A 3LKUA 5EX3A 3GZSA 5J08A 4BX9A 3JQ0A 3MX3A 1TNBA 2WXPA 3ASHA 2CFUA 5LOZA 5ARFA 1N0QA 3ZXSA 2GRMA 3ASFA 5FQ7A 4I1OB 3RIBA 3KAEA 2I6HA 4DRXE 5JA4D 4JPSA 4WAFA 1FT2A 4FU3A 5EX0A 3PEVB 4BSXA 3ZU7B 4N3BA 1IQUA 4EBAA 1UOHA 3NQPA 1HZ4A 1TEZA 5HKPA 3ZN3A 2P2CP 3CVQA 1IQRA 4K5BA 3SFYA 1Z3YA 1OCRE 4O60A 3FUMA 3I4GA 4XX5A 5IY5E 1TJCA 5DBKA 5KBAA 1K1BA 2I1JA 4UWHA 4RG6A 4WNFA 3GZ2A 2FEZA 5HI7A 1LF8A 5T3RA 3ASOE 5ARGA 4R7LA 3FHEA 4XI9A 5FQ4A 3ZUVB 1UN9A 2IOSA 2X3MA 3D9MA 2WXHA 1QZ2A 3G2SA 3N71A 4XKCA 3B7BA 4A55A 4HRLA 3JYSA 4WNDA 3Q7AA 4GTRA 3ZXPA 1OT8A 4CYMD 4CDMA 2Y69E 1S63A 3RSEG 3FUDA 4KZ0A 4NRHB 4W9RA 5ANRA 2IY0C 4GCNA 1H0AA 2OEVA 2X6IA 4N2SA 4H7XA 3CVNA 3BEEA 3FTUA 4JVSA 4BTAA 3PE4A 4KZCA 3CVYA 4HOTA 1YA0A 2XENA 3B7UX 1SA4A 3B7SA 4G23A 3MZLB 2Y1LE 3QC1A 4N5QA 2VSOE 4F7AA 2DIWA 5JJ6A 1AWCB 3G2UA 1O1RA 3S7BA 2P9IG 3IHYA 4HQDA 4TXPA 3MYVA 1XNFA 3TGOA 2ZGGA 5FWQA 3UIPC 4DI4A 3ZPJA 4JXTA 3F6QA 3PZ3A 4DLQA 1Z5SC 5A23A 1O1SA 2HYZA 4A3TA 3HIZA 5G05C 1ELKA 5D0OD 3ZW3A 3VLEA 3HXCA 1IHGA 5FTPA 2DYRE 2R2LA 3PZ1A 3CV0A 5EYLA 3KS2A 2RFAA 2LSUA 3C98A 2L0TB 5EIDA 3U64A 4QQIA 3RJVA 3GZ1A 2DBAA 4XZ4A 4Z68A 5DIZA 3TG5A 4C9BB 2IOLA 4UI9C 3T8KA 1BPOA 1G3NB 4LUNU 4L2LA 3CK8A 4LNBA 1FPPA 4K5AB 4ABNA 2AVPA 1FVHA 3JUEA 4HLLA 3Q73A 2BKKB 4I6JA 1NL4A 3AG4E 5E75A 4EHMA 4HOSA 4JW1A 3O48A 4RSYA 3ASGA 3DXKG 2J49A 3FH7A 2C2LA 2P58C 2MHKA 1QYMA 1WG0A 4XEIG 3RU0A 3L54A 3HXBA 1VDYA 2F8XK 3E33A 3ABLE 2KATA 4AP2A 4GTQA 5A6CA 1AP7A 3TWWA 4JA9A 3NOCD 4DX2A 4FA6A 3LY7A 3UI2A 3FWVA 3KD7A 1H6KA 1PC2A 4Y6WA 3S2AA 4AJWA 3SBTB 1TN8A 1ELWA 5BUZA 3DBSA 2XQ0A 3SF4A 3CVPA 2GRNB 2YNQA 3CHSA 1UJJA 4AOFA 3DSWA 5KCMA 3FUNA 5FJYA 2GRLA 2J8SD 4GTSA 5AARA 2A5EA 1E8XA 4U8YD 4UWKA 2X6FA 4IRUA 1D9SA 2XPYA 3L82A 2LNIA 1KT0A 1SQMA 4GTOA 3SY2A 3NZSA 2WVIA 5AN8A 1DNPA 3FU6A 1SZ9A 5KJKA 3SBSA 4QFVA 4ANXA 3D9HA 4BTBA 5KNHD 4ATZD 4U63A 4LNUD 2AW6A 5D66A 3ZYLA 3FU5A 4LNGA 5JHBA 3WXXA 1ZB1A 4FHKA 4Q94A 1Y8MA 1DCQA 1TNOA 4G11A 2V4LA 3Q75A 2QYJA 2NYJA 3PZ4A 3ABKE 5CCLA 5AQAA 5ENSD 1ELRA 1INZA 2J4DA 3MV3B
chains in the Genus database with same CATH topology
1KZOA 1TNYA 1TN7A 2IEJA 3DRAA 3SFXA 2F0YA 2BEDA 1TN8A 4GTPA 4YDOA 3E34A 3DPYA 3PZ3A 1QBQA 1N4PA 3HXDA 1O1SA 2H6GA 4GTTA 3EU5A 4GTMA 3E32A 3HXCA 1SA5A 4GTVA 1D8DA 1JCSA 3Q7AA 2R2LA 3PZ1A 4GTRA 1N4QA 3DSWA 1O5MA 1S63A 1X81A 1TNBA 1D8EA 1KZPA 3Q79A 4GTSA 3EUVA 3PZ2A 1TN6A 1NI1A 3KSQA 1S64A 3DSXA 4GTOA 3DSTA 1O1TA 1DCEA 1FPPA 1TNUA 4LNBA 1JCQA 2H6IA 1FT2A 1JCRA 1N9AA 3DSSA 3E30A 1FT1A 1SA4A 3Q73A 4YDEA 1NL4A 3HXEA 4EHMA 3C72A 3HXFA 2ZISA 3E37A 2ZIRA 4LNGA 1N94A 1N4SA 3DSVA 4MBGA 2H6FA 1LD7A 3KSLA 1N95A 1TNOA 2H6HA 1MZCA 3Q75A 1LTXA 1TNZA 1O1RA 3HXBA 3SFYA 3Q7FA 1LD8A 3Q78A 1N4RA 4L9PA 3E33A 3PZ4A 4GTQA 3DSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZO A;  1TNY A;  1TN7 A;  2IEJ A;  3DRA A;  3SFX A;  2F0Y A;  2BED A;  1TN8 A;  4GTP A;  4YDO A;  3E34 A;  3DPY A;  3PZ3 A;  1QBQ A;  1N4P A;  3HXD A;  1O1S A;  2H6G A;  4GTT A;  3EU5 A;  4GTM A;  3E32 A;  3HXC A;  1SA5 A;  4GTV A;  1D8D A;  1JCS A;  3Q7A A;  2R2L A;  3PZ1 A;  4GTR A;  1N4Q A;  3DSW A;  1O5M A;  1S63 A;  1X81 A;  1TNB A;  1D8E A;  1KZP A;  3Q79 A;  4GTS A;  3EUV A;  3PZ2 A;  1TN6 A;  1NI1 A;  3KSQ A;  1S64 A;  3DSX A;  4GTO A;  3DST A;  1O1T A;  1DCE A;  1FPP A;  1TNU A;  4LNB A;  1JCQ A;  2H6I A;  1FT2 A;  1JCR A;  1N9A A;  3DSS A;  3E30 A;  1FT1 A;  1SA4 A;  3Q73 A;  4YDE A;  1NL4 A;  3HXE A;  4EHM A;  3C72 A;  3HXF A;  2ZIS A;  3E37 A;  2ZIR A;  4LNG A;  1N94 A;  1N4S A;  3DSV A;  4MBG A;  2H6F A;  1LD7 A;  3KSL A;  1N95 A;  1TNO A;  2H6H A;  1MZC A;  3Q75 A;  1LTX A;  1TNZ A;  1O1R A;  3HXB A;  3SFY A;  3Q7F A;  1LD8 A;  3Q78 A;  1N4R A;  4L9P A;  3E33 A;  3PZ4 A;  4GTQ A;  3DSU A; 
#chains in the Genus database with same CATH topology
 3HG0 D;  4CZ2 D;  2B6C A;  3NAW A;  2HE0 A;  3ZYK A;  4CCA A;  2XPZ A;  2WXF A;  4A3V A;  4I6E A;  3ZYM A;  3CKC A;  4HVB A;  1L5J A;  3SNX A;  3APD A;  1D8E A;  3R9M A;  3IKO B;  1MHQ A;  1JUQ A;  3FTX A;  5CHE E;  4AVX A;  4IUL A;  4WNG A;  4JC8 A;  4PS7 A;  2A4Z A;  4LCT A;  1DCE A;  3FTS A;  3QNK A;  3DEP A;  1UN8 A;  4MS6 A;  3CK9 A;  3UM0 A;  2LAI A;  4DLO A;  5CRV A;  2ZIS A;  2LSV A;  2CG2 A;  4MKT A;  3V30 A;  4HXI A;  3TWT A;  4MBG A;  2WXI A;  4LEU A;  3S7F A;  1HH8 A;  1TR4 A;  3L6A A;  5BNW A;  5BV0 A;  3ZFW A;  3MKR A;  3KEA A;  2C0L A;  5AAO A;  2IQC A;  4C0M A;  4AM9 A;  4DX6 D;  1MX2 A;  3FU3 A;  5AJL A;  2YQ8 A;  3OXF A;  4UQZ A;  3QKY A;  5ENQ D;  4BWR A;  2L6J A;  2X6J A;  3E34 A;  1QBQ A;  3SZ7 A;  3LDZ A;  4YVQ C;  1E90 A;  2P9S G;  2QYU A;  4UI9 K;  3ISM C;  4UQX A;  3RRN B;  5HS0 A;  3MA5 A;  3JXJ A;  4I2Z A;  3PDN A;  3QAQ A;  3L22 A;  1WY6 A;  1EDU A;  2CHZ A;  4ANW A;  1Z6T A;  4I1A A;  3PNL B;  4GCO A;  2XEH A;  2OOE A;  2GW1 A;  1YCS B;  1V54 E;  2H6I A;  5ENT D;  4AY6 A;  3PUJ A;  3TJP A;  3NZU A;  1MJ0 A;  1H19 A;  1E7U A;  4J6I A;  2KBX A;  5HRY A;  2LXM A;  2XRY A;  2XEE A;  3E37 A;  1A5E A;  1N4S A;  3DSV A;  3AS5 A;  3ONK A;  3EHR A;  3IEG A;  5G05 J;  1N95 A;  5J90 A;  3Q47 B;  3LVR E;  2OV8 A;  2AXZ A;  2J07 A;  2WXK A;  3D9N A;  3Q7F A;  2I2O A;  1UG3 A;  3B7R L;  5JJ7 A;  2DCP A;  2WXR A;  1HU3 A;  2P9K G;  2NXP A;  3CQG B;  1KZO A;  3V79 K;  1RZ4 A;  3CVU A;  4UI9 J;  5EIL A;  1IXV A;  5KJL A;  2EQX A;  1KT1 A;  2R02 A;  5CCM A;  2HR2 A;  5CEC B;  4LRZ A;  1IYG A;  5G2N A;  3RRM B;  2AWI A;  3RK6 A;  3BQO A;  1SA5 A;  2DYS E;  2P9U G;  4TUM A;  4KBQ A;  3PUK A;  4U95 D;  2VYI A;  2KM4 A;  5D0Q D;  4FLH A;  4FHJ A;  2NC9 A;  3SI5 A;  1X81 A;  1GW6 A;  2WM9 A;  3OXL A;  3ZIM A;  3TL5 A;  3CHP A;  3PZ2 A;  2XGM A;  2IJG X;  1O1T A;  2ILR A;  3HVE A;  3UMV A;  2VGE A;  4RQI A;  5CMY A;  3Q4A B;  4B94 A;  2DZO A;  2WXO A;  2VGX A;  5ENO D;  2IO2 C;  2RKK A;  3TXM A;  3PNT B;  4G8L A;  4ILH B;  4A1G A;  3FP3 A;  2EIK E;  3SHF A;  4FJY A;  4HI9 A;  2E2E A;  4ANV A;  1LD7 A;  4BER A;  2C0M A;  4EBA G;  3G2V A;  2OCC E;  2WB2 A;  1U3D A;  5BXU A;  4BEP A;  4DK5 A;  2CG3 A;  3PRE A;  1Q2Z A;  3U9W A;  4MLP A;  3CGH A;  1N52 A;  5CEA A;  1E8W A;  3ZEF A;  2V0P A;  2PL2 A;  2XGS A;  1KLX A;  3L17 A;  5CBN A;  4GTP A;  4YDO A;  1QQE A;  4K5C A;  4YDY A;  1N4P A;  2KCV A;  1HE8 A;  4NAC A;  3B95 A;  3EU5 A;  4BES A;  3L13 A;  2ETA A;  1JPL A;  4XE0 A;  1K3Z D;  2JLB A;  4XIF A;  1JWG A;  4HOU A;  4CT0 A;  3R7Q A;  4WNE A;  1HG5 A;  3ESK A;  3QWV A;  3B13 A;  1EYH A;  4U8H A;  2XS8 A;  4U07 A;  3D9O A;  3AS8 A;  2VTB B;  4WWN A;  1JCQ A;  1NFI E;  3AJI A;  3CHM A;  2DWZ A;  4P29 A;  2YHE A;  1N9A A;  1FT1 A;  3U66 A;  3ABM E;  1K8K G;  5AQ7 A;  3LS8 A;  2Q7F A;  2FF4 A;  5FZS A;  2EIM E;  1OXJ A;  2CHW A;  5BPP A;  3D9L A;  3FH5 A;  3X2Q E;  2WPV A;  4DI3 A;  2H6F A;  3CIA A;  2CFZ A;  3RKV A;  2A5U A;  3E4B A;  1BLX B;  4BT9 A;  5KWD A;  3PVL A;  2IU1 A;  2WXQ A;  4TXR A;  2UY1 B;  1LTX A;  3O4Z A;  4B89 A;  4JHR A;  5LX8 A;  4U0Z A;  1BU9 A;  4GZ6 A;  4HB5 A;  1NA3 A;  3FY4 A;  4EQF A;  3FEY A;  3LY9 A;  2XPI A;  3I4R B;  4F3V A;  2KCK A;  4E85 A;  4ILG A;  3ML9 A;  2BED A;  3D9P A;  4N5C A;  4EPZ A;  3ULQ A;  1WM5 A;  2ZGD A;  5JMN D;  3FTY A;  2AXU A;  4GPK A;  4UQY A;  4JEH A;  2XZT G;  1D8D A;  3LVQ E;  4J8F A;  3MJW A;  4JHJ A;  2VJ8 A;  4GB9 A;  3FH8 A;  1QNF A;  4HBD A;  3PS6 A;  2R17 C;  4NIK A;  2AXV A;  3NOG D;  2X38 A;  2L6B A;  4A63 B;  5LCW C;  1S64 A;  4J8Y A;  3CVV A;  1MYO A;  3ML8 A;  2WQ7 A;  4UWL A;  3AAA C;  2P9L G;  3DSS A;  5BXO A;  4AEZ C;  1SVX A;  4ATG A;  3HXE A;  3MEK A;  4I2W A;  5CRU A;  3EJN A;  2KXP C;  4BET A;  3P1U A;  1EF1 C;  2F37 A;  3CHO A;  3FTW A;  5T8I A;  2ZIR A;  1N94 A;  4FUL A;  3PRZ A;  2HO1 A;  2H6H A;  2WQ6 A;  4PDX A;  2FO7 A;  2PM6 A;  4TRQ A;  3AU4 A;  3TXN A;  1N54 A;  3C3O A;  2QC9 A;  3DPD A;  3VTY A;  3CK7 A;  3UXG A;  1S70 B;  4GML A;  4I1M A;  1IKN D;  3AS4 A;  4CDN A;  4J8S A;  3CVX A;  4BY6 A;  1MX6 A;  3PEU B;  1IHB A;  1BD8 A;  4EZJ A;  4GYY A;  4ANU A;  3CHR A;  5C1D A;  2OVB A;  4L2Y A;  1HO8 A;  3MV2 B;  3OTN A;  3LJN A;  5EN5 D;  5JHA A;  3VTX A;  1JCS A;  4XI0 A;  3ONL A;  2M63 A;  3EHM A;  4J8D A;  3FTV A;  4GZ3 A;  4LSZ E;  3L08 A;  3TWX A;  3CSF A;  4PUC A;  3EUV A;  3ASN E;  1P5Q A;  3LY8 A;  4KT6 B;  4LER A;  3BU8 A;  4I6G A;  2VTB A;  3J5Q B;  3TWU A;  3HRA A;  3UQ3 A;  3QWP A;  3JQ1 A;  4G24 A;  3TWQ A;  4CEM A;  3T5X A;  5BV1 A;  3EHQ A;  3CVW A;  4A1S A;  5CER B;  3HVE B;  3C3Q A;  3APF A;  4CDR A;  2OND A;  3UT4 A;  3UIN C;  2VGX B;  2KCL A;  2QY7 A;  2UY1 A;  3UKU G;  4ME2 A;  3Q78 A;  1N4R A;  4G8K A;  4L9P A;  3RAU A;  1OY3 D;  3ULY A;  1NZN A;  3L16 A;  3CHQ A;  3EIJ A;  3EDT B;  5G04 C;  5D2M C;  2XHE A;  3T8M A;  3AU5 A;  5FZR A;  3QOU A;  3HXD A;  2KC7 A;  1H6P A;  2GRQ B;  4LG6 A;  2XGO A;  2DVW A;  2Y4U A;  3ZVV A;  2GRP B;  3BUA A;  2EIJ E;  3URZ A;  3PH0 C;  5B1A E;  2F8Y A;  3W9F A;  4EEC A;  3UT7 A;  3G2T A;  2R05 A;  4ZFH A;  3SGH A;  3IV0 A;  4ILI A;  2NSZ A;  3NB2 A;  2YIN A;  3L9T A;  4PH4 B;  2BF0 X;  4U8V D;  3DST A;  2I9C A;  2L9B A;  4BSZ B;  4HS2 A;  2MRI A;  3QWW A;  1X5B A;  1TJF A;  4RLY A;  4URK A;  2CHX A;  3QDN A;  3DEO A;  5AQ9 A;  4BT8 A;  5ENP D;  1OWP A;  4GU5 A;  4KMO A;  4I43 A;  4HLE A;  4Q69 A;  1YMP A;  3FUL A;  2V5F A;  4F53 A;  2LO6 A;  3JCK C;  1HXI A;  2RD0 A;  5KNG A;  3FUE A;  2PZI A;  4CGV A;  4J0U A;  4M7C A;  1W3B A;  3SQV A;  4M3O A;  5M72 A;  3ZNG A;  1ZU2 A;  1OUV A;  5AQB A;  4U0S A;  2R59 A;  1PY1 A;  2Y3A A;  2UWJ G;  3SD5 A;  4Q96 A;  3UPV A;  3ZRH A;  2J09 A;  2F0Y A;  3UM1 A;  3FUF A;  4O6F A;  3FTZ A;  4KVO A;  4FC8 A;  2DZN A;  3I3N A;  3QJZ A;  3W9G A;  2H6G A;  4B93 B;  3E32 A;  4F6R D;  4GA1 A;  1MX4 A;  4FJZ A;  3CVL A;  3FU0 A;  5EKQ D;  4ACK A;  4OAU C;  1A17 A;  2YHC A;  3LPZ A;  4TUU A;  1HF8 A;  3Q5M A;  4JB8 P;  3ULE G;  4J8E A;  3ZHE A;  3DSX A;  4HRM B;  4CRW A;  5BT1 A;  1OWM A;  4F1S A;  5AYW D;  4B8C B;  1DVP A;  4AV7 A;  4UWF A;  3AG2 E;  1E7V A;  4EZK A;  3NF1 A;  4C48 B;  4L1B A;  2B0O E;  1SW6 A;  1U3C A;  3CR3 A;  2HM8 A;  3CQC B;  3ENE A;  2ETB A;  1V55 E;  5LFA A;  5AEN A;  3C5R A;  2OEW A;  1OWO A;  4U96 D;  1TYQ G;  3TWV A;  3U3W A;  2VGY A;  4B0Z A;  2IO3 C;  3QAR A;  3JUI A;  1TNY A;  2MOW A;  5BW8 C;  2IEJ A;  3DRA A;  2Y4T A;  2FUL A;  3V31 A;  5LCW J;  4U7E B;  5ENN A;  3HHM A;  2QFC A;  2XS1 A;  1HX8 A;  4GTM A;  2ION A;  4WWO A;  1UW4 B;  2PNN A;  4JA7 A;  3S7D A;  4APF A;  1UJK A;  4GZC A;  4D10 C;  4I17 A;  5FZQ A;  4DPR A;  1N11 A;  5CBO A;  5LP0 A;  1WDY A;  5KJN A;  3CLJ A;  1N0R A;  4BX8 A;  2FI7 A;  4KYO B;  4RVB A;  2VSN A;  3KSQ A;  4ACL A;  1TNU A;  1WAO 1;  3IBE A;  3Q9U C;  3UX4 A;  3BG1 B;  4IN3 B;  3MKQ A;  2WXJ A;  3ZGQ A;  3D9I A;  2ZU6 B;  4IYP A;  4NUR A;  1E96 B;  4HOQ A;  4U0U A;  2EIN E;  4YDE A;  3HDX A;  4KVM A;  3RRU A;  3B7T A;  3C72 A;  2LAH A;  3HXF A;  2XCC A;  2FBN A;  2JEK A;  3LYA A;  2VSX E;  3NBN B;  3ZYQ A;  4JZY A;  3Q15 A;  4GZD A;  5FIN A;  3APC A;  2WMO A;  3KSL A;  5JJT A;  5FQ8 A;  3DXM G;  4DX1 A;  5B1B E;  4FAD A;  2R03 A;  4C0E A;  4I9C A;  2PM7 A;  2PQN A;  3OAW A;  3TWR A;  3DSU A;  1ZBP A;  3EHN A;  5FT9 A;  3UTM A;  1MQS A;  4DX5 D;  5H7P A;  3VLF A;  3SFX A;  4JL0 A;  3CST A;  2P9P G;  2RG8 A;  1HG2 A;  3DPY A;  4E6H A;  4DX7 D;  3V2X A;  4HI8 A;  2VQ2 A;  3S7J A;  1NA0 A;  3EU9 A;  4WUY A;  5HQ8 A;  2V5Q C;  2WMN A;  2J9Q A;  1EPU A;  3QK0 A;  3FUK A;  4GZ5 A;  3K9I A;  2I1K A;  1OWN A;  3UKR G;  4O1O A;  4UWG A;  1JWF A;  5FQ6 A;  5E76 A;  4L7T A;  1NP7 A;  4L23 A;  4JHK A;  4K03 A;  1E8Y A;  3KEZ A;  3TAX A;  5ANL A;  3MGB A;  1BI8 B;  2KZT B;  4N3A A;  2AJA A;  4APO A;  3UUX A;  3SO8 A;  4GAA A;  2LXL A;  5G04 J;  4GA0 A;  4PS8 A;  2QZA A;  3FFL A;  4FP7 A;  4AXH A;  4J7W A;  1E8Z A;  5G55 A;  4N39 A;  4NQ0 A;  5AIJ A;  1KPS B;  4G26 A;  2EIL E;  2GGF A;  1LD8 A;  3FDH A;  1SZA A;  3R7R A;  3MCX A;  3Q49 B;  3RO3 A;  5EYP F;  4AIF A;  2MYO A;  4G25 A;  3ASD A;  2GRR B;  3HYM B;  4N3C A;  4V3I A;  2XZD G;  2R5S A;  1OCO E;  4XKB A;  3QB2 A;  4JD2 G;  1B89 A;  3J5P A;  1YYH A;  1RW2 A;  1U2V G;  2XEV A;  3T9K A;  4OVV A;  3P2B A;  5CMW A;  4TXQ A;  1BI7 B;  3GW4 A;  1N4Q A;  3ESL A;  3FUJ A;  3CKB A;  4PS3 A;  2VSY A;  1OCC E;  4TV3 A;  4B8A A;  3Q79 A;  4FLB A;  4GA2 A;  3PE3 A;  3DWL G;  5EDS A;  1TN6 A;  2XRZ A;  1DC2 A;  4U04 A;  3U4T A;  3JXI A;  4CGW A;  3UIO C;  5CED B;  3V2O A;  5B3S E;  1H2U A;  2WXN A;  4G1T A;  3E30 A;  1K1A A;  2BUG A;  5A7D B;  1HFA A;  3TWS A;  2V8S E;  1FCH A;  3TG4 A;  4AY5 A;  2GRO B;  3GYZ A;  4X8Q A;  3ZHE B;  4WWP A;  3D3M A;  3T5V A;  4OVU A;  4GYO A;  1MZC A;  2IFU A;  3LJ3 A;  2WXG A;  1XGW A;  3Q9N C;  2FO1 E;  4HRN A;  3D9K A;  1H2V C;  2ZXW E;  2WXM A;  2BTD A;  3FUH A;  4HOR A;  3RO2 A;  4YDW A;  1OCZ E;  4OAV B;  1TN7 A;  1S0P A;  3AG3 E;  5AJD A;  4CT4 A;  3ZKJ A;  2PQR A;  4OYS A;  3UT8 A;  2RFM A;  3SFZ A;  4H7Y A;  1FVF A;  4O1P A;  2OVF A;  2IF4 A;  4GTT A;  4K0R A;  2JAB A;  3I5P A;  4GTV A;  2WXL A;  1O5M A;  4ZHB A;  4RG9 A;  3CEQ A;  2X6K A;  1H2T C;  1Y6I A;  5FIO A;  1KZP A;  4EZL A;  3OXG A;  3D9J A;  3VLD A;  3FUI A;  2E0I A;  3AG1 E;  4Y6C A;  2Y0B G;  3FEX A;  2L0I A;  3R9A B;  1Z3X A;  1NI1 A;  3C3R A;  3LEW A;  4HFG A;  4N2Q A;  4G2V A;  2J4B A;  4I9E A;  5EIB E;  2BKG A;  4HNA D;  4YVO A;  2P9N G;  4KXK B;  2X6H A;  4MRU A;  3PZD A;  1JCR A;  4GMJ A;  2KZT A;  1PAQ A;  5KJM A;  2WQH A;  4UUC A;  4GPM A;  4GMR A;  2V4H C;  4YND A;  3MKQ B;  3BG0 B;  3LCA A;  1OWL A;  4GYW A;  1TNZ A;  4DJA A;  3EIQ C;  5C2Y A;  2XCB A;  5ITZ F;  3IHV A;  5ENR D;  3WG7 E;  2LUH A;  1H6O A;  3LXU X;  2J08 A;  3IXE A;  4JEU A;  3G2W A;  3UM2 A;  4BFR A;  1HS6 A;  2ETC A;  4F1P A;  5T4Y A;  4DUI A;  3UM3 A;  3LKU A;  5EX3 A;  3GZS A;  5J08 A;  4BX9 A;  3JQ0 A;  3MX3 A;  1TNB A;  2WXP A;  3ASH A;  2CFU A;  5LOZ A;  5ARF A;  1N0Q A;  3ZXS A;  2GRM A;  3ASF A;  5FQ7 A;  4I1O B;  3RIB A;  3KAE A;  2I6H A;  4DRX E;  5JA4 D;  4JPS A;  4WAF A;  1FT2 A;  4FU3 A;  5EX0 A;  3PEV B;  4BSX A;  3ZU7 B;  4N3B A;  1IQU A;  4EBA A;  1UOH A;  3NQP A;  1HZ4 A;  1TEZ A;  5HKP A;  3ZN3 A;  2P2C P;  3CVQ A;  1IQR A;  4K5B A;  3SFY A;  1Z3Y A;  1OCR E;  4O60 A;  3FUM A;  3I4G A;  4XX5 A;  5IY5 E;  1TJC A;  5DBK A;  5KBA A;  1K1B A;  2I1J A;  4UWH A;  4RG6 A;  4WNF A;  3GZ2 A;  2FEZ A;  5HI7 A;  1LF8 A;  5T3R A;  3ASO E;  5ARG A;  4R7L A;  3FHE A;  4XI9 A;  5FQ4 A;  3ZUV B;  1UN9 A;  2IOS A;  2X3M A;  3D9M A;  2WXH A;  1QZ2 A;  3G2S A;  3N71 A;  4XKC A;  3B7B A;  4A55 A;  4HRL A;  3JYS A;  4WND A;  3Q7A A;  4GTR A;  3ZXP A;  1OT8 A;  4CYM D;  4CDM A;  2Y69 E;  1S63 A;  3RSE G;  3FUD A;  4KZ0 A;  4NRH B;  4W9R A;  5ANR A;  2IY0 C;  4GCN A;  1H0A A;  2OEV A;  2X6I A;  4N2S A;  4H7X A;  3CVN A;  3BEE A;  3FTU A;  4JVS A;  4BTA A;  3PE4 A;  4KZC A;  3CVY A;  4HOT A;  1YA0 A;  2XEN A;  3B7U X;  1SA4 A;  3B7S A;  4G23 A;  3MZL B;  2Y1L E;  3QC1 A;  4N5Q A;  2VSO E;  4F7A A;  2DIW A;  5JJ6 A;  1AWC B;  3G2U A;  1O1R A;  3S7B A;  2P9I G;  3IHY A;  4HQD A;  4TXP A;  3MYV A;  1XNF A;  3TGO A;  2ZGG A;  5FWQ A;  3UIP C;  4DI4 A;  3ZPJ A;  4JXT A;  3F6Q A;  3PZ3 A;  4DLQ A;  1Z5S C;  5A23 A;  1O1S A;  2HYZ A;  4A3T A;  3HIZ A;  5G05 C;  1ELK A;  5D0O D;  3ZW3 A;  3VLE A;  3HXC A;  1IHG A;  5FTP A;  2DYR E;  2R2L A;  3PZ1 A;  3CV0 A;  5EYL A;  3KS2 A;  2RFA A;  2LSU A;  3C98 A;  2L0T B;  5EID A;  3U64 A;  4QQI A;  3RJV A;  3GZ1 A;  2DBA A;  4XZ4 A;  4Z68 A;  5DIZ A;  3TG5 A;  4C9B B;  2IOL A;  4UI9 C;  3T8K A;  1BPO A;  1G3N B;  4LUN U;  4L2L A;  3CK8 A;  4LNB A;  1FPP A;  4K5A B;  4ABN A;  2AVP A;  1FVH A;  3JUE A;  4HLL A;  3Q73 A;  2BKK B;  4I6J A;  1NL4 A;  3AG4 E;  5E75 A;  4EHM A;  4HOS A;  4JW1 A;  3O48 A;  4RSY A;  3ASG A;  3DXK G;  2J49 A;  3FH7 A;  2C2L A;  2P58 C;  2MHK A;  1QYM A;  1WG0 A;  4XEI G;  3RU0 A;  3L54 A;  3HXB A;  1VDY A;  2F8X K;  3E33 A;  3ABL E;  2KAT A;  4AP2 A;  4GTQ A;  5A6C A;  1AP7 A;  3TWW A;  4JA9 A;  3NOC D;  4DX2 A;  4FA6 A;  3LY7 A;  3UI2 A;  3FWV A;  3KD7 A;  1H6K A;  1PC2 A;  4Y6W A;  3S2A A;  4AJW A;  3SBT B;  1TN8 A;  1ELW A;  5BUZ A;  3DBS A;  2XQ0 A;  3SF4 A;  3CVP A;  2GRN B;  2YNQ A;  3CHS A;  1UJJ A;  4AOF A;  3DSW A;  5KCM A;  3FUN A;  5FJY A;  2GRL A;  2J8S D;  4GTS A;  5AAR A;  2A5E A;  1E8X A;  4U8Y D;  4UWK A;  2X6F A;  4IRU A;  1D9S A;  2XPY A;  3L82 A;  2LNI A;  1KT0 A;  1SQM A;  4GTO A;  3SY2 A;  3NZS A;  2WVI A;  5AN8 A;  1DNP A;  3FU6 A;  1SZ9 A;  5KJK A;  3SBS A;  4QFV A;  4ANX A;  3D9H A;  4BTB A;  5KNH D;  4ATZ D;  4U63 A;  4LNU D;  2AW6 A;  5D66 A;  3ZYL A;  3FU5 A;  4LNG A;  5JHB A;  3WXX A;  1ZB1 A;  4FHK A;  4Q94 A;  1Y8M A;  1DCQ A;  1TNO A;  4G11 A;  2V4L A;  3Q75 A;  2QYJ A;  2NYJ A;  3PZ4 A;  3ABK E;  5CCL A;  5AQA A;  5ENS D;  1ELR A;  1INZ A;  2J4D A;  3MV3 B; 
#chains in the Genus database with same CATH homology
 1KZO A;  1TNY A;  1TN7 A;  2IEJ A;  3DRA A;  3SFX A;  2F0Y A;  2BED A;  1TN8 A;  4GTP A;  4YDO A;  3E34 A;  3DPY A;  3PZ3 A;  1QBQ A;  1N4P A;  3HXD A;  1O1S A;  2H6G A;  4GTT A;  3EU5 A;  4GTM A;  3E32 A;  3HXC A;  1SA5 A;  4GTV A;  1D8D A;  1JCS A;  3Q7A A;  2R2L A;  3PZ1 A;  4GTR A;  1N4Q A;  3DSW A;  1O5M A;  1S63 A;  1X81 A;  1TNB A;  1D8E A;  1KZP A;  3Q79 A;  4GTS A;  3EUV A;  3PZ2 A;  1TN6 A;  1NI1 A;  3KSQ A;  1S64 A;  3DSX A;  4GTO A;  3DST A;  1O1T A;  1DCE A;  1FPP A;  1TNU A;  4LNB A;  1JCQ A;  2H6I A;  1FT2 A;  1JCR A;  1N9A A;  3DSS A;  3E30 A;  1FT1 A;  1SA4 A;  3Q73 A;  4YDE A;  1NL4 A;  3HXE A;  4EHM A;  3C72 A;  3HXF A;  2ZIS A;  3E37 A;  2ZIR A;  4LNG A;  1N94 A;  1N4S A;  3DSV A;  4MBG A;  2H6F A;  1LD7 A;  3KSL A;  1N95 A;  1TNO A;  2H6H A;  1MZC A;  3Q75 A;  1LTX A;  1TNZ A;  1O1R A;  3HXB A;  3SFY A;  3Q7F A;  1LD8 A;  3Q78 A;  1N4R A;  4L9P A;  3E33 A;  3PZ4 A;  4GTQ A;  3DSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...