3D9NA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
138
structure length
138
Chain Sequence
b'EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein 16
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 57
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9nA00
1EDUA 2MOWA 5CMYA 5LP0A 3D9LA 3D9OA 1EYHA 3CLJA 1LF8A 3ZYQA 1JWFA 3D9IA 2QY7A 3D9NA 3G2WA 3D9KA 1INZA 1ELKA 4FLBA 4HFGA 3D9PA 3D9MA 4NACA 4FU3A 4JXTA 3LDZA 1SZ9A 1H0AA 3ONLA 1HG2A 1HX8A 1JUQA 3ZYKA 5LOZA 4GZDA 1XGWA 3G2SA 3ZYMA 1DVPA 1VDYA 2DCPA 3G2UA 3D9JA 1X5BA 3RRUA 2L0TB 5CMWA 4Q94A 1HG5A 5J08A 1MHQA 3ZYLA 1JPLA 1SZAA 2L0IA 1HFAA 1HF8A 2LO6A 2V8SE 3G2TA 1UJJA 2KM4A 1JWGA 3G2VA 4GZCA 1PY1A 4Q96A 4AVXA 2DIWA 3ONKA 1UJKA 2BF0X
chains in the Genus database with same CATH superfamily
2PNNA 3TL5A 5KJLA 3DPYA 1AP7A 4DI3A 3UM2A 1DC2A 3PEVB 4JEHA 2XPZA 1S0PA 3Q73A 3VLDA 3DPDA 3UPVA 4FA6A 5EIDA 3Q49B 2XEHA 1P5QA 5CBNA 4GTOA 4O1PA 3AU4A 2PQNA 2WXLA 5CERB 1K8KG 1JUQA 1KLXA 3TGOA 1WDYA 2Y4TA 5DBKA 3L6AA 2HR2A 3PZ2A 1MX4A 4U0SA 1S64A 4ANUA 3EIQC 4J8FA 3HXBA 1D9SA 5AN8A 3CVPA 1SZ9A 4DJAA 4FC8A 4I43A 4UWKA 1W3BA 1OWNA 4LNBA 5FTPA 2WXFA 4ACKA 5T4YA 3FUJA 4M3OA 2XS1A 3EU5A 4O60A 3J5PA 4KT6B 3LDZA 3AG2E 4LG6A 3EIJA 1E8YA 4FP7A 5AQ7A 5AQBA 3UXGA 4OAUC 4QQIA 1JCQA 3JQ1A 3TJPA 3RRUA 3ZXPA 3UT7A 4EZLA 4HRNA 4GZ3A 3FDHA 3AJIA 5KJMA 3L9TA 4TXQA 3FU5A 2GRPB 2WB2A 1K1AA 4NACA 3U64A 3IXEA 2CG2A 2IEJA 2ZGDA 1A5EA 3TWWA 1HG5A 1JPLA 2EILE 4U8VD 5G05J 2IU1A 2AXVA 3RRNB 4LSZE 4A55A 3BUAA 3HXEA 3ZXSA 4O1OA 1QNFA 3FEYA 1SA5A 3EHMA 2PL2A 1VDYA 3FH7A 2X6KA 4FJZA 2L0IA 3L17A 3LPZA 2VGEA 4U96D 4M7CA 4D10C 1WM5A 4TXRA 5AAOA 3PZ1A 3IEGA 3W9GA 1GW6A 3D9JA 3UT4A 3BEEA 4F7AA 3Q9UC 4G25A 3AG1E 3FTVA 3RO2A 3ZGQA 2LUHA 4KVMA 5CRVA 2MOWA 4I2WA 4DX1A 3CVVA 3HYMB 4TXPA 5FZRA 2DBAA 4IYPA 4RG6A 1TJFA 4CGWA 5LCWJ 3PVLA 2MYOA 3FULA 4LCTA 4C9BB 1E7UA 2H6FA 1OT8A 5CMYA 4GTQA 4IN3B 2WXOA 4LEUA 4GPMA 3AS8A 1S63A 4PUCA 5EDSA 1OWLA 4EHMA 3EUVA 1V55E 3JXJA 1EPUA 4JZYA 3QKYA 4U7EB 5FIOA 5ENNA 1N9AA 2KXPC 2ZU6B 3T8KA 4FLBA 4N3AA 3ABKE 4XE0A 4GTRA 3NF1A 2GRMA 3KSQA 2J08A 3AAAC 4N3BA 1NI1A 3QAQA 2ETBA 4W9RA 4J8YA 3HRAA 2OEVA 3TWUA 4GMRA 4DLQA 3IHYA 4Z68A 5HKPA 4GTSA 4EPZA 3FY4A 3L08A 1E8ZA 5G04C 1IHBA 4B0ZA 4WWPA 2EIKE 2BKKB 3IHVA 4PS7A 3RU0A 2XRYA 5BUZA 4N2SA 4U95D 1L5JA 4UWFA 1H2UA 1TNBA 2P58C 3JXIA 1EYHA 4CRWA 3Q9NC 4AXHA 3FFLA 4YNDA 3SFXA 5D0OD 4I2ZA 3ZYKA 3CHPA 3SO8A 4JA9A 2KATA 1KZOA 2OCCE 4J7WA 4L1BA 3Q79A 5ENOD 3MEKA 4E85A 3ZN3A 5T3RA 1OCOE 3ZKJA 3SQVA 5EIBE 1MX2A 2VGXB 3P1UA 4UQYA 2RD0A 1HX8A 4B8CB 5ARFA 4KXKB 4BESA 4YVQC 4WNFA 2JLBA 4B89A 4PDXA 1U2VG 2XEEA 1NFIE 4J8DA 2E0IA 4UI9K 2VSOE 3OAWA 1DVPA 2LSUA 3TG5A 3HVEB 1IQRA 4YDWA 1YMPA 2GRNB 2BKGA 4EBAA 3G2TA 1UJJA 3PE3A 4AY6A 2R5SA 3FU0A 5LP0A 4U8HA 3UIOC 4DRXE 3L22A 2RFMA 3DEPA 1Q2ZA 4ANVA 2R02A 3CGHA 1N54A 5FQ6A 4ME2A 4OYSA 4TUUA 5JJTA 2FO1E 1EDUA 3ZHEA 1NA0A 4U04A 1E8XA 3B7SA 5KJKA 2PM6A 2GW1A 2P9UG 1ZBPA 4JB8P 3CSTA 1QYMA 2V4HC 3NAWA 3S2AA 4AY5A 4HXIA 1Y8MA 4DI4A 5D66A 1OCZE 4GA2A 3PEUB 3ONLA 1YA0A 3SF4A 2KBXA 3RSEG 2ZGGA 4F1PA 4HORA 5J08A 3ENEA 4F3VA 1NL4A 3E37A 1HFAA 4XKBA 3PNTB 4GCNA 1N4SA 5D0QD 3UI2A 3T5VA 4N2QA 3U9WA 1BLXB 4HVBA 3UINC 3HG0D 3QDNA 5JA4D 5ANLA 1QZ2A 4GZ5A 1TNOA 4GMJA 2C0MA 2WXIA 3FTWA 2V8SE 3ZRHA 4JW1A 3ULQA 4AVXA 3V79K 4A63B 2AW6A 1KT0A 3AU5A 4RG9A 4BERA 5ENSD 4ILIA 4BY6A 3Q4AB 2P9SG 4G8KA 3AG3E 3E30A 1KZPA 2RG8A 3APCA 4Q94A 2XZTG 3SHFA 2WM9A 3LJNA 3DXKG 1TEZA 1B89A 5EKQD 2AVPA 1U3CA 2ZISA 3PUKA 1N4RA 2B6CA 5C1DA 5JJ7A 1HE8A 2OVFA 2R59A 3MCXA 2RKKA 3OXLA 5EN5D 5FQ8A 3RJVA 5JHAA 1OY3D 2XZDG 4JA7A 2YQ8A 4CGVA 4K5CA 4BWRA 2OV8A 4I6GA 3EHQA 1JCSA 2KZTB 4GCOA 4GPKA 3FWVA 1ZU2A 1DCQA 4AM9A 2WXRA 3CVQA 2L9BA 1SQMA 4TV3A 4GZ6A 3FH8A 3SD5A 2J49A 4N5QA 1HU3A 4N39A 3ESKA 4C48B 2VJ8A 2I1JA 3G2VA 2WXPA 3S7DA 3TAXA 3CQGB 2F0YA 2P9LG 4JHKA 3FUKA 3V2XA 3FTSA 2AXUA 4I6JA 4XIFA 4WNGA 5KNGA 5BXOA 4PS3A 3AS5A 3ZYMA 2JEKA 3R9AB 5A7DB 3JUEA 4L9PA 4PS8A 4UWLA 2OVBA 4WAFA 2L6BA 3D9NA 4JHJA 3TWSA 3D9MA 4L2YA 3CKCA 3MKRA 2FBNA 2DCPA 2IY0C 2V4LA 3E32A 3V2OA 4U63A 4GYWA 4TUMA 2PZIA 3B7BA 3RIBA 1MJ0A 3KEAA 2X6HA 1UW4B 2IO3C 3PDNA 3QNKA 4GMLA 4HOQA 3UM3A 4AJWA 1KT1A 1Z3YA 3CHQA 3ASOE 2VGYA 2B0OE 3FUFA 5G05C 3ASNE 3ZVVA 3CVXA 3DSWA 1HO8A 2QY7A 1TNYA 3FUMA 2XHEA 3GW4A 2QFCA 1FPPA 3DWLG 1OWMA 3MKQA 3TWTA 4NIKA 5FZSA 1U3DA 4HNAD 3Q5MA 4OVUA 2EIJE 2I1KA 3PZDA 1FVHA 1N94A 2I9CA 4CCAA 3ABME 4NURA 5BT1A 2V5FA 3S7BA 3KD7A 5BW8C 4EZJA 2X6FA 3C3RA 3BU8A 3T9KA 1BPOA 4WUYA 4AEZC 4WNDA 2VGXA 3DSTA 2AXZA 5D2MC 5LCWC 5BXUA 2ETCA 3SI5A 2CHXA 2LAHA 1MZCA 4P29A 1BI8B 1QQEA 3SY2A 2CHZA 4GYYA 2DWZA 1EF1C 2DIWA 1MQSA 4U0UA 4MS6A 2IJGX 3LJ3A 3R7RA 1ELKA 1O1TA 1X81A 1YCSB 1FCHA 2XGOA 2F8XK 4A3VA 3C3OA 4MRUA 5KWDA 1D8DA 1TYQG 3HVEA 1HZ4A 2MRIA 3CHSA 5JJ6A 5BV1A 3DBSA 3PH0C 3D9OA 4HBDA 1TNZA 5HS0A 3FP3A 3B7UX 5JHBA 2X6IA 1TNUA 1KPSB 4A1SA 2I6HA 4YDEA 1TJCA 4NQ0A 4N3CA 3CVWA 4G24A 1N11A 3LEWA 3LVQE 4JL0A 4HRMB 3HXCA 3PUJA 2VSNA 4ATZD 1G3NB 3APFA 4URKA 5J90A 3IKOB 2LAIA 5B1BE 1E90A 1H6PA 3GZSA 1SW6A 4RSYA 2F37A 1K3ZD 5AYWD 3TG4A 4DX2A 2KCVA 4YVOA 2LNIA 3JQ0A 3C3QA 2VTBA 4KBQA 4XI0A 1HS6A 2IOLA 2R17C 2KCKA 5DIZA 4HI8A 4FADA 2FF4A 2HE0A 2ZIRA 4BEPA 3LCAA 3BG1B 3U66A 2Y4UA 4BFRA 3O48A 2FULA 2JABA 1K1BA 4KMOA 1NZNA 5EYLA 2GRLA 3G2SA 3FUIA 4I9EA 1LTXA 4JHRA 3FU3A 3E33A 5A6CA 2QC9A 4UQZA 4MBGA 3D9LA 2KC7A 2WMNA 3OXFA 4YDOA 4BX8A 3O4ZA 4O6FA 2NXPA 4RQIA 1Z5SC 3T5XA 4H7YA 3QJZA 4MLPA 3ZNGA 3NQPA 2J9QA 4CT4A 4U0ZA 4DLOA 4UWGA 2PM7A 3ZUVB 5CECB 1TN7A 5BV0A 2F8YA 4NRHB 3VLFA 3D9HA 4HOTA 4F1SA 1HF8A 2LO6A 3QOUA 3ASFA 3K9IA 1IHGA 5KJNA 4LNUD 4N5CA 4X8QA 3TWXA 3AS4A 5T8IA 3D9IA 3D9KA 3QWWA 3U3WA 2IOSA 3JYSA 2M63A 1H0AA 3J5QB 5G55A 2NSZA 3RO3A 3UIPC 1IQUA 5LX8A 3PNLB 3QARA 3V31A 3GYZA 1SVXA 4XKCA 5ANRA 2IO2C 5EILA 4G8LA 2KZTA 4XZ4A 3I3NA 3CHMA 3HIZA 2P2CP 3CR3A 1V54E 5B3SE 4BTBA 4L2LA 4KZCA 5FWQA 2CFUA 3MV3B 1OWPA 3OXGA 2Y3AA 2HM8A 3ASGA 4AOFA 1LD8A 5ARGA 4R7LA 4CT0A 3ISMC 4LRZA 2WXQA 5KNHD 3UX4A 1O1SA 4G2VA 4JPSA 3ASHA 5CRUA 4PH4B 2L6JA 3MJWA 4DUIA 4Y6CA 1WY6A 2J07A 3R9MA 3TWRA 4OVVA 4K03A 3GZ1A 3UTMA 3Q75A 2J8SD 4I1OB 3CIAA 1X5BA 3QWPA 4KVOA 1XNFA 4JEUA 3VLEA 5CCMA 5HRYA 3NZUA 1PAQA 3WG7E 4JC8A 2P9IG 2XQ0A 3I4GA 2WXMA 4XX5A 2C0LA 4UQXA 1DCEA 5IY5E 1A17A 2H6HA 3QB2A 2YHCA 3B13A 2CFZA 3C72A 3V30A 4TRQA 1H2VC 3CKBA 2GRRB 3ESLA 2ZXWE 3C98A 3ML8A 5EX3A 3LY7A 3RK6A 5HI7A 4UWHA 3Q7FA 4GAAA 1SZAA 2J09A 2CHWA 4GU5A 5ENRD 3RAUA 4GA0A 4QFVA 4BETA 3E34A 5AQAA 1LF8A 3FUNA 3SNXA 1OWOA 3B7TA 3P2BA 4K5AB 4FULA 2A5EA 3EJNA 4CEMA 3F6QA 3EU9A 3PREA 1UG3A 4FJYA 2I2OA 4BTAA 3DEOA 4AV7A 4HLEA 2XPIA 1IXVA 3JCKC 1H6KA 3R7QA 3Q7AA 2R03A 4UUCA 1PC2A 4GA1A 3ZU7B 3I4RB 2GGFA 1BU9A 3ZYQA 4ACLA 3Q78A 1MYOA 3UKRG 3NZSA 3FUDA 2YNQA 4XI9A 2HYZA 4A3TA 3G2UA 2WXJA 4C0MA 5CMWA 5CBOA 4I9CA 4GYOA 3CVNA 1FT1A 3ZHEB 4APOA 2PQRA 4ILGA 5BPPA 1RZ4A 4RVBA 3ULYA 4DX5D 3HXFA 4BT9A 4APFA 4ZFHA 2WQHA 3KSLA 2IF4A 4CYMD 2J4DA 3CQCB 1FT2A 1ELRA 2WPVA 2X3MA 3FHEA 4C0EA 3FTUA 4I17A 3NOCD 2XCCA 3VTYA 4JD2G 1YYHA 3CK9A 3BQOA 2A4ZA 3G2WA 1ZB1A 2XPYA 4JXTA 3ZFWA 3D3MA 3KEZA 4GTMA 4A1GA 4FHJA 2IONA 3MZLB 3ZEFA 2UY1B 3OTNA 1IYGA 3C5RA 3CHOA 3UM1A 4EECA 4CDMA 1E7VA 2DZOA 2WQ7A 2BF0X 3DSVA 1SA4A 4BX9A 3Q15A 1BD8A 2RFAA 2NYJA 1NP7A 3FEXA 3ZYLA 3L82A 2DVWA 1ELWA 3MGBA 1NA3A 3ZW3A 2HO1A 4DX6D 1MX6A 2LSVA 3FU6A 3UQ3A 3RKVA 5E75A 1OCCE 2Y69E 1HXIA 3HHMA 3ULEG 4HRLA 5AJLA 4FHKA 1O5MA 3SBTB 1N52A 3NBNB 4B8AA 3S7JA 2Y0BG 2P9PG 3D9PA 2EIME 3CVYA 5CEDB 4CDNA 1Z6TA 2WXHA 5FQ4A 2DYSE 4HOUA 3SBSA 2V5QC 2DZNA 2EQXA 4J8SA 4HI9A 4WWOA 3UM0A 5AQ9A 4F6RD 4BSXA 4ILHB 4ATGA 1HG2A 1OCRE 1H6OA 3TWVA 4LUNU 2OEWA 4ZHBA 3TWQA 2QZAA 2KCLA 4LNGA 2MHKA 2BEDA 2XEVA 5FINA 3TXNA 4Y6WA 5BNWA 2Y1LE 1E8WA 1N4QA 4GZDA 3LYAA 3PZ3A 3FTZA 5ENPD 3TXMA 3LXUX 4HLLA 4DX7D 4V3IA 4BT8A 1DNPA 4CZ2D 3GZ2A 1D8EA 2FO7A 4U07A 4L23A 3CVLA 3CV0A 1H2TC 2XENA 5ITZF 4XEIG 3B7RL 2BTDA 2EINE 3CK8A 5FT9A 2XGSA 1PY1A 3HXDA 3QC1A 2X6JA 4EZKA 4HFGA 4GB9A 3KAEA 1JCRA 4AIFA 1XGWA 3DSXA 2OOEA 3CEQA 1N0QA 5EYPF 3SFZA 5M72A 1TN8A 5AARA 3EHNA 4GZCA 4K5BA 4RLYA 5CHEE 3UKUG 4IULA 4B94A 3MYVA 3MKQB 2P9KG 3I5PA 3UUXA 5AJDA 2FI7A 5JMND 3HDXA 1S70B 4HQDA 3AG4E 2CG3A 3DSUA 2ONDA 3LVRE 3WXXA 2AJAA 5B1AE 2VYIA 5AENA 2H6IA 1AWCB 4G11A 1E96B 5LOZA 2VSXE 3DSSA 5G04J 5AIJA 4ANWA 2R2LA 3X2QE 1UN8A 1JWGA 1UOHA 4KYOB 4GTPA 3MV2B 4HB5A 3LY8A 3NOGD 2WVIA 3NB2A 3URZA 2P9NG 3FH5A 4FU3A 1OUVA 4HS2A 3BG0B 1TN6A 1OXJA 4J6IA 2ILRA 4K0RA 3ZIMA 1Y6IA 2AWIA 4DK5A 4WNEA 4WWNA 2QYUA 3PS6A 2FEZA 2KM4A 4H7XA 5KBAA 4I1MA 4F53A 3UT8A 3LKUA 4I1AA 4G26A 2R05A 4FLHA 1UN9A 3MA5A 2WXKA 3W9FA 3U4TA 5FQ7A 3FTXA 2UWJG 3ML9A 4B93B 2XGMA 2LXLA 4KZ0A 3APDA 4Q69A 3CVUA 2BUGA 2H6GA 4JVSA 3T8MA 3CLJA 3ASDA 3PZ4A 3EDTB 5ENQD 3SZ7A 2LXMA 3L16A 3IV0A 3CHRA 2V0PA 2QYJA 2NC9A 4ANXA 1RW2A 2GRQB 4J8EA 1N4PA 2VSYA 3QWVA 3FTYA 4L7TA 4J0UA 5G2NA 2ETAA 1O1RA 4G23A 4IRUA 5ENTD 1WG0A 2YINA 2VTBB 4CDRA 1H19A 4Q96A 5CEAA 2C2LA 1INZA 2XCBA 1WAO1 3UMVA 3LY9A 1N0RA 3MX3A 5FZQA 5HQ8A 4OAVB 2X38A 3LS8A 5E76A 4LERA 4HOSA 2E2EA 2XRZA 5C2YA 2UY1A 4AP2A 3SGHA 1FVFA 4E6HA 1LD7A 5EX0A 1IKND 3QK0A 3L54A 2Q7FA 3E4BA 2WMOA 5CCLA 5KCMA 3ABLE 4GTVA 2IFUA 3Q47B 1MHQA 2YHEA 2GROB 3FUEA 2WXNA 3CSFA 3DXMG 1JWFA 3B95A 2A5UA 3S7FA 1QBQA 4U8YD 4I6EA 4EBAG 4UI9C 3VTXA 2L0TB 3N71A 4BSZB 3FUHA 2WQ6A 3L13A 3PE4A 3JUIA 3ONKA 3EHRA 4MKTA 2IQCA 1N95A 1HH8A 3SFYA 3ZPJA 2VQ2A 2XS8A 4ABNA 4EQFA 2WXGA 5FJYA 3KS2A 4GTTA 2J4BA 5A23A 4G1TA 3DRAA 4YDYA 1BI7B 3CK7A 1TR4A 3PRZA 1Z3XA 4UI9J 5H7PA 4DPRA 3RRMB 3IBEA 2DYRE 1UJKA 5LFAA
chains in the Genus database with same CATH topology
1EDUA 3BG1B 3U66A 3ZHEA 1NA0A 2LSVA 4U04A 3TL5A 5KJLA 1E8XA 2Y4UA 3B7SA 4BFRA 3FU6A 3O48A 2FULA 5KJKA 4DI3A 3UQ3A 3RKVA 2PM6A 2GW1A 5E75A 4KMOA 1NZNA 3PEVB 4JEHA 2GRLA 3G2SA 2XPZA 1ZBPA 3FUIA 1S0PA 4I9EA 4JHRA 3VLDA 3DPDA 3FU3A 3CSTA 1HXIA 3HHMA 3UPVA 4FA6A 5AJLA 5A6CA 3S2AA 4FHKA 4UQZA 3Q49B 3SBTB 1N52A 4B8AA 3D9LA 1P5QA 2KC7A 3S7JA 4AY5A 4HXIA 2WMNA 3OXFA 1Y8MA 3AU4A 4DI4A 2PQNA 3D9PA 4BX8A 3O4ZA 4O6FA 2WXLA 4GA2A 3PEUB 2NXPA 1YA0A 3ONLA 1JUQA 1KLXA 3SF4A 3CVYA 3T5XA 4H7YA 4HORA 3QJZA 3ENEA 4F3VA 5J08A 4CDNA 1Z6TA 2WXHA 3TGOA 2Y4TA 5DBKA 1HFAA 4MLPA 5FQ4A 3NQPA 2J9QA 3L6AA 4HOUA 4XKBA 3PNTB 4CT4A 2HR2A 4U0ZA 3SBSA 4DLOA 4GCNA 4U0SA 5D0QD 3T5VA 4N2QA 4UWGA 2EQXA 4ANUA 3EIQC 3U9WA 2PM7A 4J8FA 4HVBA 4J8SA 4WWOA 5BV0A 4BSXA 3CVPA 1SZ9A 4ILHB 4ATGA 4DJAA 4FC8A 1HG2A 3QDNA 4I43A 4NRHB 5ANLA 4UWKA 3VLFA 1W3BA 1QZ2A 4GZ5A 4HOTA 1OWNA 4GMJA 4LUNU 2C0MA 2WXIA 3FTWA 5FTPA 4F1SA 1HF8A 2LO6A 2V8SE 3QOUA 3ASFA 4JW1A 3K9IA 2WXFA 3ULQA 3ZRHA 1IHGA 4ACKA 4AVXA 5KJNA 5T4YA 3FUJA 4M3OA 2KCLA 4N5CA 2MHKA 3AS4A 2XEVA 2AW6A 3TXNA 4Y6WA 5T8IA 3D9IA 5BNWA 3D9KA 1KT0A 3QWWA 3U3WA 2IOSA 3AU5A 4RG9A 4ILIA 4KT6B 4BY6A 3Q4AB 3LDZA 3JYSA 2M63A 1H0AA 3EIJA 1E8WA 4GZDA 3LYAA 5G55A 1E8YA 2RG8A 3APCA 3FTZA 4Q94A 2NSZA 4FP7A 3TXMA 3RO3A 3SHFA 3LXUX 2WM9A 4V3IA 5LFAA 1IQUA 5LX8A 4BT8A 1TEZA 1DNPA 1B89A 3PNLB 5EKQD 2AVPA 2FO7A 3GZ2A 3QARA 1U3CA 4U07A 4L23A 3GYZA 3CVLA 3PUKA 3CV0A 3JQ1A 4XKCA 5C1DA 1H2TC 5ANRA 5JJ7A 1HE8A 2OVFA 2R59A 3TJPA 3MCXA 2KZTA 4XZ4A 3I3NA 3CHMA 3B7RL 3RRUA 2BTDA 3UT7A 4EZLA 4GZ3A 3FDHA 3OXLA 3CK8A 5FT9A 5FQ8A 2XGSA 5KJMA 3HIZA 3RJVA 1PY1A 5JHAA 3CR3A 3FU5A 4BTBA 4JA7A 2YQ8A 4CGVA 4L2LA 4KZCA 5FWQA 4BWRA 2WB2A 2CFUA 3QC1A 3MV3B 2X6JA 2OV8A 4I6GA 4EZKA 4HFGA 4NACA 4GB9A 1OWPA 3U64A 3KAEA 3OXGA 2Y3AA 2KZTB 2HM8A 2CG2A 4GCOA 4AIFA 4GPKA 1XGWA 3FWVA 1ZU2A 3ASGA 4AOFA 2OOEA 3CEQA 1HG5A 4AM9A 3SFZA 5ARGA 5M72A 1JPLA 2WXRA 3CVQA 5G05J 4R7LA 4CT0A 2IU1A 2L9BA 2AXVA 3EHNA 4GZCA 2WXQA 4LRZA 3RRNB 1SQMA 4TV3A 3UX4A 4GZ6A 5CHEE 4IULA 4A55A 4G2VA 3FH8A 4JPSA 3ASHA 4PH4B 2L6JA 3SD5A 3MJWA 4Y6CA 3ZXSA 4B94A 1QNFA 1WY6A 2J07A 3MYVA 3FEYA 4OVVA 4K03A 3EHMA 2J49A 1HU3A 3GZ1A 3MKQB 4N39A 3ESKA 2PL2A 4I1OB 3I5PA 1VDYA 5AJDA 2VJ8A 3CIAA 1X5BA 3UUXA 3QWPA 2I1JA 4KVOA 3FH7A 1XNFA 2FI7A 4JEUA 3VLEA 2X6KA 3HDXA 5CCMA 4FJZA 2L0IA 3NZUA 3L17A 3LPZA 2CG3A 1PAQA 2ONDA 3G2VA 2WXPA 3LVRE 3S7DA 3TAXA 4JC8A 3CQGB 3WXXA 2XQ0A 4JHKA 2VYIA 3I4GA 2WXMA 5AENA 4XX5A 4D10C 3FUKA 2C0LA 4UQXA 1WM5A 3FTSA 2AXUA 4I6JA 4XIFA 4WNGA 4G11A 3IEGA 1A17A 1E96B 3QB2A 3AS5A 1GW6A 4PS3A 2VSXE 2YHCA 5LOZA 5G04J 3ZYMA 3D9JA 3UT4A 3B13A 3BEEA 5AIJA 2CFZA 4TRQA 4F7AA 4ANWA 4G25A 2JEKA 1H2VC 1UN8A 3R9AB 5A7DB 3FTVA 1JWGA 3CKBA 3RO2A 3ZGQA 4KYOB 4KVMA 2MOWA 3MV2B 4UWLA 4PS8A 4I2WA 2OVBA 3ESLA 4WAFA 3D9NA 3LY8A 3CVVA 2WVIA 4JHJA 3C98A 3HYMB 3URZA 3FH5A 3D9MA 3ML8A 5FZRA 4L2YA 4FU3A 5EX3A 1OUVA 3CKCA 3LY7A 4HS2A 2DBAA 3BG0B 3RK6A 4IYPA 5HI7A 3MKRA 4J6IA 2FBNA 2ILRA 2DCPA 4K0RA 4UWHA 2V4LA 4RG6A 1TJFA 3ZIMA 4CGWA 1Y6IA 5LCWJ 4GAAA 3PVLA 2AWIA 4DK5A 3FULA 4U63A 1SZAA 4GYWA 4LCTA 4WNEA 3PS6A 4WWNA 2FEZA 4C9BB 2J09A 2CHWA 2KM4A 2PZIA 4H7XA 4GU5A 4I1MA 1E7UA 3RIBA 3UT8A 3LKUA 4I1AA 4F53A 5CMYA 4GA0A 4QFVA 4IN3B 4G26A 2WXOA 4FLHA 2X6HA 1LF8A 1UW4B 1UN9A 3PDNA 3FUNA 3QNKA 4GMLA 4LEUA 3SNXA 3MA5A 2WXKA 4HOQA 4AJWA 1OWOA 3AS8A 3B7TA 1KT1A 3FTXA 3P2BA 5FQ7A 3U4TA 4PUCA 2UWJG 5EDSA 1Z3YA 3ML9A 1OWLA 3CHQA 4FULA 2VGYA 3FUFA 3EJNA 5G05C 2XGMA 4KZ0A 4CEMA 1EPUA 3APDA 3ZVVA 4Q69A 3CVUA 2BUGA 4JZYA 3QKYA 5ENNA 4JVSA 3CVXA 2ZU6B 3T8MA 3CLJA 3ASDA 3PREA 1HO8A 2QY7A 3FUMA 1UG3A 3EDTB 4FJYA 2I2OA 3SZ7A 4FLBA 3L16A 4BTAA 3IV0A 4N3AA 3CHRA 2V0PA 4XE0A 2XHEA 3NF1A 3GW4A 2GRMA 4AV7A 2J08A 2NC9A 2QFCA 2XPIA 4HLEA 3JCKC 1H6KA 4ANXA 3R7QA 1OWMA 4N3BA 3QAQA 3MKQA 4J8EA 4W9RA 5FZSA 1U3DA 1PC2A 2VSYA 3QWVA 3FTYA 4GA1A 3Q5MA 4L7TA 4OVUA 4DLQA 3IHYA 4J0UA 5G2NA 3I4RB 2GGFA 3ZYQA 2I1KA 4ACLA 3PZDA 1FVHA 2I9CA 4G23A 4EPZA 4IRUA 3FY4A 3L08A 4CCAA 1E8ZA 3NZSA 5G04C 2YINA 3FUDA 2YNQA 4B0ZA 4XI9A 4WWPA 2HYZA 4NURA 5BT1A 2V5FA 3G2UA 4A3TA 2VTBB 4CDRA 2WXJA 4C0MA 3S7BA 5CMWA 4I9CA 3IHVA 3KD7A 4PS7A 5BW8C 4GYOA 3RU0A 3CVNA 4EZJA 2X6FA 2XRYA 5BUZA 4N2SA 1H19A 1L5JA 4Q96A 1BPOA 4WUYA 3ZHEB 4WNDA 4AEZC 4UWFA 1H2UA 4APOA 2P58C 2PQRA 4ILGA 1EYHA 4C0EA 4CRWA 5BPPA 4AXHA 2C2LA 2VGXA 4RVBA 1INZA 2XCBA 3FFLA 1WAO1 2AXZA 4YNDA 5D0OD 3UMVA 4BT9A 4I2ZA 3LY9A 4APFA 2WQHA 3ZYKA 3CHPA 4JA9A 5LCWC 3MX3A 2KATA 5FZQA 3SI5A 5HQ8A 2CHXA 2IF4A 2X38A 2J4DA 2LAHA 3CQCB 4L1BA 3LS8A 5E76A 4P29A 1ELRA 3MEKA 4E85A 1QQEA 4LERA 4HOSA 2WPVA 3ZN3A 2X3MA 3FHEA 2CHZA 4GYYA 2E2EA 5T3RA 1EF1C 2DIWA 3FTUA 1MQSA 4I17A 4MS6A 2UY1A 2IJGX 2XCCA 4U0UA 5C2YA 3VTYA 2XRZA 3CK9A 2A4ZA 2VGXB 3G2WA 3LJ3A 3R7RA 3P1UA 1ELKA 4AP2A 4UQYA 2RD0A 2XPYA 3SGHA 4JXTA 1FVFA 3ZFWA 4E6HA 5EX0A 1FCHA 2XGOA 1HX8A 3D3MA 3KEZA 5ARFA 4B8CB 3QK0A 4KXKB 4A3VA 3L54A 2Q7FA 3E4BA 2WMOA 4MRUA 5CCLA 5KCMA 4FHJA 4A1GA 3HVEA 2IFUA 2IONA 3Q47B 1MHQA 1HZ4A 4YVQC 4WNFA 2JLBA 4B89A 2YHEA 2MRIA 3CHSA 5JJ6A 5BV1A 3MZLB 3ZEFA 4PDXA 2UY1B 3DBSA 3PH0C 3FUEA 3OTNA 2WXNA 3CSFA 3D9OA 1JWFA 2A5UA 3S7FA 3FP3A 1IYGA 3B7UX 4J8DA 5JHBA 2X6IA 3CHOA 2E0IA 4A1SA 2I6HA 1TJCA 4NQ0A 4UI9K 2VSOE 3OAWA 1DVPA 4I6EA 4N3CA 4EBAG 2LSUA 4UI9C 3TG5A 3VTXA 2L0TB 4EECA 3HVEB 1IQRA 3N71A 3CVWA 4G24A 3LEWA 3LVQE 4JL0A 3PUJA 4EBAA 3G2TA 2VSNA 1UJJA 4CDMA 3FUHA 1E7VA 3APFA 3PE3A 2WQ6A 3L13A 3PE4A 4URKA 3JUIA 3ONKA 4MKTA 2WQ7A 2BF0X 4AY6A 2IQCA 2R5SA 5J90A 3FU0A 3IKOB 5LP0A 1HH8A 2LAIA 3ZPJA 2VQ2A 1E90A 3GZSA 4RSYA 4U8HA 4ABNA 4EQFA 2WXGA 5FJYA 5AYWD 4BX9A 3L22A 3KS2A 3TG4A 2KCVA 2J4BA 3Q15A 4ANVA 5A23A 4G1TA 2LNIA 3JQ0A 4YVOA 3CK7A 2VTBA 4KBQA 4XI0A 1HS6A 1NP7A 1N54A 2IOLA 2R17C 3CGHA 3FEXA 3PRZA 5FQ6A 3ZYLA 2KCKA 1ELWA 1Z3XA 3MGBA 5DIZA 4FADA 2FF4A 4ME2A 4UI9J 1NA3A 4OYSA 3ZW3A 2HO1A 4TUUA 4DPRA 5JJTA 3RRMB 3IBEA 1UJKA 3LCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDU A;  2MOW A;  5CMY A;  5LP0 A;  3D9L A;  3D9O A;  1EYH A;  3CLJ A;  1LF8 A;  3ZYQ A;  1JWF A;  3D9I A;  2QY7 A;  3D9N A;  3G2W A;  3D9K A;  1INZ A;  1ELK A;  4FLB A;  4HFG A;  3D9P A;  3D9M A;  4NAC A;  4FU3 A;  4JXT A;  3LDZ A;  1SZ9 A;  1H0A A;  3ONL A;  1HG2 A;  1HX8 A;  1JUQ A;  3ZYK A;  5LOZ A;  4GZD A;  1XGW A;  3G2S A;  3ZYM A;  1DVP A;  1VDY A;  2DCP A;  3G2U A;  3D9J A;  1X5B A;  3RRU A;  2L0T B;  5CMW A;  4Q94 A;  1HG5 A;  5J08 A;  1MHQ A;  3ZYL A;  1JPL A;  1SZA A;  2L0I A;  1HFA A;  1HF8 A;  2LO6 A;  2V8S E;  3G2T A;  1UJJ A;  2KM4 A;  1JWG A;  3G2V A;  4GZC A;  1PY1 A;  4Q96 A;  4AVX A;  2DIW A;  3ONK A;  1UJK A;  2BF0 X; 
#chains in the Genus database with same CATH topology
 2PNN A;  3TL5 A;  5KJL A;  3DPY A;  1AP7 A;  4DI3 A;  3UM2 A;  1DC2 A;  3PEV B;  4JEH A;  2XPZ A;  1S0P A;  3Q73 A;  3VLD A;  3DPD A;  3UPV A;  4FA6 A;  5EID A;  3Q49 B;  2XEH A;  1P5Q A;  5CBN A;  4GTO A;  4O1P A;  3AU4 A;  2PQN A;  2WXL A;  5CER B;  1K8K G;  1JUQ A;  1KLX A;  3TGO A;  1WDY A;  2Y4T A;  5DBK A;  3L6A A;  2HR2 A;  3PZ2 A;  1MX4 A;  4U0S A;  1S64 A;  4ANU A;  3EIQ C;  4J8F A;  3HXB A;  1D9S A;  5AN8 A;  3CVP A;  1SZ9 A;  4DJA A;  4FC8 A;  4I43 A;  4UWK A;  1W3B A;  1OWN A;  4LNB A;  5FTP A;  2WXF A;  4ACK A;  5T4Y A;  3FUJ A;  4M3O A;  2XS1 A;  3EU5 A;  4O60 A;  3J5P A;  4KT6 B;  3LDZ A;  3AG2 E;  4LG6 A;  3EIJ A;  1E8Y A;  4FP7 A;  5AQ7 A;  5AQB A;  3UXG A;  4OAU C;  4QQI A;  1JCQ A;  3JQ1 A;  3TJP A;  3RRU A;  3ZXP A;  3UT7 A;  4EZL A;  4HRN A;  4GZ3 A;  3FDH A;  3AJI A;  5KJM A;  3L9T A;  4TXQ A;  3FU5 A;  2GRP B;  2WB2 A;  1K1A A;  4NAC A;  3U64 A;  3IXE A;  2CG2 A;  2IEJ A;  2ZGD A;  1A5E A;  3TWW A;  1HG5 A;  1JPL A;  2EIL E;  4U8V D;  5G05 J;  2IU1 A;  2AXV A;  3RRN B;  4LSZ E;  4A55 A;  3BUA A;  3HXE A;  3ZXS A;  4O1O A;  1QNF A;  3FEY A;  1SA5 A;  3EHM A;  2PL2 A;  1VDY A;  3FH7 A;  2X6K A;  4FJZ A;  2L0I A;  3L17 A;  3LPZ A;  2VGE A;  4U96 D;  4M7C A;  4D10 C;  1WM5 A;  4TXR A;  5AAO A;  3PZ1 A;  3IEG A;  3W9G A;  1GW6 A;  3D9J A;  3UT4 A;  3BEE A;  4F7A A;  3Q9U C;  4G25 A;  3AG1 E;  3FTV A;  3RO2 A;  3ZGQ A;  2LUH A;  4KVM A;  5CRV A;  2MOW A;  4I2W A;  4DX1 A;  3CVV A;  3HYM B;  4TXP A;  5FZR A;  2DBA A;  4IYP A;  4RG6 A;  1TJF A;  4CGW A;  5LCW J;  3PVL A;  2MYO A;  3FUL A;  4LCT A;  4C9B B;  1E7U A;  2H6F A;  1OT8 A;  5CMY A;  4GTQ A;  4IN3 B;  2WXO A;  4LEU A;  4GPM A;  3AS8 A;  1S63 A;  4PUC A;  5EDS A;  1OWL A;  4EHM A;  3EUV A;  1V55 E;  3JXJ A;  1EPU A;  4JZY A;  3QKY A;  4U7E B;  5FIO A;  5ENN A;  1N9A A;  2KXP C;  2ZU6 B;  3T8K A;  4FLB A;  4N3A A;  3ABK E;  4XE0 A;  4GTR A;  3NF1 A;  2GRM A;  3KSQ A;  2J08 A;  3AAA C;  4N3B A;  1NI1 A;  3QAQ A;  2ETB A;  4W9R A;  4J8Y A;  3HRA A;  2OEV A;  3TWU A;  4GMR A;  4DLQ A;  3IHY A;  4Z68 A;  5HKP A;  4GTS A;  4EPZ A;  3FY4 A;  3L08 A;  1E8Z A;  5G04 C;  1IHB A;  4B0Z A;  4WWP A;  2EIK E;  2BKK B;  3IHV A;  4PS7 A;  3RU0 A;  2XRY A;  5BUZ A;  4N2S A;  4U95 D;  1L5J A;  4UWF A;  1H2U A;  1TNB A;  2P58 C;  3JXI A;  1EYH A;  4CRW A;  3Q9N C;  4AXH A;  3FFL A;  4YND A;  3SFX A;  5D0O D;  4I2Z A;  3ZYK A;  3CHP A;  3SO8 A;  4JA9 A;  2KAT A;  1KZO A;  2OCC E;  4J7W A;  4L1B A;  3Q79 A;  5ENO D;  3MEK A;  4E85 A;  3ZN3 A;  5T3R A;  1OCO E;  3ZKJ A;  3SQV A;  5EIB E;  1MX2 A;  2VGX B;  3P1U A;  4UQY A;  2RD0 A;  1HX8 A;  4B8C B;  5ARF A;  4KXK B;  4BES A;  4YVQ C;  4WNF A;  2JLB A;  4B89 A;  4PDX A;  1U2V G;  2XEE A;  1NFI E;  4J8D A;  2E0I A;  4UI9 K;  2VSO E;  3OAW A;  1DVP A;  2LSU A;  3TG5 A;  3HVE B;  1IQR A;  4YDW A;  1YMP A;  2GRN B;  2BKG A;  4EBA A;  3G2T A;  1UJJ A;  3PE3 A;  4AY6 A;  2R5S A;  3FU0 A;  5LP0 A;  4U8H A;  3UIO C;  4DRX E;  3L22 A;  2RFM A;  3DEP A;  1Q2Z A;  4ANV A;  2R02 A;  3CGH A;  1N54 A;  5FQ6 A;  4ME2 A;  4OYS A;  4TUU A;  5JJT A;  2FO1 E;  1EDU A;  3ZHE A;  1NA0 A;  4U04 A;  1E8X A;  3B7S A;  5KJK A;  2PM6 A;  2GW1 A;  2P9U G;  1ZBP A;  4JB8 P;  3CST A;  1QYM A;  2V4H C;  3NAW A;  3S2A A;  4AY5 A;  4HXI A;  1Y8M A;  4DI4 A;  5D66 A;  1OCZ E;  4GA2 A;  3PEU B;  3ONL A;  1YA0 A;  3SF4 A;  2KBX A;  3RSE G;  2ZGG A;  4F1P A;  4HOR A;  5J08 A;  3ENE A;  4F3V A;  1NL4 A;  3E37 A;  1HFA A;  4XKB A;  3PNT B;  4GCN A;  1N4S A;  5D0Q D;  3UI2 A;  3T5V A;  4N2Q A;  3U9W A;  1BLX B;  4HVB A;  3UIN C;  3HG0 D;  3QDN A;  5JA4 D;  5ANL A;  1QZ2 A;  4GZ5 A;  1TNO A;  4GMJ A;  2C0M A;  2WXI A;  3FTW A;  2V8S E;  3ZRH A;  4JW1 A;  3ULQ A;  4AVX A;  3V79 K;  4A63 B;  2AW6 A;  1KT0 A;  3AU5 A;  4RG9 A;  4BER A;  5ENS D;  4ILI A;  4BY6 A;  3Q4A B;  2P9S G;  4G8K A;  3AG3 E;  3E30 A;  1KZP A;  2RG8 A;  3APC A;  4Q94 A;  2XZT G;  3SHF A;  2WM9 A;  3LJN A;  3DXK G;  1TEZ A;  1B89 A;  5EKQ D;  2AVP A;  1U3C A;  2ZIS A;  3PUK A;  1N4R A;  2B6C A;  5C1D A;  5JJ7 A;  1HE8 A;  2OVF A;  2R59 A;  3MCX A;  2RKK A;  3OXL A;  5EN5 D;  5FQ8 A;  3RJV A;  5JHA A;  1OY3 D;  2XZD G;  4JA7 A;  2YQ8 A;  4CGV A;  4K5C A;  4BWR A;  2OV8 A;  4I6G A;  3EHQ A;  1JCS A;  2KZT B;  4GCO A;  4GPK A;  3FWV A;  1ZU2 A;  1DCQ A;  4AM9 A;  2WXR A;  3CVQ A;  2L9B A;  1SQM A;  4TV3 A;  4GZ6 A;  3FH8 A;  3SD5 A;  2J49 A;  4N5Q A;  1HU3 A;  4N39 A;  3ESK A;  4C48 B;  2VJ8 A;  2I1J A;  3G2V A;  2WXP A;  3S7D A;  3TAX A;  3CQG B;  2F0Y A;  2P9L G;  4JHK A;  3FUK A;  3V2X A;  3FTS A;  2AXU A;  4I6J A;  4XIF A;  4WNG A;  5KNG A;  5BXO A;  4PS3 A;  3AS5 A;  3ZYM A;  2JEK A;  3R9A B;  5A7D B;  3JUE A;  4L9P A;  4PS8 A;  4UWL A;  2OVB A;  4WAF A;  2L6B A;  3D9N A;  4JHJ A;  3TWS A;  3D9M A;  4L2Y A;  3CKC A;  3MKR A;  2FBN A;  2DCP A;  2IY0 C;  2V4L A;  3E32 A;  3V2O A;  4U63 A;  4GYW A;  4TUM A;  2PZI A;  3B7B A;  3RIB A;  1MJ0 A;  3KEA A;  2X6H A;  1UW4 B;  2IO3 C;  3PDN A;  3QNK A;  4GML A;  4HOQ A;  3UM3 A;  4AJW A;  1KT1 A;  1Z3Y A;  3CHQ A;  3ASO E;  2VGY A;  2B0O E;  3FUF A;  5G05 C;  3ASN E;  3ZVV A;  3CVX A;  3DSW A;  1HO8 A;  2QY7 A;  1TNY A;  3FUM A;  2XHE A;  3GW4 A;  2QFC A;  1FPP A;  3DWL G;  1OWM A;  3MKQ A;  3TWT A;  4NIK A;  5FZS A;  1U3D A;  4HNA D;  3Q5M A;  4OVU A;  2EIJ E;  2I1K A;  3PZD A;  1FVH A;  1N94 A;  2I9C A;  4CCA A;  3ABM E;  4NUR A;  5BT1 A;  2V5F A;  3S7B A;  3KD7 A;  5BW8 C;  4EZJ A;  2X6F A;  3C3R A;  3BU8 A;  3T9K A;  1BPO A;  4WUY A;  4AEZ C;  4WND A;  2VGX A;  3DST A;  2AXZ A;  5D2M C;  5LCW C;  5BXU A;  2ETC A;  3SI5 A;  2CHX A;  2LAH A;  1MZC A;  4P29 A;  1BI8 B;  1QQE A;  3SY2 A;  2CHZ A;  4GYY A;  2DWZ A;  1EF1 C;  2DIW A;  1MQS A;  4U0U A;  4MS6 A;  2IJG X;  3LJ3 A;  3R7R A;  1ELK A;  1O1T A;  1X81 A;  1YCS B;  1FCH A;  2XGO A;  2F8X K;  4A3V A;  3C3O A;  4MRU A;  5KWD A;  1D8D A;  1TYQ G;  3HVE A;  1HZ4 A;  2MRI A;  3CHS A;  5JJ6 A;  5BV1 A;  3DBS A;  3PH0 C;  3D9O A;  4HBD A;  1TNZ A;  5HS0 A;  3FP3 A;  3B7U X;  5JHB A;  2X6I A;  1TNU A;  1KPS B;  4A1S A;  2I6H A;  4YDE A;  1TJC A;  4NQ0 A;  4N3C A;  3CVW A;  4G24 A;  1N11 A;  3LEW A;  3LVQ E;  4JL0 A;  4HRM B;  3HXC A;  3PUJ A;  2VSN A;  4ATZ D;  1G3N B;  3APF A;  4URK A;  5J90 A;  3IKO B;  2LAI A;  5B1B E;  1E90 A;  1H6P A;  3GZS A;  1SW6 A;  4RSY A;  2F37 A;  1K3Z D;  5AYW D;  3TG4 A;  4DX2 A;  2KCV A;  4YVO A;  2LNI A;  3JQ0 A;  3C3Q A;  2VTB A;  4KBQ A;  4XI0 A;  1HS6 A;  2IOL A;  2R17 C;  2KCK A;  5DIZ A;  4HI8 A;  4FAD A;  2FF4 A;  2HE0 A;  2ZIR A;  4BEP A;  3LCA A;  3BG1 B;  3U66 A;  2Y4U A;  4BFR A;  3O48 A;  2FUL A;  2JAB A;  1K1B A;  4KMO A;  1NZN A;  5EYL A;  2GRL A;  3G2S A;  3FUI A;  4I9E A;  1LTX A;  4JHR A;  3FU3 A;  3E33 A;  5A6C A;  2QC9 A;  4UQZ A;  4MBG A;  3D9L A;  2KC7 A;  2WMN A;  3OXF A;  4YDO A;  4BX8 A;  3O4Z A;  4O6F A;  2NXP A;  4RQI A;  1Z5S C;  3T5X A;  4H7Y A;  3QJZ A;  4MLP A;  3ZNG A;  3NQP A;  2J9Q A;  4CT4 A;  4U0Z A;  4DLO A;  4UWG A;  2PM7 A;  3ZUV B;  5CEC B;  1TN7 A;  5BV0 A;  2F8Y A;  4NRH B;  3VLF A;  3D9H A;  4HOT A;  4F1S A;  1HF8 A;  2LO6 A;  3QOU A;  3ASF A;  3K9I A;  1IHG A;  5KJN A;  4LNU D;  4N5C A;  4X8Q A;  3TWX A;  3AS4 A;  5T8I A;  3D9I A;  3D9K A;  3QWW A;  3U3W A;  2IOS A;  3JYS A;  2M63 A;  1H0A A;  3J5Q B;  5G55 A;  2NSZ A;  3RO3 A;  3UIP C;  1IQU A;  5LX8 A;  3PNL B;  3QAR A;  3V31 A;  3GYZ A;  1SVX A;  4XKC A;  5ANR A;  2IO2 C;  5EIL A;  4G8L A;  2KZT A;  4XZ4 A;  3I3N A;  3CHM A;  3HIZ A;  2P2C P;  3CR3 A;  1V54 E;  5B3S E;  4BTB A;  4L2L A;  4KZC A;  5FWQ A;  2CFU A;  3MV3 B;  1OWP A;  3OXG A;  2Y3A A;  2HM8 A;  3ASG A;  4AOF A;  1LD8 A;  5ARG A;  4R7L A;  4CT0 A;  3ISM C;  4LRZ A;  2WXQ A;  5KNH D;  3UX4 A;  1O1S A;  4G2V A;  4JPS A;  3ASH A;  5CRU A;  4PH4 B;  2L6J A;  3MJW A;  4DUI A;  4Y6C A;  1WY6 A;  2J07 A;  3R9M A;  3TWR A;  4OVV A;  4K03 A;  3GZ1 A;  3UTM A;  3Q75 A;  2J8S D;  4I1O B;  3CIA A;  1X5B A;  3QWP A;  4KVO A;  1XNF A;  4JEU A;  3VLE A;  5CCM A;  5HRY A;  3NZU A;  1PAQ A;  3WG7 E;  4JC8 A;  2P9I G;  2XQ0 A;  3I4G A;  2WXM A;  4XX5 A;  2C0L A;  4UQX A;  1DCE A;  5IY5 E;  1A17 A;  2H6H A;  3QB2 A;  2YHC A;  3B13 A;  2CFZ A;  3C72 A;  3V30 A;  4TRQ A;  1H2V C;  3CKB A;  2GRR B;  3ESL A;  2ZXW E;  3C98 A;  3ML8 A;  5EX3 A;  3LY7 A;  3RK6 A;  5HI7 A;  4UWH A;  3Q7F A;  4GAA A;  1SZA A;  2J09 A;  2CHW A;  4GU5 A;  5ENR D;  3RAU A;  4GA0 A;  4QFV A;  4BET A;  3E34 A;  5AQA A;  1LF8 A;  3FUN A;  3SNX A;  1OWO A;  3B7T A;  3P2B A;  4K5A B;  4FUL A;  2A5E A;  3EJN A;  4CEM A;  3F6Q A;  3EU9 A;  3PRE A;  1UG3 A;  4FJY A;  2I2O A;  4BTA A;  3DEO A;  4AV7 A;  4HLE A;  2XPI A;  1IXV A;  3JCK C;  1H6K A;  3R7Q A;  3Q7A A;  2R03 A;  4UUC A;  1PC2 A;  4GA1 A;  3ZU7 B;  3I4R B;  2GGF A;  1BU9 A;  3ZYQ A;  4ACL A;  3Q78 A;  1MYO A;  3UKR G;  3NZS A;  3FUD A;  2YNQ A;  4XI9 A;  2HYZ A;  4A3T A;  3G2U A;  2WXJ A;  4C0M A;  5CMW A;  5CBO A;  4I9C A;  4GYO A;  3CVN A;  1FT1 A;  3ZHE B;  4APO A;  2PQR A;  4ILG A;  5BPP A;  1RZ4 A;  4RVB A;  3ULY A;  4DX5 D;  3HXF A;  4BT9 A;  4APF A;  4ZFH A;  2WQH A;  3KSL A;  2IF4 A;  4CYM D;  2J4D A;  3CQC B;  1FT2 A;  1ELR A;  2WPV A;  2X3M A;  3FHE A;  4C0E A;  3FTU A;  4I17 A;  3NOC D;  2XCC A;  3VTY A;  4JD2 G;  1YYH A;  3CK9 A;  3BQO A;  2A4Z A;  3G2W A;  1ZB1 A;  2XPY A;  4JXT A;  3ZFW A;  3D3M A;  3KEZ A;  4GTM A;  4A1G A;  4FHJ A;  2ION A;  3MZL B;  3ZEF A;  2UY1 B;  3OTN A;  1IYG A;  3C5R A;  3CHO A;  3UM1 A;  4EEC A;  4CDM A;  1E7V A;  2DZO A;  2WQ7 A;  2BF0 X;  3DSV A;  1SA4 A;  4BX9 A;  3Q15 A;  1BD8 A;  2RFA A;  2NYJ A;  1NP7 A;  3FEX A;  3ZYL A;  3L82 A;  2DVW A;  1ELW A;  3MGB A;  1NA3 A;  3ZW3 A;  2HO1 A;  4DX6 D;  1MX6 A;  2LSV A;  3FU6 A;  3UQ3 A;  3RKV A;  5E75 A;  1OCC E;  2Y69 E;  1HXI A;  3HHM A;  3ULE G;  4HRL A;  5AJL A;  4FHK A;  1O5M A;  3SBT B;  1N52 A;  3NBN B;  4B8A A;  3S7J A;  2Y0B G;  2P9P G;  3D9P A;  2EIM E;  3CVY A;  5CED B;  4CDN A;  1Z6T A;  2WXH A;  5FQ4 A;  2DYS E;  4HOU A;  3SBS A;  2V5Q C;  2DZN A;  2EQX A;  4J8S A;  4HI9 A;  4WWO A;  3UM0 A;  5AQ9 A;  4F6R D;  4BSX A;  4ILH B;  4ATG A;  1HG2 A;  1OCR E;  1H6O A;  3TWV A;  4LUN U;  2OEW A;  4ZHB A;  3TWQ A;  2QZA A;  2KCL A;  4LNG A;  2MHK A;  2BED A;  2XEV A;  5FIN A;  3TXN A;  4Y6W A;  5BNW A;  2Y1L E;  1E8W A;  1N4Q A;  4GZD A;  3LYA A;  3PZ3 A;  3FTZ A;  5ENP D;  3TXM A;  3LXU X;  4HLL A;  4DX7 D;  4V3I A;  4BT8 A;  1DNP A;  4CZ2 D;  3GZ2 A;  1D8E A;  2FO7 A;  4U07 A;  4L23 A;  3CVL A;  3CV0 A;  1H2T C;  2XEN A;  5ITZ F;  4XEI G;  3B7R L;  2BTD A;  2EIN E;  3CK8 A;  5FT9 A;  2XGS A;  1PY1 A;  3HXD A;  3QC1 A;  2X6J A;  4EZK A;  4HFG A;  4GB9 A;  3KAE A;  1JCR A;  4AIF A;  1XGW A;  3DSX A;  2OOE A;  3CEQ A;  1N0Q A;  5EYP F;  3SFZ A;  5M72 A;  1TN8 A;  5AAR A;  3EHN A;  4GZC A;  4K5B A;  4RLY A;  5CHE E;  3UKU G;  4IUL A;  4B94 A;  3MYV A;  3MKQ B;  2P9K G;  3I5P A;  3UUX A;  5AJD A;  2FI7 A;  5JMN D;  3HDX A;  1S70 B;  4HQD A;  3AG4 E;  2CG3 A;  3DSU A;  2OND A;  3LVR E;  3WXX A;  2AJA A;  5B1A E;  2VYI A;  5AEN A;  2H6I A;  1AWC B;  4G11 A;  1E96 B;  5LOZ A;  2VSX E;  3DSS A;  5G04 J;  5AIJ A;  4ANW A;  2R2L A;  3X2Q E;  1UN8 A;  1JWG A;  1UOH A;  4KYO B;  4GTP A;  3MV2 B;  4HB5 A;  3LY8 A;  3NOG D;  2WVI A;  3NB2 A;  3URZ A;  2P9N G;  3FH5 A;  4FU3 A;  1OUV A;  4HS2 A;  3BG0 B;  1TN6 A;  1OXJ A;  4J6I A;  2ILR A;  4K0R A;  3ZIM A;  1Y6I A;  2AWI A;  4DK5 A;  4WNE A;  4WWN A;  2QYU A;  3PS6 A;  2FEZ A;  2KM4 A;  4H7X A;  5KBA A;  4I1M A;  4F53 A;  3UT8 A;  3LKU A;  4I1A A;  4G26 A;  2R05 A;  4FLH A;  1UN9 A;  3MA5 A;  2WXK A;  3W9F A;  3U4T A;  5FQ7 A;  3FTX A;  2UWJ G;  3ML9 A;  4B93 B;  2XGM A;  2LXL A;  4KZ0 A;  3APD A;  4Q69 A;  3CVU A;  2BUG A;  2H6G A;  4JVS A;  3T8M A;  3CLJ A;  3ASD A;  3PZ4 A;  3EDT B;  5ENQ D;  3SZ7 A;  2LXM A;  3L16 A;  3IV0 A;  3CHR A;  2V0P A;  2QYJ A;  2NC9 A;  4ANX A;  1RW2 A;  2GRQ B;  4J8E A;  1N4P A;  2VSY A;  3QWV A;  3FTY A;  4L7T A;  4J0U A;  5G2N A;  2ETA A;  1O1R A;  4G23 A;  4IRU A;  5ENT D;  1WG0 A;  2YIN A;  2VTB B;  4CDR A;  1H19 A;  4Q96 A;  5CEA A;  2C2L A;  1INZ A;  2XCB A;  1WAO 1;  3UMV A;  3LY9 A;  1N0R A;  3MX3 A;  5FZQ A;  5HQ8 A;  4OAV B;  2X38 A;  3LS8 A;  5E76 A;  4LER A;  4HOS A;  2E2E A;  2XRZ A;  5C2Y A;  2UY1 A;  4AP2 A;  3SGH A;  1FVF A;  4E6H A;  1LD7 A;  5EX0 A;  1IKN D;  3QK0 A;  3L54 A;  2Q7F A;  3E4B A;  2WMO A;  5CCL A;  5KCM A;  3ABL E;  4GTV A;  2IFU A;  3Q47 B;  1MHQ A;  2YHE A;  2GRO B;  3FUE A;  2WXN A;  3CSF A;  3DXM G;  1JWF A;  3B95 A;  2A5U A;  3S7F A;  1QBQ A;  4U8Y D;  4I6E A;  4EBA G;  4UI9 C;  3VTX A;  2L0T B;  3N71 A;  4BSZ B;  3FUH A;  2WQ6 A;  3L13 A;  3PE4 A;  3JUI A;  3ONK A;  3EHR A;  4MKT A;  2IQC A;  1N95 A;  1HH8 A;  3SFY A;  3ZPJ A;  2VQ2 A;  2XS8 A;  4ABN A;  4EQF A;  2WXG A;  5FJY A;  3KS2 A;  4GTT A;  2J4B A;  5A23 A;  4G1T A;  3DRA A;  4YDY A;  1BI7 B;  3CK7 A;  1TR4 A;  3PRZ A;  1Z3X A;  4UI9 J;  5H7P A;  4DPR A;  3RRM B;  3IBE A;  2DYR E;  1UJK A;  5LFA A; 
#chains in the Genus database with same CATH homology
 1EDU A;  3BG1 B;  3U66 A;  3ZHE A;  1NA0 A;  2LSV A;  4U04 A;  3TL5 A;  5KJL A;  1E8X A;  2Y4U A;  3B7S A;  4BFR A;  3FU6 A;  3O48 A;  2FUL A;  5KJK A;  4DI3 A;  3UQ3 A;  3RKV A;  2PM6 A;  2GW1 A;  5E75 A;  4KMO A;  1NZN A;  3PEV B;  4JEH A;  2GRL A;  3G2S A;  2XPZ A;  1ZBP A;  3FUI A;  1S0P A;  4I9E A;  4JHR A;  3VLD A;  3DPD A;  3FU3 A;  3CST A;  1HXI A;  3HHM A;  3UPV A;  4FA6 A;  5AJL A;  5A6C A;  3S2A A;  4FHK A;  4UQZ A;  3Q49 B;  3SBT B;  1N52 A;  4B8A A;  3D9L A;  1P5Q A;  2KC7 A;  3S7J A;  4AY5 A;  4HXI A;  2WMN A;  3OXF A;  1Y8M A;  3AU4 A;  4DI4 A;  2PQN A;  3D9P A;  4BX8 A;  3O4Z A;  4O6F A;  2WXL A;  4GA2 A;  3PEU B;  2NXP A;  1YA0 A;  3ONL A;  1JUQ A;  1KLX A;  3SF4 A;  3CVY A;  3T5X A;  4H7Y A;  4HOR A;  3QJZ A;  3ENE A;  4F3V A;  5J08 A;  4CDN A;  1Z6T A;  2WXH A;  3TGO A;  2Y4T A;  5DBK A;  1HFA A;  4MLP A;  5FQ4 A;  3NQP A;  2J9Q A;  3L6A A;  4HOU A;  4XKB A;  3PNT B;  4CT4 A;  2HR2 A;  4U0Z A;  3SBS A;  4DLO A;  4GCN A;  4U0S A;  5D0Q D;  3T5V A;  4N2Q A;  4UWG A;  2EQX A;  4ANU A;  3EIQ C;  3U9W A;  2PM7 A;  4J8F A;  4HVB A;  4J8S A;  4WWO A;  5BV0 A;  4BSX A;  3CVP A;  1SZ9 A;  4ILH B;  4ATG A;  4DJA A;  4FC8 A;  1HG2 A;  3QDN A;  4I43 A;  4NRH B;  5ANL A;  4UWK A;  3VLF A;  1W3B A;  1QZ2 A;  4GZ5 A;  4HOT A;  1OWN A;  4GMJ A;  4LUN U;  2C0M A;  2WXI A;  3FTW A;  5FTP A;  4F1S A;  1HF8 A;  2LO6 A;  2V8S E;  3QOU A;  3ASF A;  4JW1 A;  3K9I A;  2WXF A;  3ULQ A;  3ZRH A;  1IHG A;  4ACK A;  4AVX A;  5KJN A;  5T4Y A;  3FUJ A;  4M3O A;  2KCL A;  4N5C A;  2MHK A;  3AS4 A;  2XEV A;  2AW6 A;  3TXN A;  4Y6W A;  5T8I A;  3D9I A;  5BNW A;  3D9K A;  1KT0 A;  3QWW A;  3U3W A;  2IOS A;  3AU5 A;  4RG9 A;  4ILI A;  4KT6 B;  4BY6 A;  3Q4A B;  3LDZ A;  3JYS A;  2M63 A;  1H0A A;  3EIJ A;  1E8W A;  4GZD A;  3LYA A;  5G55 A;  1E8Y A;  2RG8 A;  3APC A;  3FTZ A;  4Q94 A;  2NSZ A;  4FP7 A;  3TXM A;  3RO3 A;  3SHF A;  3LXU X;  2WM9 A;  4V3I A;  5LFA A;  1IQU A;  5LX8 A;  4BT8 A;  1TEZ A;  1DNP A;  1B89 A;  3PNL B;  5EKQ D;  2AVP A;  2FO7 A;  3GZ2 A;  3QAR A;  1U3C A;  4U07 A;  4L23 A;  3GYZ A;  3CVL A;  3PUK A;  3CV0 A;  3JQ1 A;  4XKC A;  5C1D A;  1H2T C;  5ANR A;  5JJ7 A;  1HE8 A;  2OVF A;  2R59 A;  3TJP A;  3MCX A;  2KZT A;  4XZ4 A;  3I3N A;  3CHM A;  3B7R L;  3RRU A;  2BTD A;  3UT7 A;  4EZL A;  4GZ3 A;  3FDH A;  3OXL A;  3CK8 A;  5FT9 A;  5FQ8 A;  2XGS A;  5KJM A;  3HIZ A;  3RJV A;  1PY1 A;  5JHA A;  3CR3 A;  3FU5 A;  4BTB A;  4JA7 A;  2YQ8 A;  4CGV A;  4L2L A;  4KZC A;  5FWQ A;  4BWR A;  2WB2 A;  2CFU A;  3QC1 A;  3MV3 B;  2X6J A;  2OV8 A;  4I6G A;  4EZK A;  4HFG A;  4NAC A;  4GB9 A;  1OWP A;  3U64 A;  3KAE A;  3OXG A;  2Y3A A;  2KZT B;  2HM8 A;  2CG2 A;  4GCO A;  4AIF A;  4GPK A;  1XGW A;  3FWV A;  1ZU2 A;  3ASG A;  4AOF A;  2OOE A;  3CEQ A;  1HG5 A;  4AM9 A;  3SFZ A;  5ARG A;  5M72 A;  1JPL A;  2WXR A;  3CVQ A;  5G05 J;  4R7L A;  4CT0 A;  2IU1 A;  2L9B A;  2AXV A;  3EHN A;  4GZC A;  2WXQ A;  4LRZ A;  3RRN B;  1SQM A;  4TV3 A;  3UX4 A;  4GZ6 A;  5CHE E;  4IUL A;  4A55 A;  4G2V A;  3FH8 A;  4JPS A;  3ASH A;  4PH4 B;  2L6J A;  3SD5 A;  3MJW A;  4Y6C A;  3ZXS A;  4B94 A;  1QNF A;  1WY6 A;  2J07 A;  3MYV A;  3FEY A;  4OVV A;  4K03 A;  3EHM A;  2J49 A;  1HU3 A;  3GZ1 A;  3MKQ B;  4N39 A;  3ESK A;  2PL2 A;  4I1O B;  3I5P A;  1VDY A;  5AJD A;  2VJ8 A;  3CIA A;  1X5B A;  3UUX A;  3QWP A;  2I1J A;  4KVO A;  3FH7 A;  1XNF A;  2FI7 A;  4JEU A;  3VLE A;  2X6K A;  3HDX A;  5CCM A;  4FJZ A;  2L0I A;  3NZU A;  3L17 A;  3LPZ A;  2CG3 A;  1PAQ A;  2OND A;  3G2V A;  2WXP A;  3LVR E;  3S7D A;  3TAX A;  4JC8 A;  3CQG B;  3WXX A;  2XQ0 A;  4JHK A;  2VYI A;  3I4G A;  2WXM A;  5AEN A;  4XX5 A;  4D10 C;  3FUK A;  2C0L A;  4UQX A;  1WM5 A;  3FTS A;  2AXU A;  4I6J A;  4XIF A;  4WNG A;  4G11 A;  3IEG A;  1A17 A;  1E96 B;  3QB2 A;  3AS5 A;  1GW6 A;  4PS3 A;  2VSX E;  2YHC A;  5LOZ A;  5G04 J;  3ZYM A;  3D9J A;  3UT4 A;  3B13 A;  3BEE A;  5AIJ A;  2CFZ A;  4TRQ A;  4F7A A;  4ANW A;  4G25 A;  2JEK A;  1H2V C;  1UN8 A;  3R9A B;  5A7D B;  3FTV A;  1JWG A;  3CKB A;  3RO2 A;  3ZGQ A;  4KYO B;  4KVM A;  2MOW A;  3MV2 B;  4UWL A;  4PS8 A;  4I2W A;  2OVB A;  3ESL A;  4WAF A;  3D9N A;  3LY8 A;  3CVV A;  2WVI A;  4JHJ A;  3C98 A;  3HYM B;  3URZ A;  3FH5 A;  3D9M A;  3ML8 A;  5FZR A;  4L2Y A;  4FU3 A;  5EX3 A;  1OUV A;  3CKC A;  3LY7 A;  4HS2 A;  2DBA A;  3BG0 B;  3RK6 A;  4IYP A;  5HI7 A;  3MKR A;  4J6I A;  2FBN A;  2ILR A;  2DCP A;  4K0R A;  4UWH A;  2V4L A;  4RG6 A;  1TJF A;  3ZIM A;  4CGW A;  1Y6I A;  5LCW J;  4GAA A;  3PVL A;  2AWI A;  4DK5 A;  3FUL A;  4U63 A;  1SZA A;  4GYW A;  4LCT A;  4WNE A;  3PS6 A;  4WWN A;  2FEZ A;  4C9B B;  2J09 A;  2CHW A;  2KM4 A;  2PZI A;  4H7X A;  4GU5 A;  4I1M A;  1E7U A;  3RIB A;  3UT8 A;  3LKU A;  4I1A A;  4F53 A;  5CMY A;  4GA0 A;  4QFV A;  4IN3 B;  4G26 A;  2WXO A;  4FLH A;  2X6H A;  1LF8 A;  1UW4 B;  1UN9 A;  3PDN A;  3FUN A;  3QNK A;  4GML A;  4LEU A;  3SNX A;  3MA5 A;  2WXK A;  4HOQ A;  4AJW A;  1OWO A;  3AS8 A;  3B7T A;  1KT1 A;  3FTX A;  3P2B A;  5FQ7 A;  3U4T A;  4PUC A;  2UWJ G;  5EDS A;  1Z3Y A;  3ML9 A;  1OWL A;  3CHQ A;  4FUL A;  2VGY A;  3FUF A;  3EJN A;  5G05 C;  2XGM A;  4KZ0 A;  4CEM A;  1EPU A;  3APD A;  3ZVV A;  4Q69 A;  3CVU A;  2BUG A;  4JZY A;  3QKY A;  5ENN A;  4JVS A;  3CVX A;  2ZU6 B;  3T8M A;  3CLJ A;  3ASD A;  3PRE A;  1HO8 A;  2QY7 A;  3FUM A;  1UG3 A;  3EDT B;  4FJY A;  2I2O A;  3SZ7 A;  4FLB A;  3L16 A;  4BTA A;  3IV0 A;  4N3A A;  3CHR A;  2V0P A;  4XE0 A;  2XHE A;  3NF1 A;  3GW4 A;  2GRM A;  4AV7 A;  2J08 A;  2NC9 A;  2QFC A;  2XPI A;  4HLE A;  3JCK C;  1H6K A;  4ANX A;  3R7Q A;  1OWM A;  4N3B A;  3QAQ A;  3MKQ A;  4J8E A;  4W9R A;  5FZS A;  1U3D A;  1PC2 A;  2VSY A;  3QWV A;  3FTY A;  4GA1 A;  3Q5M A;  4L7T A;  4OVU A;  4DLQ A;  3IHY A;  4J0U A;  5G2N A;  3I4R B;  2GGF A;  3ZYQ A;  2I1K A;  4ACL A;  3PZD A;  1FVH A;  2I9C A;  4G23 A;  4EPZ A;  4IRU A;  3FY4 A;  3L08 A;  4CCA A;  1E8Z A;  3NZS A;  5G04 C;  2YIN A;  3FUD A;  2YNQ A;  4B0Z A;  4XI9 A;  4WWP A;  2HYZ A;  4NUR A;  5BT1 A;  2V5F A;  3G2U A;  4A3T A;  2VTB B;  4CDR A;  2WXJ A;  4C0M A;  3S7B A;  5CMW A;  4I9C A;  3IHV A;  3KD7 A;  4PS7 A;  5BW8 C;  4GYO A;  3RU0 A;  3CVN A;  4EZJ A;  2X6F A;  2XRY A;  5BUZ A;  4N2S A;  1H19 A;  1L5J A;  4Q96 A;  1BPO A;  4WUY A;  3ZHE B;  4WND A;  4AEZ C;  4UWF A;  1H2U A;  4APO A;  2P58 C;  2PQR A;  4ILG A;  1EYH A;  4C0E A;  4CRW A;  5BPP A;  4AXH A;  2C2L A;  2VGX A;  4RVB A;  1INZ A;  2XCB A;  3FFL A;  1WAO 1;  2AXZ A;  4YND A;  5D0O D;  3UMV A;  4BT9 A;  4I2Z A;  3LY9 A;  4APF A;  2WQH A;  3ZYK A;  3CHP A;  4JA9 A;  5LCW C;  3MX3 A;  2KAT A;  5FZQ A;  3SI5 A;  5HQ8 A;  2CHX A;  2IF4 A;  2X38 A;  2J4D A;  2LAH A;  3CQC B;  4L1B A;  3LS8 A;  5E76 A;  4P29 A;  1ELR A;  3MEK A;  4E85 A;  1QQE A;  4LER A;  4HOS A;  2WPV A;  3ZN3 A;  2X3M A;  3FHE A;  2CHZ A;  4GYY A;  2E2E A;  5T3R A;  1EF1 C;  2DIW A;  3FTU A;  1MQS A;  4I17 A;  4MS6 A;  2UY1 A;  2IJG X;  2XCC A;  4U0U A;  5C2Y A;  3VTY A;  2XRZ A;  3CK9 A;  2A4Z A;  2VGX B;  3G2W A;  3LJ3 A;  3R7R A;  3P1U A;  1ELK A;  4AP2 A;  4UQY A;  2RD0 A;  2XPY A;  3SGH A;  4JXT A;  1FVF A;  3ZFW A;  4E6H A;  5EX0 A;  1FCH A;  2XGO A;  1HX8 A;  3D3M A;  3KEZ A;  5ARF A;  4B8C B;  3QK0 A;  4KXK B;  4A3V A;  3L54 A;  2Q7F A;  3E4B A;  2WMO A;  4MRU A;  5CCL A;  5KCM A;  4FHJ A;  4A1G A;  3HVE A;  2IFU A;  2ION A;  3Q47 B;  1MHQ A;  1HZ4 A;  4YVQ C;  4WNF A;  2JLB A;  4B89 A;  2YHE A;  2MRI A;  3CHS A;  5JJ6 A;  5BV1 A;  3MZL B;  3ZEF A;  4PDX A;  2UY1 B;  3DBS A;  3PH0 C;  3FUE A;  3OTN A;  2WXN A;  3CSF A;  3D9O A;  1JWF A;  2A5U A;  3S7F A;  3FP3 A;  1IYG A;  3B7U X;  4J8D A;  5JHB A;  2X6I A;  3CHO A;  2E0I A;  4A1S A;  2I6H A;  1TJC A;  4NQ0 A;  4UI9 K;  2VSO E;  3OAW A;  1DVP A;  4I6E A;  4N3C A;  4EBA G;  2LSU A;  4UI9 C;  3TG5 A;  3VTX A;  2L0T B;  4EEC A;  3HVE B;  1IQR A;  3N71 A;  3CVW A;  4G24 A;  3LEW A;  3LVQ E;  4JL0 A;  3PUJ A;  4EBA A;  3G2T A;  2VSN A;  1UJJ A;  4CDM A;  3FUH A;  1E7V A;  3APF A;  3PE3 A;  2WQ6 A;  3L13 A;  3PE4 A;  4URK A;  3JUI A;  3ONK A;  4MKT A;  2WQ7 A;  2BF0 X;  4AY6 A;  2IQC A;  2R5S A;  5J90 A;  3FU0 A;  3IKO B;  5LP0 A;  1HH8 A;  2LAI A;  3ZPJ A;  2VQ2 A;  1E90 A;  3GZS A;  4RSY A;  4U8H A;  4ABN A;  4EQF A;  2WXG A;  5FJY A;  5AYW D;  4BX9 A;  3L22 A;  3KS2 A;  3TG4 A;  2KCV A;  2J4B A;  3Q15 A;  4ANV A;  5A23 A;  4G1T A;  2LNI A;  3JQ0 A;  4YVO A;  3CK7 A;  2VTB A;  4KBQ A;  4XI0 A;  1HS6 A;  1NP7 A;  1N54 A;  2IOL A;  2R17 C;  3CGH A;  3FEX A;  3PRZ A;  5FQ6 A;  3ZYL A;  2KCK A;  1ELW A;  1Z3X A;  3MGB A;  5DIZ A;  4FAD A;  2FF4 A;  4ME2 A;  4UI9 J;  1NA3 A;  4OYS A;  3ZW3 A;  2HO1 A;  4TUU A;  4DPR A;  5JJT A;  3RRM B;  3IBE A;  1UJK A;  3LCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...