3D9NA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
138
structure length
138
Chain Sequence
EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein 16
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 57
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9nA00
1INZA 4AVXA 3ONKA 2KM4A 1ELKA 3G2WA 1EDUA 2LO6A 4GZCA 2V8SE 4GZDA 1JPLA 1JUQA 3RRUA 4FLBA 3D9OA 3ZYLA 4Q94A 5LP0A 2L0TB 2QY7A 5J08A 3G2TA 1SZ9A 3G2UA 1MHQA 2BF0X 1LF8A 2DCPA 1JWGA 1HFAA 3D9IA 1H0AA 3D9MA 4FU3A 3D9LA 3G2SA 3ZYMA 5CMWA 3D9NA 3D9KA 1UJJA 4NACA 5CMYA 1VDYA 1HG5A 2MOWA 3ZYKA 3LDZA 2L0IA 1EYHA 2DIWA 4Q96A 1JWFA 3ONLA 3CLJA 1HG2A 3G2VA 1DVPA 1SZAA 4HFGA 4JXTA 1XGWA 1HF8A 3D9JA 1HX8A 3D9PA 1UJKA 1X5BA 3ZYQA 5LOZA 1PY1A
chains in the Genus database with same CATH superfamily
2UY1A 4D10C 4F7AA 3TXMA 4ILGA 3UKUG 3CVXA 2IO2C 2H6GA 2H6IA 3LY8A 3ASDA 3UX4A 4UWFA 4JC8A 4UWLA 3Q75A 1HXIA 1U2VG 3R9AB 3SFYA 3ULQA 1MHQA 2P9LG 2MYOA 3FULA 3LEWA 2XS1A 4EPZA 2IONA 4O1OA 1HX8A 3MV3B 2KXPC 4ILHB 1RZ4A 3PREA 1MJ0A 4MRUA 3HXEA 5ENPD 1N4QA 2XPZA 3F6QA 1UJJA 2MOWA 4GYYA 5BXOA 3T5VA 1QNFA 4IULA 3PZDA 3CIAA 3SFZA 1KT1A 2WM9A 3LY9A 2CHZA 1V55E 5KNHD 2ZGGA 3MJWA 5LP0A 3L6AA 3AU5A 3DXKG 3PZ2A 5H7PA 4KZCA 3EIQC 5AN8A 4W9RA 4DX1A 2DZNA 3KEAA 2J4DA 2RG8A 3HHMA 3CSFA 1KZOA 2XRYA 1HS6A 3FTWA 2EILE 5FQ7A 1OWNA 4GA1A 1D9SA 1TN8A 3NAWA 2FO1E 3LDZA 3TJPA 1QZ2A 3U4TA 2RD0A 3ABME 3B7SA 4C48B 5A23A 1PY1A 4BTBA 3DPDA 2PM7A 3RO3A 3MKQA 2I1JA 3CVWA 2X38A 4URKA 2WQ7A 2KBXA 4ANWA 3C3QA 1G3NB 4OAUC 3DSTA 4U0ZA 3DRAA 2QFCA 5EIBE 3EJNA 4B8CB 4U7EB 4UWGA 1NI1A 3EUVA 3ASGA 2F37A 3R7QA 2KZTB 4I6GA 5D0OD 3TWWA 3N71A 3SGHA 2R05A 3G2SA 3Q47B 4FP7A 3X2QE 1WM5A 3TAXA 1IYGA 5JJ7A 2KCLA 4DX7D 1HU3A 3FWVA 2LXMA 1BI8B 5LOZA 3DSWA 4GZDA 4ANUA 3AS4A 1OY3D 5FT9A 2DWZA 3DSVA 4E85A 2NSZA 3IV0A 1Z6TA 2L0IA 4CEMA 2XRZA 4XI9A 5KCMA 5EX0A 3FUKA 5ANLA 5FIOA 1KZPA 2YHEA 3NOGD 3L16A 4GMLA 1E8WA 3SNXA 3U3WA 4PUCA 1N95A 1TYQG 1OUVA 4XZ4A 4J8EA 3DBSA 1TNYA 3CKCA 3LVQE 3MGBA 4UQZA 5B3SE 2F0YA 4ANVA 4KMOA 2I9CA 3UM1A 3BQOA 4AIFA 2JLBA 2WQ6A 4GTSA 2A4ZA 3DSUA 3GW4A 4HOSA 1SA4A 3APFA 3LCAA 2XZTG 1MX2A 4GAAA 2C0LA 3BEEA 3L08A 4APOA 3RRUA 2KCVA 5FTPA 3AG4E 3APCA 5G2NA 3LJNA 2ETBA 1S0PA 4EZJA 3CVQA 3PZ4A 4HI9A 4N3CA 1EF1C 5KNGA 4WNEA 3JXJA 4CCAA 4I1OB 4BTAA 3ZGQA 2P9NG 3TWSA 4C0MA 2XPIA 5AYWD 3TL5A 4FA6A 2IOSA 3NZSA 4MBGA 4EZLA 1N94A 1Y8MA 4LRZA 3QB2A 1JCRA 3I4RB 1SQMA 1JCQA 3ESLA 4K5CA 5ITZF 2LNIA 3JQ0A 2VGXA 3E34A 4K5AB 1HFAA 2HE0A 3QC1A 4GTQA 3B7RL 2R2LA 2J9QA 3OAWA 5D66A 2PQRA 1HF8A 4I17A 5BPPA 4UQYA 4C0EA 4A1SA 3FUMA 2WXQA 3FUIA 3U64A 1YMPA 4JA9A 1DCQA 2L6BA 3CLJA 4HFGA 5AJLA 2IOLA 2L6JA 3B95A 3IKOB 4IN3B 2BUGA 3Q7AA 3CQCB 3TWQA 1H19A 2GGFA 1XNFA 2AXVA 4GA2A 3LVRE 4GMRA 4PH4B 1MZCA 3ML9A 2FI7A 2A5UA 4BERA 3ABLE 4DJAA 1K8KG 2GRQB 2WXHA 3ZRHA 5A6CA 1U3CA 4N3BA 1N4PA 2IY0C 3EHMA 1HG5A 5HI7A 3UINC 4Z68A 1JWFA 3J5PA 3MV2B 2KZTA 2OVBA 3AAAC 2H6FA 1S63A 2HM8A 4JVSA 2WXNA 4LSZE 3GZ1A 4L9PA 3D9OA 4BT9A 2C2LA 1E7VA 3UPVA 4CT4A 2WQHA 1N0QA 2X6JA 3FTUA 1NA3A 4V3IA 4FADA 2M63A 2J07A 4G1TA 4TXRA 2PM6A 3QWPA 1TNOA 1QQEA 1UN8A 3ZIMA 1IQRA 1H6OA 2DYRE 4JHKA 4R7LA 3ZXPA 4FC8A 4AEZC 4J8SA 5C2YA 2GRRB 2GRPB 4GZCA 3ZW3A 1P5QA 4I6JA 2V5FA 5FZRA 5LCWC 4TUUA 3CR3A 4XKBA 3UM2A 2WXMA 2F8XK 3JQ1A 3DEOA 4A63B 3S7DA 4HORA 1E8XA 3EHNA 2LSVA 3EHQA 1E8YA 3HG0D 1O1SA 4A55A 2EQXA 4CT0A 2GW1A 4EQFA 3LJ3A 5EX3A 3KD7A 4LNUD 5FWQA 2IF4A 3WXXA 3ENEA 2VSYA 5AIJA 4LG6A 1UG3A 2KC7A 4JL0A 3RRMB 3MZLB 5AQAA 5CCMA 4J0UA 3CVUA 3Q49B 5EIDA 1HG2A 1PC2A 4GYWA 4GB9A 1A17A 1H2TC 1N4RA 2XGSA 3W9FA 4DLQA 4HBDA 2DZOA 3FUNA 3GYZA 4CDNA 2NYJA 3DSSA 2NC9A 5FQ8A 3CK8A 4AP2A 4GYOA 1OXJA 3CK9A 2FO7A 3WG7E 4UQXA 2KATA 2XCBA 3UKRG 2AJAA 4OVVA 3L9TA 3SBSA 3APDA 2GRLA 3JUIA 5JMND 1Y6IA 5EYLA 2P58C 2XENA 3T8KA 4G8KA 5CERB 2VTBB 5ENQD 1OCZE 4B89A 2Y4TA 2P9KG 2KCKA 1E7UA 3FEXA 3PE3A 1FT2A 4MLPA 2X6KA 3FTZA 5CRVA 3TWVA 3SQVA 4BFRA 4F6RD 1LD7A 5G04C 1Z3XA 3D9LA 2Y69E 4XX5A 1BPOA 5AAOA 3L17A 4J8DA 4BX9A 3L82A 3QJZA 4JA7A 3ML8A 1SZ9A 3HRAA 5CEDB 4YDOA 1ZBPA 1JWGA 2DCPA 5T3RA 3RK6A 3OTNA 3CVLA 3CVVA 3IEGA 1OWPA 4FULA 5ARFA 4GMJA 4CDRA 3FU0A 3TG4A 3AJIA 5HRYA 3TXNA 3FH7A 3ASOE 2XS8A 3RU0A 2X3MA 1BI7B 1S64A 4XKCA 3EU9A 4AY6A 2XCCA 4I43A 4NQ0A 3ZU7B 3SD5A 4WNDA 4AXHA 2KM4A 5AQBA 3URZA 1OT8A 2OV8A 3FEYA 4GA0A 1TJCA 2V4HC 4F1PA 2GRMA 2I6HA 2FF4A 4L23A 3ZHEB 4NIKA 2OCCE 3T8MA 4UI9K 3PEUB 2HO1A 1KT0A 2WXPA 2EINE 2Y3AA 3U9WA 2ZU6B 4Q94A 4ANXA 4HXIA 3CQGB 1V54E 1E8ZA 1BLXB 4L7TA 3MYVA 1IKND 2F8YA 2P2CP 4HOQA 4RG9A 5FQ6A 4YDEA 4N5QA 3ZVVA 4OVUA 4I9CA 1WDYA 4ILIA 4FLHA 4U0UA 3UT8A 1FVFA 4TV3A 5D2MC 2J4BA 5BUZA 4O6FA 1EYHA 3W9GA 3Q5MA 3FY4A 3J5QB 2Q7FA 5CCLA 4GU5A 4I9EA 2CHWA 3T5XA 3VLDA 4GTVA 1D8DA 2WXRA 4GPKA 4BX8A 2L0TB 3NB2A 4N2QA 3IXEA 2ZXWE 1AP7A 2UWJG 4G8LA 3SFXA 3KSLA 3SO8A 4TXPA 2YHCA 4BT8A 2WPVA 4N2SA 2J09A 4B8AA 4WWOA 4RG6A 1SW6A 3HIZA 3ZYMA 1KPSB 4CGWA 4BWRA 2EIKE 4U8HA 2R17C 1UW4B 2P9PG 2ZGDA 3CHSA 5B1BE 3CHRA 4X8QA 3MCXA 4HRLA 3T9KA 4ACKA 4K5BA 3DSXA 3QKYA 3OXLA 3C3OA 4YVOA 2WXFA 5ENSD 4I6EA 3QARA 3Q9NC 2ETCA 1TN6A 3I5PA 3CVPA 3UIPC 5LCWJ 3DWLG 5DIZA 5EDSA 2NXPA 2Y4UA 1PAQA 1N11A 3NZUA 4UUCA 3AS8A 3E30A 3E33A 2UY1B 3GZ2A 4M3OA 4N5CA 2QC9A 3D9PA 3HDXA 2PNNA 3ZNGA 4PS7A 3QK0A 3O4ZA 4HRMB 5BNWA 2QYJA 3VTYA 4KXKB 3D9KA 4BSZB 2FULA 4B94A 5JJTA 3BG1B 2CFZA 2XEVA 4BY6A 1DNPA 5CHEE 2VGYA 2L9BA 4MS6A 4G26A 5KJNA 5T8IA 2C0MA 2FEZA 2VSXE 3UI2A 5HKPA 2P9SG 5AARA 3TWUA 2CG3A 2XEEA 5BXUA 2VGEA 4JZYA 2WB2A 2YINA 2DBAA 5CBOA 4CZ2D 4J8YA 2AXZA 2J49A 3E4BA 4EBAG 2XQ0A 3ZUVB 3FTSA 4G25A 1H2VC 3ONLA 1ELWA 4DX6D 3EDTB 2I1KA 3V30A 4KVOA 1A5EA 3FTXA 4YDYA 3UT7A 2BKGA 5BT1A 3KEZA 1TNUA 4EBAA 3ZYLA 3Q7FA 3EU5A 5D0QD 4AY5A 3UIOC 5T4YA 3D3MA 3B13A 1O1TA 3B7BA 4WAFA 1INZA 4I2ZA 3B7TA 3HYMB 1O5MA 2R03A 3HXBA 1JPLA 3S7JA 4Q69A 1LTXA 3KSQA 2R59A 2X6IA 4QFVA 5G04J 5JA4D 3IHYA 4TRQA 4LNGA 3VTXA 4L2LA 4F53A 4HS2A 1MQSA 2WXLA 4NRHB 3ESKA 4H7YA 2Y0BG 1HO8A 3FU5A 2XGOA 3LY7A 4ATZD 3HXFA 3LPZA 2VJ8A 5KBAA 5AENA 4FJZA 2JABA 3QWWA 1RW2A 3ZEFA 4AOFA 1QBQA 3Q9UC 4DX2A 1YA0A 4HRNA 2R5SA 4BSXA 3JCKC 4YNDA 5HS0A 2BKKB 4O60A 2J08A 1FCHA 1IQUA 3PZ1A 2WMOA 2I2OA 1SZAA 5G05C 4BETA 3CHOA 4N39A 3AG3E 4APFA 3AU4A 2J8SD 4GZ3A 4OYSA 2LAIA 4FHJA 4GTTA 3G2TA 5KJMA 3CVNA 2WXOA 4JHJA 4C9BB 1IHBA 4GZ6A 2B6CA 1XGWA 2WXJA 2E0IA 3DXMG 3ASFA 3LKUA 3Q15A 3QAQA 2IFUA 3CVYA 4Y6WA 1UN9A 3CKBA 1D8EA 5CRUA 4DRXE 4M7CA 4A1GA 3RAUA 3OXGA 4MKTA 3FTYA 4IYPA 1YYHA 4JEHA 4P29A 5LX8A 1GW6A 4LCTA 3PS6A 2V8SE 3NOCD 4UI9C 3G2UA 2EIJE 1ZB1A 4H7XA 2CG2A 5EYPF 3PVLA 1TR4A 3NQPA 3IHVA 1NZNA 3QNKA 4JXTA 3DPYA 1OCCE 3FUEA 3UT4A 2QYUA 3FUDA 4LNBA 3L13A 3ZKJA 3Q4AB 2QY7A 2IU1A 4DK5A 1ELRA 4GTMA 4U07A 3ZXSA 5ENNA 4PS8A 2IO3C 1E90A 2BTDA 3IBEA 3RO2A 3FHEA 2JEKA 4PS3A 3ZPJA 5BW8C 4I2WA 3S7BA 1MX6A 1NP7A 4I1AA 4K03A 4FU3A 3FDHA 4HLEA 3BUAA 4CGVA 1OWMA 3QWVA 2VGXB 3D9JA 3UM0A 5AQ7A 2ETAA 2PZIA 1TNZA 3U66A 4HI8A 3FU6A 4KVMA 1KLXA 2ONDA 4G11A 3QDNA 2V0PA 5EKQD 4RVBA 3CHMA 5KWDA 3PH0C 1H6PA 3TGOA 4KBQA 1NFIE 3LXUX 4EECA 1H6KA 4HQDA 3ABKE 3TWXA 2WXGA 3VLFA 3CGHA 4DLOA 4GPMA 5JJ6A 1N4SA 1NA0A 1SA5A 4CDMA 2MHKA 3UM3A 4E6HA 1N52A 1VDYA 4J7WA 3UXGA 1O1RA 3AG1E 4B0ZA 3L54A 3NF1A 3PDNA 5G55A 1N9AA 3MA5A 3MKRA 2DYSE 2QZAA 2XGMA 1X81A 4JD2G 1OWOA 3ZN3A 4A3VA 2VYIA 4DI4A 4I1MA 3S7FA 2LAHA 4K0RA 4ABNA 3C98A 4WWPA 4XI0A 3ONKA 4HOUA 3LS8A 3V2OA 5ENOD 3UQ3A 5BV1A 3D9IA 2PQNA 3PRZA 3JUEA 4UWHA 5DBKA 4F3VA 4ATGA 4Y6CA 1DVPA 3OXFA 5ANRA 4U04A 1UJKA 4U96D 3K9IA 3RJVA 2CFUA 1MX4A 4FJYA 3ULEG 3KS2A 4QQIA 4KYOB 2WXKA 4J6IA 3V31A 1QYMA 3Q78A 4NACA 3V79K 2WVIA 2GROB 5A7DB 5JHAA 5FQ4A 3HVEB 2FBNA 3ULYA 3SF4A 4DX5D 3R7RA 5CMWA 3ZFWA 5ENRD 3C72A 3PEVB 1K1AA 3G2VA 4TUMA 5E76A 3O48A 4O1PA 3HXDA 2OOEA 4GTPA 3FH5A 1DCEA 2AVPA 1JCSA 3I3NA 2RKKA 4BEPA 2DVWA 4TXQA 4XIFA 4L2YA 5FINA 3QOUA 3ZYKA 2IQCA 3LYAA 3SBTB 5EILA 1IXVA 1AWCB 4B93B 3FUFA 2AW6A 4NURA 4WNFA 2V5QC 2AWIA 4FLBA 5AJDA 4GCOA 4U8VD 2E2EA 3C3RA 5CMYA 2IJGX 4GTOA 2XPYA 2RFAA 2DIWA 4XEIG 1TEZA 1S70B 2WMNA 2X6HA 4RLYA 4AV7A 3SHFA 4U95D 3PNTB 3S2AA 1YCSB 1K3ZD 3UTMA 2ZISA 4WNGA 3RKVA 2H6HA 3AG2E 3KAEA 2VTBA 4OAVB 4J8FA 5AQ9A 5M72A 2MRIA 3CHPA 5LFAA 4GZ5A 4RQIA 3GZSA 5ENTD 4KT6B 4JW1A 2V4LA 5CECB 1K1BA 1IHGA 5G05J 3BG0B 1OCOE 2LXLA 4IRUA 3FTVA 1FVHA 1WG0A 3Q79A 4JHRA 3ASHA 4N3AA 5E75A 2GRNB 2Y1LE 1OWLA 3JXIA 3TWRA 1E96B 3ZYQA 2P9UG 4PDXA 4ZHBA 3RSEG 2VSOE 2OEVA 3SY2A 2BF0X 5CEAA 4GTRA 3MX3A 2R02A 1Z5SC 3JYSA 4L1BA 5KJLA 2YNQA 3UMVA 4AM9A 4CRWA 5EN5D 1UOHA 5C1DA 2YQ8A 4LUNU 2VQ2A 4F1SA 4AVXA 3G2WA 4XE0A 3CSTA 1TN7A 2XHEA 4HNAD 3FFLA 1ZU2A 1TJFA 1Z3YA 4UI9J 4ACLA 2BEDA 2X6FA 3FH8A 4WWNA 2B0OE 2OVFA 4DUIA 3PNLB 4HVBA 3FUHA 1X5BA 4HLLA 5ARGA 3L22A 3ZHEA 1ELKA 1BU9A 4YDWA 3D9HA 3FP3A 4ZFHA 3PZ3A 5CBNA 1WAO1 3P2BA 2PL2A 4UWKA 3I4GA 3BU8A 1U3DA 3FU3A 2RFMA 1MYOA 1HE8A 3PUJA 1NL4A 4FHKA 3AS5A 3Q73A 3TWTA 3E32A 2VSNA 3CEQA 1LD8A 4BESA 4G23A 3RIBA 2XZDG 4AJWA 3C5RA 2P9IG 5FZSA 2HR2A 3D9NA 3CHQA 4GCNA 4U0SA 3MEKA 4EHMA 3SZ7A 3MKQB 5FZQA 3DEPA 3EHRA 4U8YD 5B1AE 3CK7A 4JPSA 1FPPA 4CYMD 2LO6A 3PE4A 1JUQA 3E37A 1HH8A 1W3BA 3HVEA 4ME2A 4WUYA 5HQ8A 2A5EA 1WY6A 2EIME 4DPRA 3UUXA 3VLEA 1EDUA 3TG5A 2XEHA 3FUJA 2LSUA 1HZ4A 3V2XA 2WXIA 3CV0A 4JB8P 4DI3A 1L5JA 1N54A 4RSYA 3NBNB 1OCRE 2OEWA 1B89A 2ILRA 5KJKA 4G2VA 1EPUA 5JHBA 3PUKA 3B7UX 1FT1A 2LUHA 4G24A 1TNBA 2CHXA 4HOTA 3ASNE 4JEUA 4YVQC 2ZIRA 1H2UA 3D9MA 3P1UA 1DC2A 1SVXA 1H0AA 4LERA 4HB5A 3RRNB 4EZKA 2IEJA 1BD8A 1Q2ZA 4A3TA 4U63A 5FJYA 5BV0A 2HYZA 3R9MA 3ISMC 5J08A 4LEUA 1LF8A 3HXCA 4Q96A 3EIJA 5J90A 3SI5A 2AXUA 5IY5E 4KZ0A 1N0RA
chains in the Genus database with same CATH topology
3CHRA 3MKRA 2HM8A 2UY1A 4D10C 4F7AA 4JVSA 3MCXA 3TXMA 2WXNA 4ILGA 3GZ1A 3D9OA 4ACKA 3QKYA 4YVOA 2XGMA 3OXLA 3CVXA 1OWOA 2C2LA 2WXFA 3ZN3A 4A3VA 4BT9A 2VYIA 1E7VA 3UPVA 4DI4A 4I1MA 4CT4A 4I6EA 3QARA 2WQHA 2X6JA 3S7FA 2LAHA 3FTUA 4K0RA 3LY8A 1NA3A 3C98A 3ASDA 3CVPA 3I5PA 4WWPA 4V3IA 3UX4A 4ABNA 4FADA 5LCWJ 4UWFA 4JC8A 5DIZA 2M63A 4XI0A 5EDSA 2J07A 2NXPA 2Y4UA 4G1TA 1PAQA 2PM6A 3ONKA 3QWPA 4HOUA 3NZUA 4UWLA 1QQEA 1HXIA 1UN8A 3LS8A 3AS8A 3ZIMA 3UQ3A 3R9AB 5BV1A 3ULQA 1MHQA 1IQRA 3D9IA 2PQNA 2UY1B 3PRZA 4UWHA 3GZ2A 5DBKA 4JHKA 4F3VA 3FULA 4M3OA 3LEWA 4R7LA 4ATGA 4Y6CA 4N5CA 4FC8A 4EPZA 1DVPA 3OXFA 5ANRA 4AEZC 2IONA 4J8SA 4U04A 5C2YA 1HX8A 3D9PA 1UJKA 3HDXA 3MV3B 3K9IA 3RJVA 2CFUA 4ILHB 4GZCA 4FJYA 3PREA 4PS7A 3QK0A 3O4ZA 4MRUA 3KS2A 3ZW3A 1P5QA 4KYOB 5BNWA 4I6JA 2WXKA 2V5FA 2XPZA 5FZRA 4J6IA 5LCWC 4TUUA 3VTYA 4KXKB 3D9KA 3CR3A 1UJJA 4NACA 4XKBA 2FULA 2MOWA 2WXMA 4B94A 2WVIA 4GYYA 5JJTA 5A7DB 3BG1B 3JQ1A 3T5VA 1QNFA 2CFZA 5JHAA 5FQ4A 3HVEB 3S7DA 4HORA 1E8XA 3EHNA 2FBNA 2XEVA 4BY6A 2LSVA 4IULA 3PZDA 3CIAA 3SF4A 3SFZA 1DNPA 5CHEE 1E8YA 2VGYA 1KT1A 2WM9A 3LY9A 2CHZA 4A55A 2L9BA 4MS6A 5LP0A 3MJWA 4G26A 2EQXA 3L6AA 3R7RA 5KJNA 5T8IA 3AU5A 2C0MA 4CT0A 2FEZA 4KZCA 3EIQC 5CMWA 2GW1A 2VSXE 4EQFA 3LJ3A 3ZFWA 5EX3A 4W9RA 3KD7A 3PEVB 2CG3A 5FWQA 2IF4A 3G2VA 3ENEA 3WXXA 5E76A 2VSYA 3O48A 4JZYA 2J4DA 2RG8A 2WB2A 2OOEA 2YINA 3HHMA 5AIJA 2DBAA 3FH5A 1UG3A 3CSFA 2KC7A 4JL0A 2AVPA 3RRMB 2XRYA 3I3NA 2AXZA 1HS6A 3MZLB 3FTWA 2J49A 3E4BA 5FQ7A 4EBAG 5CCMA 4XIFA 1OWNA 4GA1A 2XQ0A 4L2YA 4J0UA 3CVUA 3QOUA 3ZYKA 3LDZA 2IQCA 3LYAA 3SBTB 3FTSA 3Q49B 1QZ2A 4G25A 1H2VC 2RD0A 3ONLA 3TJPA 1HG2A 3U4TA 3B7SA 1ELWA 3EDTB 2I1KA 5A23A 1PC2A 1PY1A 3FUFA 2AW6A 4NURA 4KVOA 4BTBA 3FTXA 3UT7A 5BT1A 3DPDA 2PM7A 4GYWA 4WNFA 3RO3A 3KEZA 1A17A 1H2TC 2AWIA 3MKQA 4FLBA 4GB9A 5AJDA 2I1JA 3ZYLA 4GCOA 4EBAA 2X38A 4URKA 3CVWA 2E2EA 2XGSA 2WQ7A 5D0QD 4AY5A 4ANWA 5T4YA 3D3MA 5CMYA 2IJGX 3B13A 2XPYA 4DLQA 2DIWA 1TEZA 2WMNA 2X6HA 3FUNA 4WAFA 4AV7A 3SHFA 4U0ZA 3GYZA 3PNTB 4CDNA 4I2ZA 1INZA 2QFCA 3S2AA 3EJNA 4WNGA 3RKVA 4B8CB 3B7TA 3HYMB 2NC9A 3KAEA 3CK8A 4UWGA 4J8FA 5FQ8A 3ASGA 1JPLA 3S7JA 5M72A 2MRIA 4AP2A 4Q69A 4GYOA 3R7QA 2VTBA 2KZTB 4I6GA 5D0OD 3CK9A 3CHPA 2R59A 3N71A 3SGHA 5LFAA 3G2SA 2FO7A 2X6IA 4UQXA 2KATA 2XCBA 3Q47B 4GZ5A 4OVVA 4QFVA 4FP7A 3SBSA 3APDA 5G04J 1WM5A 2GRLA 3TAXA 3GZSA 3JUIA 5JJ7A 1Y6IA 2KCLA 4KT6B 1HU3A 5JHBA 1IYGA 3FWVA 4JW1A 3IHYA 2V4LA 4TRQA 3VTXA 4L2LA 4F53A 5LOZA 4HS2A 1MQSA 2WXLA 1IHGA 4NRHB 5G05J 4GZDA 3BG0B 2P58C 3ESKA 4ANUA 4H7YA 3AS4A 4IRUA 1HO8A 3FU5A 5FT9A 3FTVA 1FVHA 2XGOA 3LY7A 4E85A 2VTBB 4JHRA 3ASHA 3LPZA 2NSZA 3IV0A 4N3AA 1Z6TA 2L0IA 5E75A 4CEMA 2XRZA 2VJ8A 4XI9A 1OWLA 4B89A 2Y4TA 5KCMA 5AENA 2KCKA 5EX0A 4FJZA 1E96B 1E7UA 3FEXA 3ZYQA 3FUKA 5ANLA 3QWWA 3ZEFA 3PE3A 4AOFA 4MLPA 1YA0A 2X6KA 3FTZA 4PDXA 2R5SA 2YHEA 3L16A 4GMLA 4BFRA 2VSOE 5G04C 1E8WA 3SNXA 2BF0X 4BSXA 3JCKC 4YNDA 1Z3XA 3D9LA 3U3WA 2J08A 3MX3A 4PUCA 1FCHA 1IQUA 3JYSA 4L1BA 2YNQA 4XX5A 1BPOA 5KJLA 1OUVA 3UMVA 4AM9A 2WMOA 4CRWA 2I2OA 5C1DA 4XZ4A 1SZAA 5G05C 2YQ8A 3CHOA 4J8EA 3DBSA 4LUNU 3L17A 3CKCA 2VQ2A 4J8DA 3LVQE 4N39A 4F1SA 4AVXA 3G2WA 3MGBA 4XE0A 3CSTA 2XHEA 4UQZA 4APFA 4BX9A 3AU4A 4GZ3A 3QJZA 3FFLA 1ZU2A 4OYSA 2LAIA 4JA7A 3ML8A 4FHJA 4ANVA 3G2TA 1SZ9A 4KMOA 5KJMA 1TJFA 2I9CA 1ZBPA 1JWGA 2DCPA 5T3RA 3RK6A 3CVNA 4AIFA 1Z3YA 2JLBA 2WXOA 3OTNA 4UI9J 4ACLA 2X6FA 3FH8A 4WWNA 3CVLA 2OVFA 4JHJA 3CVVA 3PNLB 4C9BB 3IEGA 2WQ6A 4HVBA 1OWPA 4FULA 2A4ZA 4HOSA 3GW4A 3FUHA 4GZ6A 5ARFA 1XGWA 4GMJA 1X5BA 3APFA 3LCAA 4CDRA 3FU0A 4GAAA 5ARGA 2WXJA 3TG4A 3L22A 3ZHEA 1ELKA 2E0IA 2C0LA 3TXNA 3BEEA 3FH7A 3L08A 4APOA 3RRUA 3FP3A 2KCVA 3ASFA 3LKUA 5FTPA 3APCA 3RU0A 1WAO1 3P2BA 2X3MA 2PL2A 5G2NA 4UWKA 1S0PA 3Q15A 4EZJA 3QAQA 2IFUA 3CVYA 3CVQA 1UN9A 4N3CA 3CKBA 1EF1C 3I4GA 4Y6WA 4XKCA 1U3DA 3FU3A 4WNEA 4AY6A 4A1GA 2XCCA 4I43A 3OXGA 4MKTA 1HE8A 3PUJA 3FTYA 4IYPA 4NQ0A 4I1OB 4CCAA 3SD5A 4FHKA 4JEHA 4P29A 4WNDA 4AXHA 5LX8A 3AS5A 1GW6A 4LCTA 2KM4A 4BTAA 3URZA 3ZGQA 2OV8A 3FEYA 4GA0A 4C0MA 2XPIA 2VSNA 3PS6A 2V8SE 3CEQA 1TJCA 4UI9C 4G23A 5AYWD 3RIBA 3TL5A 4AJWA 4FA6A 2GRMA 5FZSA 2I6HA 2FF4A 4L23A 3G2UA 2HR2A 4H7XA 2CG2A 2IOSA 3NZSA 3ZHEB 3D9NA 3CHQA 4GCNA 3PVLA 4U0SA 3MEKA 4EZLA 3NQPA 3IHVA 3MKQB 1NZNA 3SZ7A 3QNKA 5FZQA 3T8MA 4JXTA 4UI9K 3PEUB 2HO1A 1Y8MA 4LRZA 3QB2A 3FUEA 1KT0A 3UT4A 3CK7A 2WXPA 4JPSA 2Y3AA 3U9WA 3I4RB 1SQMA 2LO6A 3FUDA 3PE4A 1JUQA 3L13A 3ESLA 2ZU6B 4Q94A 4ANXA 3Q4AB 4HXIA 2QY7A 2LNIA 3CQGB 2IU1A 3JQ0A 4DK5A 2VGXA 1E8ZA 1HH8A 1W3BA 1ELRA 1HFAA 3HVEA 4ME2A 3QC1A 4U07A 4L7TA 3ZXSA 5ENNA 4PS8A 4WUYA 3MYVA 3B7RL 5HQ8A 2J9QA 1E90A 3OAWA 2PQRA 2BTDA 1WY6A 1HF8A 4I17A 3IBEA 4UQYA 4C0EA 4DPRA 3UUXA 5BPPA 4A1SA 4HOQA 4RG9A 5FQ6A 3RO2A 3FHEA 3VLEA 3FUMA 2WXQA 3ZVVA 2JEKA 4OVUA 1EDUA 4PS3A 3FUIA 3ZPJA 5BW8C 4I2WA 4I9CA 3S7BA 3TG5A 1NP7A 3FUJA 2LSUA 4ILIA 3U64A 1HZ4A 2WXIA 4I1AA 3CV0A 4FLHA 4U0UA 4K03A 3UT8A 1FVFA 1L5JA 1N54A 4FU3A 4DI3A 4JA9A 4RSYA 3FDHA 4TV3A 4HLEA 2J4BA 5BUZA 4O6FA 1EYHA 1B89A 2ILRA 5KJKA 4CGVA 1OWMA 1EPUA 3CLJA 3Q5MA 2VGXB 3FY4A 3QWVA 4G2VA 3PUKA 4HFGA 2Q7FA 5CCLA 5AJLA 3D9JA 4GU5A 4I9EA 2CHWA 2PZIA 2IOLA 3B7UX 2L6JA 3U66A 3FU6A 3IKOB 4KVMA 4G24A 4IN3B 2BUGA 1KLXA 3T5XA 3VLDA 2CHXA 2ONDA 2WXRA 4GPKA 4HOTA 4JEUA 4BX8A 2L0TB 4G11A 3QDNA 4YVQC 1H2UA 3CQCB 2V0PA 3D9MA 3P1UA 4N2QA 1H0AA 1H19A 5EKQD 2GGFA 4RVBA 1XNFA 2AXVA 3CHMA 4LERA 4GA2A 2UWJG 3PH0C 3TGOA 3RRNB 3LVRE 4KBQA 4PH4B 3LXUX 4EZKA 2YHCA 4EECA 4BT8A 2WPVA 1H6KA 4A3TA 4N2SA 4U63A 3ML9A 2FI7A 2A5UA 2J09A 5FJYA 4B8AA 5BV0A 2WXGA 3VLFA 2HYZA 4WWOA 3CGHA 4RG6A 4DJAA 4DLOA 5J08A 4LEUA 5JJ6A 1NA0A 2WXHA 3ZRHA 1LF8A 4CDMA 5A6CA 3HIZA 1U3CA 2MHKA 3ZYMA 4N3BA 4E6HA 1N52A 3EHMA 1VDYA 1HG5A 5HI7A 4CGWA 4BWRA 4U8HA 4Q96A 1JWFA 2R17C 1UW4B 3EIJA 5J90A 3MV2B 4B0ZA 2KZTA 3L54A 3CHSA 3SI5A 2AXUA 2OVBA 4KZ0A 3NF1A 3PDNA 5G55A 3MA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1INZ A;  4AVX A;  3ONK A;  2KM4 A;  1ELK A;  3G2W A;  1EDU A;  2LO6 A;  4GZC A;  2V8S E;  4GZD A;  1JPL A;  1JUQ A;  3RRU A;  4FLB A;  3D9O A;  3ZYL A;  4Q94 A;  5LP0 A;  2L0T B;  2QY7 A;  5J08 A;  3G2T A;  1SZ9 A;  3G2U A;  1MHQ A;  2BF0 X;  1LF8 A;  2DCP A;  1JWG A;  1HFA A;  3D9I A;  1H0A A;  3D9M A;  4FU3 A;  3D9L A;  3G2S A;  3ZYM A;  5CMW A;  3D9N A;  3D9K A;  1UJJ A;  4NAC A;  5CMY A;  1VDY A;  1HG5 A;  2MOW A;  3ZYK A;  3LDZ A;  2L0I A;  1EYH A;  2DIW A;  4Q96 A;  1JWF A;  3ONL A;  3CLJ A;  1HG2 A;  3G2V A;  1DVP A;  1SZA A;  4HFG A;  4JXT A;  1XGW A;  1HF8 A;  3D9J A;  1HX8 A;  3D9P A;  1UJK A;  1X5B A;  3ZYQ A;  5LOZ A;  1PY1 A; 
#chains in the Genus database with same CATH topology
 2UY1 A;  4D10 C;  4F7A A;  3TXM A;  4ILG A;  3UKU G;  3CVX A;  2IO2 C;  2H6G A;  2H6I A;  3LY8 A;  3ASD A;  3UX4 A;  4UWF A;  4JC8 A;  4UWL A;  3Q75 A;  1HXI A;  1U2V G;  3R9A B;  3SFY A;  3ULQ A;  1MHQ A;  2P9L G;  2MYO A;  3FUL A;  3LEW A;  2XS1 A;  4EPZ A;  2ION A;  4O1O A;  1HX8 A;  3MV3 B;  2KXP C;  4ILH B;  1RZ4 A;  3PRE A;  1MJ0 A;  4MRU A;  3HXE A;  5ENP D;  1N4Q A;  2XPZ A;  3F6Q A;  1UJJ A;  2MOW A;  4GYY A;  5BXO A;  3T5V A;  1QNF A;  4IUL A;  3PZD A;  3CIA A;  3SFZ A;  1KT1 A;  2WM9 A;  3LY9 A;  2CHZ A;  1V55 E;  5KNH D;  2ZGG A;  3MJW A;  5LP0 A;  3L6A A;  3AU5 A;  3DXK G;  3PZ2 A;  5H7P A;  4KZC A;  3EIQ C;  5AN8 A;  4W9R A;  4DX1 A;  2DZN A;  3KEA A;  2J4D A;  2RG8 A;  3HHM A;  3CSF A;  1KZO A;  2XRY A;  1HS6 A;  3FTW A;  2EIL E;  5FQ7 A;  1OWN A;  4GA1 A;  1D9S A;  1TN8 A;  3NAW A;  2FO1 E;  3LDZ A;  3TJP A;  1QZ2 A;  3U4T A;  2RD0 A;  3ABM E;  3B7S A;  4C48 B;  5A23 A;  1PY1 A;  4BTB A;  3DPD A;  2PM7 A;  3RO3 A;  3MKQ A;  2I1J A;  3CVW A;  2X38 A;  4URK A;  2WQ7 A;  2KBX A;  4ANW A;  3C3Q A;  1G3N B;  4OAU C;  3DST A;  4U0Z A;  3DRA A;  2QFC A;  5EIB E;  3EJN A;  4B8C B;  4U7E B;  4UWG A;  1NI1 A;  3EUV A;  3ASG A;  2F37 A;  3R7Q A;  2KZT B;  4I6G A;  5D0O D;  3TWW A;  3N71 A;  3SGH A;  2R05 A;  3G2S A;  3Q47 B;  4FP7 A;  3X2Q E;  1WM5 A;  3TAX A;  1IYG A;  5JJ7 A;  2KCL A;  4DX7 D;  1HU3 A;  3FWV A;  2LXM A;  1BI8 B;  5LOZ A;  3DSW A;  4GZD A;  4ANU A;  3AS4 A;  1OY3 D;  5FT9 A;  2DWZ A;  3DSV A;  4E85 A;  2NSZ A;  3IV0 A;  1Z6T A;  2L0I A;  4CEM A;  2XRZ A;  4XI9 A;  5KCM A;  5EX0 A;  3FUK A;  5ANL A;  5FIO A;  1KZP A;  2YHE A;  3NOG D;  3L16 A;  4GML A;  1E8W A;  3SNX A;  3U3W A;  4PUC A;  1N95 A;  1TYQ G;  1OUV A;  4XZ4 A;  4J8E A;  3DBS A;  1TNY A;  3CKC A;  3LVQ E;  3MGB A;  4UQZ A;  5B3S E;  2F0Y A;  4ANV A;  4KMO A;  2I9C A;  3UM1 A;  3BQO A;  4AIF A;  2JLB A;  2WQ6 A;  4GTS A;  2A4Z A;  3DSU A;  3GW4 A;  4HOS A;  1SA4 A;  3APF A;  3LCA A;  2XZT G;  1MX2 A;  4GAA A;  2C0L A;  3BEE A;  3L08 A;  4APO A;  3RRU A;  2KCV A;  5FTP A;  3AG4 E;  3APC A;  5G2N A;  3LJN A;  2ETB A;  1S0P A;  4EZJ A;  3CVQ A;  3PZ4 A;  4HI9 A;  4N3C A;  1EF1 C;  5KNG A;  4WNE A;  3JXJ A;  4CCA A;  4I1O B;  4BTA A;  3ZGQ A;  2P9N G;  3TWS A;  4C0M A;  2XPI A;  5AYW D;  3TL5 A;  4FA6 A;  2IOS A;  3NZS A;  4MBG A;  4EZL A;  1N94 A;  1Y8M A;  4LRZ A;  3QB2 A;  1JCR A;  3I4R B;  1SQM A;  1JCQ A;  3ESL A;  4K5C A;  5ITZ F;  2LNI A;  3JQ0 A;  2VGX A;  3E34 A;  4K5A B;  1HFA A;  2HE0 A;  3QC1 A;  4GTQ A;  3B7R L;  2R2L A;  2J9Q A;  3OAW A;  5D66 A;  2PQR A;  1HF8 A;  4I17 A;  5BPP A;  4UQY A;  4C0E A;  4A1S A;  3FUM A;  2WXQ A;  3FUI A;  3U64 A;  1YMP A;  4JA9 A;  1DCQ A;  2L6B A;  3CLJ A;  4HFG A;  5AJL A;  2IOL A;  2L6J A;  3B95 A;  3IKO B;  4IN3 B;  2BUG A;  3Q7A A;  3CQC B;  3TWQ A;  1H19 A;  2GGF A;  1XNF A;  2AXV A;  4GA2 A;  3LVR E;  4GMR A;  4PH4 B;  1MZC A;  3ML9 A;  2FI7 A;  2A5U A;  4BER A;  3ABL E;  4DJA A;  1K8K G;  2GRQ B;  2WXH A;  3ZRH A;  5A6C A;  1U3C A;  4N3B A;  1N4P A;  2IY0 C;  3EHM A;  1HG5 A;  5HI7 A;  3UIN C;  4Z68 A;  1JWF A;  3J5P A;  3MV2 B;  2KZT A;  2OVB A;  3AAA C;  2H6F A;  1S63 A;  2HM8 A;  4JVS A;  2WXN A;  4LSZ E;  3GZ1 A;  4L9P A;  3D9O A;  4BT9 A;  2C2L A;  1E7V A;  3UPV A;  4CT4 A;  2WQH A;  1N0Q A;  2X6J A;  3FTU A;  1NA3 A;  4V3I A;  4FAD A;  2M63 A;  2J07 A;  4G1T A;  4TXR A;  2PM6 A;  3QWP A;  1TNO A;  1QQE A;  1UN8 A;  3ZIM A;  1IQR A;  1H6O A;  2DYR E;  4JHK A;  4R7L A;  3ZXP A;  4FC8 A;  4AEZ C;  4J8S A;  5C2Y A;  2GRR B;  2GRP B;  4GZC A;  3ZW3 A;  1P5Q A;  4I6J A;  2V5F A;  5FZR A;  5LCW C;  4TUU A;  3CR3 A;  4XKB A;  3UM2 A;  2WXM A;  2F8X K;  3JQ1 A;  3DEO A;  4A63 B;  3S7D A;  4HOR A;  1E8X A;  3EHN A;  2LSV A;  3EHQ A;  1E8Y A;  3HG0 D;  1O1S A;  4A55 A;  2EQX A;  4CT0 A;  2GW1 A;  4EQF A;  3LJ3 A;  5EX3 A;  3KD7 A;  4LNU D;  5FWQ A;  2IF4 A;  3WXX A;  3ENE A;  2VSY A;  5AIJ A;  4LG6 A;  1UG3 A;  2KC7 A;  4JL0 A;  3RRM B;  3MZL B;  5AQA A;  5CCM A;  4J0U A;  3CVU A;  3Q49 B;  5EID A;  1HG2 A;  1PC2 A;  4GYW A;  4GB9 A;  1A17 A;  1H2T C;  1N4R A;  2XGS A;  3W9F A;  4DLQ A;  4HBD A;  2DZO A;  3FUN A;  3GYZ A;  4CDN A;  2NYJ A;  3DSS A;  2NC9 A;  5FQ8 A;  3CK8 A;  4AP2 A;  4GYO A;  1OXJ A;  3CK9 A;  2FO7 A;  3WG7 E;  4UQX A;  2KAT A;  2XCB A;  3UKR G;  2AJA A;  4OVV A;  3L9T A;  3SBS A;  3APD A;  2GRL A;  3JUI A;  5JMN D;  1Y6I A;  5EYL A;  2P58 C;  2XEN A;  3T8K A;  4G8K A;  5CER B;  2VTB B;  5ENQ D;  1OCZ E;  4B89 A;  2Y4T A;  2P9K G;  2KCK A;  1E7U A;  3FEX A;  3PE3 A;  1FT2 A;  4MLP A;  2X6K A;  3FTZ A;  5CRV A;  3TWV A;  3SQV A;  4BFR A;  4F6R D;  1LD7 A;  5G04 C;  1Z3X A;  3D9L A;  2Y69 E;  4XX5 A;  1BPO A;  5AAO A;  3L17 A;  4J8D A;  4BX9 A;  3L82 A;  3QJZ A;  4JA7 A;  3ML8 A;  1SZ9 A;  3HRA A;  5CED B;  4YDO A;  1ZBP A;  1JWG A;  2DCP A;  5T3R A;  3RK6 A;  3OTN A;  3CVL A;  3CVV A;  3IEG A;  1OWP A;  4FUL A;  5ARF A;  4GMJ A;  4CDR A;  3FU0 A;  3TG4 A;  3AJI A;  5HRY A;  3TXN A;  3FH7 A;  3ASO E;  2XS8 A;  3RU0 A;  2X3M A;  1BI7 B;  1S64 A;  4XKC A;  3EU9 A;  4AY6 A;  2XCC A;  4I43 A;  4NQ0 A;  3ZU7 B;  3SD5 A;  4WND A;  4AXH A;  2KM4 A;  5AQB A;  3URZ A;  1OT8 A;  2OV8 A;  3FEY A;  4GA0 A;  1TJC A;  2V4H C;  4F1P A;  2GRM A;  2I6H A;  2FF4 A;  4L23 A;  3ZHE B;  4NIK A;  2OCC E;  3T8M A;  4UI9 K;  3PEU B;  2HO1 A;  1KT0 A;  2WXP A;  2EIN E;  2Y3A A;  3U9W A;  2ZU6 B;  4Q94 A;  4ANX A;  4HXI A;  3CQG B;  1V54 E;  1E8Z A;  1BLX B;  4L7T A;  3MYV A;  1IKN D;  2F8Y A;  2P2C P;  4HOQ A;  4RG9 A;  5FQ6 A;  4YDE A;  4N5Q A;  3ZVV A;  4OVU A;  4I9C A;  1WDY A;  4ILI A;  4FLH A;  4U0U A;  3UT8 A;  1FVF A;  4TV3 A;  5D2M C;  2J4B A;  5BUZ A;  4O6F A;  1EYH A;  3W9G A;  3Q5M A;  3FY4 A;  3J5Q B;  2Q7F A;  5CCL A;  4GU5 A;  4I9E A;  2CHW A;  3T5X A;  3VLD A;  4GTV A;  1D8D A;  2WXR A;  4GPK A;  4BX8 A;  2L0T B;  3NB2 A;  4N2Q A;  3IXE A;  2ZXW E;  1AP7 A;  2UWJ G;  4G8L A;  3SFX A;  3KSL A;  3SO8 A;  4TXP A;  2YHC A;  4BT8 A;  2WPV A;  4N2S A;  2J09 A;  4B8A A;  4WWO A;  4RG6 A;  1SW6 A;  3HIZ A;  3ZYM A;  1KPS B;  4CGW A;  4BWR A;  2EIK E;  4U8H A;  2R17 C;  1UW4 B;  2P9P G;  2ZGD A;  3CHS A;  5B1B E;  3CHR A;  4X8Q A;  3MCX A;  4HRL A;  3T9K A;  4ACK A;  4K5B A;  3DSX A;  3QKY A;  3OXL A;  3C3O A;  4YVO A;  2WXF A;  5ENS D;  4I6E A;  3QAR A;  3Q9N C;  2ETC A;  1TN6 A;  3I5P A;  3CVP A;  3UIP C;  5LCW J;  3DWL G;  5DIZ A;  5EDS A;  2NXP A;  2Y4U A;  1PAQ A;  1N11 A;  3NZU A;  4UUC A;  3AS8 A;  3E30 A;  3E33 A;  2UY1 B;  3GZ2 A;  4M3O A;  4N5C A;  2QC9 A;  3D9P A;  3HDX A;  2PNN A;  3ZNG A;  4PS7 A;  3QK0 A;  3O4Z A;  4HRM B;  5BNW A;  2QYJ A;  3VTY A;  4KXK B;  3D9K A;  4BSZ B;  2FUL A;  4B94 A;  5JJT A;  3BG1 B;  2CFZ A;  2XEV A;  4BY6 A;  1DNP A;  5CHE E;  2VGY A;  2L9B A;  4MS6 A;  4G26 A;  5KJN A;  5T8I A;  2C0M A;  2FEZ A;  2VSX E;  3UI2 A;  5HKP A;  2P9S G;  5AAR A;  3TWU A;  2CG3 A;  2XEE A;  5BXU A;  2VGE A;  4JZY A;  2WB2 A;  2YIN A;  2DBA A;  5CBO A;  4CZ2 D;  4J8Y A;  2AXZ A;  2J49 A;  3E4B A;  4EBA G;  2XQ0 A;  3ZUV B;  3FTS A;  4G25 A;  1H2V C;  3ONL A;  1ELW A;  4DX6 D;  3EDT B;  2I1K A;  3V30 A;  4KVO A;  1A5E A;  3FTX A;  4YDY A;  3UT7 A;  2BKG A;  5BT1 A;  3KEZ A;  1TNU A;  4EBA A;  3ZYL A;  3Q7F A;  3EU5 A;  5D0Q D;  4AY5 A;  3UIO C;  5T4Y A;  3D3M A;  3B13 A;  1O1T A;  3B7B A;  4WAF A;  1INZ A;  4I2Z A;  3B7T A;  3HYM B;  1O5M A;  2R03 A;  3HXB A;  1JPL A;  3S7J A;  4Q69 A;  1LTX A;  3KSQ A;  2R59 A;  2X6I A;  4QFV A;  5G04 J;  5JA4 D;  3IHY A;  4TRQ A;  4LNG A;  3VTX A;  4L2L A;  4F53 A;  4HS2 A;  1MQS A;  2WXL A;  4NRH B;  3ESK A;  4H7Y A;  2Y0B G;  1HO8 A;  3FU5 A;  2XGO A;  3LY7 A;  4ATZ D;  3HXF A;  3LPZ A;  2VJ8 A;  5KBA A;  5AEN A;  4FJZ A;  2JAB A;  3QWW A;  1RW2 A;  3ZEF A;  4AOF A;  1QBQ A;  3Q9U C;  4DX2 A;  1YA0 A;  4HRN A;  2R5S A;  4BSX A;  3JCK C;  4YND A;  5HS0 A;  2BKK B;  4O60 A;  2J08 A;  1FCH A;  1IQU A;  3PZ1 A;  2WMO A;  2I2O A;  1SZA A;  5G05 C;  4BET A;  3CHO A;  4N39 A;  3AG3 E;  4APF A;  3AU4 A;  2J8S D;  4GZ3 A;  4OYS A;  2LAI A;  4FHJ A;  4GTT A;  3G2T A;  5KJM A;  3CVN A;  2WXO A;  4JHJ A;  4C9B B;  1IHB A;  4GZ6 A;  2B6C A;  1XGW A;  2WXJ A;  2E0I A;  3DXM G;  3ASF A;  3LKU A;  3Q15 A;  3QAQ A;  2IFU A;  3CVY A;  4Y6W A;  1UN9 A;  3CKB A;  1D8E A;  5CRU A;  4DRX E;  4M7C A;  4A1G A;  3RAU A;  3OXG A;  4MKT A;  3FTY A;  4IYP A;  1YYH A;  4JEH A;  4P29 A;  5LX8 A;  1GW6 A;  4LCT A;  3PS6 A;  2V8S E;  3NOC D;  4UI9 C;  3G2U A;  2EIJ E;  1ZB1 A;  4H7X A;  2CG2 A;  5EYP F;  3PVL A;  1TR4 A;  3NQP A;  3IHV A;  1NZN A;  3QNK A;  4JXT A;  3DPY A;  1OCC E;  3FUE A;  3UT4 A;  2QYU A;  3FUD A;  4LNB A;  3L13 A;  3ZKJ A;  3Q4A B;  2QY7 A;  2IU1 A;  4DK5 A;  1ELR A;  4GTM A;  4U07 A;  3ZXS A;  5ENN A;  4PS8 A;  2IO3 C;  1E90 A;  2BTD A;  3IBE A;  3RO2 A;  3FHE A;  2JEK A;  4PS3 A;  3ZPJ A;  5BW8 C;  4I2W A;  3S7B A;  1MX6 A;  1NP7 A;  4I1A A;  4K03 A;  4FU3 A;  3FDH A;  4HLE A;  3BUA A;  4CGV A;  1OWM A;  3QWV A;  2VGX B;  3D9J A;  3UM0 A;  5AQ7 A;  2ETA A;  2PZI A;  1TNZ A;  3U66 A;  4HI8 A;  3FU6 A;  4KVM A;  1KLX A;  2OND A;  4G11 A;  3QDN A;  2V0P A;  5EKQ D;  4RVB A;  3CHM A;  5KWD A;  3PH0 C;  1H6P A;  3TGO A;  4KBQ A;  1NFI E;  3LXU X;  4EEC A;  1H6K A;  4HQD A;  3ABK E;  3TWX A;  2WXG A;  3VLF A;  3CGH A;  4DLO A;  4GPM A;  5JJ6 A;  1N4S A;  1NA0 A;  1SA5 A;  4CDM A;  2MHK A;  3UM3 A;  4E6H A;  1N52 A;  1VDY A;  4J7W A;  3UXG A;  1O1R A;  3AG1 E;  4B0Z A;  3L54 A;  3NF1 A;  3PDN A;  5G55 A;  1N9A A;  3MA5 A;  3MKR A;  2DYS E;  2QZA A;  2XGM A;  1X81 A;  4JD2 G;  1OWO A;  3ZN3 A;  4A3V A;  2VYI A;  4DI4 A;  4I1M A;  3S7F A;  2LAH A;  4K0R A;  4ABN A;  3C98 A;  4WWP A;  4XI0 A;  3ONK A;  4HOU A;  3LS8 A;  3V2O A;  5ENO D;  3UQ3 A;  5BV1 A;  3D9I A;  2PQN A;  3PRZ A;  3JUE A;  4UWH A;  5DBK A;  4F3V A;  4ATG A;  4Y6C A;  1DVP A;  3OXF A;  5ANR A;  4U04 A;  1UJK A;  4U96 D;  3K9I A;  3RJV A;  2CFU A;  1MX4 A;  4FJY A;  3ULE G;  3KS2 A;  4QQI A;  4KYO B;  2WXK A;  4J6I A;  3V31 A;  1QYM A;  3Q78 A;  4NAC A;  3V79 K;  2WVI A;  2GRO B;  5A7D B;  5JHA A;  5FQ4 A;  3HVE B;  2FBN A;  3ULY A;  3SF4 A;  4DX5 D;  3R7R A;  5CMW A;  3ZFW A;  5ENR D;  3C72 A;  3PEV B;  1K1A A;  3G2V A;  4TUM A;  5E76 A;  3O48 A;  4O1P A;  3HXD A;  2OOE A;  4GTP A;  3FH5 A;  1DCE A;  2AVP A;  1JCS A;  3I3N A;  2RKK A;  4BEP A;  2DVW A;  4TXQ A;  4XIF A;  4L2Y A;  5FIN A;  3QOU A;  3ZYK A;  2IQC A;  3LYA A;  3SBT B;  5EIL A;  1IXV A;  1AWC B;  4B93 B;  3FUF A;  2AW6 A;  4NUR A;  4WNF A;  2V5Q C;  2AWI A;  4FLB A;  5AJD A;  4GCO A;  4U8V D;  2E2E A;  3C3R A;  5CMY A;  2IJG X;  4GTO A;  2XPY A;  2RFA A;  2DIW A;  4XEI G;  1TEZ A;  1S70 B;  2WMN A;  2X6H A;  4RLY A;  4AV7 A;  3SHF A;  4U95 D;  3PNT B;  3S2A A;  1YCS B;  1K3Z D;  3UTM A;  2ZIS A;  4WNG A;  3RKV A;  2H6H A;  3AG2 E;  3KAE A;  2VTB A;  4OAV B;  4J8F A;  5AQ9 A;  5M72 A;  2MRI A;  3CHP A;  5LFA A;  4GZ5 A;  4RQI A;  3GZS A;  5ENT D;  4KT6 B;  4JW1 A;  2V4L A;  5CEC B;  1K1B A;  1IHG A;  5G05 J;  3BG0 B;  1OCO E;  2LXL A;  4IRU A;  3FTV A;  1FVH A;  1WG0 A;  3Q79 A;  4JHR A;  3ASH A;  4N3A A;  5E75 A;  2GRN B;  2Y1L E;  1OWL A;  3JXI A;  3TWR A;  1E96 B;  3ZYQ A;  2P9U G;  4PDX A;  4ZHB A;  3RSE G;  2VSO E;  2OEV A;  3SY2 A;  2BF0 X;  5CEA A;  4GTR A;  3MX3 A;  2R02 A;  1Z5S C;  3JYS A;  4L1B A;  5KJL A;  2YNQ A;  3UMV A;  4AM9 A;  4CRW A;  5EN5 D;  1UOH A;  5C1D A;  2YQ8 A;  4LUN U;  2VQ2 A;  4F1S A;  4AVX A;  3G2W A;  4XE0 A;  3CST A;  1TN7 A;  2XHE A;  4HNA D;  3FFL A;  1ZU2 A;  1TJF A;  1Z3Y A;  4UI9 J;  4ACL A;  2BED A;  2X6F A;  3FH8 A;  4WWN A;  2B0O E;  2OVF A;  4DUI A;  3PNL B;  4HVB A;  3FUH A;  1X5B A;  4HLL A;  5ARG A;  3L22 A;  3ZHE A;  1ELK A;  1BU9 A;  4YDW A;  3D9H A;  3FP3 A;  4ZFH A;  3PZ3 A;  5CBN A;  1WAO 1;  3P2B A;  2PL2 A;  4UWK A;  3I4G A;  3BU8 A;  1U3D A;  3FU3 A;  2RFM A;  1MYO A;  1HE8 A;  3PUJ A;  1NL4 A;  4FHK A;  3AS5 A;  3Q73 A;  3TWT A;  3E32 A;  2VSN A;  3CEQ A;  1LD8 A;  4BES A;  4G23 A;  3RIB A;  2XZD G;  4AJW A;  3C5R A;  2P9I G;  5FZS A;  2HR2 A;  3D9N A;  3CHQ A;  4GCN A;  4U0S A;  3MEK A;  4EHM A;  3SZ7 A;  3MKQ B;  5FZQ A;  3DEP A;  3EHR A;  4U8Y D;  5B1A E;  3CK7 A;  4JPS A;  1FPP A;  4CYM D;  2LO6 A;  3PE4 A;  1JUQ A;  3E37 A;  1HH8 A;  1W3B A;  3HVE A;  4ME2 A;  4WUY A;  5HQ8 A;  2A5E A;  1WY6 A;  2EIM E;  4DPR A;  3UUX A;  3VLE A;  1EDU A;  3TG5 A;  2XEH A;  3FUJ A;  2LSU A;  1HZ4 A;  3V2X A;  2WXI A;  3CV0 A;  4JB8 P;  4DI3 A;  1L5J A;  1N54 A;  4RSY A;  3NBN B;  1OCR E;  2OEW A;  1B89 A;  2ILR A;  5KJK A;  4G2V A;  1EPU A;  5JHB A;  3PUK A;  3B7U X;  1FT1 A;  2LUH A;  4G24 A;  1TNB A;  2CHX A;  4HOT A;  3ASN E;  4JEU A;  4YVQ C;  2ZIR A;  1H2U A;  3D9M A;  3P1U A;  1DC2 A;  1SVX A;  1H0A A;  4LER A;  4HB5 A;  3RRN B;  4EZK A;  2IEJ A;  1BD8 A;  1Q2Z A;  4A3T A;  4U63 A;  5FJY A;  5BV0 A;  2HYZ A;  3R9M A;  3ISM C;  5J08 A;  4LEU A;  1LF8 A;  3HXC A;  4Q96 A;  3EIJ A;  5J90 A;  3SI5 A;  2AXU A;  5IY5 E;  4KZ0 A;  1N0R A; 
#chains in the Genus database with same CATH homology
 3CHR A;  3MKR A;  2HM8 A;  2UY1 A;  4D10 C;  4F7A A;  4JVS A;  3MCX A;  3TXM A;  2WXN A;  4ILG A;  3GZ1 A;  3D9O A;  4ACK A;  3QKY A;  4YVO A;  2XGM A;  3OXL A;  3CVX A;  1OWO A;  2C2L A;  2WXF A;  3ZN3 A;  4A3V A;  4BT9 A;  2VYI A;  1E7V A;  3UPV A;  4DI4 A;  4I1M A;  4CT4 A;  4I6E A;  3QAR A;  2WQH A;  2X6J A;  3S7F A;  2LAH A;  3FTU A;  4K0R A;  3LY8 A;  1NA3 A;  3C98 A;  3ASD A;  3CVP A;  3I5P A;  4WWP A;  4V3I A;  3UX4 A;  4ABN A;  4FAD A;  5LCW J;  4UWF A;  4JC8 A;  5DIZ A;  2M63 A;  4XI0 A;  5EDS A;  2J07 A;  2NXP A;  2Y4U A;  4G1T A;  1PAQ A;  2PM6 A;  3ONK A;  3QWP A;  4HOU A;  3NZU A;  4UWL A;  1QQE A;  1HXI A;  1UN8 A;  3LS8 A;  3AS8 A;  3ZIM A;  3UQ3 A;  3R9A B;  5BV1 A;  3ULQ A;  1MHQ A;  1IQR A;  3D9I A;  2PQN A;  2UY1 B;  3PRZ A;  4UWH A;  3GZ2 A;  5DBK A;  4JHK A;  4F3V A;  3FUL A;  4M3O A;  3LEW A;  4R7L A;  4ATG A;  4Y6C A;  4N5C A;  4FC8 A;  4EPZ A;  1DVP A;  3OXF A;  5ANR A;  4AEZ C;  2ION A;  4J8S A;  4U04 A;  5C2Y A;  1HX8 A;  3D9P A;  1UJK A;  3HDX A;  3MV3 B;  3K9I A;  3RJV A;  2CFU A;  4ILH B;  4GZC A;  4FJY A;  3PRE A;  4PS7 A;  3QK0 A;  3O4Z A;  4MRU A;  3KS2 A;  3ZW3 A;  1P5Q A;  4KYO B;  5BNW A;  4I6J A;  2WXK A;  2V5F A;  2XPZ A;  5FZR A;  4J6I A;  5LCW C;  4TUU A;  3VTY A;  4KXK B;  3D9K A;  3CR3 A;  1UJJ A;  4NAC A;  4XKB A;  2FUL A;  2MOW A;  2WXM A;  4B94 A;  2WVI A;  4GYY A;  5JJT A;  5A7D B;  3BG1 B;  3JQ1 A;  3T5V A;  1QNF A;  2CFZ A;  5JHA A;  5FQ4 A;  3HVE B;  3S7D A;  4HOR A;  1E8X A;  3EHN A;  2FBN A;  2XEV A;  4BY6 A;  2LSV A;  4IUL A;  3PZD A;  3CIA A;  3SF4 A;  3SFZ A;  1DNP A;  5CHE E;  1E8Y A;  2VGY A;  1KT1 A;  2WM9 A;  3LY9 A;  2CHZ A;  4A55 A;  2L9B A;  4MS6 A;  5LP0 A;  3MJW A;  4G26 A;  2EQX A;  3L6A A;  3R7R A;  5KJN A;  5T8I A;  3AU5 A;  2C0M A;  4CT0 A;  2FEZ A;  4KZC A;  3EIQ C;  5CMW A;  2GW1 A;  2VSX E;  4EQF A;  3LJ3 A;  3ZFW A;  5EX3 A;  4W9R A;  3KD7 A;  3PEV B;  2CG3 A;  5FWQ A;  2IF4 A;  3G2V A;  3ENE A;  3WXX A;  5E76 A;  2VSY A;  3O48 A;  4JZY A;  2J4D A;  2RG8 A;  2WB2 A;  2OOE A;  2YIN A;  3HHM A;  5AIJ A;  2DBA A;  3FH5 A;  1UG3 A;  3CSF A;  2KC7 A;  4JL0 A;  2AVP A;  3RRM B;  2XRY A;  3I3N A;  2AXZ A;  1HS6 A;  3MZL B;  3FTW A;  2J49 A;  3E4B A;  5FQ7 A;  4EBA G;  5CCM A;  4XIF A;  1OWN A;  4GA1 A;  2XQ0 A;  4L2Y A;  4J0U A;  3CVU A;  3QOU A;  3ZYK A;  3LDZ A;  2IQC A;  3LYA A;  3SBT B;  3FTS A;  3Q49 B;  1QZ2 A;  4G25 A;  1H2V C;  2RD0 A;  3ONL A;  3TJP A;  1HG2 A;  3U4T A;  3B7S A;  1ELW A;  3EDT B;  2I1K A;  5A23 A;  1PC2 A;  1PY1 A;  3FUF A;  2AW6 A;  4NUR A;  4KVO A;  4BTB A;  3FTX A;  3UT7 A;  5BT1 A;  3DPD A;  2PM7 A;  4GYW A;  4WNF A;  3RO3 A;  3KEZ A;  1A17 A;  1H2T C;  2AWI A;  3MKQ A;  4FLB A;  4GB9 A;  5AJD A;  2I1J A;  3ZYL A;  4GCO A;  4EBA A;  2X38 A;  4URK A;  3CVW A;  2E2E A;  2XGS A;  2WQ7 A;  5D0Q D;  4AY5 A;  4ANW A;  5T4Y A;  3D3M A;  5CMY A;  2IJG X;  3B13 A;  2XPY A;  4DLQ A;  2DIW A;  1TEZ A;  2WMN A;  2X6H A;  3FUN A;  4WAF A;  4AV7 A;  3SHF A;  4U0Z A;  3GYZ A;  3PNT B;  4CDN A;  4I2Z A;  1INZ A;  2QFC A;  3S2A A;  3EJN A;  4WNG A;  3RKV A;  4B8C B;  3B7T A;  3HYM B;  2NC9 A;  3KAE A;  3CK8 A;  4UWG A;  4J8F A;  5FQ8 A;  3ASG A;  1JPL A;  3S7J A;  5M72 A;  2MRI A;  4AP2 A;  4Q69 A;  4GYO A;  3R7Q A;  2VTB A;  2KZT B;  4I6G A;  5D0O D;  3CK9 A;  3CHP A;  2R59 A;  3N71 A;  3SGH A;  5LFA A;  3G2S A;  2FO7 A;  2X6I A;  4UQX A;  2KAT A;  2XCB A;  3Q47 B;  4GZ5 A;  4OVV A;  4QFV A;  4FP7 A;  3SBS A;  3APD A;  5G04 J;  1WM5 A;  2GRL A;  3TAX A;  3GZS A;  3JUI A;  5JJ7 A;  1Y6I A;  2KCL A;  4KT6 B;  1HU3 A;  5JHB A;  1IYG A;  3FWV A;  4JW1 A;  3IHY A;  2V4L A;  4TRQ A;  3VTX A;  4L2L A;  4F53 A;  5LOZ A;  4HS2 A;  1MQS A;  2WXL A;  1IHG A;  4NRH B;  5G05 J;  4GZD A;  3BG0 B;  2P58 C;  3ESK A;  4ANU A;  4H7Y A;  3AS4 A;  4IRU A;  1HO8 A;  3FU5 A;  5FT9 A;  3FTV A;  1FVH A;  2XGO A;  3LY7 A;  4E85 A;  2VTB B;  4JHR A;  3ASH A;  3LPZ A;  2NSZ A;  3IV0 A;  4N3A A;  1Z6T A;  2L0I A;  5E75 A;  4CEM A;  2XRZ A;  2VJ8 A;  4XI9 A;  1OWL A;  4B89 A;  2Y4T A;  5KCM A;  5AEN A;  2KCK A;  5EX0 A;  4FJZ A;  1E96 B;  1E7U A;  3FEX A;  3ZYQ A;  3FUK A;  5ANL A;  3QWW A;  3ZEF A;  3PE3 A;  4AOF A;  4MLP A;  1YA0 A;  2X6K A;  3FTZ A;  4PDX A;  2R5S A;  2YHE A;  3L16 A;  4GML A;  4BFR A;  2VSO E;  5G04 C;  1E8W A;  3SNX A;  2BF0 X;  4BSX A;  3JCK C;  4YND A;  1Z3X A;  3D9L A;  3U3W A;  2J08 A;  3MX3 A;  4PUC A;  1FCH A;  1IQU A;  3JYS A;  4L1B A;  2YNQ A;  4XX5 A;  1BPO A;  5KJL A;  1OUV A;  3UMV A;  4AM9 A;  2WMO A;  4CRW A;  2I2O A;  5C1D A;  4XZ4 A;  1SZA A;  5G05 C;  2YQ8 A;  3CHO A;  4J8E A;  3DBS A;  4LUN U;  3L17 A;  3CKC A;  2VQ2 A;  4J8D A;  3LVQ E;  4N39 A;  4F1S A;  4AVX A;  3G2W A;  3MGB A;  4XE0 A;  3CST A;  2XHE A;  4UQZ A;  4APF A;  4BX9 A;  3AU4 A;  4GZ3 A;  3QJZ A;  3FFL A;  1ZU2 A;  4OYS A;  2LAI A;  4JA7 A;  3ML8 A;  4FHJ A;  4ANV A;  3G2T A;  1SZ9 A;  4KMO A;  5KJM A;  1TJF A;  2I9C A;  1ZBP A;  1JWG A;  2DCP A;  5T3R A;  3RK6 A;  3CVN A;  4AIF A;  1Z3Y A;  2JLB A;  2WXO A;  3OTN A;  4UI9 J;  4ACL A;  2X6F A;  3FH8 A;  4WWN A;  3CVL A;  2OVF A;  4JHJ A;  3CVV A;  3PNL B;  4C9B B;  3IEG A;  2WQ6 A;  4HVB A;  1OWP A;  4FUL A;  2A4Z A;  4HOS A;  3GW4 A;  3FUH A;  4GZ6 A;  5ARF A;  1XGW A;  4GMJ A;  1X5B A;  3APF A;  3LCA A;  4CDR A;  3FU0 A;  4GAA A;  5ARG A;  2WXJ A;  3TG4 A;  3L22 A;  3ZHE A;  1ELK A;  2E0I A;  2C0L A;  3TXN A;  3BEE A;  3FH7 A;  3L08 A;  4APO A;  3RRU A;  3FP3 A;  2KCV A;  3ASF A;  3LKU A;  5FTP A;  3APC A;  3RU0 A;  1WAO 1;  3P2B A;  2X3M A;  2PL2 A;  5G2N A;  4UWK A;  1S0P A;  3Q15 A;  4EZJ A;  3QAQ A;  2IFU A;  3CVY A;  3CVQ A;  1UN9 A;  4N3C A;  3CKB A;  1EF1 C;  3I4G A;  4Y6W A;  4XKC A;  1U3D A;  3FU3 A;  4WNE A;  4AY6 A;  4A1G A;  2XCC A;  4I43 A;  3OXG A;  4MKT A;  1HE8 A;  3PUJ A;  3FTY A;  4IYP A;  4NQ0 A;  4I1O B;  4CCA A;  3SD5 A;  4FHK A;  4JEH A;  4P29 A;  4WND A;  4AXH A;  5LX8 A;  3AS5 A;  1GW6 A;  4LCT A;  2KM4 A;  4BTA A;  3URZ A;  3ZGQ A;  2OV8 A;  3FEY A;  4GA0 A;  4C0M A;  2XPI A;  2VSN A;  3PS6 A;  2V8S E;  3CEQ A;  1TJC A;  4UI9 C;  4G23 A;  5AYW D;  3RIB A;  3TL5 A;  4AJW A;  4FA6 A;  2GRM A;  5FZS A;  2I6H A;  2FF4 A;  4L23 A;  3G2U A;  2HR2 A;  4H7X A;  2CG2 A;  2IOS A;  3NZS A;  3ZHE B;  3D9N A;  3CHQ A;  4GCN A;  3PVL A;  4U0S A;  3MEK A;  4EZL A;  3NQP A;  3IHV A;  3MKQ B;  1NZN A;  3SZ7 A;  3QNK A;  5FZQ A;  3T8M A;  4JXT A;  4UI9 K;  3PEU B;  2HO1 A;  1Y8M A;  4LRZ A;  3QB2 A;  3FUE A;  1KT0 A;  3UT4 A;  3CK7 A;  2WXP A;  4JPS A;  2Y3A A;  3U9W A;  3I4R B;  1SQM A;  2LO6 A;  3FUD A;  3PE4 A;  1JUQ A;  3L13 A;  3ESL A;  2ZU6 B;  4Q94 A;  4ANX A;  3Q4A B;  4HXI A;  2QY7 A;  2LNI A;  3CQG B;  2IU1 A;  3JQ0 A;  4DK5 A;  2VGX A;  1E8Z A;  1HH8 A;  1W3B A;  1ELR A;  1HFA A;  3HVE A;  4ME2 A;  3QC1 A;  4U07 A;  4L7T A;  3ZXS A;  5ENN A;  4PS8 A;  4WUY A;  3MYV A;  3B7R L;  5HQ8 A;  2J9Q A;  1E90 A;  3OAW A;  2PQR A;  2BTD A;  1WY6 A;  1HF8 A;  4I17 A;  3IBE A;  4UQY A;  4C0E A;  4DPR A;  3UUX A;  5BPP A;  4A1S A;  4HOQ A;  4RG9 A;  5FQ6 A;  3RO2 A;  3FHE A;  3VLE A;  3FUM A;  2WXQ A;  3ZVV A;  2JEK A;  4OVU A;  1EDU A;  4PS3 A;  3FUI A;  3ZPJ A;  5BW8 C;  4I2W A;  4I9C A;  3S7B A;  3TG5 A;  1NP7 A;  3FUJ A;  2LSU A;  4ILI A;  3U64 A;  1HZ4 A;  2WXI A;  4I1A A;  3CV0 A;  4FLH A;  4U0U A;  4K03 A;  3UT8 A;  1FVF A;  1L5J A;  1N54 A;  4FU3 A;  4DI3 A;  4JA9 A;  4RSY A;  3FDH A;  4TV3 A;  4HLE A;  2J4B A;  5BUZ A;  4O6F A;  1EYH A;  1B89 A;  2ILR A;  5KJK A;  4CGV A;  1OWM A;  1EPU A;  3CLJ A;  3Q5M A;  2VGX B;  3FY4 A;  3QWV A;  4G2V A;  3PUK A;  4HFG A;  2Q7F A;  5CCL A;  5AJL A;  3D9J A;  4GU5 A;  4I9E A;  2CHW A;  2PZI A;  2IOL A;  3B7U X;  2L6J A;  3U66 A;  3FU6 A;  3IKO B;  4KVM A;  4G24 A;  4IN3 B;  2BUG A;  1KLX A;  3T5X A;  3VLD A;  2CHX A;  2OND A;  2WXR A;  4GPK A;  4HOT A;  4JEU A;  4BX8 A;  2L0T B;  4G11 A;  3QDN A;  4YVQ C;  1H2U A;  3CQC B;  2V0P A;  3D9M A;  3P1U A;  4N2Q A;  1H0A A;  1H19 A;  5EKQ D;  2GGF A;  4RVB A;  1XNF A;  2AXV A;  3CHM A;  4LER A;  4GA2 A;  2UWJ G;  3PH0 C;  3TGO A;  3RRN B;  3LVR E;  4KBQ A;  4PH4 B;  3LXU X;  4EZK A;  2YHC A;  4EEC A;  4BT8 A;  2WPV A;  1H6K A;  4A3T A;  4N2S A;  4U63 A;  3ML9 A;  2FI7 A;  2A5U A;  2J09 A;  5FJY A;  4B8A A;  5BV0 A;  2WXG A;  3VLF A;  2HYZ A;  4WWO A;  3CGH A;  4RG6 A;  4DJA A;  4DLO A;  5J08 A;  4LEU A;  5JJ6 A;  1NA0 A;  2WXH A;  3ZRH A;  1LF8 A;  4CDM A;  5A6C A;  3HIZ A;  1U3C A;  2MHK A;  3ZYM A;  4N3B A;  4E6H A;  1N52 A;  3EHM A;  1VDY A;  1HG5 A;  5HI7 A;  4CGW A;  4BWR A;  4U8H A;  4Q96 A;  1JWF A;  2R17 C;  1UW4 B;  3EIJ A;  5J90 A;  3MV2 B;  4B0Z A;  2KZT A;  3L54 A;  3CHS A;  3SI5 A;  2AXU A;  2OVB A;  4KZ0 A;  3NF1 A;  3PDN A;  5G55 A;  3MA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...