3D9NA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
138
structure length
138
Chain Sequence
EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords RNA-binding protein 16
total genus 57
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9nA00
3CLJA 3D9MA 3G2VA 1XGWA 1HG5A 1LF8A 1HFAA 3RRUA 1UJJA 1H0AA 1EDUA 3G2TA 2LO6A 5LP0A 4FLBA 1EYHA 5CMYA 5CMWA 1JPLA 3D9PA 4GZDA 4Q96A 2DIWA 3LDZA 1JWGA 3G2UA 2V8SE 3ZYQA 3D9NA 3ONKA 3ZYLA 2BF0X 2KM4A 2DCPA 1UJKA 2MOWA 3D9JA 3D9IA 4HFGA 1HF8A 4GZCA 4FU3A 2QY7A 1JWFA 1VDYA 1MHQA 3ONLA 1DVPA 3D9LA 1INZA 1SZAA 3G2SA 5J08A 2L0TB 4AVXA 4NACA 3ZYMA 4JXTA 1X5BA 3ZYKA 1JUQA 1HX8A 3G2WA 3D9OA 1HG2A 1SZ9A 3D9KA 4Q94A 1ELKA 5LOZA 1PY1A 2L0IA
chains in the Genus database with same CATH superfamily
4AEZC 4WUYA 2XPIA 4I1MA 3CR3A 5ENTD 1SA5A 3DBSA 2P9NG 4UWFA 5ENNA 2X3MA 3SD5A 3Q47B 5FWQA 5FZQA 2MHKA 3AU4A 4O60A 2X6IA 3Q9NC 1H19A 5JJTA 3MV3B 3PE3A 3FTWA 2R05A 2DIWA 1MZCA 4GMJA 3ASDA 2AXUA 3FUEA 3CKBA 2OEWA 4J8FA 2ETCA 3PUJA 3D9LA 3PZ3A 3QWVA 2I1KA 4K0RA 3CIAA 4FHJA 4YDWA 4E6HA 2XGMA 4YDEA 3D9MA 1U3CA 3ULEG 3FU5A 2IJGX 4UQXA 2IO2C 3PEUB 1ELWA 2NC9A 4F3VA 1ZBPA 4YVOA 3AG1E 2E2EA 2Y4TA 3BQOA 3E33A 3UPVA 1LD8A 3ASGA 3T5XA 3ZVVA 1FT1A 2EILE 4JZYA 3FHEA 3EIJA 3RAUA 2WQHA 3QDNA 3UIPC 4BETA 3CHMA 1FVFA 1UG3A 4LUNU 3Q79A 3IKOB 5FQ4A 3ZGQA 1HFAA 2PQRA 5LCWC 3CGHA 4MLPA 3NAWA 3Q75A 2GRMA 5EKQD 2R03A 1E7VA 4FC8A 5C2YA 3KAEA 4HORA 5G04C 3EHRA 4JC8A 4WWOA 2Y0BG 1H2TC 2V0PA 3NBNB 3HXEA 1N4SA 3CSFA 3GZSA 1O1TA 1NP7A 1MX2A 3ZHEB 3RK6A 1P5QA 3HXBA 2DCPA 4I9CA 5BPPA 3B95A 4JPSA 2LSUA 4HLLA 2VTBA 1LTXA 3MCXA 5CCMA 3ZYKA 4Q69A 4GYWA 4ANWA 3ZUVB 3CVVA 3G2TA 3GYZA 2J08A 4ANUA 2FEZA 5HQ8A 3ZNGA 5BXOA 4U04A 4DLOA 3FUDA 3ASFA 1BI7B 1E8WA 1H6KA 3LYAA 3TJPA 2PNNA 1NZNA 4OYSA 2J4DA 5BT1A 4GU5A 3QKYA 4XIFA 3DPYA 3S7FA 5T8IA 4HRMB 3CSTA 4HOQA 4HB5A 3B7TA 3MA5A 1N0RA 5AJDA 4AP2A 4N2SA 3LJ3A 3CEQA 3E37A 3QWPA 5AQ9A 4KZCA 2XZTG 2WXHA 4GTTA 3E32A 2LXLA 5A23A 3KSQA 5LCWJ 3JYSA 3TWQA 3TAXA 2WXGA 3UI2A 2XZDG 2QFCA 2EIME 3CLJA 5AIJA 1EF1C 3UT4A 4PS8A 4GB9A 4N3BA 4U8YD 3LY8A 1QBQA 4FU3A 1UOHA 3MGBA 5DIZA 3FUFA 3MKRA 1MQSA 2AW6A 3Q7FA 1HZ4A 4PDXA 4HRLA 4QFVA 3LY7A 4JHKA 1BU9A 1H0AA 4KBQA 1S0PA 3R7QA 5EX0A 2X6HA 1D9SA 3ZRHA 5EILA 2X38A 2ZGDA 2DBAA 2DVWA 1SQMA 4I43A 3LPZA 5KJLA 4ATGA 5FQ8A 2XCBA 3CQGB 3MKQB 1N95A 1UJKA 2DWZA 3UT7A 3UQ3A 1OWOA 1X5BA 3PE4A 5KBAA 3D9KA 4OVVA 3L54A 4AV7A 4RG9A 4L23A 1QZ2A 1KZPA 3S7BA 1TNYA 4JW1A 3DXKG 4CDRA 2OEVA 3G2UA 4CGVA 3OXFA 3ABME 4K5BA 1B89A 2DYSE 2I2OA 1Y8MA 2VSYA 3Q78A 4CZ2D 2XEVA 4NIKA 3FU3A 3CVQA 5BNWA 4TXPA 2KBXA 3NF1A 2XGSA 2GRRB 3T9KA 3D9IA 3EJNA 4BX9A 4QQIA 3J5PA 5AYWD 4I6GA 4UQZA 3L6AA 4I6JA 4PH4B 3AG3E 4GTPA 4BT8A 2L0IA 2J9QA 4B0ZA 3L9TA 3HVEB 3ONKA 4DX5D 4W9RA 4EECA 4GYYA 4N5QA 2EQXA 4HS2A 3FY4A 3PNLB 2EIJE 5BV0A 3SNXA 3JXJA 4A1SA 2LAIA 2QYJA 3CK7A 2UY1B 3HXCA 4CT0A 2KXPC 3D9PA 3ZKJA 1KLXA 2WXMA 4Z68A 5J90A 1TN6A 1INZA 2KC7A 3CHSA 3TWTA 1V55E 2Y3AA 4A3TA 2XS8A 3TG4A 1RW2A 1S64A 4TUUA 4WNDA 4D10C 3LVRE 1K1BA 3TG5A 3QK0A 5CBOA 1JCSA 2GW1A 2PQNA 2P9UG 3U4TA 1OT8A 2RFMA 4FP7A 5EDSA 1MX4A 4NRHB 4J8YA 3L17A 5EYLA 5HI7A 3ASOE 3APFA 1E8XA 3AG2E 3QB2A 1U3DA 2BF0X 1S70B 3OXGA 4JB8P 4V3IA 2YQ8A 2BUGA 4YNDA 4PS7A 3LVQE 4HRNA 3QAQA 4EBAA 3CVWA 1AWCB 5FQ7A 4J0UA 5ANRA 4APFA 3Q5MA 2WMOA 2KM4A 4IN3B 3I5PA 4AM9A 4IYPA 3UT8A 1KZOA 2R02A 3C3OA 5EIDA 4GTSA 3JCKC 2BKGA 1A17A 3URZA 3V30A 2OV8A 2VGEA 1E8YA 4HI8A 1ELRA 5CHEE 4F1SA 2HO1A 3D9JA 3FTVA 1Z3YA 3ZXPA 2BEDA 2V5FA 4IULA 3EU9A 2XRYA 2J8SD 1NFIE 1AP7A 3ENEA 2VTBB 1IYGA 1SA4A 2LO6A 3S7DA 4KZ0A 1TNZA 4JD2G 1RZ4A 4U96D 5ITZF 3APCA 1TNBA 1H6PA 4ILIA 2GRPB 3L08A 1IHGA 2F8XK 2FO7A 3ESLA 5EX3A 3Q7AA 4GA0A 2KCLA 3LDZA 2FO1E 2R59A 3V31A 5AQAA 3ISMC 3UTMA 3R7RA 4LG6A 5ENSD 4B89A 3ZN3A 4XE0A 5KWDA 1E96B 1SZ9A 5FZRA 5D0QD 3VLDA 3FDHA 5A7DB 3NOCD 4LEUA 3SO8A 4APOA 2YHEA 4N2QA 1IHBA 3LCAA 4NURA 4XI9A 2C0LA 1NL4A 2RKKA 3G2SA 2XENA 4U0SA 1MYOA 1UN9A 4I17A 4O1PA 5HRYA 3FTYA 3UINC 1OCCE 1DC2A 4GTVA 5D0OD 3ULQA 2RG8A 5AN8A 3R9MA 3NOGD 3FUJA 4RQIA 1O5MA 3SQVA 5JA4D 1Y6IA 1IXVA 3IBEA 2IONA 1JWFA 2XS1A 3JQ0A 4ANVA 4DI3A 3JUIA 3EU5A 2YINA 5M72A 3RRUA 5CEAA 5DBKA 4DLQA 4WNEA 1KPSB 3E4BA 1PAQA 4CGWA 4EZLA 3ZFWA 4I6EA 5KNGA 3PS6A 2HR2A 3RRMB 2ZGGA 4FJYA 1EDUA 3QC1A 3BG0B 3B7UX 4F1PA 4L2LA 4OVUA 3PZDA 5ENPD 1HXIA 1DVPA 1FT2A 3ZW3A 4BSZB 3DWLG 4F6RD 4GCOA 5BXUA 1TYQG 1HU3A 2GRNB 3LXUX 2KCKA 1OCZE 4CDNA 3AS5A 2QC9A 3FUNA 3TWSA 3T8KA 4A55A 3GW4A 1YCSB 4I2WA 5KJNA 5FJYA 2LAHA 4UUCA 1TNUA 1DCQA 2KCVA 3DPDA 4CDMA 3HDXA 4C0EA 4J7WA 1N4QA 3ONLA 3FFLA 1N4RA 4N3AA 3L82A 2VYIA 2P9IG 5A6CA 3FH7A 4XKBA 4CYMD 2RD0A 3OTNA 4K5CA 2V4HC 4G24A 1QNFA 4ANXA 2HM8A 4XX5A 2L0TB 3FWVA 4LRZA 3NB2A 3WXXA 2VGXA 3LKUA 3E34A 4B8AA 4MS6A 3EUVA 4J8SA 1PC2A 4B8CB 2QYUA 4A3VA 4WWNA 2L6BA 4CRWA 4I2ZA 5CRVA 5AENA 5LOZA 4AXHA 2AXVA 1H2VC 4R7LA 2H6IA 5G05J 1TJFA 3G2VA 4YDOA 2LXMA 2GRQB 1OUVA 4DRXE 3MKQA 3DRAA 5AAOA 2XEEA 1WM5A 4ME2A 1SW6A 3TXNA 3P2BA 4PUCA 2ZXWE 4UWHA 3UM1A 3HYMB 4DJAA 3F6QA 1ZB1A 4G11A 2IU1A 1TN8A 4BY6A 4AVXA 3P1UA 4JXTA 4J8EA 2FI7A 1ELKA 2Y1LE 3D9OA 3ZEFA 4N3CA 3L13A 4M7CA 5G55A 4GPKA 2X6KA 1TR4A 3DEOA 4XI0A 3JQ1A 3HVEA 3E30A 5B1BE 1UW4B 3LY9A 3D3MA 3SI5A 2NSZA 2P2CP 4NACA 3UUXA 4JHRA 5D66A 3IXEA 3DSUA 2FF4A 3RRNB 2R5SA 5ENQD 1BI8B 1A5EA 3W9GA 3B7BA 3CVNA 5JJ6A 3X2QE 4NQ0A 4XEIG 2OCCE 3SY2A 4G1TA 4HFGA 3U3WA 4GZ5A 2WMNA 3PVLA 3CVXA 4GAAA 4GTQA 4I1OB 2J09A 3TL5A 4HQDA 2ETAA 4TUMA 1JUQA 1E90A 1JCQA 4UWGA 2I1JA 3Q15A 3OXLA 1N9AA 3HXFA 3FTUA 4N5CA 3ABLE 1OCRE 4RSYA 3TWXA 3FH8A 5ENOD 4O1OA 2KZTA 2Q7FA 3UM0A 3Q73A 1NA3A 2ETBA 1IQUA 4JA9A 1XGWA 4F53A 4HLEA 4UI9J 4URKA 4I9EA 3ZYLA 1OXJA 3DSWA 2HYZA 4FHKA 4BFRA 3BG1B 4A1GA 1PY1A 3VTXA 5B3SE 4A63B 3JXIA 3MV2B 4Q96A 5BW8C 3DSTA 3KSLA 4LNUD 2WM9A 4F7AA 4H7YA 2WQ6A 4G25A 3HG0D 1O1SA 1MJ0A 5C1DA 3U9WA 4N39A 3ZYQA 2P58C 4BERA 3CV0A 4UQYA 5LFAA 1Z5SC 3SF4A 2LSVA 2OOEA 4C0MA 4G8LA 1HG2A 2OVBA 1X81A 3J5QB 2A5EA 1QQEA 4BWRA 2IOLA 2WXPA 1BD8A 3UIOC 2IF4A 3PZ2A 3VLFA 4DX6D 4L2YA 2RFAA 3R9AB 2VQ2A 2CG2A 3AJIA 4C48B 3VLEA 1TEZA 3V79K 2AVPA 5E76A 4HXIA 2DZOA 2YHCA 1OY3D 2XEHA 4FLBA 3CVLA 5CMYA 3UXGA 4TRQA 3MX3A 3FEXA 3RO2A 2IO3C 2EIKE 3HRAA 3RJVA 3UKRG 4FULA 3RU0A 1K8KG 1IQRA 3Q4AB 5BV1A 2ZU6B 5FQ6A 1U2VG 3C3QA 3GZ2A 4BEPA 3ZIMA 4B94A 1LF8A 3FTSA 1YMPA 3FU6A 3FP3A 1O1RA 1YYHA 4LERA 2P9KG 3IHYA 4HNAD 1S63A 3IEGA 2A5UA 1EPUA 4MBGA 3SHFA 2IY0C 1Z6TA 3KS2A 3MZLB 3PEVB 4J6IA 4DX2A 3C3RA 2QZAA 2MOWA 1OWPA 4GZCA 4HI9A 2J49A 5G05C 4DX7D 5JHAA 3W9FA 2PM7A 3HHMA 3L22A 4M3OA 4XKCA 4GA1A 3ASHA 4UWLA 4C9BB 1D8DA 3UMVA 3LS8A 2XCCA 4E85A 3ML9A 2BTDA 4HOTA 1D8EA 2FBNA 3FTZA 2GROB 1W3BA 2H6FA 2XGOA 1OWMA 3B7SA 3IV0A 3BEEA 3NZSA 3LJNA 3K9IA 4JEUA 4PS3A 3U64A 4U0UA 4AIFA 3U66A 1LD7A 3UKUG 2ZIRA 4EQFA 3I4GA 3TWUA 4U63A 3BU8A 2XQ0A 4KYOB 1JPLA 3FEYA 1N52A 2Y69E 2UWJG 5KNHD 4LNBA 4L7TA 2FULA 2VSOE 3I3NA 4GA2A 4X8QA 2WXFA 3FTXA 3HXDA 5JJ7A 2P9LG 5ARGA 2F0YA 3CHRA 4U8VD 1HS6A 3CVPA 1YA0A 2WQ7A 4LSZE 5LX8A 2WVIA 4AOFA 2VGXB 1HG5A 4G26A 1E7UA 4KT6B 1L5JA 3AS4A 5T4YA 1WY6A 4ZHBA 3FULA 2VJ8A 4U95D 2JLBA 4WAFA 4U7EB 5IY5E 3G2WA 4J8DA 5AARA 4ZFHA 4HBDA 5FTPA 2AXZA 2H6HA 3DSSA 3CVYA 4HVBA 4HOUA 2IOSA 1N4PA 4EHMA 3CK8A 4DI4A 1JWGA 2A4ZA 2WXKA 2MYOA 4LNGA 3AG4E 2QY7A 1JCRA 4MRUA 2F8YA 3CHOA 2KATA 3RKVA 4GMLA 4GTMA 2PZIA 3T8MA 3DSXA 3TWRA 3PZ1A 3MYVA 3TXMA 4ATZD 3FUIA 2C0MA 5H7PA 3SFXA 2XRZA 4ILHB 2ONDA 4UI9C 1HF8A 4TXQA 3PUKA 3CK9A 4Y6WA 2L6JA 3APDA 5CEDB 3V2XA 1E8ZA 1FCHA 3ML8A 2M63A 3HIZA 2IEJA 1N0QA 4RLYA 1BPOA 1DCEA 4FLHA 2CHZA 5ANLA 1OWNA 4G8KA 1N54A 2VGYA 2E0IA 1WAO1 3PNTB 1VDYA 1MHQA 3KEZA 4O6FA 3QOUA 3DSVA 3CQCB 5CCLA 4L1BA 3T5VA 1H6OA 5G04J 5D2MC 3SBSA 1SVXA 1HO8A 4P29A 3GZ1A 3O48A 4ILGA 3OAWA 3MJWA 4ACKA 5BUZA 3PREA 1MX6A 5ENRD 4HOSA 3WG7E 5JHBA 2BKKB 1TJCA 3ZHEA 3V2OA 3EHMA 4AJWA 3Q49B 2J4BA 2WXOA 5E75A 4YVQC 3BUAA 2VSNA 3EHNA 1OWLA 4JL0A 1NI1A 5EN5D 3EIQC 1IKND 2F37A 2V5QC 1TNOA 3AAAC 5CECB 4CCAA 5HS0A 1KT0A 1HE8A 4KVOA 3PZ4A 1N11A 3ESKA 2LNIA 3C5RA 1UN8A 3AS8A 5EYPF 3UM3A 4CT4A 4FJZA 1KT1A 5FIOA 2MRIA 3QNKA 5KCMA 3N71A 3QARA 4TXRA 4BX8A 4U0ZA 1H2UA 4KMOA 3B7RL 1K1AA 1Q2ZA 3DEPA 3AU5A 2H6GA 3ASNE 4GZ6A 3TWVA 4I1AA 5LP0A 5KJKA 4AY6A 4EZJA 2JABA 4GCNA 4H7XA 5FZSA 2WXNA 4L9PA 4ABNA 2NXPA 4U07A 1HX8A 4GMRA 2JEKA 3CHPA 2V4LA 2GRLA 3TGOA 2WXRA 2Y4UA 3SFYA 3D9HA 3CVUA 4LCTA 3RSEG 2AWIA 4DPRA 5AJLA 3FH5A 2DZNA 2R2LA 5CRUA 5FINA 2B6CA 2IFUA 2NYJA 3FUKA 4DUIA 4EBAG 4DK5A 3UX4A 2AJAA 3RO3A 4UI9K 4GTOA 4GPMA 5J08A 2CHWA 4YDYA 1ZU2A 4FA6A 4KVMA 3NQPA 1V54E 4RG6A 5JMND 3O4ZA 2X6JA 4WNFA 3EDTB 2HE0A 5T3RA 4OAUC 1GW6A 4DX1A 5FT9A 5B1AE 3C72A 3SZ7A 5G2NA 3PRZA 4JVSA 4TV3A 2C2LA 4UWKA 5EIBE 3ZXSA 2WXJA 4K5AB 3PH0C 3MEKA 1UJJA 4G23A 5ARFA 2IQCA 3EHQA 1BLXB 2I6HA 4GZDA 2WB2A 3JUEA 2WXIA 2CG3A 5KJMA 1Z3XA 1K3ZD 1G3NB 2ILRA 2DYRE 1DNPA 3SFZA 3FUHA 4EZKA 3C98A 5HKPA 3QWWA 4BTBA 1EYHA 4BTAA 2XPZA 3SBTB 4BSXA 1HH8A 2XPYA 4OAVB 2WXQA 3Q9UC 3ABKE 4FADA 4KXKB 4MKTA 5CERB 2PM6A 3FU0A 4GZ3A 4Y6CA 4AY5A 3RIBA 1QYMA 2J07A 4B93B 2XHEA 2V8SE 3IHVA 3CKCA 4IRUA 3KD7A 3ZYMA 1N94A 5AQ7A 4GTRA 3S7JA 3QJZA 4U8HA 2R17C 1FVHA 4GYOA 1OCOE 4K03A 4CEMA 4EPZA 4ACLA 3L16A 4JHJA 2YNQA 2ZISA 3B13A 2WXLA 1FPPA 4XZ4A 3UM2A 4JEHA 4Q94A 3SGHA 3I4RB 5CBNA 3LEWA 2WPVA 3KEAA 2X6FA 3NZUA 2KZTB 3TWWA 3S2AA 4WWPA 2UY1A 2CHXA 4G2VA 2PL2A 2OVFA 3ZPJA 1XNFA 1SZAA 2L9BA 5AQBA 1NA0A 2EINE 2B0OE 4RVBA 3VTYA 1WDYA 2LUHA 3ZU7B 2P9SG 5CMWA 2P9PG 1TN7A 3CHQA 3ULYA 3D9NA 2GGFA 2CFZA 1WG0A 3PDNA 4WNGA 2VSXE 4JA7A 3FUMA 4BT9A 3DXMG 2I9CA 2CFUA 4BESA
chains in the Genus database with same CATH topology
3L13A 4AEZC 4WUYA 5G55A 3TXMA 4GPKA 2XPIA 2X6KA 4I1MA 3CR3A 3FUIA 2C0MA 3TG5A 3QK0A 3DBSA 2XRZA 4ILHB 4UWFA 2ONDA 4XI0A 2GW1A 3JQ1A 5ENNA 2PQNA 2X3MA 3HVEA 3U4TA 4UI9C 3SD5A 1UW4B 3Q47B 5FZQA 1HF8A 5FWQA 4FP7A 5EDSA 3LY9A 3D3MA 2MHKA 3SI5A 3PUKA 3AU4A 3CK9A 2NSZA 4Y6WA 2L6JA 2X6IA 3APDA 4NACA 3UUXA 4JHRA 1E8ZA 1FCHA 1H19A 4NRHB 3ML8A 3L17A 2FF4A 2M63A 3RRNB 5HI7A 5JJTA 4N3CA 2R5SA 3HIZA 3MV3B 3APFA 3PE3A 5JJ6A 1E8XA 1BPOA 3CVNA 4FLHA 4NQ0A 2CHZA 3FTWA 3QB2A 1U3DA 5ANLA 1OWNA 2DIWA 4G1TA 2BF0X 4GMJA 1N54A 3ASDA 4HFGA 3OXGA 2AXUA 2VGYA 3FUEA 4GZ5A 2E0IA 3CKBA 3U3WA 1WAO1 4J8FA 3PUJA 4V3IA 3PNTB 2WMNA 1VDYA 2YQ8A 1MHQA 2BUGA 3KEZA 3D9LA 3PVLA 3QWVA 2I1KA 4GAAA 3CIAA 3LVQE 4FHJA 4K0RA 4I1OB 4O6FA 3QOUA 3QAQA 4E6HA 4EBAA 2XGMA 2J09A 3CQCB 3TL5A 5CCLA 3CVWA 5FQ7A 4L1BA 3T5VA 1JUQA 5G04J 3SBSA 3D9MA 1U3CA 1E90A 4UWGA 3FU5A 2I1JA 4J0UA 3Q15A 3OXLA 2IJGX 1HO8A 4UQXA 4P29A 5ANRA 3PEUB 3GZ1A 3O48A 4APFA 3FTUA 4N5CA 3Q5MA 1ELWA 2WMOA 4ILGA 2KM4A 4IN3B 4RSYA 2NC9A 4F3VA 3FH8A 3I5PA 4AM9A 4IYPA 3OAWA 2KZTA 3MJWA 3UT8A 1ZBPA 4YVOA 3JCKC 2E2EA 4ACKA 2Y4TA 2Q7FA 5BUZA 3PREA 3UPVA 3ASGA 3ZVVA 3T5XA 4HOSA 1NA3A 1A17A 4JZYA 3FHEA 3URZA 1IQUA 3EIJA 4JA9A 1XGWA 2OV8A 3CVXA 5JHBA 1E8YA 4F53A 1ELRA 1TJCA 4HLEA 2WQHA 3QDNA 3ZHEA 5CHEE 4UI9J 4URKA 4F1SA 4I9EA 2HO1A 3ZYLA 3CHMA 1FVFA 3D9JA 3FTVA 3EHMA 1Z3YA 4AJWA 3Q49B 1UG3A 2HYZA 2J4BA 2WXOA 4LUNU 5E75A 2V5FA 4IULA 4FHKA 4YVQC 4BFRA 2VSNA 3BG1B 2XRYA 3IKOB 3EHNA 1OWLA 4JL0A 4A1GA 1PY1A 5FQ4A 3VTXA 3ENEA 3ZGQA 3EIQC 2VTBB 1IYGA 1HFAA 2PQRA 5LCWC 3MV2B 2LO6A 3S7DA 4KZ0A 4Q96A 3CGHA 4MLPA 4CCAA 1KT0A 2GRMA 5EKQD 1HE8A 4KVOA 5BW8C 1E7VA 4FC8A 3APCA 5C2YA 3KAEA 3ESKA 4ILIA 4HORA 2LNIA 2WM9A 4F7AA 3L08A 1UN8A 5G04C 1IHGA 3AS8A 4JC8A 4WWOA 1H2TC 4H7YA 4CT4A 2V0PA 2WQ6A 4FJZA 1KT1A 4G25A 2FO7A 3ESLA 3CSFA 3GZSA 5C1DA 5EX3A 1NP7A 2KCLA 4GA0A 3U9WA 3LDZA 4N39A 1P5QA 3RK6A 3ZHEB 3ZYQA 2P58C 2DCPA 2R59A 2MRIA 4I9CA 5BPPA 3QNKA 5KCMA 4JPSA 3CV0A 4UQYA 3R7RA 3N71A 5LFAA 2LSUA 3SF4A 4B89A 2VTBA 2LSVA 3QARA 4BX8A 2OOEA 4U0ZA 3ZN3A 4C0MA 1H2UA 4XE0A 3MCXA 4KMOA 3ZYKA 3B7RL 5CCMA 4Q69A 1E96B 1HG2A 1SZ9A 3AU5A 4GYWA 4ANWA 2OVBA 5FZRA 4GZ6A 5D0QD 3VLDA 3FDHA 3CVVA 3G2TA 4I1AA 5A7DB 3GYZA 4WNDA 5LP0A 2J08A 4LEUA 4APOA 5KJKA 4AY6A 2YHEA 1QQEA 4ANUA 4EZJA 2FEZA 4N2QA 3LCAA 4NURA 5HQ8A 4GCNA 4XI9A 2IOLA 4BWRA 2WXPA 2C0LA 4U04A 4H7XA 5FZSA 2IF4A 2WXNA 3VLFA 4L2YA 4ABNA 4DLOA 3FUDA 3G2SA 2NXPA 3R9AB 2VQ2A 2CG2A 3ASFA 4U0SA 4PS7A 4U07A 1HX8A 1UN9A 4I17A 3VLEA 1E8WA 2JEKA 1H6KA 3CHPA 3FTYA 1TEZA 2AVPA 5E76A 4HXIA 2V4LA 2GRLA 3TGOA 3LYAA 2YHCA 2WXRA 5D0OD 2Y4UA 4FLBA 3TJPA 3CVLA 5CMYA 3ULQA 4OYSA 1NZNA 2RG8A 4TRQA 2J4DA 3FUJA 3MX3A 3FEXA 5BT1A 4GU5A 3QKYA 3RO2A 1Y6IA 3RJVA 4XIFA 3CVUA 4FULA 4LCTA 3IBEA 2IONA 1JWFA 3RU0A 3S7FA 5T8IA 1IQRA 3Q4AB 5BV1A 2AWIA 2ZU6B 4DPRA 5FQ6A 3GZ2A 3CSTA 3JQ0A 5AJLA 4HOQA 4ANVA 4DI3A 3B7TA 3MA5A 5AJDA 3FH5A 4AP2A 4N2SA 3LJ3A 3CEQA 2YINA 3ZIMA 4B94A 1LF8A 5M72A 3QWPA 3FTSA 4KZCA 3RRUA 3FU6A 5DBKA 2WXHA 4DLQA 2IFUA 3FP3A 4WNEA 3FUKA 4EBAG 3E4BA 4DK5A 5A23A 3UX4A 1PAQA 4LERA 4CGWA 5LCWJ 3JYSA 3IHYA 3RO3A 4UI9K 4EZLA 3ZFWA 3IEGA 2A5UA 5J08A 3TAXA 1EPUA 3SHFA 2CHWA 2WXGA 1Z6TA 3KS2A 3ZEFA 4I6EA 3PS6A 1ZU2A 2QFCA 3MZLB 4KVMA 4FA6A 3NQPA 2HR2A 3CLJA 3PEVB 5AIJA 3RRMB 1EF1C 4RG6A 4FJYA 1EDUA 3O4ZA 4J6IA 3QC1A 2X6JA 4WNFA 3EDTB 3UT4A 4PS8A 3BG0B 5T3RA 3B7UX 4GB9A 4L2LA 2MOWA 4N3BA 1OWPA 1GW6A 4OVUA 3PZDA 5FT9A 4GZCA 3LY8A 4FU3A 3SZ7A 5G2NA 2J49A 1HXIA 3MGBA 3PRZA 5DIZA 1DVPA 3FUFA 4JVSA 5G05C 3MKRA 1MQSA 2AW6A 2C2LA 4TV3A 3ZW3A 4UWKA 5JHAA 3ZXSA 1HZ4A 4GCOA 2PM7A 2WXJA 4PDXA 4QFVA 1HU3A 3PH0C 3LY7A 3HHMA 3MEKA 3L22A 1UJJA 1H0AA 3LXUX 4JHKA 4G23A 4KBQA 1S0PA 3R7QA 2KCKA 5ARFA 2IQCA 4M3OA 4XKCA 2I6HA 4GA1A 4GZDA 3ASHA 5EX0A 4CDNA 3AS5A 2WB2A 4UWLA 4C9BB 3FUNA 2X6HA 3UMVA 3LS8A 2WXIA 2CG3A 5KJMA 3ZRHA 2XCCA 4A55A 2X38A 4E85A 3GW4A 3ML9A 2BTDA 4HOTA 1Z3XA 4YNDA 2FBNA 4I2WA 2ILRA 5KJNA 5FJYA 2LAHA 3FTZA 1DNPA 3SFZA 1W3BA 3FUHA 4EZKA 3C98A 2XGOA 2DBAA 4I43A 1SQMA 3LPZA 1OWMA 2KCVA 3QWWA 3B7SA 5KJLA 3IV0A 4BTBA 3BEEA 3NZSA 4ATGA 3MYVA 1EYHA 4BTAA 3DPDA 2XPZA 3SBTB 5FQ8A 4CDMA 2XCBA 3CQGB 1HH8A 4BSXA 2XPYA 3K9IA 3HDXA 3MKQB 4C0EA 4JEUA 4PS3A 1UJKA 2WXQA 3U64A 4U0UA 4AIFA 3U66A 3UT7A 3ONLA 3FFLA 3UQ3A 1OWOA 4FADA 4EQFA 3I4GA 1X5BA 4KXKB 4MKTA 4U63A 3PE4A 2PM6A 3FU0A 4N3AA 3D9KA 4GZ3A 4Y6CA 4OVVA 3L54A 4AV7A 4AY5A 2XQ0A 3RIBA 4RG9A 2VYIA 2J07A 4KYOB 4L23A 1QZ2A 5A6CA 3S7BA 3FH7A 1JPLA 4JW1A 4CDRA 2XHEA 1N52A 3G2UA 3FEYA 2V8SE 2RD0A 4XKBA 3OTNA 4CGVA 3IHVA 3OXFA 2UWJG 3CKCA 4G24A 1QNFA 4L7TA 4ANXA 2HM8A 4XX5A 1B89A 4IRUA 2I2OA 2FULA 2L0TB 3KD7A 3ZYMA 1Y8MA 2VSYA 3FWVA 4LRZA 2XEVA 2VSOE 3I3NA 3QJZA 4GA2A 4U8HA 3S7JA 2R17C 3WXXA 3FU3A 3CVQA 1FVHA 2VGXA 3LKUA 5BNWA 2WXFA 3FTXA 4GYOA 4K03A 4CEMA 3NF1A 4B8AA 4MS6A 4EPZA 5JJ7A 4ACLA 3L16A 2XGSA 4J8SA 5ARGA 1PC2A 3D9IA 4JHJA 3EJNA 4B8CB 4BX9A 3CHRA 4A3VA 4WWNA 2YNQA 1HS6A 4CRWA 4I2ZA 3CVPA 5AYWD 3B13A 4I6GA 1YA0A 4UQZA 3L6AA 2WXLA 4I6JA 4XZ4A 4PH4B 5AENA 2WQ7A 5LX8A 5LOZA 2WVIA 4JEHA 4AOFA 4Q94A 3SGHA 4AXHA 2AXVA 3I4RB 3LEWA 1H2VC 2WPVA 2X6FA 3NZUA 4R7LA 2L0IA 2VGXB 4BT8A 5G05J 1TJFA 2J9QA 3G2VA 2KZTB 1HG5A 4B0ZA 4G26A 1E7UA 1OUVA 4KT6B 3S2AA 1L5JA 3AS4A 4WWPA 5T4YA 2UY1A 1WY6A 2CHXA 3HVEB 4G2VA 2PL2A 3ONKA 2OVFA 3MKQA 3FULA 1WM5A 4ME2A 4W9RA 3TXNA 2VJ8A 2JLBA 4WAFA 4EECA 3ZPJA 1XNFA 3P2BA 4GYYA 1SZAA 2L9BA 4PUCA 2EQXA 4HS2A 3G2WA 3FY4A 4UWHA 3PNLB 4J8DA 1NA0A 3HYMB 4DJAA 5BV0A 5FTPA 3SNXA 2AXZA 4A1SA 4RVBA 3VTYA 4HVBA 2LAIA 3CVYA 3CK7A 4G11A 2UY1B 5CMWA 4HOUA 2IOSA 4CT0A 3D9PA 3CK8A 3CHQA 4DI4A 1JWGA 2A4ZA 2WXKA 3D9NA 2IU1A 2CFZA 2GGFA 3PDNA 4BY6A 1KLXA 4WNGA 2WXMA 2QY7A 2VSXE 5J90A 4JA7A 4MRUA 1INZA 2KC7A 3CHSA 3CHOA 3FUMA 4AVXA 3P1UA 2KATA 4JXTA 3RKVA 4GMLA 2PZIA 2Y3AA 4BT9A 4A3TA 4J8EA 2FI7A 3T8MA 3TG4A 1ELKA 4TUUA 3LVRE 4D10C 3D9OA 2I9CA 2CFUA 3JUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLJ A;  3D9M A;  3G2V A;  1XGW A;  1HG5 A;  1LF8 A;  1HFA A;  3RRU A;  1UJJ A;  1H0A A;  1EDU A;  3G2T A;  2LO6 A;  5LP0 A;  4FLB A;  1EYH A;  5CMY A;  5CMW A;  1JPL A;  3D9P A;  4GZD A;  4Q96 A;  2DIW A;  3LDZ A;  1JWG A;  3G2U A;  2V8S E;  3ZYQ A;  3D9N A;  3ONK A;  3ZYL A;  2BF0 X;  2KM4 A;  2DCP A;  1UJK A;  2MOW A;  3D9J A;  3D9I A;  4HFG A;  1HF8 A;  4GZC A;  4FU3 A;  2QY7 A;  1JWF A;  1VDY A;  1MHQ A;  3ONL A;  1DVP A;  3D9L A;  1INZ A;  1SZA A;  3G2S A;  5J08 A;  2L0T B;  4AVX A;  4NAC A;  3ZYM A;  4JXT A;  1X5B A;  3ZYK A;  1JUQ A;  1HX8 A;  3G2W A;  3D9O A;  1HG2 A;  1SZ9 A;  3D9K A;  4Q94 A;  1ELK A;  5LOZ A;  1PY1 A;  2L0I A; 
#chains in the Genus database with same CATH topology
 4AEZ C;  4WUY A;  2XPI A;  4I1M A;  3CR3 A;  5ENT D;  1SA5 A;  3DBS A;  2P9N G;  4UWF A;  5ENN A;  2X3M A;  3SD5 A;  3Q47 B;  5FWQ A;  5FZQ A;  2MHK A;  3AU4 A;  4O60 A;  2X6I A;  3Q9N C;  1H19 A;  5JJT A;  3MV3 B;  3PE3 A;  3FTW A;  2R05 A;  2DIW A;  1MZC A;  4GMJ A;  3ASD A;  2AXU A;  3FUE A;  3CKB A;  2OEW A;  4J8F A;  2ETC A;  3PUJ A;  3D9L A;  3PZ3 A;  3QWV A;  2I1K A;  4K0R A;  3CIA A;  4FHJ A;  4YDW A;  4E6H A;  2XGM A;  4YDE A;  3D9M A;  1U3C A;  3ULE G;  3FU5 A;  2IJG X;  4UQX A;  2IO2 C;  3PEU B;  1ELW A;  2NC9 A;  4F3V A;  1ZBP A;  4YVO A;  3AG1 E;  2E2E A;  2Y4T A;  3BQO A;  3E33 A;  3UPV A;  1LD8 A;  3ASG A;  3T5X A;  3ZVV A;  1FT1 A;  2EIL E;  4JZY A;  3FHE A;  3EIJ A;  3RAU A;  2WQH A;  3QDN A;  3UIP C;  4BET A;  3CHM A;  1FVF A;  1UG3 A;  4LUN U;  3Q79 A;  3IKO B;  5FQ4 A;  3ZGQ A;  1HFA A;  2PQR A;  5LCW C;  3CGH A;  4MLP A;  3NAW A;  3Q75 A;  2GRM A;  5EKQ D;  2R03 A;  1E7V A;  4FC8 A;  5C2Y A;  3KAE A;  4HOR A;  5G04 C;  3EHR A;  4JC8 A;  4WWO A;  2Y0B G;  1H2T C;  2V0P A;  3NBN B;  3HXE A;  1N4S A;  3CSF A;  3GZS A;  1O1T A;  1NP7 A;  1MX2 A;  3ZHE B;  3RK6 A;  1P5Q A;  3HXB A;  2DCP A;  4I9C A;  5BPP A;  3B95 A;  4JPS A;  2LSU A;  4HLL A;  2VTB A;  1LTX A;  3MCX A;  5CCM A;  3ZYK A;  4Q69 A;  4GYW A;  4ANW A;  3ZUV B;  3CVV A;  3G2T A;  3GYZ A;  2J08 A;  4ANU A;  2FEZ A;  5HQ8 A;  3ZNG A;  5BXO A;  4U04 A;  4DLO A;  3FUD A;  3ASF A;  1BI7 B;  1E8W A;  1H6K A;  3LYA A;  3TJP A;  2PNN A;  1NZN A;  4OYS A;  2J4D A;  5BT1 A;  4GU5 A;  3QKY A;  4XIF A;  3DPY A;  3S7F A;  5T8I A;  4HRM B;  3CST A;  4HOQ A;  4HB5 A;  3B7T A;  3MA5 A;  1N0R A;  5AJD A;  4AP2 A;  4N2S A;  3LJ3 A;  3CEQ A;  3E37 A;  3QWP A;  5AQ9 A;  4KZC A;  2XZT G;  2WXH A;  4GTT A;  3E32 A;  2LXL A;  5A23 A;  3KSQ A;  5LCW J;  3JYS A;  3TWQ A;  3TAX A;  2WXG A;  3UI2 A;  2XZD G;  2QFC A;  2EIM E;  3CLJ A;  5AIJ A;  1EF1 C;  3UT4 A;  4PS8 A;  4GB9 A;  4N3B A;  4U8Y D;  3LY8 A;  1QBQ A;  4FU3 A;  1UOH A;  3MGB A;  5DIZ A;  3FUF A;  3MKR A;  1MQS A;  2AW6 A;  3Q7F A;  1HZ4 A;  4PDX A;  4HRL A;  4QFV A;  3LY7 A;  4JHK A;  1BU9 A;  1H0A A;  4KBQ A;  1S0P A;  3R7Q A;  5EX0 A;  2X6H A;  1D9S A;  3ZRH A;  5EIL A;  2X38 A;  2ZGD A;  2DBA A;  2DVW A;  1SQM A;  4I43 A;  3LPZ A;  5KJL A;  4ATG A;  5FQ8 A;  2XCB A;  3CQG B;  3MKQ B;  1N95 A;  1UJK A;  2DWZ A;  3UT7 A;  3UQ3 A;  1OWO A;  1X5B A;  3PE4 A;  5KBA A;  3D9K A;  4OVV A;  3L54 A;  4AV7 A;  4RG9 A;  4L23 A;  1QZ2 A;  1KZP A;  3S7B A;  1TNY A;  4JW1 A;  3DXK G;  4CDR A;  2OEV A;  3G2U A;  4CGV A;  3OXF A;  3ABM E;  4K5B A;  1B89 A;  2DYS E;  2I2O A;  1Y8M A;  2VSY A;  3Q78 A;  4CZ2 D;  2XEV A;  4NIK A;  3FU3 A;  3CVQ A;  5BNW A;  4TXP A;  2KBX A;  3NF1 A;  2XGS A;  2GRR B;  3T9K A;  3D9I A;  3EJN A;  4BX9 A;  4QQI A;  3J5P A;  5AYW D;  4I6G A;  4UQZ A;  3L6A A;  4I6J A;  4PH4 B;  3AG3 E;  4GTP A;  4BT8 A;  2L0I A;  2J9Q A;  4B0Z A;  3L9T A;  3HVE B;  3ONK A;  4DX5 D;  4W9R A;  4EEC A;  4GYY A;  4N5Q A;  2EQX A;  4HS2 A;  3FY4 A;  3PNL B;  2EIJ E;  5BV0 A;  3SNX A;  3JXJ A;  4A1S A;  2LAI A;  2QYJ A;  3CK7 A;  2UY1 B;  3HXC A;  4CT0 A;  2KXP C;  3D9P A;  3ZKJ A;  1KLX A;  2WXM A;  4Z68 A;  5J90 A;  1TN6 A;  1INZ A;  2KC7 A;  3CHS A;  3TWT A;  1V55 E;  2Y3A A;  4A3T A;  2XS8 A;  3TG4 A;  1RW2 A;  1S64 A;  4TUU A;  4WND A;  4D10 C;  3LVR E;  1K1B A;  3TG5 A;  3QK0 A;  5CBO A;  1JCS A;  2GW1 A;  2PQN A;  2P9U G;  3U4T A;  1OT8 A;  2RFM A;  4FP7 A;  5EDS A;  1MX4 A;  4NRH B;  4J8Y A;  3L17 A;  5EYL A;  5HI7 A;  3ASO E;  3APF A;  1E8X A;  3AG2 E;  3QB2 A;  1U3D A;  2BF0 X;  1S70 B;  3OXG A;  4JB8 P;  4V3I A;  2YQ8 A;  2BUG A;  4YND A;  4PS7 A;  3LVQ E;  4HRN A;  3QAQ A;  4EBA A;  3CVW A;  1AWC B;  5FQ7 A;  4J0U A;  5ANR A;  4APF A;  3Q5M A;  2WMO A;  2KM4 A;  4IN3 B;  3I5P A;  4AM9 A;  4IYP A;  3UT8 A;  1KZO A;  2R02 A;  3C3O A;  5EID A;  4GTS A;  3JCK C;  2BKG A;  1A17 A;  3URZ A;  3V30 A;  2OV8 A;  2VGE A;  1E8Y A;  4HI8 A;  1ELR A;  5CHE E;  4F1S A;  2HO1 A;  3D9J A;  3FTV A;  1Z3Y A;  3ZXP A;  2BED A;  2V5F A;  4IUL A;  3EU9 A;  2XRY A;  2J8S D;  1NFI E;  1AP7 A;  3ENE A;  2VTB B;  1IYG A;  1SA4 A;  2LO6 A;  3S7D A;  4KZ0 A;  1TNZ A;  4JD2 G;  1RZ4 A;  4U96 D;  5ITZ F;  3APC A;  1TNB A;  1H6P A;  4ILI A;  2GRP B;  3L08 A;  1IHG A;  2F8X K;  2FO7 A;  3ESL A;  5EX3 A;  3Q7A A;  4GA0 A;  2KCL A;  3LDZ A;  2FO1 E;  2R59 A;  3V31 A;  5AQA A;  3ISM C;  3UTM A;  3R7R A;  4LG6 A;  5ENS D;  4B89 A;  3ZN3 A;  4XE0 A;  5KWD A;  1E96 B;  1SZ9 A;  5FZR A;  5D0Q D;  3VLD A;  3FDH A;  5A7D B;  3NOC D;  4LEU A;  3SO8 A;  4APO A;  2YHE A;  4N2Q A;  1IHB A;  3LCA A;  4NUR A;  4XI9 A;  2C0L A;  1NL4 A;  2RKK A;  3G2S A;  2XEN A;  4U0S A;  1MYO A;  1UN9 A;  4I17 A;  4O1P A;  5HRY A;  3FTY A;  3UIN C;  1OCC E;  1DC2 A;  4GTV A;  5D0O D;  3ULQ A;  2RG8 A;  5AN8 A;  3R9M A;  3NOG D;  3FUJ A;  4RQI A;  1O5M A;  3SQV A;  5JA4 D;  1Y6I A;  1IXV A;  3IBE A;  2ION A;  1JWF A;  2XS1 A;  3JQ0 A;  4ANV A;  4DI3 A;  3JUI A;  3EU5 A;  2YIN A;  5M72 A;  3RRU A;  5CEA A;  5DBK A;  4DLQ A;  4WNE A;  1KPS B;  3E4B A;  1PAQ A;  4CGW A;  4EZL A;  3ZFW A;  4I6E A;  5KNG A;  3PS6 A;  2HR2 A;  3RRM B;  2ZGG A;  4FJY A;  1EDU A;  3QC1 A;  3BG0 B;  3B7U X;  4F1P A;  4L2L A;  4OVU A;  3PZD A;  5ENP D;  1HXI A;  1DVP A;  1FT2 A;  3ZW3 A;  4BSZ B;  3DWL G;  4F6R D;  4GCO A;  5BXU A;  1TYQ G;  1HU3 A;  2GRN B;  3LXU X;  2KCK A;  1OCZ E;  4CDN A;  3AS5 A;  2QC9 A;  3FUN A;  3TWS A;  3T8K A;  4A55 A;  3GW4 A;  1YCS B;  4I2W A;  5KJN A;  5FJY A;  2LAH A;  4UUC A;  1TNU A;  1DCQ A;  2KCV A;  3DPD A;  4CDM A;  3HDX A;  4C0E A;  4J7W A;  1N4Q A;  3ONL A;  3FFL A;  1N4R A;  4N3A A;  3L82 A;  2VYI A;  2P9I G;  5A6C A;  3FH7 A;  4XKB A;  4CYM D;  2RD0 A;  3OTN A;  4K5C A;  2V4H C;  4G24 A;  1QNF A;  4ANX A;  2HM8 A;  4XX5 A;  2L0T B;  3FWV A;  4LRZ A;  3NB2 A;  3WXX A;  2VGX A;  3LKU A;  3E34 A;  4B8A A;  4MS6 A;  3EUV A;  4J8S A;  1PC2 A;  4B8C B;  2QYU A;  4A3V A;  4WWN A;  2L6B A;  4CRW A;  4I2Z A;  5CRV A;  5AEN A;  5LOZ A;  4AXH A;  2AXV A;  1H2V C;  4R7L A;  2H6I A;  5G05 J;  1TJF A;  3G2V A;  4YDO A;  2LXM A;  2GRQ B;  1OUV A;  4DRX E;  3MKQ A;  3DRA A;  5AAO A;  2XEE A;  1WM5 A;  4ME2 A;  1SW6 A;  3TXN A;  3P2B A;  4PUC A;  2ZXW E;  4UWH A;  3UM1 A;  3HYM B;  4DJA A;  3F6Q A;  1ZB1 A;  4G11 A;  2IU1 A;  1TN8 A;  4BY6 A;  4AVX A;  3P1U A;  4JXT A;  4J8E A;  2FI7 A;  1ELK A;  2Y1L E;  3D9O A;  3ZEF A;  4N3C A;  3L13 A;  4M7C A;  5G55 A;  4GPK A;  2X6K A;  1TR4 A;  3DEO A;  4XI0 A;  3JQ1 A;  3HVE A;  3E30 A;  5B1B E;  1UW4 B;  3LY9 A;  3D3M A;  3SI5 A;  2NSZ A;  2P2C P;  4NAC A;  3UUX A;  4JHR A;  5D66 A;  3IXE A;  3DSU A;  2FF4 A;  3RRN B;  2R5S A;  5ENQ D;  1BI8 B;  1A5E A;  3W9G A;  3B7B A;  3CVN A;  5JJ6 A;  3X2Q E;  4NQ0 A;  4XEI G;  2OCC E;  3SY2 A;  4G1T A;  4HFG A;  3U3W A;  4GZ5 A;  2WMN A;  3PVL A;  3CVX A;  4GAA A;  4GTQ A;  4I1O B;  2J09 A;  3TL5 A;  4HQD A;  2ETA A;  4TUM A;  1JUQ A;  1E90 A;  1JCQ A;  4UWG A;  2I1J A;  3Q15 A;  3OXL A;  1N9A A;  3HXF A;  3FTU A;  4N5C A;  3ABL E;  1OCR E;  4RSY A;  3TWX A;  3FH8 A;  5ENO D;  4O1O A;  2KZT A;  2Q7F A;  3UM0 A;  3Q73 A;  1NA3 A;  2ETB A;  1IQU A;  4JA9 A;  1XGW A;  4F53 A;  4HLE A;  4UI9 J;  4URK A;  4I9E A;  3ZYL A;  1OXJ A;  3DSW A;  2HYZ A;  4FHK A;  4BFR A;  3BG1 B;  4A1G A;  1PY1 A;  3VTX A;  5B3S E;  4A63 B;  3JXI A;  3MV2 B;  4Q96 A;  5BW8 C;  3DST A;  3KSL A;  4LNU D;  2WM9 A;  4F7A A;  4H7Y A;  2WQ6 A;  4G25 A;  3HG0 D;  1O1S A;  1MJ0 A;  5C1D A;  3U9W A;  4N39 A;  3ZYQ A;  2P58 C;  4BER A;  3CV0 A;  4UQY A;  5LFA A;  1Z5S C;  3SF4 A;  2LSV A;  2OOE A;  4C0M A;  4G8L A;  1HG2 A;  2OVB A;  1X81 A;  3J5Q B;  2A5E A;  1QQE A;  4BWR A;  2IOL A;  2WXP A;  1BD8 A;  3UIO C;  2IF4 A;  3PZ2 A;  3VLF A;  4DX6 D;  4L2Y A;  2RFA A;  3R9A B;  2VQ2 A;  2CG2 A;  3AJI A;  4C48 B;  3VLE A;  1TEZ A;  3V79 K;  2AVP A;  5E76 A;  4HXI A;  2DZO A;  2YHC A;  1OY3 D;  2XEH A;  4FLB A;  3CVL A;  5CMY A;  3UXG A;  4TRQ A;  3MX3 A;  3FEX A;  3RO2 A;  2IO3 C;  2EIK E;  3HRA A;  3RJV A;  3UKR G;  4FUL A;  3RU0 A;  1K8K G;  1IQR A;  3Q4A B;  5BV1 A;  2ZU6 B;  5FQ6 A;  1U2V G;  3C3Q A;  3GZ2 A;  4BEP A;  3ZIM A;  4B94 A;  1LF8 A;  3FTS A;  1YMP A;  3FU6 A;  3FP3 A;  1O1R A;  1YYH A;  4LER A;  2P9K G;  3IHY A;  4HNA D;  1S63 A;  3IEG A;  2A5U A;  1EPU A;  4MBG A;  3SHF A;  2IY0 C;  1Z6T A;  3KS2 A;  3MZL B;  3PEV B;  4J6I A;  4DX2 A;  3C3R A;  2QZA A;  2MOW A;  1OWP A;  4GZC A;  4HI9 A;  2J49 A;  5G05 C;  4DX7 D;  5JHA A;  3W9F A;  2PM7 A;  3HHM A;  3L22 A;  4M3O A;  4XKC A;  4GA1 A;  3ASH A;  4UWL A;  4C9B B;  1D8D A;  3UMV A;  3LS8 A;  2XCC A;  4E85 A;  3ML9 A;  2BTD A;  4HOT A;  1D8E A;  2FBN A;  3FTZ A;  2GRO B;  1W3B A;  2H6F A;  2XGO A;  1OWM A;  3B7S A;  3IV0 A;  3BEE A;  3NZS A;  3LJN A;  3K9I A;  4JEU A;  4PS3 A;  3U64 A;  4U0U A;  4AIF A;  3U66 A;  1LD7 A;  3UKU G;  2ZIR A;  4EQF A;  3I4G A;  3TWU A;  4U63 A;  3BU8 A;  2XQ0 A;  4KYO B;  1JPL A;  3FEY A;  1N52 A;  2Y69 E;  2UWJ G;  5KNH D;  4LNB A;  4L7T A;  2FUL A;  2VSO E;  3I3N A;  4GA2 A;  4X8Q A;  2WXF A;  3FTX A;  3HXD A;  5JJ7 A;  2P9L G;  5ARG A;  2F0Y A;  3CHR A;  4U8V D;  1HS6 A;  3CVP A;  1YA0 A;  2WQ7 A;  4LSZ E;  5LX8 A;  2WVI A;  4AOF A;  2VGX B;  1HG5 A;  4G26 A;  1E7U A;  4KT6 B;  1L5J A;  3AS4 A;  5T4Y A;  1WY6 A;  4ZHB A;  3FUL A;  2VJ8 A;  4U95 D;  2JLB A;  4WAF A;  4U7E B;  5IY5 E;  3G2W A;  4J8D A;  5AAR A;  4ZFH A;  4HBD A;  5FTP A;  2AXZ A;  2H6H A;  3DSS A;  3CVY A;  4HVB A;  4HOU A;  2IOS A;  1N4P A;  4EHM A;  3CK8 A;  4DI4 A;  1JWG A;  2A4Z A;  2WXK A;  2MYO A;  4LNG A;  3AG4 E;  2QY7 A;  1JCR A;  4MRU A;  2F8Y A;  3CHO A;  2KAT A;  3RKV A;  4GML A;  4GTM A;  2PZI A;  3T8M A;  3DSX A;  3TWR A;  3PZ1 A;  3MYV A;  3TXM A;  4ATZ D;  3FUI A;  2C0M A;  5H7P A;  3SFX A;  2XRZ A;  4ILH B;  2OND A;  4UI9 C;  1HF8 A;  4TXQ A;  3PUK A;  3CK9 A;  4Y6W A;  2L6J A;  3APD A;  5CED B;  3V2X A;  1E8Z A;  1FCH A;  3ML8 A;  2M63 A;  3HIZ A;  2IEJ A;  1N0Q A;  4RLY A;  1BPO A;  1DCE A;  4FLH A;  2CHZ A;  5ANL A;  1OWN A;  4G8K A;  1N54 A;  2VGY A;  2E0I A;  1WAO 1;  3PNT B;  1VDY A;  1MHQ A;  3KEZ A;  4O6F A;  3QOU A;  3DSV A;  3CQC B;  5CCL A;  4L1B A;  3T5V A;  1H6O A;  5G04 J;  5D2M C;  3SBS A;  1SVX A;  1HO8 A;  4P29 A;  3GZ1 A;  3O48 A;  4ILG A;  3OAW A;  3MJW A;  4ACK A;  5BUZ A;  3PRE A;  1MX6 A;  5ENR D;  4HOS A;  3WG7 E;  5JHB A;  2BKK B;  1TJC A;  3ZHE A;  3V2O A;  3EHM A;  4AJW A;  3Q49 B;  2J4B A;  2WXO A;  5E75 A;  4YVQ C;  3BUA A;  2VSN A;  3EHN A;  1OWL A;  4JL0 A;  1NI1 A;  5EN5 D;  3EIQ C;  1IKN D;  2F37 A;  2V5Q C;  1TNO A;  3AAA C;  5CEC B;  4CCA A;  5HS0 A;  1KT0 A;  1HE8 A;  4KVO A;  3PZ4 A;  1N11 A;  3ESK A;  2LNI A;  3C5R A;  1UN8 A;  3AS8 A;  5EYP F;  3UM3 A;  4CT4 A;  4FJZ A;  1KT1 A;  5FIO A;  2MRI A;  3QNK A;  5KCM A;  3N71 A;  3QAR A;  4TXR A;  4BX8 A;  4U0Z A;  1H2U A;  4KMO A;  3B7R L;  1K1A A;  1Q2Z A;  3DEP A;  3AU5 A;  2H6G A;  3ASN E;  4GZ6 A;  3TWV A;  4I1A A;  5LP0 A;  5KJK A;  4AY6 A;  4EZJ A;  2JAB A;  4GCN A;  4H7X A;  5FZS A;  2WXN A;  4L9P A;  4ABN A;  2NXP A;  4U07 A;  1HX8 A;  4GMR A;  2JEK A;  3CHP A;  2V4L A;  2GRL A;  3TGO A;  2WXR A;  2Y4U A;  3SFY A;  3D9H A;  3CVU A;  4LCT A;  3RSE G;  2AWI A;  4DPR A;  5AJL A;  3FH5 A;  2DZN A;  2R2L A;  5CRU A;  5FIN A;  2B6C A;  2IFU A;  2NYJ A;  3FUK A;  4DUI A;  4EBA G;  4DK5 A;  3UX4 A;  2AJA A;  3RO3 A;  4UI9 K;  4GTO A;  4GPM A;  5J08 A;  2CHW A;  4YDY A;  1ZU2 A;  4FA6 A;  4KVM A;  3NQP A;  1V54 E;  4RG6 A;  5JMN D;  3O4Z A;  2X6J A;  4WNF A;  3EDT B;  2HE0 A;  5T3R A;  4OAU C;  1GW6 A;  4DX1 A;  5FT9 A;  5B1A E;  3C72 A;  3SZ7 A;  5G2N A;  3PRZ A;  4JVS A;  4TV3 A;  2C2L A;  4UWK A;  5EIB E;  3ZXS A;  2WXJ A;  4K5A B;  3PH0 C;  3MEK A;  1UJJ A;  4G23 A;  5ARF A;  2IQC A;  3EHQ A;  1BLX B;  2I6H A;  4GZD A;  2WB2 A;  3JUE A;  2WXI A;  2CG3 A;  5KJM A;  1Z3X A;  1K3Z D;  1G3N B;  2ILR A;  2DYR E;  1DNP A;  3SFZ A;  3FUH A;  4EZK A;  3C98 A;  5HKP A;  3QWW A;  4BTB A;  1EYH A;  4BTA A;  2XPZ A;  3SBT B;  4BSX A;  1HH8 A;  2XPY A;  4OAV B;  2WXQ A;  3Q9U C;  3ABK E;  4FAD A;  4KXK B;  4MKT A;  5CER B;  2PM6 A;  3FU0 A;  4GZ3 A;  4Y6C A;  4AY5 A;  3RIB A;  1QYM A;  2J07 A;  4B93 B;  2XHE A;  2V8S E;  3IHV A;  3CKC A;  4IRU A;  3KD7 A;  3ZYM A;  1N94 A;  5AQ7 A;  4GTR A;  3S7J A;  3QJZ A;  4U8H A;  2R17 C;  1FVH A;  4GYO A;  1OCO E;  4K03 A;  4CEM A;  4EPZ A;  4ACL A;  3L16 A;  4JHJ A;  2YNQ A;  2ZIS A;  3B13 A;  2WXL A;  1FPP A;  4XZ4 A;  3UM2 A;  4JEH A;  4Q94 A;  3SGH A;  3I4R B;  5CBN A;  3LEW A;  2WPV A;  3KEA A;  2X6F A;  3NZU A;  2KZT B;  3TWW A;  3S2A A;  4WWP A;  2UY1 A;  2CHX A;  4G2V A;  2PL2 A;  2OVF A;  3ZPJ A;  1XNF A;  1SZA A;  2L9B A;  5AQB A;  1NA0 A;  2EIN E;  2B0O E;  4RVB A;  3VTY A;  1WDY A;  2LUH A;  3ZU7 B;  2P9S G;  5CMW A;  2P9P G;  1TN7 A;  3CHQ A;  3ULY A;  3D9N A;  2GGF A;  2CFZ A;  1WG0 A;  3PDN A;  4WNG A;  2VSX E;  4JA7 A;  3FUM A;  4BT9 A;  3DXM G;  2I9C A;  2CFU A;  4BES A; 
#chains in the Genus database with same CATH homology
 3L13 A;  4AEZ C;  4WUY A;  5G55 A;  3TXM A;  4GPK A;  2XPI A;  2X6K A;  4I1M A;  3CR3 A;  3FUI A;  2C0M A;  3TG5 A;  3QK0 A;  3DBS A;  2XRZ A;  4ILH B;  4UWF A;  2OND A;  4XI0 A;  2GW1 A;  3JQ1 A;  5ENN A;  2PQN A;  2X3M A;  3HVE A;  3U4T A;  4UI9 C;  3SD5 A;  1UW4 B;  3Q47 B;  5FZQ A;  1HF8 A;  5FWQ A;  4FP7 A;  5EDS A;  3LY9 A;  3D3M A;  2MHK A;  3SI5 A;  3PUK A;  3AU4 A;  3CK9 A;  2NSZ A;  4Y6W A;  2L6J A;  2X6I A;  3APD A;  4NAC A;  3UUX A;  4JHR A;  1E8Z A;  1FCH A;  1H19 A;  4NRH B;  3ML8 A;  3L17 A;  2FF4 A;  2M63 A;  3RRN B;  5HI7 A;  5JJT A;  4N3C A;  2R5S A;  3HIZ A;  3MV3 B;  3APF A;  3PE3 A;  5JJ6 A;  1E8X A;  1BPO A;  3CVN A;  4FLH A;  4NQ0 A;  2CHZ A;  3FTW A;  3QB2 A;  1U3D A;  5ANL A;  1OWN A;  2DIW A;  4G1T A;  2BF0 X;  4GMJ A;  1N54 A;  3ASD A;  4HFG A;  3OXG A;  2AXU A;  2VGY A;  3FUE A;  4GZ5 A;  2E0I A;  3CKB A;  3U3W A;  1WAO 1;  4J8F A;  3PUJ A;  4V3I A;  3PNT B;  2WMN A;  1VDY A;  2YQ8 A;  1MHQ A;  2BUG A;  3KEZ A;  3D9L A;  3PVL A;  3QWV A;  2I1K A;  4GAA A;  3CIA A;  3LVQ E;  4FHJ A;  4K0R A;  4I1O B;  4O6F A;  3QOU A;  3QAQ A;  4E6H A;  4EBA A;  2XGM A;  2J09 A;  3CQC B;  3TL5 A;  5CCL A;  3CVW A;  5FQ7 A;  4L1B A;  3T5V A;  1JUQ A;  5G04 J;  3SBS A;  3D9M A;  1U3C A;  1E90 A;  4UWG A;  3FU5 A;  2I1J A;  4J0U A;  3Q15 A;  3OXL A;  2IJG X;  1HO8 A;  4UQX A;  4P29 A;  5ANR A;  3PEU B;  3GZ1 A;  3O48 A;  4APF A;  3FTU A;  4N5C A;  3Q5M A;  1ELW A;  2WMO A;  4ILG A;  2KM4 A;  4IN3 B;  4RSY A;  2NC9 A;  4F3V A;  3FH8 A;  3I5P A;  4AM9 A;  4IYP A;  3OAW A;  2KZT A;  3MJW A;  3UT8 A;  1ZBP A;  4YVO A;  3JCK C;  2E2E A;  4ACK A;  2Y4T A;  2Q7F A;  5BUZ A;  3PRE A;  3UPV A;  3ASG A;  3ZVV A;  3T5X A;  4HOS A;  1NA3 A;  1A17 A;  4JZY A;  3FHE A;  3URZ A;  1IQU A;  3EIJ A;  4JA9 A;  1XGW A;  2OV8 A;  3CVX A;  5JHB A;  1E8Y A;  4F53 A;  1ELR A;  1TJC A;  4HLE A;  2WQH A;  3QDN A;  3ZHE A;  5CHE E;  4UI9 J;  4URK A;  4F1S A;  4I9E A;  2HO1 A;  3ZYL A;  3CHM A;  1FVF A;  3D9J A;  3FTV A;  3EHM A;  1Z3Y A;  4AJW A;  3Q49 B;  1UG3 A;  2HYZ A;  2J4B A;  2WXO A;  4LUN U;  5E75 A;  2V5F A;  4IUL A;  4FHK A;  4YVQ C;  4BFR A;  2VSN A;  3BG1 B;  2XRY A;  3IKO B;  3EHN A;  1OWL A;  4JL0 A;  4A1G A;  1PY1 A;  5FQ4 A;  3VTX A;  3ENE A;  3ZGQ A;  3EIQ C;  2VTB B;  1IYG A;  1HFA A;  2PQR A;  5LCW C;  3MV2 B;  2LO6 A;  3S7D A;  4KZ0 A;  4Q96 A;  3CGH A;  4MLP A;  4CCA A;  1KT0 A;  2GRM A;  5EKQ D;  1HE8 A;  4KVO A;  5BW8 C;  1E7V A;  4FC8 A;  3APC A;  5C2Y A;  3KAE A;  3ESK A;  4ILI A;  4HOR A;  2LNI A;  2WM9 A;  4F7A A;  3L08 A;  1UN8 A;  5G04 C;  1IHG A;  3AS8 A;  4JC8 A;  4WWO A;  1H2T C;  4H7Y A;  4CT4 A;  2V0P A;  2WQ6 A;  4FJZ A;  1KT1 A;  4G25 A;  2FO7 A;  3ESL A;  3CSF A;  3GZS A;  5C1D A;  5EX3 A;  1NP7 A;  2KCL A;  4GA0 A;  3U9W A;  3LDZ A;  4N39 A;  1P5Q A;  3RK6 A;  3ZHE B;  3ZYQ A;  2P58 C;  2DCP A;  2R59 A;  2MRI A;  4I9C A;  5BPP A;  3QNK A;  5KCM A;  4JPS A;  3CV0 A;  4UQY A;  3R7R A;  3N71 A;  5LFA A;  2LSU A;  3SF4 A;  4B89 A;  2VTB A;  2LSV A;  3QAR A;  4BX8 A;  2OOE A;  4U0Z A;  3ZN3 A;  4C0M A;  1H2U A;  4XE0 A;  3MCX A;  4KMO A;  3ZYK A;  3B7R L;  5CCM A;  4Q69 A;  1E96 B;  1HG2 A;  1SZ9 A;  3AU5 A;  4GYW A;  4ANW A;  2OVB A;  5FZR A;  4GZ6 A;  5D0Q D;  3VLD A;  3FDH A;  3CVV A;  3G2T A;  4I1A A;  5A7D B;  3GYZ A;  4WND A;  5LP0 A;  2J08 A;  4LEU A;  4APO A;  5KJK A;  4AY6 A;  2YHE A;  1QQE A;  4ANU A;  4EZJ A;  2FEZ A;  4N2Q A;  3LCA A;  4NUR A;  5HQ8 A;  4GCN A;  4XI9 A;  2IOL A;  4BWR A;  2WXP A;  2C0L A;  4U04 A;  4H7X A;  5FZS A;  2IF4 A;  2WXN A;  3VLF A;  4L2Y A;  4ABN A;  4DLO A;  3FUD A;  3G2S A;  2NXP A;  3R9A B;  2VQ2 A;  2CG2 A;  3ASF A;  4U0S A;  4PS7 A;  4U07 A;  1HX8 A;  1UN9 A;  4I17 A;  3VLE A;  1E8W A;  2JEK A;  1H6K A;  3CHP A;  3FTY A;  1TEZ A;  2AVP A;  5E76 A;  4HXI A;  2V4L A;  2GRL A;  3TGO A;  3LYA A;  2YHC A;  2WXR A;  5D0O D;  2Y4U A;  4FLB A;  3TJP A;  3CVL A;  5CMY A;  3ULQ A;  4OYS A;  1NZN A;  2RG8 A;  4TRQ A;  2J4D A;  3FUJ A;  3MX3 A;  3FEX A;  5BT1 A;  4GU5 A;  3QKY A;  3RO2 A;  1Y6I A;  3RJV A;  4XIF A;  3CVU A;  4FUL A;  4LCT A;  3IBE A;  2ION A;  1JWF A;  3RU0 A;  3S7F A;  5T8I A;  1IQR A;  3Q4A B;  5BV1 A;  2AWI A;  2ZU6 B;  4DPR A;  5FQ6 A;  3GZ2 A;  3CST A;  3JQ0 A;  5AJL A;  4HOQ A;  4ANV A;  4DI3 A;  3B7T A;  3MA5 A;  5AJD A;  3FH5 A;  4AP2 A;  4N2S A;  3LJ3 A;  3CEQ A;  2YIN A;  3ZIM A;  4B94 A;  1LF8 A;  5M72 A;  3QWP A;  3FTS A;  4KZC A;  3RRU A;  3FU6 A;  5DBK A;  2WXH A;  4DLQ A;  2IFU A;  3FP3 A;  4WNE A;  3FUK A;  4EBA G;  3E4B A;  4DK5 A;  5A23 A;  3UX4 A;  1PAQ A;  4LER A;  4CGW A;  5LCW J;  3JYS A;  3IHY A;  3RO3 A;  4UI9 K;  4EZL A;  3ZFW A;  3IEG A;  2A5U A;  5J08 A;  3TAX A;  1EPU A;  3SHF A;  2CHW A;  2WXG A;  1Z6T A;  3KS2 A;  3ZEF A;  4I6E A;  3PS6 A;  1ZU2 A;  2QFC A;  3MZL B;  4KVM A;  4FA6 A;  3NQP A;  2HR2 A;  3CLJ A;  3PEV B;  5AIJ A;  3RRM B;  1EF1 C;  4RG6 A;  4FJY A;  1EDU A;  3O4Z A;  4J6I A;  3QC1 A;  2X6J A;  4WNF A;  3EDT B;  3UT4 A;  4PS8 A;  3BG0 B;  5T3R A;  3B7U X;  4GB9 A;  4L2L A;  2MOW A;  4N3B A;  1OWP A;  1GW6 A;  4OVU A;  3PZD A;  5FT9 A;  4GZC A;  3LY8 A;  4FU3 A;  3SZ7 A;  5G2N A;  2J49 A;  1HXI A;  3MGB A;  3PRZ A;  5DIZ A;  1DVP A;  3FUF A;  4JVS A;  5G05 C;  3MKR A;  1MQS A;  2AW6 A;  2C2L A;  4TV3 A;  3ZW3 A;  4UWK A;  5JHA A;  3ZXS A;  1HZ4 A;  4GCO A;  2PM7 A;  2WXJ A;  4PDX A;  4QFV A;  1HU3 A;  3PH0 C;  3LY7 A;  3HHM A;  3MEK A;  3L22 A;  1UJJ A;  1H0A A;  3LXU X;  4JHK A;  4G23 A;  4KBQ A;  1S0P A;  3R7Q A;  2KCK A;  5ARF A;  2IQC A;  4M3O A;  4XKC A;  2I6H A;  4GA1 A;  4GZD A;  3ASH A;  5EX0 A;  4CDN A;  3AS5 A;  2WB2 A;  4UWL A;  4C9B B;  3FUN A;  2X6H A;  3UMV A;  3LS8 A;  2WXI A;  2CG3 A;  5KJM A;  3ZRH A;  2XCC A;  4A55 A;  2X38 A;  4E85 A;  3GW4 A;  3ML9 A;  2BTD A;  4HOT A;  1Z3X A;  4YND A;  2FBN A;  4I2W A;  2ILR A;  5KJN A;  5FJY A;  2LAH A;  3FTZ A;  1DNP A;  3SFZ A;  1W3B A;  3FUH A;  4EZK A;  3C98 A;  2XGO A;  2DBA A;  4I43 A;  1SQM A;  3LPZ A;  1OWM A;  2KCV A;  3QWW A;  3B7S A;  5KJL A;  3IV0 A;  4BTB A;  3BEE A;  3NZS A;  4ATG A;  3MYV A;  1EYH A;  4BTA A;  3DPD A;  2XPZ A;  3SBT B;  5FQ8 A;  4CDM A;  2XCB A;  3CQG B;  1HH8 A;  4BSX A;  2XPY A;  3K9I A;  3HDX A;  3MKQ B;  4C0E A;  4JEU A;  4PS3 A;  1UJK A;  2WXQ A;  3U64 A;  4U0U A;  4AIF A;  3U66 A;  3UT7 A;  3ONL A;  3FFL A;  3UQ3 A;  1OWO A;  4FAD A;  4EQF A;  3I4G A;  1X5B A;  4KXK B;  4MKT A;  4U63 A;  3PE4 A;  2PM6 A;  3FU0 A;  4N3A A;  3D9K A;  4GZ3 A;  4Y6C A;  4OVV A;  3L54 A;  4AV7 A;  4AY5 A;  2XQ0 A;  3RIB A;  4RG9 A;  2VYI A;  2J07 A;  4KYO B;  4L23 A;  1QZ2 A;  5A6C A;  3S7B A;  3FH7 A;  1JPL A;  4JW1 A;  4CDR A;  2XHE A;  1N52 A;  3G2U A;  3FEY A;  2V8S E;  2RD0 A;  4XKB A;  3OTN A;  4CGV A;  3IHV A;  3OXF A;  2UWJ G;  3CKC A;  4G24 A;  1QNF A;  4L7T A;  4ANX A;  2HM8 A;  4XX5 A;  1B89 A;  4IRU A;  2I2O A;  2FUL A;  2L0T B;  3KD7 A;  3ZYM A;  1Y8M A;  2VSY A;  3FWV A;  4LRZ A;  2XEV A;  2VSO E;  3I3N A;  3QJZ A;  4GA2 A;  4U8H A;  3S7J A;  2R17 C;  3WXX A;  3FU3 A;  3CVQ A;  1FVH A;  2VGX A;  3LKU A;  5BNW A;  2WXF A;  3FTX A;  4GYO A;  4K03 A;  4CEM A;  3NF1 A;  4B8A A;  4MS6 A;  4EPZ A;  5JJ7 A;  4ACL A;  3L16 A;  2XGS A;  4J8S A;  5ARG A;  1PC2 A;  3D9I A;  4JHJ A;  3EJN A;  4B8C B;  4BX9 A;  3CHR A;  4A3V A;  4WWN A;  2YNQ A;  1HS6 A;  4CRW A;  4I2Z A;  3CVP A;  5AYW D;  3B13 A;  4I6G A;  1YA0 A;  4UQZ A;  3L6A A;  2WXL A;  4I6J A;  4XZ4 A;  4PH4 B;  5AEN A;  2WQ7 A;  5LX8 A;  5LOZ A;  2WVI A;  4JEH A;  4AOF A;  4Q94 A;  3SGH A;  4AXH A;  2AXV A;  3I4R B;  3LEW A;  1H2V C;  2WPV A;  2X6F A;  3NZU A;  4R7L A;  2L0I A;  2VGX B;  4BT8 A;  5G05 J;  1TJF A;  2J9Q A;  3G2V A;  2KZT B;  1HG5 A;  4B0Z A;  4G26 A;  1E7U A;  1OUV A;  4KT6 B;  3S2A A;  1L5J A;  3AS4 A;  4WWP A;  5T4Y A;  2UY1 A;  1WY6 A;  2CHX A;  3HVE B;  4G2V A;  2PL2 A;  3ONK A;  2OVF A;  3MKQ A;  3FUL A;  1WM5 A;  4ME2 A;  4W9R A;  3TXN A;  2VJ8 A;  2JLB A;  4WAF A;  4EEC A;  3ZPJ A;  1XNF A;  3P2B A;  4GYY A;  1SZA A;  2L9B A;  4PUC A;  2EQX A;  4HS2 A;  3G2W A;  3FY4 A;  4UWH A;  3PNL B;  4J8D A;  1NA0 A;  3HYM B;  4DJA A;  5BV0 A;  5FTP A;  3SNX A;  2AXZ A;  4A1S A;  4RVB A;  3VTY A;  4HVB A;  2LAI A;  3CVY A;  3CK7 A;  4G11 A;  2UY1 B;  5CMW A;  4HOU A;  2IOS A;  4CT0 A;  3D9P A;  3CK8 A;  3CHQ A;  4DI4 A;  1JWG A;  2A4Z A;  2WXK A;  3D9N A;  2IU1 A;  2CFZ A;  2GGF A;  3PDN A;  4BY6 A;  1KLX A;  4WNG A;  2WXM A;  2QY7 A;  2VSX E;  5J90 A;  4JA7 A;  4MRU A;  1INZ A;  2KC7 A;  3CHS A;  3CHO A;  3FUM A;  4AVX A;  3P1U A;  2KAT A;  4JXT A;  3RKV A;  4GML A;  2PZI A;  2Y3A A;  4BT9 A;  4A3T A;  4J8E A;  2FI7 A;  3T8M A;  3TG4 A;  1ELK A;  4TUU A;  3LVR E;  4D10 C;  3D9O A;  2I9C A;  2CFU A;  3JUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...