1N4QA

Protein geranylgeranyltransferase type-i complexed with a ggpp analog and a kkksktkcvil peptide
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Structure of mammalian protein geranylgeranyltransferase type-I
pubmed doi rcsb
source organism Rattus norvegicus
total genus 124
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n4qA00
4LNGA 1JCSA 3E33A 3PZ2A 1N95A 4YDOA 1SA4A 3E30A 3DSSA 1MZCA 1S63A 4GTMA 3HXBA 3HXEA 1FPPA 1O1TA 1N9AA 3E32A 3HXDA 4GTPA 4L9PA 3DRAA 1JCRA 3DSUA 2H6IA 3Q78A 1LD8A 1TNYA 1TNBA 3Q7AA 1N94A 3DSWA 1TN7A 3Q7FA 3DPYA 3Q75A 1TN6A 4EHMA 2H6HA 3KSLA 1D8DA 1FT1A 4GTQA 1FT2A 3EUVA 2BEDA 3HXCA 3PZ3A 3PZ1A 1TNZA 2IEJA 1NI1A 4GTRA 2H6GA 3E34A 1D8EA 2H6FA 3Q73A 1S64A 4YDEA 1O5MA 3EU5A 1N4RA 1SA5A 1O1RA 3SFXA 1TNUA 1X81A 1N4QA 4MBGA 3KSQA 1TNOA 3DSXA 1LTXA 1TN8A 1NL4A 1LD7A 4GTSA 3DSVA 4GTTA 2F0YA 1QBQA 2ZIRA 1JCQA 3HXFA 1DCEA 3C72A 4LNBA 3SFYA 3PZ4A 3Q79A 1KZOA 4GTOA 3E37A 1O1SA 2R2LA 4GTVA 1N4SA 3DSTA 1N4PA 1KZPA 2ZISA
chains in the Genus database with same CATH superfamily
2JABA 4JXTA 4AEZC 4M3OA 4E85A 4GTMA 4CCAA 2VSOE 1N9AA 4WNFA 2CFUA 2VTBA 5EKQD 2GRQB 3FH8A 2AXVA 4N5QA 4G8KA 5ENPD 5FZSA 4ILIA 3B7RL 3B95A 4GZ6A 2VGXB 2DZNA 1WM5A 4EHMA 4B89A 1K8KG 2RFAA 2CHZA 1SZ9A 3KS2A 1N52A 2R59A 4HRNA 5D2MC 3ZHEA 2VJ8A 4U8VD 1RW2A 3S7JA 3ONKA 3CVWA 4HOUA 2RG8A 4KVMA 4BSXA 1V55E 1ZBPA 2B0OE 4B8AA 2P9KG 3C3RA 5ENSD 3ZYMA 5FQ6A 3ABME 2FO7A 3CIAA 4GZ3A 2PQRA 3NBNB 3FULA 3UPVA 2WXFA 2J8SD 3UKUG 3QWPA 3FTUA 3P2BA 5T4YA 4PUCA 3U9WA 4P29A 2L6JA 2A5EA 3AG1E 4NURA 4XKBA 2EQXA 3TAXA 3D9JA 5CBNA 1N4SA 1JWGA 1IQUA 4I2ZA 5M72A 5EDSA 1QNFA 4K03A 1H2VC 1ELRA 4Y6WA 1H0AA 5G05J 2M63A 1BI8B 3G2WA 3FEXA 4BY6A 3CHQA 3B13A 3VTYA 1DC2A 1WY6A 2Y4UA 2WM9A 1Z3YA 5B1BE 3GYZA 3EDTB 4AY6A 4DPRA 1FT2A 3HXCA 3JQ1A 4U7EB 3GZ2A 1OCOE 5G05C 3D9LA 4IYPA 2GW1A 1H19A 3D3MA 4J6IA 2H6FA 5FZQA 4G11A 1HU3A 2FULA 4YNDA 3IEGA 4ME2A 3U4TA 4WWNA 2IOSA 4KMOA 3QB2A 1OWLA 4HOSA 3DEOA 4U0SA 3ML8A 2DZOA 5CHEE 3T5VA 4CT0A 5ARGA 3L9TA 5G04J 2KXPC 2XZDG 3KD7A 5CMYA 1TYQG 3APCA 2IU1A 4EZLA 2IJGX 4BT9A 4XI0A 4L1BA 4I1MA 2MRIA 1V54E 3LJNA 2J09A 2XEHA 5LCWC 1MZCA 3T5XA 2WVIA 3HXBA 3HXEA 4J8EA 4I6EA 1MX6A 1K1AA 3PEUB 5FJYA 4A63B 3MEKA 3AJIA 3FUEA 2E2EA 2JLBA 4LCTA 3TWVA 3DSUA 3DPYA 2V4LA 4GTQA 3ZVVA 3FUJA 4KZ0A 4GZ5A 3ABKE 2LUHA 3EHMA 3IHVA 2QZAA 1QQEA 4ZFHA 3CVPA 3V2OA 1AP7A 1D8EA 4UUCA 4GYYA 1DVPA 4FJYA 3FDHA 1HFAA 3RAUA 2WXLA 3C3OA 3UT8A 3OTNA 3VLDA 5LFAA 2GRRB 3CK7A 4IULA 4MBGA 3QWWA 3SGHA 1QZ2A 2ETAA 4HS2A 3LY8A 4LSZE 3S7BA 3ZRHA 4YVQC 2LXLA 2P2CP 1TEZA 1PY1A 2OV8A 3NQPA 2MHKA 1OXJA 3ABLE 3CKBA 3CHMA 4BESA 3MJWA 3AG4E 3NOCD 4UWKA 2J9QA 4CGWA 2ZISA 3D9NA 4V3IA 2BKKB 2J49A 2DWZA 2PM7A 1X5BA 4ATGA 4MS6A 2WMNA 5ENNA 2RD0A 4KVOA 2CHWA 2LAIA 4O1OA 1OY3D 2H6IA 4MKTA 4EZJA 2R05A 4FADA 1TNBA 5AYWD 3IV0A 5C2YA 4F3VA 4J8DA 3CQGB 5HI7A 2KCKA 2FI7A 5EX0A 2Y3AA 4DRXE 2R17C 4U96D 4I1AA 5BUZA 3HG0D 3FUHA 3PZ1A 2PZIA 5ITZF 4UQZA 4M7CA 1UN8A 2KZTA 3AAAC 2IONA 5BNWA 4JC8A 1SQMA 3BUAA 5CBOA 2CFZA 4ANXA 2KM4A 3PNTB 1ZU2A 5FQ8A 4W9RA 4HOTA 1N4QA 3G2VA 4UI9K 3SF4A 5BV0A 3J5QB 2I6HA 4WNDA 4R7LA 4FC8A 1LD7A 4QQIA 4PS3A 2F0YA 3O48A 2F8YA 3C72A 3SBTB 4U8HA 4HI9A 3APFA 4PS7A 4FLHA 2GRLA 1O1SA 3L16A 3QJZA 4A1SA 4I1OB 1TJFA 4GZDA 3ZYKA 2WMOA 4O6FA 3Q47B 3FTSA 4XKCA 3PDNA 5DBKA 3MYVA 4N2SA 4EZKA 4F6RD 1E8YA 1OUVA 3U66A 1TNYA 1MX2A 3ZFWA 3Q75A 5C1DA 2VYIA 3FH5A 3KSLA 1KT1A 4OAUC 5D66A 3R7QA 4HORA 3SQVA 3PUJA 1Z5SC 3CHOA 4RG9A 4PH4B 2GROB 1N0RA 4A3TA 1BI7B 3CSTA 1XGWA 4N3BA 4TXPA 4JHRA 3RSEG 3TGOA 2YINA 4JA9A 2WXNA 2J07A 2HE0A 3D9MA 2Y69E 4HBDA 1BU9A 2XPIA 4APOA 2IO2C 1FCHA 3DEPA 1OCCE 4CYMD 2OVFA 3L17A 4ZHBA 2XGOA 1IYGA 3PH0C 2XPYA 4YDWA 1E8WA 5DIZA 3NF1A 4XEIG 3SY2A 3E37A 1NA0A 3CVQA 4G8LA 5EIDA 3ZXPA 3D9KA 5AQ9A 4G23A 1JCSA 1ZB1A 1N95A 4WNEA 3E30A 2J4DA 2IY0C 3PE4A 3IHYA 3EHRA 3S2AA 1OWOA 3Q15A 3LVRE 4JD2G 3LY7A 4J8SA 5AAOA 4CDRA 3B7UX 3UUXA 2WQ6A 2NYJA 3FUKA 4HRLA 2CG3A 4IN3B 1EF1C 3UXGA 2VGEA 5HQ8A 2EINE 2BEDA 3CHRA 3TWTA 4CDMA 3PEVB 3MV2B 2XS1A 4DJAA 1H6KA 4UQXA 1HF8A 4BT8A 4EECA 3N71A 5G2NA 3FP3A 1G3NB 5FQ7A 1HZ4A 1LF8A 4QFVA 1HXIA 1B89A 4K5CA 1HE8A 2L0IA 3ENEA 5EN5D 1U3DA 2L0TB 4EPZA 3D9IA 4FJZA 1E8ZA 4AXHA 4DI3A 3PE3A 3RK6A 2PQNA 3SD5A 1E96B 3GZSA 3ML9A 5T8IA 3AG3E 4LUNU 4L23A 2X6IA 1JCQA 2P9IG 3EIJA 4FLBA 1NP7A 3ASDA 2X6FA 3CK9A 1E7VA 3AS5A 3D9PA 3DSTA 4RG6A 3ASGA 4BETA 5LOZA 3CR3A 4JVSA 4YDOA 5H7PA 3DSSA 5KJMA 2YQ8A 2OCCE 4I9EA 3ASNE 3CHSA 1YMPA 3EJNA 2QC9A 3S7DA 5B1AE 2HM8A 4NQ0A 4YVOA 4GTPA 4U8YD 3QKYA 3DRAA 4ACKA 1MQSA 3ULQA 4C0MA 3ZYQA 4G1TA 4F53A 3MKQB 3Q7AA 2F8XK 1Z3XA 2H6HA 3NOGD 3FU6A 5BXUA 5FQ4A 2X3MA 3LPZA 4BERA 2AXUA 2ONDA 3FUNA 3BU8A 2LXMA 3L82A 5J90A 5JJ7A 2DIWA 2UY1A 3ZW3A 4CT4A 4GZCA 3SI5A 2RFMA 2DVWA 5AENA 1DNPA 4J8FA 2P9PG 3QNKA 4ANUA 4TUUA 2BUGA 2VQ2A 2NSZA 3IXEA 1EDUA 2V5FA 3L22A 4GYOA 2LO6A 2GRPB 1HX8A 4WNGA 4CZ2D 1S70B 3EIQC 3HVEA 2V8SE 4F1PA 5KJNA 3FTXA 3LDZA 3SHFA 4FULA 1UW4B 3DSVA 3V2XA 4XZ4A 2ZIRA 3TWSA 4RVBA 4N39A 1TR4A 3DPDA 5BW8C 5FINA 2Y0BG 5A23A 3OXGA 4ANWA 4GTVA 1A17A 4HOQA 3AS4A 5LCWJ 5JHAA 5B3SE 4DX1A 2BKGA 3RU0A 1ELWA 3ZYLA 5LP0A 2F37A 2XCBA 4HVBA 3LCAA 2VSYA 2P9SG 2PNNA 3DXKG 2E0IA 3E32A 2VGXA 2FBNA 3UM2A 3RRMB 5ANRA 5CCLA 3UKRG 4AVXA 2YNQA 5G55A 2P58C 5HS0A 5CMWA 3TWXA 3PS6A 5E76A 4E6HA 2UWJG 1JWFA 4UWFA 1HG5A 2L9BA 3JUEA 2I9CA 4XI9A 2ETBA 5CRUA 4C9BB 1TNZA 1H6OA 1UN9A 4ILHB 4HI8A 1HO8A 1S64A 3FTZA 3SBSA 4LNUD 3JXIA 2KBXA 1N4RA 3I4GA 3D9HA 1X81A 4GAAA 1KLXA 4LRZA 4GA1A 1Q2ZA 1NFIE 4AIFA 3FU5A 3AG2E 3Q4AB 2Q7FA 4JPSA 2LNIA 3ULEG 4LNBA 3Q9NC 3FWVA 3T9KA 2WXMA 2Y4TA 2V0PA 4G25A 2J08A 4G24A 3MV3B 2P9NG 4JEHA 4HB5A 2NC9A 4U04A 5IY5E 4LEUA 3NZSA 3J5PA 4DLOA 4N5CA 1SA4A 1MHQA 3P1UA 1FPPA 3C3QA 4FP7A 2NXPA 1BLXB 2QY7A 2P9LG 3PZDA 3JUIA 4YDYA 4L2LA 3MA5A 2HR2A 3PREA 3ULYA 2ETCA 3T8MA 5KNHD 2AXZA 2ZGDA 3FUFA 2WXRA 5JJ6A 1H2TC 3JCKC 5AQ7A 4RSYA 2QYJA 1OCRE 4F1SA 3CVLA 5JJTA 3C5RA 2IO3C 3HDXA 4ANVA 2HYZA 5FWQA 2KCLA 3EHNA 4J0UA 5JHBA 5EIBE 5CECB 1HS6A 2A5UA 4WAFA 5LX8A 4OYSA 4O60A 2JEKA 3TWUA 4OAVB 3IBEA 2WQ7A 3UIPC 4UI9J 4HQDA 4KT6B 3ZGQA 3TJPA 3ZU7B 4TV3A 2BF0X 2WB2A 2I1KA 1A5EA 4TXRA 4FHKA 3FEYA 2ZXWE 3JYSA 4A55A 4U07A 1EPUA 4Q69A 2XRYA 3C98A 3TWWA 2GRMA 3E4BA 3UI2A 3RIBA 4GU5A 4UI9C 4J7WA 1O1TA 3KAEA 3L13A 3RJVA 5ARFA 5KBAA 4PDXA 4D10C 4KXKB 2XHEA 5JA4D 3MCXA 3Q78A 4GB9A 3ZPJA 3QWVA 4Y6CA 3LYAA 3CKCA 1PAQA 5CEAA 4UQYA 2VTBB 5ENTD 4I43A 5KWDA 3UTMA 5D0QD 4AY5A 3G2TA 4FA6A 1KPSB 3FTYA 4WWOA 3TXMA 1NI1A 3LXUX 2XQ0A 4GMRA 1K1BA 3GZ1A 1IHGA 3ZHEB 3QOUA 3EU5A 1U3CA 4DX7D 2IQCA 3SFXA 1L5JA 2BTDA 5EILA 4K0RA 4H7YA 3KSQA 2OOEA 2X6JA 3OXFA 3CV0A 4MRUA 2AJAA 2OEVA 2IOLA 2WXPA 2FEZA 3HXFA 4GPKA 4DX2A 3FHEA 5BV1A 1KZOA 3BG1B 4IRUA 5FZRA 3URZA 5E75A 2VSNA 1P5QA 5AQBA 4JA7A 2CG2A 2DYSE 4DLQA 3JXJA 3NAWA 5CRVA 4NRHB 3AU4A 4NACA 4LERA 4UWLA 2EILE 2RKKA 1E90A 3RO2A 1UJKA 3VLEA 2C0LA 3GW4A 4GPMA 1K3ZD 1MX4A 4L9PA 1H2UA 1LD8A 3FH7A 4HFGA 3UM3A 1N94A 3DSWA 3HIZA 4CGVA 1EYHA 3F6QA 3EUVA 5KJKA 3CVXA 5CEDB 3Q49B 2MOWA 4UWGA 2IEJA 4DK5A 4GA0A 4BX9A 1OT8A 3UMVA 3SNXA 3E34A 3ASOE 3O4ZA 1OWPA 3CEQA 3PRZA 3L08A 4L2YA 5BPPA 1N11A 3DSXA 3PUKA 1JUQA 4HNAD 2AW6A 3ZIMA 3EHQA 5AARA 1BD8A 3HRAA 1QBQA 3PNLB 3AS8A 1DCEA 3G2SA 3FUIA 3R9MA 1S0PA 3LEWA 4GA2A 1U2VG 3Q5MA 4OVUA 2C0MA 4ACLA 2R2LA 1UG3A 4AM9A 4GCNA 4ABNA 3L6AA 2XZTG 4EBAA 3X2QE 2WQHA 2DBAA 3CVUA 3ZKJA 3PVLA 2VSXE 3UQ3A 3BEEA 3ZUVB 3B7SA 5EYPF 4BFRA 4H7XA 1BPOA 3K9IA 5FTPA 1JCRA 4A3VA 4HLEA 4KYOB 4EBAG 3I3NA 2LSVA 4U63A 2WXKA 1TN7A 3Q7FA 4CEMA 4A1GA 1TN6A 4XE0A 3ZN3A 4XIFA 1MYOA 3L54A 3VTXA 4BTAA 2KATA 4F7AA 4MLPA 4BTBA 2H6GA 5BT1A 2FF4A 1Z6TA 3ZEFA 1INZA 1D9SA 4JB8P 1HG2A 3DBSA 4APFA 2I1JA 2PM6A 3V79K 3NZUA 3Q9UC 5T3RA 4N3AA 3UM0A 1TNOA 4I2WA 2WXIA 4N2QA 4TUMA 1E8XA 2XCCA 2MYOA 3CQCB 3ISMC 2X38A 2YHCA 2X6HA 1WAO1 3Q79A 3CLJA 4BSZB 2XGSA 2EIKE 2WPVA 2DCPA 3TG4A 2ILRA 4K5AB 4J8YA 3S7FA 3R9AB 2AVPA 2GRNB 1VDYA 3FUDA 4ILGA 2LSUA 3HXDA 4U95D 1NZNA 4PS8A 2WXGA 4I17A 1IHBA 4GYWA 4RQIA 1W3BA 2EIJE 5HKPA 1SW6A 2QYUA 1PC2A 3HHMA 2V5QC 3PZ3A 1DCQA 3CVYA 4WUYA 3TG5A 4FU3A 3FUMA 4NIKA 3FTWA 1OWMA 4JHJA 3ESKA 3OXLA 3CSFA 2AWIA 4C48B 4YDEA 4G26A 5AJDA 1N54A 3UT4A 4I6GA 1O1RA 2J4BA 4HXIA 2KZTB 3CVNA 4JZYA 2DYRE 1QYMA 1KT0A 3KEAA 4I6JA 3V31A 2IF4A 5AJLA 2FO1E 3HYMB 4GTSA 5FT9A 4B8CB 3W9GA 1TJCA 4C0EA 3TXNA 1GW6A 1RZ4A 4GTOA 4XX5A 4Z68A 2Y1LE 5G04C 4GCOA 3DWLG 4DX5D 4X8QA 4LNGA 3LS8A 5AQAA 3ZXSA 3E33A 3KEZA 1S63A 2HO1A 3MKQA 5KCMA 3RKVA 3UINC 3UM1A 2CHXA 2VGYA 2EIME 1IKND 5A7DB 3VLFA 4DI4A 4URKA 4AOFA 2OVBA 1XNFA 4Q96A 3OAWA 3LJ3A 1FT1A 2KCVA 3BQOA 1NA3A 4B93B 2R02A 2XS8A 3LVQE 3CVVA 4JL0A 3QAQA 1YYHA 5KJLA 4CRWA 3FFLA 3MZLB 2P9UG 1IXVA 4GTRA 5ANLA 4L7TA 5AN8A 4WWPA 1YCSB 3UIOC 3BG0B 2ZU6B 4OVVA 1SZAA 3DXMG 1JPLA 2WXQA 3B7TA 3MGBA 4GTTA 2R03A 4B0ZA 4I9CA 2PL2A 3ASHA 4N3CA 3U64A 3SFYA 3LY9A 3TWRA 3PZ4A 3CK8A 2C2LA 5KNGA 4JW1A 3UT7A 2IFUA 4UWHA 1N4PA 3JQ0A 3U3WA 4RLYA 5EYLA 2R5SA 4BWRA 3CHPA 1WG0A 3AU5A 4HLLA 5BXOA 2I2OA 2YHEA 3I4RB 4EQFA 3QDNA 2WXHA 1E7UA 4O1PA 3LKUA 2XGMA 4BEPA 4DX6D 3FU3A 2A4ZA 1OWNA 1IQRA 3IKOB 3MKRA 3RO3A 1Y8MA 3Q73A 1ELKA 3TL5A 5AIJA 2LAHA 3I5PA 5ENOD 1FVHA 3WXXA 2OEWA 3SO8A 1SA5A 5D0OD 4KBQA 4AV7A 1TNUA 1N0QA 3NB2A 5JMND 2XEVA 5CERB 4AJWA 3FU0A 4U0ZA 1LTXA 4BX8A 3SZ7A 1HH8A 4JEUA 4JHKA 5A6CA 2XRZA 3V30A 5CCMA 4G2VA 3RRNB 5ENRD 3FY4A 2KC7A 3QK0A 3PZ2A 3R7RA 3UX4A 1UJJA 5ENQD 5J08A 1OCZE 4DUIA 1FVFA 3B7BA 4KZCA 3ZNGA 3G2UA 1UOHA 1Y6IA 3APDA 3D9OA 3RRUA 3TWQA 2XENA 1D8DA 4GMJA 4U0UA 2WXJA 3W9FA 4CDNA 2XPZA 3ASFA 3MX3A 2X6KA 5HRYA 1H6PA 2WXOA 3QARA 4LG6A 5FIOA 1YA0A 2B6CA 1SVXA 2L6BA 2QFCA 3EU9A 1O5MA 2UY1B 3SFZA 3ONLA 3QC1A 3ESLA 4K5BA 3CGHA 4ATZD 2V4HC 1TN8A 4HRMB 1NL4A 3WG7E 4GMLA 4TXQA 4AP2A 3T8KA 2XEEA 4FHJA 1AWCB 5EX3A 2GGFA 3HVEB 4Q94A 2ZGGA 1MJ0A 4B94A 3FTVA 1KZPA 1WDYA 4TRQA
chains in the Genus database with same CATH topology
4LNGA 1JCSA 3E33A 3PZ2A 1N95A 4YDOA 1SA4A 3E30A 3DSSA 1MZCA 1S63A 4GTMA 3HXBA 3HXEA 1FPPA 1O1TA 1N9AA 3E32A 3HXDA 4GTPA 4L9PA 3DRAA 1JCRA 3DSUA 2H6IA 3Q78A 1LD8A 1TNYA 1TNBA 3Q7AA 1N94A 3DSWA 1TN7A 3Q7FA 3DPYA 3Q75A 1TN6A 4EHMA 2H6HA 3KSLA 1D8DA 1FT1A 4GTQA 1FT2A 3EUVA 2BEDA 3HXCA 3PZ3A 3PZ1A 1TNZA 2IEJA 1NI1A 4GTRA 2H6GA 3E34A 1D8EA 2H6FA 3Q73A 1S64A 4YDEA 1O5MA 3EU5A 1N4RA 1SA5A 1O1RA 3SFXA 1TNUA 1X81A 1N4QA 4MBGA 3KSQA 1TNOA 3DSXA 1LTXA 1TN8A 1NL4A 1LD7A 4GTSA 3DSVA 4GTTA 2F0YA 1QBQA 2ZIRA 1JCQA 3HXFA 1DCEA 3C72A 4LNBA 3SFYA 3PZ4A 3Q79A 1KZOA 4GTOA 3E37A 1O1SA 2R2LA 4GTVA 1N4SA 3DSTA 1N4PA 1KZPA 2ZISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LNG A;  1JCS A;  3E33 A;  3PZ2 A;  1N95 A;  4YDO A;  1SA4 A;  3E30 A;  3DSS A;  1MZC A;  1S63 A;  4GTM A;  3HXB A;  3HXE A;  1FPP A;  1O1T A;  1N9A A;  3E32 A;  3HXD A;  4GTP A;  4L9P A;  3DRA A;  1JCR A;  3DSU A;  2H6I A;  3Q78 A;  1LD8 A;  1TNY A;  1TNB A;  3Q7A A;  1N94 A;  3DSW A;  1TN7 A;  3Q7F A;  3DPY A;  3Q75 A;  1TN6 A;  4EHM A;  2H6H A;  3KSL A;  1D8D A;  1FT1 A;  4GTQ A;  1FT2 A;  3EUV A;  2BED A;  3HXC A;  3PZ3 A;  3PZ1 A;  1TNZ A;  2IEJ A;  1NI1 A;  4GTR A;  2H6G A;  3E34 A;  1D8E A;  2H6F A;  3Q73 A;  1S64 A;  4YDE A;  1O5M A;  3EU5 A;  1N4R A;  1SA5 A;  1O1R A;  3SFX A;  1TNU A;  1X81 A;  1N4Q A;  4MBG A;  3KSQ A;  1TNO A;  3DSX A;  1LTX A;  1TN8 A;  1NL4 A;  1LD7 A;  4GTS A;  3DSV A;  4GTT A;  2F0Y A;  1QBQ A;  2ZIR A;  1JCQ A;  3HXF A;  1DCE A;  3C72 A;  4LNB A;  3SFY A;  3PZ4 A;  3Q79 A;  1KZO A;  4GTO A;  3E37 A;  1O1S A;  2R2L A;  4GTV A;  1N4S A;  3DST A;  1N4P A;  1KZP A;  2ZIS A; 
#chains in the Genus database with same CATH topology
 2JAB A;  4JXT A;  4AEZ C;  4M3O A;  4E85 A;  4GTM A;  4CCA A;  2VSO E;  1N9A A;  4WNF A;  2CFU A;  2VTB A;  5EKQ D;  2GRQ B;  3FH8 A;  2AXV A;  4N5Q A;  4G8K A;  5ENP D;  5FZS A;  4ILI A;  3B7R L;  3B95 A;  4GZ6 A;  2VGX B;  2DZN A;  1WM5 A;  4EHM A;  4B89 A;  1K8K G;  2RFA A;  2CHZ A;  1SZ9 A;  3KS2 A;  1N52 A;  2R59 A;  4HRN A;  5D2M C;  3ZHE A;  2VJ8 A;  4U8V D;  1RW2 A;  3S7J A;  3ONK A;  3CVW A;  4HOU A;  2RG8 A;  4KVM A;  4BSX A;  1V55 E;  1ZBP A;  2B0O E;  4B8A A;  2P9K G;  3C3R A;  5ENS D;  3ZYM A;  5FQ6 A;  3ABM E;  2FO7 A;  3CIA A;  4GZ3 A;  2PQR A;  3NBN B;  3FUL A;  3UPV A;  2WXF A;  2J8S D;  3UKU G;  3QWP A;  3FTU A;  3P2B A;  5T4Y A;  4PUC A;  3U9W A;  4P29 A;  2L6J A;  2A5E A;  3AG1 E;  4NUR A;  4XKB A;  2EQX A;  3TAX A;  3D9J A;  5CBN A;  1N4S A;  1JWG A;  1IQU A;  4I2Z A;  5M72 A;  5EDS A;  1QNF A;  4K03 A;  1H2V C;  1ELR A;  4Y6W A;  1H0A A;  5G05 J;  2M63 A;  1BI8 B;  3G2W A;  3FEX A;  4BY6 A;  3CHQ A;  3B13 A;  3VTY A;  1DC2 A;  1WY6 A;  2Y4U A;  2WM9 A;  1Z3Y A;  5B1B E;  3GYZ A;  3EDT B;  4AY6 A;  4DPR A;  1FT2 A;  3HXC A;  3JQ1 A;  4U7E B;  3GZ2 A;  1OCO E;  5G05 C;  3D9L A;  4IYP A;  2GW1 A;  1H19 A;  3D3M A;  4J6I A;  2H6F A;  5FZQ A;  4G11 A;  1HU3 A;  2FUL A;  4YND A;  3IEG A;  4ME2 A;  3U4T A;  4WWN A;  2IOS A;  4KMO A;  3QB2 A;  1OWL A;  4HOS A;  3DEO A;  4U0S A;  3ML8 A;  2DZO A;  5CHE E;  3T5V A;  4CT0 A;  5ARG A;  3L9T A;  5G04 J;  2KXP C;  2XZD G;  3KD7 A;  5CMY A;  1TYQ G;  3APC A;  2IU1 A;  4EZL A;  2IJG X;  4BT9 A;  4XI0 A;  4L1B A;  4I1M A;  2MRI A;  1V54 E;  3LJN A;  2J09 A;  2XEH A;  5LCW C;  1MZC A;  3T5X A;  2WVI A;  3HXB A;  3HXE A;  4J8E A;  4I6E A;  1MX6 A;  1K1A A;  3PEU B;  5FJY A;  4A63 B;  3MEK A;  3AJI A;  3FUE A;  2E2E A;  2JLB A;  4LCT A;  3TWV A;  3DSU A;  3DPY A;  2V4L A;  4GTQ A;  3ZVV A;  3FUJ A;  4KZ0 A;  4GZ5 A;  3ABK E;  2LUH A;  3EHM A;  3IHV A;  2QZA A;  1QQE A;  4ZFH A;  3CVP A;  3V2O A;  1AP7 A;  1D8E A;  4UUC A;  4GYY A;  1DVP A;  4FJY A;  3FDH A;  1HFA A;  3RAU A;  2WXL A;  3C3O A;  3UT8 A;  3OTN A;  3VLD A;  5LFA A;  2GRR B;  3CK7 A;  4IUL A;  4MBG A;  3QWW A;  3SGH A;  1QZ2 A;  2ETA A;  4HS2 A;  3LY8 A;  4LSZ E;  3S7B A;  3ZRH A;  4YVQ C;  2LXL A;  2P2C P;  1TEZ A;  1PY1 A;  2OV8 A;  3NQP A;  2MHK A;  1OXJ A;  3ABL E;  3CKB A;  3CHM A;  4BES A;  3MJW A;  3AG4 E;  3NOC D;  4UWK A;  2J9Q A;  4CGW A;  2ZIS A;  3D9N A;  4V3I A;  2BKK B;  2J49 A;  2DWZ A;  2PM7 A;  1X5B A;  4ATG A;  4MS6 A;  2WMN A;  5ENN A;  2RD0 A;  4KVO A;  2CHW A;  2LAI A;  4O1O A;  1OY3 D;  2H6I A;  4MKT A;  4EZJ A;  2R05 A;  4FAD A;  1TNB A;  5AYW D;  3IV0 A;  5C2Y A;  4F3V A;  4J8D A;  3CQG B;  5HI7 A;  2KCK A;  2FI7 A;  5EX0 A;  2Y3A A;  4DRX E;  2R17 C;  4U96 D;  4I1A A;  5BUZ A;  3HG0 D;  3FUH A;  3PZ1 A;  2PZI A;  5ITZ F;  4UQZ A;  4M7C A;  1UN8 A;  2KZT A;  3AAA C;  2ION A;  5BNW A;  4JC8 A;  1SQM A;  3BUA A;  5CBO A;  2CFZ A;  4ANX A;  2KM4 A;  3PNT B;  1ZU2 A;  5FQ8 A;  4W9R A;  4HOT A;  1N4Q A;  3G2V A;  4UI9 K;  3SF4 A;  5BV0 A;  3J5Q B;  2I6H A;  4WND A;  4R7L A;  4FC8 A;  1LD7 A;  4QQI A;  4PS3 A;  2F0Y A;  3O48 A;  2F8Y A;  3C72 A;  3SBT B;  4U8H A;  4HI9 A;  3APF A;  4PS7 A;  4FLH A;  2GRL A;  1O1S A;  3L16 A;  3QJZ A;  4A1S A;  4I1O B;  1TJF A;  4GZD A;  3ZYK A;  2WMO A;  4O6F A;  3Q47 B;  3FTS A;  4XKC A;  3PDN A;  5DBK A;  3MYV A;  4N2S A;  4EZK A;  4F6R D;  1E8Y A;  1OUV A;  3U66 A;  1TNY A;  1MX2 A;  3ZFW A;  3Q75 A;  5C1D A;  2VYI A;  3FH5 A;  3KSL A;  1KT1 A;  4OAU C;  5D66 A;  3R7Q A;  4HOR A;  3SQV A;  3PUJ A;  1Z5S C;  3CHO A;  4RG9 A;  4PH4 B;  2GRO B;  1N0R A;  4A3T A;  1BI7 B;  3CST A;  1XGW A;  4N3B A;  4TXP A;  4JHR A;  3RSE G;  3TGO A;  2YIN A;  4JA9 A;  2WXN A;  2J07 A;  2HE0 A;  3D9M A;  2Y69 E;  4HBD A;  1BU9 A;  2XPI A;  4APO A;  2IO2 C;  1FCH A;  3DEP A;  1OCC E;  4CYM D;  2OVF A;  3L17 A;  4ZHB A;  2XGO A;  1IYG A;  3PH0 C;  2XPY A;  4YDW A;  1E8W A;  5DIZ A;  3NF1 A;  4XEI G;  3SY2 A;  3E37 A;  1NA0 A;  3CVQ A;  4G8L A;  5EID A;  3ZXP A;  3D9K A;  5AQ9 A;  4G23 A;  1JCS A;  1ZB1 A;  1N95 A;  4WNE A;  3E30 A;  2J4D A;  2IY0 C;  3PE4 A;  3IHY A;  3EHR A;  3S2A A;  1OWO A;  3Q15 A;  3LVR E;  4JD2 G;  3LY7 A;  4J8S A;  5AAO A;  4CDR A;  3B7U X;  3UUX A;  2WQ6 A;  2NYJ A;  3FUK A;  4HRL A;  2CG3 A;  4IN3 B;  1EF1 C;  3UXG A;  2VGE A;  5HQ8 A;  2EIN E;  2BED A;  3CHR A;  3TWT A;  4CDM A;  3PEV B;  3MV2 B;  2XS1 A;  4DJA A;  1H6K A;  4UQX A;  1HF8 A;  4BT8 A;  4EEC A;  3N71 A;  5G2N A;  3FP3 A;  1G3N B;  5FQ7 A;  1HZ4 A;  1LF8 A;  4QFV A;  1HXI A;  1B89 A;  4K5C A;  1HE8 A;  2L0I A;  3ENE A;  5EN5 D;  1U3D A;  2L0T B;  4EPZ A;  3D9I A;  4FJZ A;  1E8Z A;  4AXH A;  4DI3 A;  3PE3 A;  3RK6 A;  2PQN A;  3SD5 A;  1E96 B;  3GZS A;  3ML9 A;  5T8I A;  3AG3 E;  4LUN U;  4L23 A;  2X6I A;  1JCQ A;  2P9I G;  3EIJ A;  4FLB A;  1NP7 A;  3ASD A;  2X6F A;  3CK9 A;  1E7V A;  3AS5 A;  3D9P A;  3DST A;  4RG6 A;  3ASG A;  4BET A;  5LOZ A;  3CR3 A;  4JVS A;  4YDO A;  5H7P A;  3DSS A;  5KJM A;  2YQ8 A;  2OCC E;  4I9E A;  3ASN E;  3CHS A;  1YMP A;  3EJN A;  2QC9 A;  3S7D A;  5B1A E;  2HM8 A;  4NQ0 A;  4YVO A;  4GTP A;  4U8Y D;  3QKY A;  3DRA A;  4ACK A;  1MQS A;  3ULQ A;  4C0M A;  3ZYQ A;  4G1T A;  4F53 A;  3MKQ B;  3Q7A A;  2F8X K;  1Z3X A;  2H6H A;  3NOG D;  3FU6 A;  5BXU A;  5FQ4 A;  2X3M A;  3LPZ A;  4BER A;  2AXU A;  2OND A;  3FUN A;  3BU8 A;  2LXM A;  3L82 A;  5J90 A;  5JJ7 A;  2DIW A;  2UY1 A;  3ZW3 A;  4CT4 A;  4GZC A;  3SI5 A;  2RFM A;  2DVW A;  5AEN A;  1DNP A;  4J8F A;  2P9P G;  3QNK A;  4ANU A;  4TUU A;  2BUG A;  2VQ2 A;  2NSZ A;  3IXE A;  1EDU A;  2V5F A;  3L22 A;  4GYO A;  2LO6 A;  2GRP B;  1HX8 A;  4WNG A;  4CZ2 D;  1S70 B;  3EIQ C;  3HVE A;  2V8S E;  4F1P A;  5KJN A;  3FTX A;  3LDZ A;  3SHF A;  4FUL A;  1UW4 B;  3DSV A;  3V2X A;  4XZ4 A;  2ZIR A;  3TWS A;  4RVB A;  4N39 A;  1TR4 A;  3DPD A;  5BW8 C;  5FIN A;  2Y0B G;  5A23 A;  3OXG A;  4ANW A;  4GTV A;  1A17 A;  4HOQ A;  3AS4 A;  5LCW J;  5JHA A;  5B3S E;  4DX1 A;  2BKG A;  3RU0 A;  1ELW A;  3ZYL A;  5LP0 A;  2F37 A;  2XCB A;  4HVB A;  3LCA A;  2VSY A;  2P9S G;  2PNN A;  3DXK G;  2E0I A;  3E32 A;  2VGX A;  2FBN A;  3UM2 A;  3RRM B;  5ANR A;  5CCL A;  3UKR G;  4AVX A;  2YNQ A;  5G55 A;  2P58 C;  5HS0 A;  5CMW A;  3TWX A;  3PS6 A;  5E76 A;  4E6H A;  2UWJ G;  1JWF A;  4UWF A;  1HG5 A;  2L9B A;  3JUE A;  2I9C A;  4XI9 A;  2ETB A;  5CRU A;  4C9B B;  1TNZ A;  1H6O A;  1UN9 A;  4ILH B;  4HI8 A;  1HO8 A;  1S64 A;  3FTZ A;  3SBS A;  4LNU D;  3JXI A;  2KBX A;  1N4R A;  3I4G A;  3D9H A;  1X81 A;  4GAA A;  1KLX A;  4LRZ A;  4GA1 A;  1Q2Z A;  1NFI E;  4AIF A;  3FU5 A;  3AG2 E;  3Q4A B;  2Q7F A;  4JPS A;  2LNI A;  3ULE G;  4LNB A;  3Q9N C;  3FWV A;  3T9K A;  2WXM A;  2Y4T A;  2V0P A;  4G25 A;  2J08 A;  4G24 A;  3MV3 B;  2P9N G;  4JEH A;  4HB5 A;  2NC9 A;  4U04 A;  5IY5 E;  4LEU A;  3NZS A;  3J5P A;  4DLO A;  4N5C A;  1SA4 A;  1MHQ A;  3P1U A;  1FPP A;  3C3Q A;  4FP7 A;  2NXP A;  1BLX B;  2QY7 A;  2P9L G;  3PZD A;  3JUI A;  4YDY A;  4L2L A;  3MA5 A;  2HR2 A;  3PRE A;  3ULY A;  2ETC A;  3T8M A;  5KNH D;  2AXZ A;  2ZGD A;  3FUF A;  2WXR A;  5JJ6 A;  1H2T C;  3JCK C;  5AQ7 A;  4RSY A;  2QYJ A;  1OCR E;  4F1S A;  3CVL A;  5JJT A;  3C5R A;  2IO3 C;  3HDX A;  4ANV A;  2HYZ A;  5FWQ A;  2KCL A;  3EHN A;  4J0U A;  5JHB A;  5EIB E;  5CEC B;  1HS6 A;  2A5U A;  4WAF A;  5LX8 A;  4OYS A;  4O60 A;  2JEK A;  3TWU A;  4OAV B;  3IBE A;  2WQ7 A;  3UIP C;  4UI9 J;  4HQD A;  4KT6 B;  3ZGQ A;  3TJP A;  3ZU7 B;  4TV3 A;  2BF0 X;  2WB2 A;  2I1K A;  1A5E A;  4TXR A;  4FHK A;  3FEY A;  2ZXW E;  3JYS A;  4A55 A;  4U07 A;  1EPU A;  4Q69 A;  2XRY A;  3C98 A;  3TWW A;  2GRM A;  3E4B A;  3UI2 A;  3RIB A;  4GU5 A;  4UI9 C;  4J7W A;  1O1T A;  3KAE A;  3L13 A;  3RJV A;  5ARF A;  5KBA A;  4PDX A;  4D10 C;  4KXK B;  2XHE A;  5JA4 D;  3MCX A;  3Q78 A;  4GB9 A;  3ZPJ A;  3QWV A;  4Y6C A;  3LYA A;  3CKC A;  1PAQ A;  5CEA A;  4UQY A;  2VTB B;  5ENT D;  4I43 A;  5KWD A;  3UTM A;  5D0Q D;  4AY5 A;  3G2T A;  4FA6 A;  1KPS B;  3FTY A;  4WWO A;  3TXM A;  1NI1 A;  3LXU X;  2XQ0 A;  4GMR A;  1K1B A;  3GZ1 A;  1IHG A;  3ZHE B;  3QOU A;  3EU5 A;  1U3C A;  4DX7 D;  2IQC A;  3SFX A;  1L5J A;  2BTD A;  5EIL A;  4K0R A;  4H7Y A;  3KSQ A;  2OOE A;  2X6J A;  3OXF A;  3CV0 A;  4MRU A;  2AJA A;  2OEV A;  2IOL A;  2WXP A;  2FEZ A;  3HXF A;  4GPK A;  4DX2 A;  3FHE A;  5BV1 A;  1KZO A;  3BG1 B;  4IRU A;  5FZR A;  3URZ A;  5E75 A;  2VSN A;  1P5Q A;  5AQB A;  4JA7 A;  2CG2 A;  2DYS E;  4DLQ A;  3JXJ A;  3NAW A;  5CRV A;  4NRH B;  3AU4 A;  4NAC A;  4LER A;  4UWL A;  2EIL E;  2RKK A;  1E90 A;  3RO2 A;  1UJK A;  3VLE A;  2C0L A;  3GW4 A;  4GPM A;  1K3Z D;  1MX4 A;  4L9P A;  1H2U A;  1LD8 A;  3FH7 A;  4HFG A;  3UM3 A;  1N94 A;  3DSW A;  3HIZ A;  4CGV A;  1EYH A;  3F6Q A;  3EUV A;  5KJK A;  3CVX A;  5CED B;  3Q49 B;  2MOW A;  4UWG A;  2IEJ A;  4DK5 A;  4GA0 A;  4BX9 A;  1OT8 A;  3UMV A;  3SNX A;  3E34 A;  3ASO E;  3O4Z A;  1OWP A;  3CEQ A;  3PRZ A;  3L08 A;  4L2Y A;  5BPP A;  1N11 A;  3DSX A;  3PUK A;  1JUQ A;  4HNA D;  2AW6 A;  3ZIM A;  3EHQ A;  5AAR A;  1BD8 A;  3HRA A;  1QBQ A;  3PNL B;  3AS8 A;  1DCE A;  3G2S A;  3FUI A;  3R9M A;  1S0P A;  3LEW A;  4GA2 A;  1U2V G;  3Q5M A;  4OVU A;  2C0M A;  4ACL A;  2R2L A;  1UG3 A;  4AM9 A;  4GCN A;  4ABN A;  3L6A A;  2XZT G;  4EBA A;  3X2Q E;  2WQH A;  2DBA A;  3CVU A;  3ZKJ A;  3PVL A;  2VSX E;  3UQ3 A;  3BEE A;  3ZUV B;  3B7S A;  5EYP F;  4BFR A;  4H7X A;  1BPO A;  3K9I A;  5FTP A;  1JCR A;  4A3V A;  4HLE A;  4KYO B;  4EBA G;  3I3N A;  2LSV A;  4U63 A;  2WXK A;  1TN7 A;  3Q7F A;  4CEM A;  4A1G A;  1TN6 A;  4XE0 A;  3ZN3 A;  4XIF A;  1MYO A;  3L54 A;  3VTX A;  4BTA A;  2KAT A;  4F7A A;  4MLP A;  4BTB A;  2H6G A;  5BT1 A;  2FF4 A;  1Z6T A;  3ZEF A;  1INZ A;  1D9S A;  4JB8 P;  1HG2 A;  3DBS A;  4APF A;  2I1J A;  2PM6 A;  3V79 K;  3NZU A;  3Q9U C;  5T3R A;  4N3A A;  3UM0 A;  1TNO A;  4I2W A;  2WXI A;  4N2Q A;  4TUM A;  1E8X A;  2XCC A;  2MYO A;  3CQC B;  3ISM C;  2X38 A;  2YHC A;  2X6H A;  1WAO 1;  3Q79 A;  3CLJ A;  4BSZ B;  2XGS A;  2EIK E;  2WPV A;  2DCP A;  3TG4 A;  2ILR A;  4K5A B;  4J8Y A;  3S7F A;  3R9A B;  2AVP A;  2GRN B;  1VDY A;  3FUD A;  4ILG A;  2LSU A;  3HXD A;  4U95 D;  1NZN A;  4PS8 A;  2WXG A;  4I17 A;  1IHB A;  4GYW A;  4RQI A;  1W3B A;  2EIJ E;  5HKP A;  1SW6 A;  2QYU A;  1PC2 A;  3HHM A;  2V5Q C;  3PZ3 A;  1DCQ A;  3CVY A;  4WUY A;  3TG5 A;  4FU3 A;  3FUM A;  4NIK A;  3FTW A;  1OWM A;  4JHJ A;  3ESK A;  3OXL A;  3CSF A;  2AWI A;  4C48 B;  4YDE A;  4G26 A;  5AJD A;  1N54 A;  3UT4 A;  4I6G A;  1O1R A;  2J4B A;  4HXI A;  2KZT B;  3CVN A;  4JZY A;  2DYR E;  1QYM A;  1KT0 A;  3KEA A;  4I6J A;  3V31 A;  2IF4 A;  5AJL A;  2FO1 E;  3HYM B;  4GTS A;  5FT9 A;  4B8C B;  3W9G A;  1TJC A;  4C0E A;  3TXN A;  1GW6 A;  1RZ4 A;  4GTO A;  4XX5 A;  4Z68 A;  2Y1L E;  5G04 C;  4GCO A;  3DWL G;  4DX5 D;  4X8Q A;  4LNG A;  3LS8 A;  5AQA A;  3ZXS A;  3E33 A;  3KEZ A;  1S63 A;  2HO1 A;  3MKQ A;  5KCM A;  3RKV A;  3UIN C;  3UM1 A;  2CHX A;  2VGY A;  2EIM E;  1IKN D;  5A7D B;  3VLF A;  4DI4 A;  4URK A;  4AOF A;  2OVB A;  1XNF A;  4Q96 A;  3OAW A;  3LJ3 A;  1FT1 A;  2KCV A;  3BQO A;  1NA3 A;  4B93 B;  2R02 A;  2XS8 A;  3LVQ E;  3CVV A;  4JL0 A;  3QAQ A;  1YYH A;  5KJL A;  4CRW A;  3FFL A;  3MZL B;  2P9U G;  1IXV A;  4GTR A;  5ANL A;  4L7T A;  5AN8 A;  4WWP A;  1YCS B;  3UIO C;  3BG0 B;  2ZU6 B;  4OVV A;  1SZA A;  3DXM G;  1JPL A;  2WXQ A;  3B7T A;  3MGB A;  4GTT A;  2R03 A;  4B0Z A;  4I9C A;  2PL2 A;  3ASH A;  4N3C A;  3U64 A;  3SFY A;  3LY9 A;  3TWR A;  3PZ4 A;  3CK8 A;  2C2L A;  5KNG A;  4JW1 A;  3UT7 A;  2IFU A;  4UWH A;  1N4P A;  3JQ0 A;  3U3W A;  4RLY A;  5EYL A;  2R5S A;  4BWR A;  3CHP A;  1WG0 A;  3AU5 A;  4HLL A;  5BXO A;  2I2O A;  2YHE A;  3I4R B;  4EQF A;  3QDN A;  2WXH A;  1E7U A;  4O1P A;  3LKU A;  2XGM A;  4BEP A;  4DX6 D;  3FU3 A;  2A4Z A;  1OWN A;  1IQR A;  3IKO B;  3MKR A;  3RO3 A;  1Y8M A;  3Q73 A;  1ELK A;  3TL5 A;  5AIJ A;  2LAH A;  3I5P A;  5ENO D;  1FVH A;  3WXX A;  2OEW A;  3SO8 A;  1SA5 A;  5D0O D;  4KBQ A;  4AV7 A;  1TNU A;  1N0Q A;  3NB2 A;  5JMN D;  2XEV A;  5CER B;  4AJW A;  3FU0 A;  4U0Z A;  1LTX A;  4BX8 A;  3SZ7 A;  1HH8 A;  4JEU A;  4JHK A;  5A6C A;  2XRZ A;  3V30 A;  5CCM A;  4G2V A;  3RRN B;  5ENR D;  3FY4 A;  2KC7 A;  3QK0 A;  3PZ2 A;  3R7R A;  3UX4 A;  1UJJ A;  5ENQ D;  5J08 A;  1OCZ E;  4DUI A;  1FVF A;  3B7B A;  4KZC A;  3ZNG A;  3G2U A;  1UOH A;  1Y6I A;  3APD A;  3D9O A;  3RRU A;  3TWQ A;  2XEN A;  1D8D A;  4GMJ A;  4U0U A;  2WXJ A;  3W9F A;  4CDN A;  2XPZ A;  3ASF A;  3MX3 A;  2X6K A;  5HRY A;  1H6P A;  2WXO A;  3QAR A;  4LG6 A;  5FIO A;  1YA0 A;  2B6C A;  1SVX A;  2L6B A;  2QFC A;  3EU9 A;  1O5M A;  2UY1 B;  3SFZ A;  3ONL A;  3QC1 A;  3ESL A;  4K5B A;  3CGH A;  4ATZ D;  2V4H C;  1TN8 A;  4HRM B;  1NL4 A;  3WG7 E;  4GML A;  4TXQ A;  4AP2 A;  3T8K A;  2XEE A;  4FHJ A;  1AWC B;  5EX3 A;  2GGF A;  3HVE B;  4Q94 A;  2ZGG A;  1MJ0 A;  4B94 A;  3FTV A;  1KZP A;  1WDY A;  4TRQ A; 
#chains in the Genus database with same CATH homology
 4LNG A;  1JCS A;  3E33 A;  3PZ2 A;  1N95 A;  4YDO A;  1SA4 A;  3E30 A;  3DSS A;  1MZC A;  1S63 A;  4GTM A;  3HXB A;  3HXE A;  1FPP A;  1O1T A;  1N9A A;  3E32 A;  3HXD A;  4GTP A;  4L9P A;  3DRA A;  1JCR A;  3DSU A;  2H6I A;  3Q78 A;  1LD8 A;  1TNY A;  1TNB A;  3Q7A A;  1N94 A;  3DSW A;  1TN7 A;  3Q7F A;  3DPY A;  3Q75 A;  1TN6 A;  4EHM A;  2H6H A;  3KSL A;  1D8D A;  1FT1 A;  4GTQ A;  1FT2 A;  3EUV A;  2BED A;  3HXC A;  3PZ3 A;  3PZ1 A;  1TNZ A;  2IEJ A;  1NI1 A;  4GTR A;  2H6G A;  3E34 A;  1D8E A;  2H6F A;  3Q73 A;  1S64 A;  4YDE A;  1O5M A;  3EU5 A;  1N4R A;  1SA5 A;  1O1R A;  3SFX A;  1TNU A;  1X81 A;  1N4Q A;  4MBG A;  3KSQ A;  1TNO A;  3DSX A;  1LTX A;  1TN8 A;  1NL4 A;  1LD7 A;  4GTS A;  3DSV A;  4GTT A;  2F0Y A;  1QBQ A;  2ZIR A;  1JCQ A;  3HXF A;  1DCE A;  3C72 A;  4LNB A;  3SFY A;  3PZ4 A;  3Q79 A;  1KZO A;  4GTO A;  3E37 A;  1O1S A;  2R2L A;  4GTV A;  1N4S A;  3DST A;  1N4P A;  1KZP A;  2ZIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...