1N4QA

Protein geranylgeranyltransferase type-i complexed with a ggpp analog and a kkksktkcvil peptide
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of mammalian protein geranylgeranyltransferase type-I
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
total genus 124
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n4qA00
1N4RA 1JCQA 3E37A 1TN6A 1JCRA 1LD8A 1LTXA 1N95A 3DSWA 3DSTA 2H6GA 3HXDA 3Q7FA 3Q75A 3SFYA 1DCEA 1SA4A 1O5MA 3DSSA 3E34A 3PZ4A 1NI1A 4EHMA 3KSLA 3HXEA 1KZOA 1N4PA 1N4QA 4GTSA 3DRAA 1FT2A 3E32A 4GTPA 1D8EA 1TN8A 2BEDA 1S63A 4L9PA 3EUVA 3PZ3A 4GTVA 2R2LA 1TNOA 3HXBA 4LNBA 3PZ2A 4GTQA 3E30A 3DPYA 2F0YA 4GTRA 1FT1A 4GTOA 3Q78A 1JCSA 1LD7A 1SA5A 4GTMA 1N9AA 1S64A 3EU5A 1FPPA 3DSVA 4YDOA 1TNYA 1TNZA 2H6FA 3PZ1A 1NL4A 3C72A 2ZIRA 3KSQA 3Q73A 3DSUA 3E33A 1O1TA 1D8DA 4LNGA 1TNUA 2IEJA 3HXFA 3HXCA 1QBQA 3Q7AA 1N94A 1TN7A 1MZCA 3SFXA 4YDEA 2ZISA 4GTTA 1N4SA 3Q79A 1KZPA 1O1RA 1TNBA 2H6IA 3DSXA 4MBGA 1O1SA 2H6HA 1X81A
chains in the Genus database with same CATH superfamily
4A1SA 2IONA 3APDA 1KLXA 2YNQA 3V31A 4OVVA 4L2LA 4XKBA 3SBSA 1IXVA 3TWSA 2WQ6A 3HXDA 4XI0A 3Q7FA 4KVMA 4A3TA 5AN8A 5KNHD 2P58C 4EHMA 2WXLA 3JYSA 2FI7A 2X3MA 2QYUA 4OAVB 3VLDA 2V4HC 1HFAA 5ENTD 4L9PA 2HE0A 1QZ2A 1E7VA 4GTVA 3CHRA 3CR3A 5E76A 3W9FA 4BSZB 1BD8A 3DPYA 2OVBA 4L23A 2F8XK 2VYIA 1IKND 2XEEA 2LAHA 5EYPF 1OCZE 4I6EA 3D9HA 2PM7A 4R7LA 2X6FA 3PZ1A 4GB9A 3FTWA 3CEQA 3CSFA 3PEVB 2KATA 3JXJA 3CVVA 4UQZA 4B94A 3HXFA 1ELRA 4F6RD 3DPDA 3UM3A 4N5QA 4B93B 4JHRA 3V30A 1H2TC 1LF8A 3G2WA 4CEMA 4FHJA 5AYWD 3TWWA 3I4RB 3RRMB 4PS7A 2WXKA 2MOWA 4GPMA 2X6JA 3AS4A 3IBEA 3B13A 5H7PA 2CHZA 5HRYA 3ONLA 2X6IA 3DXMG 3CVWA 3FTVA 4FADA 1H19A 4CT0A 1HO8A 3AU4A 1L5JA 4JD2G 3J5PA 4HFGA 2ONDA 3FFLA 1BLXB 4JB8P 2MRIA 3QNKA 4GTQA 5CCLA 4GTRA 3ZVVA 3UKUG 4JHKA 3HG0D 3UT8A 3W9GA 3NZUA 3NB2A 2UY1A 2LSUA 1ZBPA 2ZIRA 1NA0A 3MCXA 3PH0C 1IHGA 5FINA 4M3OA 5CRUA 2VQ2A 5M72A 5ENSD 5AJDA 4GMRA 3CVLA 3HYMB 4KT6B 4XX5A 2IFUA 5KJLA 3D9JA 4LNUD 3DSXA 4FP7A 4BWRA 2H6HA 5KCMA 2QFCA 5ENQD 2V0PA 4BY6A 3S7JA 2A4ZA 3Q15A 3QKYA 4O6FA 4B8AA 1INZA 3ZN3A 2V5FA 4GZDA 3PVLA 3FUMA 2C0LA 3GW4A 3FTYA 5A6CA 3CHPA 1Z5SC 2ETCA 3AAAC 3U9WA 5BV1A 3FH8A 2J09A 3DBSA 3UM2A 3HXBA 4YNDA 4X8QA 1EPUA 1P5QA 1MHQA 4JHJA 3QAQA 3CVPA 4F53A 2AW6A 4YDOA 1UJKA 2XEVA 5ANRA 1E8XA 2AXZA 2VSYA 5KJNA 3KEAA 3ASDA 3ASNE 4FHKA 4G8KA 4MLPA 5ENRD 1YCSB 1WG0A 2CHWA 2BF0X 1HS6A 2PQRA 4GU5A 4GMJA 1YA0A 2AXUA 2J49A 3T9KA 3GZ2A 5FIOA 3UM1A 4UWFA 4JC8A 2E0IA 2DCPA 2GRQB 2LSVA 1OXJA 3CHOA 4JA7A 3QWWA 3SFYA 2GRNB 2WXHA 4XKCA 1NI1A 5BPPA 2DYRE 4RVBA 1FVFA 3ABLE 3TWTA 3L6AA 3I5PA 2GROB 2VGXA 2BEDA 4KVOA 5BV0A 3IXEA 2DVWA 3NQPA 5B3SE 2ETBA 1RZ4A 3CQCB 5CECB 4KZ0A 5AQAA 5ARFA 1MX6A 3UMVA 3ZKJA 1BI8B 1FPPA 4LUNU 4U04A 2DBAA 1TYQG 3FU0A 3CHMA 4I6JA 4W9RA 2ZGGA 2AJAA 4WNDA 3KSQA 4KBQA 4ATGA 2P2CP 3ONKA 3JXIA 3TXNA 2FO1E 1ZU2A 1HZ4A 4U0SA 3EDTB 3APFA 1MZCA 1U3CA 2ZISA 2OEWA 3X2QE 4ANUA 3LJ3A 2VTBB 3FTXA 2B6CA 3D9NA 1NA3A 4I2WA 1EYHA 5FT9A 1OCOE 4JXTA 1TN6A 1JCRA 2WVIA 3P2BA 2JEKA 4HB5A 2ZU6B 5C2YA 3LXUX 4JA9A 4QFVA 4J8SA 2JLBA 4GTSA 5JMND 2IO2C 5KWDA 4GTPA 5BUZA 5DIZA 5FQ8A 1TN8A 3FULA 2L9BA 2HO1A 3UXGA 3RRNB 3ZYKA 4UI9C 2GGFA 4PDXA 3ASOE 1HX8A 3DWLG 3ISMC 2ZXWE 2X6HA 2OEVA 1FVHA 4URKA 3LCAA 1TNZA 3G2UA 3RSEG 3FTZA 4RSYA 1KPSB 2QYJA 3FU3A 5KJMA 2AVPA 5G04C 2L0TB 4DX5D 3RRUA 4AY6A 2NSZA 4A63B 2YHEA 3VLEA 3ZRHA 3ZFWA 4N39A 4Q94A 3SFXA 4JPSA 4WWPA 1AP7A 1Z3XA 4DJAA 2PNNA 4APOA 5ITZF 1IQRA 3UIPC 2LXMA 2CHXA 3FUIA 2M63A 1X5BA 2EINE 4WUYA 3B7RL 4KXKB 1S70B 4AOFA 2KXPC 4CCAA 4HRLA 4EECA 2FEZA 3E34A 4CT4A 3J5QB 3ABKE 2AWIA 4UWLA 3FTUA 3NOCD 2R59A 3CK7A 3RKVA 3S2AA 4A3VA 3KAEA 3S7BA 2X38A 2WMNA 2DYSE 3FDHA 3EUVA 3PZ3A 3ASHA 5A23A 1E8WA 4HI9A 1S64A 1HG2A 4AXHA 4UWKA 4JZYA 5DBKA 3S7FA 4JEUA 4DLOA 1E90A 5CEDB 4JVSA 3T5XA 3QDNA 5ANLA 1EF1C 5FQ7A 2WXOA 2FULA 4FA6A 4N3AA 1WAO1 4HI8A 4HLLA 3CIAA 1WM5A 1N11A 4F1PA 1QBQA 3I3NA 3IV0A 2HYZA 3FUNA 3QC1A 3FH5A 4N3CA 4Q69A 2F37A 3MKRA 4KYOB 4A1GA 5ARGA 2VGXB 4MS6A 2J08A 3L54A 4IN3B 1OY3D 3FUJA 3DSTA 3BUAA 2OCCE 1H6KA 4GA0A 4O1PA 2PM6A 1FCHA 5LCWJ 4C9BB 1DVPA 3BEEA 3ULYA 2RD0A 3LPZA 3U64A 2WXFA 3B7TA 4LERA 2EQXA 2WM9A 2IOSA 4APFA 1E8ZA 5BW8C 1H0AA 4B8CB 5FTPA 2I1KA 2PL2A 2P9SG 4B0ZA 5IY5E 1K1AA 4J7WA 1UG3A 1OCCE 2HR2A 2EILE 5BT1A 3TG4A 4UWGA 3CHSA 3CKCA 1VDYA 1V54E 4WNGA 2IF4A 1PY1A 3CGHA 5G55A 4F3VA 3TL5A 4AVXA 1TNUA 4RLYA 1MX2A 3CQGB 4LRZA 4AM9A 4L7TA 3JUEA 3NAWA 1Y8MA 2Q7FA 4AY5A 1TN7A 4ZHBA 2IO3C 5EN5D 1ELWA 4J0UA 4UI9J 3EJNA 4DI4A 4N3BA 3UUXA 3PNTB 3TWQA 3WXXA 4BEPA 4PS8A 4A55A 2A5EA 3FWVA 5CMWA 2WQ7A 1JWGA 1N4RA 4UWHA 4XI9A 3E4BA 2EIME 1LTXA 4C48B 2EIJE 2GW1A 3UPVA 2I2OA 5LCWC 3Q75A 4YVOA 4QQIA 1DCEA 4P29A 3DSSA 5J90A 3LY7A 4EZKA 4C0MA 1NZNA 3PZ4A 4UI9K 4ILIA 4XZ4A 4N2SA 5A7DB 1N4PA 1N0RA 3B95A 3QARA 4GCOA 1UOHA 3OTNA 4IYPA 2R05A 5FZRA 2EIKE 3CVNA 4TXRA 2XCBA 4UQYA 3RO3A 2R2LA 2L6JA 5G05J 4ZFHA 3CK8A 2WXMA 4BERA 1SA5A 4FULA 2NYJA 4Y6CA 3TGOA 4GPKA 3D9LA 4U8VD 5FZQA 5JJTA 1MX4A 2XEHA 3LVQE 3G2TA 1QYMA 1EDUA 3ZU7B 2GRLA 3MGBA 3IHYA 3DSUA 5CCMA 2VGEA 2PZIA 3IKOB 5EIDA 1H6OA 5AQ7A 4LSZE 3HIZA 2V8SE 1K3ZD 2XQ0A 3CVYA 4BETA 3ESLA 2XCCA 1OWMA 2IY0C 5CBNA 3MZLB 4MKTA 4HNAD 3R7QA 2GRPB 3ZXPA 3E37A 5EYLA 5LP0A 1SVXA 1UN9A 5T3RA 3DSWA 4DK5A 2FO7A 2H6GA 4RQIA 4WWNA 1SA4A 1O5MA 2OV8A 4Y6WA 3TWUA 5JA4D 1BPOA 1KT0A 4EZLA 2HM8A 1G3NB 5E75A 4BFRA 2AXVA 5G05C 3U3WA 3FP3A 3CVXA 4BX9A 5KJKA 2ILRA 4I6GA 4U7EB 4WNFA 3KS2A 4G11A 2OOEA 3F6QA 1MYOA 5CMYA 4U63A 3BQOA 3Q73A 3E33A 3SD5A 4HVBA 2DZNA 3SI5A 3JQ1A 5CHEE 5BXUA 4AIFA 1NP7A 5AJLA 3LVRE 3R9AB 3ZHEA 4BT9A 3RU0A 4PS3A 3QJZA 5ENOD 4GTTA 3JUIA 4EZJA 1KZPA 4G23A 1HF8A 1WDYA 3PREA 2C0MA 1TNBA 4BSXA 2KZTA 4MBGA 3TWXA 3AS8A 5KNGA 3L9TA 2QZAA 1Z6TA 3UT4A 3PDNA 3ENEA 3ZYQA 3HRAA 1DNPA 3PEUB 3SZ7A 2BKGA 4NURA 2V4LA 1V55E 4GMLA 2LAIA 3MJWA 2IU1A 3DRAA 3NF1A 5ENPD 4TRQA 4H7XA 2J4BA 4YDWA 1OWNA 4HOUA 4ACLA 3CLJA 5FWQA 5BNWA 2P9IG 4GZ3A 3VTXA 2WXJA 5AQBA 3C5RA 2QC9A 2R03A 3APCA 3BG0B 1QQEA 5EX0A 3L82A 1LD7A 2WXQA 2NC9A 2E2EA 2P9NG 1TNYA 4LCTA 4OVUA 5KBAA 2MYOA 4AJWA 3LKUA 3AS5A 2WXIA 4I1AA 4HOTA 3C3OA 3CSTA 2KBXA 1OUVA 4CGWA 2WXNA 5D2MC 3SO8A 4BTBA 1HG5A 2KCVA 3EU9A 4HXIA 4H7YA 4U0ZA 3O4ZA 3ZNGA 1E7UA 4EBAA 4G1TA 1W3BA 4EQFA 1OCRE 4XIFA 5AQ9A 3RJVA 3ULEG 4NQ0A 1N52A 1U3DA 3LY8A 3SGHA 2Y1LE 4FC8A 4XEIG 5G2NA 4OYSA 3URZA 1ELKA 5CERB 1YYHA 3WG7E 3PUJA 3NZSA 4YDYA 1KT1A 4LEUA 3Q9UC 5LOZA 3KSLA 1KZOA 2UY1B 3SNXA 3B7BA 3TWVA 3ZYMA 3T8MA 3DXKG 5EKQD 3C3QA 2XZDG 3LYAA 5D0OD 2XPIA 2YQ8A 3D9IA 2XENA 4AEZC 2I9CA 2F0YA 1DCQA 4WAFA 3OXLA 4GTOA 2P9PG 1S0PA 1PC2A 1IHBA 1N9AA 3GYZA 3SBTB 4M7CA 2DZOA 1SZAA 2XZTG 2XRYA 4U07A 4ANVA 3AG1E 2KM4A 4EPZA 3PE3A 3FUFA 3CHQA 2DWZA 4J8YA 3HHMA 2R02A 1MQSA 3CV0A 2RFAA 4LNGA 4HOSA 4G25A 1H6PA 5HI7A 2P9UG 2ZGDA 3HXCA 1E8YA 5CRVA 3V2XA 3I4GA 3FUHA 4OAUC 1JWFA 1NFIE 2CFUA 4HLEA 3FTSA 4BX8A 4J6IA 5B1AE 2VSNA 5J08A 2JABA 4L1BA 2VSXE 4ANXA 4DX1A 3EHRA 1Y6IA 4XE0A 4TUUA 3LEWA 3VLFA 2I6HA 5AENA 3LY9A 2XGMA 4E85A 2CG3A 4BTAA 1N4QA 2XPZA 3EHQA 5C1DA 3E32A 1YMPA 2CG2A 2OVFA 1JPLA 3BG1B 3ZPJA 3ZGQA 4I2ZA 2J8SD 4U95D 3ZYLA 3E30A 3ZHEB 2IJGX 4IULA 3Q78A 4FJYA 4JL0A 2Y69E 1IQUA 2KCKA 3Q47B 1NL4A 3ZXSA 1MJ0A 3HDXA 3UX4A 3UIOC 2UWJG 1Z3YA 2WPVA 3TJPA 1A17A 2PQNA 3B7SA 5JJ7A 2WB2A 1BI7B 3K9IA 2J4DA 3PZDA 4DRXE 5BXOA 3UTMA 2RFMA 4G24A 3PS6A 3CKBA 3G2VA 1SZ9A 2YHCA 4PH4B 1X81A 2MHKA 4N2QA 1OWPA 2B0OE 4RG6A 4CDMA 1LD8A 3LJNA 2J07A 4E6HA 3EIJA 4J8FA 5HKPA 3L22A 4HBDA 4GCNA 4I1MA 4O60A 4CZ2D 2WXRA 4WWOA 5EIBE 3MYVA 4L2YA 1K1BA 4I9CA 4CYMD 4KMOA 1HU3A 2Y3AA 2LXLA 1H2UA 2XHEA 4C0EA 3R7RA 4FLBA 4DLQA 2R17C 3KEZA 5ENNA 2FF4A 3V79K 2R5SA 4D10C 1A5EA 4J8DA 4K0RA 1TNOA 1TEZA 3EIQC 5D0QD 3AJIA 2J9QA 3C98A 3R9MA 3TWRA 5B1BE 3SF4A 1HXIA 1OWLA 3Q4AB 2VTBA 4CGVA 2F8YA 2VSOE 3PNLB 4O1OA 4U8HA 2VGYA 4FU3A 4B89A 3N71A 4CRWA 3HVEA 4V3IA 1OWOA 1O1TA 3D3MA 1D8DA 4G8LA 3C3RA 3FHEA 2GRRB 1TJCA 3JQ0A 3ZIMA 4K5BA 4MRUA 4TXPA 4GA1A 3ZEFA 3JCKC 1JUQA 4YVQC 4TV3A 3FY4A 4FJZA 5CBOA 3L08A 4DPRA 3ML8A 3LDZA 2H6IA 1BU9A 4I43A 2Y4TA 4J8EA 4U0UA 3KD7A 3HVEB 3TXMA 1N95A 4ME2A 2RKKA 4KZCA 3P1UA 3UQ3A 3MEKA 3CVUA 2V5QC 4BT8A 3DEPA 2DIWA 2NXPA 3Q5MA 1HE8A 3HXEA 3CVQA 5EILA 3U4TA 5FJYA 4HRNA 4TUMA 3RO2A 3ASGA 2LO6A 5AARA 5EX3A 1U2VG 4EBAG 1SQMA 3PZ2A 3QWVA 4GZCA 3TG5A 4UQXA 3SFZA 1FT1A 5JHBA 2X6KA 4HORA 3FU6A 2XGOA 2WXPA 3UINC 4IRUA 3OXGA 3NBNB 4GAAA 2GRMA 3FUDA 5FQ6A 2XPYA 3C72A 3PE4A 3UM0A 3T5VA 4U8YD 4AP2A 4RG9A 4G2VA 1QNFA 3D9OA 3T8KA 2C2LA 4DX2A 4I9EA 5LX8A 4JEHA 5D66A 2XRZA 4DX6D 2Y0BG 3L13A 3AG4E 3QWPA 1N94A 3L16A 3EHMA 3AG2E 1N0QA 5JHAA 2ETAA 3ZW3A 4JW1A 1O1SA 3QK0A 2P9KG 1JCQA 2I1JA 1WY6A 5HS0A 1UJJA 2L6BA 2VJ8A 3UKRG 4CDRA 2A5UA 2QY7A 3AG3E 3GZ1A 3IHVA 1E96B 3S7DA 4NIKA 2KC7A 4K5CA 1FT2A 3B7UX 4NRHB 1S63A 4F1SA 4DX7D 3ABME 1XGWA 1PAQA 1AWCB 4K5AB 5LFAA 4GA2A 1OT8A 2BUGA 1JCSA 1N54A 3ML9A 4ACKA 1TR4A 4CDNA 4HOQA 4GTMA 4GYWA 3MA5A 3RIBA 3DSVA 4N5CA 3RK6A 4I1OB 2XGSA 3GZSA 3MKQA 3MV3B 2KZTB 2P9LG 4HQDA 3OXFA 1B89A 3PUKA 2FBNA 2Y4UA 5AAOA 3QOUA 2BKKB 1Q2ZA 3ZUVB 2IEJA 4GZ5A 5AIJA 3BU8A 4WNEA 5HQ8A 2IQCA 4DUIA 3Q7AA 4FLHA 4ILGA 2WMOA 2YINA 4ILHB 3RAUA 3O48A 2LUHA 4ANWA 4F7AA 1O1RA 3ASFA 1DC2A 1K8KG 1GW6A 3MX3A 3MKQB 3QB2A 2CFZA 3G2SA 1H2VC 3AU5A 4Q96A 3FUKA 1XNFA 3Q9NC 3D9PA 3FUEA 3FEXA 3UT7A 2RG8A 4Z68A 5CEAA 1SW6A 1D9SA 4HS2A 2BTDA 5FQ4A 5G04J 3FH7A 3OAWA 4U96D 3V2OA 3NOGD 3MV2B 4GZ6A 2IOLA 3TAXA 3D9KA 4BESA 3Q49B 4I17A 4DI3A 1D8EA 4K03A 4UUCA 3EHNA 4NACA 2L0IA 3SHFA 3DEOA 4LNBA 1ZB1A 3FEYA 4TXQA 5T4YA 5EDSA 3D9MA 2LNIA 3EU5A 1IYGA 2H6FA 1UN8A 3ULQA 3SQVA 1HH8A 4PUCA 2KCLA 2WQHA 5JJ6A 4GYYA 3ESKA 2WXGA 3PRZA 5T8IA 5FZSA 3SY2A 1RW2A 1TJFA 3LS8A 2XS8A 4ATZD 4ABNA 4GYOA 4HRMB 3UI2A 3U66A 2XS1A 4AV7A 3IEGA 4YDEA 3VTYA 1N4SA 3Q79A 4LG6A 3CK9A 3FU5A 4G26A 1UW4B 3L17A
chains in the Genus database with same CATH topology
1N4RA 1JCQA 3E37A 1TN6A 1JCRA 1LD8A 1LTXA 1N95A 3DSWA 3DSTA 2H6GA 3HXDA 3Q7FA 3Q75A 3SFYA 1DCEA 1SA4A 1O5MA 3DSSA 3E34A 3PZ4A 1NI1A 4EHMA 3KSLA 3HXEA 1KZOA 1N4PA 1N4QA 4GTSA 3DRAA 1FT2A 3E32A 4GTPA 1D8EA 1TN8A 2BEDA 1S63A 4L9PA 3EUVA 3PZ3A 4GTVA 2R2LA 1TNOA 3HXBA 4LNBA 3PZ2A 4GTQA 3E30A 3DPYA 2F0YA 4GTRA 1FT1A 4GTOA 3Q78A 1JCSA 1LD7A 1SA5A 4GTMA 1N9AA 1S64A 3EU5A 1FPPA 3DSVA 4YDOA 1TNYA 1TNZA 2H6FA 3PZ1A 1NL4A 3C72A 2ZIRA 3KSQA 3Q73A 3DSUA 3E33A 1O1TA 1D8DA 4LNGA 1TNUA 2IEJA 3HXFA 3HXCA 1QBQA 3Q7AA 1N94A 1TN7A 1MZCA 3SFXA 4YDEA 2ZISA 4GTTA 1N4SA 3Q79A 1KZPA 1O1RA 1TNBA 2H6IA 3DSXA 4MBGA 1O1SA 2H6HA 1X81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4R A;  1JCQ A;  3E37 A;  1TN6 A;  1JCR A;  1LD8 A;  1LTX A;  1N95 A;  3DSW A;  3DST A;  2H6G A;  3HXD A;  3Q7F A;  3Q75 A;  3SFY A;  1DCE A;  1SA4 A;  1O5M A;  3DSS A;  3E34 A;  3PZ4 A;  1NI1 A;  4EHM A;  3KSL A;  3HXE A;  1KZO A;  1N4P A;  1N4Q A;  4GTS A;  3DRA A;  1FT2 A;  3E32 A;  4GTP A;  1D8E A;  1TN8 A;  2BED A;  1S63 A;  4L9P A;  3EUV A;  3PZ3 A;  4GTV A;  2R2L A;  1TNO A;  3HXB A;  4LNB A;  3PZ2 A;  4GTQ A;  3E30 A;  3DPY A;  2F0Y A;  4GTR A;  1FT1 A;  4GTO A;  3Q78 A;  1JCS A;  1LD7 A;  1SA5 A;  4GTM A;  1N9A A;  1S64 A;  3EU5 A;  1FPP A;  3DSV A;  4YDO A;  1TNY A;  1TNZ A;  2H6F A;  3PZ1 A;  1NL4 A;  3C72 A;  2ZIR A;  3KSQ A;  3Q73 A;  3DSU A;  3E33 A;  1O1T A;  1D8D A;  4LNG A;  1TNU A;  2IEJ A;  3HXF A;  3HXC A;  1QBQ A;  3Q7A A;  1N94 A;  1TN7 A;  1MZC A;  3SFX A;  4YDE A;  2ZIS A;  4GTT A;  1N4S A;  3Q79 A;  1KZP A;  1O1R A;  1TNB A;  2H6I A;  3DSX A;  4MBG A;  1O1S A;  2H6H A;  1X81 A; 
#chains in the Genus database with same CATH topology
 4A1S A;  2ION A;  3APD A;  1KLX A;  2YNQ A;  3V31 A;  4OVV A;  4L2L A;  4XKB A;  3SBS A;  1IXV A;  3TWS A;  2WQ6 A;  3HXD A;  4XI0 A;  3Q7F A;  4KVM A;  4A3T A;  5AN8 A;  5KNH D;  2P58 C;  4EHM A;  2WXL A;  3JYS A;  2FI7 A;  2X3M A;  2QYU A;  4OAV B;  3VLD A;  2V4H C;  1HFA A;  5ENT D;  4L9P A;  2HE0 A;  1QZ2 A;  1E7V A;  4GTV A;  3CHR A;  3CR3 A;  5E76 A;  3W9F A;  4BSZ B;  1BD8 A;  3DPY A;  2OVB A;  4L23 A;  2F8X K;  2VYI A;  1IKN D;  2XEE A;  2LAH A;  5EYP F;  1OCZ E;  4I6E A;  3D9H A;  2PM7 A;  4R7L A;  2X6F A;  3PZ1 A;  4GB9 A;  3FTW A;  3CEQ A;  3CSF A;  3PEV B;  2KAT A;  3JXJ A;  3CVV A;  4UQZ A;  4B94 A;  3HXF A;  1ELR A;  4F6R D;  3DPD A;  3UM3 A;  4N5Q A;  4B93 B;  4JHR A;  3V30 A;  1H2T C;  1LF8 A;  3G2W A;  4CEM A;  4FHJ A;  5AYW D;  3TWW A;  3I4R B;  3RRM B;  4PS7 A;  2WXK A;  2MOW A;  4GPM A;  2X6J A;  3AS4 A;  3IBE A;  3B13 A;  5H7P A;  2CHZ A;  5HRY A;  3ONL A;  2X6I A;  3DXM G;  3CVW A;  3FTV A;  4FAD A;  1H19 A;  4CT0 A;  1HO8 A;  3AU4 A;  1L5J A;  4JD2 G;  3J5P A;  4HFG A;  2OND A;  3FFL A;  1BLX B;  4JB8 P;  2MRI A;  3QNK A;  4GTQ A;  5CCL A;  4GTR A;  3ZVV A;  3UKU G;  4JHK A;  3HG0 D;  3UT8 A;  3W9G A;  3NZU A;  3NB2 A;  2UY1 A;  2LSU A;  1ZBP A;  2ZIR A;  1NA0 A;  3MCX A;  3PH0 C;  1IHG A;  5FIN A;  4M3O A;  5CRU A;  2VQ2 A;  5M72 A;  5ENS D;  5AJD A;  4GMR A;  3CVL A;  3HYM B;  4KT6 B;  4XX5 A;  2IFU A;  5KJL A;  3D9J A;  4LNU D;  3DSX A;  4FP7 A;  4BWR A;  2H6H A;  5KCM A;  2QFC A;  5ENQ D;  2V0P A;  4BY6 A;  3S7J A;  2A4Z A;  3Q15 A;  3QKY A;  4O6F A;  4B8A A;  1INZ A;  3ZN3 A;  2V5F A;  4GZD A;  3PVL A;  3FUM A;  2C0L A;  3GW4 A;  3FTY A;  5A6C A;  3CHP A;  1Z5S C;  2ETC A;  3AAA C;  3U9W A;  5BV1 A;  3FH8 A;  2J09 A;  3DBS A;  3UM2 A;  3HXB A;  4YND A;  4X8Q A;  1EPU A;  1P5Q A;  1MHQ A;  4JHJ A;  3QAQ A;  3CVP A;  4F53 A;  2AW6 A;  4YDO A;  1UJK A;  2XEV A;  5ANR A;  1E8X A;  2AXZ A;  2VSY A;  5KJN A;  3KEA A;  3ASD A;  3ASN E;  4FHK A;  4G8K A;  4MLP A;  5ENR D;  1YCS B;  1WG0 A;  2CHW A;  2BF0 X;  1HS6 A;  2PQR A;  4GU5 A;  4GMJ A;  1YA0 A;  2AXU A;  2J49 A;  3T9K A;  3GZ2 A;  5FIO A;  3UM1 A;  4UWF A;  4JC8 A;  2E0I A;  2DCP A;  2GRQ B;  2LSV A;  1OXJ A;  3CHO A;  4JA7 A;  3QWW A;  3SFY A;  2GRN B;  2WXH A;  4XKC A;  1NI1 A;  5BPP A;  2DYR E;  4RVB A;  1FVF A;  3ABL E;  3TWT A;  3L6A A;  3I5P A;  2GRO B;  2VGX A;  2BED A;  4KVO A;  5BV0 A;  3IXE A;  2DVW A;  3NQP A;  5B3S E;  2ETB A;  1RZ4 A;  3CQC B;  5CEC B;  4KZ0 A;  5AQA A;  5ARF A;  1MX6 A;  3UMV A;  3ZKJ A;  1BI8 B;  1FPP A;  4LUN U;  4U04 A;  2DBA A;  1TYQ G;  3FU0 A;  3CHM A;  4I6J A;  4W9R A;  2ZGG A;  2AJA A;  4WND A;  3KSQ A;  4KBQ A;  4ATG A;  2P2C P;  3ONK A;  3JXI A;  3TXN A;  2FO1 E;  1ZU2 A;  1HZ4 A;  4U0S A;  3EDT B;  3APF A;  1MZC A;  1U3C A;  2ZIS A;  2OEW A;  3X2Q E;  4ANU A;  3LJ3 A;  2VTB B;  3FTX A;  2B6C A;  3D9N A;  1NA3 A;  4I2W A;  1EYH A;  5FT9 A;  1OCO E;  4JXT A;  1TN6 A;  1JCR A;  2WVI A;  3P2B A;  2JEK A;  4HB5 A;  2ZU6 B;  5C2Y A;  3LXU X;  4JA9 A;  4QFV A;  4J8S A;  2JLB A;  4GTS A;  5JMN D;  2IO2 C;  5KWD A;  4GTP A;  5BUZ A;  5DIZ A;  5FQ8 A;  1TN8 A;  3FUL A;  2L9B A;  2HO1 A;  3UXG A;  3RRN B;  3ZYK A;  4UI9 C;  2GGF A;  4PDX A;  3ASO E;  1HX8 A;  3DWL G;  3ISM C;  2ZXW E;  2X6H A;  2OEV A;  1FVH A;  4URK A;  3LCA A;  1TNZ A;  3G2U A;  3RSE G;  3FTZ A;  4RSY A;  1KPS B;  2QYJ A;  3FU3 A;  5KJM A;  2AVP A;  5G04 C;  2L0T B;  4DX5 D;  3RRU A;  4AY6 A;  2NSZ A;  4A63 B;  2YHE A;  3VLE A;  3ZRH A;  3ZFW A;  4N39 A;  4Q94 A;  3SFX A;  4JPS A;  4WWP A;  1AP7 A;  1Z3X A;  4DJA A;  2PNN A;  4APO A;  5ITZ F;  1IQR A;  3UIP C;  2LXM A;  2CHX A;  3FUI A;  2M63 A;  1X5B A;  2EIN E;  4WUY A;  3B7R L;  4KXK B;  1S70 B;  4AOF A;  2KXP C;  4CCA A;  4HRL A;  4EEC A;  2FEZ A;  3E34 A;  4CT4 A;  3J5Q B;  3ABK E;  2AWI A;  4UWL A;  3FTU A;  3NOC D;  2R59 A;  3CK7 A;  3RKV A;  3S2A A;  4A3V A;  3KAE A;  3S7B A;  2X38 A;  2WMN A;  2DYS E;  3FDH A;  3EUV A;  3PZ3 A;  3ASH A;  5A23 A;  1E8W A;  4HI9 A;  1S64 A;  1HG2 A;  4AXH A;  4UWK A;  4JZY A;  5DBK A;  3S7F A;  4JEU A;  4DLO A;  1E90 A;  5CED B;  4JVS A;  3T5X A;  3QDN A;  5ANL A;  1EF1 C;  5FQ7 A;  2WXO A;  2FUL A;  4FA6 A;  4N3A A;  1WAO 1;  4HI8 A;  4HLL A;  3CIA A;  1WM5 A;  1N11 A;  4F1P A;  1QBQ A;  3I3N A;  3IV0 A;  2HYZ A;  3FUN A;  3QC1 A;  3FH5 A;  4N3C A;  4Q69 A;  2F37 A;  3MKR A;  4KYO B;  4A1G A;  5ARG A;  2VGX B;  4MS6 A;  2J08 A;  3L54 A;  4IN3 B;  1OY3 D;  3FUJ A;  3DST A;  3BUA A;  2OCC E;  1H6K A;  4GA0 A;  4O1P A;  2PM6 A;  1FCH A;  5LCW J;  4C9B B;  1DVP A;  3BEE A;  3ULY A;  2RD0 A;  3LPZ A;  3U64 A;  2WXF A;  3B7T A;  4LER A;  2EQX A;  2WM9 A;  2IOS A;  4APF A;  1E8Z A;  5BW8 C;  1H0A A;  4B8C B;  5FTP A;  2I1K A;  2PL2 A;  2P9S G;  4B0Z A;  5IY5 E;  1K1A A;  4J7W A;  1UG3 A;  1OCC E;  2HR2 A;  2EIL E;  5BT1 A;  3TG4 A;  4UWG A;  3CHS A;  3CKC A;  1VDY A;  1V54 E;  4WNG A;  2IF4 A;  1PY1 A;  3CGH A;  5G55 A;  4F3V A;  3TL5 A;  4AVX A;  1TNU A;  4RLY A;  1MX2 A;  3CQG B;  4LRZ A;  4AM9 A;  4L7T A;  3JUE A;  3NAW A;  1Y8M A;  2Q7F A;  4AY5 A;  1TN7 A;  4ZHB A;  2IO3 C;  5EN5 D;  1ELW A;  4J0U A;  4UI9 J;  3EJN A;  4DI4 A;  4N3B A;  3UUX A;  3PNT B;  3TWQ A;  3WXX A;  4BEP A;  4PS8 A;  4A55 A;  2A5E A;  3FWV A;  5CMW A;  2WQ7 A;  1JWG A;  1N4R A;  4UWH A;  4XI9 A;  3E4B A;  2EIM E;  1LTX A;  4C48 B;  2EIJ E;  2GW1 A;  3UPV A;  2I2O A;  5LCW C;  3Q75 A;  4YVO A;  4QQI A;  1DCE A;  4P29 A;  3DSS A;  5J90 A;  3LY7 A;  4EZK A;  4C0M A;  1NZN A;  3PZ4 A;  4UI9 K;  4ILI A;  4XZ4 A;  4N2S A;  5A7D B;  1N4P A;  1N0R A;  3B95 A;  3QAR A;  4GCO A;  1UOH A;  3OTN A;  4IYP A;  2R05 A;  5FZR A;  2EIK E;  3CVN A;  4TXR A;  2XCB A;  4UQY A;  3RO3 A;  2R2L A;  2L6J A;  5G05 J;  4ZFH A;  3CK8 A;  2WXM A;  4BER A;  1SA5 A;  4FUL A;  2NYJ A;  4Y6C A;  3TGO A;  4GPK A;  3D9L A;  4U8V D;  5FZQ A;  5JJT A;  1MX4 A;  2XEH A;  3LVQ E;  3G2T A;  1QYM A;  1EDU A;  3ZU7 B;  2GRL A;  3MGB A;  3IHY A;  3DSU A;  5CCM A;  2VGE A;  2PZI A;  3IKO B;  5EID A;  1H6O A;  5AQ7 A;  4LSZ E;  3HIZ A;  2V8S E;  1K3Z D;  2XQ0 A;  3CVY A;  4BET A;  3ESL A;  2XCC A;  1OWM A;  2IY0 C;  5CBN A;  3MZL B;  4MKT A;  4HNA D;  3R7Q A;  2GRP B;  3ZXP A;  3E37 A;  5EYL A;  5LP0 A;  1SVX A;  1UN9 A;  5T3R A;  3DSW A;  4DK5 A;  2FO7 A;  2H6G A;  4RQI A;  4WWN A;  1SA4 A;  1O5M A;  2OV8 A;  4Y6W A;  3TWU A;  5JA4 D;  1BPO A;  1KT0 A;  4EZL A;  2HM8 A;  1G3N B;  5E75 A;  4BFR A;  2AXV A;  5G05 C;  3U3W A;  3FP3 A;  3CVX A;  4BX9 A;  5KJK A;  2ILR A;  4I6G A;  4U7E B;  4WNF A;  3KS2 A;  4G11 A;  2OOE A;  3F6Q A;  1MYO A;  5CMY A;  4U63 A;  3BQO A;  3Q73 A;  3E33 A;  3SD5 A;  4HVB A;  2DZN A;  3SI5 A;  3JQ1 A;  5CHE E;  5BXU A;  4AIF A;  1NP7 A;  5AJL A;  3LVR E;  3R9A B;  3ZHE A;  4BT9 A;  3RU0 A;  4PS3 A;  3QJZ A;  5ENO D;  4GTT A;  3JUI A;  4EZJ A;  1KZP A;  4G23 A;  1HF8 A;  1WDY A;  3PRE A;  2C0M A;  1TNB A;  4BSX A;  2KZT A;  4MBG A;  3TWX A;  3AS8 A;  5KNG A;  3L9T A;  2QZA A;  1Z6T A;  3UT4 A;  3PDN A;  3ENE A;  3ZYQ A;  3HRA A;  1DNP A;  3PEU B;  3SZ7 A;  2BKG A;  4NUR A;  2V4L A;  1V55 E;  4GML A;  2LAI A;  3MJW A;  2IU1 A;  3DRA A;  3NF1 A;  5ENP D;  4TRQ A;  4H7X A;  2J4B A;  4YDW A;  1OWN A;  4HOU A;  4ACL A;  3CLJ A;  5FWQ A;  5BNW A;  2P9I G;  4GZ3 A;  3VTX A;  2WXJ A;  5AQB A;  3C5R A;  2QC9 A;  2R03 A;  3APC A;  3BG0 B;  1QQE A;  5EX0 A;  3L82 A;  1LD7 A;  2WXQ A;  2NC9 A;  2E2E A;  2P9N G;  1TNY A;  4LCT A;  4OVU A;  5KBA A;  2MYO A;  4AJW A;  3LKU A;  3AS5 A;  2WXI A;  4I1A A;  4HOT A;  3C3O A;  3CST A;  2KBX A;  1OUV A;  4CGW A;  2WXN A;  5D2M C;  3SO8 A;  4BTB A;  1HG5 A;  2KCV A;  3EU9 A;  4HXI A;  4H7Y A;  4U0Z A;  3O4Z A;  3ZNG A;  1E7U A;  4EBA A;  4G1T A;  1W3B A;  4EQF A;  1OCR E;  4XIF A;  5AQ9 A;  3RJV A;  3ULE G;  4NQ0 A;  1N52 A;  1U3D A;  3LY8 A;  3SGH A;  2Y1L E;  4FC8 A;  4XEI G;  5G2N A;  4OYS A;  3URZ A;  1ELK A;  5CER B;  1YYH A;  3WG7 E;  3PUJ A;  3NZS A;  4YDY A;  1KT1 A;  4LEU A;  3Q9U C;  5LOZ A;  3KSL A;  1KZO A;  2UY1 B;  3SNX A;  3B7B A;  3TWV A;  3ZYM A;  3T8M A;  3DXK G;  5EKQ D;  3C3Q A;  2XZD G;  3LYA A;  5D0O D;  2XPI A;  2YQ8 A;  3D9I A;  2XEN A;  4AEZ C;  2I9C A;  2F0Y A;  1DCQ A;  4WAF A;  3OXL A;  4GTO A;  2P9P G;  1S0P A;  1PC2 A;  1IHB A;  1N9A A;  3GYZ A;  3SBT B;  4M7C A;  2DZO A;  1SZA A;  2XZT G;  2XRY A;  4U07 A;  4ANV A;  3AG1 E;  2KM4 A;  4EPZ A;  3PE3 A;  3FUF A;  3CHQ A;  2DWZ A;  4J8Y A;  3HHM A;  2R02 A;  1MQS A;  3CV0 A;  2RFA A;  4LNG A;  4HOS A;  4G25 A;  1H6P A;  5HI7 A;  2P9U G;  2ZGD A;  3HXC A;  1E8Y A;  5CRV A;  3V2X A;  3I4G A;  3FUH A;  4OAU C;  1JWF A;  1NFI E;  2CFU A;  4HLE A;  3FTS A;  4BX8 A;  4J6I A;  5B1A E;  2VSN A;  5J08 A;  2JAB A;  4L1B A;  2VSX E;  4ANX A;  4DX1 A;  3EHR A;  1Y6I A;  4XE0 A;  4TUU A;  3LEW A;  3VLF A;  2I6H A;  5AEN A;  3LY9 A;  2XGM A;  4E85 A;  2CG3 A;  4BTA A;  1N4Q A;  2XPZ A;  3EHQ A;  5C1D A;  3E32 A;  1YMP A;  2CG2 A;  2OVF A;  1JPL A;  3BG1 B;  3ZPJ A;  3ZGQ A;  4I2Z A;  2J8S D;  4U95 D;  3ZYL A;  3E30 A;  3ZHE B;  2IJG X;  4IUL A;  3Q78 A;  4FJY A;  4JL0 A;  2Y69 E;  1IQU A;  2KCK A;  3Q47 B;  1NL4 A;  3ZXS A;  1MJ0 A;  3HDX A;  3UX4 A;  3UIO C;  2UWJ G;  1Z3Y A;  2WPV A;  3TJP A;  1A17 A;  2PQN A;  3B7S A;  5JJ7 A;  2WB2 A;  1BI7 B;  3K9I A;  2J4D A;  3PZD A;  4DRX E;  5BXO A;  3UTM A;  2RFM A;  4G24 A;  3PS6 A;  3CKB A;  3G2V A;  1SZ9 A;  2YHC A;  4PH4 B;  1X81 A;  2MHK A;  4N2Q A;  1OWP A;  2B0O E;  4RG6 A;  4CDM A;  1LD8 A;  3LJN A;  2J07 A;  4E6H A;  3EIJ A;  4J8F A;  5HKP A;  3L22 A;  4HBD A;  4GCN A;  4I1M A;  4O60 A;  4CZ2 D;  2WXR A;  4WWO A;  5EIB E;  3MYV A;  4L2Y A;  1K1B A;  4I9C A;  4CYM D;  4KMO A;  1HU3 A;  2Y3A A;  2LXL A;  1H2U A;  2XHE A;  4C0E A;  3R7R A;  4FLB A;  4DLQ A;  2R17 C;  3KEZ A;  5ENN A;  2FF4 A;  3V79 K;  2R5S A;  4D10 C;  1A5E A;  4J8D A;  4K0R A;  1TNO A;  1TEZ A;  3EIQ C;  5D0Q D;  3AJI A;  2J9Q A;  3C98 A;  3R9M A;  3TWR A;  5B1B E;  3SF4 A;  1HXI A;  1OWL A;  3Q4A B;  2VTB A;  4CGV A;  2F8Y A;  2VSO E;  3PNL B;  4O1O A;  4U8H A;  2VGY A;  4FU3 A;  4B89 A;  3N71 A;  4CRW A;  3HVE A;  4V3I A;  1OWO A;  1O1T A;  3D3M A;  1D8D A;  4G8L A;  3C3R A;  3FHE A;  2GRR B;  1TJC A;  3JQ0 A;  3ZIM A;  4K5B A;  4MRU A;  4TXP A;  4GA1 A;  3ZEF A;  3JCK C;  1JUQ A;  4YVQ C;  4TV3 A;  3FY4 A;  4FJZ A;  5CBO A;  3L08 A;  4DPR A;  3ML8 A;  3LDZ A;  2H6I A;  1BU9 A;  4I43 A;  2Y4T A;  4J8E A;  4U0U A;  3KD7 A;  3HVE B;  3TXM A;  1N95 A;  4ME2 A;  2RKK A;  4KZC A;  3P1U A;  3UQ3 A;  3MEK A;  3CVU A;  2V5Q C;  4BT8 A;  3DEP A;  2DIW A;  2NXP A;  3Q5M A;  1HE8 A;  3HXE A;  3CVQ A;  5EIL A;  3U4T A;  5FJY A;  4HRN A;  4TUM A;  3RO2 A;  3ASG A;  2LO6 A;  5AAR A;  5EX3 A;  1U2V G;  4EBA G;  1SQM A;  3PZ2 A;  3QWV A;  4GZC A;  3TG5 A;  4UQX A;  3SFZ A;  1FT1 A;  5JHB A;  2X6K A;  4HOR A;  3FU6 A;  2XGO A;  2WXP A;  3UIN C;  4IRU A;  3OXG A;  3NBN B;  4GAA A;  2GRM A;  3FUD A;  5FQ6 A;  2XPY A;  3C72 A;  3PE4 A;  3UM0 A;  3T5V A;  4U8Y D;  4AP2 A;  4RG9 A;  4G2V A;  1QNF A;  3D9O A;  3T8K A;  2C2L A;  4DX2 A;  4I9E A;  5LX8 A;  4JEH A;  5D66 A;  2XRZ A;  4DX6 D;  2Y0B G;  3L13 A;  3AG4 E;  3QWP A;  1N94 A;  3L16 A;  3EHM A;  3AG2 E;  1N0Q A;  5JHA A;  2ETA A;  3ZW3 A;  4JW1 A;  1O1S A;  3QK0 A;  2P9K G;  1JCQ A;  2I1J A;  1WY6 A;  5HS0 A;  1UJJ A;  2L6B A;  2VJ8 A;  3UKR G;  4CDR A;  2A5U A;  2QY7 A;  3AG3 E;  3GZ1 A;  3IHV A;  1E96 B;  3S7D A;  4NIK A;  2KC7 A;  4K5C A;  1FT2 A;  3B7U X;  4NRH B;  1S63 A;  4F1S A;  4DX7 D;  3ABM E;  1XGW A;  1PAQ A;  1AWC B;  4K5A B;  5LFA A;  4GA2 A;  1OT8 A;  2BUG A;  1JCS A;  1N54 A;  3ML9 A;  4ACK A;  1TR4 A;  4CDN A;  4HOQ A;  4GTM A;  4GYW A;  3MA5 A;  3RIB A;  3DSV A;  4N5C A;  3RK6 A;  4I1O B;  2XGS A;  3GZS A;  3MKQ A;  3MV3 B;  2KZT B;  2P9L G;  4HQD A;  3OXF A;  1B89 A;  3PUK A;  2FBN A;  2Y4U A;  5AAO A;  3QOU A;  2BKK B;  1Q2Z A;  3ZUV B;  2IEJ A;  4GZ5 A;  5AIJ A;  3BU8 A;  4WNE A;  5HQ8 A;  2IQC A;  4DUI A;  3Q7A A;  4FLH A;  4ILG A;  2WMO A;  2YIN A;  4ILH B;  3RAU A;  3O48 A;  2LUH A;  4ANW A;  4F7A A;  1O1R A;  3ASF A;  1DC2 A;  1K8K G;  1GW6 A;  3MX3 A;  3MKQ B;  3QB2 A;  2CFZ A;  3G2S A;  1H2V C;  3AU5 A;  4Q96 A;  3FUK A;  1XNF A;  3Q9N C;  3D9P A;  3FUE A;  3FEX A;  3UT7 A;  2RG8 A;  4Z68 A;  5CEA A;  1SW6 A;  1D9S A;  4HS2 A;  2BTD A;  5FQ4 A;  5G04 J;  3FH7 A;  3OAW A;  4U96 D;  3V2O A;  3NOG D;  3MV2 B;  4GZ6 A;  2IOL A;  3TAX A;  3D9K A;  4BES A;  3Q49 B;  4I17 A;  4DI3 A;  1D8E A;  4K03 A;  4UUC A;  3EHN A;  4NAC A;  2L0I A;  3SHF A;  3DEO A;  4LNB A;  1ZB1 A;  3FEY A;  4TXQ A;  5T4Y A;  5EDS A;  3D9M A;  2LNI A;  3EU5 A;  1IYG A;  2H6F A;  1UN8 A;  3ULQ A;  3SQV A;  1HH8 A;  4PUC A;  2KCL A;  2WQH A;  5JJ6 A;  4GYY A;  3ESK A;  2WXG A;  3PRZ A;  5T8I A;  5FZS A;  3SY2 A;  1RW2 A;  1TJF A;  3LS8 A;  2XS8 A;  4ATZ D;  4ABN A;  4GYO A;  4HRM B;  3UI2 A;  3U66 A;  2XS1 A;  4AV7 A;  3IEG A;  4YDE A;  3VTY A;  1N4S A;  3Q79 A;  4LG6 A;  3CK9 A;  3FU5 A;  4G26 A;  1UW4 B;  3L17 A; 
#chains in the Genus database with same CATH homology
 1N4R A;  1JCQ A;  3E37 A;  1TN6 A;  1JCR A;  1LD8 A;  1LTX A;  1N95 A;  3DSW A;  3DST A;  2H6G A;  3HXD A;  3Q7F A;  3Q75 A;  3SFY A;  1DCE A;  1SA4 A;  1O5M A;  3DSS A;  3E34 A;  3PZ4 A;  1NI1 A;  4EHM A;  3KSL A;  3HXE A;  1KZO A;  1N4P A;  1N4Q A;  4GTS A;  3DRA A;  1FT2 A;  3E32 A;  4GTP A;  1D8E A;  1TN8 A;  2BED A;  1S63 A;  4L9P A;  3EUV A;  3PZ3 A;  4GTV A;  2R2L A;  1TNO A;  3HXB A;  4LNB A;  3PZ2 A;  4GTQ A;  3E30 A;  3DPY A;  2F0Y A;  4GTR A;  1FT1 A;  4GTO A;  3Q78 A;  1JCS A;  1LD7 A;  1SA5 A;  4GTM A;  1N9A A;  1S64 A;  3EU5 A;  1FPP A;  3DSV A;  4YDO A;  1TNY A;  1TNZ A;  2H6F A;  3PZ1 A;  1NL4 A;  3C72 A;  2ZIR A;  3KSQ A;  3Q73 A;  3DSU A;  3E33 A;  1O1T A;  1D8D A;  4LNG A;  1TNU A;  2IEJ A;  3HXF A;  3HXC A;  1QBQ A;  3Q7A A;  1N94 A;  1TN7 A;  1MZC A;  3SFX A;  4YDE A;  2ZIS A;  4GTT A;  1N4S A;  3Q79 A;  1KZP A;  1O1R A;  1TNB A;  2H6I A;  3DSX A;  4MBG A;  1O1S A;  2H6H A;  1X81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...