1N4QA

Protein geranylgeranyltransferase type-i complexed with a ggpp analog and a kkksktkcvil peptide
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of mammalian protein geranylgeranyltransferase type-I
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
total genus 124
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n4qA00
1N4SA 1SA5A 1S64A 1QBQA 1NL4A 1O1RA 1FT2A 3EU5A 3DRAA 1O1SA 2BEDA 1KZPA 1TNBA 2ZIRA 3SFXA 1LD8A 2ZISA 4YDOA 4GTSA 1O1TA 1LD7A 3DSWA 3KSQA 3SFYA 3PZ1A 4EHMA 1O5MA 3E34A 1D8EA 3DPYA 2R2LA 3KSLA 3DSVA 3Q73A 3E30A 3HXFA 3Q75A 1N94A 1TNUA 3HXBA 1JCQA 1KZOA 3PZ3A 4LNGA 1TN7A 3E37A 4GTOA 3DSXA 3PZ2A 1TNOA 1N4PA 1X81A 2H6IA 3C72A 3DSTA 4GTQA 1TN8A 1TNYA 2H6FA 2IEJA 4GTRA 1DCEA 1TNZA 4GTTA 1N4QA 1FPPA 1MZCA 1S63A 3HXEA 3HXCA 1D8DA 1TN6A 1NI1A 1JCSA 3PZ4A 3EUVA 2F0YA 3DSSA 3HXDA 3E32A 4YDEA 3DSUA 4LNBA 1N9AA 4GTMA 3Q7FA 4GTVA 4GTPA 4L9PA 2H6GA 1N95A 3Q78A 1JCRA 3E33A 3Q7AA 1FT1A 4MBGA 2H6HA 1LTXA 3Q79A 1N4RA 1SA4A
chains in the Genus database with same CATH superfamily
4KZ0A 3KAEA 4WWPA 3D9KA 4AM9A 3UM0A 1FT2A 3DXKG 4FADA 4BT9A 3ONLA 3B7BA 2DYRE 4G11A 3JQ1A 3CVUA 4DPRA 2HM8A 2FI7A 3J5PA 5LCWJ 5G05C 3RKVA 2JEKA 3E34A 3R9MA 5E75A 3B7RL 4A1GA 3CK9A 1AWCB 4FP7A 2QY7A 3PNTB 4HLLA 1FCHA 2WXOA 1JCQA 2KATA 1KZOA 4V3IA 3NBNB 4HRLA 5CBOA 3UX4A 1H2UA 1SW6A 3UM3A 3PZ2A 5FJYA 4JHKA 4U96D 3TG4A 3QKYA 3MKQB 2XGOA 1ZB1A 1FPPA 3FULA 3N71A 2RKKA 1JCSA 4WWNA 4I2WA 1EYHA 2CFZA 3PVLA 4GCNA 1YYHA 4WNGA 3MEKA 3ZN3A 1ZBPA 3AS8A 4J0UA 3T5VA 4GTMA 4JA7A 2DZOA 4X8QA 3ZYMA 4G8LA 1BI8B 4TV3A 1MX2A 3F6QA 4I2ZA 2GW1A 2WXHA 4GCOA 4G24A 3PNLB 3ULQA 4CCAA 3S7FA 2KZTB 1N4SA 1EPUA 4CRWA 5KJMA 2VJ8A 2VSOE 2Y3AA 2CG2A 2X6IA 4LG6A 4L2LA 1B89A 4U7EB 4HOTA 3HRAA 3FTSA 3AG2E 4HRMB 4GTSA 2OV8A 1LF8A 4ANXA 3ZXSA 3MX3A 4DJAA 4L1BA 4O6FA 4FA6A 1OWPA 3RRNB 1D8EA 3KD7A 3FDHA 3DPYA 3FEYA 4XI9A 3ZKJA 3DSVA 3E30A 3L54A 4JEHA 3R7QA 4BX8A 3ZRHA 3TAXA 4D10C 5CERB 2XEEA 3OXGA 1EDUA 3HHMA 5BV0A 1MHQA 1YA0A 5ITZF 1Q2ZA 3C98A 2WXMA 4G23A 2X6KA 5G05J 3SNXA 4U63A 3ASOE 1PC2A 1TJCA 2UY1A 3SHFA 2QC9A 2GRRB 1OT8A 2A4ZA 3FTWA 4HI8A 2WXPA 2R03A 2VTBA 3NQPA 5FWQA 4F53A 2UY1B 3D9OA 3MKQA 1XGWA 4I17A 3HXDA 3AS5A 3LVQE 2MRIA 4TUUA 3L6AA 2BKGA 4C0EA 4GU5A 3C3OA 3HIZA 3T8KA 4EQFA 1OCCE 1KPSB 3OXLA 2LAHA 3AU5A 2VYIA 1NL4A 4AP2A 3EU5A 1SZ9A 4FLHA 1NP7A 4JD2G 2BEDA 4GA1A 3D9NA 1LD7A 5ENSD 2OVBA 5G04J 4N5CA 5EYPF 3TGOA 4BESA 2VSYA 4N3BA 2GROB 2MHKA 3FUEA 2WB2A 3SO8A 3MV2B 3QK0A 3PE4A 3GYZA 2OEWA 4PS3A 4DX1A 3FY4A 4YNDA 2H6FA 2Y0BG 2XGMA 1OWOA 5BXUA 4OVUA 3TWSA 1MZCA 4I6GA 4LEUA 4G8KA 2AXVA 3ABKE 3P1UA 1IXVA 4ZFHA 1K1AA 2WXQA 3LDZA 1N0QA 2CFUA 1DC2A 5AQ9A 3Q78A 3TJPA 2EIKE 4FC8A 4JZYA 2XQ0A 1OCRE 3BUAA 1S64A 2L9BA 3I4RB 4K5CA 2CG3A 2DIWA 4F7AA 4PH4B 2ZIRA 2LO6A 3T8MA 4CGWA 3JUEA 4BSXA 4BSZB 5LFAA 3BEEA 1IYGA 1BLXB 4ILGA 2WXGA 2GRPB 1HH8A 4HOUA 2KC7A 3DWLG 3SGHA 4AV7A 1N11A 4DK5A 5EX3A 3HXFA 4R7LA 2XPIA 2MYOA 2R02A 5IY5E 4XEIG 4LCTA 5FQ4A 3PE3A 2KM4A 3ABLE 3IXEA 3NZSA 2FULA 5EILA 2FF4A 1SQMA 2XHEA 3ABME 3JQ0A 4FULA 1TEZA 2AW6A 2ZGDA 3FFLA 4KMOA 5ENTD 3Q47B 5EIDA 4LUNU 4EZKA 4JVSA 3JXJA 3DPDA 2I9CA 4UQZA 4CDRA 2F8XK 2GRMA 2PL2A 4DX6D 3X2QE 4JL0A 3CQGB 3SFZA 1H19A 1E8YA 2DVWA 4JPSA 3QWPA 5BT1A 3L08A 3CGHA 1N95A 1JCRA 3QAQA 4I6JA 2ONDA 2LSUA 3MKRA 3LY8A 3NZUA 3DEOA 4ABNA 5B3SE 3T5XA 4CGVA 1OY3D 4JHJA 1H0AA 2UWJG 2ZXWE 4MLPA 1E8ZA 3S7BA 5T3RA 2BF0X 3SI5A 3ZXPA 4J8EA 4U0SA 5BXOA 3FU0A 2XRZA 5FT9A 5G2NA 4PS7A 2YHCA 4RSYA 3R9AB 2J09A 3ZEFA 3ASHA 5A7DB 3CIAA 3ASFA 3CHSA 5KNHD 2IJGX 3PZ3A 2J07A 2M63A 2R59A 3UKRG 2XEHA 3G2VA 4RLYA 3RRUA 3ZGQA 1TR4A 2EIJE 5AN8A 3FH7A 1VDYA 3HXEA 1TN6A 4F1SA 3L82A 3EHQA 2P9LG 1V54E 3CHPA 4KVOA 3SBTB 1HF8A 2J9QA 2PNNA 2WXRA 2Y1LE 5ANLA 3ULYA 4TXQA 2IOLA 4JHRA 4BY6A 5AQAA 1Z3YA 2J4DA 2WXFA 1X5BA 3G2SA 3UI2A 5AJDA 5AQ7A 2X38A 3Q15A 5EYLA 3FEXA 5BNWA 3BG0B 3UXGA 4GZDA 4JW1A 4J8FA 2LAIA 4IYPA 4UI9K 1S0PA 2XZTG 5JHAA 2J8SD 1E90A 4J8SA 3FUNA 3O4ZA 2VTBB 5EIBE 4B89A 2YINA 2BTDA 2P58C 5CRVA 3APDA 3RU0A 5HRYA 3APCA 3CVVA 4RVBA 2IQCA 1N0RA 3SD5A 3EHMA 2KCKA 3UT4A 3LVRE 2X6FA 3UUXA 2GRQB 3FUDA 4U95D 4E85A 1G3NB 5FIOA 5CMWA 1QNFA 1IHGA 4KZCA 3C3RA 3LYAA 5AAOA 2V4LA 3CSTA 4UWKA 2P9KG 1JWFA 1TNYA 1A17A 1H6KA 1MX6A 1JPLA 4ILHB 1UN8A 4LERA 3HXCA 3QNKA 4JXTA 1NI1A 1WG0A 3SZ7A 5EX0A 1GW6A 3APFA 3L17A 2L6BA 3CHMA 4UUCA 2RFMA 4XX5A 1N9AA 4FLBA 4PDXA 3ML9A 3LJ3A 4RG6A 2IOSA 4XKCA 5H7PA 2NYJA 1PY1A 2KXPC 4GYWA 5DIZA 2NC9A 3C3QA 1N4RA 5D0QD 4UWGA 1QBQA 4M7CA 1Z6TA 1HS6A 2DBAA 3IEGA 3LKUA 3O48A 3RIBA 1PAQA 5CCMA 3FUJA 3UINC 3JYSA 3LS8A 3TXNA 3CVLA 4JC8A 1ELKA 3HG0D 4MRUA 3AS4A 1WDYA 2R5SA 3S7JA 5T8IA 4BEPA 2WQ7A 2V4HC 5J90A 4GMLA 3TWTA 4HBDA 4G26A 4AY6A 1X81A 2ETBA 1IKND 2DZNA 2IEJA 3FUKA 4HS2A 3FTUA 3T9KA 2IFUA 2VGYA 3IKOB 5JMND 5JJ7A 4YDEA 2WXKA 4GMJA 4W9RA 4QFVA 2V5FA 4GTPA 3CVQA 3L22A 3FP3A 4EZJA 3R7RA 4NRHB 4F6RD 3QWVA 5G04C 2MOWA 2C0MA 2GRLA 2R05A 4RG9A 4B8AA 3PEVB 3FUMA 4GZCA 1NA3A 4QQIA 4YDYA 4N39A 5CCLA 2CHXA 1HX8A 3U9WA 2X6JA 3MZLB 4ANWA 4WUYA 4CT4A 4Y6WA 4TXRA 3PREA 1U2VG 2ZISA 3UIOC 4N2QA 3PDNA 3ZVVA 5HS0A 3UM1A 3ASNE 2E0IA 4TRQA 2I1JA 3VLDA 5AYWD 3PZ1A 1WY6A 1IQUA 4EBAG 2QYJA 1E96B 2HR2A 3PRZA 5FZSA 2WXLA 3Q73A 3CSFA 4WAFA 1Y6IA 3RK6A 2I1KA 1Z3XA 1RZ4A 5CMYA 3FH5A 2AWIA 3UM2A 5ENRD 2VGEA 4N3AA 1IQRA 2P9IG 5B1AE 2DYSE 5D2MC 3MA5A 3DSTA 1ELRA 4HFGA 3RO3A 3CVNA 3NOGD 2EILE 1HO8A 5EDSA 2LXMA 1RW2A 2V8SE 4OVVA 3I4GA 3ZYKA 1MQSA 2OCCE 3DSUA 2DCPA 2J08A 4EBAA 5BW8C 3KEAA 1BI7B 3TWRA 2GGFA 2OEVA 2Y69E 3FU6A 3E33A 4L2YA 2XPZA 2NXPA 2Y4UA 4Q69A 3Q5MA 5EN5D 1DVPA 2EINE 2LSVA 1O1SA 4FJZA 2IO3C 4CDMA 4OAUC 3I3NA 5B1BE 4AJWA 4K5AB 3G2WA 2IU1A 3CK7A 4WWOA 3CKCA 5ENNA 5JJTA 3EHRA 4ACLA 3IV0A 3G2TA 4XKBA 3RSEG 1N94A 2Y4TA 3TXMA 3CK8A 3NOCD 3UKUG 3OTNA 4XZ4A 3PZDA 2C2LA 3IHVA 4FU3A 2ZU6B 1FVFA 5LCWC 2H6IA 2VSNA 5JHBA 2A5UA 3JCKC 3LPZA 1ELWA 5FQ8A 5CEAA 3D9HA 4NIKA 3LXUX 3ZHEB 1BD8A 4KYOB 4GMRA 2XENA 1UOHA 5C2YA 2XCCA 4LNBA 4DUIA 2PQNA 2XZDG 3MCXA 3HDXA 4WNEA 4GTVA 3ASGA 1QQEA 2RD0A 3CVPA 3UIPC 1EF1C 4NACA 3PEUB 3W9GA 2A5EA 2LUHA 2IF4A 4UWLA 1N54A 2WXJA 4ANUA 3B7UX 4HOSA 3DRAA 4HI9A 1KZPA 3FUIA 5AJLA 2RFAA 3DXMG 4JEUA 4KVMA 4AXHA 4HRNA 3B7SA 4URKA 4UQYA 5KCMA 1HE8A 4EHMA 2PM7A 5ENPD 1JUQA 4HB5A 2DWZA 2YQ8A 3ZIMA 3TWWA 3V31A 3TL5A 3PH0C 3Q49B 1NFIE 4KXKB 3JXIA 4L23A 2XEVA 1TN7A 4K5BA 1UG3A 1TNOA 3S7DA 4DI3A 5LX8A 4CEMA 5ARFA 3PUJA 3DEPA 4F1PA 3KS2A 4UI9J 3SF4A 4ACKA 4A3VA 4UWFA 1P5QA 2I2OA 3FTXA 3TG5A 5E76A 2LXLA 1S70B 3CVYA 2WPVA 1H6PA 3WG7E 3ZHEA 4BETA 4UI9C 2WVIA 4PUCA 1UN9A 1UJJA 3Q79A 3BQOA 1SA4A 4TUMA 4C48B 2JABA 3IBEA 4O1PA 3ASDA 5CRUA 1TJFA 3U66A 4CZ2D 4G2VA 3D9LA 1K8KG 3S2AA 1U3DA 1LD8A 4YDOA 2X6HA 1AP7A 4E6HA 3PS6A 5KNGA 3QC1A 4XE0A 5FZQA 2R2LA 4YDWA 4MS6A 3C5RA 2L0TB 2XS8A 3NF1A 4U0UA 4ILIA 4DRXE 3V30A 3RO2A 3CVXA 3E37A 2VQ2A 3BU8A 1MYOA 3DSXA 3CKBA 1OWLA 3D9MA 2VSXE 4BTBA 4YVOA 1DCEA 3U3WA 2AJAA 3Q9NC 3V79K 1HG5A 3RRMB 4J7WA 1K3ZD 1OWMA 5AIJA 3LJNA 2OVFA 4JB8P 2P2CP 2RG8A 2WXIA 4HQDA 5CECB 4YVQC 4ANVA 3CHRA 1Y8MA 5ANRA 2WM9A 2WMNA 3ONKA 4C9BB 4TXPA 3L16A 4L9PA 5ENQD 1NA0A 3L9TA 3ZNGA 1E7VA 2BUGA 2FO7A 3QJZA 1OWNA 5BUZA 1HG2A 1TNBA 2KCVA 1HFAA 4Q96A 4HOQA 2HO1A 4F3VA 1L5JA 2ZGGA 1IHBA 1UW4B 4I1OB 4HORA 3KSQA 2ETCA 4BWRA 3AG4E 5KJLA 2PM6A 4GZ6A 1BU9A 3ZUVB 2IONA 3CHOA 5G55A 5FQ6A 3ULEG 4HVBA 4IRUA 3CR3A 5HI7A 3D3MA 3ML8A 4GB9A 2QYUA 2QZAA 1N4PA 2WQ6A 3NB2A 4GTRA 1KLXA 1W3BA 1N4QA 2X3MA 2AVPA 3FU3A 1D8DA 3UTMA 3UMVA 4APOA 4DX7D 3ZU7B 3D9IA 4FJYA 3ZFWA 4APFA 3NAWA 1WAO1 3BG1B 3EJNA 3E32A 5BPPA 3TWQA 3B13A 2CHWA 1YMPA 4WNFA 4I9CA 3CLJA 4M3OA 5FINA 4AOFA 3K9IA 4OYSA 4GPKA 4MBGA 2H6HA 3G2UA 5A23A 1K1BA 3D9JA 4EPZA 4Y6CA 3ESLA 4A55A 4ZHBA 4Q94A 3LEWA 4GYOA 3SFXA 3FTZA 1KT1A 3ISMC 1O1TA 3VLEA 2F37A 2P9PG 3B95A 3VLFA 5D66A 3RJVA 2Q7FA 3DSWA 5JJ6A 3OXFA 1UJKA 2I6HA 4DX5D 3PUKA 5BV1A 3GW4A 3QB2A 1TNUA 5C1DA 4HXIA 1U3CA 1A5EA 3FUHA 4KT6B 4U8VD 2P9UG 2J49A 3V2XA 1OUVA 4U8HA 1H2TC 3W9FA 4U07A 5KJNA 2B6CA 3MJWA 1FVHA 3TWVA 5J08A 1HXIA 3C72A 5LOZA 1TN8A 5DBKA 3QDNA 4GTTA 3AJIA 4J8YA 2AXZA 1INZA 3LCAA 4DX2A 4GZ3A 3EUVA 2BKKB 4GZ5A 5CBNA 4GA2A 3FUFA 4XI0A 2FBNA 1DNPA 5CEDB 3IHYA 2YNQA 4K03A 4DI4A 2C0LA 4J8DA 1MX4A 3I5PA 5FQ7A 3AU4A 5HQ8A 2HE0A 1LTXA 2XGSA 3DBSA 2EQXA 4N3CA 2OOEA 4B8CB 3TWXA 2YHEA 1ZU2A 1SA5A 4L7TA 4LRZA 3FTVA 1O1RA 5A6CA 2PQRA 2XS1A 1DCQA 3AG3E 4NQ0A 3SFYA 3FHEA 3CHQA 4J6IA 3JUIA 4LSZE 4I1MA 3WXXA 3EU9A 3Q75A 5KBAA 3ZW3A 2LNIA 4UWHA 5T4YA 5AENA 4HNAD 3SQVA 3UT8A 4N2SA 5LP0A 2E2EA 3U4TA 4C0MA 4GTOA 4HLEA 4ATGA 5EKQD 1QZ2A 5M72A 2CHZA 4GTQA 3TWUA 5KWDA 2B0OE 4A1SA 4DLOA 4BFRA 3QARA 3URZA 2V0PA 3Q4AB 1XNFA 2EIME 4H7XA 3VTXA 2P9SG 4BERA 1SZAA 3UPVA 2KZTA 4ME2A 3GZ1A 2GRNB 4I6EA 3SBSA 5HKPA 3GZ2A 4U8YD 4GAAA 3J5QB 4BT8A 4AEZC 2J4BA 1FT1A 3FU5A 3QOUA 5FTPA 1E7UA 1NZNA 3ENEA 3CV0A 2WMOA 2FO1E 4K0RA 1OCOE 2NSZA 1E8XA 4LNUD 4GPMA 4O60A 3ZPJA 1HU3A 1D9SA 4UQXA 1O5MA 2WQHA 2ETAA 3EHNA 4G25A 4NURA 3GZSA 2KCLA 4G1TA 4I1AA 3MV3B 1KT0A 3HXBA 3CQCB 4FHKA 4KBQA 3B7TA 4B94A 4LNGA 4WNDA 1WM5A 1TYQG 3ZYQA 3LY9A 3KEZA 4ATZD 3P2BA 3LY7A 5FZRA 4H7YA 2PZIA 4IULA 1TNZA 4EECA 1SVXA 1YCSB 1MJ0A 2XCBA 4CYMD 4B93B 3D9PA 3PZ4A 4DLQA 2HYZA 4AVXA 2F0YA 3FH8A 1H6OA 3Q9UC 3HYMB 5ARGA 4O1OA 3FTYA 5KJKA 1N52A 2F8YA 3ZYLA 4CT0A 1JWGA 3Q7FA 3CEQA 4FHJA 3V2OA 4U04A 2H6GA 3E4BA 3ESKA 3Q7AA 3AG1E 4P29A 2R17C 2VGXB 2IY0C 2IO2C 4N5QA 4BTAA 4XIFA 3UQ3A 4IN3B 4GA0A 1H2VC 3HVEA 3UT7A 5AARA 5CHEE 4CDNA 3L13A 1OCZE 3HVEB 4I43A 3U64A 3OAWA 2FEZA 2VGXA 4BX9A 2AXUA 2KBXA 3KSLA 2QFCA 5AQBA 4A63B 4A3TA 4EZLA 2L6JA 1Z5SC 1QYMA 3RAUA 4PS8A 3QWWA 3EIQC 2V5QC 5JA4D 1V55E 3VTYA 3EIJA 3MGBA 2WXNA 4AY5A 3SY2A 3AAAC 1S63A 2XPYA 1HZ4A 5ENOD 4MKTA 2L0IA 3FWVA 3EDTB 2P9NG 4I9EA 3DSSA 5D0OD 3MYVA 4Z68A 4GYYA 3CVWA 1OXJA 4U0ZA 2ILRA 4B0ZA 1E8WA 2JLBA 4RQIA 1BPOA 4AIFA 4OAVB 2XRYA 4JA9A
chains in the Genus database with same CATH topology
1N4SA 1SA5A 1S64A 1QBQA 1NL4A 1O1RA 1FT2A 3EU5A 3DRAA 1O1SA 2BEDA 1KZPA 1TNBA 2ZIRA 3SFXA 1LD8A 2ZISA 4YDOA 4GTSA 1O1TA 1LD7A 3DSWA 3KSQA 3SFYA 3PZ1A 4EHMA 1O5MA 3E34A 1D8EA 3DPYA 2R2LA 3KSLA 3DSVA 3Q73A 3E30A 3HXFA 3Q75A 1N94A 1TNUA 3HXBA 1JCQA 1KZOA 3PZ3A 4LNGA 1TN7A 3E37A 4GTOA 3DSXA 3PZ2A 1TNOA 1N4PA 1X81A 2H6IA 3C72A 3DSTA 4GTQA 1TN8A 1TNYA 2H6FA 2IEJA 4GTRA 1DCEA 1TNZA 4GTTA 1N4QA 1FPPA 1MZCA 1S63A 3HXEA 3HXCA 1D8DA 1TN6A 1NI1A 1JCSA 3PZ4A 3EUVA 2F0YA 3DSSA 3HXDA 3E32A 4YDEA 3DSUA 4LNBA 1N9AA 4GTMA 3Q7FA 4GTVA 4GTPA 4L9PA 2H6GA 1N95A 3Q78A 1JCRA 3E33A 3Q7AA 1FT1A 4MBGA 2H6HA 1LTXA 3Q79A 1N4RA 1SA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4S A;  1SA5 A;  1S64 A;  1QBQ A;  1NL4 A;  1O1R A;  1FT2 A;  3EU5 A;  3DRA A;  1O1S A;  2BED A;  1KZP A;  1TNB A;  2ZIR A;  3SFX A;  1LD8 A;  2ZIS A;  4YDO A;  4GTS A;  1O1T A;  1LD7 A;  3DSW A;  3KSQ A;  3SFY A;  3PZ1 A;  4EHM A;  1O5M A;  3E34 A;  1D8E A;  3DPY A;  2R2L A;  3KSL A;  3DSV A;  3Q73 A;  3E30 A;  3HXF A;  3Q75 A;  1N94 A;  1TNU A;  3HXB A;  1JCQ A;  1KZO A;  3PZ3 A;  4LNG A;  1TN7 A;  3E37 A;  4GTO A;  3DSX A;  3PZ2 A;  1TNO A;  1N4P A;  1X81 A;  2H6I A;  3C72 A;  3DST A;  4GTQ A;  1TN8 A;  1TNY A;  2H6F A;  2IEJ A;  4GTR A;  1DCE A;  1TNZ A;  4GTT A;  1N4Q A;  1FPP A;  1MZC A;  1S63 A;  3HXE A;  3HXC A;  1D8D A;  1TN6 A;  1NI1 A;  1JCS A;  3PZ4 A;  3EUV A;  2F0Y A;  3DSS A;  3HXD A;  3E32 A;  4YDE A;  3DSU A;  4LNB A;  1N9A A;  4GTM A;  3Q7F A;  4GTV A;  4GTP A;  4L9P A;  2H6G A;  1N95 A;  3Q78 A;  1JCR A;  3E33 A;  3Q7A A;  1FT1 A;  4MBG A;  2H6H A;  1LTX A;  3Q79 A;  1N4R A;  1SA4 A; 
#chains in the Genus database with same CATH topology
 4KZ0 A;  3KAE A;  4WWP A;  3D9K A;  4AM9 A;  3UM0 A;  1FT2 A;  3DXK G;  4FAD A;  4BT9 A;  3ONL A;  3B7B A;  2DYR E;  4G11 A;  3JQ1 A;  3CVU A;  4DPR A;  2HM8 A;  2FI7 A;  3J5P A;  5LCW J;  5G05 C;  3RKV A;  2JEK A;  3E34 A;  3R9M A;  5E75 A;  3B7R L;  4A1G A;  3CK9 A;  1AWC B;  4FP7 A;  2QY7 A;  3PNT B;  4HLL A;  1FCH A;  2WXO A;  1JCQ A;  2KAT A;  1KZO A;  4V3I A;  3NBN B;  4HRL A;  5CBO A;  3UX4 A;  1H2U A;  1SW6 A;  3UM3 A;  3PZ2 A;  5FJY A;  4JHK A;  4U96 D;  3TG4 A;  3QKY A;  3MKQ B;  2XGO A;  1ZB1 A;  1FPP A;  3FUL A;  3N71 A;  2RKK A;  1JCS A;  4WWN A;  4I2W A;  1EYH A;  2CFZ A;  3PVL A;  4GCN A;  1YYH A;  4WNG A;  3MEK A;  3ZN3 A;  1ZBP A;  3AS8 A;  4J0U A;  3T5V A;  4GTM A;  4JA7 A;  2DZO A;  4X8Q A;  3ZYM A;  4G8L A;  1BI8 B;  4TV3 A;  1MX2 A;  3F6Q A;  4I2Z A;  2GW1 A;  2WXH A;  4GCO A;  4G24 A;  3PNL B;  3ULQ A;  4CCA A;  3S7F A;  2KZT B;  1N4S A;  1EPU A;  4CRW A;  5KJM A;  2VJ8 A;  2VSO E;  2Y3A A;  2CG2 A;  2X6I A;  4LG6 A;  4L2L A;  1B89 A;  4U7E B;  4HOT A;  3HRA A;  3FTS A;  3AG2 E;  4HRM B;  4GTS A;  2OV8 A;  1LF8 A;  4ANX A;  3ZXS A;  3MX3 A;  4DJA A;  4L1B A;  4O6F A;  4FA6 A;  1OWP A;  3RRN B;  1D8E A;  3KD7 A;  3FDH A;  3DPY A;  3FEY A;  4XI9 A;  3ZKJ A;  3DSV A;  3E30 A;  3L54 A;  4JEH A;  3R7Q A;  4BX8 A;  3ZRH A;  3TAX A;  4D10 C;  5CER B;  2XEE A;  3OXG A;  1EDU A;  3HHM A;  5BV0 A;  1MHQ A;  1YA0 A;  5ITZ F;  1Q2Z A;  3C98 A;  2WXM A;  4G23 A;  2X6K A;  5G05 J;  3SNX A;  4U63 A;  3ASO E;  1PC2 A;  1TJC A;  2UY1 A;  3SHF A;  2QC9 A;  2GRR B;  1OT8 A;  2A4Z A;  3FTW A;  4HI8 A;  2WXP A;  2R03 A;  2VTB A;  3NQP A;  5FWQ A;  4F53 A;  2UY1 B;  3D9O A;  3MKQ A;  1XGW A;  4I17 A;  3HXD A;  3AS5 A;  3LVQ E;  2MRI A;  4TUU A;  3L6A A;  2BKG A;  4C0E A;  4GU5 A;  3C3O A;  3HIZ A;  3T8K A;  4EQF A;  1OCC E;  1KPS B;  3OXL A;  2LAH A;  3AU5 A;  2VYI A;  1NL4 A;  4AP2 A;  3EU5 A;  1SZ9 A;  4FLH A;  1NP7 A;  4JD2 G;  2BED A;  4GA1 A;  3D9N A;  1LD7 A;  5ENS D;  2OVB A;  5G04 J;  4N5C A;  5EYP F;  3TGO A;  4BES A;  2VSY A;  4N3B A;  2GRO B;  2MHK A;  3FUE A;  2WB2 A;  3SO8 A;  3MV2 B;  3QK0 A;  3PE4 A;  3GYZ A;  2OEW A;  4PS3 A;  4DX1 A;  3FY4 A;  4YND A;  2H6F A;  2Y0B G;  2XGM A;  1OWO A;  5BXU A;  4OVU A;  3TWS A;  1MZC A;  4I6G A;  4LEU A;  4G8K A;  2AXV A;  3ABK E;  3P1U A;  1IXV A;  4ZFH A;  1K1A A;  2WXQ A;  3LDZ A;  1N0Q A;  2CFU A;  1DC2 A;  5AQ9 A;  3Q78 A;  3TJP A;  2EIK E;  4FC8 A;  4JZY A;  2XQ0 A;  1OCR E;  3BUA A;  1S64 A;  2L9B A;  3I4R B;  4K5C A;  2CG3 A;  2DIW A;  4F7A A;  4PH4 B;  2ZIR A;  2LO6 A;  3T8M A;  4CGW A;  3JUE A;  4BSX A;  4BSZ B;  5LFA A;  3BEE A;  1IYG A;  1BLX B;  4ILG A;  2WXG A;  2GRP B;  1HH8 A;  4HOU A;  2KC7 A;  3DWL G;  3SGH A;  4AV7 A;  1N11 A;  4DK5 A;  5EX3 A;  3HXF A;  4R7L A;  2XPI A;  2MYO A;  2R02 A;  5IY5 E;  4XEI G;  4LCT A;  5FQ4 A;  3PE3 A;  2KM4 A;  3ABL E;  3IXE A;  3NZS A;  2FUL A;  5EIL A;  2FF4 A;  1SQM A;  2XHE A;  3ABM E;  3JQ0 A;  4FUL A;  1TEZ A;  2AW6 A;  2ZGD A;  3FFL A;  4KMO A;  5ENT D;  3Q47 B;  5EID A;  4LUN U;  4EZK A;  4JVS A;  3JXJ A;  3DPD A;  2I9C A;  4UQZ A;  4CDR A;  2F8X K;  2GRM A;  2PL2 A;  4DX6 D;  3X2Q E;  4JL0 A;  3CQG B;  3SFZ A;  1H19 A;  1E8Y A;  2DVW A;  4JPS A;  3QWP A;  5BT1 A;  3L08 A;  3CGH A;  1N95 A;  1JCR A;  3QAQ A;  4I6J A;  2OND A;  2LSU A;  3MKR A;  3LY8 A;  3NZU A;  3DEO A;  4ABN A;  5B3S E;  3T5X A;  4CGV A;  1OY3 D;  4JHJ A;  1H0A A;  2UWJ G;  2ZXW E;  4MLP A;  1E8Z A;  3S7B A;  5T3R A;  2BF0 X;  3SI5 A;  3ZXP A;  4J8E A;  4U0S A;  5BXO A;  3FU0 A;  2XRZ A;  5FT9 A;  5G2N A;  4PS7 A;  2YHC A;  4RSY A;  3R9A B;  2J09 A;  3ZEF A;  3ASH A;  5A7D B;  3CIA A;  3ASF A;  3CHS A;  5KNH D;  2IJG X;  3PZ3 A;  2J07 A;  2M63 A;  2R59 A;  3UKR G;  2XEH A;  3G2V A;  4RLY A;  3RRU A;  3ZGQ A;  1TR4 A;  2EIJ E;  5AN8 A;  3FH7 A;  1VDY A;  3HXE A;  1TN6 A;  4F1S A;  3L82 A;  3EHQ A;  2P9L G;  1V54 E;  3CHP A;  4KVO A;  3SBT B;  1HF8 A;  2J9Q A;  2PNN A;  2WXR A;  2Y1L E;  5ANL A;  3ULY A;  4TXQ A;  2IOL A;  4JHR A;  4BY6 A;  5AQA A;  1Z3Y A;  2J4D A;  2WXF A;  1X5B A;  3G2S A;  3UI2 A;  5AJD A;  5AQ7 A;  2X38 A;  3Q15 A;  5EYL A;  3FEX A;  5BNW A;  3BG0 B;  3UXG A;  4GZD A;  4JW1 A;  4J8F A;  2LAI A;  4IYP A;  4UI9 K;  1S0P A;  2XZT G;  5JHA A;  2J8S D;  1E90 A;  4J8S A;  3FUN A;  3O4Z A;  2VTB B;  5EIB E;  4B89 A;  2YIN A;  2BTD A;  2P58 C;  5CRV A;  3APD A;  3RU0 A;  5HRY A;  3APC A;  3CVV A;  4RVB A;  2IQC A;  1N0R A;  3SD5 A;  3EHM A;  2KCK A;  3UT4 A;  3LVR E;  2X6F A;  3UUX A;  2GRQ B;  3FUD A;  4U95 D;  4E85 A;  1G3N B;  5FIO A;  5CMW A;  1QNF A;  1IHG A;  4KZC A;  3C3R A;  3LYA A;  5AAO A;  2V4L A;  3CST A;  4UWK A;  2P9K G;  1JWF A;  1TNY A;  1A17 A;  1H6K A;  1MX6 A;  1JPL A;  4ILH B;  1UN8 A;  4LER A;  3HXC A;  3QNK A;  4JXT A;  1NI1 A;  1WG0 A;  3SZ7 A;  5EX0 A;  1GW6 A;  3APF A;  3L17 A;  2L6B A;  3CHM A;  4UUC A;  2RFM A;  4XX5 A;  1N9A A;  4FLB A;  4PDX A;  3ML9 A;  3LJ3 A;  4RG6 A;  2IOS A;  4XKC A;  5H7P A;  2NYJ A;  1PY1 A;  2KXP C;  4GYW A;  5DIZ A;  2NC9 A;  3C3Q A;  1N4R A;  5D0Q D;  4UWG A;  1QBQ A;  4M7C A;  1Z6T A;  1HS6 A;  2DBA A;  3IEG A;  3LKU A;  3O48 A;  3RIB A;  1PAQ A;  5CCM A;  3FUJ A;  3UIN C;  3JYS A;  3LS8 A;  3TXN A;  3CVL A;  4JC8 A;  1ELK A;  3HG0 D;  4MRU A;  3AS4 A;  1WDY A;  2R5S A;  3S7J A;  5T8I A;  4BEP A;  2WQ7 A;  2V4H C;  5J90 A;  4GML A;  3TWT A;  4HBD A;  4G26 A;  4AY6 A;  1X81 A;  2ETB A;  1IKN D;  2DZN A;  2IEJ A;  3FUK A;  4HS2 A;  3FTU A;  3T9K A;  2IFU A;  2VGY A;  3IKO B;  5JMN D;  5JJ7 A;  4YDE A;  2WXK A;  4GMJ A;  4W9R A;  4QFV A;  2V5F A;  4GTP A;  3CVQ A;  3L22 A;  3FP3 A;  4EZJ A;  3R7R A;  4NRH B;  4F6R D;  3QWV A;  5G04 C;  2MOW A;  2C0M A;  2GRL A;  2R05 A;  4RG9 A;  4B8A A;  3PEV B;  3FUM A;  4GZC A;  1NA3 A;  4QQI A;  4YDY A;  4N39 A;  5CCL A;  2CHX A;  1HX8 A;  3U9W A;  2X6J A;  3MZL B;  4ANW A;  4WUY A;  4CT4 A;  4Y6W A;  4TXR A;  3PRE A;  1U2V G;  2ZIS A;  3UIO C;  4N2Q A;  3PDN A;  3ZVV A;  5HS0 A;  3UM1 A;  3ASN E;  2E0I A;  4TRQ A;  2I1J A;  3VLD A;  5AYW D;  3PZ1 A;  1WY6 A;  1IQU A;  4EBA G;  2QYJ A;  1E96 B;  2HR2 A;  3PRZ A;  5FZS A;  2WXL A;  3Q73 A;  3CSF A;  4WAF A;  1Y6I A;  3RK6 A;  2I1K A;  1Z3X A;  1RZ4 A;  5CMY A;  3FH5 A;  2AWI A;  3UM2 A;  5ENR D;  2VGE A;  4N3A A;  1IQR A;  2P9I G;  5B1A E;  2DYS E;  5D2M C;  3MA5 A;  3DST A;  1ELR A;  4HFG A;  3RO3 A;  3CVN A;  3NOG D;  2EIL E;  1HO8 A;  5EDS A;  2LXM A;  1RW2 A;  2V8S E;  4OVV A;  3I4G A;  3ZYK A;  1MQS A;  2OCC E;  3DSU A;  2DCP A;  2J08 A;  4EBA A;  5BW8 C;  3KEA A;  1BI7 B;  3TWR A;  2GGF A;  2OEV A;  2Y69 E;  3FU6 A;  3E33 A;  4L2Y A;  2XPZ A;  2NXP A;  2Y4U A;  4Q69 A;  3Q5M A;  5EN5 D;  1DVP A;  2EIN E;  2LSV A;  1O1S A;  4FJZ A;  2IO3 C;  4CDM A;  4OAU C;  3I3N A;  5B1B E;  4AJW A;  4K5A B;  3G2W A;  2IU1 A;  3CK7 A;  4WWO A;  3CKC A;  5ENN A;  5JJT A;  3EHR A;  4ACL A;  3IV0 A;  3G2T A;  4XKB A;  3RSE G;  1N94 A;  2Y4T A;  3TXM A;  3CK8 A;  3NOC D;  3UKU G;  3OTN A;  4XZ4 A;  3PZD A;  2C2L A;  3IHV A;  4FU3 A;  2ZU6 B;  1FVF A;  5LCW C;  2H6I A;  2VSN A;  5JHB A;  2A5U A;  3JCK C;  3LPZ A;  1ELW A;  5FQ8 A;  5CEA A;  3D9H A;  4NIK A;  3LXU X;  3ZHE B;  1BD8 A;  4KYO B;  4GMR A;  2XEN A;  1UOH A;  5C2Y A;  2XCC A;  4LNB A;  4DUI A;  2PQN A;  2XZD G;  3MCX A;  3HDX A;  4WNE A;  4GTV A;  3ASG A;  1QQE A;  2RD0 A;  3CVP A;  3UIP C;  1EF1 C;  4NAC A;  3PEU B;  3W9G A;  2A5E A;  2LUH A;  2IF4 A;  4UWL A;  1N54 A;  2WXJ A;  4ANU A;  3B7U X;  4HOS A;  3DRA A;  4HI9 A;  1KZP A;  3FUI A;  5AJL A;  2RFA A;  3DXM G;  4JEU A;  4KVM A;  4AXH A;  4HRN A;  3B7S A;  4URK A;  4UQY A;  5KCM A;  1HE8 A;  4EHM A;  2PM7 A;  5ENP D;  1JUQ A;  4HB5 A;  2DWZ A;  2YQ8 A;  3ZIM A;  3TWW A;  3V31 A;  3TL5 A;  3PH0 C;  3Q49 B;  1NFI E;  4KXK B;  3JXI A;  4L23 A;  2XEV A;  1TN7 A;  4K5B A;  1UG3 A;  1TNO A;  3S7D A;  4DI3 A;  5LX8 A;  4CEM A;  5ARF A;  3PUJ A;  3DEP A;  4F1P A;  3KS2 A;  4UI9 J;  3SF4 A;  4ACK A;  4A3V A;  4UWF A;  1P5Q A;  2I2O A;  3FTX A;  3TG5 A;  5E76 A;  2LXL A;  1S70 B;  3CVY A;  2WPV A;  1H6P A;  3WG7 E;  3ZHE A;  4BET A;  4UI9 C;  2WVI A;  4PUC A;  1UN9 A;  1UJJ A;  3Q79 A;  3BQO A;  1SA4 A;  4TUM A;  4C48 B;  2JAB A;  3IBE A;  4O1P A;  3ASD A;  5CRU A;  1TJF A;  3U66 A;  4CZ2 D;  4G2V A;  3D9L A;  1K8K G;  3S2A A;  1U3D A;  1LD8 A;  4YDO A;  2X6H A;  1AP7 A;  4E6H A;  3PS6 A;  5KNG A;  3QC1 A;  4XE0 A;  5FZQ A;  2R2L A;  4YDW A;  4MS6 A;  3C5R A;  2L0T B;  2XS8 A;  3NF1 A;  4U0U A;  4ILI A;  4DRX E;  3V30 A;  3RO2 A;  3CVX A;  3E37 A;  2VQ2 A;  3BU8 A;  1MYO A;  3DSX A;  3CKB A;  1OWL A;  3D9M A;  2VSX E;  4BTB A;  4YVO A;  1DCE A;  3U3W A;  2AJA A;  3Q9N C;  3V79 K;  1HG5 A;  3RRM B;  4J7W A;  1K3Z D;  1OWM A;  5AIJ A;  3LJN A;  2OVF A;  4JB8 P;  2P2C P;  2RG8 A;  2WXI A;  4HQD A;  5CEC B;  4YVQ C;  4ANV A;  3CHR A;  1Y8M A;  5ANR A;  2WM9 A;  2WMN A;  3ONK A;  4C9B B;  4TXP A;  3L16 A;  4L9P A;  5ENQ D;  1NA0 A;  3L9T A;  3ZNG A;  1E7V A;  2BUG A;  2FO7 A;  3QJZ A;  1OWN A;  5BUZ A;  1HG2 A;  1TNB A;  2KCV A;  1HFA A;  4Q96 A;  4HOQ A;  2HO1 A;  4F3V A;  1L5J A;  2ZGG A;  1IHB A;  1UW4 B;  4I1O B;  4HOR A;  3KSQ A;  2ETC A;  4BWR A;  3AG4 E;  5KJL A;  2PM6 A;  4GZ6 A;  1BU9 A;  3ZUV B;  2ION A;  3CHO A;  5G55 A;  5FQ6 A;  3ULE G;  4HVB A;  4IRU A;  3CR3 A;  5HI7 A;  3D3M A;  3ML8 A;  4GB9 A;  2QYU A;  2QZA A;  1N4P A;  2WQ6 A;  3NB2 A;  4GTR A;  1KLX A;  1W3B A;  1N4Q A;  2X3M A;  2AVP A;  3FU3 A;  1D8D A;  3UTM A;  3UMV A;  4APO A;  4DX7 D;  3ZU7 B;  3D9I A;  4FJY A;  3ZFW A;  4APF A;  3NAW A;  1WAO 1;  3BG1 B;  3EJN A;  3E32 A;  5BPP A;  3TWQ A;  3B13 A;  2CHW A;  1YMP A;  4WNF A;  4I9C A;  3CLJ A;  4M3O A;  5FIN A;  4AOF A;  3K9I A;  4OYS A;  4GPK A;  4MBG A;  2H6H A;  3G2U A;  5A23 A;  1K1B A;  3D9J A;  4EPZ A;  4Y6C A;  3ESL A;  4A55 A;  4ZHB A;  4Q94 A;  3LEW A;  4GYO A;  3SFX A;  3FTZ A;  1KT1 A;  3ISM C;  1O1T A;  3VLE A;  2F37 A;  2P9P G;  3B95 A;  3VLF A;  5D66 A;  3RJV A;  2Q7F A;  3DSW A;  5JJ6 A;  3OXF A;  1UJK A;  2I6H A;  4DX5 D;  3PUK A;  5BV1 A;  3GW4 A;  3QB2 A;  1TNU A;  5C1D A;  4HXI A;  1U3C A;  1A5E A;  3FUH A;  4KT6 B;  4U8V D;  2P9U G;  2J49 A;  3V2X A;  1OUV A;  4U8H A;  1H2T C;  3W9F A;  4U07 A;  5KJN A;  2B6C A;  3MJW A;  1FVH A;  3TWV A;  5J08 A;  1HXI A;  3C72 A;  5LOZ A;  1TN8 A;  5DBK A;  3QDN A;  4GTT A;  3AJI A;  4J8Y A;  2AXZ A;  1INZ A;  3LCA A;  4DX2 A;  4GZ3 A;  3EUV A;  2BKK B;  4GZ5 A;  5CBN A;  4GA2 A;  3FUF A;  4XI0 A;  2FBN A;  1DNP A;  5CED B;  3IHY A;  2YNQ A;  4K03 A;  4DI4 A;  2C0L A;  4J8D A;  1MX4 A;  3I5P A;  5FQ7 A;  3AU4 A;  5HQ8 A;  2HE0 A;  1LTX A;  2XGS A;  3DBS A;  2EQX A;  4N3C A;  2OOE A;  4B8C B;  3TWX A;  2YHE A;  1ZU2 A;  1SA5 A;  4L7T A;  4LRZ A;  3FTV A;  1O1R A;  5A6C A;  2PQR A;  2XS1 A;  1DCQ A;  3AG3 E;  4NQ0 A;  3SFY A;  3FHE A;  3CHQ A;  4J6I A;  3JUI A;  4LSZ E;  4I1M A;  3WXX A;  3EU9 A;  3Q75 A;  5KBA A;  3ZW3 A;  2LNI A;  4UWH A;  5T4Y A;  5AEN A;  4HNA D;  3SQV A;  3UT8 A;  4N2S A;  5LP0 A;  2E2E A;  3U4T A;  4C0M A;  4GTO A;  4HLE A;  4ATG A;  5EKQ D;  1QZ2 A;  5M72 A;  2CHZ A;  4GTQ A;  3TWU A;  5KWD A;  2B0O E;  4A1S A;  4DLO A;  4BFR A;  3QAR A;  3URZ A;  2V0P A;  3Q4A B;  1XNF A;  2EIM E;  4H7X A;  3VTX A;  2P9S G;  4BER A;  1SZA A;  3UPV A;  2KZT A;  4ME2 A;  3GZ1 A;  2GRN B;  4I6E A;  3SBS A;  5HKP A;  3GZ2 A;  4U8Y D;  4GAA A;  3J5Q B;  4BT8 A;  4AEZ C;  2J4B A;  1FT1 A;  3FU5 A;  3QOU A;  5FTP A;  1E7U A;  1NZN A;  3ENE A;  3CV0 A;  2WMO A;  2FO1 E;  4K0R A;  1OCO E;  2NSZ A;  1E8X A;  4LNU D;  4GPM A;  4O60 A;  3ZPJ A;  1HU3 A;  1D9S A;  4UQX A;  1O5M A;  2WQH A;  2ETA A;  3EHN A;  4G25 A;  4NUR A;  3GZS A;  2KCL A;  4G1T A;  4I1A A;  3MV3 B;  1KT0 A;  3HXB A;  3CQC B;  4FHK A;  4KBQ A;  3B7T A;  4B94 A;  4LNG A;  4WND A;  1WM5 A;  1TYQ G;  3ZYQ A;  3LY9 A;  3KEZ A;  4ATZ D;  3P2B A;  3LY7 A;  5FZR A;  4H7Y A;  2PZI A;  4IUL A;  1TNZ A;  4EEC A;  1SVX A;  1YCS B;  1MJ0 A;  2XCB A;  4CYM D;  4B93 B;  3D9P A;  3PZ4 A;  4DLQ A;  2HYZ A;  4AVX A;  2F0Y A;  3FH8 A;  1H6O A;  3Q9U C;  3HYM B;  5ARG A;  4O1O A;  3FTY A;  5KJK A;  1N52 A;  2F8Y A;  3ZYL A;  4CT0 A;  1JWG A;  3Q7F A;  3CEQ A;  4FHJ A;  3V2O A;  4U04 A;  2H6G A;  3E4B A;  3ESK A;  3Q7A A;  3AG1 E;  4P29 A;  2R17 C;  2VGX B;  2IY0 C;  2IO2 C;  4N5Q A;  4BTA A;  4XIF A;  3UQ3 A;  4IN3 B;  4GA0 A;  1H2V C;  3HVE A;  3UT7 A;  5AAR A;  5CHE E;  4CDN A;  3L13 A;  1OCZ E;  3HVE B;  4I43 A;  3U64 A;  3OAW A;  2FEZ A;  2VGX A;  4BX9 A;  2AXU A;  2KBX A;  3KSL A;  2QFC A;  5AQB A;  4A63 B;  4A3T A;  4EZL A;  2L6J A;  1Z5S C;  1QYM A;  3RAU A;  4PS8 A;  3QWW A;  3EIQ C;  2V5Q C;  5JA4 D;  1V55 E;  3VTY A;  3EIJ A;  3MGB A;  2WXN A;  4AY5 A;  3SY2 A;  3AAA C;  1S63 A;  2XPY A;  1HZ4 A;  5ENO D;  4MKT A;  2L0I A;  3FWV A;  3EDT B;  2P9N G;  4I9E A;  3DSS A;  5D0O D;  3MYV A;  4Z68 A;  4GYY A;  3CVW A;  1OXJ A;  4U0Z A;  2ILR A;  4B0Z A;  1E8W A;  2JLB A;  4RQI A;  1BPO A;  4AIF A;  4OAV B;  2XRY A;  4JA9 A; 
#chains in the Genus database with same CATH homology
 1N4S A;  1SA5 A;  1S64 A;  1QBQ A;  1NL4 A;  1O1R A;  1FT2 A;  3EU5 A;  3DRA A;  1O1S A;  2BED A;  1KZP A;  1TNB A;  2ZIR A;  3SFX A;  1LD8 A;  2ZIS A;  4YDO A;  4GTS A;  1O1T A;  1LD7 A;  3DSW A;  3KSQ A;  3SFY A;  3PZ1 A;  4EHM A;  1O5M A;  3E34 A;  1D8E A;  3DPY A;  2R2L A;  3KSL A;  3DSV A;  3Q73 A;  3E30 A;  3HXF A;  3Q75 A;  1N94 A;  1TNU A;  3HXB A;  1JCQ A;  1KZO A;  3PZ3 A;  4LNG A;  1TN7 A;  3E37 A;  4GTO A;  3DSX A;  3PZ2 A;  1TNO A;  1N4P A;  1X81 A;  2H6I A;  3C72 A;  3DST A;  4GTQ A;  1TN8 A;  1TNY A;  2H6F A;  2IEJ A;  4GTR A;  1DCE A;  1TNZ A;  4GTT A;  1N4Q A;  1FPP A;  1MZC A;  1S63 A;  3HXE A;  3HXC A;  1D8D A;  1TN6 A;  1NI1 A;  1JCS A;  3PZ4 A;  3EUV A;  2F0Y A;  3DSS A;  3HXD A;  3E32 A;  4YDE A;  3DSU A;  4LNB A;  1N9A A;  4GTM A;  3Q7F A;  4GTV A;  4GTP A;  4L9P A;  2H6G A;  1N95 A;  3Q78 A;  1JCR A;  3E33 A;  3Q7A A;  1FT1 A;  4MBG A;  2H6H A;  1LTX A;  3Q79 A;  1N4R A;  1SA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...