3TWVA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human numa1 (chimeric peptide)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/peptide
molecule keywords Tankyrase-2
publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 155
sequence length 155
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twvA00
5EIDA 4BSZB 3TWQA 3V31A 1QYMA 3ZUVB 3EU9A 4U95D 2QYJA 4N5QA 4DX1A 2V4HC 2XENA 2XZDG 5FIOA 1MYOA 2BKGA 3JXIA 3T9KA 5CERB 5HKPA 1BU9A 5ENPD 2DWZA 1OT8A 4HI8A 1MX4A 5AAOA 1IXVA 5ENTD 1N11A 4O1PA 4BEPA 5AQ9A 5JMND 4CYMD 5KNGA 5FINA 2AJAA 4HBDA 5AN8A 5BXUA 2ZGDA 3HG0D 1SVXA 1BD8A 2A5EA 1NFIE 3J5QB 3EHRA 2DZNA 3V2OA 5KBAA 5EYLA 2VGEA 1SW6A 2Y1LE 4HNAD 4K5BA 3Q9UC 2BKKB 4TUMA 4F6RD 2KXPC 3B95A 4QFVA 3TWUA 2B0OE 3UXGA 4A63B 5CBNA 3NBNB 1K1BA 1DC2A 3UI2A 4HLLA 3B7BA 4J7WA 4BERA 5CECB 5AQBA 4F1PA 2MYOA 4HRMB 4HQDA 1UOHA 4GMRA 2DZOA 4DRXE 4U96D 3JXJA 2KBXA 4K5AB 1AP7A 5ENSD 2F37A 4HB5A 1N0QA 4OAVB 3W9GA 4DX2A 1YYHA 4YDYA 3TWWA 2RFAA 5EYPF 4LG6A 5KNHD 4J8YA 3TWSA 4LNUD 4DX6D 1BLXB 4DX5D 3D9HA 2NYJA 1OY3D 2HE0A 5HS0A 2FO1E 2P2CP 5JA4D 1D9SA 4G8KA 4GPMA 3V2XA 3IXEA 3ZNGA 3NOGD 1MJ0A 1MX6A 1IHBA 3TWTA 3V79K 3Q9NC 1YMPA 3KEAA 4DUIA 3W9FA 3ZKJA 5KWDA 5CBOA 3UTMA 4Z68A 4NIKA 2V5QC 4BETA 5EIBE 2F8YA 5ITZF 4B93B 1BI8B 1K1AA 1TR4A 4G8LA 1YCSB 4RLYA 4C48B 5BXOA 4CZ2D 1AWCB 1WG0A 3EHQA 4OAUC 4ZHBA 5EN5D 2XEEA 3AJIA 2L6BA 4JB8P 5D66A 4HRLA 1S70B 3F6QA 5EILA 2ZGGA 3V30A 4BESA 5CEAA 1A5EA 2DVWA 3TWRA 5CEDB 3TWXA 2Y0BG 1BI7B 2RFMA 3LJNA 4HI9A 5ENRD 1MX2A 4ATZD 2PNNA 1WDYA 2XEHA 3NOCD 4YDWA 4O1OA 5AQ7A 4DX7D 1IKND 1N0RA 4ZFHA 2JABA 5AARA 3DEPA 1K3ZD 4UUCA 3SO8A 2QC9A 3C5RA 3J5PA 3AAAC 4K5CA 5AQAA 3T8KA 4LSZE 3DEOA 4U8VD 3HRAA 2J8SD 4U8YD 1G3NB 5ENQD 5HRYA 4O60A 4HRNA 4QQIA 3TWVA 2ETBA 2ETAA 5ENOD 2XZTG 3ZU7B 2F8XK 1DCQA 2ETCA 3JUEA
chains in the Genus database with same CATH superfamily
4BSZB 4TXRA 3ZUVB 5ARFA 2XRYA 3CK9A 2NXPA 1O1TA 5JMND 2V0PA 4GTRA 4KZCA 4EZLA 3RJVA 3UX4A 2WXFA 1PC2A 3EHNA 1UN9A 4JA7A 5G05C 3DSSA 2FO7A 1FT2A 5CMWA 3DBSA 2L0TB 1ELRA 2GRNB 1OUVA 3FTWA 1BLXB 1TN7A 2IF4A 1OY3D 1TYQG 4GPMA 3FDHA 4DUIA 4AJWA 2IFUA 1HS6A 3UQ3A 2IO2C 2OEVA 4FJZA 4AP2A 3AS4A 4C48B 4IRUA 3AS5A 3TXMA 1H2UA 4JB8P 4L2YA 1EDUA 4V3IA 1BI7B 2V5FA 3FY4A 2R03A 1NZNA 5BPPA 1YA0A 1LF8A 2X6FA 2ILRA 2XHEA 4CDMA 2V8SE 1PAQA 4I9EA 1XNFA 2HYZA 2X38A 5FQ7A 3CSFA 5ARGA 4GCOA 3PZ1A 3CVQA 4R7LA 4EHMA 3FUDA 1H6PA 3ZVVA 2J4DA 2WXKA 4XX5A 1OCCE 2LAIA 1BD8A 5BUZA 4I1MA 3S7BA 3QAQA 2B0OE 1S0PA 1V55E 2P9IG 3Q5MA 1E8WA 4OVVA 5AJLA 4U96D 2I1JA 5CHEE 4K5AB 4EPZA 4GB9A 2CFUA 5JHAA 5T4YA 2RFAA 5EYPF 4HFGA 2CG3A 5JA4D 1D9SA 1Z3YA 3JCKC 3ASHA 4CCAA 4AXHA 1IYGA 4B93B 2DYSE 1KT1A 4RG9A 2PZIA 4M3OA 3HXFA 5E76A 3IV0A 4G2VA 4AY6A 1FVHA 3FHEA 3LJNA 3L13A 4MKTA 4FA6A 3CHOA 3CQCB 1NP7A 3MZLB 2V4LA 3EIQC 3J5PA 4K5CA 3I3NA 3DEOA 4U8VD 3DSWA 5HRYA 4FJYA 2EILE 2OOEA 2GRRB 4A55A 4JC8A 4BT9A 1Y6IA 1B89A 2ETCA 3CK7A 4GA2A 1HZ4A 3HIZA 3C72A 3AS8A 4N5QA 5LOZA 3SF4A 5BW8C 4U0SA 2F0YA 3QB2A 2AXVA 3SI5A 1SA5A 5HKPA 4BX9A 3ZIMA 3U4TA 5JJ6A 3HXBA 3CVNA 2XGMA 3JYSA 4YNDA 4I6GA 3FUEA 5ANRA 2Y1LE 3SY2A 4K5BA 3LY9A 2GRPB 1K1BA 3OXGA 4HRMB 1SZ9A 4YDEA 1UOHA 2KBXA 3O4ZA 3UINC 4BTAA 5FZRA 4J8SA 3VLDA 3AG3E 1IHBA 2R05A 2XCBA 3Q7FA 3ZKJA 5CBOA 4OYSA 4PS8A 2J4BA 3UTMA 3DSTA 3QNKA 3FH7A 3QWVA 3URZA 4HORA 1Z3XA 4B94A 4J8DA 2VTBB 3EDTB 1RW2A 4FHKA 5DIZA 4WNEA 4UWKA 1GW6A 4L23A 4JL0A 1G3NB 4HRNA 4QQIA 1EYHA 4F7AA 3ZYLA 1ZU2A 3JUEA 5E75A 3DXKG 1NA3A 4UQXA 3PREA 5AJDA 5T8IA 5KJLA 2C2LA 5CRUA 3D9MA 3MV2B 3RRUA 2A5EA 4UI9K 3QJZA 3HYMB 3ABLE 3T8MA 5ENSD 3L22A 1N0QA 2MHKA 4G25A 3BG0B 3LS8A 2OV8A 5ANLA 4KYOB 2EIJE 1ELWA 2XCCA 1E7UA 4FLBA 4DI3A 4L2LA 3WXXA 4GZ5A 5EIBE 1Y8MA 4O6FA 4RLYA 1UJKA 5FQ4A 3PEUB 4NACA 4EBAG 2Y0BG 3CKCA 2YHCA 2Y3AA 1WDYA 4ATGA 3ULQA 4O1OA 1IKND 4WWPA 2A5UA 5AQAA 4JEHA 4GAAA 3B7SA 3CV0A 3G2TA 4DPRA 2DCPA 3FP3A 3HXEA 3ZU7B 3ESKA 4LERA 2KCLA 3U3WA 2QZAA 1MYOA 3KD7A 5CERB 1IXVA 4Q96A 2DYRE 4IYPA 2C0LA 5AN8A 4PS7A 2DZNA 3VLEA 2VGEA 2L6JA 4TUMA 2GRMA 3DSUA 4LUNU 4QFVA 1IQUA 2WM9A 5JJ7A 2AVPA 4I2ZA 1N4SA 5AQBA 4CDNA 4APOA 2IOSA 2RKKA 2LXLA 4N2QA 1QNFA 5JJTA 4DX5D 2FULA 2NYJA 3UM1A 4ABNA 2Y4UA 3G2SA 5A23A 4U0UA 1TNUA 2KCKA 2F8YA 3Q47B 4GYYA 3SFXA 4A3VA 3HVEA 5H7PA 5EX3A 5D66A 2LO6A 3L82A 3LPZA 4I9CA 4GZ3A 1MX2A 3Q75A 3PRZA 2JABA 2ZIRA 3C5RA 3FTUA 3T8KA 4XIFA 3D9IA 1O1SA 4CGWA 2XPZA 1HX8A 4GTPA 3FUIA 2BF0X 3AU5A 4WAFA 2XZTG 2F8XK 1MX4A 5J08A 2IQCA 3I5PA 2E2EA 1S64A 4HXIA 4DX1A 2BKGA 3WG7E 2XS1A 4U63A 2X6IA 5BV0A 4KT6B 2VGXA 2KZTA 1HXIA 5BXUA 3G2UA 3TJPA 1SW6A 5FZQA 1WY6A 2IJGX 3I4RB 3TL5A 3AG2E 3NBNB 3FEXA 4BERA 4Y6WA 3NZUA 3Q15A 3DPDA 1HG2A 2PQNA 4PS3A 3W9GA 3B7RL 4JD2G 4J6IA 4Q94A 3KAEA 3TWSA 1N54A 3Q78A 3DWLG 3TWTA 3ZHEA 2IO3C 3RIBA 3OTNA 4CGVA 2LSUA 4Z68A 4LCTA 4GCNA 2FEZA 1U2VG 1K1AA 4MRUA 1PY1A 3ASOE 4LEUA 3BQOA 3TWRA 1JWFA 2RG8A 4B0ZA 5B3SE 2WXIA 1E96B 3R9AB 3ZYKA 5AQ7A 3ESLA 1QBQA 1H6OA 3Q73A 5CMYA 1UJJA 3C3QA 3LXUX 3R9MA 2I2OA 4BT8A 2IONA 4ACKA 4HOUA 5EIDA 3UIPC 4U95D 1ELKA 3FUNA 1KZOA 1KPSB 4ME2A 4HI8A 2AXUA 2QYUA 1JUQA 3EHMA 4BEPA 4CYMD 2EIME 4JEUA 3UUXA 5EKQD 3ASDA 1K8KG 5G04J 2BTDA 2X6KA 5M72A 4CT0A 1HF8A 4BX8A 5B1BE 1U3DA 2PQRA 3B7BA 5CECB 3GZ1A 2DZOA 4KMOA 1SZAA 4E6HA 4F3VA 1U3CA 3T5VA 2RD0A 3L08A 3ZPJA 1P5QA 3UPVA 3MX3A 2FF4A 2XGSA 2EQXA 3DSXA 3HHMA 3IHYA 1MX6A 4HS2A 2P9PG 1NI1A 4BWRA 3FTVA 5KWDA 1N4RA 3X2QE 3RU0A 3EJNA 3SFYA 4BETA 2JLBA 3AJIA 2CHXA 2L6BA 4K03A 3ABME 4BESA 4N3AA 1O1RA 1D8DA 1SA4A 2X6HA 2RFMA 5ENRD 3RRNB 5C1DA 3NOCD 4DLOA 1FVFA 2DIWA 3P2BA 3UM2A 3S7JA 4IN3B 1DVPA 2HR2A 4A1SA 2FBNA 3FUKA 3EU5A 3CVYA 2J07A 2WQ6A 4B89A 2P9NG 1HFAA 3ZRHA 2X6JA 1D8EA 2IEJA 3PUJA 2P9KG 4GTMA 2AWIA 2KCVA 3T9KA 4XKCA 1BU9A 5FZSA 5ENPD 4AEZC 3RSEG 4JXTA 5AQ9A 3LJ3A 1JPLA 3APDA 4ILIA 1NFIE 4G24A 1VDYA 3B95A 4N3BA 2XPIA 4HLLA 3L16A 2LNIA 3JXJA 3BU8A 2F37A 3RAUA 5BT1A 3ML9A 2AXZA 1RZ4A 2I9CA 4DX6D 5KJKA 3FTSA 3QDNA 3GZ2A 3CHMA 3CLJA 2H6FA 5BXOA 3MJWA 4CRWA 2BEDA 4I6EA 1LTXA 3JQ0A 3KEZA 1OCOE 4L9PA 3FU3A 4GYOA 4GTTA 4JHKA 2CG2A 3D9NA 3S7DA 4C9BB 4N2SA 3PE3A 4ACLA 3SNXA 4U8YD 4PUCA 2VQ2A 5T3RA 3NQPA 1KZPA 2PM6A 3SHFA 4UI9J 4YVOA 2YNQA 4E85A 4YVQC 2GROB 2WXRA 4JHJA 3APFA 4GYWA 5ENTD 4O1PA 4MS6A 2AJAA 5AENA 4Y6CA 5DBKA 2HM8A 3TXNA 2IU1A 2WXJA 4X8QA 3HVEB 3ONLA 3MKQB 3FH5A 3LKUA 4I2WA 2WQ7A 2LAHA 1H19A 1IHGA 5CRVA 4B8CB 2QFCA 1X5BA 3D9HA 4FADA 4TRQA 2WMOA 5CCMA 4L7TA 3PVLA 2L9BA 3QC1A 3HXDA 1TNOA 3GYZA 3ZFWA 4L1BA 1AWCB 5EN5D 4ANWA 4HRLA 1MQSA 5CEDB 2PNNA 4HOQA 2VGXB 2KZTB 4C0MA 2XEHA 4ILGA 3VTYA 3DEPA 3FEYA 4TXPA 2VYIA 3TGOA 1H6KA 2ZISA 3HRAA 5BNWA 3C3RA 2NSZA 3TWVA 1O5MA 3TG5A 4DLQA 5G04C 1DCQA 5A6CA 3V31A 2V4HC 3BUAA 2XENA 3PNTB 2C0MA 1S63A 2ZU6B 3NF1A 4BSXA 4DI4A 4I1OB 1E90A 2Q7FA 3J5QB 3MYVA 5D2MC 3E4BA 2BKKB 3E34A 5CBNA 4GTOA 1DC2A 3E37A 3UI2A 3CGHA 1SQMA 4DRXE 3T5XA 3OXLA 3MA5A 1TNZA 2WXGA 2R59A 5HI7A 3TG4A 3QARA 4XE0A 3PNLB 4PDXA 2WVIA 2FO1E 5KJNA 5FWQA 3V2XA 3ZNGA 1FPPA 3UT7A 3V79K 3UMVA 2XPYA 3DSVA 3ASFA 5JHBA 4F53A 2OCCE 3E33A 3QKYA 2YHEA 3DXMG 1OWNA 4KVMA 3P1UA 3AU4A 4ZHBA 2H6IA 1ZBPA 2R17C 4JVSA 1S70B 1N95A 3VLFA 4ATZD 5IY5E 1OCRE 2PL2A 4YDWA 3SGHA 3KS2A 2J08A 2UY1A 4DX7D 4F1SA 2GRQB 2H6GA 3CIAA 4O60A 3CHPA 4LNBA 3U66A 4D10C 2ONDA 1OWMA 5ENOD 3DRAA 3EU9A 2XZDG 4ILHB 3R7RA 4M7CA 3LEWA 4U0ZA 3PS6A 5FJYA 2ZGDA 1IQRA 3EHRA 4CT4A 3LVQE 2P9UG 1N4PA 3Q4AB 3CVVA 3CKBA 4GZDA 2ZXWE 3SFZA 4HLEA 4J7WA 3DPYA 3UM0A 3FUMA 3ZN3A 4GTSA 1YYHA 2MOWA 5A7DB 3C98A 4W9RA 3UIOC 4G8KA 1YMPA 4UWHA 2WXLA 4U7EB 4J8FA 3CEQA 1EPUA 2L0IA 1LD8A 4FHJA 3FU0A 2CFZA 3OXFA 2XEEA 5D0QD 1HU3A 4UI9C 4G11A 1KT0A 1WM5A 1W3BA 5C2YA 3LDZA 1TNYA 4EZJA 3FU5A 2VSNA 2A4ZA 2M63A 2WXQA 2ETAA 3ENEA 3QOUA 3ZYQA 4I43A 3G2WA 4AY5A 2WXNA 2VJ8A 3Q7AA 3LY8A 3KSLA 3Q79A 1DNPA 2Y69E 3EUVA 3V2OA 3CVLA 4N39A 1Q2ZA 3BEEA 4APFA 2XEVA 4H7XA 2KXPC 4GPKA 1E8ZA 4UWLA 1DCEA 4WNFA 3PEVB 4GMRA 2OVFA 3ZW3A 3E32A 1L5JA 4J8EA 5FT9A 3U9WA 1N52A 3ZXPA 4DX2A 3TWWA 2P58C 4YDYA 1EF1C 2OVBA 3CVPA 3MKRA 3PZ4A 4AV7A 2WXOA 4DK5A 4YDOA 4EECA 1MJ0A 3KEAA 3NZSA 4G23A 3MCXA 3R7QA 1HG5A 5FTPA 2YINA 5G55A 4N3CA 3D9OA 3KSQA 4UWFA 2XQ0A 4G8LA 3IKOB 1YCSB 5D0OD 4CZ2D 3RKVA 4H7YA 5LCWJ 1QZ2A 5FQ8A 3QWPA 3TAXA 4J0UA 3B7UX 3V30A 4AVXA 4XZ4A 1NA0A 1OCZE 4UQZA 3RO2A 3D9JA 5AARA 4UUCA 1HO8A 2QC9A 4NURA 2JEKA 2OEWA 2XGOA 4DJAA 1H2VC 3FH8A 3D9LA 4FULA 3E30A 4FLHA 3AG1E 4RQIA 3TWQA 4KZ0A 1TJCA 3L17A 5G2NA 5FIOA 1E8YA 3CVUA 3ZXSA 1TEZA 3CR3A 1SVXA 4KBQA 5EYLA 2KC7A 4ANVA 5FQ6A 1X81A 4TV3A 1UN8A 3FTZA 3L9TA 2IOLA 1N4QA 2WXPA 4JA9A 4F1PA 5EDSA 1TNBA 4WNDA 4HQDA 3CSTA 1AP7A 3LYAA 1OWPA 4GMJA 4BFRA 5KNHD 4J8YA 4RG6A 5BV1A 3JUIA 2P2CP 4AM9A 3IXEA 3LY7A 3Q9NC 3W9FA 3CHRA 4KVOA 1JCRA 2AW6A 3ZEFA 3FUJA 4OVUA 1MZCA 3PZDA 3ULEG 3MGBA 3UKRG 2EIKE 1MHQA 3EHQA 3Q49B 3SQVA 5AYWD 3UT8A 3FUFA 5KCMA 1JCQA 5CEAA 4CEMA 3MV3B 3UM3A 1TN6A 2J9QA 3AG4E 3ASGA 3SO8A 3JQ1A 3CHQA 4TUUA 4BY6A 3NB2A 4TXQA 3OAWA 3SD5A 4G26A 1H0AA 3BG1B 3SBSA 2FI7A 5KJMA 4HOSA 3ZYMA 4LSZE 3FFLA 2GGFA 1FCHA 2QYJA 3SZ7A 3RRMB 3JXIA 4EZKA 2J09A 3GZSA 5AAOA 4RSYA 3CVXA 3ONKA 5KNGA 4I17A 4MLPA 3HXCA 4XI9A 4G1TA 4GZ6A 4F6RD 3CQGB 3ML8A 2MRIA 3VTXA 3ASNE 4A63B 4FU3A 4GMLA 4NRHB 2WPVA 4CDRA 4GA0A 1H2TC 3SBTB 4PH4B 3RK6A 1XGWA 3UT4A 1Z5SC 3B7TA 3FTYA 5G05J 5HQ8A 1ZB1A 2P9SG 4AIFA 4AOFA 3RO3A 2UY1B 3FWVA 2HE0A 4XKBA 4JW1A 2HO1A 2LUHA 2WMNA 4XEIG 4HOTA 4JHRA 2YQ8A 4GTVA 4U04A 4EBAA 4LRZA 1TR4A 1WG0A 4RVBA 4OAUC 5EILA 2ZGGA 2DVWA 1E8XA 3L6AA 2WQHA 3FUHA 1TN8A 2X3MA 4Q69A 2WXMA 1A17A 3APCA 1BPOA 2R2LA 3FU6A 1N9AA 2Y4TA 5LP0A 4C0EA 1V54E 5ENQD 4NQ0A 3G2VA 3CVWA 1JWGA 1OWLA 1WAO1 2LSVA 3QWWA 2R5SA 1TJFA 4P29A 3GW4A 4K0RA 2KM4A 3B13A 4HVBA 3FTXA 1OXJA 1OT8A 3C3OA 3FULA 1N11A 4N5CA 4WWNA 5FINA 4HBDA 3QK0A 2NC9A 3HG0D 3ABKE 3EIJA 5KBAA 4U07A 2VSYA 2IY0C 4HNAD 1FT1A 3K9IA 4GTQA 4FC8A 2MYOA 5AIJA 1Z6TA 5J90A 4HB5A 1JCSA 4WNGA 3ZHEB 3N71A 1UW4B 1OWOA 5HS0A 5LCWC 3S2AA 3PDNA 5EX0A 4NIKA 3O48A 3PH0C 1N94A 2PM7A 1BI8B 2EINE 3CK8A 3MEKA 3IBEA 3F6QA 1A5EA 1UG3A 3L54A 4I6JA 2VSOE 4HI9A 3HDXA 2QY7A 4XI0A 1N0RA 3PUKA 2UWJG 3U64A 4KXKB 2J8SD 2GW1A 4BTBA 2ETBA 4B8AA 3PE4A 4URKA 3NAWA 2J49A 1QYMA 4I1AA 4GA1A 1LD7A 2VTBA 3D3MA 2DWZA 5LX8A 4EQFA 3LVRE 3ULYA 3D9PA 4UQYA 4ANXA 1INZA 2H6HA 2XS8A 3I4GA 3Q9UC 1KLXA 3TWUA 4WUYA 3UXGA 3ISMC 5CCLA 1QQEA 4GZCA 5LFAA 2CHWA 2BUGA 3D9KA 2GRLA 3S7FA 4OAVB 4JZYA 3UKUG 4GU5A 4JPSA 3ZGQA 4LG6A 3MKQA 4LNUD 2B6CA 2WB2A 2VSXE 3NOGD 3IEGA 1HE8A 2DBAA 4U8HA 2R02A 2V5QC 2I6HA 2XRZA 4MBGA 3IHVA 5ENNA 5ITZF 2VGYA 4A3TA 2LXMA 3CHSA 2CHZA 2P9LG 3TWXA 2E0IA 4WWOA 2KATA 4A1GA 2WXHA 4FP7A 3PZ3A 4ZFHA 1K3ZD 4ANUA 1E7VA 3AAAC 3LCAA 3PZ2A 1HH8A 4UWGA 2I1KA 4IULA 4LNGA 1NL4A 5B1AE
chains in the Genus database with same CATH topology
5EIDA 4BSZB 3TWQA 3V31A 1QYMA 3ZUVB 3EU9A 4U95D 2QYJA 4N5QA 4DX1A 2V4HC 2XENA 2XZDG 5FIOA 1MYOA 2BKGA 3JXIA 3T9KA 5CERB 5HKPA 1BU9A 5ENPD 2DWZA 1OT8A 4HI8A 1MX4A 5AAOA 1IXVA 5ENTD 1N11A 4O1PA 4BEPA 5AQ9A 5JMND 4CYMD 5KNGA 5FINA 2AJAA 4HBDA 5AN8A 5BXUA 2ZGDA 3HG0D 1SVXA 1BD8A 2A5EA 1NFIE 3J5QB 3EHRA 2DZNA 3V2OA 5KBAA 5EYLA 2VGEA 1SW6A 2Y1LE 4HNAD 4K5BA 3Q9UC 2BKKB 4TUMA 4F6RD 2KXPC 3B95A 4QFVA 3TWUA 2B0OE 3UXGA 4A63B 5CBNA 3NBNB 1K1BA 1DC2A 3UI2A 4HLLA 3B7BA 4J7WA 4BERA 5CECB 5AQBA 4F1PA 2MYOA 4HRMB 4HQDA 1UOHA 4GMRA 2DZOA 4DRXE 4U96D 3JXJA 2KBXA 4K5AB 1AP7A 5ENSD 2F37A 4HB5A 1N0QA 4OAVB 3W9GA 4DX2A 1YYHA 4YDYA 3TWWA 2RFAA 5EYPF 4LG6A 5KNHD 4J8YA 3TWSA 4LNUD 4DX6D 1BLXB 4DX5D 3D9HA 2NYJA 1OY3D 2HE0A 5HS0A 2FO1E 2P2CP 5JA4D 1D9SA 4G8KA 4GPMA 3V2XA 3IXEA 3ZNGA 3NOGD 1MJ0A 1MX6A 1IHBA 3TWTA 3V79K 3Q9NC 1YMPA 3KEAA 4DUIA 3W9FA 3ZKJA 5KWDA 5CBOA 3UTMA 4Z68A 4NIKA 2V5QC 4BETA 5EIBE 2F8YA 5ITZF 4B93B 1BI8B 1K1AA 1TR4A 4G8LA 1YCSB 4RLYA 4C48B 5BXOA 4CZ2D 1AWCB 1WG0A 3EHQA 4OAUC 4ZHBA 5EN5D 2XEEA 3AJIA 2L6BA 4JB8P 5D66A 4HRLA 1S70B 3F6QA 5EILA 2ZGGA 3V30A 4BESA 5CEAA 1A5EA 2DVWA 3TWRA 5CEDB 3TWXA 2Y0BG 1BI7B 2RFMA 3LJNA 4HI9A 5ENRD 1MX2A 4ATZD 2PNNA 1WDYA 2XEHA 3NOCD 4YDWA 4O1OA 5AQ7A 4DX7D 1IKND 1N0RA 4ZFHA 2JABA 5AARA 3DEPA 1K3ZD 4UUCA 3SO8A 2QC9A 3C5RA 3J5PA 3AAAC 4K5CA 5AQAA 3T8KA 4LSZE 3DEOA 4U8VD 3HRAA 2J8SD 4U8YD 1G3NB 5ENQD 5HRYA 4O60A 4HRNA 4QQIA 3TWVA 2ETBA 2ETAA 5ENOD 2XZTG 3ZU7B 2F8XK 1DCQA 2ETCA 3JUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EID A;  4BSZ B;  3TWQ A;  3V31 A;  1QYM A;  3ZUV B;  3EU9 A;  4U95 D;  2QYJ A;  4N5Q A;  4DX1 A;  2V4H C;  2XEN A;  2XZD G;  5FIO A;  1MYO A;  2BKG A;  3JXI A;  3T9K A;  5CER B;  5HKP A;  1BU9 A;  5ENP D;  2DWZ A;  1OT8 A;  4HI8 A;  1MX4 A;  5AAO A;  1IXV A;  5ENT D;  1N11 A;  4O1P A;  4BEP A;  5AQ9 A;  5JMN D;  4CYM D;  5KNG A;  5FIN A;  2AJA A;  4HBD A;  5AN8 A;  5BXU A;  2ZGD A;  3HG0 D;  1SVX A;  1BD8 A;  2A5E A;  1NFI E;  3J5Q B;  3EHR A;  2DZN A;  3V2O A;  5KBA A;  5EYL A;  2VGE A;  1SW6 A;  2Y1L E;  4HNA D;  4K5B A;  3Q9U C;  2BKK B;  4TUM A;  4F6R D;  2KXP C;  3B95 A;  4QFV A;  3TWU A;  2B0O E;  3UXG A;  4A63 B;  5CBN A;  3NBN B;  1K1B A;  1DC2 A;  3UI2 A;  4HLL A;  3B7B A;  4J7W A;  4BER A;  5CEC B;  5AQB A;  4F1P A;  2MYO A;  4HRM B;  4HQD A;  1UOH A;  4GMR A;  2DZO A;  4DRX E;  4U96 D;  3JXJ A;  2KBX A;  4K5A B;  1AP7 A;  5ENS D;  2F37 A;  4HB5 A;  1N0Q A;  4OAV B;  3W9G A;  4DX2 A;  1YYH A;  4YDY A;  3TWW A;  2RFA A;  5EYP F;  4LG6 A;  5KNH D;  4J8Y A;  3TWS A;  4LNU D;  4DX6 D;  1BLX B;  4DX5 D;  3D9H A;  2NYJ A;  1OY3 D;  2HE0 A;  5HS0 A;  2FO1 E;  2P2C P;  5JA4 D;  1D9S A;  4G8K A;  4GPM A;  3V2X A;  3IXE A;  3ZNG A;  3NOG D;  1MJ0 A;  1MX6 A;  1IHB A;  3TWT A;  3V79 K;  3Q9N C;  1YMP A;  3KEA A;  4DUI A;  3W9F A;  3ZKJ A;  5KWD A;  5CBO A;  3UTM A;  4Z68 A;  4NIK A;  2V5Q C;  4BET A;  5EIB E;  2F8Y A;  5ITZ F;  4B93 B;  1BI8 B;  1K1A A;  1TR4 A;  4G8L A;  1YCS B;  4RLY A;  4C48 B;  5BXO A;  4CZ2 D;  1AWC B;  1WG0 A;  3EHQ A;  4OAU C;  4ZHB A;  5EN5 D;  2XEE A;  3AJI A;  2L6B A;  4JB8 P;  5D66 A;  4HRL A;  1S70 B;  3F6Q A;  5EIL A;  2ZGG A;  3V30 A;  4BES A;  5CEA A;  1A5E A;  2DVW A;  3TWR A;  5CED B;  3TWX A;  2Y0B G;  1BI7 B;  2RFM A;  3LJN A;  4HI9 A;  5ENR D;  1MX2 A;  4ATZ D;  2PNN A;  1WDY A;  2XEH A;  3NOC D;  4YDW A;  4O1O A;  5AQ7 A;  4DX7 D;  1IKN D;  1N0R A;  4ZFH A;  2JAB A;  5AAR A;  3DEP A;  1K3Z D;  4UUC A;  3SO8 A;  2QC9 A;  3C5R A;  3J5P A;  3AAA C;  4K5C A;  5AQA A;  3T8K A;  4LSZ E;  3DEO A;  4U8V D;  3HRA A;  2J8S D;  4U8Y D;  1G3N B;  5ENQ D;  5HRY A;  4O60 A;  4HRN A;  4QQI A;  3TWV A;  2ETB A;  2ETA A;  5ENO D;  2XZT G;  3ZU7 B;  2F8X K;  1DCQ A;  2ETC A;  3JUE A; 
#chains in the Genus database with same CATH topology
 4BSZ B;  4TXR A;  3ZUV B;  5ARF A;  2XRY A;  3CK9 A;  2NXP A;  1O1T A;  5JMN D;  2V0P A;  4GTR A;  4KZC A;  4EZL A;  3RJV A;  3UX4 A;  2WXF A;  1PC2 A;  3EHN A;  1UN9 A;  4JA7 A;  5G05 C;  3DSS A;  2FO7 A;  1FT2 A;  5CMW A;  3DBS A;  2L0T B;  1ELR A;  2GRN B;  1OUV A;  3FTW A;  1BLX B;  1TN7 A;  2IF4 A;  1OY3 D;  1TYQ G;  4GPM A;  3FDH A;  4DUI A;  4AJW A;  2IFU A;  1HS6 A;  3UQ3 A;  2IO2 C;  2OEV A;  4FJZ A;  4AP2 A;  3AS4 A;  4C48 B;  4IRU A;  3AS5 A;  3TXM A;  1H2U A;  4JB8 P;  4L2Y A;  1EDU A;  4V3I A;  1BI7 B;  2V5F A;  3FY4 A;  2R03 A;  1NZN A;  5BPP A;  1YA0 A;  1LF8 A;  2X6F A;  2ILR A;  2XHE A;  4CDM A;  2V8S E;  1PAQ A;  4I9E A;  1XNF A;  2HYZ A;  2X38 A;  5FQ7 A;  3CSF A;  5ARG A;  4GCO A;  3PZ1 A;  3CVQ A;  4R7L A;  4EHM A;  3FUD A;  1H6P A;  3ZVV A;  2J4D A;  2WXK A;  4XX5 A;  1OCC E;  2LAI A;  1BD8 A;  5BUZ A;  4I1M A;  3S7B A;  3QAQ A;  2B0O E;  1S0P A;  1V55 E;  2P9I G;  3Q5M A;  1E8W A;  4OVV A;  5AJL A;  4U96 D;  2I1J A;  5CHE E;  4K5A B;  4EPZ A;  4GB9 A;  2CFU A;  5JHA A;  5T4Y A;  2RFA A;  5EYP F;  4HFG A;  2CG3 A;  5JA4 D;  1D9S A;  1Z3Y A;  3JCK C;  3ASH A;  4CCA A;  4AXH A;  1IYG A;  4B93 B;  2DYS E;  1KT1 A;  4RG9 A;  2PZI A;  4M3O A;  3HXF A;  5E76 A;  3IV0 A;  4G2V A;  4AY6 A;  1FVH A;  3FHE A;  3LJN A;  3L13 A;  4MKT A;  4FA6 A;  3CHO A;  3CQC B;  1NP7 A;  3MZL B;  2V4L A;  3EIQ C;  3J5P A;  4K5C A;  3I3N A;  3DEO A;  4U8V D;  3DSW A;  5HRY A;  4FJY A;  2EIL E;  2OOE A;  2GRR B;  4A55 A;  4JC8 A;  4BT9 A;  1Y6I A;  1B89 A;  2ETC A;  3CK7 A;  4GA2 A;  1HZ4 A;  3HIZ A;  3C72 A;  3AS8 A;  4N5Q A;  5LOZ A;  3SF4 A;  5BW8 C;  4U0S A;  2F0Y A;  3QB2 A;  2AXV A;  3SI5 A;  1SA5 A;  5HKP A;  4BX9 A;  3ZIM A;  3U4T A;  5JJ6 A;  3HXB A;  3CVN A;  2XGM A;  3JYS A;  4YND A;  4I6G A;  3FUE A;  5ANR A;  2Y1L E;  3SY2 A;  4K5B A;  3LY9 A;  2GRP B;  1K1B A;  3OXG A;  4HRM B;  1SZ9 A;  4YDE A;  1UOH A;  2KBX A;  3O4Z A;  3UIN C;  4BTA A;  5FZR A;  4J8S A;  3VLD A;  3AG3 E;  1IHB A;  2R05 A;  2XCB A;  3Q7F A;  3ZKJ A;  5CBO A;  4OYS A;  4PS8 A;  2J4B A;  3UTM A;  3DST A;  3QNK A;  3FH7 A;  3QWV A;  3URZ A;  4HOR A;  1Z3X A;  4B94 A;  4J8D A;  2VTB B;  3EDT B;  1RW2 A;  4FHK A;  5DIZ A;  4WNE A;  4UWK A;  1GW6 A;  4L23 A;  4JL0 A;  1G3N B;  4HRN A;  4QQI A;  1EYH A;  4F7A A;  3ZYL A;  1ZU2 A;  3JUE A;  5E75 A;  3DXK G;  1NA3 A;  4UQX A;  3PRE A;  5AJD A;  5T8I A;  5KJL A;  2C2L A;  5CRU A;  3D9M A;  3MV2 B;  3RRU A;  2A5E A;  4UI9 K;  3QJZ A;  3HYM B;  3ABL E;  3T8M A;  5ENS D;  3L22 A;  1N0Q A;  2MHK A;  4G25 A;  3BG0 B;  3LS8 A;  2OV8 A;  5ANL A;  4KYO B;  2EIJ E;  1ELW A;  2XCC A;  1E7U A;  4FLB A;  4DI3 A;  4L2L A;  3WXX A;  4GZ5 A;  5EIB E;  1Y8M A;  4O6F A;  4RLY A;  1UJK A;  5FQ4 A;  3PEU B;  4NAC A;  4EBA G;  2Y0B G;  3CKC A;  2YHC A;  2Y3A A;  1WDY A;  4ATG A;  3ULQ A;  4O1O A;  1IKN D;  4WWP A;  2A5U A;  5AQA A;  4JEH A;  4GAA A;  3B7S A;  3CV0 A;  3G2T A;  4DPR A;  2DCP A;  3FP3 A;  3HXE A;  3ZU7 B;  3ESK A;  4LER A;  2KCL A;  3U3W A;  2QZA A;  1MYO A;  3KD7 A;  5CER B;  1IXV A;  4Q96 A;  2DYR E;  4IYP A;  2C0L A;  5AN8 A;  4PS7 A;  2DZN A;  3VLE A;  2VGE A;  2L6J A;  4TUM A;  2GRM A;  3DSU A;  4LUN U;  4QFV A;  1IQU A;  2WM9 A;  5JJ7 A;  2AVP A;  4I2Z A;  1N4S A;  5AQB A;  4CDN A;  4APO A;  2IOS A;  2RKK A;  2LXL A;  4N2Q A;  1QNF A;  5JJT A;  4DX5 D;  2FUL A;  2NYJ A;  3UM1 A;  4ABN A;  2Y4U A;  3G2S A;  5A23 A;  4U0U A;  1TNU A;  2KCK A;  2F8Y A;  3Q47 B;  4GYY A;  3SFX A;  4A3V A;  3HVE A;  5H7P A;  5EX3 A;  5D66 A;  2LO6 A;  3L82 A;  3LPZ A;  4I9C A;  4GZ3 A;  1MX2 A;  3Q75 A;  3PRZ A;  2JAB A;  2ZIR A;  3C5R A;  3FTU A;  3T8K A;  4XIF A;  3D9I A;  1O1S A;  4CGW A;  2XPZ A;  1HX8 A;  4GTP A;  3FUI A;  2BF0 X;  3AU5 A;  4WAF A;  2XZT G;  2F8X K;  1MX4 A;  5J08 A;  2IQC A;  3I5P A;  2E2E A;  1S64 A;  4HXI A;  4DX1 A;  2BKG A;  3WG7 E;  2XS1 A;  4U63 A;  2X6I A;  5BV0 A;  4KT6 B;  2VGX A;  2KZT A;  1HXI A;  5BXU A;  3G2U A;  3TJP A;  1SW6 A;  5FZQ A;  1WY6 A;  2IJG X;  3I4R B;  3TL5 A;  3AG2 E;  3NBN B;  3FEX A;  4BER A;  4Y6W A;  3NZU A;  3Q15 A;  3DPD A;  1HG2 A;  2PQN A;  4PS3 A;  3W9G A;  3B7R L;  4JD2 G;  4J6I A;  4Q94 A;  3KAE A;  3TWS A;  1N54 A;  3Q78 A;  3DWL G;  3TWT A;  3ZHE A;  2IO3 C;  3RIB A;  3OTN A;  4CGV A;  2LSU A;  4Z68 A;  4LCT A;  4GCN A;  2FEZ A;  1U2V G;  1K1A A;  4MRU A;  1PY1 A;  3ASO E;  4LEU A;  3BQO A;  3TWR A;  1JWF A;  2RG8 A;  4B0Z A;  5B3S E;  2WXI A;  1E96 B;  3R9A B;  3ZYK A;  5AQ7 A;  3ESL A;  1QBQ A;  1H6O A;  3Q73 A;  5CMY A;  1UJJ A;  3C3Q A;  3LXU X;  3R9M A;  2I2O A;  4BT8 A;  2ION A;  4ACK A;  4HOU A;  5EID A;  3UIP C;  4U95 D;  1ELK A;  3FUN A;  1KZO A;  1KPS B;  4ME2 A;  4HI8 A;  2AXU A;  2QYU A;  1JUQ A;  3EHM A;  4BEP A;  4CYM D;  2EIM E;  4JEU A;  3UUX A;  5EKQ D;  3ASD A;  1K8K G;  5G04 J;  2BTD A;  2X6K A;  5M72 A;  4CT0 A;  1HF8 A;  4BX8 A;  5B1B E;  1U3D A;  2PQR A;  3B7B A;  5CEC B;  3GZ1 A;  2DZO A;  4KMO A;  1SZA A;  4E6H A;  4F3V A;  1U3C A;  3T5V A;  2RD0 A;  3L08 A;  3ZPJ A;  1P5Q A;  3UPV A;  3MX3 A;  2FF4 A;  2XGS A;  2EQX A;  3DSX A;  3HHM A;  3IHY A;  1MX6 A;  4HS2 A;  2P9P G;  1NI1 A;  4BWR A;  3FTV A;  5KWD A;  1N4R A;  3X2Q E;  3RU0 A;  3EJN A;  3SFY A;  4BET A;  2JLB A;  3AJI A;  2CHX A;  2L6B A;  4K03 A;  3ABM E;  4BES A;  4N3A A;  1O1R A;  1D8D A;  1SA4 A;  2X6H A;  2RFM A;  5ENR D;  3RRN B;  5C1D A;  3NOC D;  4DLO A;  1FVF A;  2DIW A;  3P2B A;  3UM2 A;  3S7J A;  4IN3 B;  1DVP A;  2HR2 A;  4A1S A;  2FBN A;  3FUK A;  3EU5 A;  3CVY A;  2J07 A;  2WQ6 A;  4B89 A;  2P9N G;  1HFA A;  3ZRH A;  2X6J A;  1D8E A;  2IEJ A;  3PUJ A;  2P9K G;  4GTM A;  2AWI A;  2KCV A;  3T9K A;  4XKC A;  1BU9 A;  5FZS A;  5ENP D;  4AEZ C;  3RSE G;  4JXT A;  5AQ9 A;  3LJ3 A;  1JPL A;  3APD A;  4ILI A;  1NFI E;  4G24 A;  1VDY A;  3B95 A;  4N3B A;  2XPI A;  4HLL A;  3L16 A;  2LNI A;  3JXJ A;  3BU8 A;  2F37 A;  3RAU A;  5BT1 A;  3ML9 A;  2AXZ A;  1RZ4 A;  2I9C A;  4DX6 D;  5KJK A;  3FTS A;  3QDN A;  3GZ2 A;  3CHM A;  3CLJ A;  2H6F A;  5BXO A;  3MJW A;  4CRW A;  2BED A;  4I6E A;  1LTX A;  3JQ0 A;  3KEZ A;  1OCO E;  4L9P A;  3FU3 A;  4GYO A;  4GTT A;  4JHK A;  2CG2 A;  3D9N A;  3S7D A;  4C9B B;  4N2S A;  3PE3 A;  4ACL A;  3SNX A;  4U8Y D;  4PUC A;  2VQ2 A;  5T3R A;  3NQP A;  1KZP A;  2PM6 A;  3SHF A;  4UI9 J;  4YVO A;  2YNQ A;  4E85 A;  4YVQ C;  2GRO B;  2WXR A;  4JHJ A;  3APF A;  4GYW A;  5ENT D;  4O1P A;  4MS6 A;  2AJA A;  5AEN A;  4Y6C A;  5DBK A;  2HM8 A;  3TXN A;  2IU1 A;  2WXJ A;  4X8Q A;  3HVE B;  3ONL A;  3MKQ B;  3FH5 A;  3LKU A;  4I2W A;  2WQ7 A;  2LAH A;  1H19 A;  1IHG A;  5CRV A;  4B8C B;  2QFC A;  1X5B A;  3D9H A;  4FAD A;  4TRQ A;  2WMO A;  5CCM A;  4L7T A;  3PVL A;  2L9B A;  3QC1 A;  3HXD A;  1TNO A;  3GYZ A;  3ZFW A;  4L1B A;  1AWC B;  5EN5 D;  4ANW A;  4HRL A;  1MQS A;  5CED B;  2PNN A;  4HOQ A;  2VGX B;  2KZT B;  4C0M A;  2XEH A;  4ILG A;  3VTY A;  3DEP A;  3FEY A;  4TXP A;  2VYI A;  3TGO A;  1H6K A;  2ZIS A;  3HRA A;  5BNW A;  3C3R A;  2NSZ A;  3TWV A;  1O5M A;  3TG5 A;  4DLQ A;  5G04 C;  1DCQ A;  5A6C A;  3V31 A;  2V4H C;  3BUA A;  2XEN A;  3PNT B;  2C0M A;  1S63 A;  2ZU6 B;  3NF1 A;  4BSX A;  4DI4 A;  4I1O B;  1E90 A;  2Q7F A;  3J5Q B;  3MYV A;  5D2M C;  3E4B A;  2BKK B;  3E34 A;  5CBN A;  4GTO A;  1DC2 A;  3E37 A;  3UI2 A;  3CGH A;  1SQM A;  4DRX E;  3T5X A;  3OXL A;  3MA5 A;  1TNZ A;  2WXG A;  2R59 A;  5HI7 A;  3TG4 A;  3QAR A;  4XE0 A;  3PNL B;  4PDX A;  2WVI A;  2FO1 E;  5KJN A;  5FWQ A;  3V2X A;  3ZNG A;  1FPP A;  3UT7 A;  3V79 K;  3UMV A;  2XPY A;  3DSV A;  3ASF A;  5JHB A;  4F53 A;  2OCC E;  3E33 A;  3QKY A;  2YHE A;  3DXM G;  1OWN A;  4KVM A;  3P1U A;  3AU4 A;  4ZHB A;  2H6I A;  1ZBP A;  2R17 C;  4JVS A;  1S70 B;  1N95 A;  3VLF A;  4ATZ D;  5IY5 E;  1OCR E;  2PL2 A;  4YDW A;  3SGH A;  3KS2 A;  2J08 A;  2UY1 A;  4DX7 D;  4F1S A;  2GRQ B;  2H6G A;  3CIA A;  4O60 A;  3CHP A;  4LNB A;  3U66 A;  4D10 C;  2OND A;  1OWM A;  5ENO D;  3DRA A;  3EU9 A;  2XZD G;  4ILH B;  3R7R A;  4M7C A;  3LEW A;  4U0Z A;  3PS6 A;  5FJY A;  2ZGD A;  1IQR A;  3EHR A;  4CT4 A;  3LVQ E;  2P9U G;  1N4P A;  3Q4A B;  3CVV A;  3CKB A;  4GZD A;  2ZXW E;  3SFZ A;  4HLE A;  4J7W A;  3DPY A;  3UM0 A;  3FUM A;  3ZN3 A;  4GTS A;  1YYH A;  2MOW A;  5A7D B;  3C98 A;  4W9R A;  3UIO C;  4G8K A;  1YMP A;  4UWH A;  2WXL A;  4U7E B;  4J8F A;  3CEQ A;  1EPU A;  2L0I A;  1LD8 A;  4FHJ A;  3FU0 A;  2CFZ A;  3OXF A;  2XEE A;  5D0Q D;  1HU3 A;  4UI9 C;  4G11 A;  1KT0 A;  1WM5 A;  1W3B A;  5C2Y A;  3LDZ A;  1TNY A;  4EZJ A;  3FU5 A;  2VSN A;  2A4Z A;  2M63 A;  2WXQ A;  2ETA A;  3ENE A;  3QOU A;  3ZYQ A;  4I43 A;  3G2W A;  4AY5 A;  2WXN A;  2VJ8 A;  3Q7A A;  3LY8 A;  3KSL A;  3Q79 A;  1DNP A;  2Y69 E;  3EUV A;  3V2O A;  3CVL A;  4N39 A;  1Q2Z A;  3BEE A;  4APF A;  2XEV A;  4H7X A;  2KXP C;  4GPK A;  1E8Z A;  4UWL A;  1DCE A;  4WNF A;  3PEV B;  4GMR A;  2OVF A;  3ZW3 A;  3E32 A;  1L5J A;  4J8E A;  5FT9 A;  3U9W A;  1N52 A;  3ZXP A;  4DX2 A;  3TWW A;  2P58 C;  4YDY A;  1EF1 C;  2OVB A;  3CVP A;  3MKR A;  3PZ4 A;  4AV7 A;  2WXO A;  4DK5 A;  4YDO A;  4EEC A;  1MJ0 A;  3KEA A;  3NZS A;  4G23 A;  3MCX A;  3R7Q A;  1HG5 A;  5FTP A;  2YIN A;  5G55 A;  4N3C A;  3D9O A;  3KSQ A;  4UWF A;  2XQ0 A;  4G8L A;  3IKO B;  1YCS B;  5D0O D;  4CZ2 D;  3RKV A;  4H7Y A;  5LCW J;  1QZ2 A;  5FQ8 A;  3QWP A;  3TAX A;  4J0U A;  3B7U X;  3V30 A;  4AVX A;  4XZ4 A;  1NA0 A;  1OCZ E;  4UQZ A;  3RO2 A;  3D9J A;  5AAR A;  4UUC A;  1HO8 A;  2QC9 A;  4NUR A;  2JEK A;  2OEW A;  2XGO A;  4DJA A;  1H2V C;  3FH8 A;  3D9L A;  4FUL A;  3E30 A;  4FLH A;  3AG1 E;  4RQI A;  3TWQ A;  4KZ0 A;  1TJC A;  3L17 A;  5G2N A;  5FIO A;  1E8Y A;  3CVU A;  3ZXS A;  1TEZ A;  3CR3 A;  1SVX A;  4KBQ A;  5EYL A;  2KC7 A;  4ANV A;  5FQ6 A;  1X81 A;  4TV3 A;  1UN8 A;  3FTZ A;  3L9T A;  2IOL A;  1N4Q A;  2WXP A;  4JA9 A;  4F1P A;  5EDS A;  1TNB A;  4WND A;  4HQD A;  3CST A;  1AP7 A;  3LYA A;  1OWP A;  4GMJ A;  4BFR A;  5KNH D;  4J8Y A;  4RG6 A;  5BV1 A;  3JUI A;  2P2C P;  4AM9 A;  3IXE A;  3LY7 A;  3Q9N C;  3W9F A;  3CHR A;  4KVO A;  1JCR A;  2AW6 A;  3ZEF A;  3FUJ A;  4OVU A;  1MZC A;  3PZD A;  3ULE G;  3MGB A;  3UKR G;  2EIK E;  1MHQ A;  3EHQ A;  3Q49 B;  3SQV A;  5AYW D;  3UT8 A;  3FUF A;  5KCM A;  1JCQ A;  5CEA A;  4CEM A;  3MV3 B;  3UM3 A;  1TN6 A;  2J9Q A;  3AG4 E;  3ASG A;  3SO8 A;  3JQ1 A;  3CHQ A;  4TUU A;  4BY6 A;  3NB2 A;  4TXQ A;  3OAW A;  3SD5 A;  4G26 A;  1H0A A;  3BG1 B;  3SBS A;  2FI7 A;  5KJM A;  4HOS A;  3ZYM A;  4LSZ E;  3FFL A;  2GGF A;  1FCH A;  2QYJ A;  3SZ7 A;  3RRM B;  3JXI A;  4EZK A;  2J09 A;  3GZS A;  5AAO A;  4RSY A;  3CVX A;  3ONK A;  5KNG A;  4I17 A;  4MLP A;  3HXC A;  4XI9 A;  4G1T A;  4GZ6 A;  4F6R D;  3CQG B;  3ML8 A;  2MRI A;  3VTX A;  3ASN E;  4A63 B;  4FU3 A;  4GML A;  4NRH B;  2WPV A;  4CDR A;  4GA0 A;  1H2T C;  3SBT B;  4PH4 B;  3RK6 A;  1XGW A;  3UT4 A;  1Z5S C;  3B7T A;  3FTY A;  5G05 J;  5HQ8 A;  1ZB1 A;  2P9S G;  4AIF A;  4AOF A;  3RO3 A;  2UY1 B;  3FWV A;  2HE0 A;  4XKB A;  4JW1 A;  2HO1 A;  2LUH A;  2WMN A;  4XEI G;  4HOT A;  4JHR A;  2YQ8 A;  4GTV A;  4U04 A;  4EBA A;  4LRZ A;  1TR4 A;  1WG0 A;  4RVB A;  4OAU C;  5EIL A;  2ZGG A;  2DVW A;  1E8X A;  3L6A A;  2WQH A;  3FUH A;  1TN8 A;  2X3M A;  4Q69 A;  2WXM A;  1A17 A;  3APC A;  1BPO A;  2R2L A;  3FU6 A;  1N9A A;  2Y4T A;  5LP0 A;  4C0E A;  1V54 E;  5ENQ D;  4NQ0 A;  3G2V A;  3CVW A;  1JWG A;  1OWL A;  1WAO 1;  2LSV A;  3QWW A;  2R5S A;  1TJF A;  4P29 A;  3GW4 A;  4K0R A;  2KM4 A;  3B13 A;  4HVB A;  3FTX A;  1OXJ A;  1OT8 A;  3C3O A;  3FUL A;  1N11 A;  4N5C A;  4WWN A;  5FIN A;  4HBD A;  3QK0 A;  2NC9 A;  3HG0 D;  3ABK E;  3EIJ A;  5KBA A;  4U07 A;  2VSY A;  2IY0 C;  4HNA D;  1FT1 A;  3K9I A;  4GTQ A;  4FC8 A;  2MYO A;  5AIJ A;  1Z6T A;  5J90 A;  4HB5 A;  1JCS A;  4WNG A;  3ZHE B;  3N71 A;  1UW4 B;  1OWO A;  5HS0 A;  5LCW C;  3S2A A;  3PDN A;  5EX0 A;  4NIK A;  3O48 A;  3PH0 C;  1N94 A;  2PM7 A;  1BI8 B;  2EIN E;  3CK8 A;  3MEK A;  3IBE A;  3F6Q A;  1A5E A;  1UG3 A;  3L54 A;  4I6J A;  2VSO E;  4HI9 A;  3HDX A;  2QY7 A;  4XI0 A;  1N0R A;  3PUK A;  2UWJ G;  3U64 A;  4KXK B;  2J8S D;  2GW1 A;  4BTB A;  2ETB A;  4B8A A;  3PE4 A;  4URK A;  3NAW A;  2J49 A;  1QYM A;  4I1A A;  4GA1 A;  1LD7 A;  2VTB A;  3D3M A;  2DWZ A;  5LX8 A;  4EQF A;  3LVR E;  3ULY A;  3D9P A;  4UQY A;  4ANX A;  1INZ A;  2H6H A;  2XS8 A;  3I4G A;  3Q9U C;  1KLX A;  3TWU A;  4WUY A;  3UXG A;  3ISM C;  5CCL A;  1QQE A;  4GZC A;  5LFA A;  2CHW A;  2BUG A;  3D9K A;  2GRL A;  3S7F A;  4OAV B;  4JZY A;  3UKU G;  4GU5 A;  4JPS A;  3ZGQ A;  4LG6 A;  3MKQ A;  4LNU D;  2B6C A;  2WB2 A;  2VSX E;  3NOG D;  3IEG A;  1HE8 A;  2DBA A;  4U8H A;  2R02 A;  2V5Q C;  2I6H A;  2XRZ A;  4MBG A;  3IHV A;  5ENN A;  5ITZ F;  2VGY A;  4A3T A;  2LXM A;  3CHS A;  2CHZ A;  2P9L G;  3TWX A;  2E0I A;  4WWO A;  2KAT A;  4A1G A;  2WXH A;  4FP7 A;  3PZ3 A;  4ZFH A;  1K3Z D;  4ANU A;  1E7V A;  3AAA C;  3LCA A;  3PZ2 A;  1HH8 A;  4UWG A;  2I1K A;  4IUL A;  4LNG A;  1NL4 A;  5B1A E; 
#chains in the Genus database with same CATH homology
 5EID A;  4BSZ B;  3TWQ A;  3V31 A;  1QYM A;  3ZUV B;  3EU9 A;  4U95 D;  2QYJ A;  4N5Q A;  4DX1 A;  2V4H C;  2XEN A;  2XZD G;  5FIO A;  1MYO A;  2BKG A;  3JXI A;  3T9K A;  5CER B;  5HKP A;  1BU9 A;  5ENP D;  2DWZ A;  1OT8 A;  4HI8 A;  1MX4 A;  5AAO A;  1IXV A;  5ENT D;  1N11 A;  4O1P A;  4BEP A;  5AQ9 A;  5JMN D;  4CYM D;  5KNG A;  5FIN A;  2AJA A;  4HBD A;  5AN8 A;  5BXU A;  2ZGD A;  3HG0 D;  1SVX A;  1BD8 A;  2A5E A;  1NFI E;  3J5Q B;  3EHR A;  2DZN A;  3V2O A;  5KBA A;  5EYL A;  2VGE A;  1SW6 A;  2Y1L E;  4HNA D;  4K5B A;  3Q9U C;  2BKK B;  4TUM A;  4F6R D;  2KXP C;  3B95 A;  4QFV A;  3TWU A;  2B0O E;  3UXG A;  4A63 B;  5CBN A;  3NBN B;  1K1B A;  1DC2 A;  3UI2 A;  4HLL A;  3B7B A;  4J7W A;  4BER A;  5CEC B;  5AQB A;  4F1P A;  2MYO A;  4HRM B;  4HQD A;  1UOH A;  4GMR A;  2DZO A;  4DRX E;  4U96 D;  3JXJ A;  2KBX A;  4K5A B;  1AP7 A;  5ENS D;  2F37 A;  4HB5 A;  1N0Q A;  4OAV B;  3W9G A;  4DX2 A;  1YYH A;  4YDY A;  3TWW A;  2RFA A;  5EYP F;  4LG6 A;  5KNH D;  4J8Y A;  3TWS A;  4LNU D;  4DX6 D;  1BLX B;  4DX5 D;  3D9H A;  2NYJ A;  1OY3 D;  2HE0 A;  5HS0 A;  2FO1 E;  2P2C P;  5JA4 D;  1D9S A;  4G8K A;  4GPM A;  3V2X A;  3IXE A;  3ZNG A;  3NOG D;  1MJ0 A;  1MX6 A;  1IHB A;  3TWT A;  3V79 K;  3Q9N C;  1YMP A;  3KEA A;  4DUI A;  3W9F A;  3ZKJ A;  5KWD A;  5CBO A;  3UTM A;  4Z68 A;  4NIK A;  2V5Q C;  4BET A;  5EIB E;  2F8Y A;  5ITZ F;  4B93 B;  1BI8 B;  1K1A A;  1TR4 A;  4G8L A;  1YCS B;  4RLY A;  4C48 B;  5BXO A;  4CZ2 D;  1AWC B;  1WG0 A;  3EHQ A;  4OAU C;  4ZHB A;  5EN5 D;  2XEE A;  3AJI A;  2L6B A;  4JB8 P;  5D66 A;  4HRL A;  1S70 B;  3F6Q A;  5EIL A;  2ZGG A;  3V30 A;  4BES A;  5CEA A;  1A5E A;  2DVW A;  3TWR A;  5CED B;  3TWX A;  2Y0B G;  1BI7 B;  2RFM A;  3LJN A;  4HI9 A;  5ENR D;  1MX2 A;  4ATZ D;  2PNN A;  1WDY A;  2XEH A;  3NOC D;  4YDW A;  4O1O A;  5AQ7 A;  4DX7 D;  1IKN D;  1N0R A;  4ZFH A;  2JAB A;  5AAR A;  3DEP A;  1K3Z D;  4UUC A;  3SO8 A;  2QC9 A;  3C5R A;  3J5P A;  3AAA C;  4K5C A;  5AQA A;  3T8K A;  4LSZ E;  3DEO A;  4U8V D;  3HRA A;  2J8S D;  4U8Y D;  1G3N B;  5ENQ D;  5HRY A;  4O60 A;  4HRN A;  4QQI A;  3TWV A;  2ETB A;  2ETA A;  5ENO D;  2XZT G;  3ZU7 B;  2F8X K;  1DCQ A;  2ETC A;  3JUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...