3TWQA

Crystal structure of arc4 from human tankyrase 2 (apo form)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
164
structure length
164
Chain Sequence
GAMGISLGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 51
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twqA00
4OAUC 1TR4A 4J8YA 2L6BA 3ZUVB 4DRXE 5EYLA 4DX1A 1MJ0A 1WDYA 4K5CA 5CEAA 1N0RA 3EHRA 5AQAA 5CERB 2XZTG 4GMRA 5ENPD 2XENA 1IHBA 3TWUA 4HRMB 4DX7D 4YDWA 2AJAA 2Y1LE 3SO8A 3C5RA 3TWXA 2B0OE 4O60A 3UXGA 1BU9A 3TWWA 1AP7A 2F8XK 3NBNB 5HKPA 4OAVB 2A5EA 4B93B 1BD8A 2ETAA 4HNAD 1SVXA 5FIOA 5HS0A 5ITZF 4LG6A 1BI7B 3JXIA 4HRLA 4U95D 1YCSB 1MYOA 1QYMA 2DVWA 3J5QB 5EILA 1DCQA 5FINA 5JMND 2DWZA 1N0QA 4J7WA 2J8SD 3Q9NC 5EYPF 5BXOA 5HRYA 5AQ7A 2RFAA 3ZNGA 4DX2A 4F6RD 2MYOA 1WG0A 1K1AA 4TUMA 1A5EA 2BKGA 3T9KA 4QQIA 3EU9A 4JB8P 3IXEA 4ZFHA 4A63B 2QYJA 2QC9A 4K5AB 4BSZB 4C48B 3TWRA 2XEHA 5AARA 4HBDA 4HRNA 3TWTA 2ETCA 1YMPA 2DZNA 1K1BA 1MX2A 5KNGA 4DX6D 2NYJA 3ZU7B 5ENQD 3D9HA 2ETBA 5D66A 5ENOD 5AQBA 5ENRD 5CBOA 2V4HC 3AAAC 5BXUA 4G8KA 3F6QA 1SW6A 4U96D 3W9GA 4HQDA 3KEAA 4K5BA 3V2OA 2ZGGA 3TWSA 4ATZD 4CYMD 5AQ9A 4DUIA 2XZDG 1MX4A 3ZKJA 3T8KA 4Z68A 3LJNA 3JXJA 4HI9A 1NFIE 4HB5A 3V31A 1OY3D 5CBNA 5KWDA 3EHQA 5CEDB 5EIBE 3UI2A 3B7BA 4G8LA 3TWVA 5AN8A 4U8YD 3AJIA 2Y0BG 3UTMA 3V2XA 4HLLA 4N5QA 2KXPC 2BKKB 5ENTD 4QFVA 2RFMA 5KNHD 3JUEA 3B95A 4BESA 4RLYA 2V5QC 4LSZE 4GPMA 2KBXA 4YDYA 1N11A 1OT8A 2ZGDA 4F1PA 2P2CP 1IKND 4ZHBA 2PNNA 3V79K 4UUCA 1K3ZD 2FO1E 3J5PA 1D9SA 1BI8B 1IXVA 4BEPA 1UOHA 3NOCD 2HE0A 4LNUD 4O1OA 3TWQA 1MX6A 3DEOA 3HRAA 5AAOA 3HG0D 1DC2A 3V30A 4CZ2D 1YYHA 4U8VD 4NIKA 5KBAA 1AWCB 2VGEA 1BLXB 1G3NB 3Q9UC 4DX5D 3NOGD 4BETA 5ENSD 2F8YA 5JA4D 5CECB 3W9FA 1S70B 2DZOA 3DEPA 4BERA 5EN5D 2F37A 2JABA 2XEEA 4HI8A 4O1PA 5EIDA
chains in the Genus database with same CATH superfamily
1HG5A 3O4ZA 4GB9A 2XZTG 1IHBA 4UQYA 3OTNA 1O5MA 3SGHA 2J9QA 4HRLA 1YCSB 5EILA 5FINA 2YHEA 4TXQA 4AY6A 1N0QA 3FEXA 3QAQA 1E8ZA 4CGWA 3RO3A 3FUKA 5H7PA 2ZXWE 3PS6A 2UY1B 4HRNA 3CVUA 3ZEFA 3ZU7B 4AIFA 4C9BB 5EDSA 1LD7A 3ESKA 3RAUA 2OEWA 4XEIG 4K5BA 4UQXA 5CHEE 3ASOE 1D8EA 1TEZA 2EQXA 4N3CA 3LJNA 3L54A 4HI9A 1NFIE 3IV0A 4HB5A 3AG1E 3RRUA 1U3CA 5BW8C 4Q94A 5C2YA 2Y4UA 1OWPA 1H0AA 1RZ4A 3V2XA 3QWVA 3R9MA 2J4BA 3PREA 3DSXA 3AG2E 2FO1E 2V5FA 4ME2A 2HE0A 3DPDA 1JCRA 4WNFA 1MX6A 1P5QA 2CFUA 3MA5A 4FHJA 3MV3B 3SZ7A 4AP2A 3FU0A 3OXGA 3LEWA 5D2MC 4AJWA 3MKQB 4TV3A 2F8YA 3UM0A 2DZOA 3DEPA 4GMLA 4HI8A 4OAUC 2LNIA 4J8FA 2EIME 3TWXA 4WNGA 3LY8A 4BX9A 4G26A 2FBNA 3ONLA 1TYQG 4B93B 5FZQA 3CHQA 1IQRA 2C2LA 5KJKA 3UM2A 3IBEA 3I5PA 2WM9A 2XS1A 2IO2C 3HVEA 1WG0A 1FVFA 2VSOE 4GA0A 3ESLA 4KMOA 3PZ4A 2GROB 4MLPA 3ASFA 4YVOA 4G8KA 4HS2A 3JQ1A 4U96D 1W3BA 4UQZA 4JPSA 4K03A 3B7SA 4FLHA 4ANUA 1TNYA 4KT6B 4DUIA 3T8KA 2QYUA 1O1TA 2XPZA 4FLBA 5T4YA 4PS3A 3UKRG 5CMYA 2CG3A 3L22A 2KCVA 1S63A 4ANXA 4G2VA 5ENTD 4DLOA 3E30A 3TAXA 5ANLA 2Y4TA 1QNFA 3RK6A 1X81A 3HG0D 2Y3AA 4JEUA 2VSXE 4GZ5A 3PEUB 4CT4A 4EQFA 1TN6A 3S7JA 3ASGA 5ENSD 5ENPD 5EYLA 4YNDA 2GW1A 4HOUA 2XENA 1DCEA 2DIWA 4HOQA 4G24A 3FUDA 3PZ2A 1HU3A 4OAVB 2ETAA 1UN8A 1SVXA 4RSYA 3UQ3A 2HO1A 1NI1A 3PE4A 4FA6A 4AV7A 2P58C 2IEJA 3EUVA 1OCRE 3EU9A 5FTPA 3G2VA 4ZFHA 1HXIA 1KZPA 2BEDA 5AJLA 3FULA 5EX3A 3VLFA 2RG8A 1KZOA 3LCAA 4BX8A 1E96B 2L0TB 1YMPA 3FEYA 3Q7AA 4G23A 1JCQA 2IO3C 4KZ0A 1ELWA 2GRMA 2ZGGA 1B89A 1QQEA 3MCXA 2GRQB 3DWLG 3EHNA 5LOZA 3MZLB 4L2YA 3SF4A 4PS8A 3AJIA 2VYIA 3B95A 2P9KG 4WWPA 1Z6TA 3ZYKA 1FT1A 4JZYA 3CSTA 2LSVA 2CG2A 4M3OA 3J5PA 4UWLA 1XNFA 3QWPA 3TWQA 4L7TA 3FY4A 4I6EA 2VGEA 4AEZC 3FWVA 3K9IA 3CHOA 2LSUA 2ZU6B 4K5CA 3D9IA 4DK5A 2PQNA 1KPSB 4U7EB 3UXGA 3ULEG 1S0PA 1TNUA 2CHZA 3WG7E 4N3BA 3SI5A 3CEQA 2VJ8A 1Z3XA 2ILRA 1BI7B 2IU1A 4ACKA 5D0QD 2VGYA 2DYRE 3Q9NC 3NZSA 2RFAA 3CHMA 5DIZA 2PQRA 2X6HA 3KD7A 4GTMA 3U66A 2R5SA 3AG3E 2R02A 4BSZB 5KJLA 1KT1A 3L9TA 5KNGA 2P9SG 3OXFA 2JEKA 2OV8A 4HQDA 3V2OA 2M63A 3Q5MA 3HXDA 5LP0A 2PM6A 5B3SE 1U2VG 3L82A 3P2BA 3IHVA 3Q7FA 3NAWA 4G8LA 3CVYA 2P9LG 3FTVA 2QFCA 2P9UG 2KXPC 2BKKB 2RFMA 5KNHD 3JUEA 1ZBPA 4DI3A 1OT8A 4LERA 3PZ1A 5AAOA 1NZNA 2GRLA 1VDYA 4JW1A 4Q96A 3DSWA 4AM9A 4EZLA 3UIOC 3RO2A 3R7RA 4IYPA 3U4TA 5CERB 5AQAA 4G11A 3UT8A 1MHQA 4CDRA 3MX3A 3EIJA 2VTBB 2KZTB 2FULA 3Q49B 1RW2A 4EZKA 3GW4A 2P9NG 3JXIA 1MYOA 3RSEG 3J5QB 5JMND 2KATA 2DWZA 1JUQA 3N71A 1FVHA 2WQ7A 3PRZA 3L08A 3L13A 5G05C 3UPVA 3FUEA 3L6AA 3ZFWA 1K1BA 3AS5A 3FH8A 4DX6D 3L17A 5D66A 5AQBA 2WXRA 2WXPA 4F7AA 3JYSA 3G2SA 5FZSA 3ZYMA 2KCLA 2PL2A 2AXVA 4ILGA 2P9PG 2XGMA 2A5UA 3D9JA 3I4RB 5FQ4A 3U3WA 1OCCE 3V31A 2R17C 3CQCB 3PVLA 4N5QA 4MS6A 3IEGA 5E76A 3ZYQA 3D3MA 4XIFA 4U07A 2LAHA 4F53A 2Y69E 4RVBA 3LPZA 3PZ3A 3ULYA 4CZ2D 1NA0A 3CVPA 4NIKA 4KYOB 3CR3A 4WUYA 4I6GA 3C3RA 2X3MA 5FQ7A 1OWOA 2DBAA 4JXTA 3ZHEA 3B7UX 1OUVA 1HS6A 3KAEA 1EDUA 2CFZA 4PUCA 2J8SD 5EYPF 4FJZA 2UY1A 2PM7A 3UT7A 3FDHA 3HHMA 4TUMA 1OCZE 5IY5E 5M72A 5KJNA 3D9PA 4A1SA 3PNTB 4LNGA 4BT8A 3LVRE 3RRNB 1V54E 3AAAC 3F6QA 3W9GA 2IQCA 3EU5A 4G1TA 4Z68A 1TJFA 3FP3A 5EIBE 2H6FA 3TWVA 4BESA 5EX0A 4EZJA 4EBAG 3DSSA 2P2CP 1K3ZD 2ONDA 3Q4AB 4GCNA 3HRAA 2J09A 2GRNB 1MZCA 5JJ7A 4NACA 1Z5SC 1EYHA 4WAFA 4H7YA 3HIZA 5A7DB 4BETA 1FT2A 3FUIA 5D0OD 3ZRHA 4ABNA 1X5BA 1MJ0A 3CK9A 5BV0A 4IN3B 4O60A 2XHEA 1PC2A 4LRZA 2FF4A 2F8XK 3JCKC 2OVFA 1Y6IA 2A5EA 3D9OA 4ACLA 4XX5A 3Q75A 4DJAA 3BEEA 1HH8A 1HO8A 4N39A 3FU6A 2GRRB 1TNOA 4FP7A 5BXOA 5EKQD 1K1AA 1HFAA 4ATGA 1N94A 3HXFA 1HG2A 2RD0A 2VGXB 3QDNA 4TXPA 1IYGA 3IHYA 4B0ZA 2IJGX 4B8AA 3QARA 3B7RL 5DBKA 3DSVA 2XQ0A 4APFA 2BUGA 1FCHA 4I6JA 5CBNA 3UI2A 3FTYA 2IY0C 1E7VA 3LY7A 4YDYA 2FO7A 3OAWA 5A23A 4GTRA 1JPLA 3P1UA 2L6JA 2LAIA 4JHKA 2HR2A 2XEEA 4ILHB 3C72A 2WQ6A 3QJZA 3EDTB 4DRXE 1SA5A 2X6KA 4HRMB 3NB2A 5C1DA 2XGOA 3TWWA 1AP7A 5ANRA 2XRYA 1PY1A 4B94A 2WQHA 4L23A 2DVWA 1YA0A 4A3VA 3R9AB 3CVNA 5CCLA 4I1OB 2WXMA 2OOEA 4F6RD 5HQ8A 5AENA 1WAO1 4BWRA 3URZA 2BKGA 1KT0A 2OCCE 3RKVA 3MKRA 3E4BA 1Y8MA 2QYJA 4K5AB 3I3NA 1MX2A 3NQPA 2NYJA 5ARFA 5BXUA 4ANWA 1SW6A 2XS8A 4FJYA 4OYSA 4JL0A 4XE0A 4PDXA 4GZCA 3TXNA 4ATZD 4CYMD 5AQ9A 3SD5A 2WXIA 4IRUA 1EF1C 3VTYA 5AN8A 4U8HA 1SZAA 1N4PA 4EECA 2X38A 3CLJA 3CSFA 3KS2A 4F1PA 2PNNA 2X6FA 1LTXA 4HFGA 5T3RA 1UOHA 5JHBA 3PEVB 3TG5A 3BG0B 2J49A 4U8VD 3VTXA 3C98A 3Q47B 3I4GA 1E90A 5JA4D 1INZA 2JABA 3FUJA 1L5JA 4O1PA 4BSXA 4AVXA 2I1KA 2WXHA 2C0LA 4DX7D 4DPRA 4YDWA 1ELRA 4G25A 2JLBA 3FHEA 4RG6A 4GYOA 4DI4A 2IONA 1O1RA 3D9KA 2I6HA 3QC1A 3AU4A 3Q79A 1TNBA 4L1BA 3ZNGA 4DX2A 1PAQA 2XEVA 4AXHA 3CVXA 1LD8A 4AOFA 2VQ2A 2XPIA 4HLEA 5ARGA 3PZDA 1ZB1A 3DRAA 3AS8A 2H6IA 1XGWA 3PUJA 4A55A 4OVUA 5B1BE 4A3TA 3SHFA 2LXMA 3AG4E 4BTAA 3V79K 3DBSA 2AXZA 1S64A 4IULA 3DEOA 1H19A 1DC2A 1H2VC 4P29A 2AW6A 2YQ8A 2ZIRA 3FU5A 2BTDA 3AU5A 3QNKA 1AWCB 1BLXB 4DX5D 4A1GA 1GW6A 2L0IA 4BTBA 1QZ2A 4TUUA 5LCWJ 2R03A 1TR4A 5JJ6A 4GZDA 3EHRA 2IOSA 4ANVA 2AJAA 1BU9A 3CQGB 2WXGA 2V8SE 1N54A 1H2UA 4U0UA 5FWQA 4U95D 1QYMA 3GZSA 2EILE 4JA7A 1ZU2A 4NURA 3LYAA 5HRYA 2KCKA 2R05A 4JB8P 3TXMA 3FTUA 5AJDA 3AS4A 4U0SA 3FUNA 1NA3A 2WXLA 2IFUA 4M7CA 5ENQD 3D9HA 2V4HC 3ZGQA 2WMOA 1OWMA 3E37A 3BQOA 5BNWA 4W9RA 3QB2A 2J07A 3ZKJA 4LNBA 2LO6A 5G2NA 3X2QE 3UM1A 4TRQA 3RJVA 4HOSA 3LS8A 5J08A 1OWNA 3CHRA 4HVBA 1IQUA 2R59A 4F3VA 4GPMA 5BV1A 3ABLE 1D9SA 4RG9A 3Q78A 2V0PA 1TN8A 3ZXPA 4MKTA 4UWGA 3CKCA 4FHKA 2NC9A 3W9FA 3CK7A 1Q2ZA 4J8YA 1NL4A 2L6BA 1WDYA 4APOA 4GU5A 4YVQC 4KZCA 3CVVA 5G04J 2VSYA 4CDMA 3FUHA 4H7XA 4E85A 3LJ3A 4C0EA 1NP7A 3CHPA 3C3OA 2QY7A 3HXCA 4RQIA 4A63B 2FI7A 3CV0A 2XEHA 3T5XA 1E8XA 1H6PA 1OCOE 5ENOD 1TN7A 2HM8A 5ENRD 4U04A 4BY6A 4I43A 1DVPA 4GAAA 4N2SA 4JVSA 3KEAA 3ML9A 5FJYA 2DCPA 3TWSA 2MHKA 3EJNA 4GA2A 3E34A 3UINC 3PDNA 4Q69A 3JXJA 1N95A 5CEDB 3FU3A 2C0MA 3WXXA 2OEVA 4B89A 1H2TC 2XRZA 4JEHA 1BI8B 1N4QA 4D10C 2CHWA 4OVVA 1E7UA 3TGOA 3U9WA 4GZ3A 3VLDA 3DSUA 2X6JA 5JJTA 3Q73A 4JHRA 3ZHEB 3APDA 3IKOB 3LKUA 5EIDA 4DX1A 3FTWA 3SFXA 1N0RA 4AY5A 3MKQA 2Y1LE 3FTZA 5CCMA 3B13A 1JWFA 3PH0C 3CVWA 2WXFA 3CVQA 1BD8A 4NRHB 4GTPA 3DSTA 5T8IA 3JUIA 5BT1A 4C0MA 2IF4A 2KM4A 1FPPA 1WM5A 2VGXA 1DNPA 3RRMB 2MYOA 4QQIA 3DPYA 3SQVA 2P9IG 4C48B 4I9EA 4CCAA 4DLQA 2LUHA 3UMVA 3O48A 5CBOA 3ASNE 4I1AA 3B7TA 3FUMA 2ZISA 4JA9A 2XZDG 2YINA 3TL5A 4GZ6A 3EIQC 3TG4A 3EHQA 4J8EA 5CRVA 2I9CA 4KVMA 5JHAA 2CHXA 3UT4A 4GTOA 2V5QC 2E2EA 4LSZE 3E32A 2WMNA 2UWJG 4V3IA 4ZHBA 2KC7A 3ZXSA 4O1OA 3CK8A 5E75A 2F0YA 2I1JA 1JWGA 1S70B 3ZIMA 1UW4B 5CRUA 3APFA 4HOTA 4EPZA 4CDNA 5A6CA 4GMRA 2DYSE 3ASDA 3D9LA 4MBGA 3BG1B 3L16A 5CMWA 4GTVA 3BUAA 3HXBA 3SBTB 3CKBA 3E33A 5KJMA 1DCQA 3PNLB 3RIBA 1UJJA 4J7WA 4J8DA 4J0UA 3R7QA 4Y6WA 1H6KA 1SQMA 1A5EA 4L2LA 4UWFA 3FTSA 1OXJA 4URKA 4PH4B 3CIAA 5AARA 1OWLA 3Q15A 3HVEB 1UG3A 3EHMA 4UI9K 2I2OA 3SNXA 2WXJA 2J08A 4HORA 2R2LA 4X8QA 1N9AA 5FQ8A 3ABME 2XCCA 4ILIA 4J6IA 4YDEA 2V4LA 1MX4A 4I2ZA 3UX4A 4I17A 3QWWA 3D9NA 2PZIA 5KWDA 3ASHA 4KXKB 2L9BA 2Y0BG 2XCBA 4HLLA 4QFVA 3KEZA 2WB2A 3HDXA 1N11A 2LXLA 2ZGDA 4XKCA 1IKND 3S7DA 1ELKA 1BPOA 4EBAA 1H6OA 2EIJE 3ZYLA 1N4SA 4LCTA 4UI9C 5ENNA 3UIPC 3KSQA 5KBAA 1HF8A 3FH7A 2WVIA 4XZ4A 3ENEA 1HE8A 3NOGD 4J8SA 3MYVA 2H6GA 4B8CB 4GMJA 1SZ9A 2WXOA 3ML8A 3C5RA 2GRPB 2MOWA 3RU0A 3UKUG 1V55E 3ONKA 4GTSA 4HXIA 4JD2G 3PE3A 5G55A 4U0ZA 4CEMA 3LDZA 4N5CA 2WPVA 4UI9J 3GYZA 4N2QA 2FEZA 3S7BA 4WNEA 3FUFA 3TWRA 3BU8A 3MGBA 2H6HA 1SA4A 3TJPA 3S7FA 1MQSA 3VLEA 4CRWA 3SY2A 3UUXA 3ZW3A 3HXEA 3SFYA 4GYWA 5FQ6A 1OY3D 1LF8A 1U3DA 3B7BA 4LUNU 4JHJA 2YHCA 4Y6CA 4NQ0A 4LEUA 2VSNA 2AVPA 5LCWC 4MRUA 2IOLA 3LVQE 3U64A 4LNUD 4XI9A 2E0IA 3SFZA 3V30A 1YYHA 3LXUX 3OXLA 2WXKA 1G3NB 4XKBA 1EPUA 2WXNA 4GA1A 4KVOA 3QKYA 4R7LA 3ZUVB 3FTXA 4E6HA 4FC8A 4N3AA 5CEAA 1UN9A 3SO8A 3CGHA 3UM3A 4U63A 4FADA 2HYZA 3APCA 3NBNB 5HKPA 4WNDA 5J90A 4HNAD 5FIOA 5ITZF 3MJWA 1HZ4A 5LX8A 4GTQA 2VTBA 2KZTA 1JCSA 4I9CA 1KLXA 5BPPA 3T9KA 3GZ1A 5FT9A 3CVLA 3JQ0A 3CHSA 4HBDA 5LFAA 4XI0A 2XPYA 2X6IA 3DXMG 5AIJA 4UWHA 3FH5A 4GTTA 2Q7FA 2NXPA 3DXKG 3GZ2A 2BF0X 2J4DA 1O1SA 2NSZA 5FZRA 3C3QA 1Z3YA 4YDOA 3ZPJA 4GPKA 4JC8A 5HI7A 1IXVA 3NF1A 4BEPA 3FFLA 4CGVA 1E8YA 2A4ZA 2OVBA 4BFRA 4O6FA 3QOUA 5G04C 2RKKA 5B1AE 1IHGA 2GGFA 3PUKA 1TNZA 2MRIA 1N4RA 1D8DA 1TJCA 2B6CA 2EINE 3ABKE 3TWUA 3ZN3A 2B0OE 1N52A 4WWOA 3ZVVA 4WWNA 4I2WA 5HS0A 3HYMB 3D9MA 4LG6A 4FULA 2YNQA 5AQ7A 5AYWD 4K0RA 3IXEA 4F1SA 3T8MA 2EIKE 2QC9A 1QBQA 2AXUA 3ULQA 3S2AA 4EHMA 3TWTA 3G2TA 2ETCA 2DZNA 2ETBA 4GCOA 3T5VA 4FU3A 1WY6A 5BUZA 4L9PA 3LY9A 4KBQA 1HX8A 4BT9A 2XGSA 1UJKA 5KCMA 3NZUA 2WXQA 4CT0A 3ISMC 5G05J 3G2UA 4I1MA 4UWKA 3G2WA 4U8YD 3MEKA 3UTMA 2QZAA 4GYYA 1A17A 3KSLA 4RLYA 2KBXA 4PS7A 4UUCA 2AWIA 3NOCD 1E8WA 3MV2B 3Q9UC 1K8KG 3QK0A 5CECB 4BERA 5EN5D 2F37A 3SBSA 4TXRA
chains in the Genus database with same CATH topology
4OAUC 1TR4A 4J8YA 2L6BA 3ZUVB 4DRXE 5EYLA 4DX1A 1MJ0A 1WDYA 4K5CA 5CEAA 1N0RA 3EHRA 5AQAA 5CERB 2XZTG 4GMRA 5ENPD 2XENA 1IHBA 3TWUA 4HRMB 4DX7D 4YDWA 2AJAA 2Y1LE 3SO8A 3C5RA 3TWXA 2B0OE 4O60A 3UXGA 1BU9A 3TWWA 1AP7A 2F8XK 3NBNB 5HKPA 4OAVB 2A5EA 4B93B 1BD8A 2ETAA 4HNAD 1SVXA 5FIOA 5HS0A 5ITZF 4LG6A 1BI7B 3JXIA 4HRLA 4U95D 1YCSB 1MYOA 1QYMA 2DVWA 3J5QB 5EILA 1DCQA 5FINA 5JMND 2DWZA 1N0QA 4J7WA 2J8SD 3Q9NC 5EYPF 5BXOA 5HRYA 5AQ7A 2RFAA 3ZNGA 4DX2A 4F6RD 2MYOA 1WG0A 1K1AA 4TUMA 1A5EA 2BKGA 3T9KA 4QQIA 3EU9A 4JB8P 3IXEA 4ZFHA 4A63B 2QYJA 2QC9A 4K5AB 4BSZB 4C48B 3TWRA 2XEHA 5AARA 4HBDA 4HRNA 3TWTA 2ETCA 1YMPA 2DZNA 1K1BA 1MX2A 5KNGA 4DX6D 2NYJA 3ZU7B 5ENQD 3D9HA 2ETBA 5D66A 5ENOD 5AQBA 5ENRD 5CBOA 2V4HC 3AAAC 5BXUA 4G8KA 3F6QA 1SW6A 4U96D 3W9GA 4HQDA 3KEAA 4K5BA 3V2OA 2ZGGA 3TWSA 4ATZD 4CYMD 5AQ9A 4DUIA 2XZDG 1MX4A 3ZKJA 3T8KA 4Z68A 3LJNA 3JXJA 4HI9A 1NFIE 4HB5A 3V31A 1OY3D 5CBNA 5KWDA 3EHQA 5CEDB 5EIBE 3UI2A 3B7BA 4G8LA 3TWVA 5AN8A 4U8YD 3AJIA 2Y0BG 3UTMA 3V2XA 4HLLA 4N5QA 2KXPC 2BKKB 5ENTD 4QFVA 2RFMA 5KNHD 3JUEA 3B95A 4BESA 4RLYA 2V5QC 4LSZE 4GPMA 2KBXA 4YDYA 1N11A 1OT8A 2ZGDA 4F1PA 2P2CP 1IKND 4ZHBA 2PNNA 3V79K 4UUCA 1K3ZD 2FO1E 3J5PA 1D9SA 1BI8B 1IXVA 4BEPA 1UOHA 3NOCD 2HE0A 4LNUD 4O1OA 3TWQA 1MX6A 3DEOA 3HRAA 5AAOA 3HG0D 1DC2A 3V30A 4CZ2D 1YYHA 4U8VD 4NIKA 5KBAA 1AWCB 2VGEA 1BLXB 1G3NB 3Q9UC 4DX5D 3NOGD 4BETA 5ENSD 2F8YA 5JA4D 5CECB 3W9FA 1S70B 2DZOA 3DEPA 4BERA 5EN5D 2F37A 2JABA 2XEEA 4HI8A 4O1PA 5EIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAU C;  1TR4 A;  4J8Y A;  2L6B A;  3ZUV B;  4DRX E;  5EYL A;  4DX1 A;  1MJ0 A;  1WDY A;  4K5C A;  5CEA A;  1N0R A;  3EHR A;  5AQA A;  5CER B;  2XZT G;  4GMR A;  5ENP D;  2XEN A;  1IHB A;  3TWU A;  4HRM B;  4DX7 D;  4YDW A;  2AJA A;  2Y1L E;  3SO8 A;  3C5R A;  3TWX A;  2B0O E;  4O60 A;  3UXG A;  1BU9 A;  3TWW A;  1AP7 A;  2F8X K;  3NBN B;  5HKP A;  4OAV B;  2A5E A;  4B93 B;  1BD8 A;  2ETA A;  4HNA D;  1SVX A;  5FIO A;  5HS0 A;  5ITZ F;  4LG6 A;  1BI7 B;  3JXI A;  4HRL A;  4U95 D;  1YCS B;  1MYO A;  1QYM A;  2DVW A;  3J5Q B;  5EIL A;  1DCQ A;  5FIN A;  5JMN D;  2DWZ A;  1N0Q A;  4J7W A;  2J8S D;  3Q9N C;  5EYP F;  5BXO A;  5HRY A;  5AQ7 A;  2RFA A;  3ZNG A;  4DX2 A;  4F6R D;  2MYO A;  1WG0 A;  1K1A A;  4TUM A;  1A5E A;  2BKG A;  3T9K A;  4QQI A;  3EU9 A;  4JB8 P;  3IXE A;  4ZFH A;  4A63 B;  2QYJ A;  2QC9 A;  4K5A B;  4BSZ B;  4C48 B;  3TWR A;  2XEH A;  5AAR A;  4HBD A;  4HRN A;  3TWT A;  2ETC A;  1YMP A;  2DZN A;  1K1B A;  1MX2 A;  5KNG A;  4DX6 D;  2NYJ A;  3ZU7 B;  5ENQ D;  3D9H A;  2ETB A;  5D66 A;  5ENO D;  5AQB A;  5ENR D;  5CBO A;  2V4H C;  3AAA C;  5BXU A;  4G8K A;  3F6Q A;  1SW6 A;  4U96 D;  3W9G A;  4HQD A;  3KEA A;  4K5B A;  3V2O A;  2ZGG A;  3TWS A;  4ATZ D;  4CYM D;  5AQ9 A;  4DUI A;  2XZD G;  1MX4 A;  3ZKJ A;  3T8K A;  4Z68 A;  3LJN A;  3JXJ A;  4HI9 A;  1NFI E;  4HB5 A;  3V31 A;  1OY3 D;  5CBN A;  5KWD A;  3EHQ A;  5CED B;  5EIB E;  3UI2 A;  3B7B A;  4G8L A;  3TWV A;  5AN8 A;  4U8Y D;  3AJI A;  2Y0B G;  3UTM A;  3V2X A;  4HLL A;  4N5Q A;  2KXP C;  2BKK B;  5ENT D;  4QFV A;  2RFM A;  5KNH D;  3JUE A;  3B95 A;  4BES A;  4RLY A;  2V5Q C;  4LSZ E;  4GPM A;  2KBX A;  4YDY A;  1N11 A;  1OT8 A;  2ZGD A;  4F1P A;  2P2C P;  1IKN D;  4ZHB A;  2PNN A;  3V79 K;  4UUC A;  1K3Z D;  2FO1 E;  3J5P A;  1D9S A;  1BI8 B;  1IXV A;  4BEP A;  1UOH A;  3NOC D;  2HE0 A;  4LNU D;  4O1O A;  3TWQ A;  1MX6 A;  3DEO A;  3HRA A;  5AAO A;  3HG0 D;  1DC2 A;  3V30 A;  4CZ2 D;  1YYH A;  4U8V D;  4NIK A;  5KBA A;  1AWC B;  2VGE A;  1BLX B;  1G3N B;  3Q9U C;  4DX5 D;  3NOG D;  4BET A;  5ENS D;  2F8Y A;  5JA4 D;  5CEC B;  3W9F A;  1S70 B;  2DZO A;  3DEP A;  4BER A;  5EN5 D;  2F37 A;  2JAB A;  2XEE A;  4HI8 A;  4O1P A;  5EID A; 
#chains in the Genus database with same CATH topology
 1HG5 A;  3O4Z A;  4GB9 A;  2XZT G;  1IHB A;  4UQY A;  3OTN A;  1O5M A;  3SGH A;  2J9Q A;  4HRL A;  1YCS B;  5EIL A;  5FIN A;  2YHE A;  4TXQ A;  4AY6 A;  1N0Q A;  3FEX A;  3QAQ A;  1E8Z A;  4CGW A;  3RO3 A;  3FUK A;  5H7P A;  2ZXW E;  3PS6 A;  2UY1 B;  4HRN A;  3CVU A;  3ZEF A;  3ZU7 B;  4AIF A;  4C9B B;  5EDS A;  1LD7 A;  3ESK A;  3RAU A;  2OEW A;  4XEI G;  4K5B A;  4UQX A;  5CHE E;  3ASO E;  1D8E A;  1TEZ A;  2EQX A;  4N3C A;  3LJN A;  3L54 A;  4HI9 A;  1NFI E;  3IV0 A;  4HB5 A;  3AG1 E;  3RRU A;  1U3C A;  5BW8 C;  4Q94 A;  5C2Y A;  2Y4U A;  1OWP A;  1H0A A;  1RZ4 A;  3V2X A;  3QWV A;  3R9M A;  2J4B A;  3PRE A;  3DSX A;  3AG2 E;  2FO1 E;  2V5F A;  4ME2 A;  2HE0 A;  3DPD A;  1JCR A;  4WNF A;  1MX6 A;  1P5Q A;  2CFU A;  3MA5 A;  4FHJ A;  3MV3 B;  3SZ7 A;  4AP2 A;  3FU0 A;  3OXG A;  3LEW A;  5D2M C;  4AJW A;  3MKQ B;  4TV3 A;  2F8Y A;  3UM0 A;  2DZO A;  3DEP A;  4GML A;  4HI8 A;  4OAU C;  2LNI A;  4J8F A;  2EIM E;  3TWX A;  4WNG A;  3LY8 A;  4BX9 A;  4G26 A;  2FBN A;  3ONL A;  1TYQ G;  4B93 B;  5FZQ A;  3CHQ A;  1IQR A;  2C2L A;  5KJK A;  3UM2 A;  3IBE A;  3I5P A;  2WM9 A;  2XS1 A;  2IO2 C;  3HVE A;  1WG0 A;  1FVF A;  2VSO E;  4GA0 A;  3ESL A;  4KMO A;  3PZ4 A;  2GRO B;  4MLP A;  3ASF A;  4YVO A;  4G8K A;  4HS2 A;  3JQ1 A;  4U96 D;  1W3B A;  4UQZ A;  4JPS A;  4K03 A;  3B7S A;  4FLH A;  4ANU A;  1TNY A;  4KT6 B;  4DUI A;  3T8K A;  2QYU A;  1O1T A;  2XPZ A;  4FLB A;  5T4Y A;  4PS3 A;  3UKR G;  5CMY A;  2CG3 A;  3L22 A;  2KCV A;  1S63 A;  4ANX A;  4G2V A;  5ENT D;  4DLO A;  3E30 A;  3TAX A;  5ANL A;  2Y4T A;  1QNF A;  3RK6 A;  1X81 A;  3HG0 D;  2Y3A A;  4JEU A;  2VSX E;  4GZ5 A;  3PEU B;  4CT4 A;  4EQF A;  1TN6 A;  3S7J A;  3ASG A;  5ENS D;  5ENP D;  5EYL A;  4YND A;  2GW1 A;  4HOU A;  2XEN A;  1DCE A;  2DIW A;  4HOQ A;  4G24 A;  3FUD A;  3PZ2 A;  1HU3 A;  4OAV B;  2ETA A;  1UN8 A;  1SVX A;  4RSY A;  3UQ3 A;  2HO1 A;  1NI1 A;  3PE4 A;  4FA6 A;  4AV7 A;  2P58 C;  2IEJ A;  3EUV A;  1OCR E;  3EU9 A;  5FTP A;  3G2V A;  4ZFH A;  1HXI A;  1KZP A;  2BED A;  5AJL A;  3FUL A;  5EX3 A;  3VLF A;  2RG8 A;  1KZO A;  3LCA A;  4BX8 A;  1E96 B;  2L0T B;  1YMP A;  3FEY A;  3Q7A A;  4G23 A;  1JCQ A;  2IO3 C;  4KZ0 A;  1ELW A;  2GRM A;  2ZGG A;  1B89 A;  1QQE A;  3MCX A;  2GRQ B;  3DWL G;  3EHN A;  5LOZ A;  3MZL B;  4L2Y A;  3SF4 A;  4PS8 A;  3AJI A;  2VYI A;  3B95 A;  2P9K G;  4WWP A;  1Z6T A;  3ZYK A;  1FT1 A;  4JZY A;  3CST A;  2LSV A;  2CG2 A;  4M3O A;  3J5P A;  4UWL A;  1XNF A;  3QWP A;  3TWQ A;  4L7T A;  3FY4 A;  4I6E A;  2VGE A;  4AEZ C;  3FWV A;  3K9I A;  3CHO A;  2LSU A;  2ZU6 B;  4K5C A;  3D9I A;  4DK5 A;  2PQN A;  1KPS B;  4U7E B;  3UXG A;  3ULE G;  1S0P A;  1TNU A;  2CHZ A;  3WG7 E;  4N3B A;  3SI5 A;  3CEQ A;  2VJ8 A;  1Z3X A;  2ILR A;  1BI7 B;  2IU1 A;  4ACK A;  5D0Q D;  2VGY A;  2DYR E;  3Q9N C;  3NZS A;  2RFA A;  3CHM A;  5DIZ A;  2PQR A;  2X6H A;  3KD7 A;  4GTM A;  3U66 A;  2R5S A;  3AG3 E;  2R02 A;  4BSZ B;  5KJL A;  1KT1 A;  3L9T A;  5KNG A;  2P9S G;  3OXF A;  2JEK A;  2OV8 A;  4HQD A;  3V2O A;  2M63 A;  3Q5M A;  3HXD A;  5LP0 A;  2PM6 A;  5B3S E;  1U2V G;  3L82 A;  3P2B A;  3IHV A;  3Q7F A;  3NAW A;  4G8L A;  3CVY A;  2P9L G;  3FTV A;  2QFC A;  2P9U G;  2KXP C;  2BKK B;  2RFM A;  5KNH D;  3JUE A;  1ZBP A;  4DI3 A;  1OT8 A;  4LER A;  3PZ1 A;  5AAO A;  1NZN A;  2GRL A;  1VDY A;  4JW1 A;  4Q96 A;  3DSW A;  4AM9 A;  4EZL A;  3UIO C;  3RO2 A;  3R7R A;  4IYP A;  3U4T A;  5CER B;  5AQA A;  4G11 A;  3UT8 A;  1MHQ A;  4CDR A;  3MX3 A;  3EIJ A;  2VTB B;  2KZT B;  2FUL A;  3Q49 B;  1RW2 A;  4EZK A;  3GW4 A;  2P9N G;  3JXI A;  1MYO A;  3RSE G;  3J5Q B;  5JMN D;  2KAT A;  2DWZ A;  1JUQ A;  3N71 A;  1FVH A;  2WQ7 A;  3PRZ A;  3L08 A;  3L13 A;  5G05 C;  3UPV A;  3FUE A;  3L6A A;  3ZFW A;  1K1B A;  3AS5 A;  3FH8 A;  4DX6 D;  3L17 A;  5D66 A;  5AQB A;  2WXR A;  2WXP A;  4F7A A;  3JYS A;  3G2S A;  5FZS A;  3ZYM A;  2KCL A;  2PL2 A;  2AXV A;  4ILG A;  2P9P G;  2XGM A;  2A5U A;  3D9J A;  3I4R B;  5FQ4 A;  3U3W A;  1OCC E;  3V31 A;  2R17 C;  3CQC B;  3PVL A;  4N5Q A;  4MS6 A;  3IEG A;  5E76 A;  3ZYQ A;  3D3M A;  4XIF A;  4U07 A;  2LAH A;  4F53 A;  2Y69 E;  4RVB A;  3LPZ A;  3PZ3 A;  3ULY A;  4CZ2 D;  1NA0 A;  3CVP A;  4NIK A;  4KYO B;  3CR3 A;  4WUY A;  4I6G A;  3C3R A;  2X3M A;  5FQ7 A;  1OWO A;  2DBA A;  4JXT A;  3ZHE A;  3B7U X;  1OUV A;  1HS6 A;  3KAE A;  1EDU A;  2CFZ A;  4PUC A;  2J8S D;  5EYP F;  4FJZ A;  2UY1 A;  2PM7 A;  3UT7 A;  3FDH A;  3HHM A;  4TUM A;  1OCZ E;  5IY5 E;  5M72 A;  5KJN A;  3D9P A;  4A1S A;  3PNT B;  4LNG A;  4BT8 A;  3LVR E;  3RRN B;  1V54 E;  3AAA C;  3F6Q A;  3W9G A;  2IQC A;  3EU5 A;  4G1T A;  4Z68 A;  1TJF A;  3FP3 A;  5EIB E;  2H6F A;  3TWV A;  4BES A;  5EX0 A;  4EZJ A;  4EBA G;  3DSS A;  2P2C P;  1K3Z D;  2OND A;  3Q4A B;  4GCN A;  3HRA A;  2J09 A;  2GRN B;  1MZC A;  5JJ7 A;  4NAC A;  1Z5S C;  1EYH A;  4WAF A;  4H7Y A;  3HIZ A;  5A7D B;  4BET A;  1FT2 A;  3FUI A;  5D0O D;  3ZRH A;  4ABN A;  1X5B A;  1MJ0 A;  3CK9 A;  5BV0 A;  4IN3 B;  4O60 A;  2XHE A;  1PC2 A;  4LRZ A;  2FF4 A;  2F8X K;  3JCK C;  2OVF A;  1Y6I A;  2A5E A;  3D9O A;  4ACL A;  4XX5 A;  3Q75 A;  4DJA A;  3BEE A;  1HH8 A;  1HO8 A;  4N39 A;  3FU6 A;  2GRR B;  1TNO A;  4FP7 A;  5BXO A;  5EKQ D;  1K1A A;  1HFA A;  4ATG A;  1N94 A;  3HXF A;  1HG2 A;  2RD0 A;  2VGX B;  3QDN A;  4TXP A;  1IYG A;  3IHY A;  4B0Z A;  2IJG X;  4B8A A;  3QAR A;  3B7R L;  5DBK A;  3DSV A;  2XQ0 A;  4APF A;  2BUG A;  1FCH A;  4I6J A;  5CBN A;  3UI2 A;  3FTY A;  2IY0 C;  1E7V A;  3LY7 A;  4YDY A;  2FO7 A;  3OAW A;  5A23 A;  4GTR A;  1JPL A;  3P1U A;  2L6J A;  2LAI A;  4JHK A;  2HR2 A;  2XEE A;  4ILH B;  3C72 A;  2WQ6 A;  3QJZ A;  3EDT B;  4DRX E;  1SA5 A;  2X6K A;  4HRM B;  3NB2 A;  5C1D A;  2XGO A;  3TWW A;  1AP7 A;  5ANR A;  2XRY A;  1PY1 A;  4B94 A;  2WQH A;  4L23 A;  2DVW A;  1YA0 A;  4A3V A;  3R9A B;  3CVN A;  5CCL A;  4I1O B;  2WXM A;  2OOE A;  4F6R D;  5HQ8 A;  5AEN A;  1WAO 1;  4BWR A;  3URZ A;  2BKG A;  1KT0 A;  2OCC E;  3RKV A;  3MKR A;  3E4B A;  1Y8M A;  2QYJ A;  4K5A B;  3I3N A;  1MX2 A;  3NQP A;  2NYJ A;  5ARF A;  5BXU A;  4ANW A;  1SW6 A;  2XS8 A;  4FJY A;  4OYS A;  4JL0 A;  4XE0 A;  4PDX A;  4GZC A;  3TXN A;  4ATZ D;  4CYM D;  5AQ9 A;  3SD5 A;  2WXI A;  4IRU A;  1EF1 C;  3VTY A;  5AN8 A;  4U8H A;  1SZA A;  1N4P A;  4EEC A;  2X38 A;  3CLJ A;  3CSF A;  3KS2 A;  4F1P A;  2PNN A;  2X6F A;  1LTX A;  4HFG A;  5T3R A;  1UOH A;  5JHB A;  3PEV B;  3TG5 A;  3BG0 B;  2J49 A;  4U8V D;  3VTX A;  3C98 A;  3Q47 B;  3I4G A;  1E90 A;  5JA4 D;  1INZ A;  2JAB A;  3FUJ A;  1L5J A;  4O1P A;  4BSX A;  4AVX A;  2I1K A;  2WXH A;  2C0L A;  4DX7 D;  4DPR A;  4YDW A;  1ELR A;  4G25 A;  2JLB A;  3FHE A;  4RG6 A;  4GYO A;  4DI4 A;  2ION A;  1O1R A;  3D9K A;  2I6H A;  3QC1 A;  3AU4 A;  3Q79 A;  1TNB A;  4L1B A;  3ZNG A;  4DX2 A;  1PAQ A;  2XEV A;  4AXH A;  3CVX A;  1LD8 A;  4AOF A;  2VQ2 A;  2XPI A;  4HLE A;  5ARG A;  3PZD A;  1ZB1 A;  3DRA A;  3AS8 A;  2H6I A;  1XGW A;  3PUJ A;  4A55 A;  4OVU A;  5B1B E;  4A3T A;  3SHF A;  2LXM A;  3AG4 E;  4BTA A;  3V79 K;  3DBS A;  2AXZ A;  1S64 A;  4IUL A;  3DEO A;  1H19 A;  1DC2 A;  1H2V C;  4P29 A;  2AW6 A;  2YQ8 A;  2ZIR A;  3FU5 A;  2BTD A;  3AU5 A;  3QNK A;  1AWC B;  1BLX B;  4DX5 D;  4A1G A;  1GW6 A;  2L0I A;  4BTB A;  1QZ2 A;  4TUU A;  5LCW J;  2R03 A;  1TR4 A;  5JJ6 A;  4GZD A;  3EHR A;  2IOS A;  4ANV A;  2AJA A;  1BU9 A;  3CQG B;  2WXG A;  2V8S E;  1N54 A;  1H2U A;  4U0U A;  5FWQ A;  4U95 D;  1QYM A;  3GZS A;  2EIL E;  4JA7 A;  1ZU2 A;  4NUR A;  3LYA A;  5HRY A;  2KCK A;  2R05 A;  4JB8 P;  3TXM A;  3FTU A;  5AJD A;  3AS4 A;  4U0S A;  3FUN A;  1NA3 A;  2WXL A;  2IFU A;  4M7C A;  5ENQ D;  3D9H A;  2V4H C;  3ZGQ A;  2WMO A;  1OWM A;  3E37 A;  3BQO A;  5BNW A;  4W9R A;  3QB2 A;  2J07 A;  3ZKJ A;  4LNB A;  2LO6 A;  5G2N A;  3X2Q E;  3UM1 A;  4TRQ A;  3RJV A;  4HOS A;  3LS8 A;  5J08 A;  1OWN A;  3CHR A;  4HVB A;  1IQU A;  2R59 A;  4F3V A;  4GPM A;  5BV1 A;  3ABL E;  1D9S A;  4RG9 A;  3Q78 A;  2V0P A;  1TN8 A;  3ZXP A;  4MKT A;  4UWG A;  3CKC A;  4FHK A;  2NC9 A;  3W9F A;  3CK7 A;  1Q2Z A;  4J8Y A;  1NL4 A;  2L6B A;  1WDY A;  4APO A;  4GU5 A;  4YVQ C;  4KZC A;  3CVV A;  5G04 J;  2VSY A;  4CDM A;  3FUH A;  4H7X A;  4E85 A;  3LJ3 A;  4C0E A;  1NP7 A;  3CHP A;  3C3O A;  2QY7 A;  3HXC A;  4RQI A;  4A63 B;  2FI7 A;  3CV0 A;  2XEH A;  3T5X A;  1E8X A;  1H6P A;  1OCO E;  5ENO D;  1TN7 A;  2HM8 A;  5ENR D;  4U04 A;  4BY6 A;  4I43 A;  1DVP A;  4GAA A;  4N2S A;  4JVS A;  3KEA A;  3ML9 A;  5FJY A;  2DCP A;  3TWS A;  2MHK A;  3EJN A;  4GA2 A;  3E34 A;  3UIN C;  3PDN A;  4Q69 A;  3JXJ A;  1N95 A;  5CED B;  3FU3 A;  2C0M A;  3WXX A;  2OEV A;  4B89 A;  1H2T C;  2XRZ A;  4JEH A;  1BI8 B;  1N4Q A;  4D10 C;  2CHW A;  4OVV A;  1E7U A;  3TGO A;  3U9W A;  4GZ3 A;  3VLD A;  3DSU A;  2X6J A;  5JJT A;  3Q73 A;  4JHR A;  3ZHE B;  3APD A;  3IKO B;  3LKU A;  5EID A;  4DX1 A;  3FTW A;  3SFX A;  1N0R A;  4AY5 A;  3MKQ A;  2Y1L E;  3FTZ A;  5CCM A;  3B13 A;  1JWF A;  3PH0 C;  3CVW A;  2WXF A;  3CVQ A;  1BD8 A;  4NRH B;  4GTP A;  3DST A;  5T8I A;  3JUI A;  5BT1 A;  4C0M A;  2IF4 A;  2KM4 A;  1FPP A;  1WM5 A;  2VGX A;  1DNP A;  3RRM B;  2MYO A;  4QQI A;  3DPY A;  3SQV A;  2P9I G;  4C48 B;  4I9E A;  4CCA A;  4DLQ A;  2LUH A;  3UMV A;  3O48 A;  5CBO A;  3ASN E;  4I1A A;  3B7T A;  3FUM A;  2ZIS A;  4JA9 A;  2XZD G;  2YIN A;  3TL5 A;  4GZ6 A;  3EIQ C;  3TG4 A;  3EHQ A;  4J8E A;  5CRV A;  2I9C A;  4KVM A;  5JHA A;  2CHX A;  3UT4 A;  4GTO A;  2V5Q C;  2E2E A;  4LSZ E;  3E32 A;  2WMN A;  2UWJ G;  4V3I A;  4ZHB A;  2KC7 A;  3ZXS A;  4O1O A;  3CK8 A;  5E75 A;  2F0Y A;  2I1J A;  1JWG A;  1S70 B;  3ZIM A;  1UW4 B;  5CRU A;  3APF A;  4HOT A;  4EPZ A;  4CDN A;  5A6C A;  4GMR A;  2DYS E;  3ASD A;  3D9L A;  4MBG A;  3BG1 B;  3L16 A;  5CMW A;  4GTV A;  3BUA A;  3HXB A;  3SBT B;  3CKB A;  3E33 A;  5KJM A;  1DCQ A;  3PNL B;  3RIB A;  1UJJ A;  4J7W A;  4J8D A;  4J0U A;  3R7Q A;  4Y6W A;  1H6K A;  1SQM A;  1A5E A;  4L2L A;  4UWF A;  3FTS A;  1OXJ A;  4URK A;  4PH4 B;  3CIA A;  5AAR A;  1OWL A;  3Q15 A;  3HVE B;  1UG3 A;  3EHM A;  4UI9 K;  2I2O A;  3SNX A;  2WXJ A;  2J08 A;  4HOR A;  2R2L A;  4X8Q A;  1N9A A;  5FQ8 A;  3ABM E;  2XCC A;  4ILI A;  4J6I A;  4YDE A;  2V4L A;  1MX4 A;  4I2Z A;  3UX4 A;  4I17 A;  3QWW A;  3D9N A;  2PZI A;  5KWD A;  3ASH A;  4KXK B;  2L9B A;  2Y0B G;  2XCB A;  4HLL A;  4QFV A;  3KEZ A;  2WB2 A;  3HDX A;  1N11 A;  2LXL A;  2ZGD A;  4XKC A;  1IKN D;  3S7D A;  1ELK A;  1BPO A;  4EBA A;  1H6O A;  2EIJ E;  3ZYL A;  1N4S A;  4LCT A;  4UI9 C;  5ENN A;  3UIP C;  3KSQ A;  5KBA A;  1HF8 A;  3FH7 A;  2WVI A;  4XZ4 A;  3ENE A;  1HE8 A;  3NOG D;  4J8S A;  3MYV A;  2H6G A;  4B8C B;  4GMJ A;  1SZ9 A;  2WXO A;  3ML8 A;  3C5R A;  2GRP B;  2MOW A;  3RU0 A;  3UKU G;  1V55 E;  3ONK A;  4GTS A;  4HXI A;  4JD2 G;  3PE3 A;  5G55 A;  4U0Z A;  4CEM A;  3LDZ A;  4N5C A;  2WPV A;  4UI9 J;  3GYZ A;  4N2Q A;  2FEZ A;  3S7B A;  4WNE A;  3FUF A;  3TWR A;  3BU8 A;  3MGB A;  2H6H A;  1SA4 A;  3TJP A;  3S7F A;  1MQS A;  3VLE A;  4CRW A;  3SY2 A;  3UUX A;  3ZW3 A;  3HXE A;  3SFY A;  4GYW A;  5FQ6 A;  1OY3 D;  1LF8 A;  1U3D A;  3B7B A;  4LUN U;  4JHJ A;  2YHC A;  4Y6C A;  4NQ0 A;  4LEU A;  2VSN A;  2AVP A;  5LCW C;  4MRU A;  2IOL A;  3LVQ E;  3U64 A;  4LNU D;  4XI9 A;  2E0I A;  3SFZ A;  3V30 A;  1YYH A;  3LXU X;  3OXL A;  2WXK A;  1G3N B;  4XKB A;  1EPU A;  2WXN A;  4GA1 A;  4KVO A;  3QKY A;  4R7L A;  3ZUV B;  3FTX A;  4E6H A;  4FC8 A;  4N3A A;  5CEA A;  1UN9 A;  3SO8 A;  3CGH A;  3UM3 A;  4U63 A;  4FAD A;  2HYZ A;  3APC A;  3NBN B;  5HKP A;  4WND A;  5J90 A;  4HNA D;  5FIO A;  5ITZ F;  3MJW A;  1HZ4 A;  5LX8 A;  4GTQ A;  2VTB A;  2KZT A;  1JCS A;  4I9C A;  1KLX A;  5BPP A;  3T9K A;  3GZ1 A;  5FT9 A;  3CVL A;  3JQ0 A;  3CHS A;  4HBD A;  5LFA A;  4XI0 A;  2XPY A;  2X6I A;  3DXM G;  5AIJ A;  4UWH A;  3FH5 A;  4GTT A;  2Q7F A;  2NXP A;  3DXK G;  3GZ2 A;  2BF0 X;  2J4D A;  1O1S A;  2NSZ A;  5FZR A;  3C3Q A;  1Z3Y A;  4YDO A;  3ZPJ A;  4GPK A;  4JC8 A;  5HI7 A;  1IXV A;  3NF1 A;  4BEP A;  3FFL A;  4CGV A;  1E8Y A;  2A4Z A;  2OVB A;  4BFR A;  4O6F A;  3QOU A;  5G04 C;  2RKK A;  5B1A E;  1IHG A;  2GGF A;  3PUK A;  1TNZ A;  2MRI A;  1N4R A;  1D8D A;  1TJC A;  2B6C A;  2EIN E;  3ABK E;  3TWU A;  3ZN3 A;  2B0O E;  1N52 A;  4WWO A;  3ZVV A;  4WWN A;  4I2W A;  5HS0 A;  3HYM B;  3D9M A;  4LG6 A;  4FUL A;  2YNQ A;  5AQ7 A;  5AYW D;  4K0R A;  3IXE A;  4F1S A;  3T8M A;  2EIK E;  2QC9 A;  1QBQ A;  2AXU A;  3ULQ A;  3S2A A;  4EHM A;  3TWT A;  3G2T A;  2ETC A;  2DZN A;  2ETB A;  4GCO A;  3T5V A;  4FU3 A;  1WY6 A;  5BUZ A;  4L9P A;  3LY9 A;  4KBQ A;  1HX8 A;  4BT9 A;  2XGS A;  1UJK A;  5KCM A;  3NZU A;  2WXQ A;  4CT0 A;  3ISM C;  5G05 J;  3G2U A;  4I1M A;  4UWK A;  3G2W A;  4U8Y D;  3MEK A;  3UTM A;  2QZA A;  4GYY A;  1A17 A;  3KSL A;  4RLY A;  2KBX A;  4PS7 A;  4UUC A;  2AWI A;  3NOC D;  1E8W A;  3MV2 B;  3Q9U C;  1K8K G;  3QK0 A;  5CEC B;  4BER A;  5EN5 D;  2F37 A;  3SBS A;  4TXR A; 
#chains in the Genus database with same CATH homology
 4OAU C;  1TR4 A;  4J8Y A;  2L6B A;  3ZUV B;  4DRX E;  5EYL A;  4DX1 A;  1MJ0 A;  1WDY A;  4K5C A;  5CEA A;  1N0R A;  3EHR A;  5AQA A;  5CER B;  2XZT G;  4GMR A;  5ENP D;  2XEN A;  1IHB A;  3TWU A;  4HRM B;  4DX7 D;  4YDW A;  2AJA A;  2Y1L E;  3SO8 A;  3C5R A;  3TWX A;  2B0O E;  4O60 A;  3UXG A;  1BU9 A;  3TWW A;  1AP7 A;  2F8X K;  3NBN B;  5HKP A;  4OAV B;  2A5E A;  4B93 B;  1BD8 A;  2ETA A;  4HNA D;  1SVX A;  5FIO A;  5HS0 A;  5ITZ F;  4LG6 A;  1BI7 B;  3JXI A;  4HRL A;  4U95 D;  1YCS B;  1MYO A;  1QYM A;  2DVW A;  3J5Q B;  5EIL A;  1DCQ A;  5FIN A;  5JMN D;  2DWZ A;  1N0Q A;  4J7W A;  2J8S D;  3Q9N C;  5EYP F;  5BXO A;  5HRY A;  5AQ7 A;  2RFA A;  3ZNG A;  4DX2 A;  4F6R D;  2MYO A;  1WG0 A;  1K1A A;  4TUM A;  1A5E A;  2BKG A;  3T9K A;  4QQI A;  3EU9 A;  4JB8 P;  3IXE A;  4ZFH A;  4A63 B;  2QYJ A;  2QC9 A;  4K5A B;  4BSZ B;  4C48 B;  3TWR A;  2XEH A;  5AAR A;  4HBD A;  4HRN A;  3TWT A;  2ETC A;  1YMP A;  2DZN A;  1K1B A;  1MX2 A;  5KNG A;  4DX6 D;  2NYJ A;  3ZU7 B;  5ENQ D;  3D9H A;  2ETB A;  5D66 A;  5ENO D;  5AQB A;  5ENR D;  5CBO A;  2V4H C;  3AAA C;  5BXU A;  4G8K A;  3F6Q A;  1SW6 A;  4U96 D;  3W9G A;  4HQD A;  3KEA A;  4K5B A;  3V2O A;  2ZGG A;  3TWS A;  4ATZ D;  4CYM D;  5AQ9 A;  4DUI A;  2XZD G;  1MX4 A;  3ZKJ A;  3T8K A;  4Z68 A;  3LJN A;  3JXJ A;  4HI9 A;  1NFI E;  4HB5 A;  3V31 A;  1OY3 D;  5CBN A;  5KWD A;  3EHQ A;  5CED B;  5EIB E;  3UI2 A;  3B7B A;  4G8L A;  3TWV A;  5AN8 A;  4U8Y D;  3AJI A;  2Y0B G;  3UTM A;  3V2X A;  4HLL A;  4N5Q A;  2KXP C;  2BKK B;  5ENT D;  4QFV A;  2RFM A;  5KNH D;  3JUE A;  3B95 A;  4BES A;  4RLY A;  2V5Q C;  4LSZ E;  4GPM A;  2KBX A;  4YDY A;  1N11 A;  1OT8 A;  2ZGD A;  4F1P A;  2P2C P;  1IKN D;  4ZHB A;  2PNN A;  3V79 K;  4UUC A;  1K3Z D;  2FO1 E;  3J5P A;  1D9S A;  1BI8 B;  1IXV A;  4BEP A;  1UOH A;  3NOC D;  2HE0 A;  4LNU D;  4O1O A;  3TWQ A;  1MX6 A;  3DEO A;  3HRA A;  5AAO A;  3HG0 D;  1DC2 A;  3V30 A;  4CZ2 D;  1YYH A;  4U8V D;  4NIK A;  5KBA A;  1AWC B;  2VGE A;  1BLX B;  1G3N B;  3Q9U C;  4DX5 D;  3NOG D;  4BET A;  5ENS D;  2F8Y A;  5JA4 D;  5CEC B;  3W9F A;  1S70 B;  2DZO A;  3DEP A;  4BER A;  5EN5 D;  2F37 A;  2JAB A;  2XEE A;  4HI8 A;  4O1P A;  5EID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...