3D9NA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
138
structure length
138
Chain Sequence
EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA-binding protein 16
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9nA00
3ONKA 1H0AA 4FLBA 3ZYMA 1SZAA 5LOZA 4JXTA 1JUQA 4FU3A 1X5BA 3G2VA 1UJJA 1HG5A 1VDYA 2DCPA 1JWFA 1SZ9A 2KM4A 2L0IA 4GZCA 3LDZA 3G2TA 5CMYA 1XGWA 5LP0A 1JPLA 3ZYLA 2MOWA 1HX8A 3D9KA 2QY7A 5J08A 3D9MA 1HFAA 1INZA 1EYHA 1JWGA 1LF8A 1MHQA 1EDUA 3G2SA 1HF8A 4NACA 3D9NA 5CMWA 2BF0X 3ZYQA 1HG2A 1ELKA 2L0TB 4HFGA 3D9IA 1PY1A 1UJKA 1DVPA 4Q94A 3D9LA 3G2UA 2LO6A 3D9OA 3G2WA 4GZDA 3RRUA 4Q96A 4AVXA 3ZYKA 2DIWA 3D9JA 3D9PA 2V8SE 3ONLA 3CLJA
chains in the Genus database with same CATH superfamily
3VTYA 5LCWJ 4ATZD 2P9KG 1Z3YA 2DZOA 5EX3A 5LP0A 3UINC 3D9MA 3V31A 4JEHA 3GW4A 5JHAA 3NOCD 2YHCA 3QWWA 5E75A 4UWGA 1OXJA 2WQHA 2QYUA 1QYMA 2FO1E 4A3VA 3FTVA 2OEVA 2X38A 5KWDA 4DLOA 1WG0A 4HI9A 3CVXA 1WDYA 3GZ1A 2RD0A 4GZ6A 3HXCA 2DIWA 1A17A 2LSUA 2LNIA 4RQIA 3T9KA 4A63B 5KJNA 2DCPA 2WXQA 2FBNA 5ANLA 2QY7A 4GTTA 4HORA 2L0TB 2UWJG 5BXUA 4I2WA 4LNGA 1KLXA 1HH8A 2KZTA 3L08A 3PE4A 3SFZA 3D9KA 3DEOA 3S7BA 2KBXA 2NSZA 2IU1A 4FLHA 5D0OD 2BF0X 4WNEA 3EU5A 2VTBA 4N3CA 2WMNA 5FQ4A 4J8EA 4ZHBA 1QZ2A 4HB5A 2OEWA 5JJ7A 1N0RA 4G8LA 3U3WA 3ONLA 4XE0A 3PZ3A 3LCAA 3LY8A 4UI9C 2V5FA 4CRWA 4EZJA 4JC8A 2LXLA 2WMOA 1UW4B 3ZVVA 2WB2A 3EIQC 1QNFA 4WNGA 1ZU2A 3HXEA 2F8XK 4BT8A 3UMVA 3FU6A 5JJTA 3GZ2A 4DX1A 3UM0A 2NC9A 2RKKA 4DX2A 2IEJA 3I5PA 4AEZC 4F1SA 3SGHA 5HI7A 5AARA 5BXOA 2I6HA 3LXUX 3ASFA 2ZIRA 2GRRB 3UIOC 3FTSA 2VSYA 3C3QA 3V79K 2XGMA 4J8YA 3Q7FA 3APFA 4FLBA 1S63A 4P29A 1TJCA 1N0QA 1N94A 5FJYA 3EIJA 4DLQA 5A6CA 2XEHA 3GYZA 2DZNA 3QARA 4HOSA 4J8SA 4J8DA 3ZXSA 3ULQA 3FP3A 4DPRA 1NA0A 3TXMA 3CHRA 4KYOB 5CHEE 3EHNA 2XPYA 4GZCA 4PH4B 3DWLG 4EQFA 3PZ4A 4GAAA 3DSXA 2GRQB 4KZCA 4LSZE 2BEDA 4TXPA 2QZAA 4KT6B 4ACKA 5LOZA 3CIAA 4GPMA 4FP7A 3I4GA 4MRUA 2P9SG 4F53A 3CVUA 1KT1A 4GA2A 4KBQA 3CVLA 3RO2A 4G11A 3AAAC 4AJWA 4FJZA 3DPDA 3EJNA 4G23A 1OCRE 3DSTA 3U9WA 3FTZA 2I9CA 4UWFA 1MX6A 1GW6A 3PZ1A 1H19A 3KS2A 2VGXB 4I1MA 3E37A 3SQVA 4UI9J 5EIBE 2KZTB 1E96B 3SBTB 4GB9A 3R7RA 1D9SA 2XRZA 4EPZA 3JXIA 4KMOA 5G05C 2FEZA 4CT4A 2VTBB 2CFZA 1MX4A 3ESLA 2R05A 3Q73A 2J07A 3TWSA 3O48A 3TG4A 3ASHA 4JPSA 2ZISA 2YNQA 3SI5A 3AU5A 3DBSA 4AY5A 3D9LA 2XS1A 3EHMA 1YMPA 2QFCA 3B7RL 1SQMA 3HIZA 1N54A 4ILIA 1TEZA 5AYWD 3TWVA 1RZ4A 5T3RA 5AQBA 4GTQA 4O1OA 1LTXA 1UJKA 2WVIA 4U04A 4WWNA 2RG8A 3FUDA 5CERB 5T8IA 1HS6A 3MKQA 2P9NG 3S7JA 3TWXA 4NQ0A 1EF1C 3HXDA 1IKND 4BT9A 5CCLA 1OWNA 4ZFHA 2VYIA 4EZLA 3PREA 3T8MA 4FHKA 3X2QE 4I9CA 2DYRE 2JLBA 2FO7A 1PC2A 3IV0A 4DX5D 2AXUA 3D9NA 5CEDB 4WNFA 4PS7A 4J8FA 4HLLA 5C2YA 2LAIA 4M3OA 3LJNA 1WM5A 2FULA 4U8HA 1JUQA 3IBEA 5CBOA 1UG3A 4TUUA 3MGBA 4X8QA 3LEWA 2HE0A 2M63A 4RG6A 1HF8A 4G1TA 4B94A 3OAWA 5G05J 1UN9A 5LFAA 2J8SD 4RSYA 5B1BE 2X6JA 1BI7B 5BUZA 1BPOA 4F7AA 4JXTA 2WXMA 2ONDA 5ENRD 3MV2B 3L6AA 4AV7A 2J4DA 1OWPA 4I6EA 5E76A 5KNGA 5G2NA 3CK8A 3IHVA 4JHJA 4UWHA 4JZYA 2ETAA 3LJ3A 3EHRA 4L2YA 4CT0A 2WXLA 2WXRA 1Q2ZA 3UT8A 5EKQD 3G2TA 3HRAA 1ELWA 1JPLA 4IRUA 3Q5MA 3ULYA 3QB2A 2C2LA 1N9AA 1IQRA 3ZYKA 2JEKA 5ITZF 1YA0A 3UIPC 3L82A 1ZBPA 1KZPA 4L7TA 4JW1A 3UPVA 2J08A 3Q47B 4TXQA 3SY2A 3ZUVB 4L1BA 3F6QA 5ARFA 2X6KA 2Y4UA 2ETCA 4K5AB 5G04C 3ASGA 2LO6A 3ML8A 4WWOA 1HU3A 2YQ8A 3D9JA 4ILHB 3DRAA 3BQOA 2DVWA 2IJGX 3C72A 1U3DA 3AS4A 2IO2C 3PE3A 1KT0A 3TWRA 2WXJA 2GRMA 4EZKA 5G55A 3JXJA 3HHMA 3P1UA 4D10C 1SZAA 3G2VA 4YNDA 4HXIA 3ASNE 4E85A 3E34A 3LY7A 5HS0A 1OWLA 2GRNB 1UOHA 4BSZB 2HYZA 2MRIA 2GRPB 1TJFA 1SA4A 4WAFA 2CHXA 1TYQG 2WQ7A 5BV1A 4N2SA 1P5QA 3CKBA 3B13A 3URZA 5BNWA 3AG1E 1OT8A 5FTPA 1DCEA 1DNPA 2XZDG 2XQ0A 3NAWA 4C9BB 3RAUA 1DC2A 2AXVA 5LX8A 1Z6TA 3UT4A 3ABKE 5A7DB 4U63A 3LDZA 4GTSA 5FIOA 3JUEA 4AP2A 5EDSA 4DI4A 5M72A 4F1PA 4AM9A 2PNNA 3V2OA 2NXPA 3MCXA 1DCQA 3KAEA 3ONKA 1E8WA 1TN6A 2EIJE 2F8YA 4I6GA 4OAVB 1ZB1A 1V55E 4K03A 3T5VA 4C0EA 1IHBA 1HX8A 1MYOA 5FQ6A 4LCTA 3TWTA 3CK7A 5G04J 1N4PA 4TV3A 2I1JA 4GA0A 2PQNA 4BTAA 4K5CA 4OAUC 2XHEA 3Q78A 2AJAA 2H6FA 5ENSD 3FU3A 2IO3C 3DSVA 3C5RA 1K1AA 3CHOA 3UM2A 3CHQA 4Q94A 3G2UA 4JA9A 3SFYA 3CSFA 5BV0A 3TG5A 1QQEA 1E8XA 4ME2A 3ZYMA 1OCCE 3FH8A 2VGXA 2OVFA 4J7WA 4B89A 2DWZA 4TXRA 3ABLE 1NL4A 1BD8A 5H7PA 4O1PA 1HFAA 2LUHA 4AIFA 3CK9A 4BSXA 1YYHA 4DX6D 2H6IA 3VLEA 3CVNA 5ENOD 5ENPD 3SO8A 4APFA 5CMYA 2FI7A 3FU5A 4G25A 4ANWA 3ESKA 1N95A 2V4HC 2L6BA 4GTVA 4XKCA 1NI1A 1OY3D 3ZRHA 3PS6A 2BKGA 2V5QC 1MJ0A 3NBNB 2MOWA 1XNFA 2H6GA 3ZFWA 2MYOA 1H2TC 4BTBA 2XGSA 3PNLB 3RRUA 1N4SA 5FQ8A 3IEGA 1D8EA 2E0IA 3RO3A 1S0PA 4HRNA 3P2BA 2RFAA 5ENNA 3NOGD 3QKYA 3ZNGA 3L22A 4N5QA 3B95A 2BUGA 1H2UA 3EU9A 4NACA 4HOUA 3B7UX 1WY6A 4HBDA 3D3MA 3APCA 4AOFA 4WWPA 2IF4A 4LERA 1LF8A 5D66A 3Q7AA 1IQUA 2ZXWE 4GZ5A 4I6JA 3CHPA 1JCRA 3LKUA 3NB2A 4GPKA 3Q75A 2PQRA 3S2AA 1HO8A 3CHSA 5BPPA 3J5QB 4HQDA 1LD8A 3HXFA 2VQ2A 3AG4E 3OTNA 4OVUA 3SZ7A 4IN3B 3I4RB 5AAOA 5AENA 3ENEA 2PZIA 5JJ6A 2KM4A 3LVRE 3ML9A 4LNBA 4Y6WA 3ASOE 2VJ8A 2XCBA 4L23A 4AXHA 2KC7A 2F0YA 2IONA 3JCKC 3ISMC 1FT1A 1H6KA 3U64A 2PM6A 1S64A 2XRYA 4Y6CA 4URKA 3KEAA 1AWCB 5KJKA 3SD5A 4XI0A 2AVPA 1XGWA 5FWQA 2P9LG 2VSOE 5KNHD 4GMJA 4DUIA 2KCLA 4JVSA 2YHEA 3D9HA 2I1KA 4FHJA 3LYAA 1HG5A 3ZPJA 1IHGA 3IKOB 4N39A 4QQIA 4B8AA 2J9QA 1TNZA 3Q9UC 3UT7A 3ABME 3T8KA 2XZTG 4MS6A 2X3MA 1L5JA 4XEIG 3FTYA 3SHFA 1KZOA 3PUJA 2KXPC 3AG2E 4PS8A 3C98A 1G3NB 3CHMA 3ULEG 4NURA 3R9AB 5D0QD 3JYSA 1B89A 4M7CA 3CVWA 1TNOA 4IYPA 4B93B 5C1DA 3ZYLA 4H7XA 5D2MC 2HO1A 3FUJA 3DXMG 3CQCB 1DVPA 5AQAA 2R17C 3RRMB 4A3TA 3CLJA 5FZSA 4XZ4A 3O4ZA 3AS8A 3KSQA 4W9RA 3HG0D 1E8ZA 2Q7FA 3MX3A 2A4ZA 4BY6A 4N5CA 3MJWA 4CYMD 3VTXA 1EYHA 1EDUA 3EUVA 4EHMA 3OXFA 3D9IA 3CR3A 3FEYA 1FVFA 2CHZA 3SF4A 4DI3A 3PDNA 5IY5E 1MX2A 1FT2A 2MHKA 4E6HA 3CSTA 3UI2A 3RRNB 2KATA 1E8YA 4GZ3A 3L13A 2CFUA 3Q4AB 4NIKA 1O5MA 4FADA 3VLFA 2QYJA 2WXNA 2GROB 3UX4A 3ZU7B 1N4RA 2XCCA 4GTMA 4HI8A 4CDRA 3S7DA 3CVPA 2Y3AA 4DX7D 5HQ8A 2UY1A 5CECB 5FINA 5KJMA 2VSNA 4PS3A 2HM8A 3R9MA 1NA3A 3LPZA 2PM7A 4FC8A 4I2ZA 3UKUG 3UXGA 5CBNA 2AXZA 4L2LA 3BG0B 4B8CB 5BT1A 2R5SA 3J5PA 1HXIA 4TRQA 3C3OA 3T5XA 3RIBA 4NRHB 4APOA 1K1BA 3PEVB 4UWKA 3ZXPA 5A23A 1TR4A 1OWOA 2QC9A 4CZ2D 1VDYA 4G26A 4EBAG 3S7FA 3ZN3A 1JWGA 5FZRA 3V2XA 4HOTA 2PL2A 3UKRG 1EPUA 3UM1A 3FUMA 4JHRA 2EINE 4BFRA 5EN5D 1PAQA 2Y69E 5B3SE 3E32A 4B0ZA 2E2EA 3RU0A 3FTXA 3ZIMA 3GZSA 2BTDA 2IY0C 3D9PA 4U0SA 1OCZE 4EECA 4KZ0A 3Q9NC 3TWWA 2LXMA 3RSEG 2GW1A 5AQ7A 2XEEA 1MHQA 3FH5A 3OXLA 1BLXB 4A55A 5KJLA 3AG3E 4JHKA 2X6HA 3LVQE 3R7QA 3W9FA 4PUCA 2P58C 4I17A 3FFLA 4CGVA 2A5EA 1BU9A 4FJYA 4I43A 2P9IG 4ABNA 3CKCA 5EX0A 3AS5A 2BKKB 2XS8A 2L6JA 2X6IA 2WXIA 3NF1A 4G24A 3C3RA 2GGFA 2B0OE 2UY1B 4MLPA 4MKTA 4YDEA 2J49A 3ZYQA 3Q49B 4CGWA 4Q96A 3U4TA 4CCAA 3MEKA 4AVXA 4HS2A 3B7SA 3U66A 1UJJA 3BG1B 4ANXA 2VGYA 4KVMA 3IXEA 5CRUA 1O1RA 2XPZA 5KBAA 4C0MA 5ENQD 4HVBA 4DRXE 3RKVA 3FUIA 1JCQA 4I1OB 4DJAA 4GU5A 3BU8A 4GYOA 3QC1A 3MYVA 2AW6A 4GZDA 4HOQA 3L9TA 3EDTB 1MZCA 2OCCE 3SBSA 1IYGA 1SVXA 3LY9A 2F37A 4FULA 1OCOE 4J0UA 1O1TA 1U3CA 3G2SA 3NZUA 2IQCA 4G2VA 2I2OA 4U95D 4UQZA 3PEUB 3FWVA 3D9OA 4F6RD 2P2CP 1NZNA 2LSVA 4UWLA 4YVQC 2ETBA 5FQ7A 5HRYA 2KCKA 4ATGA 1NFIE 3PRZA 1V54E 4A1SA 3N71A 1H6OA 4JB8P 4HRLA 3APDA 3ZGQA 3DSUA 3HYMB 4BERA 4G8KA 4N2QA 4U96D 3VLDA 3DXKG 2WXHA 3WG7E 4XX5A 4FU3A 1OWMA 4BEPA 3Q79A 5EYLA 3DSWA 3ZHEA 4UQXA 3QNKA 4LRZA 4ANUA 1TN7A 3TGOA 2B6CA 1OUVA 4UQYA 5EILA 1AP7A 1E7UA 3PNTB 2WXFA 3DPYA 4OYSA 1YCSB 1K3ZD 1FVHA 3JQ1A 1WAO1 2OV8A 5AJDA 3PZDA 4U07A 4A1GA 3HDXA 3FTWA 3FDHA 2WXOA 2WM9A 3TJPA 2A5UA 3BEEA 2Y4TA 5AQ9A 4MBGA 3FUFA 5JHBA 3DEPA 1N4QA 1TNUA 4ILGA 3TL5A 4GYYA 3E33A 4J6IA 1FPPA 5FZQA 2DBAA 3HVEA 4XKBA 4CEMA 3FULA 2ZU6B 1E90A 5J08A 5CMWA 3FU0A 1A5EA 1Y6IA 2WPVA 4V3IA 1TN8A 2CG2A 4HNAD 1INZA 5HKPA 3OXGA 1K8KG 3PVLA 3ZEFA 3RK6A 2L0IA 3EHQA 2EQXA 1H6PA 2KCVA 4I9EA 3JUIA 4U8VD 2HR2A 3QOUA 2Y0BG 4RVBA 1Y8MA 5CRVA 2CG3A 1N52A 4I1AA 2YINA 3Q15A 1RW2A 4GTRA 5T4YA 4PDXA 5CEAA 3IHYA 5AN8A 5CCMA 5JMND 4AY6A 5ARGA 3AJIA 4HRMB 1HZ4A 5ANRA 4N3BA 3FUHA 1D8DA 2RFMA 3BUAA 4RG9A 3TWQA 1KPSB 5DIZA 4KVOA 4LG6A 1X81A 4GTOA 4WUYA 2WXKA 3MKRA 2R03A 3MV3B 5FT9A 4C48B 1JWFA 1QBQA 4BX9A 3UQ3A 1W3BA 3CV0A 2CHWA 4LNUD 4QFVA 2C0MA 2WXGA 3ZHEB 1O1SA 4GTPA 1FCHA 4ANVA 1H0AA 5B1AE 3QJZA 4U0UA 4WNDA 3UUXA 2X6FA 3CVYA 2VSXE 4XI9A 5EIDA 2WQ6A 4ACLA 3SFXA 3KD7A 2R2LA 4F3VA 3FHEA 2R02A 4U7EB 4CDNA 3CQGB 4GMRA 3KSLA 2IOSA 4DK5A 3AU4A 4GCNA 4JA7A 3ZKJA 4XIFA 1IXVA 1UN8A 3JQ0A 4OVVA 3CEQA 1SW6A 4YVOA 1HE8A 3L17A 3QK0A 3PUKA 1HG2A 4GYWA 3KEZA 2V4LA 3FEXA 4N3AA 2J4BA 2ZGGA 1H2VC 1MQSA 5J90A 2XEVA 5AIJA 2V8SE 2VGEA 2XENA 3FUNA 3WXXA 1X5BA 3ASDA 4R7LA 3HVEB 4LUNU 4RLYA 4BWRA 3MA5A 3PH0C 1N11A 4HLEA 3FTUA 3HXBA 3L16A 2IOLA 1S70B 3UTMA 3L54A 3NQPA 4JEUA 3TXNA 5LCWC 2C0LA 3SNXA 3DSSA 4GMLA 4FA6A 5JA4D 1E7VA 4IULA 4HFGA 2AWIA 1ELRA 4K0RA 3MZLB 4EBAA 3FUEA 1U2VG 2EILE 3TAXA 4Z68A 4JD2G 3QWPA 4K5BA 1JCSA 4CDMA 4UUCA 3FH7A 4BETA 4YDYA 2Y1LE 3RJVA 2GRLA 2EIKE 3V30A 1LD7A 4Q69A 2FF4A 5BW8C 2L9BA 2OOEA 3MKQB 1NP7A 3I3NA 3K9IA 3FUKA 4GCOA 3E4BA 2V0PA 2XPIA 3B7BA 3TWUA 1PY1A 1TNYA 3UM3A 4JL0A 3CGHA 4UI9K 2JABA 1TNBA 5KCMA 4H7YA 2J09A 4YDWA 2IFUA 5ENTD 3LS8A 5AJLA 4O60A 3QDNA 3W9GA 4TUMA 4BESA 2OVBA 4U0ZA 1Z3XA 3PZ2A 2ILRA 2DYSE 3FY4A 5EYPF 1BI8B 2P9PG 3G2WA 4KXKB 2NYJA 4U8YD 2LAHA 2R59A 2P9UG 3CVQA 4GA1A 4L9PA 2WXPA 2XGOA 1Z5SC 3NZSA 3B7TA 1SZ9A 4YDOA 3ZW3A 5DBKA 4O6FA 3QAQA 2ZGDA 1ELKA 3QWVA 1SA5A 4BX8A 3E30A 3CVVA 4LEUA 2H6HA 2EIME
chains in the Genus database with same CATH topology
4L2YA 3VTYA 2KCKA 4CT0A 2I1KA 4ATGA 3PRZA 2WXLA 2WXRA 4FHJA 5LCWJ 3LYAA 1HG5A 3ZPJA 1IHGA 3IKOB 3UT8A 5EKQD 4A1SA 1Z3YA 3G2TA 4N39A 3N71A 5EX3A 5LP0A 1ELWA 1JPLA 3D9MA 4B8AA 3APDA 2J9QA 4IRUA 3ZGQA 4JEHA 3GW4A 3HYMB 3Q5MA 5JHAA 2YHCA 3QB2A 4N2QA 3VLDA 3QWWA 2WXHA 3UT7A 2C2LA 1IQRA 3ZYKA 2JEKA 4MS6A 1YA0A 2X3MA 5E75A 4UWGA 1L5JA 4FU3A 2WQHA 1OWMA 1ZBPA 3FTYA 4XX5A 3SHFA 3PUJA 4L7TA 4JW1A 4PS8A 3UPVA 2J08A 3Q47B 3C98A 4A3VA 3FTVA 3ZHEA 2X38A 4L1BA 3QNKA 4UQXA 4LRZA 4ANUA 4DLOA 3TGOA 5ARFA 3CHMA 2X6KA 4NURA 3CVXA 3GZ1A 3R9AB 1OUVA 2Y4UA 4UQYA 2RD0A 5D0QD 5G04C 3ASGA 2LO6A 3ML8A 3JYSA 1HU3A 4GZ6A 4WWOA 1B89A 2DIWA 2YQ8A 1A17A 3D9JA 1E7UA 2LSUA 2LNIA 3PNTB 2WXFA 4ILHB 4OYSA 3CVWA 5KJNA 2DCPA 4IYPA 5C1DA 1FVHA 3JQ1A 2WXQA 1WAO1 2OV8A 3ZYLA 2FBNA 4H7XA 5ANLA 2QY7A 2IJGX 2HO1A 5AJDA 3FUJA 1U3DA 3AS4A 3PZDA 4HORA 2L0TB 3PE3A 4U07A 4A1GA 1KT0A 3HDXA 3CQCB 1DVPA 2WXJA 2GRMA 4EZKA 3FTWA 2R17C 5G55A 2UWJG 3FDHA 3HHMA 3RRMB 4A3TA 2WXOA 3P1UA 4D10C 2WM9A 3CLJA 3TJPA 4I2WA 2A5UA 1SZAA 5FZSA 4XZ4A 3BEEA 2Y4TA 1KLXA 3O4ZA 3AS8A 3G2VA 1HH8A 2KZTA 4YNDA 4HXIA 3L08A 4E85A 3LY7A 3PE4A 4W9RA 1E8ZA 3SFZA 1OWLA 2Q7FA 3FUFA 3MX3A 2A4ZA 4BY6A 3D9KA 3S7BA 2HYZA 2MRIA 3MJWA 4N5CA 3VTXA 1EYHA 1TJFA 2IU1A 2NSZA 1EDUA 4WAFA 4FLHA 5D0OD 2BF0X 5JHBA 2CHXA 4WNEA 3OXFA 2VTBA 3D9IA 4N3CA 3CR3A 2WMNA 5FQ4A 2WQ7A 4ILGA 3TL5A 4J8EA 5BV1A 4GYYA 3FEYA 4N2SA 1FVFA 2CHZA 1QZ2A 1P5QA 5JJ7A 4J6IA 3CKBA 3U3WA 3ONLA 3B13A 5FZQA 3URZA 3SF4A 4XE0A 2DBAA 3HVEA 3LCAA 4XKBA 4DI3A 5BNWA 3PDNA 4CEMA 3FULA 2ZU6B 3LY8A 1E90A 5FTPA 4UI9C 1DNPA 2V5FA 4CRWA 4EZJA 2XQ0A 2MHKA 4JC8A 5J08A 4E6HA 3CSTA 5CMWA 3RRNB 4C9BB 2KATA 1E8YA 1UW4B 2WMOA 3ZVVA 3FU0A 2WB2A 3EIQC 4GZ3A 1QNFA 2AXVA 4WNGA 1ZU2A 3L13A 2CFUA 3Q4AB 4BT8A 1Y6IA 3UMVA 2WPVA 3FU6A 5JJTA 5LX8A 4V3IA 3GZ2A 1Z6TA 4FADA 3UT4A 2CG2A 2NC9A 1INZA 3VLFA 3OXGA 5A7DB 2WXNA 3UX4A 3PVLA 3ZEFA 3RK6A 3I5PA 2L0IA 4U63A 2XCCA 3LDZA 4AEZC 4F1SA 3SGHA 2EQXA 5HI7A 4CDRA 2I6HA 3S7DA 3CVPA 2KCVA 3LXUX 4AP2A 4DI4A 5EDSA 3ASFA 5M72A 4I9EA 3JUIA 2Y3AA 5HQ8A 2HR2A 3QOUA 3FTSA 4RVBA 1Y8MA 2VSYA 2CG3A 4AM9A 2XGMA 1N52A 2NXPA 3MCXA 4I1AA 3KAEA 3APFA 3ONKA 1E8WA 2YINA 3Q15A 4FLBA 2UY1A 5T4YA 4I6GA 5KJMA 4PDXA 3IHYA 4P29A 5CCMA 4AY6A 1TJCA 5ARGA 4K03A 3T5VA 2VSNA 4C0EA 5FJYA 4PS3A 3EIJA 1HX8A 4DLQA 5A6CA 3GYZA 1HZ4A 5ANRA 5FQ6A 2HM8A 4LCTA 4N3BA 3CK7A 3FUHA 3QARA 4RG9A 1NA3A 5DIZA 4HOSA 5G04J 4KVOA 4J8SA 3LPZA 2PM7A 4J8DA 2I1JA 4TV3A 3ZXSA 3ULQA 4GA0A 4WUYA 3FP3A 4DPRA 2PQNA 4BTAA 1NA0A 3TXMA 4FC8A 2WXKA 3CHRA 4I2ZA 3MKRA 4KYOB 5CHEE 3EHNA 3MV3B 2XHEA 5FT9A 2XPYA 1JWFA 4GZCA 4PH4B 2AXZA 4L2LA 3BG0B 4GAAA 4EQFA 4BX9A 3FU3A 4B8CB 5BT1A 2R5SA 3UQ3A 1W3BA 1HXIA 3CV0A 4KZCA 4TRQA 3T5XA 3RIBA 2CHWA 4QFVA 3CHOA 2C0MA 2WXGA 4NRHB 3ZHEB 3CHQA 4APOA 4Q94A 3G2UA 4JA9A 1FCHA 4KT6B 3PEVB 3CSFA 4UWKA 3TG5A 5BV0A 5A23A 4ACKA 1QQEA 1E8XA 5LOZA 4ANVA 1H0AA 3CIAA 4ME2A 4FP7A 3ZYMA 3I4GA 1OWOA 3QJZA 3FH8A 4U0UA 4WNDA 2VGXA 2X6FA 3UUXA 2OVFA 4MRUA 1VDYA 4G26A 4UWHA 4B89A 4EBAG 4F53A 3CVYA 1KT1A 3CVUA 4GA2A 4KBQA 3CVLA 3S7FA 3ZN3A 2VSXE 4G11A 3RO2A 4XI9A 4AJWA 4FJZA 1HFAA 3DPDA 1JWGA 3EJNA 4G23A 2WQ6A 4ACLA 5FZRA 4AIFA 4HOTA 3KD7A 4F3VA 3CK9A 3FHEA 3U9WA 3FTZA 3CQGB 4CDNA 2PL2A 4BSXA 2IOSA 1EPUA 4DK5A 3AU4A 3FUMA 2I9CA 4UWFA 4JHRA 3VLEA 3CVNA 1GW6A 4GCNA 4JA7A 4BFRA 1H19A 3KS2A 1PAQA 4APFA 2VGXB 4I1MA 4XIFA 4UI9J 5CMYA 1UN8A 3JQ0A 4OVVA 2FI7A 1E96B 2KZTB 3CEQA 3FU5A 4YVOA 4G25A 3SBTB 1HE8A 3L17A 4B0ZA 2E2EA 3ESKA 3QK0A 4GB9A 3R7RA 3RU0A 3PUKA 4ANWA 2XRZA 3FTXA 1HG2A 4GYWA 3KEZA 4EPZA 4KMOA 2V4LA 3FEXA 4XKCA 5G05C 2FEZA 4N3AA 2J4BA 3ZIMA 1H2VC 4CT4A 1MQSA 5J90A 2VTBB 2XEVA 5AIJA 3GZSA 2BTDA 3D9PA 2CFZA 2V8SE 4U0SA 3ESLA 3FUNA 4EECA 3WXXA 3ZRHA 1X5BA 3ASDA 4KZ0A 4R7LA 2J07A 3PS6A 3O48A 3TG4A 3HVEB 4LUNU 2MOWA 1XNFA 3ASHA 4BWRA 3ZFWA 2GW1A 3MA5A 3PH0C 1H2TC 4JPSA 4BTBA 1MHQA 3FH5A 2YNQA 2XGSA 3OXLA 4A55A 3SI5A 3AU5A 5KJLA 3DBSA 4AY5A 3PNLB 4HLEA 3D9LA 3FTUA 2X6HA 3LVQE 4JHKA 3RRUA 3L16A 3EHMA 3R7QA 2IOLA 4PUCA 2P58C 3L54A 5FQ8A 2QFCA 4I17A 3FFLA 3IEGA 4CGVA 3B7RL 3NQPA 4FJYA 4JEUA 1SQMA 3HIZA 1N54A 4I43A 4ILIA 3TXNA 5LCWC 1TEZA 2E0IA 5AYWD 3RO3A 4ABNA 2C0LA 1S0PA 3SNXA 3CKCA 5T3RA 4GMLA 4FA6A 3P2BA 5EX0A 3AS5A 5ENNA 3QKYA 1E7VA 3L22A 4IULA 4HFGA 2AWIA 2L6JA 1ELRA 1UJKA 2WVIA 4U04A 2X6IA 2WXIA 4K0RA 3NF1A 2BUGA 1H2UA 4WWNA 2RG8A 3FUDA 4G24A 5T8IA 1HS6A 3MZLB 4NACA 4EBAA 3MKQA 3FUEA 4HOUA 3S7JA 2GGFA 3B7UX 1WY6A 3TAXA 4NQ0A 3QWPA 3D3MA 1EF1C 4CDMA 2UY1B 3APCA 4AOFA 4MLPA 4MKTA 3FH7A 4WWPA 4BT9A 5CCLA 2IF4A 1OWNA 1LF8A 4LERA 2VYIA 3RJVA 2GRLA 2J49A 3ZYQA 4EZLA 3Q49B 3PREA 1IQUA 3T8MA 4FHKA 4I9CA 4GZ5A 4CGWA 4Q69A 4Q96A 3U4TA 4I6JA 2FF4A 3MEKA 4AVXA 4CCAA 3CHPA 4HS2A 2JLBA 2FO7A 3LKUA 1PC2A 5BW8C 2L9BA 2OOEA 3B7SA 4GPKA 3IV0A 3MKQB 3U66A 1NP7A 1UJJA 3BG1B 3I3NA 3K9IA 4ANXA 2VGYA 4KVMA 2PQRA 3S2AA 1HO8A 2XPZA 3CHSA 3FUKA 4GCOA 5BPPA 2AXUA 3E4BA 3D9NA 2V0PA 4WNFA 4C0MA 4HVBA 2XPIA 2VQ2A 1PY1A 3OTNA 4OVUA 3SZ7A 4PS7A 4IN3B 4J8FA 4JL0A 5C2YA 3CGHA 3I4RB 2LAIA 4M3OA 4UI9K 3RKVA 5AENA 3ENEA 3FUIA 1WM5A 2FULA 2PZIA 4U8HA 5JJ6A 1JUQA 3IBEA 4I1OB 5KCMA 4H7YA 2J09A 2KM4A 3LVRE 2IFUA 3ML9A 1UG3A 3LS8A 5AJLA 4GU5A 4DJAA 4GYOA 3QDNA 4TUUA 3MGBA 4Y6WA 2VJ8A 3QC1A 2XCBA 3LEWA 3MYVA 2M63A 4L23A 4RG6A 4AXHA 1HF8A 4G1TA 2OVBA 4B94A 2KC7A 3OAWA 4U0ZA 2IONA 2AW6A 3JCKC 5G05J 1Z3XA 1UN9A 2ILRA 3FY4A 1H6KA 5LFAA 3U64A 3G2WA 4KXKB 2PM6A 4GZDA 4HOQA 4RSYA 2XRYA 2LAHA 2R59A 3EDTB 2X6JA 3CVQA 4GA1A 5BUZA 2WXPA 2XGOA 4Y6CA 4URKA 3SBSA 1BPOA 4F7AA 4JXTA 1IYGA 2WXMA 3LY9A 5KJKA 3SD5A 2ONDA 3NZSA 3B7TA 1SZ9A 3MV2B 4FULA 3L6AA 4XI0A 2AVPA 4AV7A 1XGWA 2J4DA 3ZW3A 5FWQA 4J0UA 5DBKA 4O6FA 3QAQA 1OWPA 4I6EA 2VSOE 1U3CA 3G2SA 3NZUA 2IQCA 4G2VA 5E76A 1ELKA 2I2OA 3QWVA 4GMJA 4UQZA 5G2NA 3PEUB 3FWVA 4BX8A 3CK8A 3IHVA 2KCLA 3D9OA 4JHJA 3CVVA 4JVSA 1NZNA 2LSVA 4LEUA 4UWLA 4YVQC 4JZYA 5FQ7A 3LJ3A 2YHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONK A;  1H0A A;  4FLB A;  3ZYM A;  1SZA A;  5LOZ A;  4JXT A;  1JUQ A;  4FU3 A;  1X5B A;  3G2V A;  1UJJ A;  1HG5 A;  1VDY A;  2DCP A;  1JWF A;  1SZ9 A;  2KM4 A;  2L0I A;  4GZC A;  3LDZ A;  3G2T A;  5CMY A;  1XGW A;  5LP0 A;  1JPL A;  3ZYL A;  2MOW A;  1HX8 A;  3D9K A;  2QY7 A;  5J08 A;  3D9M A;  1HFA A;  1INZ A;  1EYH A;  1JWG A;  1LF8 A;  1MHQ A;  1EDU A;  3G2S A;  1HF8 A;  4NAC A;  3D9N A;  5CMW A;  2BF0 X;  3ZYQ A;  1HG2 A;  1ELK A;  2L0T B;  4HFG A;  3D9I A;  1PY1 A;  1UJK A;  1DVP A;  4Q94 A;  3D9L A;  3G2U A;  2LO6 A;  3D9O A;  3G2W A;  4GZD A;  3RRU A;  4Q96 A;  4AVX A;  3ZYK A;  2DIW A;  3D9J A;  3D9P A;  2V8S E;  3ONL A;  3CLJ A; 
#chains in the Genus database with same CATH topology
 3VTY A;  5LCW J;  4ATZ D;  2P9K G;  1Z3Y A;  2DZO A;  5EX3 A;  5LP0 A;  3UIN C;  3D9M A;  3V31 A;  4JEH A;  3GW4 A;  5JHA A;  3NOC D;  2YHC A;  3QWW A;  5E75 A;  4UWG A;  1OXJ A;  2WQH A;  2QYU A;  1QYM A;  2FO1 E;  4A3V A;  3FTV A;  2OEV A;  2X38 A;  5KWD A;  4DLO A;  1WG0 A;  4HI9 A;  3CVX A;  1WDY A;  3GZ1 A;  2RD0 A;  4GZ6 A;  3HXC A;  2DIW A;  1A17 A;  2LSU A;  2LNI A;  4RQI A;  3T9K A;  4A63 B;  5KJN A;  2DCP A;  2WXQ A;  2FBN A;  5ANL A;  2QY7 A;  4GTT A;  4HOR A;  2L0T B;  2UWJ G;  5BXU A;  4I2W A;  4LNG A;  1KLX A;  1HH8 A;  2KZT A;  3L08 A;  3PE4 A;  3SFZ A;  3D9K A;  3DEO A;  3S7B A;  2KBX A;  2NSZ A;  2IU1 A;  4FLH A;  5D0O D;  2BF0 X;  4WNE A;  3EU5 A;  2VTB A;  4N3C A;  2WMN A;  5FQ4 A;  4J8E A;  4ZHB A;  1QZ2 A;  4HB5 A;  2OEW A;  5JJ7 A;  1N0R A;  4G8L A;  3U3W A;  3ONL A;  4XE0 A;  3PZ3 A;  3LCA A;  3LY8 A;  4UI9 C;  2V5F A;  4CRW A;  4EZJ A;  4JC8 A;  2LXL A;  2WMO A;  1UW4 B;  3ZVV A;  2WB2 A;  3EIQ C;  1QNF A;  4WNG A;  1ZU2 A;  3HXE A;  2F8X K;  4BT8 A;  3UMV A;  3FU6 A;  5JJT A;  3GZ2 A;  4DX1 A;  3UM0 A;  2NC9 A;  2RKK A;  4DX2 A;  2IEJ A;  3I5P A;  4AEZ C;  4F1S A;  3SGH A;  5HI7 A;  5AAR A;  5BXO A;  2I6H A;  3LXU X;  3ASF A;  2ZIR A;  2GRR B;  3UIO C;  3FTS A;  2VSY A;  3C3Q A;  3V79 K;  2XGM A;  4J8Y A;  3Q7F A;  3APF A;  4FLB A;  1S63 A;  4P29 A;  1TJC A;  1N0Q A;  1N94 A;  5FJY A;  3EIJ A;  4DLQ A;  5A6C A;  2XEH A;  3GYZ A;  2DZN A;  3QAR A;  4HOS A;  4J8S A;  4J8D A;  3ZXS A;  3ULQ A;  3FP3 A;  4DPR A;  1NA0 A;  3TXM A;  3CHR A;  4KYO B;  5CHE E;  3EHN A;  2XPY A;  4GZC A;  4PH4 B;  3DWL G;  4EQF A;  3PZ4 A;  4GAA A;  3DSX A;  2GRQ B;  4KZC A;  4LSZ E;  2BED A;  4TXP A;  2QZA A;  4KT6 B;  4ACK A;  5LOZ A;  3CIA A;  4GPM A;  4FP7 A;  3I4G A;  4MRU A;  2P9S G;  4F53 A;  3CVU A;  1KT1 A;  4GA2 A;  4KBQ A;  3CVL A;  3RO2 A;  4G11 A;  3AAA C;  4AJW A;  4FJZ A;  3DPD A;  3EJN A;  4G23 A;  1OCR E;  3DST A;  3U9W A;  3FTZ A;  2I9C A;  4UWF A;  1MX6 A;  1GW6 A;  3PZ1 A;  1H19 A;  3KS2 A;  2VGX B;  4I1M A;  3E37 A;  3SQV A;  4UI9 J;  5EIB E;  2KZT B;  1E96 B;  3SBT B;  4GB9 A;  3R7R A;  1D9S A;  2XRZ A;  4EPZ A;  3JXI A;  4KMO A;  5G05 C;  2FEZ A;  4CT4 A;  2VTB B;  2CFZ A;  1MX4 A;  3ESL A;  2R05 A;  3Q73 A;  2J07 A;  3TWS A;  3O48 A;  3TG4 A;  3ASH A;  4JPS A;  2ZIS A;  2YNQ A;  3SI5 A;  3AU5 A;  3DBS A;  4AY5 A;  3D9L A;  2XS1 A;  3EHM A;  1YMP A;  2QFC A;  3B7R L;  1SQM A;  3HIZ A;  1N54 A;  4ILI A;  1TEZ A;  5AYW D;  3TWV A;  1RZ4 A;  5T3R A;  5AQB A;  4GTQ A;  4O1O A;  1LTX A;  1UJK A;  2WVI A;  4U04 A;  4WWN A;  2RG8 A;  3FUD A;  5CER B;  5T8I A;  1HS6 A;  3MKQ A;  2P9N G;  3S7J A;  3TWX A;  4NQ0 A;  1EF1 C;  3HXD A;  1IKN D;  4BT9 A;  5CCL A;  1OWN A;  4ZFH A;  2VYI A;  4EZL A;  3PRE A;  3T8M A;  4FHK A;  3X2Q E;  4I9C A;  2DYR E;  2JLB A;  2FO7 A;  1PC2 A;  3IV0 A;  4DX5 D;  2AXU A;  3D9N A;  5CED B;  4WNF A;  4PS7 A;  4J8F A;  4HLL A;  5C2Y A;  2LAI A;  4M3O A;  3LJN A;  1WM5 A;  2FUL A;  4U8H A;  1JUQ A;  3IBE A;  5CBO A;  1UG3 A;  4TUU A;  3MGB A;  4X8Q A;  3LEW A;  2HE0 A;  2M63 A;  4RG6 A;  1HF8 A;  4G1T A;  4B94 A;  3OAW A;  5G05 J;  1UN9 A;  5LFA A;  2J8S D;  4RSY A;  5B1B E;  2X6J A;  1BI7 B;  5BUZ A;  1BPO A;  4F7A A;  4JXT A;  2WXM A;  2OND A;  5ENR D;  3MV2 B;  3L6A A;  4AV7 A;  2J4D A;  1OWP A;  4I6E A;  5E76 A;  5KNG A;  5G2N A;  3CK8 A;  3IHV A;  4JHJ A;  4UWH A;  4JZY A;  2ETA A;  3LJ3 A;  3EHR A;  4L2Y A;  4CT0 A;  2WXL A;  2WXR A;  1Q2Z A;  3UT8 A;  5EKQ D;  3G2T A;  3HRA A;  1ELW A;  1JPL A;  4IRU A;  3Q5M A;  3ULY A;  3QB2 A;  2C2L A;  1N9A A;  1IQR A;  3ZYK A;  2JEK A;  5ITZ F;  1YA0 A;  3UIP C;  3L82 A;  1ZBP A;  1KZP A;  4L7T A;  4JW1 A;  3UPV A;  2J08 A;  3Q47 B;  4TXQ A;  3SY2 A;  3ZUV B;  4L1B A;  3F6Q A;  5ARF A;  2X6K A;  2Y4U A;  2ETC A;  4K5A B;  5G04 C;  3ASG A;  2LO6 A;  3ML8 A;  4WWO A;  1HU3 A;  2YQ8 A;  3D9J A;  4ILH B;  3DRA A;  3BQO A;  2DVW A;  2IJG X;  3C72 A;  1U3D A;  3AS4 A;  2IO2 C;  3PE3 A;  1KT0 A;  3TWR A;  2WXJ A;  2GRM A;  4EZK A;  5G55 A;  3JXJ A;  3HHM A;  3P1U A;  4D10 C;  1SZA A;  3G2V A;  4YND A;  4HXI A;  3ASN E;  4E85 A;  3E34 A;  3LY7 A;  5HS0 A;  1OWL A;  2GRN B;  1UOH A;  4BSZ B;  2HYZ A;  2MRI A;  2GRP B;  1TJF A;  1SA4 A;  4WAF A;  2CHX A;  1TYQ G;  2WQ7 A;  5BV1 A;  4N2S A;  1P5Q A;  3CKB A;  3B13 A;  3URZ A;  5BNW A;  3AG1 E;  1OT8 A;  5FTP A;  1DCE A;  1DNP A;  2XZD G;  2XQ0 A;  3NAW A;  4C9B B;  3RAU A;  1DC2 A;  2AXV A;  5LX8 A;  1Z6T A;  3UT4 A;  3ABK E;  5A7D B;  4U63 A;  3LDZ A;  4GTS A;  5FIO A;  3JUE A;  4AP2 A;  5EDS A;  4DI4 A;  5M72 A;  4F1P A;  4AM9 A;  2PNN A;  3V2O A;  2NXP A;  3MCX A;  1DCQ A;  3KAE A;  3ONK A;  1E8W A;  1TN6 A;  2EIJ E;  2F8Y A;  4I6G A;  4OAV B;  1ZB1 A;  1V55 E;  4K03 A;  3T5V A;  4C0E A;  1IHB A;  1HX8 A;  1MYO A;  5FQ6 A;  4LCT A;  3TWT A;  3CK7 A;  5G04 J;  1N4P A;  4TV3 A;  2I1J A;  4GA0 A;  2PQN A;  4BTA A;  4K5C A;  4OAU C;  2XHE A;  3Q78 A;  2AJA A;  2H6F A;  5ENS D;  3FU3 A;  2IO3 C;  3DSV A;  3C5R A;  1K1A A;  3CHO A;  3UM2 A;  3CHQ A;  4Q94 A;  3G2U A;  4JA9 A;  3SFY A;  3CSF A;  5BV0 A;  3TG5 A;  1QQE A;  1E8X A;  4ME2 A;  3ZYM A;  1OCC E;  3FH8 A;  2VGX A;  2OVF A;  4J7W A;  4B89 A;  2DWZ A;  4TXR A;  3ABL E;  1NL4 A;  1BD8 A;  5H7P A;  4O1P A;  1HFA A;  2LUH A;  4AIF A;  3CK9 A;  4BSX A;  1YYH A;  4DX6 D;  2H6I A;  3VLE A;  3CVN A;  5ENO D;  5ENP D;  3SO8 A;  4APF A;  5CMY A;  2FI7 A;  3FU5 A;  4G25 A;  4ANW A;  3ESK A;  1N95 A;  2V4H C;  2L6B A;  4GTV A;  4XKC A;  1NI1 A;  1OY3 D;  3ZRH A;  3PS6 A;  2BKG A;  2V5Q C;  1MJ0 A;  3NBN B;  2MOW A;  1XNF A;  2H6G A;  3ZFW A;  2MYO A;  1H2T C;  4BTB A;  2XGS A;  3PNL B;  3RRU A;  1N4S A;  5FQ8 A;  3IEG A;  1D8E A;  2E0I A;  3RO3 A;  1S0P A;  4HRN A;  3P2B A;  2RFA A;  5ENN A;  3NOG D;  3QKY A;  3ZNG A;  3L22 A;  4N5Q A;  3B95 A;  2BUG A;  1H2U A;  3EU9 A;  4NAC A;  4HOU A;  3B7U X;  1WY6 A;  4HBD A;  3D3M A;  3APC A;  4AOF A;  4WWP A;  2IF4 A;  4LER A;  1LF8 A;  5D66 A;  3Q7A A;  1IQU A;  2ZXW E;  4GZ5 A;  4I6J A;  3CHP A;  1JCR A;  3LKU A;  3NB2 A;  4GPK A;  3Q75 A;  2PQR A;  3S2A A;  1HO8 A;  3CHS A;  5BPP A;  3J5Q B;  4HQD A;  1LD8 A;  3HXF A;  2VQ2 A;  3AG4 E;  3OTN A;  4OVU A;  3SZ7 A;  4IN3 B;  3I4R B;  5AAO A;  5AEN A;  3ENE A;  2PZI A;  5JJ6 A;  2KM4 A;  3LVR E;  3ML9 A;  4LNB A;  4Y6W A;  3ASO E;  2VJ8 A;  2XCB A;  4L23 A;  4AXH A;  2KC7 A;  2F0Y A;  2ION A;  3JCK C;  3ISM C;  1FT1 A;  1H6K A;  3U64 A;  2PM6 A;  1S64 A;  2XRY A;  4Y6C A;  4URK A;  3KEA A;  1AWC B;  5KJK A;  3SD5 A;  4XI0 A;  2AVP A;  1XGW A;  5FWQ A;  2P9L G;  2VSO E;  5KNH D;  4GMJ A;  4DUI A;  2KCL A;  4JVS A;  2YHE A;  3D9H A;  2I1K A;  4FHJ A;  3LYA A;  1HG5 A;  3ZPJ A;  1IHG A;  3IKO B;  4N39 A;  4QQI A;  4B8A A;  2J9Q A;  1TNZ A;  3Q9U C;  3UT7 A;  3ABM E;  3T8K A;  2XZT G;  4MS6 A;  2X3M A;  1L5J A;  4XEI G;  3FTY A;  3SHF A;  1KZO A;  3PUJ A;  2KXP C;  3AG2 E;  4PS8 A;  3C98 A;  1G3N B;  3CHM A;  3ULE G;  4NUR A;  3R9A B;  5D0Q D;  3JYS A;  1B89 A;  4M7C A;  3CVW A;  1TNO A;  4IYP A;  4B93 B;  5C1D A;  3ZYL A;  4H7X A;  5D2M C;  2HO1 A;  3FUJ A;  3DXM G;  3CQC B;  1DVP A;  5AQA A;  2R17 C;  3RRM B;  4A3T A;  3CLJ A;  5FZS A;  4XZ4 A;  3O4Z A;  3AS8 A;  3KSQ A;  4W9R A;  3HG0 D;  1E8Z A;  2Q7F A;  3MX3 A;  2A4Z A;  4BY6 A;  4N5C A;  3MJW A;  4CYM D;  3VTX A;  1EYH A;  1EDU A;  3EUV A;  4EHM A;  3OXF A;  3D9I A;  3CR3 A;  3FEY A;  1FVF A;  2CHZ A;  3SF4 A;  4DI3 A;  3PDN A;  5IY5 E;  1MX2 A;  1FT2 A;  2MHK A;  4E6H A;  3CST A;  3UI2 A;  3RRN B;  2KAT A;  1E8Y A;  4GZ3 A;  3L13 A;  2CFU A;  3Q4A B;  4NIK A;  1O5M A;  4FAD A;  3VLF A;  2QYJ A;  2WXN A;  2GRO B;  3UX4 A;  3ZU7 B;  1N4R A;  2XCC A;  4GTM A;  4HI8 A;  4CDR A;  3S7D A;  3CVP A;  2Y3A A;  4DX7 D;  5HQ8 A;  2UY1 A;  5CEC B;  5FIN A;  5KJM A;  2VSN A;  4PS3 A;  2HM8 A;  3R9M A;  1NA3 A;  3LPZ A;  2PM7 A;  4FC8 A;  4I2Z A;  3UKU G;  3UXG A;  5CBN A;  2AXZ A;  4L2L A;  3BG0 B;  4B8C B;  5BT1 A;  2R5S A;  3J5P A;  1HXI A;  4TRQ A;  3C3O A;  3T5X A;  3RIB A;  4NRH B;  4APO A;  1K1B A;  3PEV B;  4UWK A;  3ZXP A;  5A23 A;  1TR4 A;  1OWO A;  2QC9 A;  4CZ2 D;  1VDY A;  4G26 A;  4EBA G;  3S7F A;  3ZN3 A;  1JWG A;  5FZR A;  3V2X A;  4HOT A;  2PL2 A;  3UKR G;  1EPU A;  3UM1 A;  3FUM A;  4JHR A;  2EIN E;  4BFR A;  5EN5 D;  1PAQ A;  2Y69 E;  5B3S E;  3E32 A;  4B0Z A;  2E2E A;  3RU0 A;  3FTX A;  3ZIM A;  3GZS A;  2BTD A;  2IY0 C;  3D9P A;  4U0S A;  1OCZ E;  4EEC A;  4KZ0 A;  3Q9N C;  3TWW A;  2LXM A;  3RSE G;  2GW1 A;  5AQ7 A;  2XEE A;  1MHQ A;  3FH5 A;  3OXL A;  1BLX B;  4A55 A;  5KJL A;  3AG3 E;  4JHK A;  2X6H A;  3LVQ E;  3R7Q A;  3W9F A;  4PUC A;  2P58 C;  4I17 A;  3FFL A;  4CGV A;  2A5E A;  1BU9 A;  4FJY A;  4I43 A;  2P9I G;  4ABN A;  3CKC A;  5EX0 A;  3AS5 A;  2BKK B;  2XS8 A;  2L6J A;  2X6I A;  2WXI A;  3NF1 A;  4G24 A;  3C3R A;  2GGF A;  2B0O E;  2UY1 B;  4MLP A;  4MKT A;  4YDE A;  2J49 A;  3ZYQ A;  3Q49 B;  4CGW A;  4Q96 A;  3U4T A;  4CCA A;  3MEK A;  4AVX A;  4HS2 A;  3B7S A;  3U66 A;  1UJJ A;  3BG1 B;  4ANX A;  2VGY A;  4KVM A;  3IXE A;  5CRU A;  1O1R A;  2XPZ A;  5KBA A;  4C0M A;  5ENQ D;  4HVB A;  4DRX E;  3RKV A;  3FUI A;  1JCQ A;  4I1O B;  4DJA A;  4GU5 A;  3BU8 A;  4GYO A;  3QC1 A;  3MYV A;  2AW6 A;  4GZD A;  4HOQ A;  3L9T A;  3EDT B;  1MZC A;  2OCC E;  3SBS A;  1IYG A;  1SVX A;  3LY9 A;  2F37 A;  4FUL A;  1OCO E;  4J0U A;  1O1T A;  1U3C A;  3G2S A;  3NZU A;  2IQC A;  4G2V A;  2I2O A;  4U95 D;  4UQZ A;  3PEU B;  3FWV A;  3D9O A;  4F6R D;  2P2C P;  1NZN A;  2LSV A;  4UWL A;  4YVQ C;  2ETB A;  5FQ7 A;  5HRY A;  2KCK A;  4ATG A;  1NFI E;  3PRZ A;  1V54 E;  4A1S A;  3N71 A;  1H6O A;  4JB8 P;  4HRL A;  3APD A;  3ZGQ A;  3DSU A;  3HYM B;  4BER A;  4G8K A;  4N2Q A;  4U96 D;  3VLD A;  3DXK G;  2WXH A;  3WG7 E;  4XX5 A;  4FU3 A;  1OWM A;  4BEP A;  3Q79 A;  5EYL A;  3DSW A;  3ZHE A;  4UQX A;  3QNK A;  4LRZ A;  4ANU A;  1TN7 A;  3TGO A;  2B6C A;  1OUV A;  4UQY A;  5EIL A;  1AP7 A;  1E7U A;  3PNT B;  2WXF A;  3DPY A;  4OYS A;  1YCS B;  1K3Z D;  1FVH A;  3JQ1 A;  1WAO 1;  2OV8 A;  5AJD A;  3PZD A;  4U07 A;  4A1G A;  3HDX A;  3FTW A;  3FDH A;  2WXO A;  2WM9 A;  3TJP A;  2A5U A;  3BEE A;  2Y4T A;  5AQ9 A;  4MBG A;  3FUF A;  5JHB A;  3DEP A;  1N4Q A;  1TNU A;  4ILG A;  3TL5 A;  4GYY A;  3E33 A;  4J6I A;  1FPP A;  5FZQ A;  2DBA A;  3HVE A;  4XKB A;  4CEM A;  3FUL A;  2ZU6 B;  1E90 A;  5J08 A;  5CMW A;  3FU0 A;  1A5E A;  1Y6I A;  2WPV A;  4V3I A;  1TN8 A;  2CG2 A;  4HNA D;  1INZ A;  5HKP A;  3OXG A;  1K8K G;  3PVL A;  3ZEF A;  3RK6 A;  2L0I A;  3EHQ A;  2EQX A;  1H6P A;  2KCV A;  4I9E A;  3JUI A;  4U8V D;  2HR2 A;  3QOU A;  2Y0B G;  4RVB A;  1Y8M A;  5CRV A;  2CG3 A;  1N52 A;  4I1A A;  2YIN A;  3Q15 A;  1RW2 A;  4GTR A;  5T4Y A;  4PDX A;  5CEA A;  3IHY A;  5AN8 A;  5CCM A;  5JMN D;  4AY6 A;  5ARG A;  3AJI A;  4HRM B;  1HZ4 A;  5ANR A;  4N3B A;  3FUH A;  1D8D A;  2RFM A;  3BUA A;  4RG9 A;  3TWQ A;  1KPS B;  5DIZ A;  4KVO A;  4LG6 A;  1X81 A;  4GTO A;  4WUY A;  2WXK A;  3MKR A;  2R03 A;  3MV3 B;  5FT9 A;  4C48 B;  1JWF A;  1QBQ A;  4BX9 A;  3UQ3 A;  1W3B A;  3CV0 A;  2CHW A;  4LNU D;  4QFV A;  2C0M A;  2WXG A;  3ZHE B;  1O1S A;  4GTP A;  1FCH A;  4ANV A;  1H0A A;  5B1A E;  3QJZ A;  4U0U A;  4WND A;  3UUX A;  2X6F A;  3CVY A;  2VSX E;  4XI9 A;  5EID A;  2WQ6 A;  4ACL A;  3SFX A;  3KD7 A;  2R2L A;  4F3V A;  3FHE A;  2R02 A;  4U7E B;  4CDN A;  3CQG B;  4GMR A;  3KSL A;  2IOS A;  4DK5 A;  3AU4 A;  4GCN A;  4JA7 A;  3ZKJ A;  4XIF A;  1IXV A;  1UN8 A;  3JQ0 A;  4OVV A;  3CEQ A;  1SW6 A;  4YVO A;  1HE8 A;  3L17 A;  3QK0 A;  3PUK A;  1HG2 A;  4GYW A;  3KEZ A;  2V4L A;  3FEX A;  4N3A A;  2J4B A;  2ZGG A;  1H2V C;  1MQS A;  5J90 A;  2XEV A;  5AIJ A;  2V8S E;  2VGE A;  2XEN A;  3FUN A;  3WXX A;  1X5B A;  3ASD A;  4R7L A;  3HVE B;  4LUN U;  4RLY A;  4BWR A;  3MA5 A;  3PH0 C;  1N11 A;  4HLE A;  3FTU A;  3HXB A;  3L16 A;  2IOL A;  1S70 B;  3UTM A;  3L54 A;  3NQP A;  4JEU A;  3TXN A;  5LCW C;  2C0L A;  3SNX A;  3DSS A;  4GML A;  4FA6 A;  5JA4 D;  1E7V A;  4IUL A;  4HFG A;  2AWI A;  1ELR A;  4K0R A;  3MZL B;  4EBA A;  3FUE A;  1U2V G;  2EIL E;  3TAX A;  4Z68 A;  4JD2 G;  3QWP A;  4K5B A;  1JCS A;  4CDM A;  4UUC A;  3FH7 A;  4BET A;  4YDY A;  2Y1L E;  3RJV A;  2GRL A;  2EIK E;  3V30 A;  1LD7 A;  4Q69 A;  2FF4 A;  5BW8 C;  2L9B A;  2OOE A;  3MKQ B;  1NP7 A;  3I3N A;  3K9I A;  3FUK A;  4GCO A;  3E4B A;  2V0P A;  2XPI A;  3B7B A;  3TWU A;  1PY1 A;  1TNY A;  3UM3 A;  4JL0 A;  3CGH A;  4UI9 K;  2JAB A;  1TNB A;  5KCM A;  4H7Y A;  2J09 A;  4YDW A;  2IFU A;  5ENT D;  3LS8 A;  5AJL A;  4O60 A;  3QDN A;  3W9G A;  4TUM A;  4BES A;  2OVB A;  4U0Z A;  1Z3X A;  3PZ2 A;  2ILR A;  2DYS E;  3FY4 A;  5EYP F;  1BI8 B;  2P9P G;  3G2W A;  4KXK B;  2NYJ A;  4U8Y D;  2LAH A;  2R59 A;  2P9U G;  3CVQ A;  4GA1 A;  4L9P A;  2WXP A;  2XGO A;  1Z5S C;  3NZS A;  3B7T A;  1SZ9 A;  4YDO A;  3ZW3 A;  5DBK A;  4O6F A;  3QAQ A;  2ZGD A;  1ELK A;  3QWV A;  1SA5 A;  4BX8 A;  3E30 A;  3CVV A;  4LEU A;  2H6H A;  2EIM E; 
#chains in the Genus database with same CATH homology
 4L2Y A;  3VTY A;  2KCK A;  4CT0 A;  2I1K A;  4ATG A;  3PRZ A;  2WXL A;  2WXR A;  4FHJ A;  5LCW J;  3LYA A;  1HG5 A;  3ZPJ A;  1IHG A;  3IKO B;  3UT8 A;  5EKQ D;  4A1S A;  1Z3Y A;  3G2T A;  4N39 A;  3N71 A;  5EX3 A;  5LP0 A;  1ELW A;  1JPL A;  3D9M A;  4B8A A;  3APD A;  2J9Q A;  4IRU A;  3ZGQ A;  4JEH A;  3GW4 A;  3HYM B;  3Q5M A;  5JHA A;  2YHC A;  3QB2 A;  4N2Q A;  3VLD A;  3QWW A;  2WXH A;  3UT7 A;  2C2L A;  1IQR A;  3ZYK A;  2JEK A;  4MS6 A;  1YA0 A;  2X3M A;  5E75 A;  4UWG A;  1L5J A;  4FU3 A;  2WQH A;  1OWM A;  1ZBP A;  3FTY A;  4XX5 A;  3SHF A;  3PUJ A;  4L7T A;  4JW1 A;  4PS8 A;  3UPV A;  2J08 A;  3Q47 B;  3C98 A;  4A3V A;  3FTV A;  3ZHE A;  2X38 A;  4L1B A;  3QNK A;  4UQX A;  4LRZ A;  4ANU A;  4DLO A;  3TGO A;  5ARF A;  3CHM A;  2X6K A;  4NUR A;  3CVX A;  3GZ1 A;  3R9A B;  1OUV A;  2Y4U A;  4UQY A;  2RD0 A;  5D0Q D;  5G04 C;  3ASG A;  2LO6 A;  3ML8 A;  3JYS A;  1HU3 A;  4GZ6 A;  4WWO A;  1B89 A;  2DIW A;  2YQ8 A;  1A17 A;  3D9J A;  1E7U A;  2LSU A;  2LNI A;  3PNT B;  2WXF A;  4ILH B;  4OYS A;  3CVW A;  5KJN A;  2DCP A;  4IYP A;  5C1D A;  1FVH A;  3JQ1 A;  2WXQ A;  1WAO 1;  2OV8 A;  3ZYL A;  2FBN A;  4H7X A;  5ANL A;  2QY7 A;  2IJG X;  2HO1 A;  5AJD A;  3FUJ A;  1U3D A;  3AS4 A;  3PZD A;  4HOR A;  2L0T B;  3PE3 A;  4U07 A;  4A1G A;  1KT0 A;  3HDX A;  3CQC B;  1DVP A;  2WXJ A;  2GRM A;  4EZK A;  3FTW A;  2R17 C;  5G55 A;  2UWJ G;  3FDH A;  3HHM A;  3RRM B;  4A3T A;  2WXO A;  3P1U A;  4D10 C;  2WM9 A;  3CLJ A;  3TJP A;  4I2W A;  2A5U A;  1SZA A;  5FZS A;  4XZ4 A;  3BEE A;  2Y4T A;  1KLX A;  3O4Z A;  3AS8 A;  3G2V A;  1HH8 A;  2KZT A;  4YND A;  4HXI A;  3L08 A;  4E85 A;  3LY7 A;  3PE4 A;  4W9R A;  1E8Z A;  3SFZ A;  1OWL A;  2Q7F A;  3FUF A;  3MX3 A;  2A4Z A;  4BY6 A;  3D9K A;  3S7B A;  2HYZ A;  2MRI A;  3MJW A;  4N5C A;  3VTX A;  1EYH A;  1TJF A;  2IU1 A;  2NSZ A;  1EDU A;  4WAF A;  4FLH A;  5D0O D;  2BF0 X;  5JHB A;  2CHX A;  4WNE A;  3OXF A;  2VTB A;  3D9I A;  4N3C A;  3CR3 A;  2WMN A;  5FQ4 A;  2WQ7 A;  4ILG A;  3TL5 A;  4J8E A;  5BV1 A;  4GYY A;  3FEY A;  4N2S A;  1FVF A;  2CHZ A;  1QZ2 A;  1P5Q A;  5JJ7 A;  4J6I A;  3CKB A;  3U3W A;  3ONL A;  3B13 A;  5FZQ A;  3URZ A;  3SF4 A;  4XE0 A;  2DBA A;  3HVE A;  3LCA A;  4XKB A;  4DI3 A;  5BNW A;  3PDN A;  4CEM A;  3FUL A;  2ZU6 B;  3LY8 A;  1E90 A;  5FTP A;  4UI9 C;  1DNP A;  2V5F A;  4CRW A;  4EZJ A;  2XQ0 A;  2MHK A;  4JC8 A;  5J08 A;  4E6H A;  3CST A;  5CMW A;  3RRN B;  4C9B B;  2KAT A;  1E8Y A;  1UW4 B;  2WMO A;  3ZVV A;  3FU0 A;  2WB2 A;  3EIQ C;  4GZ3 A;  1QNF A;  2AXV A;  4WNG A;  1ZU2 A;  3L13 A;  2CFU A;  3Q4A B;  4BT8 A;  1Y6I A;  3UMV A;  2WPV A;  3FU6 A;  5JJT A;  5LX8 A;  4V3I A;  3GZ2 A;  1Z6T A;  4FAD A;  3UT4 A;  2CG2 A;  2NC9 A;  1INZ A;  3VLF A;  3OXG A;  5A7D B;  2WXN A;  3UX4 A;  3PVL A;  3ZEF A;  3RK6 A;  3I5P A;  2L0I A;  4U63 A;  2XCC A;  3LDZ A;  4AEZ C;  4F1S A;  3SGH A;  2EQX A;  5HI7 A;  4CDR A;  2I6H A;  3S7D A;  3CVP A;  2KCV A;  3LXU X;  4AP2 A;  4DI4 A;  5EDS A;  3ASF A;  5M72 A;  4I9E A;  3JUI A;  2Y3A A;  5HQ8 A;  2HR2 A;  3QOU A;  3FTS A;  4RVB A;  1Y8M A;  2VSY A;  2CG3 A;  4AM9 A;  2XGM A;  1N52 A;  2NXP A;  3MCX A;  4I1A A;  3KAE A;  3APF A;  3ONK A;  1E8W A;  2YIN A;  3Q15 A;  4FLB A;  2UY1 A;  5T4Y A;  4I6G A;  5KJM A;  4PDX A;  3IHY A;  4P29 A;  5CCM A;  4AY6 A;  1TJC A;  5ARG A;  4K03 A;  3T5V A;  2VSN A;  4C0E A;  5FJY A;  4PS3 A;  3EIJ A;  1HX8 A;  4DLQ A;  5A6C A;  3GYZ A;  1HZ4 A;  5ANR A;  5FQ6 A;  2HM8 A;  4LCT A;  4N3B A;  3CK7 A;  3FUH A;  3QAR A;  4RG9 A;  1NA3 A;  5DIZ A;  4HOS A;  5G04 J;  4KVO A;  4J8S A;  3LPZ A;  2PM7 A;  4J8D A;  2I1J A;  4TV3 A;  3ZXS A;  3ULQ A;  4GA0 A;  4WUY A;  3FP3 A;  4DPR A;  2PQN A;  4BTA A;  1NA0 A;  3TXM A;  4FC8 A;  2WXK A;  3CHR A;  4I2Z A;  3MKR A;  4KYO B;  5CHE E;  3EHN A;  3MV3 B;  2XHE A;  5FT9 A;  2XPY A;  1JWF A;  4GZC A;  4PH4 B;  2AXZ A;  4L2L A;  3BG0 B;  4GAA A;  4EQF A;  4BX9 A;  3FU3 A;  4B8C B;  5BT1 A;  2R5S A;  3UQ3 A;  1W3B A;  1HXI A;  3CV0 A;  4KZC A;  4TRQ A;  3T5X A;  3RIB A;  2CHW A;  4QFV A;  3CHO A;  2C0M A;  2WXG A;  4NRH B;  3ZHE B;  3CHQ A;  4APO A;  4Q94 A;  3G2U A;  4JA9 A;  1FCH A;  4KT6 B;  3PEV B;  3CSF A;  4UWK A;  3TG5 A;  5BV0 A;  5A23 A;  4ACK A;  1QQE A;  1E8X A;  5LOZ A;  4ANV A;  1H0A A;  3CIA A;  4ME2 A;  4FP7 A;  3ZYM A;  3I4G A;  1OWO A;  3QJZ A;  3FH8 A;  4U0U A;  4WND A;  2VGX A;  2X6F A;  3UUX A;  2OVF A;  4MRU A;  1VDY A;  4G26 A;  4UWH A;  4B89 A;  4EBA G;  4F53 A;  3CVY A;  1KT1 A;  3CVU A;  4GA2 A;  4KBQ A;  3CVL A;  3S7F A;  3ZN3 A;  2VSX E;  4G11 A;  3RO2 A;  4XI9 A;  4AJW A;  4FJZ A;  1HFA A;  3DPD A;  1JWG A;  3EJN A;  4G23 A;  2WQ6 A;  4ACL A;  5FZR A;  4AIF A;  4HOT A;  3KD7 A;  4F3V A;  3CK9 A;  3FHE A;  3U9W A;  3FTZ A;  3CQG B;  4CDN A;  2PL2 A;  4BSX A;  2IOS A;  1EPU A;  4DK5 A;  3AU4 A;  3FUM A;  2I9C A;  4UWF A;  4JHR A;  3VLE A;  3CVN A;  1GW6 A;  4GCN A;  4JA7 A;  4BFR A;  1H19 A;  3KS2 A;  1PAQ A;  4APF A;  2VGX B;  4I1M A;  4XIF A;  4UI9 J;  5CMY A;  1UN8 A;  3JQ0 A;  4OVV A;  2FI7 A;  1E96 B;  2KZT B;  3CEQ A;  3FU5 A;  4YVO A;  4G25 A;  3SBT B;  1HE8 A;  3L17 A;  4B0Z A;  2E2E A;  3ESK A;  3QK0 A;  4GB9 A;  3R7R A;  3RU0 A;  3PUK A;  4ANW A;  2XRZ A;  3FTX A;  1HG2 A;  4GYW A;  3KEZ A;  4EPZ A;  4KMO A;  2V4L A;  3FEX A;  4XKC A;  5G05 C;  2FEZ A;  4N3A A;  2J4B A;  3ZIM A;  1H2V C;  4CT4 A;  1MQS A;  5J90 A;  2VTB B;  2XEV A;  5AIJ A;  3GZS A;  2BTD A;  3D9P A;  2CFZ A;  2V8S E;  4U0S A;  3ESL A;  3FUN A;  4EEC A;  3WXX A;  3ZRH A;  1X5B A;  3ASD A;  4KZ0 A;  4R7L A;  2J07 A;  3PS6 A;  3O48 A;  3TG4 A;  3HVE B;  4LUN U;  2MOW A;  1XNF A;  3ASH A;  4BWR A;  3ZFW A;  2GW1 A;  3MA5 A;  3PH0 C;  1H2T C;  4JPS A;  4BTB A;  1MHQ A;  3FH5 A;  2YNQ A;  2XGS A;  3OXL A;  4A55 A;  3SI5 A;  3AU5 A;  5KJL A;  3DBS A;  4AY5 A;  3PNL B;  4HLE A;  3D9L A;  3FTU A;  2X6H A;  3LVQ E;  4JHK A;  3RRU A;  3L16 A;  3EHM A;  3R7Q A;  2IOL A;  4PUC A;  2P58 C;  3L54 A;  5FQ8 A;  2QFC A;  4I17 A;  3FFL A;  3IEG A;  4CGV A;  3B7R L;  3NQP A;  4FJY A;  4JEU A;  1SQM A;  3HIZ A;  1N54 A;  4I43 A;  4ILI A;  3TXN A;  5LCW C;  1TEZ A;  2E0I A;  5AYW D;  3RO3 A;  4ABN A;  2C0L A;  1S0P A;  3SNX A;  3CKC A;  5T3R A;  4GML A;  4FA6 A;  3P2B A;  5EX0 A;  3AS5 A;  5ENN A;  3QKY A;  1E7V A;  3L22 A;  4IUL A;  4HFG A;  2AWI A;  2L6J A;  1ELR A;  1UJK A;  2WVI A;  4U04 A;  2X6I A;  2WXI A;  4K0R A;  3NF1 A;  2BUG A;  1H2U A;  4WWN A;  2RG8 A;  3FUD A;  4G24 A;  5T8I A;  1HS6 A;  3MZL B;  4NAC A;  4EBA A;  3MKQ A;  3FUE A;  4HOU A;  3S7J A;  2GGF A;  3B7U X;  1WY6 A;  3TAX A;  4NQ0 A;  3QWP A;  3D3M A;  1EF1 C;  4CDM A;  2UY1 B;  3APC A;  4AOF A;  4MLP A;  4MKT A;  3FH7 A;  4WWP A;  4BT9 A;  5CCL A;  2IF4 A;  1OWN A;  1LF8 A;  4LER A;  2VYI A;  3RJV A;  2GRL A;  2J49 A;  3ZYQ A;  4EZL A;  3Q49 B;  3PRE A;  1IQU A;  3T8M A;  4FHK A;  4I9C A;  4GZ5 A;  4CGW A;  4Q69 A;  4Q96 A;  3U4T A;  4I6J A;  2FF4 A;  3MEK A;  4AVX A;  4CCA A;  3CHP A;  4HS2 A;  2JLB A;  2FO7 A;  3LKU A;  1PC2 A;  5BW8 C;  2L9B A;  2OOE A;  3B7S A;  4GPK A;  3IV0 A;  3MKQ B;  3U66 A;  1NP7 A;  1UJJ A;  3BG1 B;  3I3N A;  3K9I A;  4ANX A;  2VGY A;  4KVM A;  2PQR A;  3S2A A;  1HO8 A;  2XPZ A;  3CHS A;  3FUK A;  4GCO A;  5BPP A;  2AXU A;  3E4B A;  3D9N A;  2V0P A;  4WNF A;  4C0M A;  4HVB A;  2XPI A;  2VQ2 A;  1PY1 A;  3OTN A;  4OVU A;  3SZ7 A;  4PS7 A;  4IN3 B;  4J8F A;  4JL0 A;  5C2Y A;  3CGH A;  3I4R B;  2LAI A;  4M3O A;  4UI9 K;  3RKV A;  5AEN A;  3ENE A;  3FUI A;  1WM5 A;  2FUL A;  2PZI A;  4U8H A;  5JJ6 A;  1JUQ A;  3IBE A;  4I1O B;  5KCM A;  4H7Y A;  2J09 A;  2KM4 A;  3LVR E;  2IFU A;  3ML9 A;  1UG3 A;  3LS8 A;  5AJL A;  4GU5 A;  4DJA A;  4GYO A;  3QDN A;  4TUU A;  3MGB A;  4Y6W A;  2VJ8 A;  3QC1 A;  2XCB A;  3LEW A;  3MYV A;  2M63 A;  4L23 A;  4RG6 A;  4AXH A;  1HF8 A;  4G1T A;  2OVB A;  4B94 A;  2KC7 A;  3OAW A;  4U0Z A;  2ION A;  2AW6 A;  3JCK C;  5G05 J;  1Z3X A;  1UN9 A;  2ILR A;  3FY4 A;  1H6K A;  5LFA A;  3U64 A;  3G2W A;  4KXK B;  2PM6 A;  4GZD A;  4HOQ A;  4RSY A;  2XRY A;  2LAH A;  2R59 A;  3EDT B;  2X6J A;  3CVQ A;  4GA1 A;  5BUZ A;  2WXP A;  2XGO A;  4Y6C A;  4URK A;  3SBS A;  1BPO A;  4F7A A;  4JXT A;  1IYG A;  2WXM A;  3LY9 A;  5KJK A;  3SD5 A;  2OND A;  3NZS A;  3B7T A;  1SZ9 A;  3MV2 B;  4FUL A;  3L6A A;  4XI0 A;  2AVP A;  4AV7 A;  1XGW A;  2J4D A;  3ZW3 A;  5FWQ A;  4J0U A;  5DBK A;  4O6F A;  3QAQ A;  1OWP A;  4I6E A;  2VSO E;  1U3C A;  3G2S A;  3NZU A;  2IQC A;  4G2V A;  5E76 A;  1ELK A;  2I2O A;  3QWV A;  4GMJ A;  4UQZ A;  5G2N A;  3PEU B;  3FWV A;  4BX8 A;  3CK8 A;  3IHV A;  2KCL A;  3D9O A;  4JHJ A;  3CVV A;  4JVS A;  1NZN A;  2LSV A;  4LEU A;  4UWL A;  4YVQ C;  4JZY A;  5FQ7 A;  3LJ3 A;  2YHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...