3TWVA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human numa1 (chimeric peptide)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
molecule keywords Tankyrase-2
total genus 50
structure length 155
sequence length 155
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twvA00
2DZOA 1TR4A 3ZUVB 2L6BA 5AARA 2RFAA 1MJ0A 4K5BA 1BU9A 1N0QA 2KXPC 4J8YA 4CYMD 3IXEA 3Q9NC 5CERB 4DUIA 2BKKB 3T9KA 2XZTG 5AN8A 2RFMA 5CEDB 3JXIA 2Y0BG 3V31A 5EYPF 1QYMA 3ZNGA 4HRNA 5BXUA 4G8LA 5EN5D 1MX6A 2QC9A 2XENA 5HKPA 1UOHA 2V5QC 4BETA 4O1OA 5AAOA 3D9HA 4O60A 5KNGA 4DX7D 2VGEA 3V2XA 1DC2A 1YMPA 2A5EA 2KBXA 4HRMB 4UUCA 5JA4D 5ENPD 2ETAA 3LJNA 4BSZB 3EHRA 1IXVA 1DCQA 3TWXA 2PNNA 1WG0A 1D9SA 5CBNA 4ZFHA 5FINA 3B95A 5KNHD 5HRYA 1WDYA 1OY3D 2DVWA 4RLYA 3DEPA 5EIDA 2FO1E 3JUEA 1K3ZD 4HNAD 4CZ2D 3F6QA 4ATZD 4HB5A 4NIKA 3ZU7B 4BERA 2ZGGA 3J5QB 5D66A 4OAUC 4BESA 5JMND 3NOGD 1SW6A 4HBDA 4QFVA 3TWQA 2JABA 5ENTD 5AQBA 1OT8A 3EU9A 4F1PA 4J7WA 5AQ7A 1IKND 3V30A 3AJIA 3V79K 4JB8P 2DZNA 4DX1A 4K5CA 4N5QA 3JXJA 5KBAA 4LNUD 2F8YA 2XZDG 3TWWA 3TWVA 5EIBE 4Z68A 3UXGA 3NBNB 3EHQA 2HE0A 4LG6A 5ITZF 3DEOA 2AJAA 4TUMA 3W9FA 4K5AB 2P2CP 4B93B 3W9GA 1BI8B 2ETBA 2XEEA 3Q9UC 5AQ9A 3SO8A 1BD8A 5CECB 1YCSB 4O1PA 1BLXB 5ENQD 3TWTA 2Y1LE 1SVXA 3V2OA 1N11A 3TWSA 4YDYA 5AQAA 4ZHBA 4HQDA 5CBOA 1BI7B 3AAAC 2V4HC 4YDWA 3J5PA 1K1AA 3NOCD 3ZKJA 4OAVB 1N0RA 5ENOD 5EYLA 3UTMA 1G3NB 4U8VD 4BEPA 2ETCA 2B0OE 3KEAA 4U96D 4A63B 4DRXE 1AWCB 1MX2A 2ZGDA 5EILA 5ENSD 2QYJA 4LSZE 5HS0A 4DX6D 1NFIE 4DX5D 3HG0D 5ENRD 4C48B 2J8SD 3T8KA 1MX4A 3UI2A 2F37A 4U95D 2NYJA 4HI9A 1IHBA 1MYOA 1K1BA 2XEHA 4QQIA 4DX2A 1YYHA 2BKGA 1A5EA 2DWZA 3HRAA 4GPMA 4HI8A 3TWUA 5CEAA 4GMRA 5FIOA 3TWRA 3C5RA 4F6RD 3B7BA 5KWDA 5BXOA 1AP7A 4U8YD 4G8KA 1S70B 4HLLA 2MYOA 4HRLA 2F8XK
chains in the Genus database with same CATH superfamily
1E8YA 4DUIA 2XZTG 2XPZA 1KPSB 3FP3A 3ZNGA 3B7SA 1E7UA 2QC9A 4BETA 4G11A 3SZ7A 2C0LA 1HG5A 4TUUA 3FHEA 5JA4D 1OCOE 4I9EA 1IXVA 4MS6A 3CVWA 1D9SA 4HOSA 1HG2A 1WDYA 2FO1E 2F0YA 3ZVVA 1Z3XA 5AQ7A 1O1TA 5KCMA 3CHMA 5D0QD 2DZNA 4XE0A 2OCCE 4RVBA 2XZDG 3AG4E 4Q96A 1TNYA 4GZ6A 1KZOA 4B93B 3ZPJA 3Q9UC 3T5XA 1U3CA 4CGWA 4A1GA 4N2QA 2XEVA 3HXCA 1FT2A 1MZCA 3QC1A 2EIJE 3AAAC 3DRAA 2UY1B 4JEHA 4EZJA 5AENA 2WMNA 3PZ2A 5JJ6A 4WAFA 3D9OA 3RK6A 3FFLA 2IFUA 1V54E 2DWZA 3PEUB 3D9KA 3I3NA 3CVYA 3MV3B 5G04C 3Q75A 2RFAA 3Q9NC 1ZU2A 4FA6A 4HLEA 2RFMA 5AIJA 1SA5A 1TNBA 1JPLA 3JUIA 1MX6A 3MEKA 3PRZA 3KSLA 3ML9A 4U0UA 3LJNA 4GA1A 3IHVA 1Q2ZA 3FTXA 3S7FA 3FTSA 3Q49B 2GRQB 4HS2A 4UI9J 3HHMA 4F1PA 3DSXA 4JA9A 4WNGA 4N5QA 1LTXA 3U3WA 3NBNB 2FBNA 3AG1E 2BUGA 4CRWA 1HXIA 3DEOA 2FULA 3SBTB 1YCSB 3ML8A 3NQPA 3LYAA 3LDZA 2CG3A 2V5FA 4FP7A 4OAVB 3L54A 2YHCA 3CHRA 4BT8A 4LSZE 1Y8MA 2DBAA 2MOWA 3B7RL 1S63A 2P9KG 4HI9A 4NURA 3KEZA 1E8WA 2IOLA 4X8QA 4XKCA 5CRUA 2J4BA 3RO3A 2J9QA 3DXKG 1IYGA 3DPYA 5AARA 3FEYA 2GROB 2A5UA 1K8KG 2P9IG 4ANXA 3UM1A 4HXIA 4JC8A 4U8HA 3AG2E 5A7DB 4FHJA 3QB2A 3RO2A 3NZSA 3CVUA 2KBXA 4HRMB 2ETAA 3NAWA 3APCA 4GCOA 3RU0A 4Y6WA 4ZFHA 1HS6A 3MGBA 2XQ0A 4ILIA 1N4QA 3DEPA 1E96B 2BF0X 4BERA 3MZLB 3GZSA 3D9JA 3ULEG 4PS7A 3I5PA 3FUHA 4LNBA 3FH8A 5LCWC 3ASNE 5KJKA 4GTRA 4IULA 3FUJA 2BTDA 3EHNA 3LJ3A 4JD2G 3W9FA 2Y69E 4K5AB 3FU5A 4GYYA 2HR2A 1BI8B 2H6IA 3SO8A 4F1SA 5D2MC 3ENEA 4DX6D 5A6CA 2R59A 4UI9C 5DIZA 1L5JA 3PZDA 2OEWA 2I2OA 2I1KA 4TV3A 1UG3A 2V0PA 4KXKB 4L7TA 1H2VC 4CDRA 4ILGA 2F8XK 4DPRA 4AXHA 5H7PA 5ANLA 4GTVA 2J4DA 3UIPC 5LFAA 5FQ6A 4TXPA 3ASGA 5EYPF 1QYMA 3DBSA 3QK0A 1UJJA 2HYZA 3LVQE 5ENNA 1HX8A 4XZ4A 4JW1A 4R7LA 5B1AE 4EQFA 5EDSA 1ELWA 3PUJA 5CHEE 4L23A 2EIME 4JXTA 2QFCA 4RLYA 1K3ZD 2J49A 1OXJA 5ARGA 3ABME 2XPIA 4I1MA 4OAUC 4V3IA 2JABA 3EUVA 5ANRA 1FT1A 4GTQA 4KT6B 4FU3A 1QBQA 2WMOA 1E7VA 4TXRA 1Z5SC 4K0RA 2I1JA 3JYSA 2KZTA 3I4GA 2IJGX 2XEEA 3R7RA 1VDYA 3SNXA 5ENQD 4TRQA 3V2OA 1UJKA 1H6KA 1H0AA 2PQRA 4U8VD 4D10C 1OWOA 1AWCB 1Z6TA 2Y4UA 4LRZA 5FQ8A 5LOZA 2VGXB 4I6EA 2HM8A 3AS4A 3UT4A 4GPMA 5KWDA 3SFZA 3UPVA 3CSTA 4XIFA 1MJ0A 3FU3A 1N4PA 2XGOA 2KXPC 4A1SA 3Q79A 4G23A 3FH7A 2RKKA 1HZ4A 4DX7D 3N71A 4UUCA 2LAIA 3GW4A 4LUNU 5FZSA 3Q47B 1KT1A 1FCHA 2R02A 3LY9A 5G05J 3FH5A 2L6JA 4YDEA 4HNAD 5BPPA 3HXFA 4WNDA 3CHOA 3KAEA 1H19A 3T5VA 4AM9A 4BSXA 1QZ2A 2KCLA 4I9CA 4ABNA 2FO7A 2IONA 3E30A 2E0IA 3FUMA 2X3MA 4DK5A 1W3BA 2XHEA 1HF8A 4KBQA 1BD8A 5BV1A 4AOFA 3FUNA 4FLBA 3CR3A 5T3RA 4HOQA 5CBOA 4Y6CA 1LF8A 3PEVB 4GCNA 1D8DA 2WXLA 4LCTA 1MX2A 4N3AA 4DX5D 3U66A 3HG0D 3DSVA 3ZYLA 2ZIRA 3RSEG 3SQVA 5CEAA 4JPSA 3P2BA 4RG9A 3VLEA 2FEZA 4J8DA 4G8KA 2XCCA 4BTAA 3SGHA 4K5BA 4ANVA 2DYRE 5G05C 2PM7A 2BKKB 3HIZA 1FVFA 2WXPA 5CRVA 2Q7FA 3ESLA 3RKVA 1DCQA 3HYMB 3ASDA 2CHZA 3BQOA 4GYWA 2WM9A 5EIDA 3ASFA 4U0ZA 4AVXA 4XX5A 4AP2A 3NB2A 1SQMA 2LNIA 3S7JA 3OXGA 5AJLA 4IRUA 2WVIA 3IHYA 3UMVA 4LG6A 5ITZF 3SBSA 3E33A 1OCCE 1SVXA 2GRRB 4ACKA 3TWSA 4WNEA 4PH4B 3FUEA 5JHAA 4HOUA 3ZKJA 1HO8A 1N52A 4GPKA 2ZGDA 4U04A 2GRMA 2R5SA 4Q94A 4BT9A 2F37A 2B6CA 3LS8A 3U9WA 1A5EA 3ONKA 2V4LA 3P1UA 3TWRA 3L82A 3QDNA 3FTVA 3MA5A 3ZN3A 5E75A 3ZUVB 4MBGA 4CYMD 3IXEA 5AYWD 3RAUA 2P9SG 4NRHB 3QOUA 5CCMA 3BEEA 2KM4A 4U07A 1TNZA 5E76A 5HKPA 2YQ8A 4PUCA 4O1OA 5AAOA 3G2TA 1P5QA 1UN9A 2LXMA 1NL4A 4UQXA 2VJ8A 4G24A 1OY3D 1TYQG 1EF1C 4WUYA 3QWVA 3T8MA 2J07A 5D66A 4GZ5A 5ENTD 3LY7A 1TNOA 4O6FA 3V79K 4K5CA 4L1BA 3PNTB 2WQ7A 5FJYA 5KBAA 2WQHA 1QNFA 5J08A 4UWFA 4FLHA 4GMLA 1TJCA 4GU5A 2PM6A 1H2TC 3UINC 4XI0A 1A17A 3D9NA 4YDYA 2Y4TA 3J5PA 4F3VA 2B0OE 5IY5E 4EHMA 3G2WA 2GGFA 3GYZA 2WPVA 3PE4A 5HI7A 1K1BA 4NQ0A 3PZ3A 2XS8A 3BG1B 4I2ZA 1GW6A 4W9RA 1SZ9A 5CECB 3KS2A 2OOEA 4J8YA 5CCLA 3TAXA 2XGMA 3QWPA 2RG8A 3IV0A 3FTYA 4JZYA 2V5QC 1HU3A 2A5EA 2H6GA 1WG0A 1JWFA 2CHWA 4GA2A 3TG5A 3B95A 5KNHD 5HRYA 3CQGB 2UWJG 4B8CB 1BPOA 3WG7E 4FADA 3MV2B 3O4ZA 2LUHA 2ZISA 4BESA 3NOGD 3E37A 4EECA 2X6FA 3UUXA 1N4RA 4GZCA 1U3DA 4LNUD 3D9LA 2ZXWE 2QY7A 2KZTB 3S7DA 5KJMA 4J8FA 3ESKA 5AQAA 1JUQA 3L08A 2PQNA 4YDWA 3PZ1A 4BEPA 4DRXE 1O5MA 4KZCA 1NFIE 2J8SD 3UKUG 1MX4A 1RZ4A 4KMOA 4G2VA 2KC7A 4J8SA 3VTXA 5G55A 2MHKA 4U63A 1E8ZA 3TGOA 3RJVA 4TXQA 3FTZA 1H6PA 3ZYKA 2ILRA 2P9PG 3UM3A 2VGYA 2WXMA 1N0QA 3NZUA 1H2UA 2PZIA 3V31A 3ASOE 5JJTA 3R9MA 2P9NG 3MYVA 2XRYA 3FTWA 3AS8A 4APFA 5BW8C 2R03A 3ZHEB 5T4YA 3CEQA 2WXQA 3CVLA 1X5BA 3CK7A 3MKQA 2VSXE 3IKOB 1IKND 3MCXA 2NXPA 4MLPA 5LCWJ 2CHXA 1TN7A 3EHQA 2EILE 3HDXA 2P2CP 5AQ9A 3CV0A 2X6IA 4HORA 4AV7A 2LAHA 3R7QA 2Y1LE 1N11A 3FUKA 4F53A 2V4HC 3OAWA 5T8IA 1N0RA 3UTMA 5BV0A 2X38A 3U4TA 2YNQA 2GRPB 2WXRA 3ZXPA 1OWLA 2LXLA 3MJWA 2VTBA 2NYJA 1N54A 3HRAA 3DSSA 3MX3A 3QNKA 3CVNA 3HXBA 1AP7A 4HLLA 3BU8A 3LVRE 4H7XA 3KD7A 4ANWA 3I4RB 1BU9A 4ATGA 1NI1A 3APDA 4YDOA 3VLDA 4K03A 3JXIA 3CIAA 4C0EA 4G25A 4BTBA 2EQXA 4A3TA 4BX9A 1E90A 3CKBA 1TN8A 3OTNA 5KNGA 1ELRA 1XGWA 4BSZB 3VTYA 1FVHA 4I17A 1XNFA 2CFZA 3AU5A 4GMJA 4N5CA 4U0SA 3L16A 3SI5A 3B7UX 3SFYA 4MRUA 3JQ0A 3ZRHA 2E2EA 2IO2C 3PUKA 1NP7A 2OVFA 1ZBPA 2V8SE 4HBDA 4B89A 1OT8A 3QARA 3V30A 1U2VG 4CT4A 3QKYA 2IO3C 2X6KA 3ZW3A 4JHRA 3URZA 3DSUA 3AG3E 2ETBA 5FTPA 1OUVA 3DSWA 4APOA 3FTUA 4P29A 4ZHBA 2IQCA 4LNGA 1UN8A 3IBEA 5ENOD 2ETCA 3OXFA 2QYJA 2UY1A 3UI2A 4U95D 2CG2A 4UQZA 1OWNA 3ASHA 4UWLA 3C3OA 2P9UG 3C5RA 4F6RD 2H6FA 3LY8A 3ULYA 4BFRA 4CEMA 5CERB 1N9AA 4PS8A 3T9KA 3L9TA 4YVQC 2J08A 4GZDA 3V2XA 3L17A 4ACLA 3QWWA 3EHRA 4H7YA 5CBNA 2QYUA 3BG0B 3JCKC 1IHGA 2DVWA 4JL0A 5M72A 2WB2A 3F6QA 2R17C 1RW2A 4N3CA 4LEUA 5JMND 3L13A 5AQBA 2GW1A 2WXFA 3CK9A 4RSYA 3PVLA 3MKQB 4DX1A 4FJYA 4N2SA 3D9MA 4Z68A 2VSNA 2QZAA 1KT0A 2RD0A 2VTBB 3VLFA 4WWOA 2GRNB 3Q4AB 2DCPA 1OWPA 3AU4A 2EINE 5EYLA 3KEAA 4GZ3A 1NZNA 3KSQA 5ENRD 1HFAA 2J09A 1YYHA 3EHMA 3LCAA 3TL5A 3PREA 1PY1A 5G04J 1S70B 1NA0A 2YINA 3CK8A 4N3BA 4DLQA 5KJLA 3C3QA 3APFA 3G2UA 1HH8A 1TN6A 3ISMC 1DCEA 4I1AA 4G1TA 1V55E 2A4ZA 5CEDB 1WAO1 2R05A 1LD8A 4C0MA 3G2VA 3K9IA 4HRNA 1UOHA 3HVEB 5J90A 2CFUA 3ZYQA 5BUZA 1OWMA 4EBAG 4CT0A 3Q5MA 3B13A 3SD5A 5C1DA 3FWVA 3D9PA 4UWKA 4CGVA 4N39A 4CZ2D 4I43A 5KJNA 3CGHA 4HB5A 3UM2A 3R9AB 3J5QB 4WWPA 4CDMA 3CVPA 3TWQA 3DXMG 3EU9A 4UI9K 3LXUX 2NSZA 3ZXSA 3CVQA 2YHEA 3JXJA 3WXXA 4JVSA 2R2LA 2MRIA 2VSOE 2ZU6B 4LERA 1OCZE 1B89A 5B1BE 4TUMA 2AWIA 5FWQA 4EPZA 2JEKA 4YNDA 1DVPA 3FEXA 3CHQA 1BLXB 1S64A 2XPYA 3Q15A 4GTMA 4HQDA 1BI7B 4AY5A 4WNFA 5D0OD 5ENSD 3LPZA 1EPUA 4OVUA 2AXUA 2XEHA 4CCAA 4AY6A 3C98A 3TJPA 2IEJA 3EU5A 3C72A 5B3SE 4HRLA 3CQCB 2ONDA 2DZOA 4JA7A 3NF1A 4URKA 3PZ4A 2H6HA 3DSTA 2LSUA 2IOSA 4RQIA 4BWRA 3CKCA 4GTPA 3FY4A 4RG6A 3S2AA 5BXUA 3QAQA 5EN5D 1INZA 2WXNA 4AJWA 3FUIA 3C3RA 2NC9A 3D9IA 4O60A 5CMYA 4XEIG 3GZ2A 1PC2A 1UW4B 3ZIMA 1MQSA 3FUFA 3UT7A 3OXLA 4OVVA 4GTSA 4I2WA 4A3VA 4NIKA 4WWNA 2ZGGA 1ELKA 2LO6A 4E85A 4UQYA 5DBKA 2C2LA 3Q7AA 1O1SA 1Y6IA 3TWWA 3GZ1A 5EIBE 1PAQA 4KZ0A 3PE3A 2VGXA 2X6JA 5LP0A 2AJAA 4KVOA 4BY6A 3E4BA 3LEWA 4UWHA 4OYSA 2WXHA 5EX3A 4U96D 2VSYA 3CVXA 4A63B 4XI9A 2L9BA 4XKBA 4DJAA 3RRUA 3AS5A 4J6IA 3ZFWA 3UX4A 5FQ7A 4DI3A 3FUDA 3HVEA 4DLOA 5JHBA 1TR4A 4E6HA 4I6JA 4I6GA 3TXNA 1H6OA 1X81A 1MHQA 3RRMB 2KCKA 4AEZC 4I1OB 3UKRG 3LKUA 3L6AA 1IQRA 1Z3YA 4JHKA 4J0UA 3O48A 4A55A 5FQ4A 3D9HA 2XS1A 2BEDA 4JHJA 4B0ZA 3TWXA 5AJDA 2XGSA 4GYOA 5FINA 5JJ7A 3ONLA 2FF4A 3QJZA 3HXDA 1SZAA 3ULQA 3CSFA 4Q69A 2WXKA 4QFVA 1DNPA 3SFXA 4B8AA 3FU0A 5FT9A 4IYPA 3DWLG 5EX0A 5G2NA 5EKQD 2F8YA 3ZGQA 3UXGA 3UM0A 2WXGA 3UIOC 2KATA 3RIBA 3W9GA 4EBAA 3Q73A 3Q78A 2XCBA 3TWTA 4YVOA 2GRLA 3PH0C 2I6HA 4HOTA 3CVVA 4B94A 4JEUA 1K1AA 1HE8A 1G3NB 3FU6A 4FHKA 2WQ6A 4GTOA 5HS0A 4C48B 1E8XA 3T8KA 4EZKA 3ABLE 4FC8A 4L9PA 1IQUA 4HFGA 3SY2A 4GMRA 5FIOA 2VYIA 1YA0A 2WXIA 3SF4A 4ANUA 5BXOA 4U8YD 5BT1A 2C0MA 5A23A 2L0TB 4U7EB 5FZQA 4G26A 4ME2A 3D3MA 2LSVA 5AN8A 2IU1A 3Q7FA 4C9BB 1EYHA 1N94A 2VQ2A 3TG4A 4G8LA 3RRNB 3ZYMA 1ZB1A 1YMPA 4MKTA 2PNNA 1S0PA 2IY0C 1SA4A 2XRZA 3BUAA 1JCSA 2AXVA 3CHSA 2AVPA 1TNUA 2OEVA 1JWGA 3PDNA 2WXOA 3TXMA 1NA3A 4GAAA 5LX8A 3G2SA 2I9CA 4BX8A 3IEGA 4JB8P 3TWVA 3L22A 2AXZA 4M7CA 4DI4A 3U64A 2HE0A 1WY6A 4FJZA 3JQ1A 3EIJA 1EDUA 3EDTB 3CLJA 2Y3AA 3FDHA 4CDNA 1KLXA 2KCVA 2P9LG 5FZRA 1TJFA 2M63A 1OCRE 1WM5A 4L2YA 1MYOA 1JCRA 3B7TA 3TWUA 4HI8A 4ILHB 3B7BA 5HQ8A 4GB9A 3ZEFA 2FI7A 2L0IA 2MYOA 2L6BA 2DYSE 3PNLB 3ZHEA 2HO1A 4PS3A 2Y0BG 3PS6A 2XENA 4IN3B 2VGEA 1DC2A 5ARFA 5ENPD 4AIFA 1JCQA 3UQ3A 4M3OA 4FULA 3JUEA 3S7BA 4ATZD 2JLBA 3X2QE 3FULA 3ZU7B 2X6HA 3E32A 1O1RA 1SW6A 3SHFA 4L2LA 4KVMA 5C2YA 1QQEA 3MKRA 4J7WA 4GA0A 3AJIA 4J8EA 3CHPA 1D8EA 4KYOB 3E34A 2EIKE 1N4SA 3ABKE 2OVBA 4GTTA 4EZLA 4F7AA 2P58C 5CMWA 3EIQC 4O1PA 5BNWA 1LD7A 2WXJA 1FPPA 3NOCD 3DPDA 4HVBA 2IF4A 4PDXA 2OV8A 5EILA 2DIWA 4UWGA 3UT8A 1TEZA 3HXEA 1IHBA 4DX2A 4QQIA 1KZPA 2BKGA 2AW6A 1N95A 3EJNA 4NACA 2PL2A
chains in the Genus database with same CATH topology
2DZOA 1TR4A 3ZUVB 2L6BA 5AARA 2RFAA 1MJ0A 4K5BA 1BU9A 1N0QA 2KXPC 4J8YA 4CYMD 3IXEA 3Q9NC 5CERB 4DUIA 2BKKB 3T9KA 2XZTG 5AN8A 2RFMA 5CEDB 3JXIA 2Y0BG 3V31A 5EYPF 1QYMA 3ZNGA 4HRNA 5BXUA 4G8LA 5EN5D 1MX6A 2QC9A 2XENA 5HKPA 1UOHA 2V5QC 4BETA 4O1OA 5AAOA 3D9HA 4O60A 5KNGA 4DX7D 2VGEA 3V2XA 1DC2A 1YMPA 2A5EA 2KBXA 4HRMB 4UUCA 5JA4D 5ENPD 2ETAA 3LJNA 4BSZB 3EHRA 1IXVA 1DCQA 3TWXA 2PNNA 1WG0A 1D9SA 5CBNA 4ZFHA 5FINA 3B95A 5KNHD 5HRYA 1WDYA 1OY3D 2DVWA 4RLYA 3DEPA 5EIDA 2FO1E 3JUEA 1K3ZD 4HNAD 4CZ2D 3F6QA 4ATZD 4HB5A 4NIKA 3ZU7B 4BERA 2ZGGA 3J5QB 5D66A 4OAUC 4BESA 5JMND 3NOGD 1SW6A 4HBDA 4QFVA 3TWQA 2JABA 5ENTD 5AQBA 1OT8A 3EU9A 4F1PA 4J7WA 5AQ7A 1IKND 3V30A 3AJIA 3V79K 4JB8P 2DZNA 4DX1A 4K5CA 4N5QA 3JXJA 5KBAA 4LNUD 2F8YA 2XZDG 3TWWA 3TWVA 5EIBE 4Z68A 3UXGA 3NBNB 3EHQA 2HE0A 4LG6A 5ITZF 3DEOA 2AJAA 4TUMA 3W9FA 4K5AB 2P2CP 4B93B 3W9GA 1BI8B 2ETBA 2XEEA 3Q9UC 5AQ9A 3SO8A 1BD8A 5CECB 1YCSB 4O1PA 1BLXB 5ENQD 3TWTA 2Y1LE 1SVXA 3V2OA 1N11A 3TWSA 4YDYA 5AQAA 4ZHBA 4HQDA 5CBOA 1BI7B 3AAAC 2V4HC 4YDWA 3J5PA 1K1AA 3NOCD 3ZKJA 4OAVB 1N0RA 5ENOD 5EYLA 3UTMA 1G3NB 4U8VD 4BEPA 2ETCA 2B0OE 3KEAA 4U96D 4A63B 4DRXE 1AWCB 1MX2A 2ZGDA 5EILA 5ENSD 2QYJA 4LSZE 5HS0A 4DX6D 1NFIE 4DX5D 3HG0D 5ENRD 4C48B 2J8SD 3T8KA 1MX4A 3UI2A 2F37A 4U95D 2NYJA 4HI9A 1IHBA 1MYOA 1K1BA 2XEHA 4QQIA 4DX2A 1YYHA 2BKGA 1A5EA 2DWZA 3HRAA 4GPMA 4HI8A 3TWUA 5CEAA 4GMRA 5FIOA 3TWRA 3C5RA 4F6RD 3B7BA 5KWDA 5BXOA 1AP7A 4U8YD 4G8KA 1S70B 4HLLA 2MYOA 4HRLA 2F8XK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZO A;  1TR4 A;  3ZUV B;  2L6B A;  5AAR A;  2RFA A;  1MJ0 A;  4K5B A;  1BU9 A;  1N0Q A;  2KXP C;  4J8Y A;  4CYM D;  3IXE A;  3Q9N C;  5CER B;  4DUI A;  2BKK B;  3T9K A;  2XZT G;  5AN8 A;  2RFM A;  5CED B;  3JXI A;  2Y0B G;  3V31 A;  5EYP F;  1QYM A;  3ZNG A;  4HRN A;  5BXU A;  4G8L A;  5EN5 D;  1MX6 A;  2QC9 A;  2XEN A;  5HKP A;  1UOH A;  2V5Q C;  4BET A;  4O1O A;  5AAO A;  3D9H A;  4O60 A;  5KNG A;  4DX7 D;  2VGE A;  3V2X A;  1DC2 A;  1YMP A;  2A5E A;  2KBX A;  4HRM B;  4UUC A;  5JA4 D;  5ENP D;  2ETA A;  3LJN A;  4BSZ B;  3EHR A;  1IXV A;  1DCQ A;  3TWX A;  2PNN A;  1WG0 A;  1D9S A;  5CBN A;  4ZFH A;  5FIN A;  3B95 A;  5KNH D;  5HRY A;  1WDY A;  1OY3 D;  2DVW A;  4RLY A;  3DEP A;  5EID A;  2FO1 E;  3JUE A;  1K3Z D;  4HNA D;  4CZ2 D;  3F6Q A;  4ATZ D;  4HB5 A;  4NIK A;  3ZU7 B;  4BER A;  2ZGG A;  3J5Q B;  5D66 A;  4OAU C;  4BES A;  5JMN D;  3NOG D;  1SW6 A;  4HBD A;  4QFV A;  3TWQ A;  2JAB A;  5ENT D;  5AQB A;  1OT8 A;  3EU9 A;  4F1P A;  4J7W A;  5AQ7 A;  1IKN D;  3V30 A;  3AJI A;  3V79 K;  4JB8 P;  2DZN A;  4DX1 A;  4K5C A;  4N5Q A;  3JXJ A;  5KBA A;  4LNU D;  2F8Y A;  2XZD G;  3TWW A;  3TWV A;  5EIB E;  4Z68 A;  3UXG A;  3NBN B;  3EHQ A;  2HE0 A;  4LG6 A;  5ITZ F;  3DEO A;  2AJA A;  4TUM A;  3W9F A;  4K5A B;  2P2C P;  4B93 B;  3W9G A;  1BI8 B;  2ETB A;  2XEE A;  3Q9U C;  5AQ9 A;  3SO8 A;  1BD8 A;  5CEC B;  1YCS B;  4O1P A;  1BLX B;  5ENQ D;  3TWT A;  2Y1L E;  1SVX A;  3V2O A;  1N11 A;  3TWS A;  4YDY A;  5AQA A;  4ZHB A;  4HQD A;  5CBO A;  1BI7 B;  3AAA C;  2V4H C;  4YDW A;  3J5P A;  1K1A A;  3NOC D;  3ZKJ A;  4OAV B;  1N0R A;  5ENO D;  5EYL A;  3UTM A;  1G3N B;  4U8V D;  4BEP A;  2ETC A;  2B0O E;  3KEA A;  4U96 D;  4A63 B;  4DRX E;  1AWC B;  1MX2 A;  2ZGD A;  5EIL A;  5ENS D;  2QYJ A;  4LSZ E;  5HS0 A;  4DX6 D;  1NFI E;  4DX5 D;  3HG0 D;  5ENR D;  4C48 B;  2J8S D;  3T8K A;  1MX4 A;  3UI2 A;  2F37 A;  4U95 D;  2NYJ A;  4HI9 A;  1IHB A;  1MYO A;  1K1B A;  2XEH A;  4QQI A;  4DX2 A;  1YYH A;  2BKG A;  1A5E A;  2DWZ A;  3HRA A;  4GPM A;  4HI8 A;  3TWU A;  5CEA A;  4GMR A;  5FIO A;  3TWR A;  3C5R A;  4F6R D;  3B7B A;  5KWD A;  5BXO A;  1AP7 A;  4U8Y D;  4G8K A;  1S70 B;  4HLL A;  2MYO A;  4HRL A;  2F8X K; 
#chains in the Genus database with same CATH topology
 1E8Y A;  4DUI A;  2XZT G;  2XPZ A;  1KPS B;  3FP3 A;  3ZNG A;  3B7S A;  1E7U A;  2QC9 A;  4BET A;  4G11 A;  3SZ7 A;  2C0L A;  1HG5 A;  4TUU A;  3FHE A;  5JA4 D;  1OCO E;  4I9E A;  1IXV A;  4MS6 A;  3CVW A;  1D9S A;  4HOS A;  1HG2 A;  1WDY A;  2FO1 E;  2F0Y A;  3ZVV A;  1Z3X A;  5AQ7 A;  1O1T A;  5KCM A;  3CHM A;  5D0Q D;  2DZN A;  4XE0 A;  2OCC E;  4RVB A;  2XZD G;  3AG4 E;  4Q96 A;  1TNY A;  4GZ6 A;  1KZO A;  4B93 B;  3ZPJ A;  3Q9U C;  3T5X A;  1U3C A;  4CGW A;  4A1G A;  4N2Q A;  2XEV A;  3HXC A;  1FT2 A;  1MZC A;  3QC1 A;  2EIJ E;  3AAA C;  3DRA A;  2UY1 B;  4JEH A;  4EZJ A;  5AEN A;  2WMN A;  3PZ2 A;  5JJ6 A;  4WAF A;  3D9O A;  3RK6 A;  3FFL A;  2IFU A;  1V54 E;  2DWZ A;  3PEU B;  3D9K A;  3I3N A;  3CVY A;  3MV3 B;  5G04 C;  3Q75 A;  2RFA A;  3Q9N C;  1ZU2 A;  4FA6 A;  4HLE A;  2RFM A;  5AIJ A;  1SA5 A;  1TNB A;  1JPL A;  3JUI A;  1MX6 A;  3MEK A;  3PRZ A;  3KSL A;  3ML9 A;  4U0U A;  3LJN A;  4GA1 A;  3IHV A;  1Q2Z A;  3FTX A;  3S7F A;  3FTS A;  3Q49 B;  2GRQ B;  4HS2 A;  4UI9 J;  3HHM A;  4F1P A;  3DSX A;  4JA9 A;  4WNG A;  4N5Q A;  1LTX A;  3U3W A;  3NBN B;  2FBN A;  3AG1 E;  2BUG A;  4CRW A;  1HXI A;  3DEO A;  2FUL A;  3SBT B;  1YCS B;  3ML8 A;  3NQP A;  3LYA A;  3LDZ A;  2CG3 A;  2V5F A;  4FP7 A;  4OAV B;  3L54 A;  2YHC A;  3CHR A;  4BT8 A;  4LSZ E;  1Y8M A;  2DBA A;  2MOW A;  3B7R L;  1S63 A;  2P9K G;  4HI9 A;  4NUR A;  3KEZ A;  1E8W A;  2IOL A;  4X8Q A;  4XKC A;  5CRU A;  2J4B A;  3RO3 A;  2J9Q A;  3DXK G;  1IYG A;  3DPY A;  5AAR A;  3FEY A;  2GRO B;  2A5U A;  1K8K G;  2P9I G;  4ANX A;  3UM1 A;  4HXI A;  4JC8 A;  4U8H A;  3AG2 E;  5A7D B;  4FHJ A;  3QB2 A;  3RO2 A;  3NZS A;  3CVU A;  2KBX A;  4HRM B;  2ETA A;  3NAW A;  3APC A;  4GCO A;  3RU0 A;  4Y6W A;  4ZFH A;  1HS6 A;  3MGB A;  2XQ0 A;  4ILI A;  1N4Q A;  3DEP A;  1E96 B;  2BF0 X;  4BER A;  3MZL B;  3GZS A;  3D9J A;  3ULE G;  4PS7 A;  3I5P A;  3FUH A;  4LNB A;  3FH8 A;  5LCW C;  3ASN E;  5KJK A;  4GTR A;  4IUL A;  3FUJ A;  2BTD A;  3EHN A;  3LJ3 A;  4JD2 G;  3W9F A;  2Y69 E;  4K5A B;  3FU5 A;  4GYY A;  2HR2 A;  1BI8 B;  2H6I A;  3SO8 A;  4F1S A;  5D2M C;  3ENE A;  4DX6 D;  5A6C A;  2R59 A;  4UI9 C;  5DIZ A;  1L5J A;  3PZD A;  2OEW A;  2I2O A;  2I1K A;  4TV3 A;  1UG3 A;  2V0P A;  4KXK B;  4L7T A;  1H2V C;  4CDR A;  4ILG A;  2F8X K;  4DPR A;  4AXH A;  5H7P A;  5ANL A;  4GTV A;  2J4D A;  3UIP C;  5LFA A;  5FQ6 A;  4TXP A;  3ASG A;  5EYP F;  1QYM A;  3DBS A;  3QK0 A;  1UJJ A;  2HYZ A;  3LVQ E;  5ENN A;  1HX8 A;  4XZ4 A;  4JW1 A;  4R7L A;  5B1A E;  4EQF A;  5EDS A;  1ELW A;  3PUJ A;  5CHE E;  4L23 A;  2EIM E;  4JXT A;  2QFC A;  4RLY A;  1K3Z D;  2J49 A;  1OXJ A;  5ARG A;  3ABM E;  2XPI A;  4I1M A;  4OAU C;  4V3I A;  2JAB A;  3EUV A;  5ANR A;  1FT1 A;  4GTQ A;  4KT6 B;  4FU3 A;  1QBQ A;  2WMO A;  1E7V A;  4TXR A;  1Z5S C;  4K0R A;  2I1J A;  3JYS A;  2KZT A;  3I4G A;  2IJG X;  2XEE A;  3R7R A;  1VDY A;  3SNX A;  5ENQ D;  4TRQ A;  3V2O A;  1UJK A;  1H6K A;  1H0A A;  2PQR A;  4U8V D;  4D10 C;  1OWO A;  1AWC B;  1Z6T A;  2Y4U A;  4LRZ A;  5FQ8 A;  5LOZ A;  2VGX B;  4I6E A;  2HM8 A;  3AS4 A;  3UT4 A;  4GPM A;  5KWD A;  3SFZ A;  3UPV A;  3CST A;  4XIF A;  1MJ0 A;  3FU3 A;  1N4P A;  2XGO A;  2KXP C;  4A1S A;  3Q79 A;  4G23 A;  3FH7 A;  2RKK A;  1HZ4 A;  4DX7 D;  3N71 A;  4UUC A;  2LAI A;  3GW4 A;  4LUN U;  5FZS A;  3Q47 B;  1KT1 A;  1FCH A;  2R02 A;  3LY9 A;  5G05 J;  3FH5 A;  2L6J A;  4YDE A;  4HNA D;  5BPP A;  3HXF A;  4WND A;  3CHO A;  3KAE A;  1H19 A;  3T5V A;  4AM9 A;  4BSX A;  1QZ2 A;  2KCL A;  4I9C A;  4ABN A;  2FO7 A;  2ION A;  3E30 A;  2E0I A;  3FUM A;  2X3M A;  4DK5 A;  1W3B A;  2XHE A;  1HF8 A;  4KBQ A;  1BD8 A;  5BV1 A;  4AOF A;  3FUN A;  4FLB A;  3CR3 A;  5T3R A;  4HOQ A;  5CBO A;  4Y6C A;  1LF8 A;  3PEV B;  4GCN A;  1D8D A;  2WXL A;  4LCT A;  1MX2 A;  4N3A A;  4DX5 D;  3U66 A;  3HG0 D;  3DSV A;  3ZYL A;  2ZIR A;  3RSE G;  3SQV A;  5CEA A;  4JPS A;  3P2B A;  4RG9 A;  3VLE A;  2FEZ A;  4J8D A;  4G8K A;  2XCC A;  4BTA A;  3SGH A;  4K5B A;  4ANV A;  2DYR E;  5G05 C;  2PM7 A;  2BKK B;  3HIZ A;  1FVF A;  2WXP A;  5CRV A;  2Q7F A;  3ESL A;  3RKV A;  1DCQ A;  3HYM B;  3ASD A;  2CHZ A;  3BQO A;  4GYW A;  2WM9 A;  5EID A;  3ASF A;  4U0Z A;  4AVX A;  4XX5 A;  4AP2 A;  3NB2 A;  1SQM A;  2LNI A;  3S7J A;  3OXG A;  5AJL A;  4IRU A;  2WVI A;  3IHY A;  3UMV A;  4LG6 A;  5ITZ F;  3SBS A;  3E33 A;  1OCC E;  1SVX A;  2GRR B;  4ACK A;  3TWS A;  4WNE A;  4PH4 B;  3FUE A;  5JHA A;  4HOU A;  3ZKJ A;  1HO8 A;  1N52 A;  4GPK A;  2ZGD A;  4U04 A;  2GRM A;  2R5S A;  4Q94 A;  4BT9 A;  2F37 A;  2B6C A;  3LS8 A;  3U9W A;  1A5E A;  3ONK A;  2V4L A;  3P1U A;  3TWR A;  3L82 A;  3QDN A;  3FTV A;  3MA5 A;  3ZN3 A;  5E75 A;  3ZUV B;  4MBG A;  4CYM D;  3IXE A;  5AYW D;  3RAU A;  2P9S G;  4NRH B;  3QOU A;  5CCM A;  3BEE A;  2KM4 A;  4U07 A;  1TNZ A;  5E76 A;  5HKP A;  2YQ8 A;  4PUC A;  4O1O A;  5AAO A;  3G2T A;  1P5Q A;  1UN9 A;  2LXM A;  1NL4 A;  4UQX A;  2VJ8 A;  4G24 A;  1OY3 D;  1TYQ G;  1EF1 C;  4WUY A;  3QWV A;  3T8M A;  2J07 A;  5D66 A;  4GZ5 A;  5ENT D;  3LY7 A;  1TNO A;  4O6F A;  3V79 K;  4K5C A;  4L1B A;  3PNT B;  2WQ7 A;  5FJY A;  5KBA A;  2WQH A;  1QNF A;  5J08 A;  4UWF A;  4FLH A;  4GML A;  1TJC A;  4GU5 A;  2PM6 A;  1H2T C;  3UIN C;  4XI0 A;  1A17 A;  3D9N A;  4YDY A;  2Y4T A;  3J5P A;  4F3V A;  2B0O E;  5IY5 E;  4EHM A;  3G2W A;  2GGF A;  3GYZ A;  2WPV A;  3PE4 A;  5HI7 A;  1K1B A;  4NQ0 A;  3PZ3 A;  2XS8 A;  3BG1 B;  4I2Z A;  1GW6 A;  4W9R A;  1SZ9 A;  5CEC B;  3KS2 A;  2OOE A;  4J8Y A;  5CCL A;  3TAX A;  2XGM A;  3QWP A;  2RG8 A;  3IV0 A;  3FTY A;  4JZY A;  2V5Q C;  1HU3 A;  2A5E A;  2H6G A;  1WG0 A;  1JWF A;  2CHW A;  4GA2 A;  3TG5 A;  3B95 A;  5KNH D;  5HRY A;  3CQG B;  2UWJ G;  4B8C B;  1BPO A;  3WG7 E;  4FAD A;  3MV2 B;  3O4Z A;  2LUH A;  2ZIS A;  4BES A;  3NOG D;  3E37 A;  4EEC A;  2X6F A;  3UUX A;  1N4R A;  4GZC A;  1U3D A;  4LNU D;  3D9L A;  2ZXW E;  2QY7 A;  2KZT B;  3S7D A;  5KJM A;  4J8F A;  3ESK A;  5AQA A;  1JUQ A;  3L08 A;  2PQN A;  4YDW A;  3PZ1 A;  4BEP A;  4DRX E;  1O5M A;  4KZC A;  1NFI E;  2J8S D;  3UKU G;  1MX4 A;  1RZ4 A;  4KMO A;  4G2V A;  2KC7 A;  4J8S A;  3VTX A;  5G55 A;  2MHK A;  4U63 A;  1E8Z A;  3TGO A;  3RJV A;  4TXQ A;  3FTZ A;  1H6P A;  3ZYK A;  2ILR A;  2P9P G;  3UM3 A;  2VGY A;  2WXM A;  1N0Q A;  3NZU A;  1H2U A;  2PZI A;  3V31 A;  3ASO E;  5JJT A;  3R9M A;  2P9N G;  3MYV A;  2XRY A;  3FTW A;  3AS8 A;  4APF A;  5BW8 C;  2R03 A;  3ZHE B;  5T4Y A;  3CEQ A;  2WXQ A;  3CVL A;  1X5B A;  3CK7 A;  3MKQ A;  2VSX E;  3IKO B;  1IKN D;  3MCX A;  2NXP A;  4MLP A;  5LCW J;  2CHX A;  1TN7 A;  3EHQ A;  2EIL E;  3HDX A;  2P2C P;  5AQ9 A;  3CV0 A;  2X6I A;  4HOR A;  4AV7 A;  2LAH A;  3R7Q A;  2Y1L E;  1N11 A;  3FUK A;  4F53 A;  2V4H C;  3OAW A;  5T8I A;  1N0R A;  3UTM A;  5BV0 A;  2X38 A;  3U4T A;  2YNQ A;  2GRP B;  2WXR A;  3ZXP A;  1OWL A;  2LXL A;  3MJW A;  2VTB A;  2NYJ A;  1N54 A;  3HRA A;  3DSS A;  3MX3 A;  3QNK A;  3CVN A;  3HXB A;  1AP7 A;  4HLL A;  3BU8 A;  3LVR E;  4H7X A;  3KD7 A;  4ANW A;  3I4R B;  1BU9 A;  4ATG A;  1NI1 A;  3APD A;  4YDO A;  3VLD A;  4K03 A;  3JXI A;  3CIA A;  4C0E A;  4G25 A;  4BTB A;  2EQX A;  4A3T A;  4BX9 A;  1E90 A;  3CKB A;  1TN8 A;  3OTN A;  5KNG A;  1ELR A;  1XGW A;  4BSZ B;  3VTY A;  1FVH A;  4I17 A;  1XNF A;  2CFZ A;  3AU5 A;  4GMJ A;  4N5C A;  4U0S A;  3L16 A;  3SI5 A;  3B7U X;  3SFY A;  4MRU A;  3JQ0 A;  3ZRH A;  2E2E A;  2IO2 C;  3PUK A;  1NP7 A;  2OVF A;  1ZBP A;  2V8S E;  4HBD A;  4B89 A;  1OT8 A;  3QAR A;  3V30 A;  1U2V G;  4CT4 A;  3QKY A;  2IO3 C;  2X6K A;  3ZW3 A;  4JHR A;  3URZ A;  3DSU A;  3AG3 E;  2ETB A;  5FTP A;  1OUV A;  3DSW A;  4APO A;  3FTU A;  4P29 A;  4ZHB A;  2IQC A;  4LNG A;  1UN8 A;  3IBE A;  5ENO D;  2ETC A;  3OXF A;  2QYJ A;  2UY1 A;  3UI2 A;  4U95 D;  2CG2 A;  4UQZ A;  1OWN A;  3ASH A;  4UWL A;  3C3O A;  2P9U G;  3C5R A;  4F6R D;  2H6F A;  3LY8 A;  3ULY A;  4BFR A;  4CEM A;  5CER B;  1N9A A;  4PS8 A;  3T9K A;  3L9T A;  4YVQ C;  2J08 A;  4GZD A;  3V2X A;  3L17 A;  4ACL A;  3QWW A;  3EHR A;  4H7Y A;  5CBN A;  2QYU A;  3BG0 B;  3JCK C;  1IHG A;  2DVW A;  4JL0 A;  5M72 A;  2WB2 A;  3F6Q A;  2R17 C;  1RW2 A;  4N3C A;  4LEU A;  5JMN D;  3L13 A;  5AQB A;  2GW1 A;  2WXF A;  3CK9 A;  4RSY A;  3PVL A;  3MKQ B;  4DX1 A;  4FJY A;  4N2S A;  3D9M A;  4Z68 A;  2VSN A;  2QZA A;  1KT0 A;  2RD0 A;  2VTB B;  3VLF A;  4WWO A;  2GRN B;  3Q4A B;  2DCP A;  1OWP A;  3AU4 A;  2EIN E;  5EYL A;  3KEA A;  4GZ3 A;  1NZN A;  3KSQ A;  5ENR D;  1HFA A;  2J09 A;  1YYH A;  3EHM A;  3LCA A;  3TL5 A;  3PRE A;  1PY1 A;  5G04 J;  1S70 B;  1NA0 A;  2YIN A;  3CK8 A;  4N3B A;  4DLQ A;  5KJL A;  3C3Q A;  3APF A;  3G2U A;  1HH8 A;  1TN6 A;  3ISM C;  1DCE A;  4I1A A;  4G1T A;  1V55 E;  2A4Z A;  5CED B;  1WAO 1;  2R05 A;  1LD8 A;  4C0M A;  3G2V A;  3K9I A;  4HRN A;  1UOH A;  3HVE B;  5J90 A;  2CFU A;  3ZYQ A;  5BUZ A;  1OWM A;  4EBA G;  4CT0 A;  3Q5M A;  3B13 A;  3SD5 A;  5C1D A;  3FWV A;  3D9P A;  4UWK A;  4CGV A;  4N39 A;  4CZ2 D;  4I43 A;  5KJN A;  3CGH A;  4HB5 A;  3UM2 A;  3R9A B;  3J5Q B;  4WWP A;  4CDM A;  3CVP A;  3TWQ A;  3DXM G;  3EU9 A;  4UI9 K;  3LXU X;  2NSZ A;  3ZXS A;  3CVQ A;  2YHE A;  3JXJ A;  3WXX A;  4JVS A;  2R2L A;  2MRI A;  2VSO E;  2ZU6 B;  4LER A;  1OCZ E;  1B89 A;  5B1B E;  4TUM A;  2AWI A;  5FWQ A;  4EPZ A;  2JEK A;  4YND A;  1DVP A;  3FEX A;  3CHQ A;  1BLX B;  1S64 A;  2XPY A;  3Q15 A;  4GTM A;  4HQD A;  1BI7 B;  4AY5 A;  4WNF A;  5D0O D;  5ENS D;  3LPZ A;  1EPU A;  4OVU A;  2AXU A;  2XEH A;  4CCA A;  4AY6 A;  3C98 A;  3TJP A;  2IEJ A;  3EU5 A;  3C72 A;  5B3S E;  4HRL A;  3CQC B;  2OND A;  2DZO A;  4JA7 A;  3NF1 A;  4URK A;  3PZ4 A;  2H6H A;  3DST A;  2LSU A;  2IOS A;  4RQI A;  4BWR A;  3CKC A;  4GTP A;  3FY4 A;  4RG6 A;  3S2A A;  5BXU A;  3QAQ A;  5EN5 D;  1INZ A;  2WXN A;  4AJW A;  3FUI A;  3C3R A;  2NC9 A;  3D9I A;  4O60 A;  5CMY A;  4XEI G;  3GZ2 A;  1PC2 A;  1UW4 B;  3ZIM A;  1MQS A;  3FUF A;  3UT7 A;  3OXL A;  4OVV A;  4GTS A;  4I2W A;  4A3V A;  4NIK A;  4WWN A;  2ZGG A;  1ELK A;  2LO6 A;  4E85 A;  4UQY A;  5DBK A;  2C2L A;  3Q7A A;  1O1S A;  1Y6I A;  3TWW A;  3GZ1 A;  5EIB E;  1PAQ A;  4KZ0 A;  3PE3 A;  2VGX A;  2X6J A;  5LP0 A;  2AJA A;  4KVO A;  4BY6 A;  3E4B A;  3LEW A;  4UWH A;  4OYS A;  2WXH A;  5EX3 A;  4U96 D;  2VSY A;  3CVX A;  4A63 B;  4XI9 A;  2L9B A;  4XKB A;  4DJA A;  3RRU A;  3AS5 A;  4J6I A;  3ZFW A;  3UX4 A;  5FQ7 A;  4DI3 A;  3FUD A;  3HVE A;  4DLO A;  5JHB A;  1TR4 A;  4E6H A;  4I6J A;  4I6G A;  3TXN A;  1H6O A;  1X81 A;  1MHQ A;  3RRM B;  2KCK A;  4AEZ C;  4I1O B;  3UKR G;  3LKU A;  3L6A A;  1IQR A;  1Z3Y A;  4JHK A;  4J0U A;  3O48 A;  4A55 A;  5FQ4 A;  3D9H A;  2XS1 A;  2BED A;  4JHJ A;  4B0Z A;  3TWX A;  5AJD A;  2XGS A;  4GYO A;  5FIN A;  5JJ7 A;  3ONL A;  2FF4 A;  3QJZ A;  3HXD A;  1SZA A;  3ULQ A;  3CSF A;  4Q69 A;  2WXK A;  4QFV A;  1DNP A;  3SFX A;  4B8A A;  3FU0 A;  5FT9 A;  4IYP A;  3DWL G;  5EX0 A;  5G2N A;  5EKQ D;  2F8Y A;  3ZGQ A;  3UXG A;  3UM0 A;  2WXG A;  3UIO C;  2KAT A;  3RIB A;  3W9G A;  4EBA A;  3Q73 A;  3Q78 A;  2XCB A;  3TWT A;  4YVO A;  2GRL A;  3PH0 C;  2I6H A;  4HOT A;  3CVV A;  4B94 A;  4JEU A;  1K1A A;  1HE8 A;  1G3N B;  3FU6 A;  4FHK A;  2WQ6 A;  4GTO A;  5HS0 A;  4C48 B;  1E8X A;  3T8K A;  4EZK A;  3ABL E;  4FC8 A;  4L9P A;  1IQU A;  4HFG A;  3SY2 A;  4GMR A;  5FIO A;  2VYI A;  1YA0 A;  2WXI A;  3SF4 A;  4ANU A;  5BXO A;  4U8Y D;  5BT1 A;  2C0M A;  5A23 A;  2L0T B;  4U7E B;  5FZQ A;  4G26 A;  4ME2 A;  3D3M A;  2LSV A;  5AN8 A;  2IU1 A;  3Q7F A;  4C9B B;  1EYH A;  1N94 A;  2VQ2 A;  3TG4 A;  4G8L A;  3RRN B;  3ZYM A;  1ZB1 A;  1YMP A;  4MKT A;  2PNN A;  1S0P A;  2IY0 C;  1SA4 A;  2XRZ A;  3BUA A;  1JCS A;  2AXV A;  3CHS A;  2AVP A;  1TNU A;  2OEV A;  1JWG A;  3PDN A;  2WXO A;  3TXM A;  1NA3 A;  4GAA A;  5LX8 A;  3G2S A;  2I9C A;  4BX8 A;  3IEG A;  4JB8 P;  3TWV A;  3L22 A;  2AXZ A;  4M7C A;  4DI4 A;  3U64 A;  2HE0 A;  1WY6 A;  4FJZ A;  3JQ1 A;  3EIJ A;  1EDU A;  3EDT B;  3CLJ A;  2Y3A A;  3FDH A;  4CDN A;  1KLX A;  2KCV A;  2P9L G;  5FZR A;  1TJF A;  2M63 A;  1OCR E;  1WM5 A;  4L2Y A;  1MYO A;  1JCR A;  3B7T A;  3TWU A;  4HI8 A;  4ILH B;  3B7B A;  5HQ8 A;  4GB9 A;  3ZEF A;  2FI7 A;  2L0I A;  2MYO A;  2L6B A;  2DYS E;  3PNL B;  3ZHE A;  2HO1 A;  4PS3 A;  2Y0B G;  3PS6 A;  2XEN A;  4IN3 B;  2VGE A;  1DC2 A;  5ARF A;  5ENP D;  4AIF A;  1JCQ A;  3UQ3 A;  4M3O A;  4FUL A;  3JUE A;  3S7B A;  4ATZ D;  2JLB A;  3X2Q E;  3FUL A;  3ZU7 B;  2X6H A;  3E32 A;  1O1R A;  1SW6 A;  3SHF A;  4L2L A;  4KVM A;  5C2Y A;  1QQE A;  3MKR A;  4J7W A;  4GA0 A;  3AJI A;  4J8E A;  3CHP A;  1D8E A;  4KYO B;  3E34 A;  2EIK E;  1N4S A;  3ABK E;  2OVB A;  4GTT A;  4EZL A;  4F7A A;  2P58 C;  5CMW A;  3EIQ C;  4O1P A;  5BNW A;  1LD7 A;  2WXJ A;  1FPP A;  3NOC D;  3DPD A;  4HVB A;  2IF4 A;  4PDX A;  2OV8 A;  5EIL A;  2DIW A;  4UWG A;  3UT8 A;  1TEZ A;  3HXE A;  1IHB A;  4DX2 A;  4QQI A;  1KZP A;  2BKG A;  2AW6 A;  1N95 A;  3EJN A;  4NAC A;  2PL2 A; 
#chains in the Genus database with same CATH homology
 2DZO A;  1TR4 A;  3ZUV B;  2L6B A;  5AAR A;  2RFA A;  1MJ0 A;  4K5B A;  1BU9 A;  1N0Q A;  2KXP C;  4J8Y A;  4CYM D;  3IXE A;  3Q9N C;  5CER B;  4DUI A;  2BKK B;  3T9K A;  2XZT G;  5AN8 A;  2RFM A;  5CED B;  3JXI A;  2Y0B G;  3V31 A;  5EYP F;  1QYM A;  3ZNG A;  4HRN A;  5BXU A;  4G8L A;  5EN5 D;  1MX6 A;  2QC9 A;  2XEN A;  5HKP A;  1UOH A;  2V5Q C;  4BET A;  4O1O A;  5AAO A;  3D9H A;  4O60 A;  5KNG A;  4DX7 D;  2VGE A;  3V2X A;  1DC2 A;  1YMP A;  2A5E A;  2KBX A;  4HRM B;  4UUC A;  5JA4 D;  5ENP D;  2ETA A;  3LJN A;  4BSZ B;  3EHR A;  1IXV A;  1DCQ A;  3TWX A;  2PNN A;  1WG0 A;  1D9S A;  5CBN A;  4ZFH A;  5FIN A;  3B95 A;  5KNH D;  5HRY A;  1WDY A;  1OY3 D;  2DVW A;  4RLY A;  3DEP A;  5EID A;  2FO1 E;  3JUE A;  1K3Z D;  4HNA D;  4CZ2 D;  3F6Q A;  4ATZ D;  4HB5 A;  4NIK A;  3ZU7 B;  4BER A;  2ZGG A;  3J5Q B;  5D66 A;  4OAU C;  4BES A;  5JMN D;  3NOG D;  1SW6 A;  4HBD A;  4QFV A;  3TWQ A;  2JAB A;  5ENT D;  5AQB A;  1OT8 A;  3EU9 A;  4F1P A;  4J7W A;  5AQ7 A;  1IKN D;  3V30 A;  3AJI A;  3V79 K;  4JB8 P;  2DZN A;  4DX1 A;  4K5C A;  4N5Q A;  3JXJ A;  5KBA A;  4LNU D;  2F8Y A;  2XZD G;  3TWW A;  3TWV A;  5EIB E;  4Z68 A;  3UXG A;  3NBN B;  3EHQ A;  2HE0 A;  4LG6 A;  5ITZ F;  3DEO A;  2AJA A;  4TUM A;  3W9F A;  4K5A B;  2P2C P;  4B93 B;  3W9G A;  1BI8 B;  2ETB A;  2XEE A;  3Q9U C;  5AQ9 A;  3SO8 A;  1BD8 A;  5CEC B;  1YCS B;  4O1P A;  1BLX B;  5ENQ D;  3TWT A;  2Y1L E;  1SVX A;  3V2O A;  1N11 A;  3TWS A;  4YDY A;  5AQA A;  4ZHB A;  4HQD A;  5CBO A;  1BI7 B;  3AAA C;  2V4H C;  4YDW A;  3J5P A;  1K1A A;  3NOC D;  3ZKJ A;  4OAV B;  1N0R A;  5ENO D;  5EYL A;  3UTM A;  1G3N B;  4U8V D;  4BEP A;  2ETC A;  2B0O E;  3KEA A;  4U96 D;  4A63 B;  4DRX E;  1AWC B;  1MX2 A;  2ZGD A;  5EIL A;  5ENS D;  2QYJ A;  4LSZ E;  5HS0 A;  4DX6 D;  1NFI E;  4DX5 D;  3HG0 D;  5ENR D;  4C48 B;  2J8S D;  3T8K A;  1MX4 A;  3UI2 A;  2F37 A;  4U95 D;  2NYJ A;  4HI9 A;  1IHB A;  1MYO A;  1K1B A;  2XEH A;  4QQI A;  4DX2 A;  1YYH A;  2BKG A;  1A5E A;  2DWZ A;  3HRA A;  4GPM A;  4HI8 A;  3TWU A;  5CEA A;  4GMR A;  5FIO A;  3TWR A;  3C5R A;  4F6R D;  3B7B A;  5KWD A;  5BXO A;  1AP7 A;  4U8Y D;  4G8K A;  1S70 B;  4HLL A;  2MYO A;  4HRL A;  2F8X K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...