1N4QA

Protein geranylgeranyltransferase type-i complexed with a ggpp analog and a kkksktkcvil peptide
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of mammalian protein geranylgeranyltransferase type-I
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
total genus 124
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n4qA00
1O1TA 1S63A 4GTPA 1SA4A 4GTOA 1TNYA 1MZCA 4L9PA 2ZISA 2H6IA 1D8DA 4GTVA 3DSXA 3Q7FA 1TNOA 3DPYA 1N4PA 2BEDA 3DSTA 3EUVA 3E34A 1FPPA 1LD7A 2H6HA 1JCSA 1TNBA 3HXFA 1TNUA 3Q7AA 1LD8A 3C72A 3SFYA 3DSSA 4EHMA 1D8EA 3E37A 2F0YA 1JCQA 3HXDA 1NI1A 2H6GA 3KSLA 3DSWA 4GTSA 3HXBA 4GTTA 3SFXA 1FT2A 4MBGA 4YDEA 4YDOA 1TNZA 2IEJA 1NL4A 3HXEA 3PZ4A 1N9AA 3EU5A 3PZ1A 1TN7A 2H6FA 1S64A 3DSVA 3HXCA 1FT1A 3Q79A 4LNBA 2R2LA 4GTRA 3Q78A 1QBQA 2ZIRA 1DCEA 4GTMA 4LNGA 3E32A 3Q75A 1SA5A 3KSQA 3E30A 1TN8A 3Q73A 4GTQA 3DRAA 1N4SA 1KZOA 3PZ3A 3PZ2A 3E33A 1N94A 1N4QA 1O5MA 3DSUA 1N95A 1JCRA 1O1SA 1N4RA 1X81A 1TN6A 1KZPA 1LTXA 1O1RA
chains in the Genus database with same CATH superfamily
4FLBA 1SA4A 3FH8A 5FT9A 1TR4A 5ITZF 1K3ZD 3EHQA 3G2TA 4TRQA 1XGWA 5BW8C 1FVFA 2DWZA 3FWVA 3G2VA 3J5QB 3LXUX 4GMRA 4GYOA 3C3RA 2XEVA 1N4PA 1OT8A 4ANVA 5HRYA 2XGMA 2H6HA 1E8XA 2LSUA 3EHRA 5ENPD 3Q47B 4EHMA 4CEMA 4U96D 1OWNA 4FA6A 3LDZA 3LS8A 1JCQA 4PS8A 1G3NB 4GTSA 3LYAA 3SF4A 1UOHA 4ILHB 3SHFA 3PDNA 1V54E 1MJ0A 3PNLB 1TNZA 2XZDG 4UQYA 3QJZA 1HX8A 5EX0A 4XE0A 4LNBA 4OAUC 2VYIA 5ENQD 3RK6A 5AQAA 3D9JA 2XCCA 3TAXA 3IKOB 1H2TC 3QWWA 3BG1B 3LCAA 4CT4A 3VTYA 4HVBA 1KT0A 4WNGA 1YCSB 3S2AA 4B0ZA 3ASNE 1WDYA 3ZUVB 2CG2A 3IHYA 1TJCA 3SNXA 4BX9A 1XNFA 3FUKA 2CFZA 4G11A 3ASDA 3QOUA 3RU0A 4I1OB 4GTOA 5G04J 3R9MA 4UUCA 3K9IA 2PZIA 4C0EA 4UWGA 1Z6TA 5LOZA 3FUNA 2BEDA 3SFZA 3E34A 4AOFA 2RFMA 3L9TA 3CKBA 1K1AA 5EYLA 1E90A 4LSZE 4JPSA 3JYSA 2BKKB 3LEWA 1H19A 3TXNA 3WXXA 1OWMA 2RFAA 4XKBA 2GRMA 2MRIA 4I9CA 1K1BA 5ENTD 4IULA 3S7FA 1KLXA 2C2LA 3JQ1A 4A55A 2J9QA 3G2UA 3SGHA 4JZYA 2XGSA 4BSZB 2JLBA 4I6GA 3TWSA 1NL4A 2BF0X 2PM7A 3FUJA 1TN7A 2XQ0A 3QNKA 4Z68A 3ULYA 4GTRA 1IYGA 1A17A 2GGFA 3ZHEB 1DCEA 2C0MA 3L17A 3N71A 5AN8A 1H6KA 1HG5A 4F1PA 1BD8A 1HU3A 3SQVA 2EIME 3QAQA 1HG2A 2EIKE 1N4QA 3UXGA 4RVBA 3T8KA 1ELKA 3V30A 2DYRE 2ZXWE 3B7UX 2P9LG 3ZFWA 1TNYA 1KT1A 4DI3A 3TWRA 3KAEA 2H6IA 2KCVA 1JWFA 4HRMB 2WMNA 3CGHA 3HVEB 1TNOA 2ETCA 3UM0A 5D0QD 4N3CA 3D3MA 3NBNB 3FUHA 3JQ0A 2AXZA 1RW2A 2XZTG 3TG4A 2F0YA 3ENEA 3PE4A 3S7JA 2AJAA 3FEXA 1QZ2A 4K0RA 3FY4A 4L2YA 4D10C 3ULQA 4J8SA 3ISMC 5BV1A 3HXEA 3EU9A 5B3SE 3PZ4A 5AARA 4RG9A 1H2UA 2Y3AA 3PZ1A 4NQ0A 3FU6A 4BTBA 3L08A 1NP7A 4BSXA 5D2MC 4AXHA 1LF8A 2ZIRA 1ELRA 5AENA 3APDA 2R59A 3D9MA 4WWNA 4FADA 4U7EB 3JUEA 3DBSA 4LRZA 3DSUA 3ML9A 3WG7E 3MCXA 5LP0A 4E6HA 4XX5A 1O1TA 1INZA 3APCA 1HE8A 1IQRA 3ZEFA 3D9NA 3QWVA 1UG3A 3C3QA 3R7QA 5EIDA 3NF1A 1H0AA 5CCMA 5D66A 4TUMA 4HFGA 3Q5MA 1ELWA 2VGEA 3L54A 1MQSA 4L2LA 2J4BA 1LD8A 3MX3A 5ANLA 4DX2A 5JHAA 3E37A 3EIQC 2GRQB 2FULA 3HIZA 1OY3D 2LAIA 4N2QA 2L6BA 1TEZA 4AV7A 4B93B 3HXBA 3ZIMA 4YDOA 4K5CA 4ATZD 2VTBB 3DSVA 3KEAA 3PE3A 4U8HA 5CECB 4GZCA 2R2LA 4ACLA 3RO2A 2L9BA 3LY8A 3QK0A 3E32A 1EDUA 1TN8A 3D9IA 4FC8A 3D9KA 2WXLA 4HQDA 2NSZA 4KZ0A 2ETBA 5ARFA 2Y69E 3NOGD 4BESA 3JXJA 3PZ3A 2AW6A 2P2CP 4TV3A 4M3OA 3MV2B 3QARA 4DK5A 4G24A 3UTMA 3PREA 4XEIG 1X81A 4PDXA 4I9EA 3SY2A 3VLEA 1AWCB 3V79K 3CHPA 2RD0A 3EHNA 2VSNA 2YHCA 2IU1A 2E0IA 4L9PA 1HH8A 2JABA 3T5VA 2Q7FA 2V4LA 2L0TB 3DPYA 2FEZA 2VSOE 1E96B 3EUVA 4G25A 1TNBA 3B13A 3AG3E 1SVXA 4I2WA 5KCMA 3LY9A 4G8LA 2Y4TA 2QZAA 3PH0C 1IHGA 4UWFA 4KYOB 4JEHA 4C9BB 2JEKA 1UW4B 2WM9A 1DCQA 2WPVA 4JXTA 3G2WA 5KJLA 5IY5E 2XS8A 3UQ3A 3D9OA 2V0PA 2V4HC 3QC1A 3CVPA 3C98A 3JUIA 2PL2A 5ARGA 4CYMD 5BT1A 2WXFA 3S7DA 4GTMA 3Q75A 3I3NA 2QC9A 3C5RA 4O6FA 4GZ6A 4KMOA 4DX5D 3CVQA 3UT4A 4GA2A 2IY0C 3ZYMA 4W9RA 3FTSA 4J8DA 1N94A 4Y6CA 4U63A 2FO7A 1VDYA 2WXOA 4U0SA 2XRYA 1H6OA 3ZPJA 4G1TA 5JHBA 4U0UA 5FTPA 3B7RL 4CGVA 4HOTA 5ENRD 4ATGA 4O1OA 5AYWD 4RLYA 4FP7A 3NOCD 3VLDA 4HORA 3IXEA 3DSXA 4BT9A 4DLOA 3FTXA 3DSTA 5G2NA 2CHZA 2GRRB 3ESLA 4L7TA 1HFAA 3IHVA 3ZYQA 3SFYA 1QNFA 4WNFA 5EKQD 2WXQA 2GROB 3TXMA 2P58C 2P9SG 4XKCA 2XPZA 3TWTA 1IKND 5D0OD 5KNGA 2V5QC 1IHBA 5ENNA 5FIOA 5AIJA 3CVVA 3CQGB 3EU5A 3ZU7B 1BPOA 4RSYA 2KZTA 3Q49B 3ZYLA 3MKQB 2VSYA 3AS5A 4IN3B 4RG6A 4BEPA 5FJYA 1NA0A 3D9PA 2EIJE 3JXIA 3B7TA 4LERA 1E7VA 3IBEA 5JA4D 2QYUA 2LXLA 3ASGA 3RAUA 2ILRA 1KPSB 1N4SA 4TXPA 3PZ2A 3SBSA 2X6HA 3KEZA 4C48B 4DUIA 2GW1A 3ASOE 4LNUD 3AS4A 1W3BA 1Q2ZA 2YNQA 4MRUA 2HM8A 3UX4A 2DYSE 2OEVA 2J08A 4K03A 2UY1B 1JWGA 1HF8A 4GAAA 3MKRA 3ASHA 5H7PA 2AXVA 2QFCA 3ZN3A 3SI5A 3UI2A 4F3VA 4GPKA 1HXIA 3QKYA 3CVUA 3PVLA 1BI8B 3MV3B 4KT6B 4GTTA 2WXRA 2P9IG 4QFVA 2KATA 1X5BA 2I9CA 1GW6A 2LUHA 4EZKA 3RIBA 3EIJA 3CQCB 1SZAA 3L6AA 1E8ZA 4HI8A 4Q96A 4G8KA 5ENSD 2CFUA 2J09A 3Q78A 4BX8A 1EPUA 2Y1LE 4N5QA 3FTWA 3J5PA 4XIFA 1JPLA 5AAOA 5BPPA 2NYJA 1H2VC 3UKUG 2GRLA 4CRWA 1HO8A 1N0RA 3CHMA 1MHQA 1OCZE 4GYWA 1A5EA 3TWQA 4JA9A 2MHKA 1DVPA 4EBAG 1N54A 4XI0A 5M72A 3RRMB 3ABME 3FTUA 3OAWA 2HYZA 2IOSA 2DVWA 3AG2E 2R05A 2FO1E 3LVRE 4GZDA 5A6CA 2PNNA 4I17A 4U07A 2DZOA 4Y6WA 3PRZA 4GB9A 4FU3A 1JCSA 4DJAA 5KJNA 4LG6A 4YNDA 3D9HA 2Y0BG 4GCNA 5CRUA 2A5EA 4TXQA 1NI1A 3ABLE 3DWLG 1QQEA 4KBQA 5ENOD 5CMWA 5JJ7A 2XEEA 3P2BA 1Z5SC 1UN8A 1Z3YA 2DZNA 3TJPA 5G05J 5JMND 4ME2A 2KBXA 2YQ8A 2KM4A 5J90A 3ZVVA 3DEPA 4C0MA 4YVOA 4BTAA 1OWLA 4HRNA 2OVBA 1OCRE 3DPDA 3RRNB 1NA3A 4IYPA 2XHEA 1O5MA 2CG3A 1UJKA 2X38A 3NZSA 3UM2A 3CVYA 1PAQA 4EZLA 1O1RA 1S0PA 2EILE 2RG8A 2GRPB 3I4GA 4B8AA 3UM1A 5B1BE 2ZISA 5BUZA 3Q4AB 2FBNA 2I6HA 3CHOA 3NAWA 3JCKC 4FULA 3R9AB 3Q7FA 3Q15A 2VSXE 4HI9A 2V5FA 4F1SA 2WXHA 3CVXA 1DC2A 4H7YA 4CCAA 3G2SA 3Q7AA 4PS3A 2UWJG 2J8SD 4P29A 4R7LA 3RKVA 1PC2A 3CVWA 1NZNA 4UI9J 4PUCA 2OVFA 5CHEE 3ZRHA 2OCCE 3B95A 3UKRG 4DI4A 4NACA 2VJ8A 4CT0A 3U66A 3ZNGA 4HS2A 4CDMA 3CK7A 4MLPA 2XEHA 3BQOA 3D9LA 4QQIA 1QBQA 2LSVA 2RKKA 5B1AE 4AJWA 2CHWA 5CEDB 2WMOA 3UT8A 1YA0A 1SA5A 4AY6A 3LPZA 3TWXA 4BWRA 4N39A 4F6RD 2WXKA 4YDYA 2VTBA 3ONKA 3FUMA 3E33A 3AS8A 3VLFA 3CVLA 1N4RA 4H7XA 4LCTA 3HYMB 3B7SA 2DCPA 4O60A 3HG0D 2FF4A 4ACKA 5DIZA 3CK8A 1FVHA 4I1AA 4LEUA 2YHEA 4U0ZA 1TNUA 2B0OE 4BT8A 4A63B 1D8EA 4AVXA 3DXMG 4YDWA 4EPZA 2QYJA 3ML8A 3PNTB 1FT2A 4JB8P 1AP7A 5BV0A 4B8CB 3CHSA 3ESKA 3FTZA 1S70B 4JD2G 4AEZC 1N9AA 2PQNA 3PEVB 3LVQE 1WAO1 2MOWA 4G26A 1U2VG 2X6FA 1N52A 4Q69A 2R5SA 3LY7A 2M63A 2P9NG 4ZHBA 2KXPC 2P9UG 4O1PA 4I2ZA 2ZGGA 1YMPA 4HXIA 4J8YA 1OWOA 3DRAA 5KNHD 3ZW3A 2DBAA 2IFUA 3UIOC 5T4YA 4A3TA 2V8SE 3OXLA 4UWKA 5EILA 4DRXE 2WB2A 5FZSA 3S7BA 3Q9NC 2KCLA 2R03A 4HLLA 3FTVA 3CEQA 3LKUA 4UWHA 2R17C 5BXUA 1OCCE 4CDNA 4FHJA 3F6QA 3PEUB 2VGXA 5CBNA 4ANUA 3C3OA 3AJIA 5FZRA 4E85A 3L22A 1N11A 3HXDA 4FJZA 3O4ZA 4M7CA 3DSWA 3U64A 3TGOA 2F8YA 4L23A 2XRZA 2X6KA 1QYMA 4CDRA 2XCBA 4AY5A 2HO1A 3OXFA 3FH7A 5AQBA 5EIBE 1FT1A 5A7DB 4U8VD 4HRLA 3CSTA 3ZGQA 1IXVA 1K8KG 3QWPA 2IO2C 5CRVA 4YVQC 3W9FA 4F53A 4TUUA 5FQ4A 2BTDA 3ASFA 1IQUA 3QB2A 1BI7B 5FINA 4I6EA 1UN9A 2YINA 2FI7A 2ZGDA 4JW1A 4APFA 2WXIA 4G2VA 3FU0A 1JUQA 4BFRA 1LTXA 2DIWA 1S63A 4JEUA 5HKPA 3OXGA 3ZXSA 5LCWC 4A1SA 2WXJA 5FZQA 5KJKA 4K5BA 4KVOA 3I5PA 3GYZA 4V3IA 1NFIE 2ZU6B 4XI9A 3CK9A 3CVNA 1HZ4A 4A1GA 3MJWA 3MGBA 5CERB 1RZ4A 2LO6A 5KWDA 3AU4A 4N2SA 4ANXA 4EECA 4GYYA 3EHMA 3FUIA 4BETA 2H6GA 1OCOE 3MEKA 4KVMA 2X3MA 3FUFA 4U95D 1UJJA 4B89A 1TJFA 3LJNA 4DX7D 3U3WA 5HI7A 3UT7A 3FDHA 5FQ7A 2OOEA 4GMLA 2WXPA 1BLXB 4F7AA 2EQXA 4OVVA 4GMJA 4UWLA 4J7WA 4JL0A 5EDSA 4OAVB 4PH4B 3CHRA 3Q9UC 4DX1A 1SQMA 3QDNA 2AVPA 5G05C 1KZOA 1OWPA 3RRUA 3BUAA 2IOLA 3L82A 2BUGA 4UQZA 5FQ8A 3ULEG 1JCRA 1KZPA 2WQ6A 1D9SA 3UM3A 4GTPA 2KCKA 1HS6A 3NZUA 4TXRA 5E75A 1P5QA 4GCOA 3ONLA 3FHEA 4GTVA 2B6CA 5CCLA 2J07A 3APFA 1TYQG 2L6JA 4WWPA 5KBAA 1OUVA 3TWUA 1B89A 3RJVA 3PUJA 3V2XA 3FTYA 5HQ8A 3KS2A 3HDXA 3R7RA 2I1JA 4UI9K 3AAAC 5J08A 3HRAA 3KSLA 3ZHEA 2OEWA 1L5JA 4APOA 2P9PG 1YYHA 1OXJA 2AXUA 2IEJA 3NB2A 5JJ6A 4NURA 3Q79A 3V2OA 3GZ1A 4JHRA 4B94A 2XPYA 1WM5A 4MS6A 4GU5A 2L0IA 5DBKA 2J4DA 1ZBPA 1BU9A 3E30A 1Y8MA 3EJNA 2PQRA 4KZCA 3BG0B 2KC7A 2IO3C 4WWOA 3PZDA 4NRHB 5C1DA 3HVEA 4MKTA 1U3DA 4JVSA 4JC8A 1SW6A 2NXPA 4BY6A 1MYOA 4HBDA 4ABNA 1U3CA 3TG5A 1MX4A 4URKA 3PUKA 3T9KA 4GZ5A 3TL5A 3U9WA 3CSFA 4GA1A 4N5CA 5FQ6A 4GA0A 4CZ2D 4G23A 4JHJA 1V55E 3I4RB 4XZ4A 5CEAA 2C0LA 2X6JA 3HXFA 4I6JA 4EBAA 3C72A 1ZB1A 5T3RA 2A4ZA 5G04C 1H6PA 3SD5A 2QY7A 1ZU2A 2HE0A 3MKQA 2LAHA 2LNIA 3ZKJA 1Z3XA 3HHMA 2P9KG 2CHXA 3UIPC 4PS7A 4FJYA 4J6IA 3AG1E 4RQIA 2WQHA 4IRUA 3SZ7A 3MYVA 5EX3A 4A3VA 1FCHA 3O48A 4OVUA 4LNGA 4EZJA 3TWWA 5A23A 4JHKA 5LCWJ 3IEGA 2I1KA 5HS0A 5CMYA 3UUXA 4WAFA 1E8YA 3VTXA 2KZTB 4HNAD 2WQ7A 1WG0A 2VQ2A 3FULA 4U04A 3KD7A 3TWVA 4HLEA 1N0QA 4DLQA 4WNDA 4CGWA 5AQ9A 3IV0A 2XS1A 1D8DA 1MX2A 4L1BA 5AQ7A 2WXGA 2WXNA 3FFLA 3NQPA 1E8WA 3B7BA 4KXKB 1SZ9A 3FH5A 3AG4E 4LUNU 2AWIA 2ETAA 5AJLA 3CIAA 2F37A 5G55A 3ABKE 5JJTA 3GZSA 4HOQA 3L16A 4FHKA 4K5AB 2E2EA 4HOUA 2F8XK 2I2OA 2VGYA 2IQCA 2UY1A 2XPIA 4MBGA 4YDEA 2NC9A 5LFAA 2HR2A 3CHQA 3DXKG 4BERA 5LX8A 1S64A 1MX6A 3CLJA 3MZLB 4WNEA 3FU5A 3BEEA 2BKGA 5KJMA 1WY6A 1EF1C 5ANRA 2IJGX 4ZFHA 3UMVA 3Q73A 3BU8A 4HB5A 4J8FA 3SBTB 4DPRA 3L13A 2EINE 4U8YD 4Q94A 4ANWA 1O1SA 3ZYKA 2MYOA 1TN6A 4JA7A 4AIFA 3CV0A 2ONDA 3FUEA 3CKCA 4AM9A 1E7UA 3MA5A 3UPVA 4I1MA 1MZCA 4AP2A 5C2YA 4ILGA 4GZ3A 4N3BA 2A5UA 4ILIA 2XENA 3UINC 1FPPA 1LD7A 3X2QE 2IONA 3ZXPA 5BXOA 3FUDA 3DSSA 5EN5D 4J0UA 5T8IA 5EYPF 3URZA 1EYHA 3OTNA 5CBOA 3P1UA 3PS6A 2LXMA 2VGXB 2WXMA 2IF4A 3SFXA 5E76A 3U4TA 3AU5A 2X6IA 3T8MA 3DEOA 3W9GA 4UI9C 2Y4UA 3E4BA 2H6FA 3FP3A 3T5XA 3HXCA 4DX6D 5AJDA 2R02A 2J49A 2PM6A 1PY1A 2XGOA 4X8QA 3SO8A 3RO3A 3FEYA 3RSEG 5BNWA 4HOSA 4UQXA 3GW4A 3LJ3A 3KSQA 4FLHA 4I43A 3GZ2A 4WUYA 1DNPA 4GTQA 3V31A 3EDTB 4OYSA 4GPMA 2WVIA 2GRNB 3FU3A 1Y6IA 1N95A 4NIKA 5FWQA 2OV8A 3CR3A 4EQFA 4N3AA 4J8EA
chains in the Genus database with same CATH topology
1O1TA 1S63A 4GTPA 1SA4A 4GTOA 1TNYA 1MZCA 4L9PA 2ZISA 2H6IA 1D8DA 4GTVA 3DSXA 3Q7FA 1TNOA 3DPYA 1N4PA 2BEDA 3DSTA 3EUVA 3E34A 1FPPA 1LD7A 2H6HA 1JCSA 1TNBA 3HXFA 1TNUA 3Q7AA 1LD8A 3C72A 3SFYA 3DSSA 4EHMA 1D8EA 3E37A 2F0YA 1JCQA 3HXDA 1NI1A 2H6GA 3KSLA 3DSWA 4GTSA 3HXBA 4GTTA 3SFXA 1FT2A 4MBGA 4YDEA 4YDOA 1TNZA 2IEJA 1NL4A 3HXEA 3PZ4A 1N9AA 3EU5A 3PZ1A 1TN7A 2H6FA 1S64A 3DSVA 3HXCA 1FT1A 3Q79A 4LNBA 2R2LA 4GTRA 3Q78A 1QBQA 2ZIRA 1DCEA 4GTMA 4LNGA 3E32A 3Q75A 1SA5A 3KSQA 3E30A 1TN8A 3Q73A 4GTQA 3DRAA 1N4SA 1KZOA 3PZ3A 3PZ2A 3E33A 1N94A 1N4QA 1O5MA 3DSUA 1N95A 1JCRA 1O1SA 1N4RA 1X81A 1TN6A 1KZPA 1LTXA 1O1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O1T A;  1S63 A;  4GTP A;  1SA4 A;  4GTO A;  1TNY A;  1MZC A;  4L9P A;  2ZIS A;  2H6I A;  1D8D A;  4GTV A;  3DSX A;  3Q7F A;  1TNO A;  3DPY A;  1N4P A;  2BED A;  3DST A;  3EUV A;  3E34 A;  1FPP A;  1LD7 A;  2H6H A;  1JCS A;  1TNB A;  3HXF A;  1TNU A;  3Q7A A;  1LD8 A;  3C72 A;  3SFY A;  3DSS A;  4EHM A;  1D8E A;  3E37 A;  2F0Y A;  1JCQ A;  3HXD A;  1NI1 A;  2H6G A;  3KSL A;  3DSW A;  4GTS A;  3HXB A;  4GTT A;  3SFX A;  1FT2 A;  4MBG A;  4YDE A;  4YDO A;  1TNZ A;  2IEJ A;  1NL4 A;  3HXE A;  3PZ4 A;  1N9A A;  3EU5 A;  3PZ1 A;  1TN7 A;  2H6F A;  1S64 A;  3DSV A;  3HXC A;  1FT1 A;  3Q79 A;  4LNB A;  2R2L A;  4GTR A;  3Q78 A;  1QBQ A;  2ZIR A;  1DCE A;  4GTM A;  4LNG A;  3E32 A;  3Q75 A;  1SA5 A;  3KSQ A;  3E30 A;  1TN8 A;  3Q73 A;  4GTQ A;  3DRA A;  1N4S A;  1KZO A;  3PZ3 A;  3PZ2 A;  3E33 A;  1N94 A;  1N4Q A;  1O5M A;  3DSU A;  1N95 A;  1JCR A;  1O1S A;  1N4R A;  1X81 A;  1TN6 A;  1KZP A;  1LTX A;  1O1R A; 
#chains in the Genus database with same CATH topology
 4FLB A;  1SA4 A;  3FH8 A;  5FT9 A;  1TR4 A;  5ITZ F;  1K3Z D;  3EHQ A;  3G2T A;  4TRQ A;  1XGW A;  5BW8 C;  1FVF A;  2DWZ A;  3FWV A;  3G2V A;  3J5Q B;  3LXU X;  4GMR A;  4GYO A;  3C3R A;  2XEV A;  1N4P A;  1OT8 A;  4ANV A;  5HRY A;  2XGM A;  2H6H A;  1E8X A;  2LSU A;  3EHR A;  5ENP D;  3Q47 B;  4EHM A;  4CEM A;  4U96 D;  1OWN A;  4FA6 A;  3LDZ A;  3LS8 A;  1JCQ A;  4PS8 A;  1G3N B;  4GTS A;  3LYA A;  3SF4 A;  1UOH A;  4ILH B;  3SHF A;  3PDN A;  1V54 E;  1MJ0 A;  3PNL B;  1TNZ A;  2XZD G;  4UQY A;  3QJZ A;  1HX8 A;  5EX0 A;  4XE0 A;  4LNB A;  4OAU C;  2VYI A;  5ENQ D;  3RK6 A;  5AQA A;  3D9J A;  2XCC A;  3TAX A;  3IKO B;  1H2T C;  3QWW A;  3BG1 B;  3LCA A;  4CT4 A;  3VTY A;  4HVB A;  1KT0 A;  4WNG A;  1YCS B;  3S2A A;  4B0Z A;  3ASN E;  1WDY A;  3ZUV B;  2CG2 A;  3IHY A;  1TJC A;  3SNX A;  4BX9 A;  1XNF A;  3FUK A;  2CFZ A;  4G11 A;  3ASD A;  3QOU A;  3RU0 A;  4I1O B;  4GTO A;  5G04 J;  3R9M A;  4UUC A;  3K9I A;  2PZI A;  4C0E A;  4UWG A;  1Z6T A;  5LOZ A;  3FUN A;  2BED A;  3SFZ A;  3E34 A;  4AOF A;  2RFM A;  3L9T A;  3CKB A;  1K1A A;  5EYL A;  1E90 A;  4LSZ E;  4JPS A;  3JYS A;  2BKK B;  3LEW A;  1H19 A;  3TXN A;  3WXX A;  1OWM A;  2RFA A;  4XKB A;  2GRM A;  2MRI A;  4I9C A;  1K1B A;  5ENT D;  4IUL A;  3S7F A;  1KLX A;  2C2L A;  3JQ1 A;  4A55 A;  2J9Q A;  3G2U A;  3SGH A;  4JZY A;  2XGS A;  4BSZ B;  2JLB A;  4I6G A;  3TWS A;  1NL4 A;  2BF0 X;  2PM7 A;  3FUJ A;  1TN7 A;  2XQ0 A;  3QNK A;  4Z68 A;  3ULY A;  4GTR A;  1IYG A;  1A17 A;  2GGF A;  3ZHE B;  1DCE A;  2C0M A;  3L17 A;  3N71 A;  5AN8 A;  1H6K A;  1HG5 A;  4F1P A;  1BD8 A;  1HU3 A;  3SQV A;  2EIM E;  3QAQ A;  1HG2 A;  2EIK E;  1N4Q A;  3UXG A;  4RVB A;  3T8K A;  1ELK A;  3V30 A;  2DYR E;  2ZXW E;  3B7U X;  2P9L G;  3ZFW A;  1TNY A;  1KT1 A;  4DI3 A;  3TWR A;  3KAE A;  2H6I A;  2KCV A;  1JWF A;  4HRM B;  2WMN A;  3CGH A;  3HVE B;  1TNO A;  2ETC A;  3UM0 A;  5D0Q D;  4N3C A;  3D3M A;  3NBN B;  3FUH A;  3JQ0 A;  2AXZ A;  1RW2 A;  2XZT G;  3TG4 A;  2F0Y A;  3ENE A;  3PE4 A;  3S7J A;  2AJA A;  3FEX A;  1QZ2 A;  4K0R A;  3FY4 A;  4L2Y A;  4D10 C;  3ULQ A;  4J8S A;  3ISM C;  5BV1 A;  3HXE A;  3EU9 A;  5B3S E;  3PZ4 A;  5AAR A;  4RG9 A;  1H2U A;  2Y3A A;  3PZ1 A;  4NQ0 A;  3FU6 A;  4BTB A;  3L08 A;  1NP7 A;  4BSX A;  5D2M C;  4AXH A;  1LF8 A;  2ZIR A;  1ELR A;  5AEN A;  3APD A;  2R59 A;  3D9M A;  4WWN A;  4FAD A;  4U7E B;  3JUE A;  3DBS A;  4LRZ A;  3DSU A;  3ML9 A;  3WG7 E;  3MCX A;  5LP0 A;  4E6H A;  4XX5 A;  1O1T A;  1INZ A;  3APC A;  1HE8 A;  1IQR A;  3ZEF A;  3D9N A;  3QWV A;  1UG3 A;  3C3Q A;  3R7Q A;  5EID A;  3NF1 A;  1H0A A;  5CCM A;  5D66 A;  4TUM A;  4HFG A;  3Q5M A;  1ELW A;  2VGE A;  3L54 A;  1MQS A;  4L2L A;  2J4B A;  1LD8 A;  3MX3 A;  5ANL A;  4DX2 A;  5JHA A;  3E37 A;  3EIQ C;  2GRQ B;  2FUL A;  3HIZ A;  1OY3 D;  2LAI A;  4N2Q A;  2L6B A;  1TEZ A;  4AV7 A;  4B93 B;  3HXB A;  3ZIM A;  4YDO A;  4K5C A;  4ATZ D;  2VTB B;  3DSV A;  3KEA A;  3PE3 A;  4U8H A;  5CEC B;  4GZC A;  2R2L A;  4ACL A;  3RO2 A;  2L9B A;  3LY8 A;  3QK0 A;  3E32 A;  1EDU A;  1TN8 A;  3D9I A;  4FC8 A;  3D9K A;  2WXL A;  4HQD A;  2NSZ A;  4KZ0 A;  2ETB A;  5ARF A;  2Y69 E;  3NOG D;  4BES A;  3JXJ A;  3PZ3 A;  2AW6 A;  2P2C P;  4TV3 A;  4M3O A;  3MV2 B;  3QAR A;  4DK5 A;  4G24 A;  3UTM A;  3PRE A;  4XEI G;  1X81 A;  4PDX A;  4I9E A;  3SY2 A;  3VLE A;  1AWC B;  3V79 K;  3CHP A;  2RD0 A;  3EHN A;  2VSN A;  2YHC A;  2IU1 A;  2E0I A;  4L9P A;  1HH8 A;  2JAB A;  3T5V A;  2Q7F A;  2V4L A;  2L0T B;  3DPY A;  2FEZ A;  2VSO E;  1E96 B;  3EUV A;  4G25 A;  1TNB A;  3B13 A;  3AG3 E;  1SVX A;  4I2W A;  5KCM A;  3LY9 A;  4G8L A;  2Y4T A;  2QZA A;  3PH0 C;  1IHG A;  4UWF A;  4KYO B;  4JEH A;  4C9B B;  2JEK A;  1UW4 B;  2WM9 A;  1DCQ A;  2WPV A;  4JXT A;  3G2W A;  5KJL A;  5IY5 E;  2XS8 A;  3UQ3 A;  3D9O A;  2V0P A;  2V4H C;  3QC1 A;  3CVP A;  3C98 A;  3JUI A;  2PL2 A;  5ARG A;  4CYM D;  5BT1 A;  2WXF A;  3S7D A;  4GTM A;  3Q75 A;  3I3N A;  2QC9 A;  3C5R A;  4O6F A;  4GZ6 A;  4KMO A;  4DX5 D;  3CVQ A;  3UT4 A;  4GA2 A;  2IY0 C;  3ZYM A;  4W9R A;  3FTS A;  4J8D A;  1N94 A;  4Y6C A;  4U63 A;  2FO7 A;  1VDY A;  2WXO A;  4U0S A;  2XRY A;  1H6O A;  3ZPJ A;  4G1T A;  5JHB A;  4U0U A;  5FTP A;  3B7R L;  4CGV A;  4HOT A;  5ENR D;  4ATG A;  4O1O A;  5AYW D;  4RLY A;  4FP7 A;  3NOC D;  3VLD A;  4HOR A;  3IXE A;  3DSX A;  4BT9 A;  4DLO A;  3FTX A;  3DST A;  5G2N A;  2CHZ A;  2GRR B;  3ESL A;  4L7T A;  1HFA A;  3IHV A;  3ZYQ A;  3SFY A;  1QNF A;  4WNF A;  5EKQ D;  2WXQ A;  2GRO B;  3TXM A;  2P58 C;  2P9S G;  4XKC A;  2XPZ A;  3TWT A;  1IKN D;  5D0O D;  5KNG A;  2V5Q C;  1IHB A;  5ENN A;  5FIO A;  5AIJ A;  3CVV A;  3CQG B;  3EU5 A;  3ZU7 B;  1BPO A;  4RSY A;  2KZT A;  3Q49 B;  3ZYL A;  3MKQ B;  2VSY A;  3AS5 A;  4IN3 B;  4RG6 A;  4BEP A;  5FJY A;  1NA0 A;  3D9P A;  2EIJ E;  3JXI A;  3B7T A;  4LER A;  1E7V A;  3IBE A;  5JA4 D;  2QYU A;  2LXL A;  3ASG A;  3RAU A;  2ILR A;  1KPS B;  1N4S A;  4TXP A;  3PZ2 A;  3SBS A;  2X6H A;  3KEZ A;  4C48 B;  4DUI A;  2GW1 A;  3ASO E;  4LNU D;  3AS4 A;  1W3B A;  1Q2Z A;  2YNQ A;  4MRU A;  2HM8 A;  3UX4 A;  2DYS E;  2OEV A;  2J08 A;  4K03 A;  2UY1 B;  1JWG A;  1HF8 A;  4GAA A;  3MKR A;  3ASH A;  5H7P A;  2AXV A;  2QFC A;  3ZN3 A;  3SI5 A;  3UI2 A;  4F3V A;  4GPK A;  1HXI A;  3QKY A;  3CVU A;  3PVL A;  1BI8 B;  3MV3 B;  4KT6 B;  4GTT A;  2WXR A;  2P9I G;  4QFV A;  2KAT A;  1X5B A;  2I9C A;  1GW6 A;  2LUH A;  4EZK A;  3RIB A;  3EIJ A;  3CQC B;  1SZA A;  3L6A A;  1E8Z A;  4HI8 A;  4Q96 A;  4G8K A;  5ENS D;  2CFU A;  2J09 A;  3Q78 A;  4BX8 A;  1EPU A;  2Y1L E;  4N5Q A;  3FTW A;  3J5P A;  4XIF A;  1JPL A;  5AAO A;  5BPP A;  2NYJ A;  1H2V C;  3UKU G;  2GRL A;  4CRW A;  1HO8 A;  1N0R A;  3CHM A;  1MHQ A;  1OCZ E;  4GYW A;  1A5E A;  3TWQ A;  4JA9 A;  2MHK A;  1DVP A;  4EBA G;  1N54 A;  4XI0 A;  5M72 A;  3RRM B;  3ABM E;  3FTU A;  3OAW A;  2HYZ A;  2IOS A;  2DVW A;  3AG2 E;  2R05 A;  2FO1 E;  3LVR E;  4GZD A;  5A6C A;  2PNN A;  4I17 A;  4U07 A;  2DZO A;  4Y6W A;  3PRZ A;  4GB9 A;  4FU3 A;  1JCS A;  4DJA A;  5KJN A;  4LG6 A;  4YND A;  3D9H A;  2Y0B G;  4GCN A;  5CRU A;  2A5E A;  4TXQ A;  1NI1 A;  3ABL E;  3DWL G;  1QQE A;  4KBQ A;  5ENO D;  5CMW A;  5JJ7 A;  2XEE A;  3P2B A;  1Z5S C;  1UN8 A;  1Z3Y A;  2DZN A;  3TJP A;  5G05 J;  5JMN D;  4ME2 A;  2KBX A;  2YQ8 A;  2KM4 A;  5J90 A;  3ZVV A;  3DEP A;  4C0M A;  4YVO A;  4BTA A;  1OWL A;  4HRN A;  2OVB A;  1OCR E;  3DPD A;  3RRN B;  1NA3 A;  4IYP A;  2XHE A;  1O5M A;  2CG3 A;  1UJK A;  2X38 A;  3NZS A;  3UM2 A;  3CVY A;  1PAQ A;  4EZL A;  1O1R A;  1S0P A;  2EIL E;  2RG8 A;  2GRP B;  3I4G A;  4B8A A;  3UM1 A;  5B1B E;  2ZIS A;  5BUZ A;  3Q4A B;  2FBN A;  2I6H A;  3CHO A;  3NAW A;  3JCK C;  4FUL A;  3R9A B;  3Q7F A;  3Q15 A;  2VSX E;  4HI9 A;  2V5F A;  4F1S A;  2WXH A;  3CVX A;  1DC2 A;  4H7Y A;  4CCA A;  3G2S A;  3Q7A A;  4PS3 A;  2UWJ G;  2J8S D;  4P29 A;  4R7L A;  3RKV A;  1PC2 A;  3CVW A;  1NZN A;  4UI9 J;  4PUC A;  2OVF A;  5CHE E;  3ZRH A;  2OCC E;  3B95 A;  3UKR G;  4DI4 A;  4NAC A;  2VJ8 A;  4CT0 A;  3U66 A;  3ZNG A;  4HS2 A;  4CDM A;  3CK7 A;  4MLP A;  2XEH A;  3BQO A;  3D9L A;  4QQI A;  1QBQ A;  2LSV A;  2RKK A;  5B1A E;  4AJW A;  2CHW A;  5CED B;  2WMO A;  3UT8 A;  1YA0 A;  1SA5 A;  4AY6 A;  3LPZ A;  3TWX A;  4BWR A;  4N39 A;  4F6R D;  2WXK A;  4YDY A;  2VTB A;  3ONK A;  3FUM A;  3E33 A;  3AS8 A;  3VLF A;  3CVL A;  1N4R A;  4H7X A;  4LCT A;  3HYM B;  3B7S A;  2DCP A;  4O60 A;  3HG0 D;  2FF4 A;  4ACK A;  5DIZ A;  3CK8 A;  1FVH A;  4I1A A;  4LEU A;  2YHE A;  4U0Z A;  1TNU A;  2B0O E;  4BT8 A;  4A63 B;  1D8E A;  4AVX A;  3DXM G;  4YDW A;  4EPZ A;  2QYJ A;  3ML8 A;  3PNT B;  1FT2 A;  4JB8 P;  1AP7 A;  5BV0 A;  4B8C B;  3CHS A;  3ESK A;  3FTZ A;  1S70 B;  4JD2 G;  4AEZ C;  1N9A A;  2PQN A;  3PEV B;  3LVQ E;  1WAO 1;  2MOW A;  4G26 A;  1U2V G;  2X6F A;  1N52 A;  4Q69 A;  2R5S A;  3LY7 A;  2M63 A;  2P9N G;  4ZHB A;  2KXP C;  2P9U G;  4O1P A;  4I2Z A;  2ZGG A;  1YMP A;  4HXI A;  4J8Y A;  1OWO A;  3DRA A;  5KNH D;  3ZW3 A;  2DBA A;  2IFU A;  3UIO C;  5T4Y A;  4A3T A;  2V8S E;  3OXL A;  4UWK A;  5EIL A;  4DRX E;  2WB2 A;  5FZS A;  3S7B A;  3Q9N C;  2KCL A;  2R03 A;  4HLL A;  3FTV A;  3CEQ A;  3LKU A;  4UWH A;  2R17 C;  5BXU A;  1OCC E;  4CDN A;  4FHJ A;  3F6Q A;  3PEU B;  2VGX A;  5CBN A;  4ANU A;  3C3O A;  3AJI A;  5FZR A;  4E85 A;  3L22 A;  1N11 A;  3HXD A;  4FJZ A;  3O4Z A;  4M7C A;  3DSW A;  3U64 A;  3TGO A;  2F8Y A;  4L23 A;  2XRZ A;  2X6K A;  1QYM A;  4CDR A;  2XCB A;  4AY5 A;  2HO1 A;  3OXF A;  3FH7 A;  5AQB A;  5EIB E;  1FT1 A;  5A7D B;  4U8V D;  4HRL A;  3CST A;  3ZGQ A;  1IXV A;  1K8K G;  3QWP A;  2IO2 C;  5CRV A;  4YVQ C;  3W9F A;  4F53 A;  4TUU A;  5FQ4 A;  2BTD A;  3ASF A;  1IQU A;  3QB2 A;  1BI7 B;  5FIN A;  4I6E A;  1UN9 A;  2YIN A;  2FI7 A;  2ZGD A;  4JW1 A;  4APF A;  2WXI A;  4G2V A;  3FU0 A;  1JUQ A;  4BFR A;  1LTX A;  2DIW A;  1S63 A;  4JEU A;  5HKP A;  3OXG A;  3ZXS A;  5LCW C;  4A1S A;  2WXJ A;  5FZQ A;  5KJK A;  4K5B A;  4KVO A;  3I5P A;  3GYZ A;  4V3I A;  1NFI E;  2ZU6 B;  4XI9 A;  3CK9 A;  3CVN A;  1HZ4 A;  4A1G A;  3MJW A;  3MGB A;  5CER B;  1RZ4 A;  2LO6 A;  5KWD A;  3AU4 A;  4N2S A;  4ANX A;  4EEC A;  4GYY A;  3EHM A;  3FUI A;  4BET A;  2H6G A;  1OCO E;  3MEK A;  4KVM A;  2X3M A;  3FUF A;  4U95 D;  1UJJ A;  4B89 A;  1TJF A;  3LJN A;  4DX7 D;  3U3W A;  5HI7 A;  3UT7 A;  3FDH A;  5FQ7 A;  2OOE A;  4GML A;  2WXP A;  1BLX B;  4F7A A;  2EQX A;  4OVV A;  4GMJ A;  4UWL A;  4J7W A;  4JL0 A;  5EDS A;  4OAV B;  4PH4 B;  3CHR A;  3Q9U C;  4DX1 A;  1SQM A;  3QDN A;  2AVP A;  5G05 C;  1KZO A;  1OWP A;  3RRU A;  3BUA A;  2IOL A;  3L82 A;  2BUG A;  4UQZ A;  5FQ8 A;  3ULE G;  1JCR A;  1KZP A;  2WQ6 A;  1D9S A;  3UM3 A;  4GTP A;  2KCK A;  1HS6 A;  3NZU A;  4TXR A;  5E75 A;  1P5Q A;  4GCO A;  3ONL A;  3FHE A;  4GTV A;  2B6C A;  5CCL A;  2J07 A;  3APF A;  1TYQ G;  2L6J A;  4WWP A;  5KBA A;  1OUV A;  3TWU A;  1B89 A;  3RJV A;  3PUJ A;  3V2X A;  3FTY A;  5HQ8 A;  3KS2 A;  3HDX A;  3R7R A;  2I1J A;  4UI9 K;  3AAA C;  5J08 A;  3HRA A;  3KSL A;  3ZHE A;  2OEW A;  1L5J A;  4APO A;  2P9P G;  1YYH A;  1OXJ A;  2AXU A;  2IEJ A;  3NB2 A;  5JJ6 A;  4NUR A;  3Q79 A;  3V2O A;  3GZ1 A;  4JHR A;  4B94 A;  2XPY A;  1WM5 A;  4MS6 A;  4GU5 A;  2L0I A;  5DBK A;  2J4D A;  1ZBP A;  1BU9 A;  3E30 A;  1Y8M A;  3EJN A;  2PQR A;  4KZC A;  3BG0 B;  2KC7 A;  2IO3 C;  4WWO A;  3PZD A;  4NRH B;  5C1D A;  3HVE A;  4MKT A;  1U3D A;  4JVS A;  4JC8 A;  1SW6 A;  2NXP A;  4BY6 A;  1MYO A;  4HBD A;  4ABN A;  1U3C A;  3TG5 A;  1MX4 A;  4URK A;  3PUK A;  3T9K A;  4GZ5 A;  3TL5 A;  3U9W A;  3CSF A;  4GA1 A;  4N5C A;  5FQ6 A;  4GA0 A;  4CZ2 D;  4G23 A;  4JHJ A;  1V55 E;  3I4R B;  4XZ4 A;  5CEA A;  2C0L A;  2X6J A;  3HXF A;  4I6J A;  4EBA A;  3C72 A;  1ZB1 A;  5T3R A;  2A4Z A;  5G04 C;  1H6P A;  3SD5 A;  2QY7 A;  1ZU2 A;  2HE0 A;  3MKQ A;  2LAH A;  2LNI A;  3ZKJ A;  1Z3X A;  3HHM A;  2P9K G;  2CHX A;  3UIP C;  4PS7 A;  4FJY A;  4J6I A;  3AG1 E;  4RQI A;  2WQH A;  4IRU A;  3SZ7 A;  3MYV A;  5EX3 A;  4A3V A;  1FCH A;  3O48 A;  4OVU A;  4LNG A;  4EZJ A;  3TWW A;  5A23 A;  4JHK A;  5LCW J;  3IEG A;  2I1K A;  5HS0 A;  5CMY A;  3UUX A;  4WAF A;  1E8Y A;  3VTX A;  2KZT B;  4HNA D;  2WQ7 A;  1WG0 A;  2VQ2 A;  3FUL A;  4U04 A;  3KD7 A;  3TWV A;  4HLE A;  1N0Q A;  4DLQ A;  4WND A;  4CGW A;  5AQ9 A;  3IV0 A;  2XS1 A;  1D8D A;  1MX2 A;  4L1B A;  5AQ7 A;  2WXG A;  2WXN A;  3FFL A;  3NQP A;  1E8W A;  3B7B A;  4KXK B;  1SZ9 A;  3FH5 A;  3AG4 E;  4LUN U;  2AWI A;  2ETA A;  5AJL A;  3CIA A;  2F37 A;  5G55 A;  3ABK E;  5JJT A;  3GZS A;  4HOQ A;  3L16 A;  4FHK A;  4K5A B;  2E2E A;  4HOU A;  2F8X K;  2I2O A;  2VGY A;  2IQC A;  2UY1 A;  2XPI A;  4MBG A;  4YDE A;  2NC9 A;  5LFA A;  2HR2 A;  3CHQ A;  3DXK G;  4BER A;  5LX8 A;  1S64 A;  1MX6 A;  3CLJ A;  3MZL B;  4WNE A;  3FU5 A;  3BEE A;  2BKG A;  5KJM A;  1WY6 A;  1EF1 C;  5ANR A;  2IJG X;  4ZFH A;  3UMV A;  3Q73 A;  3BU8 A;  4HB5 A;  4J8F A;  3SBT B;  4DPR A;  3L13 A;  2EIN E;  4U8Y D;  4Q94 A;  4ANW A;  1O1S A;  3ZYK A;  2MYO A;  1TN6 A;  4JA7 A;  4AIF A;  3CV0 A;  2OND A;  3FUE A;  3CKC A;  4AM9 A;  1E7U A;  3MA5 A;  3UPV A;  4I1M A;  1MZC A;  4AP2 A;  5C2Y A;  4ILG A;  4GZ3 A;  4N3B A;  2A5U A;  4ILI A;  2XEN A;  3UIN C;  1FPP A;  1LD7 A;  3X2Q E;  2ION A;  3ZXP A;  5BXO A;  3FUD A;  3DSS A;  5EN5 D;  4J0U A;  5T8I A;  5EYP F;  3URZ A;  1EYH A;  3OTN A;  5CBO A;  3P1U A;  3PS6 A;  2LXM A;  2VGX B;  2WXM A;  2IF4 A;  3SFX A;  5E76 A;  3U4T A;  3AU5 A;  2X6I A;  3T8M A;  3DEO A;  3W9G A;  4UI9 C;  2Y4U A;  3E4B A;  2H6F A;  3FP3 A;  3T5X A;  3HXC A;  4DX6 D;  5AJD A;  2R02 A;  2J49 A;  2PM6 A;  1PY1 A;  2XGO A;  4X8Q A;  3SO8 A;  3RO3 A;  3FEY A;  3RSE G;  5BNW A;  4HOS A;  4UQX A;  3GW4 A;  3LJ3 A;  3KSQ A;  4FLH A;  4I43 A;  3GZ2 A;  4WUY A;  1DNP A;  4GTQ A;  3V31 A;  3EDT B;  4OYS A;  4GPM A;  2WVI A;  2GRN B;  3FU3 A;  1Y6I A;  1N95 A;  4NIK A;  5FWQ A;  2OV8 A;  3CR3 A;  4EQF A;  4N3A A;  4J8E A; 
#chains in the Genus database with same CATH homology
 1O1T A;  1S63 A;  4GTP A;  1SA4 A;  4GTO A;  1TNY A;  1MZC A;  4L9P A;  2ZIS A;  2H6I A;  1D8D A;  4GTV A;  3DSX A;  3Q7F A;  1TNO A;  3DPY A;  1N4P A;  2BED A;  3DST A;  3EUV A;  3E34 A;  1FPP A;  1LD7 A;  2H6H A;  1JCS A;  1TNB A;  3HXF A;  1TNU A;  3Q7A A;  1LD8 A;  3C72 A;  3SFY A;  3DSS A;  4EHM A;  1D8E A;  3E37 A;  2F0Y A;  1JCQ A;  3HXD A;  1NI1 A;  2H6G A;  3KSL A;  3DSW A;  4GTS A;  3HXB A;  4GTT A;  3SFX A;  1FT2 A;  4MBG A;  4YDE A;  4YDO A;  1TNZ A;  2IEJ A;  1NL4 A;  3HXE A;  3PZ4 A;  1N9A A;  3EU5 A;  3PZ1 A;  1TN7 A;  2H6F A;  1S64 A;  3DSV A;  3HXC A;  1FT1 A;  3Q79 A;  4LNB A;  2R2L A;  4GTR A;  3Q78 A;  1QBQ A;  2ZIR A;  1DCE A;  4GTM A;  4LNG A;  3E32 A;  3Q75 A;  1SA5 A;  3KSQ A;  3E30 A;  1TN8 A;  3Q73 A;  4GTQ A;  3DRA A;  1N4S A;  1KZO A;  3PZ3 A;  3PZ2 A;  3E33 A;  1N94 A;  1N4Q A;  1O5M A;  3DSU A;  1N95 A;  1JCR A;  1O1S A;  1N4R A;  1X81 A;  1TN6 A;  1KZP A;  1LTX A;  1O1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...