3D9NA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
138
structure length
138
Chain Sequence
EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords RNA-binding protein 16
total genus 57
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9nA00
1HFAA 1HX8A 1SZ9A 3D9OA 1INZA 2DIWA 1HG2A 3ZYLA 2DCPA 3ONKA 4JXTA 3ZYQA 1H0AA 2L0TB 3D9LA 4FU3A 3D9PA 4Q96A 2MOWA 3G2UA 1HG5A 2LO6A 1JUQA 3LDZA 4Q94A 5LOZA 1VDYA 3D9KA 3G2VA 3D9NA 3ZYMA 1XGWA 5CMYA 1JWFA 4HFGA 1JPLA 2L0IA 3D9JA 3G2WA 3CLJA 5J08A 3RRUA 1X5BA 4AVXA 3ONLA 2KM4A 1HF8A 2BF0X 1UJJA 2QY7A 1UJKA 4NACA 2V8SE 3D9IA 1PY1A 3G2TA 5CMWA 4FLBA 1DVPA 4GZDA 1LF8A 1SZAA 3D9MA 1EDUA 1EYHA 4GZCA 3G2SA 1JWGA 5LP0A 3ZYKA 1MHQA 1ELKA
chains in the Genus database with same CATH superfamily
2VGXA 2XHEA 3DSSA 3L16A 5BV1A 4LG6A 2AXUA 3J5QB 5ARGA 5A6CA 1SQMA 3T9KA 4HBDA 1DC2A 4B8AA 2AVPA 2VTBA 4FC8A 2RFMA 1A17A 3KSQA 4DX7D 4TXRA 3DSXA 4DI3A 1BLXB 4R7LA 5EYPF 4XKCA 3HXFA 2Y0BG 2EIME 3C98A 3GZ1A 3PE4A 3E37A 2QFCA 4JL0A 3R7QA 2WM9A 3L17A 5B1BE 4MBGA 4MLPA 3CVWA 2UWJG 1EPUA 4HRMB 4GTRA 4WWNA 2NC9A 2RG8A 3ABKE 2WXLA 2X6HA 3SFZA 3CQCB 4NACA 1FVFA 4AM9A 3PZ2A 4JA9A 3ZNGA 2OV8A 3U3WA 4U7EB 1N54A 5BNWA 4I1MA 5FWQA 3HXBA 4O6FA 2XCBA 1E8ZA 3FTWA 3B7RL 1S0PA 3W9GA 2YNQA 3ESLA 4U96D 3UKRG 1YA0A 4DK5A 1N0RA 3LJNA 2WXJA 1DCEA 3Q7AA 3SNXA 4GPKA 4V3IA 2ONDA 4AP2A 4W9RA 2BTDA 3EU5A 4RQIA 5FQ4A 2VYIA 2IOLA 2H6FA 3SGHA 5FZSA 4B8CB 3TWSA 2LSUA 4JZYA 4XEIG 3CHRA 3J5PA 4O1PA 5ENRD 4I2ZA 4FA6A 2ZISA 5CEDB 3JQ1A 2B6CA 3EJNA 2YHCA 1N4PA 1NA3A 2GRQB 3QWPA 3ABLE 4CDMA 3ASGA 3RAUA 4AV7A 2WB2A 5ANRA 5EDSA 4JHJA 3EIJA 5HQ8A 3LXUX 4P29A 2UY1B 3EU9A 3TWWA 4JB8P 2EIJE 4BT9A 1TR4A 2C0MA 1HFAA 3ABME 4N3BA 4TRQA 4FADA 3CVVA 4XX5A 3DRAA 5EILA 2V0PA 3L9TA 2KCVA 5FIOA 2X6JA 2Y3AA 3Q47B 3WG7E 4J6IA 5G04C 3GZ2A 5CBNA 4OAUC 2LAHA 3IHYA 2IFUA 1K3ZD 5EN5D 3QJZA 5D66A 3C3OA 3QWWA 5FZQA 4N2QA 2ETAA 3VTXA 3FWVA 3MKRA 3P1UA 2HM8A 3BEEA 5EIDA 3HXCA 3OXFA 2OVBA 3D9KA 4HXIA 3Q73A 2XGMA 2XRYA 3ASDA 5JA4D 3Q7FA 1RZ4A 1MJ0A 3ZXPA 3PEUB 3V79K 4GTTA 3PUKA 4NURA 4KZ0A 4CCAA 4I9EA 4UWFA 3CK9A 2WXPA 3E34A 3PNTB 3UM1A 2P58C 2CHWA 3APDA 1LTXA 1UJJA 3D9IA 3V2OA 1AP7A 1KPSB 5EIBE 4HNAD 3D9HA 1E90A 3RKVA 4GZ5A 3ZYKA 4F1PA 2PZIA 1OWMA 4DI4A 4WWPA 4MS6A 4BSXA 4EQFA 1P5QA 5EYLA 2Y69E 4G1TA 3UM0A 4JEHA 1V54E 2H6IA 4MRUA 3NOGD 5JJ7A 3EHQA 3S2AA 3SFYA 1IQRA 4J7WA 2CFZA 1L5JA 5A7DB 2KCLA 2A4ZA 5G05J 5FT9A 3ULEG 3CIAA 3KAEA 4UQZA 4UI9C 3W9FA 4APOA 3L6AA 4GYYA 4WNDA 4NIKA 4OVUA 3LCAA 2GRPB 5HRYA 4GCNA 3TXMA 3DSVA 4J8FA 4CGVA 3CHOA 3TWQA 4YNDA 2PQNA 1HXIA 3CGHA 4Q96A 1Q2ZA 3PUJA 4HLEA 3FU0A 3O4ZA 2C2LA 4U8YD 2QY7A 3AU5A 4OYSA 2AWIA 1UW4B 5EX3A 4GYWA 1S64A 2XEEA 4HORA 4N2SA 4G24A 5BT1A 3D9LA 3RSEG 2WVIA 2L9BA 3Q75A 3LVQE 5AQAA 4LSZE 3TWXA 2KM4A 1D8DA 4L2LA 1UN9A 5BW8C 3G2SA 1EF1C 1MX4A 5KJNA 2WXHA 3ENEA 3FU3A 2DVWA 5C2YA 4ANUA 4JEUA 3V30A 1X5BA 5KNHD 1QYMA 1IHBA 4N39A 3S7JA 2PM7A 4L1BA 1YMPA 4EHMA 3R9AB 5KJKA 2AJAA 2LUHA 4K5CA 4L23A 4CZ2D 3SO8A 4U8VD 2B0OE 5HS0A 3AJIA 1FT1A 3GW4A 3UTMA 2DBAA 1QNFA 4KT6B 2CFUA 3IKOB 3PRZA 1SA5A 3PZDA 5ENOD 4FULA 4DRXE 4I17A 5BPPA 1UG3A 5ENTD 3D9PA 1N52A 3G2VA 3MKQA 4WNFA 4A3TA 4X8QA 4DJAA 2GRLA 5LCWJ 4AJWA 3CHSA 4F3VA 3X2QE 1JWFA 1SVXA 4FJYA 4GTMA 2J09A 4GTQA 3NB2A 3R7RA 3KS2A 1ZBPA 1E8YA 3VLEA 1O5MA 4L7TA 5FINA 4UWLA 1H6OA 2L6BA 4RG6A 4HQDA 1W3BA 2HYZA 4PS3A 4DLOA 3L54A 2XEHA 4XI9A 3MZLB 2R05A 1SZAA 1MZCA 4L2YA 2J4BA 1DCQA 4N3CA 4QFVA 3CQGB 2QC9A 3JUEA 3P2BA 3CHPA 3TWRA 5AARA 3PH0C 4I9CA 2AXZA 3G2UA 2F8XK 3ASOE 2F37A 4BX9A 2LNIA 5ARFA 2XZTG 4UI9K 4GA0A 3E4BA 3B7BA 4PDXA 3U4TA 1IXVA 3PEVB 4YVQC 1IYGA 4B89A 1HZ4A 2WMNA 3HYMB 3LDZA 2F8YA 2FBNA 2XS1A 3B7TA 3CVNA 1MX6A 3BU8A 2WQ7A 2GW1A 4GZCA 2JLBA 4BY6A 5D2MC 4E85A 3R9MA 2WXQA 1H2UA 4K5BA 2LSVA 5ENQD 2I1KA 1S63A 2L0IA 4BESA 1JCRA 1OCRE 2IO2C 1D9SA 1FVHA 2JEKA 3CKCA 3S7DA 4C0EA 4RSYA 1KZPA 2VSOE 3FH5A 3ESKA 3DPYA 3UPVA 1TJFA 4CDRA 5A23A 3JYSA 4EBAG 5KWDA 5M72A 2VJ8A 1ELRA 2M63A 2CHXA 1U2VG 5D0OD 2R03A 4A55A 1IQUA 4FU3A 3PVLA 3Q5MA 4U95D 1UN8A 4IRUA 3KEAA 3T5XA 3AG3E 1LD7A 4EZKA 5T8IA 3LPZA 1OXJA 1WM5A 4ZHBA 2XPYA 3S7BA 2X6IA 2I6HA 3ZYLA 4A63B 4JXTA 2LO6A 4BTBA 3I4GA 1ELWA 2OVFA 4TXQA 3DSUA 3AS4A 1O1SA 3HXEA 4GZDA 2FO1E 4BEPA 2XS8A 3ZW3A 1YYHA 1MQSA 2P9PG 3FTXA 4WUYA 1FPPA 2F0YA 3NQPA 4PUCA 4TUMA 4N5QA 3BUAA 2I9CA 4C0MA 4U8HA 3CHQA 3Q15A 3ZHEA 4IULA 3PDNA 5IY5E 1JWGA 1BU9A 3ZUVB 4UQXA 3FH8A 1INZA 4ABNA 5JMND 3FUJA 4I6GA 4EECA 3OTNA 4WNGA 3LY9A 5FZRA 2VTBB 4GZ3A 4AEZC 4A1GA 3MX3A 3V31A 5E75A 2R2LA 4KVOA 2VGEA 2WQ6A 5KBAA 4EZJA 4YDWA 3QWVA 2IQCA 3ZYQA 3HIZA 4YDEA 3KD7A 3FEXA 4LRZA 3FTYA 1Z3YA 5JHBA 3ZIMA 3SBSA 2BKKB 3TWTA 1UJKA 3EHNA 2BUGA 4XE0A 2J07A 4GTPA 2MRIA 3BG1B 1TN8A 4HRLA 2A5UA 1TNYA 3FULA 1FT2A 2DWZA 4CT4A 2V5FA 2JABA 2WXNA 3UT8A 2L6JA 2KXPC 4UUCA 4BWRA 1NZNA 3FUIA 3JQ0A 4IN3B 3SF4A 4MKTA 3G2TA 3I5PA 4EZLA 3ZXSA 4LUNU 4G2VA 3FFLA 4U63A 3T8KA 4FHJA 3PZ3A 2P9SG 3APCA 3TWUA 2FEZA 2HE0A 2FF4A 5ENNA 3MGBA 2GGFA 4GB9A 3UIPC 3Q9UC 1VDYA 4L9PA 5CMYA 3FUFA 5ENPD 3HVEA 2J4DA 4O1OA 3B13A 3ZGQA 5FJYA 3IHVA 3SZ7A 3SI5A 1E8WA 2J08A 4JC8A 4O60A 4B93B 2PM6A 4ILIA 2RFAA 4GPMA 2VGYA 1Z6TA 1LD8A 4OVVA 2Q7FA 3MYVA 4AY5A 4CGWA 1EDUA 3APFA 5AIJA 4B0ZA 4KMOA 1SZ9A 4ATGA 2HO1A 3ZN3A 3DEOA 3U66A 1N4QA 3CR3A 2AXVA 4ANWA 3IBEA 1U3CA 3RRUA 2RD0A 3VLFA 4A1SA 1LF8A 2WXIA 2I1JA 1EYHA 1OY3D 4G26A 1NA0A 2FULA 2OCCE 4FP7A 3K9IA 1QQEA 3JXJA 2XEVA 4AY6A 2MOWA 2OEWA 4Q94A 4BFRA 2H6GA 2BEDA 3QC1A 3UQ3A 3DXKG 4FHKA 3DBSA 2X38A 3PS6A 1OUVA 3D9JA 2NSZA 5AQ9A 4AVXA 2BF0X 3OXLA 3TG5A 1DVPA 2ETCA 3EUVA 2ZGDA 4PH4B 4DLQA 4EPZA 1H0AA 3FUHA 4PS8A 5LOZA 2DYRE 4LCTA 3U64A 3FUKA 1OCCE 2EQXA 3NOCD 3S7FA 2OOEA 5CECB 3PZ4A 3CVQA 5BV0A 1TYQG 1BI8B 3MJWA 4Y6CA 4HOQA 3RRMB 4DX5D 3AG2E 4RLYA 4CEMA 3SBTB 1PAQA 4H7YA 1N94A 4JA7A 1KT0A 1N9AA 2OEVA 3AS5A 4F6RD 5AQ7A 4ACKA 4U0ZA 2P9IG 2CG2A 4E6HA 1H6PA 3ONKA 4ME2A 3ASHA 3ZU7B 1H2VC 3QK0A 3TG4A 4U0UA 3MA5A 1U3DA 2ETBA 1WG0A 4ANXA 2Y4UA 4K5AB 2XRZA 1QZ2A 3LJ3A 2KCKA 3DSWA 1OWPA 2WXGA 3CHMA 3FUNA 3ZEFA 4GMRA 4HOTA 2GRNB 3FHEA 3MEKA 5T4YA 2WQHA 1QBQA 1BI7B 3ULQA 4GYOA 2PL2A 1OWOA 5AENA 4AIFA 3GZSA 2X3MA 4GA2A 4HS2A 3DXMG 3ONLA 1TNZA 5H7PA 4N3AA 5DBKA 3O48A 5CMWA 5LFAA 5T3RA 4URKA 4UWHA 4ZFHA 1N4SA 1OWNA 1NFIE 3UM3A 3UX4A 3UUXA 2VQ2A 1HE8A 5ANLA 3ZPJA 1D8EA 2C0LA 1OT8A 1TJCA 4I2WA 4OAVB 3UXGA 4DX1A 1H2TC 2XQ0A 2QYUA 1GW6A 3C3QA 4J8SA 5BXOA 2P2CP 3JUIA 1TNOA 3LS8A 3MV3B 3C72A 5B3SE 5FQ8A 4C9BB 3IV0A 1E7VA 2P9UG 4EBAA 3FTUA 3KSLA 5AYWD 5J90A 4ANVA 3DSTA 2YQ8A 2BKGA 2R17C 3AG4E 4A3VA 3CEQA 2V8SE 2I2OA 1MX2A 3NAWA 3UM2A 4LEUA 2R5SA 3I3NA 2HR2A 3CVUA 2IONA 4LNBA 3SD5A 3LEWA 1Y8MA 4K0RA 5HI7A 2IF4A 5FQ6A 5EKQD 1SW6A 3QARA 2WMOA 2DYSE 2IEJA 3CVLA 4I1OB 3TGOA 3Q9NC 3FUMA 3HHMA 3DEPA 2IY0C 2CHZA 3LY8A 3PNLB 1DNPA 3CVXA 3FDHA 2J9QA 1KLXA 3PREA 2PQRA 4DX2A 5FTPA 2V5QC 4BX8A 3C3RA 5CRVA 3RRNB 4I6EA 3DWLG 3EDTB 1TEZA 1K1AA 3CV0A 2UY1A 4XKBA 3UKUG 2EIKE 5ITZF 3TWVA 2EILE 1HF8A 2CG3A 3RO3A 1H6KA 2VGXB 3D9OA 4G11A 1E7UA 4LERA 3KEZA 1K1BA 2QZAA 3AG1E 3T8MA 3FP3A 3MV2B 3L13A 1IHGA 2KBXA 3UINC 3ASNE 3ZKJA 5CHEE 3NZUA 3FTZA 2NXPA 4J8EA 1K8KG 3AAAC 5E76A 3ML9A 2GRMA 3SFXA 1OCZE 1HH8A 3QB2A 4GA1A 4HOUA 3ZYMA 3D9NA 1SA4A 3SQVA 2XENA 4JHRA 2ZGGA 4JVSA 1N0QA 4NRHB 3HG0D 2WXRA 5G2NA 3ASFA 3U9WA 5KJLA 3NF1A 1G3NB 1FCHA 3L82A 4HI9A 1Y6IA 5CCMA 5ENSD 4GCOA 3LY7A 1HX8A 3ZHEB 1TNUA 3FU5A 5FQ7A 3ULYA 5AQBA 4I6JA 3OAWA 4G8LA 2A5EA 4XIFA 2E2EA 4BT8A 4RG9A 2IOSA 4U0SA 1PY1A 3ZVVA 3MKQB 4CDNA 5LP0A 4QQIA 2ILRA 2WPVA 2WXOA 1HG2A 2XCCA 1OCOE 1NL4A 3UI2A 1TNBA 4BSZB 1HG5A 5KNGA 2YINA 1N4RA 4HOSA 1HS6A 4PS7A 3OXGA 2LXLA 4JW1A 3I4RB 2XGOA 2FO7A 3HRAA 5AJDA 4AOFA 5LX8A 4GU5A 3RO2A 4HI8A 3TAXA 3ZFWA 1BD8A 3ISMC 4FLHA 1XGWA 3SHFA 4I1AA 3JXIA 2NYJA 3TL5A 2X6FA 3NZSA 3UIOC 4UI9J 1Z5SC 2IO3C 1ELKA 4LNGA 3F6QA 1X81A 2VSNA 3SY2A 4I43A 3E30A 3G2WA 5J08A 4LNUD 4KYOB 4CT0A 5AAOA 1NI1A 4AXHA 3IEGA 3QNKA 2P9LG 2KC7A 4KBQA 3ZRHA 5LCWC 3Q79A 4J8DA 2XZDG 5CRUA 4GMLA 4J0UA 5DIZA 1TN6A 4F7AA 3RIBA 5G55A 4GTOA 3FU6A 3E33A 1B89A 3HDXA 5JHAA 4N5CA 3AS8A 1PC2A 4J8YA 2GRRB 3CKBA 5CERB 4ATZD 3CSFA 1BPOA 4C48B 4G8KA 2WXKA 3FY4A 4UQYA 3QDNA 4U07A 3VTYA 2KATA 1RW2A 2V4LA 5B1AE 1KT1A 3E32A 1UOHA 1JUQA 3ML8A 3CK8A 2R02A 3QKYA 1V55E 4IYPA 4JPSA 4G25A 4D10C 4KVMA 4TUUA 4DPRA 3FTVA 4RVBA 4U04A 4FLBA 2VSYA 4NQ0A 4M7CA 3FUDA 5BXUA 3Q78A 3UT4A 4HB5A 1O1TA 4WAFA 4K03A 3N71A 2AW6A 2EINE 4WNEA 5HKPA 2J49A 1JCSA 4DX6D 3EHRA 3UT7A 3QAQA 5C1DA 2WXFA 1JCQA 2LXMA 2XGSA 3PZ1A 1E96B 3L08A 4TXPA 3FH7A 4JHKA 4GAAA 1WY6A 3B7UX 4XZ4A 1HO8A 3URZA 2YHEA 4YVOA 1TN7A 4KXKB 4CYMD 5JJTA 4HVBA 4HRNA 1Z3XA 2MYOA 3IXEA 2QYJA 3VLDA 3AU4A 2ZXWE 2DZNA 1S70B 3EIQC 2LAIA 5JJ6A 2KZTA 4FJZA 1MYOA 1WAO1 4Z68A 1MHQA 1N11A 1ZB1A 1E8XA 2Y1LE 3NBNB 1IKND 1NP7A 4BETA 4G23A 4CRWA 4M3OA 3PE3A 3FUEA 1H19A 5AJLA 2XPIA 5CEAA 1AWCB 3LKUA 3CVYA 2R59A 3V2XA 5BUZA 4Y6WA 3L22A 2WXMA 2MHKA 1XNFA 3Q4AB 2IJGX 5CBOA 3FTSA 2DCPA 5KJMA 5G05C 2L0TB 2P9NG 4BERA 4ILGA 4F53A 3C5RA 3TJPA 4TV3A 2GROB 2XPZA 5KCMA 3B7SA 3RU0A 4DUIA 5CCLA 1N95A 5AN8A 4H7XA 2VSXE 5EX0A 2J8SD 1A5EA 4ILHB 3LVRE 4YDYA 2Y4TA 3CK7A 4GZ6A 4WWOA 3D9MA 3TXNA 4UWGA 2FI7A 1WDYA 2IU1A 3CVPA 2P9KG 2V4HC 1OWLA 2PNNA 3FEYA 2ZU6B 1O1RA 3JCKC 2E0IA 3DPDA 3LYAA 2H6HA 3RK6A 3HXDA 2DIWA 3UMVA 4GTSA 4Q69A 3BG0B 4ACLA 3HVEB 4GMJA 4APFA 1JPLA 1HU3A 3RJVA 3Q49B 3T5VA 1KZOA 3BQOA 4HLLA 4YDOA 4GTVA 4UWKA 2RKKA 2ZIRA 3WXXA 3CSTA 2DZOA 2KZTB 3MCXA 4F1SA 3EHMA 3GYZA 4KZCA 4HFGA 1YCSB 3CLJA 3QOUA 2X6KA 4JD2G 3D3MA 4B94A 5G04J 1ZU2A 4BTAA 5D0QD 4XI0A 3B95A
chains in the Genus database with same CATH topology
1SZ9A 2VGXA 3S7JA 2XHEA 2PM7A 4L1BA 4ATGA 3R9AB 3L16A 5KJKA 2HO1A 4L23A 5BV1A 1HH8A 2AXUA 3QB2A 4GA1A 4HOUA 5ARGA 3ZYMA 5A6CA 3D9NA 3ZN3A 3U66A 1SQMA 3CR3A 2AXVA 4ANWA 3IBEA 1U3CA 3RRUA 3GW4A 2RD0A 4JHRA 2DBAA 4B8AA 4JVSA 3VLFA 1QNFA 4A1SA 2AVPA 1LF8A 2WXIA 4NRHB 2I1JA 1EYHA 4FC8A 4KT6B 2VTBA 4G26A 2CFUA 1A17A 3IKOB 3PRZA 3PZDA 4FULA 1NA0A 2FULA 2WXRA 4DI3A 5G2NA 3ASFA 4I17A 3U9WA 5KJLA 4FP7A 3K9IA 5BPPA 3NF1A 1QQEA 1UG3A 4R7LA 1FCHA 2XEVA 3D9PA 4AY6A 1N52A 2MOWA 4Q94A 4XKCA 3G2VA 4BFRA 3MKQA 4WNFA 3C98A 3GZ1A 3PE4A 4A3TA 4DJAA 2QFCA 3QC1A 2GRLA 5LCWJ 4JL0A 3R7QA 2WM9A 3L17A 4AJWA 3CHSA 4F3VA 3UQ3A 1Y6IA 5CCMA 4GCOA 3LY7A 1JWFA 1HX8A 4FHKA 3ZHEB 4MLPA 3DBSA 4FJYA 3CVWA 2J09A 3FU5A 2UWJG 5FQ7A 3R7RA 1EPUA 3KS2A 4I6JA 2X38A 1ZBPA 3OAWA 4WWNA 2NC9A 3PS6A 2RG8A 1E8YA 4XIFA 3VLEA 2E2EA 2WXLA 1OUVA 3D9JA 2NSZA 2X6HA 4BT8A 3SFZA 4AVXA 4L7TA 3CQCB 4RG9A 2BF0X 2IOSA 4NACA 1FVFA 4U0SA 1PY1A 3ZVVA 4AM9A 4JA9A 3U3WA 2OV8A 3MKQB 3OXLA 4CDNA 3TG5A 4UWLA 1DVPA 1N54A 5LP0A 5BNWA 4I1MA 2ILRA 4RG6A 2WPVA 5FWQA 2WXOA 1HG2A 2XCCA 4PH4B 4O6FA 4DLQA 2XCBA 1E8ZA 1W3BA 3FTWA 4EPZA 3B7RL 1H0AA 3FUHA 2HYZA 4PS8A 1HG5A 2YINA 5LOZA 4HOSA 1HS6A 1S0PA 4PS7A 4PS3A 4LCTA 3U64A 3FUKA 2YNQA 2EQXA 3ESLA 3S7FA 4DLOA 2OOEA 1YA0A 3OXGA 4DK5A 3L54A 4XI9A 3MZLB 4JW1A 2WXJA 3I4RB 3CVQA 2XGOA 1SZAA 5BV0A 2FO7A 4L2YA 2J4BA 4N3CA 5AJDA 4QFVA 4AOFA 3SNXA 3MJWA 5LX8A 4Y6CA 4HOQA 3CQGB 3RRMB 3P2BA 3CHPA 4GU5A 3PH0C 4I9CA 3RO2A 2AXZA 3TAXA 3ZFWA 3G2UA 4GPKA 4FLHA 4BX9A 1XGWA 2LNIA 4V3IA 4CEMA 2ONDA 5ARFA 3SHFA 4I1AA 4AP2A 4W9RA 2BTDA 4UI9K 4GA0A 5FQ4A 2VYIA 3SBTB 2IOLA 3E4BA 1PAQA 4PDXA 3TL5A 3SGHA 3U4TA 5FZSA 4B8CB 2X6FA 4H7YA 2LSUA 3PEVB 3NZSA 4XI0A 4UI9J 4JZYA 4YVQC 1ELKA 4JA7A 3CHRA 1KT0A 1IYGA 4B89A 1HZ4A 2WMNA 3AS5A 2VSNA 3HYMB 4I2ZA 3LDZA 4FA6A 2FBNA 3B7TA 3CVNA 4I43A 5M72A 4ACKA 3JQ1A 3G2WA 5J08A 3EJNA 4KYOB 2YHCA 4CT0A 2WQ7A 2GW1A 4U0ZA 4AXHA 1NA3A 3IEGA 3QWPA 3QNKA 4GZCA 2CG2A 2JLBA 4BY6A 2KC7A 4KBQA 3ZRHA 5LCWC 4CDMA 3ASGA 4J8DA 4AV7A 4E85A 4GMLA 4E6HA 4J0UA 5DIZA 2WXQA 4F7AA 2WB2A 3RIBA 5G55A 1H2UA 3ONKA 5ANRA 5EDSA 4ME2A 3FU6A 3ASHA 4JHJA 1H2VC 1B89A 3HDXA 2LSVA 5JHAA 2I1KA 3EIJA 3QK0A 4N5CA 3LXUX 3TG4A 5HQ8A 3AS8A 1PC2A 4U0UA 3MA5A 2L0IA 4P29A 3CKBA 2UY1B 3CSFA 1BPOA 1U3DA 2WXKA 3FY4A 4UQYA 3QDNA 4U07A 4BT9A 4ANXA 2Y4UA 1FVHA 2C0MA 2JEKA 2KATA 3CKCA 1HFAA 3VTYA 2V4LA 3S7DA 2XRZA 1QZ2A 4N3BA 3LJ3A 4TRQA 4C0EA 2KCKA 4RSYA 4FADA 3CVVA 1OWPA 2VSOE 1KT1A 2WXGA 3ESKA 3FH5A 4XX5A 2V0PA 3CHMA 3FUNA 1JUQA 2KCVA 3UPVA 3ML8A 1TJFA 3CK8A 3ZEFA 4CDRA 5A23A 2X6JA 3QKYA 3JYSA 4HOTA 4IYPA 4JPSA 4EBAG 4G25A 4D10C 4KVMA 2Y3AA 3FHEA 3MEKA 4TUUA 2WQHA 3Q47B 3FTVA 4RVBA 2VJ8A 4U04A 1ELRA 2VSYA 4FLBA 4J6IA 4NQ0A 5T4YA 4HLEA 2M63A 3FUDA 5G04C 3UT4A 3GZ2A 2CHXA 3ULQA 5D0OD 4WAFA 4A55A 2LAHA 3IHYA 4K03A 4GYOA 4DPRA 2IFUA 2PL2A 3N71A 1IQUA 4FU3A 3PVLA 3Q5MA 1OWOA 1UN8A 2AW6A 5AENA 4WNEA 3QJZA 4AIFA 4IRUA 3GZSA 2X3MA 4GA2A 2J49A 4HS2A 3T5XA 3QWWA 5FZQA 4N2QA 3UT7A 3ONLA 4EZKA 3QAQA 5T8IA 5C1DA 3LPZA 4N3AA 5DBKA 3VTXA 3O48A 5CMWA 2WXFA 3FWVA 5LFAA 3MKRA 1WM5A 5T3RA 4URKA 2XPYA 3P1UA 2XGSA 4UWHA 1E96B 1OWNA 2HM8A 3L08A 3BEEA 3S7BA 2X6IA 3FH7A 4JHKA 2I6HA 4GAAA 3ZYLA 3UX4A 1WY6A 3UUXA 4JXTA 2VQ2A 3B7UX 1HE8A 4XZ4A 1HO8A 3URZA 3OXFA 2LO6A 4BTBA 2OVBA 2YHEA 3D9KA 3I4GA 4HXIA 4YVOA 5ANLA 1ELWA 2OVFA 4KXKB 3ZPJA 2XGMA 2C0LA 5JJTA 4HVBA 1TJCA 2XRYA 3ASDA 4I2WA 1Z3XA 3VLDA 3AS4A 3AU4A 1H2TC 4GZDA 2XQ0A 2LAIA 3EIQC 3PEUB 5JJ6A 1GW6A 2KZTA 4FJZA 4J8SA 1WAO1 3PUKA 4NURA 1MHQA 4KZ0A 4CCAA 4I9EA 3JUIA 4UWFA 3CK9A 3ZW3A 1MQSA 3LS8A 1E8XA 3FTXA 3MV3B 1NP7A 2WXPA 4WUYA 3PNTB 4G23A 4CRWA 2P58C 3NQPA 4M3OA 4PUCA 5FQ8A 4C9BB 2CHWA 3APDA 2I9CA 3IV0A 1E7VA 3PE3A 3FUEA 4C0MA 1H19A 5AJLA 4U8HA 2XPIA 3LKUA 1UJJA 3CHQA 3Q15A 3CVYA 4B0ZA 3D9IA 3ZHEA 2R59A 4EBAA 3FTUA 4IULA 3PDNA 5BUZA 4Y6WA 5AYWD 5J90A 3L22A 2WXMA 1JWGA 2MHKA 1E90A 1XNFA 3RKVA 4GZ5A 3ZYKA 3Q4AB 2IJGX 4UQXA 4ANVA 2PZIA 1OWMA 3FH8A 4WWPA 4DI4A 1INZA 4MS6A 3FTSA 4ABNA 2YQ8A 4BSXA 1P5QA 2DCPA 4EQFA 5KJMA 5G05C 2L0TB 3FUJA 4I6GA 4G1TA 4EECA 3OTNA 4WNGA 3LY9A 5FZRA 2R17C 4ILGA 2VTBB 4GZ3A 4AEZC 4A1GA 3MX3A 4F53A 4JEHA 3TJPA 4A3VA 4TV3A 5E75A 4MRUA 2XPZA 5KCMA 3CEQA 2V8SE 3B7SA 5JJ7A 2I2OA 4KVOA 3RU0A 5CCLA 3S2AA 4LEUA 2R5SA 2WQ6A 1IQRA 4H7XA 2CFZA 2VSXE 4EZJA 5EX0A 3QWVA 2IQCA 3I3NA 2HR2A 3ZYQA 3CVUA 3HIZA 1L5JA 2IONA 4ILHB 5A7DB 3LVRE 3SD5A 3KD7A 3LEWA 2KCLA 2A4ZA 3FEXA 4LRZA 5G05J 5FT9A 1Y8MA 3FTYA 4K0RA 3CIAA 5HI7A 2IF4A 2Y4TA 5FQ6A 1Z3YA 3CK7A 3SBSA 3KAEA 3ZIMA 5JHBA 4GZ6A 1UJKA 3EHNA 3QARA 2BUGA 2WMOA 4UQZA 4UI9C 4WWOA 5EKQD 4APOA 3L6AA 4GYYA 4WNDA 4XE0A 3D9MA 3TXNA 4UWGA 4OVUA 3CVLA 4I1OB 2FI7A 2J07A 2IU1A 3LCAA 2MRIA 3TGOA 3BG1B 4GCNA 3TXMA 3CVPA 4J8FA 4CGVA 3CHOA 4YNDA 2A5UA 2PQNA 1HXIA 3CGHA 4Q96A 3FUMA 1OWLA 3FULA 3PUJA 3HHMA 2V5FA 4CT4A 2WXNA 2CHZA 3FU0A 3LY8A 3PNLB 1DNPA 3O4ZA 3FEYA 2C2LA 2L6JA 2ZU6B 3UT8A 3CVXA 3FDHA 4BWRA 2J9QA 1KLXA 3PREA 2PQRA 1NZNA 3FUIA 3JQ0A 2QY7A 3AU5A 4IN3B 4MKTA 3G2TA 3I5PA 4OYSA 3JCKC 3SF4A 4LUNU 4G2VA 2E0IA 3FFLA 3ZXSA 4U63A 4EZLA 2AWIA 3DPDA 3LYAA 1UW4B 4FHJA 5FTPA 5EX3A 3RK6A 4GYWA 4HORA 3APCA 4N2SA 4BX8A 2FEZA 4G24A 2FF4A 2DIWA 5BT1A 5ENNA 3RRNB 3UMVA 3MGBA 4I6EA 2GGFA 3D9LA 4GB9A 3EDTB 1TEZA 2WVIA 4Q69A 2L9BA 1VDYA 3CV0A 5CMYA 2UY1A 3BG0B 3FUFA 3LVQE 4XKBA 4ACLA 3HVEB 4GMJA 4APFA 1JPLA 3HVEA 1HU3A 3RJVA 2J4DA 2KM4A 1HF8A 2CG3A 3B13A 3Q49B 3ZGQA 3T5VA 5FJYA 4L2LA 3RO3A 1UN9A 3IHVA 3G2SA 1EF1C 5BW8C 3SZ7A 5KJNA 1H6KA 2VGXB 3SI5A 4UWKA 3D9OA 3WXXA 1E8WA 4G11A 2J08A 3CSTA 1E7UA 4LERA 3KEZA 2WXHA 3ENEA 4JC8A 2KZTB 3MCXA 3T8MA 3EHMA 3FP3A 3GYZA 3MV2B 4KZCA 3L13A 4F1SA 3FU3A 1IHGA 4HFGA 2PM6A 5C2YA 4ANUA 4JEUA 3CLJA 4ILIA 1X5BA 2X6KA 2VGYA 1Z6TA 3QOUA 5CHEE 3NZUA 3D3MA 4B94A 4OVVA 3FTZA 5G04J 2NXPA 4J8EA 2Q7FA 1ZU2A 3MYVA 4AY5A 4BTAA 1EDUA 4CGWA 3APFA 5AIJA 5D0QD 5E76A 4N39A 3ML9A 2GRMA 4KMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HFA A;  1HX8 A;  1SZ9 A;  3D9O A;  1INZ A;  2DIW A;  1HG2 A;  3ZYL A;  2DCP A;  3ONK A;  4JXT A;  3ZYQ A;  1H0A A;  2L0T B;  3D9L A;  4FU3 A;  3D9P A;  4Q96 A;  2MOW A;  3G2U A;  1HG5 A;  2LO6 A;  1JUQ A;  3LDZ A;  4Q94 A;  5LOZ A;  1VDY A;  3D9K A;  3G2V A;  3D9N A;  3ZYM A;  1XGW A;  5CMY A;  1JWF A;  4HFG A;  1JPL A;  2L0I A;  3D9J A;  3G2W A;  3CLJ A;  5J08 A;  3RRU A;  1X5B A;  4AVX A;  3ONL A;  2KM4 A;  1HF8 A;  2BF0 X;  1UJJ A;  2QY7 A;  1UJK A;  4NAC A;  2V8S E;  3D9I A;  1PY1 A;  3G2T A;  5CMW A;  4FLB A;  1DVP A;  4GZD A;  1LF8 A;  1SZA A;  3D9M A;  1EDU A;  1EYH A;  4GZC A;  3G2S A;  1JWG A;  5LP0 A;  3ZYK A;  1MHQ A;  1ELK A; 
#chains in the Genus database with same CATH topology
 2VGX A;  2XHE A;  3DSS A;  3L16 A;  5BV1 A;  4LG6 A;  2AXU A;  3J5Q B;  5ARG A;  5A6C A;  1SQM A;  3T9K A;  4HBD A;  1DC2 A;  4B8A A;  2AVP A;  2VTB A;  4FC8 A;  2RFM A;  1A17 A;  3KSQ A;  4DX7 D;  4TXR A;  3DSX A;  4DI3 A;  1BLX B;  4R7L A;  5EYP F;  4XKC A;  3HXF A;  2Y0B G;  2EIM E;  3C98 A;  3GZ1 A;  3PE4 A;  3E37 A;  2QFC A;  4JL0 A;  3R7Q A;  2WM9 A;  3L17 A;  5B1B E;  4MBG A;  4MLP A;  3CVW A;  2UWJ G;  1EPU A;  4HRM B;  4GTR A;  4WWN A;  2NC9 A;  2RG8 A;  3ABK E;  2WXL A;  2X6H A;  3SFZ A;  3CQC B;  4NAC A;  1FVF A;  4AM9 A;  3PZ2 A;  4JA9 A;  3ZNG A;  2OV8 A;  3U3W A;  4U7E B;  1N54 A;  5BNW A;  4I1M A;  5FWQ A;  3HXB A;  4O6F A;  2XCB A;  1E8Z A;  3FTW A;  3B7R L;  1S0P A;  3W9G A;  2YNQ A;  3ESL A;  4U96 D;  3UKR G;  1YA0 A;  4DK5 A;  1N0R A;  3LJN A;  2WXJ A;  1DCE A;  3Q7A A;  3SNX A;  4GPK A;  4V3I A;  2OND A;  4AP2 A;  4W9R A;  2BTD A;  3EU5 A;  4RQI A;  5FQ4 A;  2VYI A;  2IOL A;  2H6F A;  3SGH A;  5FZS A;  4B8C B;  3TWS A;  2LSU A;  4JZY A;  4XEI G;  3CHR A;  3J5P A;  4O1P A;  5ENR D;  4I2Z A;  4FA6 A;  2ZIS A;  5CED B;  3JQ1 A;  2B6C A;  3EJN A;  2YHC A;  1N4P A;  1NA3 A;  2GRQ B;  3QWP A;  3ABL E;  4CDM A;  3ASG A;  3RAU A;  4AV7 A;  2WB2 A;  5ANR A;  5EDS A;  4JHJ A;  3EIJ A;  5HQ8 A;  3LXU X;  4P29 A;  2UY1 B;  3EU9 A;  3TWW A;  4JB8 P;  2EIJ E;  4BT9 A;  1TR4 A;  2C0M A;  1HFA A;  3ABM E;  4N3B A;  4TRQ A;  4FAD A;  3CVV A;  4XX5 A;  3DRA A;  5EIL A;  2V0P A;  3L9T A;  2KCV A;  5FIO A;  2X6J A;  2Y3A A;  3Q47 B;  3WG7 E;  4J6I A;  5G04 C;  3GZ2 A;  5CBN A;  4OAU C;  2LAH A;  3IHY A;  2IFU A;  1K3Z D;  5EN5 D;  3QJZ A;  5D66 A;  3C3O A;  3QWW A;  5FZQ A;  4N2Q A;  2ETA A;  3VTX A;  3FWV A;  3MKR A;  3P1U A;  2HM8 A;  3BEE A;  5EID A;  3HXC A;  3OXF A;  2OVB A;  3D9K A;  4HXI A;  3Q73 A;  2XGM A;  2XRY A;  3ASD A;  5JA4 D;  3Q7F A;  1RZ4 A;  1MJ0 A;  3ZXP A;  3PEU B;  3V79 K;  4GTT A;  3PUK A;  4NUR A;  4KZ0 A;  4CCA A;  4I9E A;  4UWF A;  3CK9 A;  2WXP A;  3E34 A;  3PNT B;  3UM1 A;  2P58 C;  2CHW A;  3APD A;  1LTX A;  1UJJ A;  3D9I A;  3V2O A;  1AP7 A;  1KPS B;  5EIB E;  4HNA D;  3D9H A;  1E90 A;  3RKV A;  4GZ5 A;  3ZYK A;  4F1P A;  2PZI A;  1OWM A;  4DI4 A;  4WWP A;  4MS6 A;  4BSX A;  4EQF A;  1P5Q A;  5EYL A;  2Y69 E;  4G1T A;  3UM0 A;  4JEH A;  1V54 E;  2H6I A;  4MRU A;  3NOG D;  5JJ7 A;  3EHQ A;  3S2A A;  3SFY A;  1IQR A;  4J7W A;  2CFZ A;  1L5J A;  5A7D B;  2KCL A;  2A4Z A;  5G05 J;  5FT9 A;  3ULE G;  3CIA A;  3KAE A;  4UQZ A;  4UI9 C;  3W9F A;  4APO A;  3L6A A;  4GYY A;  4WND A;  4NIK A;  4OVU A;  3LCA A;  2GRP B;  5HRY A;  4GCN A;  3TXM A;  3DSV A;  4J8F A;  4CGV A;  3CHO A;  3TWQ A;  4YND A;  2PQN A;  1HXI A;  3CGH A;  4Q96 A;  1Q2Z A;  3PUJ A;  4HLE A;  3FU0 A;  3O4Z A;  2C2L A;  4U8Y D;  2QY7 A;  3AU5 A;  4OYS A;  2AWI A;  1UW4 B;  5EX3 A;  4GYW A;  1S64 A;  2XEE A;  4HOR A;  4N2S A;  4G24 A;  5BT1 A;  3D9L A;  3RSE G;  2WVI A;  2L9B A;  3Q75 A;  3LVQ E;  5AQA A;  4LSZ E;  3TWX A;  2KM4 A;  1D8D A;  4L2L A;  1UN9 A;  5BW8 C;  3G2S A;  1EF1 C;  1MX4 A;  5KJN A;  2WXH A;  3ENE A;  3FU3 A;  2DVW A;  5C2Y A;  4ANU A;  4JEU A;  3V30 A;  1X5B A;  5KNH D;  1QYM A;  1IHB A;  4N39 A;  3S7J A;  2PM7 A;  4L1B A;  1YMP A;  4EHM A;  3R9A B;  5KJK A;  2AJA A;  2LUH A;  4K5C A;  4L23 A;  4CZ2 D;  3SO8 A;  4U8V D;  2B0O E;  5HS0 A;  3AJI A;  1FT1 A;  3GW4 A;  3UTM A;  2DBA A;  1QNF A;  4KT6 B;  2CFU A;  3IKO B;  3PRZ A;  1SA5 A;  3PZD A;  5ENO D;  4FUL A;  4DRX E;  4I17 A;  5BPP A;  1UG3 A;  5ENT D;  3D9P A;  1N52 A;  3G2V A;  3MKQ A;  4WNF A;  4A3T A;  4X8Q A;  4DJA A;  2GRL A;  5LCW J;  4AJW A;  3CHS A;  4F3V A;  3X2Q E;  1JWF A;  1SVX A;  4FJY A;  4GTM A;  2J09 A;  4GTQ A;  3NB2 A;  3R7R A;  3KS2 A;  1ZBP A;  1E8Y A;  3VLE A;  1O5M A;  4L7T A;  5FIN A;  4UWL A;  1H6O A;  2L6B A;  4RG6 A;  4HQD A;  1W3B A;  2HYZ A;  4PS3 A;  4DLO A;  3L54 A;  2XEH A;  4XI9 A;  3MZL B;  2R05 A;  1SZA A;  1MZC A;  4L2Y A;  2J4B A;  1DCQ A;  4N3C A;  4QFV A;  3CQG B;  2QC9 A;  3JUE A;  3P2B A;  3CHP A;  3TWR A;  5AAR A;  3PH0 C;  4I9C A;  2AXZ A;  3G2U A;  2F8X K;  3ASO E;  2F37 A;  4BX9 A;  2LNI A;  5ARF A;  2XZT G;  4UI9 K;  4GA0 A;  3E4B A;  3B7B A;  4PDX A;  3U4T A;  1IXV A;  3PEV B;  4YVQ C;  1IYG A;  4B89 A;  1HZ4 A;  2WMN A;  3HYM B;  3LDZ A;  2F8Y A;  2FBN A;  2XS1 A;  3B7T A;  3CVN A;  1MX6 A;  3BU8 A;  2WQ7 A;  2GW1 A;  4GZC A;  2JLB A;  4BY6 A;  5D2M C;  4E85 A;  3R9M A;  2WXQ A;  1H2U A;  4K5B A;  2LSV A;  5ENQ D;  2I1K A;  1S63 A;  2L0I A;  4BES A;  1JCR A;  1OCR E;  2IO2 C;  1D9S A;  1FVH A;  2JEK A;  3CKC A;  3S7D A;  4C0E A;  4RSY A;  1KZP A;  2VSO E;  3FH5 A;  3ESK A;  3DPY A;  3UPV A;  1TJF A;  4CDR A;  5A23 A;  3JYS A;  4EBA G;  5KWD A;  5M72 A;  2VJ8 A;  1ELR A;  2M63 A;  2CHX A;  1U2V G;  5D0O D;  2R03 A;  4A55 A;  1IQU A;  4FU3 A;  3PVL A;  3Q5M A;  4U95 D;  1UN8 A;  4IRU A;  3KEA A;  3T5X A;  3AG3 E;  1LD7 A;  4EZK A;  5T8I A;  3LPZ A;  1OXJ A;  1WM5 A;  4ZHB A;  2XPY A;  3S7B A;  2X6I A;  2I6H A;  3ZYL A;  4A63 B;  4JXT A;  2LO6 A;  4BTB A;  3I4G A;  1ELW A;  2OVF A;  4TXQ A;  3DSU A;  3AS4 A;  1O1S A;  3HXE A;  4GZD A;  2FO1 E;  4BEP A;  2XS8 A;  3ZW3 A;  1YYH A;  1MQS A;  2P9P G;  3FTX A;  4WUY A;  1FPP A;  2F0Y A;  3NQP A;  4PUC A;  4TUM A;  4N5Q A;  3BUA A;  2I9C A;  4C0M A;  4U8H A;  3CHQ A;  3Q15 A;  3ZHE A;  4IUL A;  3PDN A;  5IY5 E;  1JWG A;  1BU9 A;  3ZUV B;  4UQX A;  3FH8 A;  1INZ A;  4ABN A;  5JMN D;  3FUJ A;  4I6G A;  4EEC A;  3OTN A;  4WNG A;  3LY9 A;  5FZR A;  2VTB B;  4GZ3 A;  4AEZ C;  4A1G A;  3MX3 A;  3V31 A;  5E75 A;  2R2L A;  4KVO A;  2VGE A;  2WQ6 A;  5KBA A;  4EZJ A;  4YDW A;  3QWV A;  2IQC A;  3ZYQ A;  3HIZ A;  4YDE A;  3KD7 A;  3FEX A;  4LRZ A;  3FTY A;  1Z3Y A;  5JHB A;  3ZIM A;  3SBS A;  2BKK B;  3TWT A;  1UJK A;  3EHN A;  2BUG A;  4XE0 A;  2J07 A;  4GTP A;  2MRI A;  3BG1 B;  1TN8 A;  4HRL A;  2A5U A;  1TNY A;  3FUL A;  1FT2 A;  2DWZ A;  4CT4 A;  2V5F A;  2JAB A;  2WXN A;  3UT8 A;  2L6J A;  2KXP C;  4UUC A;  4BWR A;  1NZN A;  3FUI A;  3JQ0 A;  4IN3 B;  3SF4 A;  4MKT A;  3G2T A;  3I5P A;  4EZL A;  3ZXS A;  4LUN U;  4G2V A;  3FFL A;  4U63 A;  3T8K A;  4FHJ A;  3PZ3 A;  2P9S G;  3APC A;  3TWU A;  2FEZ A;  2HE0 A;  2FF4 A;  5ENN A;  3MGB A;  2GGF A;  4GB9 A;  3UIP C;  3Q9U C;  1VDY A;  4L9P A;  5CMY A;  3FUF A;  5ENP D;  3HVE A;  2J4D A;  4O1O A;  3B13 A;  3ZGQ A;  5FJY A;  3IHV A;  3SZ7 A;  3SI5 A;  1E8W A;  2J08 A;  4JC8 A;  4O60 A;  4B93 B;  2PM6 A;  4ILI A;  2RFA A;  4GPM A;  2VGY A;  1Z6T A;  1LD8 A;  4OVV A;  2Q7F A;  3MYV A;  4AY5 A;  4CGW A;  1EDU A;  3APF A;  5AIJ A;  4B0Z A;  4KMO A;  1SZ9 A;  4ATG A;  2HO1 A;  3ZN3 A;  3DEO A;  3U66 A;  1N4Q A;  3CR3 A;  2AXV A;  4ANW A;  3IBE A;  1U3C A;  3RRU A;  2RD0 A;  3VLF A;  4A1S A;  1LF8 A;  2WXI A;  2I1J A;  1EYH A;  1OY3 D;  4G26 A;  1NA0 A;  2FUL A;  2OCC E;  4FP7 A;  3K9I A;  1QQE A;  3JXJ A;  2XEV A;  4AY6 A;  2MOW A;  2OEW A;  4Q94 A;  4BFR A;  2H6G A;  2BED A;  3QC1 A;  3UQ3 A;  3DXK G;  4FHK A;  3DBS A;  2X38 A;  3PS6 A;  1OUV A;  3D9J A;  2NSZ A;  5AQ9 A;  4AVX A;  2BF0 X;  3OXL A;  3TG5 A;  1DVP A;  2ETC A;  3EUV A;  2ZGD A;  4PH4 B;  4DLQ A;  4EPZ A;  1H0A A;  3FUH A;  4PS8 A;  5LOZ A;  2DYR E;  4LCT A;  3U64 A;  3FUK A;  1OCC E;  2EQX A;  3NOC D;  3S7F A;  2OOE A;  5CEC B;  3PZ4 A;  3CVQ A;  5BV0 A;  1TYQ G;  1BI8 B;  3MJW A;  4Y6C A;  4HOQ A;  3RRM B;  4DX5 D;  3AG2 E;  4RLY A;  4CEM A;  3SBT B;  1PAQ A;  4H7Y A;  1N94 A;  4JA7 A;  1KT0 A;  1N9A A;  2OEV A;  3AS5 A;  4F6R D;  5AQ7 A;  4ACK A;  4U0Z A;  2P9I G;  2CG2 A;  4E6H A;  1H6P A;  3ONK A;  4ME2 A;  3ASH A;  3ZU7 B;  1H2V C;  3QK0 A;  3TG4 A;  4U0U A;  3MA5 A;  1U3D A;  2ETB A;  1WG0 A;  4ANX A;  2Y4U A;  4K5A B;  2XRZ A;  1QZ2 A;  3LJ3 A;  2KCK A;  3DSW A;  1OWP A;  2WXG A;  3CHM A;  3FUN A;  3ZEF A;  4GMR A;  4HOT A;  2GRN B;  3FHE A;  3MEK A;  5T4Y A;  2WQH A;  1QBQ A;  1BI7 B;  3ULQ A;  4GYO A;  2PL2 A;  1OWO A;  5AEN A;  4AIF A;  3GZS A;  2X3M A;  4GA2 A;  4HS2 A;  3DXM G;  3ONL A;  1TNZ A;  5H7P A;  4N3A A;  5DBK A;  3O48 A;  5CMW A;  5LFA A;  5T3R A;  4URK A;  4UWH A;  4ZFH A;  1N4S A;  1OWN A;  1NFI E;  3UM3 A;  3UX4 A;  3UUX A;  2VQ2 A;  1HE8 A;  5ANL A;  3ZPJ A;  1D8E A;  2C0L A;  1OT8 A;  1TJC A;  4I2W A;  4OAV B;  3UXG A;  4DX1 A;  1H2T C;  2XQ0 A;  2QYU A;  1GW6 A;  3C3Q A;  4J8S A;  5BXO A;  2P2C P;  3JUI A;  1TNO A;  3LS8 A;  3MV3 B;  3C72 A;  5B3S E;  5FQ8 A;  4C9B B;  3IV0 A;  1E7V A;  2P9U G;  4EBA A;  3FTU A;  3KSL A;  5AYW D;  5J90 A;  4ANV A;  3DST A;  2YQ8 A;  2BKG A;  2R17 C;  3AG4 E;  4A3V A;  3CEQ A;  2V8S E;  2I2O A;  1MX2 A;  3NAW A;  3UM2 A;  4LEU A;  2R5S A;  3I3N A;  2HR2 A;  3CVU A;  2ION A;  4LNB A;  3SD5 A;  3LEW A;  1Y8M A;  4K0R A;  5HI7 A;  2IF4 A;  5FQ6 A;  5EKQ D;  1SW6 A;  3QAR A;  2WMO A;  2DYS E;  2IEJ A;  3CVL A;  4I1O B;  3TGO A;  3Q9N C;  3FUM A;  3HHM A;  3DEP A;  2IY0 C;  2CHZ A;  3LY8 A;  3PNL B;  1DNP A;  3CVX A;  3FDH A;  2J9Q A;  1KLX A;  3PRE A;  2PQR A;  4DX2 A;  5FTP A;  2V5Q C;  4BX8 A;  3C3R A;  5CRV A;  3RRN B;  4I6E A;  3DWL G;  3EDT B;  1TEZ A;  1K1A A;  3CV0 A;  2UY1 A;  4XKB A;  3UKU G;  2EIK E;  5ITZ F;  3TWV A;  2EIL E;  1HF8 A;  2CG3 A;  3RO3 A;  1H6K A;  2VGX B;  3D9O A;  4G11 A;  1E7U A;  4LER A;  3KEZ A;  1K1B A;  2QZA A;  3AG1 E;  3T8M A;  3FP3 A;  3MV2 B;  3L13 A;  1IHG A;  2KBX A;  3UIN C;  3ASN E;  3ZKJ A;  5CHE E;  3NZU A;  3FTZ A;  2NXP A;  4J8E A;  1K8K G;  3AAA C;  5E76 A;  3ML9 A;  2GRM A;  3SFX A;  1OCZ E;  1HH8 A;  3QB2 A;  4GA1 A;  4HOU A;  3ZYM A;  3D9N A;  1SA4 A;  3SQV A;  2XEN A;  4JHR A;  2ZGG A;  4JVS A;  1N0Q A;  4NRH B;  3HG0 D;  2WXR A;  5G2N A;  3ASF A;  3U9W A;  5KJL A;  3NF1 A;  1G3N B;  1FCH A;  3L82 A;  4HI9 A;  1Y6I A;  5CCM A;  5ENS D;  4GCO A;  3LY7 A;  1HX8 A;  3ZHE B;  1TNU A;  3FU5 A;  5FQ7 A;  3ULY A;  5AQB A;  4I6J A;  3OAW A;  4G8L A;  2A5E A;  4XIF A;  2E2E A;  4BT8 A;  4RG9 A;  2IOS A;  4U0S A;  1PY1 A;  3ZVV A;  3MKQ B;  4CDN A;  5LP0 A;  4QQI A;  2ILR A;  2WPV A;  2WXO A;  1HG2 A;  2XCC A;  1OCO E;  1NL4 A;  3UI2 A;  1TNB A;  4BSZ B;  1HG5 A;  5KNG A;  2YIN A;  1N4R A;  4HOS A;  1HS6 A;  4PS7 A;  3OXG A;  2LXL A;  4JW1 A;  3I4R B;  2XGO A;  2FO7 A;  3HRA A;  5AJD A;  4AOF A;  5LX8 A;  4GU5 A;  3RO2 A;  4HI8 A;  3TAX A;  3ZFW A;  1BD8 A;  3ISM C;  4FLH A;  1XGW A;  3SHF A;  4I1A A;  3JXI A;  2NYJ A;  3TL5 A;  2X6F A;  3NZS A;  3UIO C;  4UI9 J;  1Z5S C;  2IO3 C;  1ELK A;  4LNG A;  3F6Q A;  1X81 A;  2VSN A;  3SY2 A;  4I43 A;  3E30 A;  3G2W A;  5J08 A;  4LNU D;  4KYO B;  4CT0 A;  5AAO A;  1NI1 A;  4AXH A;  3IEG A;  3QNK A;  2P9L G;  2KC7 A;  4KBQ A;  3ZRH A;  5LCW C;  3Q79 A;  4J8D A;  2XZD G;  5CRU A;  4GML A;  4J0U A;  5DIZ A;  1TN6 A;  4F7A A;  3RIB A;  5G55 A;  4GTO A;  3FU6 A;  3E33 A;  1B89 A;  3HDX A;  5JHA A;  4N5C A;  3AS8 A;  1PC2 A;  4J8Y A;  2GRR B;  3CKB A;  5CER B;  4ATZ D;  3CSF A;  1BPO A;  4C48 B;  4G8K A;  2WXK A;  3FY4 A;  4UQY A;  3QDN A;  4U07 A;  3VTY A;  2KAT A;  1RW2 A;  2V4L A;  5B1A E;  1KT1 A;  3E32 A;  1UOH A;  1JUQ A;  3ML8 A;  3CK8 A;  2R02 A;  3QKY A;  1V55 E;  4IYP A;  4JPS A;  4G25 A;  4D10 C;  4KVM A;  4TUU A;  4DPR A;  3FTV A;  4RVB A;  4U04 A;  4FLB A;  2VSY A;  4NQ0 A;  4M7C A;  3FUD A;  5BXU A;  3Q78 A;  3UT4 A;  4HB5 A;  1O1T A;  4WAF A;  4K03 A;  3N71 A;  2AW6 A;  2EIN E;  4WNE A;  5HKP A;  2J49 A;  1JCS A;  4DX6 D;  3EHR A;  3UT7 A;  3QAQ A;  5C1D A;  2WXF A;  1JCQ A;  2LXM A;  2XGS A;  3PZ1 A;  1E96 B;  3L08 A;  4TXP A;  3FH7 A;  4JHK A;  4GAA A;  1WY6 A;  3B7U X;  4XZ4 A;  1HO8 A;  3URZ A;  2YHE A;  4YVO A;  1TN7 A;  4KXK B;  4CYM D;  5JJT A;  4HVB A;  4HRN A;  1Z3X A;  2MYO A;  3IXE A;  2QYJ A;  3VLD A;  3AU4 A;  2ZXW E;  2DZN A;  1S70 B;  3EIQ C;  2LAI A;  5JJ6 A;  2KZT A;  4FJZ A;  1MYO A;  1WAO 1;  4Z68 A;  1MHQ A;  1N11 A;  1ZB1 A;  1E8X A;  2Y1L E;  3NBN B;  1IKN D;  1NP7 A;  4BET A;  4G23 A;  4CRW A;  4M3O A;  3PE3 A;  3FUE A;  1H19 A;  5AJL A;  2XPI A;  5CEA A;  1AWC B;  3LKU A;  3CVY A;  2R59 A;  3V2X A;  5BUZ A;  4Y6W A;  3L22 A;  2WXM A;  2MHK A;  1XNF A;  3Q4A B;  2IJG X;  5CBO A;  3FTS A;  2DCP A;  5KJM A;  5G05 C;  2L0T B;  2P9N G;  4BER A;  4ILG A;  4F53 A;  3C5R A;  3TJP A;  4TV3 A;  2GRO B;  2XPZ A;  5KCM A;  3B7S A;  3RU0 A;  4DUI A;  5CCL A;  1N95 A;  5AN8 A;  4H7X A;  2VSX E;  5EX0 A;  2J8S D;  1A5E A;  4ILH B;  3LVR E;  4YDY A;  2Y4T A;  3CK7 A;  4GZ6 A;  4WWO A;  3D9M A;  3TXN A;  4UWG A;  2FI7 A;  1WDY A;  2IU1 A;  3CVP A;  2P9K G;  2V4H C;  1OWL A;  2PNN A;  3FEY A;  2ZU6 B;  1O1R A;  3JCK C;  2E0I A;  3DPD A;  3LYA A;  2H6H A;  3RK6 A;  3HXD A;  2DIW A;  3UMV A;  4GTS A;  4Q69 A;  3BG0 B;  4ACL A;  3HVE B;  4GMJ A;  4APF A;  1JPL A;  1HU3 A;  3RJV A;  3Q49 B;  3T5V A;  1KZO A;  3BQO A;  4HLL A;  4YDO A;  4GTV A;  4UWK A;  2RKK A;  2ZIR A;  3WXX A;  3CST A;  2DZO A;  2KZT B;  3MCX A;  4F1S A;  3EHM A;  3GYZ A;  4KZC A;  4HFG A;  1YCS B;  3CLJ A;  3QOU A;  2X6K A;  4JD2 G;  3D3M A;  4B94 A;  5G04 J;  1ZU2 A;  4BTA A;  5D0Q D;  4XI0 A;  3B95 A; 
#chains in the Genus database with same CATH homology
 1SZ9 A;  2VGX A;  3S7J A;  2XHE A;  2PM7 A;  4L1B A;  4ATG A;  3R9A B;  3L16 A;  5KJK A;  2HO1 A;  4L23 A;  5BV1 A;  1HH8 A;  2AXU A;  3QB2 A;  4GA1 A;  4HOU A;  5ARG A;  3ZYM A;  5A6C A;  3D9N A;  3ZN3 A;  3U66 A;  1SQM A;  3CR3 A;  2AXV A;  4ANW A;  3IBE A;  1U3C A;  3RRU A;  3GW4 A;  2RD0 A;  4JHR A;  2DBA A;  4B8A A;  4JVS A;  3VLF A;  1QNF A;  4A1S A;  2AVP A;  1LF8 A;  2WXI A;  4NRH B;  2I1J A;  1EYH A;  4FC8 A;  4KT6 B;  2VTB A;  4G26 A;  2CFU A;  1A17 A;  3IKO B;  3PRZ A;  3PZD A;  4FUL A;  1NA0 A;  2FUL A;  2WXR A;  4DI3 A;  5G2N A;  3ASF A;  4I17 A;  3U9W A;  5KJL A;  4FP7 A;  3K9I A;  5BPP A;  3NF1 A;  1QQE A;  1UG3 A;  4R7L A;  1FCH A;  2XEV A;  3D9P A;  4AY6 A;  1N52 A;  2MOW A;  4Q94 A;  4XKC A;  3G2V A;  4BFR A;  3MKQ A;  4WNF A;  3C98 A;  3GZ1 A;  3PE4 A;  4A3T A;  4DJA A;  2QFC A;  3QC1 A;  2GRL A;  5LCW J;  4JL0 A;  3R7Q A;  2WM9 A;  3L17 A;  4AJW A;  3CHS A;  4F3V A;  3UQ3 A;  1Y6I A;  5CCM A;  4GCO A;  3LY7 A;  1JWF A;  1HX8 A;  4FHK A;  3ZHE B;  4MLP A;  3DBS A;  4FJY A;  3CVW A;  2J09 A;  3FU5 A;  2UWJ G;  5FQ7 A;  3R7R A;  1EPU A;  3KS2 A;  4I6J A;  2X38 A;  1ZBP A;  3OAW A;  4WWN A;  2NC9 A;  3PS6 A;  2RG8 A;  1E8Y A;  4XIF A;  3VLE A;  2E2E A;  2WXL A;  1OUV A;  3D9J A;  2NSZ A;  2X6H A;  4BT8 A;  3SFZ A;  4AVX A;  4L7T A;  3CQC B;  4RG9 A;  2BF0 X;  2IOS A;  4NAC A;  1FVF A;  4U0S A;  1PY1 A;  3ZVV A;  4AM9 A;  4JA9 A;  3U3W A;  2OV8 A;  3MKQ B;  3OXL A;  4CDN A;  3TG5 A;  4UWL A;  1DVP A;  1N54 A;  5LP0 A;  5BNW A;  4I1M A;  2ILR A;  4RG6 A;  2WPV A;  5FWQ A;  2WXO A;  1HG2 A;  2XCC A;  4PH4 B;  4O6F A;  4DLQ A;  2XCB A;  1E8Z A;  1W3B A;  3FTW A;  4EPZ A;  3B7R L;  1H0A A;  3FUH A;  2HYZ A;  4PS8 A;  1HG5 A;  2YIN A;  5LOZ A;  4HOS A;  1HS6 A;  1S0P A;  4PS7 A;  4PS3 A;  4LCT A;  3U64 A;  3FUK A;  2YNQ A;  2EQX A;  3ESL A;  3S7F A;  4DLO A;  2OOE A;  1YA0 A;  3OXG A;  4DK5 A;  3L54 A;  4XI9 A;  3MZL B;  4JW1 A;  2WXJ A;  3I4R B;  3CVQ A;  2XGO A;  1SZA A;  5BV0 A;  2FO7 A;  4L2Y A;  2J4B A;  4N3C A;  5AJD A;  4QFV A;  4AOF A;  3SNX A;  3MJW A;  5LX8 A;  4Y6C A;  4HOQ A;  3CQG B;  3RRM B;  3P2B A;  3CHP A;  4GU5 A;  3PH0 C;  4I9C A;  3RO2 A;  2AXZ A;  3TAX A;  3ZFW A;  3G2U A;  4GPK A;  4FLH A;  4BX9 A;  1XGW A;  2LNI A;  4V3I A;  4CEM A;  2OND A;  5ARF A;  3SHF A;  4I1A A;  4AP2 A;  4W9R A;  2BTD A;  4UI9 K;  4GA0 A;  5FQ4 A;  2VYI A;  3SBT B;  2IOL A;  3E4B A;  1PAQ A;  4PDX A;  3TL5 A;  3SGH A;  3U4T A;  5FZS A;  4B8C B;  2X6F A;  4H7Y A;  2LSU A;  3PEV B;  3NZS A;  4XI0 A;  4UI9 J;  4JZY A;  4YVQ C;  1ELK A;  4JA7 A;  3CHR A;  1KT0 A;  1IYG A;  4B89 A;  1HZ4 A;  2WMN A;  3AS5 A;  2VSN A;  3HYM B;  4I2Z A;  3LDZ A;  4FA6 A;  2FBN A;  3B7T A;  3CVN A;  4I43 A;  5M72 A;  4ACK A;  3JQ1 A;  3G2W A;  5J08 A;  3EJN A;  4KYO B;  2YHC A;  4CT0 A;  2WQ7 A;  2GW1 A;  4U0Z A;  4AXH A;  1NA3 A;  3IEG A;  3QWP A;  3QNK A;  4GZC A;  2CG2 A;  2JLB A;  4BY6 A;  2KC7 A;  4KBQ A;  3ZRH A;  5LCW C;  4CDM A;  3ASG A;  4J8D A;  4AV7 A;  4E85 A;  4GML A;  4E6H A;  4J0U A;  5DIZ A;  2WXQ A;  4F7A A;  2WB2 A;  3RIB A;  5G55 A;  1H2U A;  3ONK A;  5ANR A;  5EDS A;  4ME2 A;  3FU6 A;  3ASH A;  4JHJ A;  1H2V C;  1B89 A;  3HDX A;  2LSV A;  5JHA A;  2I1K A;  3EIJ A;  3QK0 A;  4N5C A;  3LXU X;  3TG4 A;  5HQ8 A;  3AS8 A;  1PC2 A;  4U0U A;  3MA5 A;  2L0I A;  4P29 A;  3CKB A;  2UY1 B;  3CSF A;  1BPO A;  1U3D A;  2WXK A;  3FY4 A;  4UQY A;  3QDN A;  4U07 A;  4BT9 A;  4ANX A;  2Y4U A;  1FVH A;  2C0M A;  2JEK A;  2KAT A;  3CKC A;  1HFA A;  3VTY A;  2V4L A;  3S7D A;  2XRZ A;  1QZ2 A;  4N3B A;  3LJ3 A;  4TRQ A;  4C0E A;  2KCK A;  4RSY A;  4FAD A;  3CVV A;  1OWP A;  2VSO E;  1KT1 A;  2WXG A;  3ESK A;  3FH5 A;  4XX5 A;  2V0P A;  3CHM A;  3FUN A;  1JUQ A;  2KCV A;  3UPV A;  3ML8 A;  1TJF A;  3CK8 A;  3ZEF A;  4CDR A;  5A23 A;  2X6J A;  3QKY A;  3JYS A;  4HOT A;  4IYP A;  4JPS A;  4EBA G;  4G25 A;  4D10 C;  4KVM A;  2Y3A A;  3FHE A;  3MEK A;  4TUU A;  2WQH A;  3Q47 B;  3FTV A;  4RVB A;  2VJ8 A;  4U04 A;  1ELR A;  2VSY A;  4FLB A;  4J6I A;  4NQ0 A;  5T4Y A;  4HLE A;  2M63 A;  3FUD A;  5G04 C;  3UT4 A;  3GZ2 A;  2CHX A;  3ULQ A;  5D0O D;  4WAF A;  4A55 A;  2LAH A;  3IHY A;  4K03 A;  4GYO A;  4DPR A;  2IFU A;  2PL2 A;  3N71 A;  1IQU A;  4FU3 A;  3PVL A;  3Q5M A;  1OWO A;  1UN8 A;  2AW6 A;  5AEN A;  4WNE A;  3QJZ A;  4AIF A;  4IRU A;  3GZS A;  2X3M A;  4GA2 A;  2J49 A;  4HS2 A;  3T5X A;  3QWW A;  5FZQ A;  4N2Q A;  3UT7 A;  3ONL A;  4EZK A;  3QAQ A;  5T8I A;  5C1D A;  3LPZ A;  4N3A A;  5DBK A;  3VTX A;  3O48 A;  5CMW A;  2WXF A;  3FWV A;  5LFA A;  3MKR A;  1WM5 A;  5T3R A;  4URK A;  2XPY A;  3P1U A;  2XGS A;  4UWH A;  1E96 B;  1OWN A;  2HM8 A;  3L08 A;  3BEE A;  3S7B A;  2X6I A;  3FH7 A;  4JHK A;  2I6H A;  4GAA A;  3ZYL A;  3UX4 A;  1WY6 A;  3UUX A;  4JXT A;  2VQ2 A;  3B7U X;  1HE8 A;  4XZ4 A;  1HO8 A;  3URZ A;  3OXF A;  2LO6 A;  4BTB A;  2OVB A;  2YHE A;  3D9K A;  3I4G A;  4HXI A;  4YVO A;  5ANL A;  1ELW A;  2OVF A;  4KXK B;  3ZPJ A;  2XGM A;  2C0L A;  5JJT A;  4HVB A;  1TJC A;  2XRY A;  3ASD A;  4I2W A;  1Z3X A;  3VLD A;  3AS4 A;  3AU4 A;  1H2T C;  4GZD A;  2XQ0 A;  2LAI A;  3EIQ C;  3PEU B;  5JJ6 A;  1GW6 A;  2KZT A;  4FJZ A;  4J8S A;  1WAO 1;  3PUK A;  4NUR A;  1MHQ A;  4KZ0 A;  4CCA A;  4I9E A;  3JUI A;  4UWF A;  3CK9 A;  3ZW3 A;  1MQS A;  3LS8 A;  1E8X A;  3FTX A;  3MV3 B;  1NP7 A;  2WXP A;  4WUY A;  3PNT B;  4G23 A;  4CRW A;  2P58 C;  3NQP A;  4M3O A;  4PUC A;  5FQ8 A;  4C9B B;  2CHW A;  3APD A;  2I9C A;  3IV0 A;  1E7V A;  3PE3 A;  3FUE A;  4C0M A;  1H19 A;  5AJL A;  4U8H A;  2XPI A;  3LKU A;  1UJJ A;  3CHQ A;  3Q15 A;  3CVY A;  4B0Z A;  3D9I A;  3ZHE A;  2R59 A;  4EBA A;  3FTU A;  4IUL A;  3PDN A;  5BUZ A;  4Y6W A;  5AYW D;  5J90 A;  3L22 A;  2WXM A;  1JWG A;  2MHK A;  1E90 A;  1XNF A;  3RKV A;  4GZ5 A;  3ZYK A;  3Q4A B;  2IJG X;  4UQX A;  4ANV A;  2PZI A;  1OWM A;  3FH8 A;  4WWP A;  4DI4 A;  1INZ A;  4MS6 A;  3FTS A;  4ABN A;  2YQ8 A;  4BSX A;  1P5Q A;  2DCP A;  4EQF A;  5KJM A;  5G05 C;  2L0T B;  3FUJ A;  4I6G A;  4G1T A;  4EEC A;  3OTN A;  4WNG A;  3LY9 A;  5FZR A;  2R17 C;  4ILG A;  2VTB B;  4GZ3 A;  4AEZ C;  4A1G A;  3MX3 A;  4F53 A;  4JEH A;  3TJP A;  4A3V A;  4TV3 A;  5E75 A;  4MRU A;  2XPZ A;  5KCM A;  3CEQ A;  2V8S E;  3B7S A;  5JJ7 A;  2I2O A;  4KVO A;  3RU0 A;  5CCL A;  3S2A A;  4LEU A;  2R5S A;  2WQ6 A;  1IQR A;  4H7X A;  2CFZ A;  2VSX E;  4EZJ A;  5EX0 A;  3QWV A;  2IQC A;  3I3N A;  2HR2 A;  3ZYQ A;  3CVU A;  3HIZ A;  1L5J A;  2ION A;  4ILH B;  5A7D B;  3LVR E;  3SD5 A;  3KD7 A;  3LEW A;  2KCL A;  2A4Z A;  3FEX A;  4LRZ A;  5G05 J;  5FT9 A;  1Y8M A;  3FTY A;  4K0R A;  3CIA A;  5HI7 A;  2IF4 A;  2Y4T A;  5FQ6 A;  1Z3Y A;  3CK7 A;  3SBS A;  3KAE A;  3ZIM A;  5JHB A;  4GZ6 A;  1UJK A;  3EHN A;  3QAR A;  2BUG A;  2WMO A;  4UQZ A;  4UI9 C;  4WWO A;  5EKQ D;  4APO A;  3L6A A;  4GYY A;  4WND A;  4XE0 A;  3D9M A;  3TXN A;  4UWG A;  4OVU A;  3CVL A;  4I1O B;  2FI7 A;  2J07 A;  2IU1 A;  3LCA A;  2MRI A;  3TGO A;  3BG1 B;  4GCN A;  3TXM A;  3CVP A;  4J8F A;  4CGV A;  3CHO A;  4YND A;  2A5U A;  2PQN A;  1HXI A;  3CGH A;  4Q96 A;  3FUM A;  1OWL A;  3FUL A;  3PUJ A;  3HHM A;  2V5F A;  4CT4 A;  2WXN A;  2CHZ A;  3FU0 A;  3LY8 A;  3PNL B;  1DNP A;  3O4Z A;  3FEY A;  2C2L A;  2L6J A;  2ZU6 B;  3UT8 A;  3CVX A;  3FDH A;  4BWR A;  2J9Q A;  1KLX A;  3PRE A;  2PQR A;  1NZN A;  3FUI A;  3JQ0 A;  2QY7 A;  3AU5 A;  4IN3 B;  4MKT A;  3G2T A;  3I5P A;  4OYS A;  3JCK C;  3SF4 A;  4LUN U;  4G2V A;  2E0I A;  3FFL A;  3ZXS A;  4U63 A;  4EZL A;  2AWI A;  3DPD A;  3LYA A;  1UW4 B;  4FHJ A;  5FTP A;  5EX3 A;  3RK6 A;  4GYW A;  4HOR A;  3APC A;  4N2S A;  4BX8 A;  2FEZ A;  4G24 A;  2FF4 A;  2DIW A;  5BT1 A;  5ENN A;  3RRN B;  3UMV A;  3MGB A;  4I6E A;  2GGF A;  3D9L A;  4GB9 A;  3EDT B;  1TEZ A;  2WVI A;  4Q69 A;  2L9B A;  1VDY A;  3CV0 A;  5CMY A;  2UY1 A;  3BG0 B;  3FUF A;  3LVQ E;  4XKB A;  4ACL A;  3HVE B;  4GMJ A;  4APF A;  1JPL A;  3HVE A;  1HU3 A;  3RJV A;  2J4D A;  2KM4 A;  1HF8 A;  2CG3 A;  3B13 A;  3Q49 B;  3ZGQ A;  3T5V A;  5FJY A;  4L2L A;  3RO3 A;  1UN9 A;  3IHV A;  3G2S A;  1EF1 C;  5BW8 C;  3SZ7 A;  5KJN A;  1H6K A;  2VGX B;  3SI5 A;  4UWK A;  3D9O A;  3WXX A;  1E8W A;  4G11 A;  2J08 A;  3CST A;  1E7U A;  4LER A;  3KEZ A;  2WXH A;  3ENE A;  4JC8 A;  2KZT B;  3MCX A;  3T8M A;  3EHM A;  3FP3 A;  3GYZ A;  3MV2 B;  4KZC A;  3L13 A;  4F1S A;  3FU3 A;  1IHG A;  4HFG A;  2PM6 A;  5C2Y A;  4ANU A;  4JEU A;  3CLJ A;  4ILI A;  1X5B A;  2X6K A;  2VGY A;  1Z6T A;  3QOU A;  5CHE E;  3NZU A;  3D3M A;  4B94 A;  4OVV A;  3FTZ A;  5G04 J;  2NXP A;  4J8E A;  2Q7F A;  1ZU2 A;  3MYV A;  4AY5 A;  4BTA A;  1EDU A;  4CGW A;  3APF A;  5AIJ A;  5D0Q D;  5E76 A;  4N39 A;  3ML9 A;  2GRM A;  4KMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...