1N4QA

Protein geranylgeranyltransferase type-i complexed with a ggpp analog and a kkksktkcvil peptide
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
314
structure length
314
Chain Sequence
b'FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Structure of mammalian protein geranylgeranyltransferase type-I
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 124
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n4qA00
3KSQA 1FT2A 1TNZA 3HXEA 4GTRA 3DRAA 2H6GA 1KZPA 1TN8A 3HXBA 1JCRA 4LNGA 1S63A 1TNOA 4EHMA 3HXCA 1N9AA 1MZCA 1TNUA 3Q78A 3Q7AA 1S64A 1DCEA 1O1TA 2BEDA 3Q75A 3SFXA 3KSLA 4GTTA 3DPYA 1TNBA 1SA5A 4GTQA 1O1RA 3EU5A 3DSUA 1FT1A 1N4QA 4GTMA 1N4RA 3DSVA 3E32A 2ZISA 1N4PA 4GTPA 1TN7A 1KZOA 1SA4A 3PZ4A 1QBQA 4GTSA 4L9PA 2F0YA 1O5MA 2R2LA 3PZ2A 4MBGA 3DSSA 3HXDA 1LTXA 3DSTA 1N94A 1NL4A 1TNYA 1N95A 4YDEA 3E37A 3PZ3A 3C72A 1D8EA 4GTVA 3Q79A 2IEJA 1JCQA 2ZIRA 3EUVA 3E34A 4GTOA 3E33A 2H6HA 3HXFA 4LNBA 1LD7A 3DSXA 3PZ1A 2H6FA 4YDOA 1X81A 1TN6A 1NI1A 3E30A 3SFYA 3Q73A 1N4SA 1JCSA 1FPPA 3DSWA 1LD8A 1O1SA 2H6IA 3Q7FA 1D8DA
chains in the Genus database with same CATH superfamily
4KZCA 3MGBA 1L5JA 1MX4A 4JC8A 5BV0A 3R9MA 1H6PA 3QNKA 4V3IA 4ANXA 2WXRA 3VTYA 3CR3A 3D9OA 2HM8A 4O60A 1OWLA 2I1KA 3NF1A 1PY1A 5AARA 3Q7AA 3PNLB 5B1BE 3APFA 3FUKA 2BEDA 3HVEA 4BESA 2KZTA 5CCLA 4F1SA 4FULA 3D9MA 3NAWA 1UN8A 2QZAA 4JHRA 4K5BA 1TR4A 1RW2A 3CLJA 3CK8A 4HRLA 1DCQA 2A5UA 4AY6A 3Q15A 3D9LA 2P9SG 3DSVA 4NQ0A 3G2UA 3FUNA 2DIWA 3ASGA 5BXUA 5EIBE 4AV7A 3E4BA 3PZ2A 5ARGA 4RG6A 4WNDA 2KCVA 3FP3A 5E75A 1TNYA 4HXIA 2F8YA 2YQ8A 3CVVA 4U8HA 2AVPA 4ILIA 3QB2A 2BKGA 3NZSA 1N52A 3FH7A 2WM9A 1UW4B 3F6QA 2E2EA 4CYMD 3O48A 3FWVA 1LD7A 3UXGA 3BG0B 3FUFA 3JQ0A 2LUHA 3FU5A 3GZSA 1QZ2A 3RSEG 4LERA 3ONKA 2Q7FA 4FU3A 3JUEA 1ZBPA 1FVFA 3LKUA 1TN8A 3MYVA 5KJNA 2L6BA 2VGEA 4UI9J 3Q78A 1DCEA 3UIOC 2QFCA 4N3CA 1HX8A 2R5SA 2P9NG 2WXIA 3R7QA 2RFAA 2R03A 3EHMA 5KJMA 2NC9A 1JPLA 4UWGA 4RQIA 4JL0A 4N5QA 4AP2A 2VSXE 3HVEB 3HHMA 3PNTB 2KZTB 2DBAA 5EX0A 4XE0A 1K3ZD 3DEPA 4Q94A 3FTYA 4ME2A 1INZA 3UKUG 1NZNA 3PDNA 2J4DA 4GPKA 3FUEA 3JXJA 5LX8A 3RU0A 2HO1A 2WQ7A 4GMRA 3FULA 4WNEA 2AXUA 5AQBA 4DRXE 1EYHA 1P5QA 4YDWA 3Q7FA 2VTBB 2GRMA 5B3SE 3KS2A 4G25A 3UI2A 2WXQA 2C0LA 4JA9A 5A23A 4ANUA 5JHBA 3Q9NC 2P9KG 4TXQA 2PNNA 3V31A 2VSOE 3UTMA 3FH8A 5FIOA 2MYOA 3I5PA 4HFGA 3I4RB 3ULYA 5FZSA 2IO2C 5JA4D 4O1OA 4JB8P 4ACKA 2FEZA 2JLBA 1OWOA 5ENOD 4GZ5A 5T4YA 5BV1A 5AAOA 4JHKA 4W9RA 4FADA 4L9PA 1EPUA 3R9AB 1UOHA 3V2OA 2UWJG 1S0PA 4M3OA 4DPRA 1UJKA 2MHKA 1HFAA 3ZPJA 2ZU6B 5AN8A 2Y69E 2IEJA 3V2XA 5FQ4A 3W9FA 5A7DB 3BQOA 4GYWA 3EUVA 4TV3A 1E8XA 2LAHA 2X6KA 4EZLA 3B7SA 3UMVA 3HXFA 3ZYMA 3J5PA 3E30A 4JPSA 5T8IA 3QK0A 2YHCA 1YMPA 1MQSA 3ML9A 5KCMA 2V4HC 5J08A 3B7RL 2B6CA 3ZHEA 4J8YA 4WUYA 3SO8A 3CVUA 4U7EB 2KC7A 3LYAA 1ZU2A 4HI9A 3EU9A 1ELKA 5G04J 1OT8A 2I2OA 4BWRA 4AEZC 3ML8A 5FZQA 3S7JA 1A5EA 4J8EA 3ULQA 4YVOA 4C9BB 3Q75A 4FA6A 3SFXA 3C3RA 3OAWA 4DK5A 4GTTA 3ZXSA 2P9LG 4AY5A 4LUNU 3UUXA 5BW8C 4I9CA 4CT4A 2CG3A 4CT0A 3UM3A 1E8YA 1SVXA 2WMNA 2RKKA 4GTMA 5AQ7A 2OCCE 3CVWA 2IY0C 3Q4AB 5CBOA 5BXOA 3PZ4A 2GRLA 3CHOA 2F37A 2PL2A 5FZRA 3HXDA 4OAUC 3C72A 2XCCA 3FY4A 3FDHA 5BT1A 3BU8A 4HVBA 4GMJA 1NA0A 1WDYA 2J08A 4UWHA 3BEEA 2H6HA 3V30A 3QARA 4Y6CA 3DSXA 2IJGX 2LSUA 4XKBA 2XS1A 2P9UG 3Q73A 2EINE 4I1OB 4DI3A 3QOUA 2J9QA 4I6JA 4ABNA 1JWFA 4EQFA 3TXMA 4X8QA 2HR2A 5AYWD 4FJZA 1TNZA 3ZYLA 2WXFA 1BD8A 4N3BA 3QWWA 3QJZA 1KZPA 4OVVA 3SQVA 2Y4UA 3FFLA 4WWOA 4EHMA 3DXKG 1Z6TA 3HXCA 2V5FA 1MZCA 2PM7A 3RKVA 5EYLA 2GW1A 1QQEA 2OVBA 4CCAA 3ASHA 2CHZA 2Y0BG 4GU5A 2V0PA 5ENQD 1FCHA 1E7UA 3BG1B 2VYIA 4UWFA 4I6EA 4PUCA 1HE8A 3E32A 3AU5A 4CDRA 5D2MC 2KCLA 3FU6A 4GTSA 1O5MA 1D9SA 1ELRA 3AS5A 5ENRD 2GRQB 2WB2A 4O1PA 4A1GA 4XI9A 4GTVA 4AJWA 2LNIA 3LXUX 3QKYA 3ZNGA 2DCPA 5EN5D 4BX8A 3ZIMA 2NYJA 4JXTA 2ETAA 5AQ9A 3CGHA 4J8DA 3MX3A 1OWMA 3IV0A 2LXMA 3ISMC 1O1SA 4FHJA 4ILHB 5C2YA 2Y1LE 4AXHA 3HXEA 2XS8A 3ASFA 1V55E 2VGXA 4HRMB 3CK7A 1HG5A 3AJIA 4LNUD 1Y6IA 2KXPC 1MX2A 4WAFA 5ENSD 1HS6A 2WXLA 2FO1E 5H7PA 4E6HA 3EJNA 3DSUA 3SZ7A 3JCKC 2VSNA 3D9KA 3ZEFA 1YA0A 2X6FA 3HDXA 1N4PA 4K03A 1G3NB 2ZGDA 2DZNA 2XPYA 5ITZF 5BNWA 2DZOA 4JA7A 2AXVA 1H6OA 1MHQA 3AS8A 3OTNA 3LEWA 3AG2E 3Q47B 4APOA 3CHSA 3TWVA 3TG5A 2CG2A 3MKQA 2XGSA 2E0IA 4GAAA 4GTOA 3B95A 3MEKA 3T8KA 4F1PA 3ESLA 1H2TC 3TL5A 4DX6D 2XEEA 1SZAA 1N4SA 3G2SA 4B93B 2WXNA 1V54E 4A55A 3TWRA 3MKRA 3S2AA 4U8YD 3IXEA 3FUDA 3FHEA 4RLYA 3FU0A 1S63A 1E90A 2YINA 4TUMA 3TAXA 4UWKA 3ASDA 1TJFA 4BSZB 5ENTD 4FC8A 5CEDB 5CCMA 2OV8A 3Q9UC 1IKND 4BERA 2VGXB 3FTVA 2WXKA 2XRYA 4I2WA 3VLFA 1FVHA 2NSZA 4J0UA 1TYQG 4BTBA 2V8SE 4DX1A 4XZ4A 4G8LA 3RRUA 4NIKA 3DEOA 4CRWA 1LTXA 2L6JA 4CEMA 2EIME 3CHQA 3ZYQA 3PEVB 4WWPA 1YCSB 1IXVA 3K9IA 4L2YA 2ILRA 3PH0C 3I4GA 4ANVA 4HOSA 3FUIA 3DPDA 3CSFA 3T5VA 2FBNA 2A4ZA 1N54A 3B7BA 2AW6A 4U0ZA 1H0AA 4DUIA 2H6IA 2PQNA 4GCNA 4U04A 5CMWA 2GRRB 3EIJA 2QYJA 4BTAA 5FQ7A 4HRNA 4BFRA 1N9AA 3J5QB 4GA0A 3UT7A 3IBEA 2XPZA 3PRZA 4MRUA 3SF4A 2IOLA 2FF4A 2OEWA 4A63B 5A6CA 1LF8A 1X5BA 4A1SA 4EZKA 5D0OD 4U8VD 3PEUB 2WVIA 5AIJA 5KJLA 4P29A 3ASNE 3RRNB 3MV3B 4L2LA 3SD5A 1Q2ZA 5G2NA 3S7FA 3OXLA 2J4BA 3CHPA 2R2LA 3I3NA 4GYOA 2RFMA 4ZFHA 2CFZA 5DIZA 2BF0X 4GA2A 4YDEA 2GRPB 4KZ0A 1W3BA 4I1MA 5EX3A 5G05C 1RZ4A 1HXIA 4GA1A 4HLLA 5C1DA 2JEKA 4I2ZA 2JABA 1TEZA 3JYSA 4I17A 4PS8A 3MV2B 3FTUA 4Y6WA 3NOCD 2PQRA 3EDTB 4GMLA 3MJWA 1LD8A 1U3DA 3U9WA 4B94A 3APDA 4AVXA 3CVXA 2Y3AA 4M7CA 3FH5A 4YVQC 1DNPA 2XCBA 5FQ6A 4JZYA 4YDYA 2H6GA 3JXIA 4DLQA 4UI9K 2WXGA 4A3TA 1ELWA 4U95D 1O1TA 3SNXA 4EZJA 2VQ2A 4AOFA 4Z68A 4BT9A 3GZ1A 3NQPA 3BUAA 1N11A 3KD7A 3RO2A 4KVMA 4G8KA 1UN9A 2DWZA 3RIBA 2ZISA 3DBSA 4BEPA 3Q49B 5B1AE 2EILE 4BETA 2KCKA 2EIJE 3SBTB 1QBQA 1Z3XA 3IHVA 3LJNA 4LG6A 4TRQA 2A5EA 2YNQA 1N94A 5CEAA 3CVPA 2ZGGA 3UT8A 4BT8A 4CDNA 4E85A 3SBSA 1MJ0A 4B89A 3QC1A 3L6AA 3CEQA 2HE0A 3D9PA 3URZA 5D0QD 5IY5E 2FO7A 3HG0D 1ZB1A 1AP7A 1D8DA 3G2TA 4Q96A 2LO6A 2X38A 4PS7A 1H2UA 3ZUVB 2P58C 5ENNA 3D9NA 3L54A 3AS4A 2DVWA 1NA3A 4FLHA 1K8KG 4LCTA 4IN3B 3ABKE 1QYMA 3P2BA 3SHFA 5LCWC 1BI7B 4AIFA 4UWLA 1U3CA 1SW6A 4JEUA 1HZ4A 2X6JA 3IHYA 1K1BA 2XEHA 3AU4A 1FT1A 2XENA 2KATA 3ZHEB 4CZ2D 2DYRE 4HLEA 5JJTA 4GTPA 3TWXA 2M63A 4CDMA 1SA4A 4GZDA 1SQMA 3IKOB 3G2VA 1N95A 3ZU7B 3E37A 1D8EA 3AG1E 4XIFA 5JJ7A 3EHRA 5EKQD 3RK6A 4HORA 3QDNA 1H19A 3CVLA 3APCA 4BX9A 3O4ZA 4TXRA 5FWQA 4B8AA 3VTXA 1EDUA 5FINA 5CMYA 3FTZA 5BPPA 3MA5A 5FJYA 4EPZA 2V5QC 2ONDA 3CQCB 1U2VG 4FLBA 1KT1A 4XX5A 3DXMG 4U96D 3LY9A 2WXPA 5FT9A 3JQ1A 3SI5A 4J7WA 1EF1C 1OCRE 2VGYA 3DRAA 4NRHB 3L82A 3R7RA 5LFAA 1JWGA 1TNUA 2CFUA 4UQZA 1UJJA 2P2CP 3CVYA 4F6RD 4GCOA 4ACLA 1TNBA 3U66A 1SA5A 4GTQA 2QYUA 2L0IA 2WXHA 3FU3A 1TJCA 2EIKE 4MKTA 2OVFA 2XHEA 3UIPC 4OAVB 3ZKJA 1HH8A 3TWQA 4KMOA 5CHEE 5E76A 5FQ8A 2IF4A 5M72A 2LAIA 4GB9A 1DC2A 3AG3E 4I43A 4WNFA 4C48B 2R02A 3FTWA 3IEGA 3EHNA 4JW1A 3HYMB 2C2LA 3VLDA 3SGHA 2AWIA 1IQRA 3UT4A 4HOQA 2CHWA 4R7LA 2XQ0A 4WNGA 2WMOA 3QWVA 4D10C 4ILGA 4HNAD 5HRYA 5LOZA 1IHBA 4YDOA 4UQXA 1N0RA 3LCAA 2UY1A 1BLXB 3KAEA 3CV0A 1OXJA 3Q5MA 3RJVA 2LSVA 4PDXA 4CGWA 1FT2A 3AG4E 5AENA 3LDZA 2AXZA 4PH4B 1DVPA 1S70B 2WQ6A 2RD0A 3FUJA 2IO3C 4LNGA 5EIDA 3CQGB 1NP7A 4UI9C 3OXGA 3B13A 1WG0A 3ENEA 5EDSA 4LSZE 4QFVA 5ANLA 3KEAA 4QQIA 3ONLA 2J8SD 2XGOA 3KEZA 4G24A 4GZ3A 3L17A 5FTPA 4G23A 4J6IA 5CRUA 4UUCA 3JUIA 1BU9A 3LY8A 1E8WA 1KZOA 3UQ3A 2VSYA 4ATGA 2VTBA 3MCXA 3DSTA 1WM5A 4I6GA 3SY2A 2ZXWE 3PUKA 5G55A 1OY3D 3L13A 2I9CA 1JCQA 1BI8B 3UM2A 5CRVA 2PZIA 5KNHD 3E33A 4B0ZA 4U0UA 4NACA 3PZ1A 4H7YA 3QAQA 1X81A 4HS2A 5LP0A 2DYSE 2I1JA 2QC9A 2HYZA 4L1BA 3DWLG 1XGWA 1FPPA 4G11A 3LVRE 4F3VA 3TJPA 4XEIG 3ZYKA 2C0MA 4IYPA 3KSQA 2XEVA 2MRIA 1WY6A 3PE3A 2I6HA 3L9TA 2UY1B 2VJ8A 4G26A 3V79K 2BKKB 1N0QA 4KXKB 1NFIE 2GGFA 3HXBA 3RAUA 1HU3A 5AJLA 3MKQB 1MYOA 2XZDG 4EECA 3CKCA 4O6FA 4KYOB 4HOTA 3KSLA 3TWSA 3PREA 1E7VA 3CVQA 5D66A 3WG7E 4A3VA 1Z5SC 2FI7A 3NOGD 1HG2A 3ASOE 3ZW3A 4AM9A 1H2VC 1Y8MA 2WXOA 3PZDA 3TXNA 2WPVA 3PE4A 4LRZA 1K1AA 3ZGQA 2V4LA 4YNDA 3MZLB 3RRMB 2RG8A 5CBNA 5JJ6A 3FTSA 2J49A 3LJ3A 3TWTA 3U4TA 4GZCA 4F53A 1E96B 3G2WA 1KPSB 3W9GA 1YYHA 4LEUA 2P9IG 5CECB 2H6FA 4ZHBA 2R05A 1TN6A 4HI8A 1WAO1 4KBQA 3CHRA 3AAAC 3FUMA 1QNFA 3C98A 4EBAG 2AJAA 4FHKA 3HRAA 4JEHA 3NZUA 2X6IA 5G04C 2L0TB 3ULEG 3UM1A 2XRZA 3ESKA 1H6KA 4N39A 2P9PG 4G1TA 4C0EA 4U0SA 1IYGA 2B0OE 3S7DA 5KNGA 3GW4A 3CK9A 3ZFWA 4HOUA 3EIQC 2WQHA 2QY7A 1BPOA 2R59A 2J07A 3DPYA 5JMND 1IHGA 4JVSA 4APFA 3WXXA 4N2QA 4KVOA 3UPVA 4GPMA 2J09A 3N71A 1N4QA 3EHQA 1SZ9A 3NB2A 3OXFA 1IQUA 1TN7A 3ABME 5ENPD 2ETCA 2NXPA 4N5CA 1JUQA 4J8FA 2F0YA 4MBGA 3DSSA 3LVQE 1KT0A 1NL4A 5KBAA 4DJAA 5ANRA 4ATZD 3CIAA 5HKPA 5G05J 4K5AB 3UX4A 4I1AA 3TG4A 4WWNA 5DBKA 4K0RA 3D3MA 2IOSA 2MOWA 3E34A 3L22A 4PS3A 4LNBA 3TWWA 5J90A 3SFYA 1NI1A 4K5CA 1OWPA 4GYYA 3CSTA 2OEVA 4HBDA 2LXLA 1A17A 3FUHA 2WXMA 4UQYA 4URKA 3C5RA 4HB5A 1VDYA 3T8MA 4N3AA 2GROB 3CKBA 3ZVVA 1HF8A 2R17C 2XPIA 4GTRA 3C3QA 2FULA 4L7TA 2IQCA 1JCRA 5CERB 3TGOA 2CHXA 4XKCA 1KLXA 5HI7A 4BY6A 3SFZA 1OCCE 3FEYA 4BSXA 5EILA 3D9JA 4C0MA 5KWDA 3LS8A 4Q69A 2BTDA 4DI4A 5BUZA 1O1RA 3S7BA 4EBAA 4J8SA 2EQXA 2KBXA 5AJDA 3LY7A 3GZ2A 4OVUA 2XGMA 4TUUA 2XZTG 5AQAA 3PZ3A 2X3MA 4U63A 1PAQA 4MLPA 3Q79A 1Z3YA 3C3OA 1XNFA 2ZIRA 3FTXA 4IULA 3P1UA 3PS6A 4F7AA 1OCOE 5KJKA 3VLEA 2IU1A 4HQDA 2OOEA 4RG9A 3ZXPA 2BUGA 5HQ8A 3PUJA 1OWNA 2ETBA 1B89A 3ZRHA 1JCSA 3TWUA 1OUVA 3DSWA 4FJYA 4G2VA 4RVBA 2Y4TA 3T5XA 5T3RA 3L08A 4CGVA 5JHAA 2PM6A 4DX5D 4KT6B 4I9EA 3ZN3A 2IFUA 1HO8A 1TNOA 4JHJA 3CVNA 4L23A 3CHMA 4DX2A 1S64A 3T9KA 4TXPA 4U07A 4RSYA 3D9HA 4ANWA 5LCWJ 3FEXA 3B7UX 4MS6A 1GW6A 3EU5A 3LPZA 2GRNB 1N4RA 1AWCB 1PC2A 3UKRG 2YHEA 3UINC 2X6HA 3RO3A 1MX6A 5ARFA 3HIZA 3U64A 3NBNB 1OCZE 3GYZA 2F8XK 4JD2G 4XI0A 3D9IA 3PVLA 4H7XA 4B8CB 3U3WA 4IRUA 4NURA 4FP7A 3X2QE 4DLOA 5EYPF 4N2SA 4GZ6A 3QWPA 1E8ZA 2IONA 3ABLE 2KM4A 3UM0A 3B7TA 3L16A 5HS0A 1UG3A 2L9BA 4OYSA 4DX7D 2WXJA
chains in the Genus database with same CATH topology
3KSQA 1FT2A 1TNZA 3HXEA 4GTRA 3DRAA 2H6GA 1KZPA 1TN8A 3HXBA 1JCRA 4LNGA 1S63A 1TNOA 4EHMA 3HXCA 1N9AA 1MZCA 1TNUA 3Q78A 3Q7AA 1S64A 1DCEA 1O1TA 2BEDA 3Q75A 3SFXA 3KSLA 4GTTA 3DPYA 1TNBA 1SA5A 4GTQA 1O1RA 3EU5A 3DSUA 1FT1A 1N4QA 4GTMA 1N4RA 3DSVA 3E32A 2ZISA 1N4PA 4GTPA 1TN7A 1KZOA 1SA4A 3PZ4A 1QBQA 4GTSA 4L9PA 2F0YA 1O5MA 2R2LA 3PZ2A 4MBGA 3DSSA 3HXDA 1LTXA 3DSTA 1N94A 1NL4A 1TNYA 1N95A 4YDEA 3E37A 3PZ3A 3C72A 1D8EA 4GTVA 3Q79A 2IEJA 1JCQA 2ZIRA 3EUVA 3E34A 4GTOA 3E33A 2H6HA 3HXFA 4LNBA 1LD7A 3DSXA 3PZ1A 2H6FA 4YDOA 1X81A 1TN6A 1NI1A 3E30A 3SFYA 3Q73A 1N4SA 1JCSA 1FPPA 3DSWA 1LD8A 1O1SA 2H6IA 3Q7FA 1D8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSQ A;  1FT2 A;  1TNZ A;  3HXE A;  4GTR A;  3DRA A;  2H6G A;  1KZP A;  1TN8 A;  3HXB A;  1JCR A;  4LNG A;  1S63 A;  1TNO A;  4EHM A;  3HXC A;  1N9A A;  1MZC A;  1TNU A;  3Q78 A;  3Q7A A;  1S64 A;  1DCE A;  1O1T A;  2BED A;  3Q75 A;  3SFX A;  3KSL A;  4GTT A;  3DPY A;  1TNB A;  1SA5 A;  4GTQ A;  1O1R A;  3EU5 A;  3DSU A;  1FT1 A;  1N4Q A;  4GTM A;  1N4R A;  3DSV A;  3E32 A;  2ZIS A;  1N4P A;  4GTP A;  1TN7 A;  1KZO A;  1SA4 A;  3PZ4 A;  1QBQ A;  4GTS A;  4L9P A;  2F0Y A;  1O5M A;  2R2L A;  3PZ2 A;  4MBG A;  3DSS A;  3HXD A;  1LTX A;  3DST A;  1N94 A;  1NL4 A;  1TNY A;  1N95 A;  4YDE A;  3E37 A;  3PZ3 A;  3C72 A;  1D8E A;  4GTV A;  3Q79 A;  2IEJ A;  1JCQ A;  2ZIR A;  3EUV A;  3E34 A;  4GTO A;  3E33 A;  2H6H A;  3HXF A;  4LNB A;  1LD7 A;  3DSX A;  3PZ1 A;  2H6F A;  4YDO A;  1X81 A;  1TN6 A;  1NI1 A;  3E30 A;  3SFY A;  3Q73 A;  1N4S A;  1JCS A;  1FPP A;  3DSW A;  1LD8 A;  1O1S A;  2H6I A;  3Q7F A;  1D8D A; 
#chains in the Genus database with same CATH topology
 4KZC A;  3MGB A;  1L5J A;  1MX4 A;  4JC8 A;  5BV0 A;  3R9M A;  1H6P A;  3QNK A;  4V3I A;  4ANX A;  2WXR A;  3VTY A;  3CR3 A;  3D9O A;  2HM8 A;  4O60 A;  1OWL A;  2I1K A;  3NF1 A;  1PY1 A;  5AAR A;  3Q7A A;  3PNL B;  5B1B E;  3APF A;  3FUK A;  2BED A;  3HVE A;  4BES A;  2KZT A;  5CCL A;  4F1S A;  4FUL A;  3D9M A;  3NAW A;  1UN8 A;  2QZA A;  4JHR A;  4K5B A;  1TR4 A;  1RW2 A;  3CLJ A;  3CK8 A;  4HRL A;  1DCQ A;  2A5U A;  4AY6 A;  3Q15 A;  3D9L A;  2P9S G;  3DSV A;  4NQ0 A;  3G2U A;  3FUN A;  2DIW A;  3ASG A;  5BXU A;  5EIB E;  4AV7 A;  3E4B A;  3PZ2 A;  5ARG A;  4RG6 A;  4WND A;  2KCV A;  3FP3 A;  5E75 A;  1TNY A;  4HXI A;  2F8Y A;  2YQ8 A;  3CVV A;  4U8H A;  2AVP A;  4ILI A;  3QB2 A;  2BKG A;  3NZS A;  1N52 A;  3FH7 A;  2WM9 A;  1UW4 B;  3F6Q A;  2E2E A;  4CYM D;  3O48 A;  3FWV A;  1LD7 A;  3UXG A;  3BG0 B;  3FUF A;  3JQ0 A;  2LUH A;  3FU5 A;  3GZS A;  1QZ2 A;  3RSE G;  4LER A;  3ONK A;  2Q7F A;  4FU3 A;  3JUE A;  1ZBP A;  1FVF A;  3LKU A;  1TN8 A;  3MYV A;  5KJN A;  2L6B A;  2VGE A;  4UI9 J;  3Q78 A;  1DCE A;  3UIO C;  2QFC A;  4N3C A;  1HX8 A;  2R5S A;  2P9N G;  2WXI A;  3R7Q A;  2RFA A;  2R03 A;  3EHM A;  5KJM A;  2NC9 A;  1JPL A;  4UWG A;  4RQI A;  4JL0 A;  4N5Q A;  4AP2 A;  2VSX E;  3HVE B;  3HHM A;  3PNT B;  2KZT B;  2DBA A;  5EX0 A;  4XE0 A;  1K3Z D;  3DEP A;  4Q94 A;  3FTY A;  4ME2 A;  1INZ A;  3UKU G;  1NZN A;  3PDN A;  2J4D A;  4GPK A;  3FUE A;  3JXJ A;  5LX8 A;  3RU0 A;  2HO1 A;  2WQ7 A;  4GMR A;  3FUL A;  4WNE A;  2AXU A;  5AQB A;  4DRX E;  1EYH A;  1P5Q A;  4YDW A;  3Q7F A;  2VTB B;  2GRM A;  5B3S E;  3KS2 A;  4G25 A;  3UI2 A;  2WXQ A;  2C0L A;  4JA9 A;  5A23 A;  4ANU A;  5JHB A;  3Q9N C;  2P9K G;  4TXQ A;  2PNN A;  3V31 A;  2VSO E;  3UTM A;  3FH8 A;  5FIO A;  2MYO A;  3I5P A;  4HFG A;  3I4R B;  3ULY A;  5FZS A;  2IO2 C;  5JA4 D;  4O1O A;  4JB8 P;  4ACK A;  2FEZ A;  2JLB A;  1OWO A;  5ENO D;  4GZ5 A;  5T4Y A;  5BV1 A;  5AAO A;  4JHK A;  4W9R A;  4FAD A;  4L9P A;  1EPU A;  3R9A B;  1UOH A;  3V2O A;  2UWJ G;  1S0P A;  4M3O A;  4DPR A;  1UJK A;  2MHK A;  1HFA A;  3ZPJ A;  2ZU6 B;  5AN8 A;  2Y69 E;  2IEJ A;  3V2X A;  5FQ4 A;  3W9F A;  5A7D B;  3BQO A;  4GYW A;  3EUV A;  4TV3 A;  1E8X A;  2LAH A;  2X6K A;  4EZL A;  3B7S A;  3UMV A;  3HXF A;  3ZYM A;  3J5P A;  3E30 A;  4JPS A;  5T8I A;  3QK0 A;  2YHC A;  1YMP A;  1MQS A;  3ML9 A;  5KCM A;  2V4H C;  5J08 A;  3B7R L;  2B6C A;  3ZHE A;  4J8Y A;  4WUY A;  3SO8 A;  3CVU A;  4U7E B;  2KC7 A;  3LYA A;  1ZU2 A;  4HI9 A;  3EU9 A;  1ELK A;  5G04 J;  1OT8 A;  2I2O A;  4BWR A;  4AEZ C;  3ML8 A;  5FZQ A;  3S7J A;  1A5E A;  4J8E A;  3ULQ A;  4YVO A;  4C9B B;  3Q75 A;  4FA6 A;  3SFX A;  3C3R A;  3OAW A;  4DK5 A;  4GTT A;  3ZXS A;  2P9L G;  4AY5 A;  4LUN U;  3UUX A;  5BW8 C;  4I9C A;  4CT4 A;  2CG3 A;  4CT0 A;  3UM3 A;  1E8Y A;  1SVX A;  2WMN A;  2RKK A;  4GTM A;  5AQ7 A;  2OCC E;  3CVW A;  2IY0 C;  3Q4A B;  5CBO A;  5BXO A;  3PZ4 A;  2GRL A;  3CHO A;  2F37 A;  2PL2 A;  5FZR A;  3HXD A;  4OAU C;  3C72 A;  2XCC A;  3FY4 A;  3FDH A;  5BT1 A;  3BU8 A;  4HVB A;  4GMJ A;  1NA0 A;  1WDY A;  2J08 A;  4UWH A;  3BEE A;  2H6H A;  3V30 A;  3QAR A;  4Y6C A;  3DSX A;  2IJG X;  2LSU A;  4XKB A;  2XS1 A;  2P9U G;  3Q73 A;  2EIN E;  4I1O B;  4DI3 A;  3QOU A;  2J9Q A;  4I6J A;  4ABN A;  1JWF A;  4EQF A;  3TXM A;  4X8Q A;  2HR2 A;  5AYW D;  4FJZ A;  1TNZ A;  3ZYL A;  2WXF A;  1BD8 A;  4N3B A;  3QWW A;  3QJZ A;  1KZP A;  4OVV A;  3SQV A;  2Y4U A;  3FFL A;  4WWO A;  4EHM A;  3DXK G;  1Z6T A;  3HXC A;  2V5F A;  1MZC A;  2PM7 A;  3RKV A;  5EYL A;  2GW1 A;  1QQE A;  2OVB A;  4CCA A;  3ASH A;  2CHZ A;  2Y0B G;  4GU5 A;  2V0P A;  5ENQ D;  1FCH A;  1E7U A;  3BG1 B;  2VYI A;  4UWF A;  4I6E A;  4PUC A;  1HE8 A;  3E32 A;  3AU5 A;  4CDR A;  5D2M C;  2KCL A;  3FU6 A;  4GTS A;  1O5M A;  1D9S A;  1ELR A;  3AS5 A;  5ENR D;  2GRQ B;  2WB2 A;  4O1P A;  4A1G A;  4XI9 A;  4GTV A;  4AJW A;  2LNI A;  3LXU X;  3QKY A;  3ZNG A;  2DCP A;  5EN5 D;  4BX8 A;  3ZIM A;  2NYJ A;  4JXT A;  2ETA A;  5AQ9 A;  3CGH A;  4J8D A;  3MX3 A;  1OWM A;  3IV0 A;  2LXM A;  3ISM C;  1O1S A;  4FHJ A;  4ILH B;  5C2Y A;  2Y1L E;  4AXH A;  3HXE A;  2XS8 A;  3ASF A;  1V55 E;  2VGX A;  4HRM B;  3CK7 A;  1HG5 A;  3AJI A;  4LNU D;  1Y6I A;  2KXP C;  1MX2 A;  4WAF A;  5ENS D;  1HS6 A;  2WXL A;  2FO1 E;  5H7P A;  4E6H A;  3EJN A;  3DSU A;  3SZ7 A;  3JCK C;  2VSN A;  3D9K A;  3ZEF A;  1YA0 A;  2X6F A;  3HDX A;  1N4P A;  4K03 A;  1G3N B;  2ZGD A;  2DZN A;  2XPY A;  5ITZ F;  5BNW A;  2DZO A;  4JA7 A;  2AXV A;  1H6O A;  1MHQ A;  3AS8 A;  3OTN A;  3LEW A;  3AG2 E;  3Q47 B;  4APO A;  3CHS A;  3TWV A;  3TG5 A;  2CG2 A;  3MKQ A;  2XGS A;  2E0I A;  4GAA A;  4GTO A;  3B95 A;  3MEK A;  3T8K A;  4F1P A;  3ESL A;  1H2T C;  3TL5 A;  4DX6 D;  2XEE A;  1SZA A;  1N4S A;  3G2S A;  4B93 B;  2WXN A;  1V54 E;  4A55 A;  3TWR A;  3MKR A;  3S2A A;  4U8Y D;  3IXE A;  3FUD A;  3FHE A;  4RLY A;  3FU0 A;  1S63 A;  1E90 A;  2YIN A;  4TUM A;  3TAX A;  4UWK A;  3ASD A;  1TJF A;  4BSZ B;  5ENT D;  4FC8 A;  5CED B;  5CCM A;  2OV8 A;  3Q9U C;  1IKN D;  4BER A;  2VGX B;  3FTV A;  2WXK A;  2XRY A;  4I2W A;  3VLF A;  1FVH A;  2NSZ A;  4J0U A;  1TYQ G;  4BTB A;  2V8S E;  4DX1 A;  4XZ4 A;  4G8L A;  3RRU A;  4NIK A;  3DEO A;  4CRW A;  1LTX A;  2L6J A;  4CEM A;  2EIM E;  3CHQ A;  3ZYQ A;  3PEV B;  4WWP A;  1YCS B;  1IXV A;  3K9I A;  4L2Y A;  2ILR A;  3PH0 C;  3I4G A;  4ANV A;  4HOS A;  3FUI A;  3DPD A;  3CSF A;  3T5V A;  2FBN A;  2A4Z A;  1N54 A;  3B7B A;  2AW6 A;  4U0Z A;  1H0A A;  4DUI A;  2H6I A;  2PQN A;  4GCN A;  4U04 A;  5CMW A;  2GRR B;  3EIJ A;  2QYJ A;  4BTA A;  5FQ7 A;  4HRN A;  4BFR A;  1N9A A;  3J5Q B;  4GA0 A;  3UT7 A;  3IBE A;  2XPZ A;  3PRZ A;  4MRU A;  3SF4 A;  2IOL A;  2FF4 A;  2OEW A;  4A63 B;  5A6C A;  1LF8 A;  1X5B A;  4A1S A;  4EZK A;  5D0O D;  4U8V D;  3PEU B;  2WVI A;  5AIJ A;  5KJL A;  4P29 A;  3ASN E;  3RRN B;  3MV3 B;  4L2L A;  3SD5 A;  1Q2Z A;  5G2N A;  3S7F A;  3OXL A;  2J4B A;  3CHP A;  2R2L A;  3I3N A;  4GYO A;  2RFM A;  4ZFH A;  2CFZ A;  5DIZ A;  2BF0 X;  4GA2 A;  4YDE A;  2GRP B;  4KZ0 A;  1W3B A;  4I1M A;  5EX3 A;  5G05 C;  1RZ4 A;  1HXI A;  4GA1 A;  4HLL A;  5C1D A;  2JEK A;  4I2Z A;  2JAB A;  1TEZ A;  3JYS A;  4I17 A;  4PS8 A;  3MV2 B;  3FTU A;  4Y6W A;  3NOC D;  2PQR A;  3EDT B;  4GML A;  3MJW A;  1LD8 A;  1U3D A;  3U9W A;  4B94 A;  3APD A;  4AVX A;  3CVX A;  2Y3A A;  4M7C A;  3FH5 A;  4YVQ C;  1DNP A;  2XCB A;  5FQ6 A;  4JZY A;  4YDY A;  2H6G A;  3JXI A;  4DLQ A;  4UI9 K;  2WXG A;  4A3T A;  1ELW A;  4U95 D;  1O1T A;  3SNX A;  4EZJ A;  2VQ2 A;  4AOF A;  4Z68 A;  4BT9 A;  3GZ1 A;  3NQP A;  3BUA A;  1N11 A;  3KD7 A;  3RO2 A;  4KVM A;  4G8K A;  1UN9 A;  2DWZ A;  3RIB A;  2ZIS A;  3DBS A;  4BEP A;  3Q49 B;  5B1A E;  2EIL E;  4BET A;  2KCK A;  2EIJ E;  3SBT B;  1QBQ A;  1Z3X A;  3IHV A;  3LJN A;  4LG6 A;  4TRQ A;  2A5E A;  2YNQ A;  1N94 A;  5CEA A;  3CVP A;  2ZGG A;  3UT8 A;  4BT8 A;  4CDN A;  4E85 A;  3SBS A;  1MJ0 A;  4B89 A;  3QC1 A;  3L6A A;  3CEQ A;  2HE0 A;  3D9P A;  3URZ A;  5D0Q D;  5IY5 E;  2FO7 A;  3HG0 D;  1ZB1 A;  1AP7 A;  1D8D A;  3G2T A;  4Q96 A;  2LO6 A;  2X38 A;  4PS7 A;  1H2U A;  3ZUV B;  2P58 C;  5ENN A;  3D9N A;  3L54 A;  3AS4 A;  2DVW A;  1NA3 A;  4FLH A;  1K8K G;  4LCT A;  4IN3 B;  3ABK E;  1QYM A;  3P2B A;  3SHF A;  5LCW C;  1BI7 B;  4AIF A;  4UWL A;  1U3C A;  1SW6 A;  4JEU A;  1HZ4 A;  2X6J A;  3IHY A;  1K1B A;  2XEH A;  3AU4 A;  1FT1 A;  2XEN A;  2KAT A;  3ZHE B;  4CZ2 D;  2DYR E;  4HLE A;  5JJT A;  4GTP A;  3TWX A;  2M63 A;  4CDM A;  1SA4 A;  4GZD A;  1SQM A;  3IKO B;  3G2V A;  1N95 A;  3ZU7 B;  3E37 A;  1D8E A;  3AG1 E;  4XIF A;  5JJ7 A;  3EHR A;  5EKQ D;  3RK6 A;  4HOR A;  3QDN A;  1H19 A;  3CVL A;  3APC A;  4BX9 A;  3O4Z A;  4TXR A;  5FWQ A;  4B8A A;  3VTX A;  1EDU A;  5FIN A;  5CMY A;  3FTZ A;  5BPP A;  3MA5 A;  5FJY A;  4EPZ A;  2V5Q C;  2OND A;  3CQC B;  1U2V G;  4FLB A;  1KT1 A;  4XX5 A;  3DXM G;  4U96 D;  3LY9 A;  2WXP A;  5FT9 A;  3JQ1 A;  3SI5 A;  4J7W A;  1EF1 C;  1OCR E;  2VGY A;  3DRA A;  4NRH B;  3L82 A;  3R7R A;  5LFA A;  1JWG A;  1TNU A;  2CFU A;  4UQZ A;  1UJJ A;  2P2C P;  3CVY A;  4F6R D;  4GCO A;  4ACL A;  1TNB A;  3U66 A;  1SA5 A;  4GTQ A;  2QYU A;  2L0I A;  2WXH A;  3FU3 A;  1TJC A;  2EIK E;  4MKT A;  2OVF A;  2XHE A;  3UIP C;  4OAV B;  3ZKJ A;  1HH8 A;  3TWQ A;  4KMO A;  5CHE E;  5E76 A;  5FQ8 A;  2IF4 A;  5M72 A;  2LAI A;  4GB9 A;  1DC2 A;  3AG3 E;  4I43 A;  4WNF A;  4C48 B;  2R02 A;  3FTW A;  3IEG A;  3EHN A;  4JW1 A;  3HYM B;  2C2L A;  3VLD A;  3SGH A;  2AWI A;  1IQR A;  3UT4 A;  4HOQ A;  2CHW A;  4R7L A;  2XQ0 A;  4WNG A;  2WMO A;  3QWV A;  4D10 C;  4ILG A;  4HNA D;  5HRY A;  5LOZ A;  1IHB A;  4YDO A;  4UQX A;  1N0R A;  3LCA A;  2UY1 A;  1BLX B;  3KAE A;  3CV0 A;  1OXJ A;  3Q5M A;  3RJV A;  2LSV A;  4PDX A;  4CGW A;  1FT2 A;  3AG4 E;  5AEN A;  3LDZ A;  2AXZ A;  4PH4 B;  1DVP A;  1S70 B;  2WQ6 A;  2RD0 A;  3FUJ A;  2IO3 C;  4LNG A;  5EID A;  3CQG B;  1NP7 A;  4UI9 C;  3OXG A;  3B13 A;  1WG0 A;  3ENE A;  5EDS A;  4LSZ E;  4QFV A;  5ANL A;  3KEA A;  4QQI A;  3ONL A;  2J8S D;  2XGO A;  3KEZ A;  4G24 A;  4GZ3 A;  3L17 A;  5FTP A;  4G23 A;  4J6I A;  5CRU A;  4UUC A;  3JUI A;  1BU9 A;  3LY8 A;  1E8W A;  1KZO A;  3UQ3 A;  2VSY A;  4ATG A;  2VTB A;  3MCX A;  3DST A;  1WM5 A;  4I6G A;  3SY2 A;  2ZXW E;  3PUK A;  5G55 A;  1OY3 D;  3L13 A;  2I9C A;  1JCQ A;  1BI8 B;  3UM2 A;  5CRV A;  2PZI A;  5KNH D;  3E33 A;  4B0Z A;  4U0U A;  4NAC A;  3PZ1 A;  4H7Y A;  3QAQ A;  1X81 A;  4HS2 A;  5LP0 A;  2DYS E;  2I1J A;  2QC9 A;  2HYZ A;  4L1B A;  3DWL G;  1XGW A;  1FPP A;  4G11 A;  3LVR E;  4F3V A;  3TJP A;  4XEI G;  3ZYK A;  2C0M A;  4IYP A;  3KSQ A;  2XEV A;  2MRI A;  1WY6 A;  3PE3 A;  2I6H A;  3L9T A;  2UY1 B;  2VJ8 A;  4G26 A;  3V79 K;  2BKK B;  1N0Q A;  4KXK B;  1NFI E;  2GGF A;  3HXB A;  3RAU A;  1HU3 A;  5AJL A;  3MKQ B;  1MYO A;  2XZD G;  4EEC A;  3CKC A;  4O6F A;  4KYO B;  4HOT A;  3KSL A;  3TWS A;  3PRE A;  1E7V A;  3CVQ A;  5D66 A;  3WG7 E;  4A3V A;  1Z5S C;  2FI7 A;  3NOG D;  1HG2 A;  3ASO E;  3ZW3 A;  4AM9 A;  1H2V C;  1Y8M A;  2WXO A;  3PZD A;  3TXN A;  2WPV A;  3PE4 A;  4LRZ A;  1K1A A;  3ZGQ A;  2V4L A;  4YND A;  3MZL B;  3RRM B;  2RG8 A;  5CBN A;  5JJ6 A;  3FTS A;  2J49 A;  3LJ3 A;  3TWT A;  3U4T A;  4GZC A;  4F53 A;  1E96 B;  3G2W A;  1KPS B;  3W9G A;  1YYH A;  4LEU A;  2P9I G;  5CEC B;  2H6F A;  4ZHB A;  2R05 A;  1TN6 A;  4HI8 A;  1WAO 1;  4KBQ A;  3CHR A;  3AAA C;  3FUM A;  1QNF A;  3C98 A;  4EBA G;  2AJA A;  4FHK A;  3HRA A;  4JEH A;  3NZU A;  2X6I A;  5G04 C;  2L0T B;  3ULE G;  3UM1 A;  2XRZ A;  3ESK A;  1H6K A;  4N39 A;  2P9P G;  4G1T A;  4C0E A;  4U0S A;  1IYG A;  2B0O E;  3S7D A;  5KNG A;  3GW4 A;  3CK9 A;  3ZFW A;  4HOU A;  3EIQ C;  2WQH A;  2QY7 A;  1BPO A;  2R59 A;  2J07 A;  3DPY A;  5JMN D;  1IHG A;  4JVS A;  4APF A;  3WXX A;  4N2Q A;  4KVO A;  3UPV A;  4GPM A;  2J09 A;  3N71 A;  1N4Q A;  3EHQ A;  1SZ9 A;  3NB2 A;  3OXF A;  1IQU A;  1TN7 A;  3ABM E;  5ENP D;  2ETC A;  2NXP A;  4N5C A;  1JUQ A;  4J8F A;  2F0Y A;  4MBG A;  3DSS A;  3LVQ E;  1KT0 A;  1NL4 A;  5KBA A;  4DJA A;  5ANR A;  4ATZ D;  3CIA A;  5HKP A;  5G05 J;  4K5A B;  3UX4 A;  4I1A A;  3TG4 A;  4WWN A;  5DBK A;  4K0R A;  3D3M A;  2IOS A;  2MOW A;  3E34 A;  3L22 A;  4PS3 A;  4LNB A;  3TWW A;  5J90 A;  3SFY A;  1NI1 A;  4K5C A;  1OWP A;  4GYY A;  3CST A;  2OEV A;  4HBD A;  2LXL A;  1A17 A;  3FUH A;  2WXM A;  4UQY A;  4URK A;  3C5R A;  4HB5 A;  1VDY A;  3T8M A;  4N3A A;  2GRO B;  3CKB A;  3ZVV A;  1HF8 A;  2R17 C;  2XPI A;  4GTR A;  3C3Q A;  2FUL A;  4L7T A;  2IQC A;  1JCR A;  5CER B;  3TGO A;  2CHX A;  4XKC A;  1KLX A;  5HI7 A;  4BY6 A;  3SFZ A;  1OCC E;  3FEY A;  4BSX A;  5EIL A;  3D9J A;  4C0M A;  5KWD A;  3LS8 A;  4Q69 A;  2BTD A;  4DI4 A;  5BUZ A;  1O1R A;  3S7B A;  4EBA A;  4J8S A;  2EQX A;  2KBX A;  5AJD A;  3LY7 A;  3GZ2 A;  4OVU A;  2XGM A;  4TUU A;  2XZT G;  5AQA A;  3PZ3 A;  2X3M A;  4U63 A;  1PAQ A;  4MLP A;  3Q79 A;  1Z3Y A;  3C3O A;  1XNF A;  2ZIR A;  3FTX A;  4IUL A;  3P1U A;  3PS6 A;  4F7A A;  1OCO E;  5KJK A;  3VLE A;  2IU1 A;  4HQD A;  2OOE A;  4RG9 A;  3ZXP A;  2BUG A;  5HQ8 A;  3PUJ A;  1OWN A;  2ETB A;  1B89 A;  3ZRH A;  1JCS A;  3TWU A;  1OUV A;  3DSW A;  4FJY A;  4G2V A;  4RVB A;  2Y4T A;  3T5X A;  5T3R A;  3L08 A;  4CGV A;  5JHA A;  2PM6 A;  4DX5 D;  4KT6 B;  4I9E A;  3ZN3 A;  2IFU A;  1HO8 A;  1TNO A;  4JHJ A;  3CVN A;  4L23 A;  3CHM A;  4DX2 A;  1S64 A;  3T9K A;  4TXP A;  4U07 A;  4RSY A;  3D9H A;  4ANW A;  5LCW J;  3FEX A;  3B7U X;  4MS6 A;  1GW6 A;  3EU5 A;  3LPZ A;  2GRN B;  1N4R A;  1AWC B;  1PC2 A;  3UKR G;  2YHE A;  3UIN C;  2X6H A;  3RO3 A;  1MX6 A;  5ARF A;  3HIZ A;  3U64 A;  3NBN B;  1OCZ E;  3GYZ A;  2F8X K;  4JD2 G;  4XI0 A;  3D9I A;  3PVL A;  4H7X A;  4B8C B;  3U3W A;  4IRU A;  4NUR A;  4FP7 A;  3X2Q E;  4DLO A;  5EYP F;  4N2S A;  4GZ6 A;  3QWP A;  1E8Z A;  2ION A;  3ABL E;  2KM4 A;  3UM0 A;  3B7T A;  3L16 A;  5HS0 A;  1UG3 A;  2L9B A;  4OYS A;  4DX7 D;  2WXJ A; 
#chains in the Genus database with same CATH homology
 3KSQ A;  1FT2 A;  1TNZ A;  3HXE A;  4GTR A;  3DRA A;  2H6G A;  1KZP A;  1TN8 A;  3HXB A;  1JCR A;  4LNG A;  1S63 A;  1TNO A;  4EHM A;  3HXC A;  1N9A A;  1MZC A;  1TNU A;  3Q78 A;  3Q7A A;  1S64 A;  1DCE A;  1O1T A;  2BED A;  3Q75 A;  3SFX A;  3KSL A;  4GTT A;  3DPY A;  1TNB A;  1SA5 A;  4GTQ A;  1O1R A;  3EU5 A;  3DSU A;  1FT1 A;  1N4Q A;  4GTM A;  1N4R A;  3DSV A;  3E32 A;  2ZIS A;  1N4P A;  4GTP A;  1TN7 A;  1KZO A;  1SA4 A;  3PZ4 A;  1QBQ A;  4GTS A;  4L9P A;  2F0Y A;  1O5M A;  2R2L A;  3PZ2 A;  4MBG A;  3DSS A;  3HXD A;  1LTX A;  3DST A;  1N94 A;  1NL4 A;  1TNY A;  1N95 A;  4YDE A;  3E37 A;  3PZ3 A;  3C72 A;  1D8E A;  4GTV A;  3Q79 A;  2IEJ A;  1JCQ A;  2ZIR A;  3EUV A;  3E34 A;  4GTO A;  3E33 A;  2H6H A;  3HXF A;  4LNB A;  1LD7 A;  3DSX A;  3PZ1 A;  2H6F A;  4YDO A;  1X81 A;  1TN6 A;  1NI1 A;  3E30 A;  3SFY A;  3Q73 A;  1N4S A;  1JCS A;  1FPP A;  3DSW A;  1LD8 A;  1O1S A;  2H6I A;  3Q7F A;  1D8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...