5FZRA

Designed tpr protein m4n delta c (cf i)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
107
structure length
107
Chain Sequence
NSIKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNNIKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNNIKTLSNLAVLLAQEGKAEEAIKYMRKAVSLIDKAAKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords DESIGNED TPR PROTEIN
publication title Origin of a folded repeat protein from an intrinsically disordered ancestor.
pubmed doi rcsb
source organism Synthetic construct
total genus 44
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5fzrA00
1KT1A 2YHCA 2VGYA 3CKCA 3UPVA 4AM9A 1A17A 4I1AA 2UY1A 3ZPJA 5EX0A 3WXXA 3LCAA 5BW8C 1ELRA 5G05J 2LSVA 4YVOA 4XI9A 2VGXB 5JJTA 5BNWA 1Y8MA 1WM5A 2MHKA 1ELWA 3E4BA 3Q4AB 3K9IA 3R9AB 3LPZA 3PDNA 4WNDA 4G2VA 3HYMB 3QDNA 3MA5A 5FJYA 4JHRA 4N3CA 4AY6A 4U07A 4GZ3A 4KXKB 4LEUA 5KJMA 3KS2A 4U0ZA 1YA0A 3LY9A 4I2WA 3ZHEB 4GPKA 2WPVA 4EQFA 1NZNA 3KAEA 3SZ7A 1HZ4A 5JJ6A 1W3BA 3ASDA 4NQ0A 5D0QD 3PE3A 4KYOB 1QZ2A 4NRHB 3QWWA 3ULQA 2XPIA 3UQ3A 5A7DB 3RU0A 4GYOA 3ZGQA 4A1SA 4N39A 3RJVA 3FP3A 2XGOA 2WQHA 3QWPA 1E96B 2KCVA 4W9RA 2VQ2A 2R5SA 5G05C 2I6HA 3O48A 2V5FA 4G25A 4XI0A 3BEEA 2XGMA 4BT9A 3CVLA 4WNGA 3CV0A 3N71A 5LCWC 3LY7A 4RG6A 2FO7A 5KJNA 4GCNA 5EX3A 1XNFA 5CCMA 4N2QA 3S7JA 1HH8A 2FEZA 2XCBA 4GA0A 5M72A 2JLBA 3QWVA 5FZSA 3ASFA 3MEKA 3CK9A 1TJCA 4GCOA 3GYZA 2KC7A 4GZ6A 3GZ2A 4BTAA 2OOEA 2IF4A 5KJKA 1KT0A 3S7FA 3UUXA 4WNEA 3CK8A 5FT9A 3CKBA 2VSYA 3ASHA 2FBNA 4N3BA 4XIFA 3CVQA 3SF4A 3TAXA 3ASGA 2NC9A 2PQRA 4YNDA 3TG4A 4H7XA 2UY1B 3NF1A 5BT1A 4G24A 5DBKA 4UQYA 4UI9K 2FI7A 3KD7A 4IN3B 1FCHA 4CGWA 4WUYA 3ZFWA 5CHEE 3QOUA 2C0LA 3ZN3A 5AYWD 4ABNA 2GW1A 3FWVA 4GA1A 2E2EA 2FF4A 2LNIA 4UI9C 3GW4A 4I2ZA 2AVPA 2VYIA 3RO2A 2HR2A 1QQEA 5C1DA 2HYZA 1IHGA 3Q15A 2QFCA 5DIZA 5FZRA 1P5QA 4BT8A 4F3VA 3TGOA 3AS8A 4G1TA 3CEQA 4J8EA 3LKUA 3IEGA 3Q5MA 5G04J 5HQ8A 4RG9A 4N5CA 3S7BA 4J0UA 5HI7A 3S7DA 1NA3A 4JL0A 3RO3A 4AY5A 3CVPA 4UQXA 2P58C 4U04A 2LSUA 2VGXA 4I17A 2PL2A 2XGSA 1PC2A 3AS4A 4O6FA 2BUGA 2XCCA 3LY8A 3CK7A 3VTYA 1WAO1 3MV3B 3MV2B 3RIBA 4APOA 3LYAA 5CCLA 1ZBPA 4U0UA 5EKQD 4KBQA 2UWJG 4GYYA 3U4TA 5D0OD 3ZHEA 2J9QA 1IYGA 4CGVA 5KJLA 4J8DA 3AS5A 3JYSA 3ESKA 4BWRA 4N3AA 2KCLA 4HOQA 2KCKA 2XEVA 2YQ8A 5A6CA 5LCWJ 5G04C 3QKYA 4G26A 3EDTB 4I9CA 4JA7A 4GZ5A 2VSNA 4I9EA 2KATA 2PQNA 4Y6CA 5FTPA 3CVNA 2Y4TA 4J8FA 4HOUA 4ME2A 2ONDA 3Q47B 3OXFA 1KLXA 2Q7FA 3FFLA 4AIFA 4HOTA 4B94A 3OXGA 4HORA 3RKVA 5JJ7A 3TG5A 2PZIA 4WNFA 4GYWA 4UQZA 4BTBA 4G23A 4U0SA 2IFUA 3MKRA 5ARGA 4H7YA 2DBAA 3U3WA 4HOSA 5ARFA 1B89A 3VTXA 3Q49B 4Y6WA 4CDRA 3OXLA 3GZ1A 3PE4A 2HO1A 1HXIA 1OUVA 5FZQA 4JA9A 4YVQC 2L6JA 2C2LA 4GA2A 1ZU2A 3URZA 4N2SA 2Y4UA 4UI9J 2C0MA 1NA0A
chains in the Genus database with same CATH superfamily
2L9BA 3DSVA 1A17A 4I1AA 4I6GA 4LNBA 2XPYA 3ONKA 5AQAA 3L16A 3LCAA 4AXHA 3JXJA 2ETBA 1HF8A 4MS6A 5FWQA 1SW6A 3EHMA 1JCSA 4YVOA 2BEDA 2PNNA 2VGXB 5EDSA 2WXQA 4ZHBA 1ELWA 1H0AA 4UWLA 5D66A 3LPZA 5LP0A 5JA4D 4WNDA 4M3OA 3E37A 3L6AA 4LERA 3MA5A 3QAQA 4JEHA 3DWLG 4AY6A 4XX5A 4DX1A 3FTSA 4U07A 3D9OA 1HE8A 2NYJA 2XRZA 4JW1A 3KS2A 3CVVA 4U0ZA 3LY9A 3MJWA 2F8XK 1LF8A 2XENA 2I2OA 4EQFA 4ILIA 3T5VA 3QB2A 3ASDA 4KZ0A 4NQ0A 5D0QD 2V4HC 2J8SD 4F1SA 3QWWA 3ZYQA 3U66A 5A7DB 3RU0A 2XZDG 4A1SA 3RJVA 3QNKA 5C2YA 1XGWA 3QWPA 3VLFA 2DVWA 1NL4A 2J4DA 5EYPF 2VJ8A 4HRLA 2R5SA 2P9SG 3UM2A 2VTBA 2V5FA 3C3RA 3LVRE 2OV8A 3PVLA 4JC8A 3HRAA 4Q69A 1U3DA 2BKKB 3CVLA 1MX6A 1TN7A 3KEZA 4DX2A 3B95A 4RG6A 3TWQA 2FO7A 5KJNA 4GCNA 4EECA 2XEHA 1S64A 3V31A 3ASOE 4PH4B 3D9PA 2IOSA 4FA6A 3ZW3A 3LXUX 3S7JA 4HBDA 3JUIA 1UJJA 3SY2A 1H6KA 4TXRA 5LOZA 4BX8A 2DWZA 3F6QA 2VTBB 4XEIG 3E34A 2EQXA 3Q78A 4BTAA 4TUMA 3PZDA 3UM1A 3TXMA 3Q9UC 4ATGA 2XHEA 3DPDA 2IEJA 5AAOA 3W9FA 1ZB1A 3ASNE 4DX6D 1E7VA 4N3BA 3LJNA 4HI8A 1NFIE 2GRLA 1E8ZA 3TAXA 4K5BA 4DX7D 3BUAA 4B8AA 2KZTA 4H7XA 3ML9A 1EDUA 5CERB 2ZGDA 3T8MA 3RSEG 1OWLA 4L2LA 5E75A 3ABKE 4IN3B 2P2CP 1QYMA 4Q94A 2C0LA 4ABNA 2GW1A 3FWVA 3FTUA 4GA1A 2WM9A 3J5QB 4TV3A 3ONLA 5AQ9A 3G2UA 2EIME 1AP7A 4CYMD 2AVPA 2VYIA 3ZEFA 4FU3A 2WVIA 3NQPA 2LXLA 3HXDA 4AP2A 4A3VA 5DIZA 1P5QA 5B1BE 4O1OA 3X2QE 1Q2ZA 2LAHA 3BG0B 3IV0A 2OVFA 3CEQA 3IEGA 4HRNA 4EBAA 4GTQA 3PEVB 1YYHA 3FU3A 1BD8A 4L7TA 3SGHA 4B8CB 3FU6A 4JL0A 3RO3A 3CVPA 1PAQA 4UQXA 1IQRA 3QARA 3JQ0A 3EJNA 3UX4A 2P9IG 3FTZA 3D9HA 2XGSA 2ZU6B 1O1SA 4L2YA 1TNZA 3NAWA 3AS4A 4BY6A 3CSTA 1N4QA 4RSYA 3Q73A 2QY7A 3MGBA 2XCCA 1DCQA 2PM6A 1SZAA 3B7RL 2ZXWE 3SFXA 4OVVA 4U0UA 2GGFA 4KBQA 1LD7A 2I1JA 3ZHEA 5KJLA 4I43A 3SI5A 3HVEA 3AS5A 4TUUA 3U64A 2DCPA 3D9IA 5HS0A 1RW2A 3CHPA 4GTMA 4MKTA 3UIPC 5FQ7A 4EZJA 1JWFA 4BEPA 4G26A 4I9CA 1UOHA 4GZ5A 1BPOA 2VSNA 3Q75A 5JHAA 2WXJA 2Y4TA 1SA5A 4J8FA 2BTDA 2IJGX 4ACKA 2ONDA 3Q47B 1HS6A 2RFAA 1IKND 4P29A 3FFLA 4B94A 4HORA 3TL5A 2PZIA 3G2TA 4U95D 3DEPA 2A4ZA 3CIAA 3D3MA 1WDYA 3KSQA 3MKRA 2R03A 3E30A 4J6IA 1K1BA 2QYJA 2GROB 3V79K 3T9KA 2RFMA 3SNXA 1N11A 3HIZA 3UI2A 4CDNA 3CLJA 3NZSA 1IHBA 3Q49B 4CZ2D 5FIOA 3FY4A 5B3SE 3OXLA 3GZ1A 3PE4A 3ZIMA 2CFUA 3OAWA 1OUVA 4O60A 3B7UX 2R05A 5T4YA 4JA9A 4Z68A 2C2LA 3I5PA 1N95A 3FH7A 3BU8A 5ITZF 2Y4UA 2F37A 2XS8A 4A3TA 4UI9J 4EHMA 2C0MA 3UTMA 5BUZA 3L17A 1V54E 4XKBA 2UY1A 3WXXA 3ENEA 1HG2A 2X3MA 3DSUA 4WAFA 4XI9A 1FVHA 4JVSA 1YCSB 3FUFA 5JJTA 2RG8A 3RRUA 1Y8MA 2WXOA 3C72A 3FTXA 3CVUA 3E4BA 3Q4AB 3LEWA 3K9IA 3R9AB 1SQMA 3CQGB 2BF0X 3I3NA 5HRYA 4U7EB 1D9SA 5FJYA 1MJ0A 2GRPB 1N4SA 4QFVA 5BV0A 4LEUA 5KJMA 5KCMA 3UIOC 4JHJA 1SVXA 2VSXE 1JUQA 3PE3A 4KYOB 5CMYA 1OXJA 3EU5A 2XPIA 3UQ3A 3PZ4A 4U8HA 4N39A 2WXHA 3HXCA 2WQHA 4XKCA 3ZXPA 2XPZA 4GTVA 3UMVA 2OCCE 3JQ1A 4F53A 3PUKA 1Z5SC 1DVPA 1HO8A 1PY1A 3TWUA 2I6HA 4JHKA 3UXGA 4C48B 1TNYA 4GTPA 2AWIA 3T5XA 4DJAA 4G25A 3LJ3A 2J08A 1LTXA 2XGMA 3AG3E 5AENA 3LY7A 1X81A 5EX3A 3UKRG 4MLPA 2X6FA 1XNFA 3UT7A 4DPRA 2IONA 2XCBA 5M72A 1OT8A 3QWVA 3CK9A 3FDHA 4APFA 3GYZA 2KC7A 2P9UG 1Z6TA 3GZSA 1WG0A 4BESA 1MX2A 5LFAA 2Y3AA 5EIDA 3UM3A 3NBNB 1N4PA 5FT9A 3CKBA 1S63A 2YNQA 4EZKA 4GMRA 2HE0A 2NXPA 1E8YA 3JUEA 3UKUG 2B0OE 3ASGA 1H19A 2I1KA 5T3RA 2WXMA 4YNDA 3L22A 3NF1A 5BT1A 3ABLE 4J7WA 5AN8A 3RRMB 4HB5A 2FI7A 3QJZA 3AAAC 3G2VA 2E2EA 2FF4A 1Y6IA 2LNIA 4PS7A 4I2ZA 2AXUA 2HR2A 1QQEA 2J4BA 3QK0A 2HYZA 3B7SA 2DZOA 4OAVB 3TWWA 1UG3A 5CRVA 2RKKA 3ULEG 4F3VA 3IKOB 4UWKA 3NOGD 2YINA 4HFGA 4G1TA 2V8SE 4J8EA 3T8KA 5EILA 1O5MA 3CQCB 3C98A 5HQ8A 4RG9A 4CT4A 1OWOA 4N5CA 1OCZE 1V55E 1Z3XA 3W9GA 4PS8A 2DIWA 5AQBA 3S7BA 5HI7A 3APFA 4GTOA 4AY5A 5AJLA 4HVBA 4NIKA 1FPPA 2BKGA 2KBXA 3ISMC 1L5JA 3ZYLA 2V4LA 2LSUA 4I17A 2PL2A 2XZTG 2ETCA 5KNHD 1FT2A 4O1PA 1H6OA 1PC2A 3AG2E 1OWPA 3APDA 2LXMA 1G3NB 5E76A 3LY8A 3CK7A 4TXPA 3RRNB 3VTYA 3DPYA 3MV3B 2MOWA 3IHVA 2DYSE 3RIBA 3LYAA 1TR4A 4LCTA 3FU5A 1NP7A 3U9WA 3D9KA 4LUNU 3U4TA 3ZU7B 1IYGA 4CGVA 2CFZA 4I6JA 3JYSA 3ESKA 3B7BA 2OEWA 4C0EA 4HLLA 5ENNA 2WMOA 1N52A 2XEVA 5AIJA 5CEAA 3L54A 5A6CA 1GW6A 1KPSB 2X6JA 2HM8A 4JA7A 4CEMA 1K8KG 3P2BA 1IQUA 2PQNA 2WXGA 4BX9A 4HOUA 3OTNA 1IXVA 2Q7FA 4OYSA 1LD8A 5JJ7A 3TG5A 4EZLA 3CR3A 1BI8B 4GYWA 4HLEA 1K3ZD 4G23A 3B13A 2KZTB 4U0SA 2YHEA 1SA4A 2WXFA 3MZLB 3TWRA 2DZNA 3U3WA 4FADA 2OVBA 4HOSA 3V30A 5ARFA 4DUIA 3D9NA 3CHRA 3CHOA 5ENPD 4L1BA 4CDRA 5CECB 4U96D 3LVQE 4HRMB 2AW6A 2HO1A 3CVXA 4ILHB 4E6HA 5FZQA 4YVQC 4GA2A 5CMWA 4UWHA 3SHFA 2AJAA 3LS8A 1NA0A 1KT1A 2YHCA 5H7PA 4DLQA 4AV7A 3TXNA 2VGYA 4AM9A 3ZXSA 3FTYA 3ZPJA 3D9JA 3FEYA 2FO1E 3TWVA 5BW8C 1U3CA 5G05J 5IY5E 3PH0C 2LSVA 4FHKA 3ZNGA 2GRQB 4A1GA 5J08A 2E0IA 5EN5D 4B89A 5BNWA 1N4RA 3DXMG 3G2SA 4YDYA 4LNGA 3PUJA 2L6BA 4FP7A 1K1AA 2ZISA 3HYMB 3ABME 3MX3A 4CDMA 2DYRE 4K5AB 4JHRA 4AEZC 4N3CA 1OWNA 1N0QA 5BXUA 2P9KG 3IBEA 1JWGA 3CHMA 4GZDA 4GZ3A 2WQ6A 1YA0A 2KM4A 4I2WA 3ZHEB 3PRZA 3L9TA 1TNBA 1NZNA 3SZ7A 4Q96A 3HVEB 5JJ6A 1W3BA 5KNGA 3MCXA 1QZ2A 3SBSA 2KXPC 4U8YD 4GYOA 2P9LG 3EIQC 3NOCD 1E96B 4GTTA 4I1OB 1N94A 4W9RA 2VQ2A 1HU3A 3O48A 4FHJA 4XI0A 4OAUC 2R2LA 3FU0A 4WNGA 3CV0A 2OEVA 3G2WA 3N71A 3PZ2A 5LCWC 2GRRB 2I9CA 1OCOE 3EHRA 3IHYA 1OCCE 2EINE 3E33A 4N2QA 5CEDB 4NURA 4ANUA 1O1RA 1OY3D 2FEZA 3VLDA 1N0RA 4ACLA 3MEKA 5ANRA 4U8VD 5BV1A 1HG5A 2R59A 1TJCA 3UT8A 2ILRA 3GZ2A 4N5QA 3P1UA 2RD0A 5LX8A 3EUVA 2OOEA 4A55A 2IF4A 1DCEA 4KVOA 4WWNA 4UUCA 1KT0A 3S7FA 3UUXA 2QYUA 3FUMA 4FLHA 2VSYA 5J90A 4X8QA 2FBNA 3ZRHA 3FTWA 1UN8A 5FQ6A 1TJFA 2WXRA 4BSZB 3SF4A 4KMOA 2NC9A 4GTSA 4PDXA 2PQRA 4WWOA 4MRUA 5G2NA 3V2OA 2UY1B 1E8XA 4JB8P 3AU5A 3TWXA 5DBKA 4UI9K 3KD7A 3SQVA 4CRWA 4XZ4A 4CGWA 3SFZA 3AG1E 4WUYA 3QOUA 5AYWD 2CHXA 4L23A 1MX4A 2X6KA 3Q9NC 2H6IA 4UWFA 3R9MA 1IHGA 3Q15A 5BXOA 5FZRA 4BT8A 2WXKA 2R02A 1BI7B 2H6FA 3VLEA 3R7QA 2QZAA 5G04J 1E90A 5BPPA 4FULA 1QNFA 1O1TA 4G11A 4GTRA 3EIJA 1E8WA 1NA3A 1D8DA 3MYVA 5JHBA 1WY6A 4FLBA 3PS6A 2VGXA 2PM7A 2J09A 2ZIRA 1N9AA 2VSOE 1KZOA 1JCQA 1QBQA 1D8EA 1YMPA 1VDYA 4B0ZA 2CHZA 4JPSA 3CVYA 3DBSA 2Y0BG 2EILE 3DXKG 4APOA 3FUIA 5EKQD 5AARA 2UWJG 2CG2A 2F0YA 3DSXA 1A5EA 4C9BB 1NI1A 1ELKA 3D9MA 4J8DA 4BWRA 2YQ8A 4GMLA 1UJKA 5ENTD 3AJIA 2L0TB 5CRUA 1OCRE 4KT6B 4B93B 4DRXE 3EDTB 3UINC 5CBOA 4JD2G 4I9EA 3SFYA 1TYQG 3UT4A 2A5EA 5ENSD 2P9NG 4Y6CA 4L9PA 5FTPA 2XQ0A 1TN8A 4JZYA 2GRMA 3CHQA 3D9LA 3OXFA 1KLXA 5ANLA 1DC2A 4HOTA 3OXGA 4YDEA 4WNFA 2MYOA 4IYPA 4UQZA 3DSSA 4DK5A 1H2VC 2R17C 5ENOD 4KZCA 4C0MA 4AVXA 1EPUA 5A23A 4CT0A 4LRZA 3Q7AA 4EBAG 4U63A 1MYOA 3FTVA 4H7YA 2AXVA 1KZPA 4MBGA 2FULA 1BLXB 3ZYMA 3ZVVA 3VTXA 5D2MC 4YDOA 3FUNA 3FUKA 4Y6WA 3HXEA 4J8SA 2B6CA 1HXIA 4K0RA 3ULYA 1MQSA 4AJWA 2L6JA 3C3QA 3TWSA 1ZU2A 3URZA 4N2SA 1INZA 3ZKJA 4HS2A 3I4RB 4F1PA 5JMND 1H6PA 3CKCA 3UPVA 3ML8A 2J49A 4DI3A 1FT1A 4HNAD 5EX0A 3WG7E 2X38A 3Q7FA 3FUJA 1ELRA 3AG4E 4V3IA 2J07A 1BU9A 4K5CA 5B1AE 4TXQA 5FINA 4PS3A 3DSTA 3DSWA 1WM5A 3RK6A 2MHKA 2L0IA 2ETAA 4EPZA 3EHNA 1HFAA 1S70B 2V5QC 3PDNA 4A63B 3KSLA 4G2VA 3QDNA 3L82A 2VGEA 3PZ1A 3DRAA 3O4ZA 4FJYA 3ZUVB 4ANWA 3ESLA 1E7UA 4KXKB 3E32A 1H2TC 4YDWA 3V2XA 4GPKA 2WPVA 2X6IA 2WXLA 5EIBE 3KAEA 1SZ9A 1HZ4A 3L08A 3BQOA 3TWTA 1JCRA 4NRHB 1UN9A 3ULQA 1TNUA 3ZGQA 4ATZD 2JABA 3FP3A 4TRQA 2XGOA 2XS1A 2H6GA 4UWGA 4WWPA 2KCVA 5G05C 3UM0A 4CCAA 2NSZA 4G8KA 4IULA 3NB2A 3BEEA 4BT9A 3CGHA 3ZYKA 2MRIA 4OVUA 4LG6A 3B7TA 3CHSA 4G8LA 4AOFA 3HHMA 5KWDA 5CCMA 2CG3A 1HH8A 4GA0A 2WXIA 5T8IA 4JXTA 2X6HA 2JLBA 5FZSA 3ASFA 3SBTB 3MKQA 1FVFA 4GCOA 1MHQA 3KEAA 5AJDA 2WQ7A 4GZ6A 2EIJE 5KJKA 3SD5A 4WNEA 3CK8A 4PUCA 2JEKA 3J5PA 4HI9A 2LUHA 5ENQD 3PNTB 3ASHA 3FUDA 4XIFA 5CBNA 1OWMA 3APCA 3HDXA 3CVQA 4ZFHA 3FULA 4D10C 1MZCA 4RLYA 2WMNA 3FUHA 3TG4A 1X5BA 3MKQB 3SO8A 3JCKC 4F7AA 4GPMA 4FJZA 4G24A 2A5UA 4UQYA 4GZCA 2GRNB 3FH5A 3Q79A 1TN6A 3L13A 1FCHA 4GMJA 3ZFWA 5CHEE 3ZN3A 4F6RD 1TEZA 3IXEA 4UI9C 3GW4A 4J8YA 3FH8A 4XE0A 3RO2A 3PNLB 1N54A 3DEOA 5C1DA 2WXPA 3FUEA 1UW4B 4BETA 3EU9A 2QFCA 1TNOA 3TGOA 3AS8A 3RAUA 2H6HA 3LKUA 4DI4A 3Q5MA 4IRUA 5G55A 2F8YA 4RQIA 4DX5D 4GAAA 1Z3YA 3FEXA 4J0UA 2IO2C 2P9PG 3C3OA 3S7DA 4LSZE 2P58C 3C5RA 4U04A 2IOLA 4GB9A 5HKPA 4ANVA 2Y1LE 4HXIA 5EYLA 1JPLA 2IU1A 4O6FA 2BUGA 4BSXA 4NACA 1S0PA 1WAO1 3HXFA 4GU5A 3MV2B 4RVBA 5CCLA 1ZBPA 3JXIA 3HG0D 4JEUA 2IQCA 4GYYA 5D0OD 4DLOA 3HXBA 5FQ4A 2J9QA 4N3AA 2KCLA 4HOQA 2KCKA 4KVMA 1H2UA 5LCWJ 4HQDA 5G04C 1RZ4A 4URKA 3QKYA 2WB2A 2Y69E 4R7LA 2AXZA 2KATA 4I1MA 3AU4A 3CVNA 4K03A 4ME2A 3I4GA 1HX8A 2IO3C 1DNPA 3PZ3A 1EF1C 4AIFA 2XEEA 3RKVA 2M63A 3NZUA 3EHQA 2IY0C 2EIKE 3S2AA 3R7RA 4BTBA 3PEUB 2IFUA 4BERA 3BG1B 2V0PA 5FQ8A 2ZGGA 5ARGA 3CSFA 2LAIA 1U2VG 2CHWA 1AWCB 2WXNA 2LO6A 4ILGA 5AQ7A 2DBAA 3FHEA 4FC8A 5ENRD 2XRYA 3LDZA 2QC9A 1B89A 4QQIA 3PREA 4LNUD 4M7CA 4BFRA 3CVWA 3QC1A 5KBAA 1EYHA 3TJPA 4E85A 4ANXA 4I6EA
chains in the Genus database with same CATH topology
1KT1A 2YHCA 4DLQA 2L9BA 4AV7A 3TXNA 5BUZA 2VGYA 3CKCA 3UPVA 3L17A 3ML8A 2J49A 4AM9A 1A17A 3ZXSA 4I1AA 4I6GA 4DI3A 3FTYA 4XKBA 2UY1A 2XPYA 3D9JA 3ONKA 5EX0A 3L16A 3ZPJA 2X38A 3FEYA 3WXXA 3LCAA 3ENEA 4AXHA 1HG2A 5BW8C 3FUJA 1U3CA 1ELRA 2X3MA 5G05J 3PH0C 1HF8A 4MS6A 5FWQA 4WAFA 3EHMA 2LSVA 4V3IA 4YVOA 4FHKA 4XI9A 4A1GA 5J08A 2J07A 1FVHA 4JVSA 2E0IA 2VGXB 5EDSA 3FUFA 5JJTA 2RG8A 3RRUA 4PS3A 4B89A 1Y8MA 5BNWA 2WXQA 2WXOA 1WM5A 3G2SA 3FTXA 2MHKA 2L0IA 1ELWA 3RK6A 3CVUA 1H0AA 4EPZA 3E4BA 4UWLA 3EHNA 1HFAA 3LEWA 3PUJA 3K9IA 3Q4AB 3R9AB 4FP7A 3LPZA 1SQMA 3CQGB 3PDNA 5LP0A 2BF0X 4WNDA 4M3OA 4G2VA 3I3NA 3HYMB 3QDNA 3L6AA 3MX3A 4CDMA 4LERA 3MA5A 3QAQA 3O4ZA 4JEHA 5FJYA 4JHRA 4AEZC 4FJYA 4N3CA 1OWNA 4AY6A 4XX5A 3IBEA 1JWGA 3FTSA 3CHMA 4U07A 3D9OA 4ANWA 4QFVA 1HE8A 4GZDA 5BV0A 3ESLA 1E7UA 4GZ3A 4KXKB 2XRZA 4LEUA 4JW1A 5KJMA 3KS2A 3CVVA 2WQ6A 4U0ZA 1YA0A 1H2TC 2KM4A 3LY9A 3MJWA 4I2WA 5KCMA 3ZHEB 4GPKA 1LF8A 2WPVA 2X6IA 2WXLA 3PRZA 4JHJA 2I2OA 4EQFA 1NZNA 3KAEA 3SZ7A 4ILIA 1SZ9A 3T5VA 4Q96A 3HVEB 1HZ4A 3QB2A 1W3BA 5JJ6A 2VSXE 3ASDA 3L08A 1JUQA 3MCXA 3PE3A 4KZ0A 4NQ0A 5D0QD 4F1SA 4KYOB 1QZ2A 5CMYA 3SBSA 4NRHB 3QWWA 3ZYQA 1UN9A 3ULQA 3U66A 2XPIA 3UQ3A 5A7DB 3RU0A 4GYOA 4U8HA 3ZGQA 4N39A 4A1SA 3RJVA 3FP3A 3EIQC 2WXHA 3QNKA 4TRQA 5C2YA 2XGOA 1XGWA 2WQHA 3QWPA 4XKCA 3VLFA 4UWGA 4WWPA 1E96B 2KCVA 2XPZA 2J4DA 3UMVA 3JQ1A 4I1OB 4W9RA 2VJ8A 2VQ2A 2R5SA 4F53A 1HU3A 3PUKA 1DVPA 1HO8A 5G05C 1PY1A 2VTBA 2I6HA 3O48A 2V5FA 3LVRE 3PVLA 2OV8A 4JHKA 4JC8A 4CCAA 4Q69A 2AWIA 2NSZA 3T5XA 1U3DA 4DJAA 4FHJA 4G25A 3LJ3A 4XI0A 4IULA 5M72A 2J08A 3BEEA 2XGMA 4BT9A 3CGHA 3ZYKA 2MRIA 3CVLA 4OVUA 3FU0A 4WNGA 3CV0A 3KEZA 3G2WA 3B7TA 5AENA 3N71A 5LCWC 3LY7A 2I9CA 3CHSA 4RG6A 2FO7A 3IHYA 5KJNA 4GCNA 4EECA 4AOFA 5EX3A 3HHMA 4MLPA 4PH4B 2X6FA 3D9PA 1XNFA 5CCMA 4N2QA 2IOSA 3UT7A 4FA6A 4NURA 4DPRA 3ZW3A 3LXUX 4ANUA 2CG3A 3S7JA 2IONA 1HH8A 2FEZA 2XCBA 4GA0A 2WXIA 3JUIA 4JXTA 5T8IA 3VLDA 1UJJA 2X6HA 1H6KA 2JLBA 3QWVA 5FZSA 4ACLA 3ASFA 3MEKA 5ANRA 5LOZA 4BX8A 3SBTB 5BV1A 1HG5A 2R59A 3CK9A 3MKQA 1FVFA 2VTBB 3FDHA 1TJCA 4GCOA 3UT8A 4APFA 1MHQA 5AJDA 2ILRA 3GYZA 2KC7A 4GZ6A 2WQ7A 2EQXA 1Z6TA 3GZ2A 4BTAA 3GZSA 3PZDA 3P1UA 2RD0A 5LX8A 2OOEA 4A55A 2IF4A 4KVOA 5KJKA 4WWNA 3SD5A 5LFAA 2Y3AA 1KT0A 3S7FA 3TXMA 3UUXA 4WNEA 3CK8A 4PUCA 3FUMA 2JEKA 4ATGA 4FLHA 5FT9A 3CKBA 2XHEA 2VSYA 5J90A 3DPDA 2YNQA 3PNTB 3ASHA 4EZKA 1E7VA 2FBNA 3FUDA 4N3BA 4XIFA 3ZRHA 2NXPA 1E8YA 3FTWA 1UN8A 5FQ6A 1TJFA 1OWMA 2WXRA 3APCA 3HDXA 2GRLA 3CVQA 3SF4A 3FULA 1E8ZA 3TAXA 3ASGA 4D10C 4KMOA 1H19A 2WMNA 3FUHA 2NC9A 2I1KA 4PDXA 2PQRA 4B8AA 5T3RA 4WWOA 2KZTA 2WXMA 4MRUA 4YNDA 5G2NA 3TG4A 1X5BA 3MKQB 2UY1B 4H7XA 3ML9A 3L22A 1E8XA 3NF1A 5BT1A 3AU5A 1EDUA 3JCKC 4F7AA 4FJZA 4G24A 5DBKA 2A5UA 4UQYA 3RRMB 3T8MA 4GZCA 2FI7A 4UI9K 3KD7A 3FH5A 1OWLA 3QJZA 4L2LA 5E75A 4CRWA 4IN3B 4XZ4A 3L13A 1FCHA 4GMJA 4CGWA 3SFZA 4WUYA 3ZFWA 5CHEE 3QOUA 4Q94A 2C0LA 3ZN3A 5AYWD 4ABNA 3G2VA 2CHXA 2GW1A 3FWVA 3FTUA 4GA1A 2WM9A 2E2EA 4TV3A 3ONLA 1TEZA 2FF4A 1Y6IA 3G2UA 4L23A 2LNIA 4UI9C 3GW4A 4PS7A 4I2ZA 2AVPA 2AXUA 2VYIA 3FH8A 4XE0A 3ZEFA 2X6KA 3RO2A 2HR2A 3PNLB 4FU3A 1QQEA 2J4BA 2WVIA 1N54A 3QK0A 4UWFA 2WXPA 5C1DA 3FUEA 1UW4B 2HYZA 3B7SA 3NQPA 1IHGA 3Q15A 4AP2A 1UG3A 4A3VA 2QFCA 5DIZA 5FZRA 1P5QA 4BT8A 2WXKA 4F3VA 2LAHA 3BG0B 3IV0A 3IKOB 4UWKA 3VLEA 2YINA 4HFGA 3TGOA 2OVFA 3AS8A 4G1TA 2V8SE 3CEQA 4J8EA 3LKUA 3IEGA 3CQCB 3C98A 3R7QA 4DI4A 3Q5MA 4IRUA 5G04J 5G55A 5HQ8A 1E90A 4RG9A 4CT4A 1OWOA 4N5CA 4GAAA 4EBAA 1Z3YA 1Z3XA 3FEXA 5BPPA 4FULA 1QNFA 3PEVB 4G11A 4PS8A 2DIWA 3FU3A 3S7BA 4J0UA 5HI7A 4L7TA 3EIJA 3APFA 3SGHA 4B8CB 3S7DA 1E8WA 1NA3A 3FU6A 4JL0A 3RO3A 4AY5A 3CVPA 3MYVA 5AJLA 5JHBA 1PAQA 4UQXA 4HVBA 2P58C 1IQRA 4U04A 1WY6A 4FLBA 3QARA 2IOLA 3JQ0A 3EJNA 4GB9A 3UX4A 1L5JA 3ZYLA 3PS6A 2V4LA 2LSUA 2VGXA 3FTZA 4I17A 2PL2A 2J09A 2PM7A 2XGSA 4ANVA 2VSOE 2ZU6B 4L2YA 1PC2A 4HXIA 3AS4A 4BY6A 3CSTA 1JPLA 4RSYA 2IU1A 1OWPA 3APDA 1VDYA 2QY7A 3MGBA 4O6FA 2BUGA 2XCCA 4B0ZA 2CHZA 3LY8A 2PM6A 4JPSA 5E76A 3CK7A 3CVYA 4BSXA 1SZAA 3B7RL 1S0PA 3DBSA 4NACA 3RRNB 3VTYA 1WAO1 3MV3B 2MOWA 4GU5A 3IHVA 3MV2B 3RIBA 4RVBA 4APOA 3LYAA 3FUIA 4OVVA 1ZBPA 4LCTA 4U0UA 2GGFA 5EKQD 4JEUA 5CCLA 3FU5A 4KBQA 1NP7A 2UWJG 3U9WA 3D9KA 2CG2A 2IQCA 4GYYA 4LUNU 3U4TA 5D0OD 4DLOA 2I1JA 3ZHEA 5FQ4A 2J9QA 4C9BB 1IYGA 4CGVA 5KJLA 2CFZA 4I43A 3SI5A 1ELKA 3D9MA 3HVEA 3AS5A 4I6JA 4J8DA 4TUUA 3JYSA 3ESKA 4BWRA 4N3AA 4C0EA 3U64A 2KCLA 2DCPA 3D9IA 4HOQA 2WMOA 5ENNA 3CHPA 4MKTA 2KCKA 1N52A 2XEVA 5AIJA 5FQ7A 2YQ8A 3L54A 4EZJA 1GW6A 5A6CA 4KVMA 1H2UA 5LCWJ 1JWFA 4GMLA 2X6JA 5G04C 1UJKA 2HM8A 4URKA 3QKYA 2L0TB 4KT6B 2WB2A 4G26A 3EDTB 4I9CA 4JA7A 4CEMA 4R7LA 4GZ5A 1BPOA 2VSNA 4I9EA 3UT4A 3P2BA 2AXZA 1IQUA 2KATA 2PQNA 2WXJA 4I1MA 5JHAA 4Y6CA 3AU4A 5FTPA 3CVNA 2Y4TA 2WXGA 4J8FA 2XQ0A 4HOUA 4BX9A 2BTDA 2IJGX 4K03A 4ME2A 4ACKA 3I4GA 2ONDA 3OTNA 3Q47B 1HX8A 4JZYA 1HS6A 1DNPA 2GRMA 3CHQA 3D9LA 1KLXA 3OXFA 4P29A 2Q7FA 1EF1C 3FFLA 5ANLA 4AIFA 4OYSA 4HOTA 4B94A 3OXGA 4HORA 3RKVA 3TL5A 5JJ7A 3TG5A 4EZLA 3CR3A 2M63A 2PZIA 4WNFA 3NZUA 3G2TA 4IYPA 4GYWA 4UQZA 2A4ZA 3CIAA 3D3MA 1H2VC 2R17C 4DK5A 4HLEA 3S2AA 3R7RA 4BTBA 4G23A 3B13A 3PEUB 4KZCA 2KZTB 4U0SA 4C0MA 2YHEA 2IFUA 3MKRA 3BG1B 4AVXA 1EPUA 2V0PA 5FQ8A 5A23A 4CT0A 4LRZA 5ARGA 2WXFA 3CSFA 4EBAG 4U63A 4J6IA 2LAIA 3FTVA 4H7YA 2CHWA 2AXVA 3MZLB 2WXNA 2LO6A 4ILGA 2DBAA 3FHEA 3SNXA 4FC8A 3U3WA 4FADA 3HIZA 2OVBA 2XRYA 4HOSA 2FULA 3ZYMA 4CDNA 3CLJA 3LDZA 5ARFA 3D9NA 3CHRA 3CHOA 3ZVVA 1B89A 3NZSA 3VTXA 3Q49B 4L1BA 3FY4A 3FUNA 3FUKA 4Y6WA 4CDRA 3PREA 3OXLA 3GZ1A 3LVQE 3PE4A 3ZIMA 2AW6A 4BFRA 4J8SA 2CFUA 2HO1A 3OAWA 3CVXA 3CVWA 1HXIA 1OUVA 3QC1A 4ILHB 4E6HA 5FZQA 3B7UX 4K0RA 5T4YA 4JA9A 4YVQC 1MQSA 4AJWA 2L6JA 2C2LA 4GA2A 1EYHA 1ZU2A 3TJPA 5CMWA 3URZA 4UWHA 3SHFA 3I5PA 4E85A 3FH7A 4N2SA 1INZA 4HS2A 3I4RB 2Y4UA 4A3TA 3LS8A 4ANXA 4UI9J 4I6EA 2C0MA 1NA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KT1 A;  2YHC A;  2VGY A;  3CKC A;  3UPV A;  4AM9 A;  1A17 A;  4I1A A;  2UY1 A;  3ZPJ A;  5EX0 A;  3WXX A;  3LCA A;  5BW8 C;  1ELR A;  5G05 J;  2LSV A;  4YVO A;  4XI9 A;  2VGX B;  5JJT A;  5BNW A;  1Y8M A;  1WM5 A;  2MHK A;  1ELW A;  3E4B A;  3Q4A B;  3K9I A;  3R9A B;  3LPZ A;  3PDN A;  4WND A;  4G2V A;  3HYM B;  3QDN A;  3MA5 A;  5FJY A;  4JHR A;  4N3C A;  4AY6 A;  4U07 A;  4GZ3 A;  4KXK B;  4LEU A;  5KJM A;  3KS2 A;  4U0Z A;  1YA0 A;  3LY9 A;  4I2W A;  3ZHE B;  4GPK A;  2WPV A;  4EQF A;  1NZN A;  3KAE A;  3SZ7 A;  1HZ4 A;  5JJ6 A;  1W3B A;  3ASD A;  4NQ0 A;  5D0Q D;  3PE3 A;  4KYO B;  1QZ2 A;  4NRH B;  3QWW A;  3ULQ A;  2XPI A;  3UQ3 A;  5A7D B;  3RU0 A;  4GYO A;  3ZGQ A;  4A1S A;  4N39 A;  3RJV A;  3FP3 A;  2XGO A;  2WQH A;  3QWP A;  1E96 B;  2KCV A;  4W9R A;  2VQ2 A;  2R5S A;  5G05 C;  2I6H A;  3O48 A;  2V5F A;  4G25 A;  4XI0 A;  3BEE A;  2XGM A;  4BT9 A;  3CVL A;  4WNG A;  3CV0 A;  3N71 A;  5LCW C;  3LY7 A;  4RG6 A;  2FO7 A;  5KJN A;  4GCN A;  5EX3 A;  1XNF A;  5CCM A;  4N2Q A;  3S7J A;  1HH8 A;  2FEZ A;  2XCB A;  4GA0 A;  5M72 A;  2JLB A;  3QWV A;  5FZS A;  3ASF A;  3MEK A;  3CK9 A;  1TJC A;  4GCO A;  3GYZ A;  2KC7 A;  4GZ6 A;  3GZ2 A;  4BTA A;  2OOE A;  2IF4 A;  5KJK A;  1KT0 A;  3S7F A;  3UUX A;  4WNE A;  3CK8 A;  5FT9 A;  3CKB A;  2VSY A;  3ASH A;  2FBN A;  4N3B A;  4XIF A;  3CVQ A;  3SF4 A;  3TAX A;  3ASG A;  2NC9 A;  2PQR A;  4YND A;  3TG4 A;  4H7X A;  2UY1 B;  3NF1 A;  5BT1 A;  4G24 A;  5DBK A;  4UQY A;  4UI9 K;  2FI7 A;  3KD7 A;  4IN3 B;  1FCH A;  4CGW A;  4WUY A;  3ZFW A;  5CHE E;  3QOU A;  2C0L A;  3ZN3 A;  5AYW D;  4ABN A;  2GW1 A;  3FWV A;  4GA1 A;  2E2E A;  2FF4 A;  2LNI A;  4UI9 C;  3GW4 A;  4I2Z A;  2AVP A;  2VYI A;  3RO2 A;  2HR2 A;  1QQE A;  5C1D A;  2HYZ A;  1IHG A;  3Q15 A;  2QFC A;  5DIZ A;  5FZR A;  1P5Q A;  4BT8 A;  4F3V A;  3TGO A;  3AS8 A;  4G1T A;  3CEQ A;  4J8E A;  3LKU A;  3IEG A;  3Q5M A;  5G04 J;  5HQ8 A;  4RG9 A;  4N5C A;  3S7B A;  4J0U A;  5HI7 A;  3S7D A;  1NA3 A;  4JL0 A;  3RO3 A;  4AY5 A;  3CVP A;  4UQX A;  2P58 C;  4U04 A;  2LSU A;  2VGX A;  4I17 A;  2PL2 A;  2XGS A;  1PC2 A;  3AS4 A;  4O6F A;  2BUG A;  2XCC A;  3LY8 A;  3CK7 A;  3VTY A;  1WAO 1;  3MV3 B;  3MV2 B;  3RIB A;  4APO A;  3LYA A;  5CCL A;  1ZBP A;  4U0U A;  5EKQ D;  4KBQ A;  2UWJ G;  4GYY A;  3U4T A;  5D0O D;  3ZHE A;  2J9Q A;  1IYG A;  4CGV A;  5KJL A;  4J8D A;  3AS5 A;  3JYS A;  3ESK A;  4BWR A;  4N3A A;  2KCL A;  4HOQ A;  2KCK A;  2XEV A;  2YQ8 A;  5A6C A;  5LCW J;  5G04 C;  3QKY A;  4G26 A;  3EDT B;  4I9C A;  4JA7 A;  4GZ5 A;  2VSN A;  4I9E A;  2KAT A;  2PQN A;  4Y6C A;  5FTP A;  3CVN A;  2Y4T A;  4J8F A;  4HOU A;  4ME2 A;  2OND A;  3Q47 B;  3OXF A;  1KLX A;  2Q7F A;  3FFL A;  4AIF A;  4HOT A;  4B94 A;  3OXG A;  4HOR A;  3RKV A;  5JJ7 A;  3TG5 A;  2PZI A;  4WNF A;  4GYW A;  4UQZ A;  4BTB A;  4G23 A;  4U0S A;  2IFU A;  3MKR A;  5ARG A;  4H7Y A;  2DBA A;  3U3W A;  4HOS A;  5ARF A;  1B89 A;  3VTX A;  3Q49 B;  4Y6W A;  4CDR A;  3OXL A;  3GZ1 A;  3PE4 A;  2HO1 A;  1HXI A;  1OUV A;  5FZQ A;  4JA9 A;  4YVQ C;  2L6J A;  2C2L A;  4GA2 A;  1ZU2 A;  3URZ A;  4N2S A;  2Y4U A;  4UI9 J;  2C0M A;  1NA0 A; 
#chains in the Genus database with same CATH topology
 2L9B A;  3DSV A;  1A17 A;  4I1A A;  4I6G A;  4LNB A;  2XPY A;  3ONK A;  5AQA A;  3L16 A;  3LCA A;  4AXH A;  3JXJ A;  2ETB A;  1HF8 A;  4MS6 A;  5FWQ A;  1SW6 A;  3EHM A;  1JCS A;  4YVO A;  2BED A;  2PNN A;  2VGX B;  5EDS A;  2WXQ A;  4ZHB A;  1ELW A;  1H0A A;  4UWL A;  5D66 A;  3LPZ A;  5LP0 A;  5JA4 D;  4WND A;  4M3O A;  3E37 A;  3L6A A;  4LER A;  3MA5 A;  3QAQ A;  4JEH A;  3DWL G;  4AY6 A;  4XX5 A;  4DX1 A;  3FTS A;  4U07 A;  3D9O A;  1HE8 A;  2NYJ A;  2XRZ A;  4JW1 A;  3KS2 A;  3CVV A;  4U0Z A;  3LY9 A;  3MJW A;  2F8X K;  1LF8 A;  2XEN A;  2I2O A;  4EQF A;  4ILI A;  3T5V A;  3QB2 A;  3ASD A;  4KZ0 A;  4NQ0 A;  5D0Q D;  2V4H C;  2J8S D;  4F1S A;  3QWW A;  3ZYQ A;  3U66 A;  5A7D B;  3RU0 A;  2XZD G;  4A1S A;  3RJV A;  3QNK A;  5C2Y A;  1XGW A;  3QWP A;  3VLF A;  2DVW A;  1NL4 A;  2J4D A;  5EYP F;  2VJ8 A;  4HRL A;  2R5S A;  2P9S G;  3UM2 A;  2VTB A;  2V5F A;  3C3R A;  3LVR E;  2OV8 A;  3PVL A;  4JC8 A;  3HRA A;  4Q69 A;  1U3D A;  2BKK B;  3CVL A;  1MX6 A;  1TN7 A;  3KEZ A;  4DX2 A;  3B95 A;  4RG6 A;  3TWQ A;  2FO7 A;  5KJN A;  4GCN A;  4EEC A;  2XEH A;  1S64 A;  3V31 A;  3ASO E;  4PH4 B;  3D9P A;  2IOS A;  4FA6 A;  3ZW3 A;  3LXU X;  3S7J A;  4HBD A;  3JUI A;  1UJJ A;  3SY2 A;  1H6K A;  4TXR A;  5LOZ A;  4BX8 A;  2DWZ A;  3F6Q A;  2VTB B;  4XEI G;  3E34 A;  2EQX A;  3Q78 A;  4BTA A;  4TUM A;  3PZD A;  3UM1 A;  3TXM A;  3Q9U C;  4ATG A;  2XHE A;  3DPD A;  2IEJ A;  5AAO A;  3W9F A;  1ZB1 A;  3ASN E;  4DX6 D;  1E7V A;  4N3B A;  3LJN A;  4HI8 A;  1NFI E;  2GRL A;  1E8Z A;  3TAX A;  4K5B A;  4DX7 D;  3BUA A;  4B8A A;  2KZT A;  4H7X A;  3ML9 A;  1EDU A;  5CER B;  2ZGD A;  3T8M A;  3RSE G;  1OWL A;  4L2L A;  5E75 A;  3ABK E;  4IN3 B;  2P2C P;  1QYM A;  4Q94 A;  2C0L A;  4ABN A;  2GW1 A;  3FWV A;  3FTU A;  4GA1 A;  2WM9 A;  3J5Q B;  4TV3 A;  3ONL A;  5AQ9 A;  3G2U A;  2EIM E;  1AP7 A;  4CYM D;  2AVP A;  2VYI A;  3ZEF A;  4FU3 A;  2WVI A;  3NQP A;  2LXL A;  3HXD A;  4AP2 A;  4A3V A;  5DIZ A;  1P5Q A;  5B1B E;  4O1O A;  3X2Q E;  1Q2Z A;  2LAH A;  3BG0 B;  3IV0 A;  2OVF A;  3CEQ A;  3IEG A;  4HRN A;  4EBA A;  4GTQ A;  3PEV B;  1YYH A;  3FU3 A;  1BD8 A;  4L7T A;  3SGH A;  4B8C B;  3FU6 A;  4JL0 A;  3RO3 A;  3CVP A;  1PAQ A;  4UQX A;  1IQR A;  3QAR A;  3JQ0 A;  3EJN A;  3UX4 A;  2P9I G;  3FTZ A;  3D9H A;  2XGS A;  2ZU6 B;  1O1S A;  4L2Y A;  1TNZ A;  3NAW A;  3AS4 A;  4BY6 A;  3CST A;  1N4Q A;  4RSY A;  3Q73 A;  2QY7 A;  3MGB A;  2XCC A;  1DCQ A;  2PM6 A;  1SZA A;  3B7R L;  2ZXW E;  3SFX A;  4OVV A;  4U0U A;  2GGF A;  4KBQ A;  1LD7 A;  2I1J A;  3ZHE A;  5KJL A;  4I43 A;  3SI5 A;  3HVE A;  3AS5 A;  4TUU A;  3U64 A;  2DCP A;  3D9I A;  5HS0 A;  1RW2 A;  3CHP A;  4GTM A;  4MKT A;  3UIP C;  5FQ7 A;  4EZJ A;  1JWF A;  4BEP A;  4G26 A;  4I9C A;  1UOH A;  4GZ5 A;  1BPO A;  2VSN A;  3Q75 A;  5JHA A;  2WXJ A;  2Y4T A;  1SA5 A;  4J8F A;  2BTD A;  2IJG X;  4ACK A;  2OND A;  3Q47 B;  1HS6 A;  2RFA A;  1IKN D;  4P29 A;  3FFL A;  4B94 A;  4HOR A;  3TL5 A;  2PZI A;  3G2T A;  4U95 D;  3DEP A;  2A4Z A;  3CIA A;  3D3M A;  1WDY A;  3KSQ A;  3MKR A;  2R03 A;  3E30 A;  4J6I A;  1K1B A;  2QYJ A;  2GRO B;  3V79 K;  3T9K A;  2RFM A;  3SNX A;  1N11 A;  3HIZ A;  3UI2 A;  4CDN A;  3CLJ A;  3NZS A;  1IHB A;  3Q49 B;  4CZ2 D;  5FIO A;  3FY4 A;  5B3S E;  3OXL A;  3GZ1 A;  3PE4 A;  3ZIM A;  2CFU A;  3OAW A;  1OUV A;  4O60 A;  3B7U X;  2R05 A;  5T4Y A;  4JA9 A;  4Z68 A;  2C2L A;  3I5P A;  1N95 A;  3FH7 A;  3BU8 A;  5ITZ F;  2Y4U A;  2F37 A;  2XS8 A;  4A3T A;  4UI9 J;  4EHM A;  2C0M A;  3UTM A;  5BUZ A;  3L17 A;  1V54 E;  4XKB A;  2UY1 A;  3WXX A;  3ENE A;  1HG2 A;  2X3M A;  3DSU A;  4WAF A;  4XI9 A;  1FVH A;  4JVS A;  1YCS B;  3FUF A;  5JJT A;  2RG8 A;  3RRU A;  1Y8M A;  2WXO A;  3C72 A;  3FTX A;  3CVU A;  3E4B A;  3Q4A B;  3LEW A;  3K9I A;  3R9A B;  1SQM A;  3CQG B;  2BF0 X;  3I3N A;  5HRY A;  4U7E B;  1D9S A;  5FJY A;  1MJ0 A;  2GRP B;  1N4S A;  4QFV A;  5BV0 A;  4LEU A;  5KJM A;  5KCM A;  3UIO C;  4JHJ A;  1SVX A;  2VSX E;  1JUQ A;  3PE3 A;  4KYO B;  5CMY A;  1OXJ A;  3EU5 A;  2XPI A;  3UQ3 A;  3PZ4 A;  4U8H A;  4N39 A;  2WXH A;  3HXC A;  2WQH A;  4XKC A;  3ZXP A;  2XPZ A;  4GTV A;  3UMV A;  2OCC E;  3JQ1 A;  4F53 A;  3PUK A;  1Z5S C;  1DVP A;  1HO8 A;  1PY1 A;  3TWU A;  2I6H A;  4JHK A;  3UXG A;  4C48 B;  1TNY A;  4GTP A;  2AWI A;  3T5X A;  4DJA A;  4G25 A;  3LJ3 A;  2J08 A;  1LTX A;  2XGM A;  3AG3 E;  5AEN A;  3LY7 A;  1X81 A;  5EX3 A;  3UKR G;  4MLP A;  2X6F A;  1XNF A;  3UT7 A;  4DPR A;  2ION A;  2XCB A;  5M72 A;  1OT8 A;  3QWV A;  3CK9 A;  3FDH A;  4APF A;  3GYZ A;  2KC7 A;  2P9U G;  1Z6T A;  3GZS A;  1WG0 A;  4BES A;  1MX2 A;  5LFA A;  2Y3A A;  5EID A;  3UM3 A;  3NBN B;  1N4P A;  5FT9 A;  3CKB A;  1S63 A;  2YNQ A;  4EZK A;  4GMR A;  2HE0 A;  2NXP A;  1E8Y A;  3JUE A;  3UKU G;  2B0O E;  3ASG A;  1H19 A;  2I1K A;  5T3R A;  2WXM A;  4YND A;  3L22 A;  3NF1 A;  5BT1 A;  3ABL E;  4J7W A;  5AN8 A;  3RRM B;  4HB5 A;  2FI7 A;  3QJZ A;  3AAA C;  3G2V A;  2E2E A;  2FF4 A;  1Y6I A;  2LNI A;  4PS7 A;  4I2Z A;  2AXU A;  2HR2 A;  1QQE A;  2J4B A;  3QK0 A;  2HYZ A;  3B7S A;  2DZO A;  4OAV B;  3TWW A;  1UG3 A;  5CRV A;  2RKK A;  3ULE G;  4F3V A;  3IKO B;  4UWK A;  3NOG D;  2YIN A;  4HFG A;  4G1T A;  2V8S E;  4J8E A;  3T8K A;  5EIL A;  1O5M A;  3CQC B;  3C98 A;  5HQ8 A;  4RG9 A;  4CT4 A;  1OWO A;  4N5C A;  1OCZ E;  1V55 E;  1Z3X A;  3W9G A;  4PS8 A;  2DIW A;  5AQB A;  3S7B A;  5HI7 A;  3APF A;  4GTO A;  4AY5 A;  5AJL A;  4HVB A;  4NIK A;  1FPP A;  2BKG A;  2KBX A;  3ISM C;  1L5J A;  3ZYL A;  2V4L A;  2LSU A;  4I17 A;  2PL2 A;  2XZT G;  2ETC A;  5KNH D;  1FT2 A;  4O1P A;  1H6O A;  1PC2 A;  3AG2 E;  1OWP A;  3APD A;  2LXM A;  1G3N B;  5E76 A;  3LY8 A;  3CK7 A;  4TXP A;  3RRN B;  3VTY A;  3DPY A;  3MV3 B;  2MOW A;  3IHV A;  2DYS E;  3RIB A;  3LYA A;  1TR4 A;  4LCT A;  3FU5 A;  1NP7 A;  3U9W A;  3D9K A;  4LUN U;  3U4T A;  3ZU7 B;  1IYG A;  4CGV A;  2CFZ A;  4I6J A;  3JYS A;  3ESK A;  3B7B A;  2OEW A;  4C0E A;  4HLL A;  5ENN A;  2WMO A;  1N52 A;  2XEV A;  5AIJ A;  5CEA A;  3L54 A;  5A6C A;  1GW6 A;  1KPS B;  2X6J A;  2HM8 A;  4JA7 A;  4CEM A;  1K8K G;  3P2B A;  1IQU A;  2PQN A;  2WXG A;  4BX9 A;  4HOU A;  3OTN A;  1IXV A;  2Q7F A;  4OYS A;  1LD8 A;  5JJ7 A;  3TG5 A;  4EZL A;  3CR3 A;  1BI8 B;  4GYW A;  4HLE A;  1K3Z D;  4G23 A;  3B13 A;  2KZT B;  4U0S A;  2YHE A;  1SA4 A;  2WXF A;  3MZL B;  3TWR A;  2DZN A;  3U3W A;  4FAD A;  2OVB A;  4HOS A;  3V30 A;  5ARF A;  4DUI A;  3D9N A;  3CHR A;  3CHO A;  5ENP D;  4L1B A;  4CDR A;  5CEC B;  4U96 D;  3LVQ E;  4HRM B;  2AW6 A;  2HO1 A;  3CVX A;  4ILH B;  4E6H A;  5FZQ A;  4YVQ C;  4GA2 A;  5CMW A;  4UWH A;  3SHF A;  2AJA A;  3LS8 A;  1NA0 A;  1KT1 A;  2YHC A;  5H7P A;  4DLQ A;  4AV7 A;  3TXN A;  2VGY A;  4AM9 A;  3ZXS A;  3FTY A;  3ZPJ A;  3D9J A;  3FEY A;  2FO1 E;  3TWV A;  5BW8 C;  1U3C A;  5G05 J;  5IY5 E;  3PH0 C;  2LSV A;  4FHK A;  3ZNG A;  2GRQ B;  4A1G A;  5J08 A;  2E0I A;  5EN5 D;  4B89 A;  5BNW A;  1N4R A;  3DXM G;  3G2S A;  4YDY A;  4LNG A;  3PUJ A;  2L6B A;  4FP7 A;  1K1A A;  2ZIS A;  3HYM B;  3ABM E;  3MX3 A;  4CDM A;  2DYR E;  4K5A B;  4JHR A;  4AEZ C;  4N3C A;  1OWN A;  1N0Q A;  5BXU A;  2P9K G;  3IBE A;  1JWG A;  3CHM A;  4GZD A;  4GZ3 A;  2WQ6 A;  1YA0 A;  2KM4 A;  4I2W A;  3ZHE B;  3PRZ A;  3L9T A;  1TNB A;  1NZN A;  3SZ7 A;  4Q96 A;  3HVE B;  5JJ6 A;  1W3B A;  5KNG A;  3MCX A;  1QZ2 A;  3SBS A;  2KXP C;  4U8Y D;  4GYO A;  2P9L G;  3EIQ C;  3NOC D;  1E96 B;  4GTT A;  4I1O B;  1N94 A;  4W9R A;  2VQ2 A;  1HU3 A;  3O48 A;  4FHJ A;  4XI0 A;  4OAU C;  2R2L A;  3FU0 A;  4WNG A;  3CV0 A;  2OEV A;  3G2W A;  3N71 A;  3PZ2 A;  5LCW C;  2GRR B;  2I9C A;  1OCO E;  3EHR A;  3IHY A;  1OCC E;  2EIN E;  3E33 A;  4N2Q A;  5CED B;  4NUR A;  4ANU A;  1O1R A;  1OY3 D;  2FEZ A;  3VLD A;  1N0R A;  4ACL A;  3MEK A;  5ANR A;  4U8V D;  5BV1 A;  1HG5 A;  2R59 A;  1TJC A;  3UT8 A;  2ILR A;  3GZ2 A;  4N5Q A;  3P1U A;  2RD0 A;  5LX8 A;  3EUV A;  2OOE A;  4A55 A;  2IF4 A;  1DCE A;  4KVO A;  4WWN A;  4UUC A;  1KT0 A;  3S7F A;  3UUX A;  2QYU A;  3FUM A;  4FLH A;  2VSY A;  5J90 A;  4X8Q A;  2FBN A;  3ZRH A;  3FTW A;  1UN8 A;  5FQ6 A;  1TJF A;  2WXR A;  4BSZ B;  3SF4 A;  4KMO A;  2NC9 A;  4GTS A;  4PDX A;  2PQR A;  4WWO A;  4MRU A;  5G2N A;  3V2O A;  2UY1 B;  1E8X A;  4JB8 P;  3AU5 A;  3TWX A;  5DBK A;  4UI9 K;  3KD7 A;  3SQV A;  4CRW A;  4XZ4 A;  4CGW A;  3SFZ A;  3AG1 E;  4WUY A;  3QOU A;  5AYW D;  2CHX A;  4L23 A;  1MX4 A;  2X6K A;  3Q9N C;  2H6I A;  4UWF A;  3R9M A;  1IHG A;  3Q15 A;  5BXO A;  5FZR A;  4BT8 A;  2WXK A;  2R02 A;  1BI7 B;  2H6F A;  3VLE A;  3R7Q A;  2QZA A;  5G04 J;  1E90 A;  5BPP A;  4FUL A;  1QNF A;  1O1T A;  4G11 A;  4GTR A;  3EIJ A;  1E8W A;  1NA3 A;  1D8D A;  3MYV A;  5JHB A;  1WY6 A;  4FLB A;  3PS6 A;  2VGX A;  2PM7 A;  2J09 A;  2ZIR A;  1N9A A;  2VSO E;  1KZO A;  1JCQ A;  1QBQ A;  1D8E A;  1YMP A;  1VDY A;  4B0Z A;  2CHZ A;  4JPS A;  3CVY A;  3DBS A;  2Y0B G;  2EIL E;  3DXK G;  4APO A;  3FUI A;  5EKQ D;  5AAR A;  2UWJ G;  2CG2 A;  2F0Y A;  3DSX A;  1A5E A;  4C9B B;  1NI1 A;  1ELK A;  3D9M A;  4J8D A;  4BWR A;  2YQ8 A;  4GML A;  1UJK A;  5ENT D;  3AJI A;  2L0T B;  5CRU A;  1OCR E;  4KT6 B;  4B93 B;  4DRX E;  3EDT B;  3UIN C;  5CBO A;  4JD2 G;  4I9E A;  3SFY A;  1TYQ G;  3UT4 A;  2A5E A;  5ENS D;  2P9N G;  4Y6C A;  4L9P A;  5FTP A;  2XQ0 A;  1TN8 A;  4JZY A;  2GRM A;  3CHQ A;  3D9L A;  3OXF A;  1KLX A;  5ANL A;  1DC2 A;  4HOT A;  3OXG A;  4YDE A;  4WNF A;  2MYO A;  4IYP A;  4UQZ A;  3DSS A;  4DK5 A;  1H2V C;  2R17 C;  5ENO D;  4KZC A;  4C0M A;  4AVX A;  1EPU A;  5A23 A;  4CT0 A;  4LRZ A;  3Q7A A;  4EBA G;  4U63 A;  1MYO A;  3FTV A;  4H7Y A;  2AXV A;  1KZP A;  4MBG A;  2FUL A;  1BLX B;  3ZYM A;  3ZVV A;  3VTX A;  5D2M C;  4YDO A;  3FUN A;  3FUK A;  4Y6W A;  3HXE A;  4J8S A;  2B6C A;  1HXI A;  4K0R A;  3ULY A;  1MQS A;  4AJW A;  2L6J A;  3C3Q A;  3TWS A;  1ZU2 A;  3URZ A;  4N2S A;  1INZ A;  3ZKJ A;  4HS2 A;  3I4R B;  4F1P A;  5JMN D;  1H6P A;  3CKC A;  3UPV A;  3ML8 A;  2J49 A;  4DI3 A;  1FT1 A;  4HNA D;  5EX0 A;  3WG7 E;  2X38 A;  3Q7F A;  3FUJ A;  1ELR A;  3AG4 E;  4V3I A;  2J07 A;  1BU9 A;  4K5C A;  5B1A E;  4TXQ A;  5FIN A;  4PS3 A;  3DST A;  3DSW A;  1WM5 A;  3RK6 A;  2MHK A;  2L0I A;  2ETA A;  4EPZ A;  3EHN A;  1HFA A;  1S70 B;  2V5Q C;  3PDN A;  4A63 B;  3KSL A;  4G2V A;  3QDN A;  3L82 A;  2VGE A;  3PZ1 A;  3DRA A;  3O4Z A;  4FJY A;  3ZUV B;  4ANW A;  3ESL A;  1E7U A;  4KXK B;  3E32 A;  1H2T C;  4YDW A;  3V2X A;  4GPK A;  2WPV A;  2X6I A;  2WXL A;  5EIB E;  3KAE A;  1SZ9 A;  1HZ4 A;  3L08 A;  3BQO A;  3TWT A;  1JCR A;  4NRH B;  1UN9 A;  3ULQ A;  1TNU A;  3ZGQ A;  4ATZ D;  2JAB A;  3FP3 A;  4TRQ A;  2XGO A;  2XS1 A;  2H6G A;  4UWG A;  4WWP A;  2KCV A;  5G05 C;  3UM0 A;  4CCA A;  2NSZ A;  4G8K A;  4IUL A;  3NB2 A;  3BEE A;  4BT9 A;  3CGH A;  3ZYK A;  2MRI A;  4OVU A;  4LG6 A;  3B7T A;  3CHS A;  4G8L A;  4AOF A;  3HHM A;  5KWD A;  5CCM A;  2CG3 A;  1HH8 A;  4GA0 A;  2WXI A;  5T8I A;  4JXT A;  2X6H A;  2JLB A;  5FZS A;  3ASF A;  3SBT B;  3MKQ A;  1FVF A;  4GCO A;  1MHQ A;  3KEA A;  5AJD A;  2WQ7 A;  4GZ6 A;  2EIJ E;  5KJK A;  3SD5 A;  4WNE A;  3CK8 A;  4PUC A;  2JEK A;  3J5P A;  4HI9 A;  2LUH A;  5ENQ D;  3PNT B;  3ASH A;  3FUD A;  4XIF A;  5CBN A;  1OWM A;  3APC A;  3HDX A;  3CVQ A;  4ZFH A;  3FUL A;  4D10 C;  1MZC A;  4RLY A;  2WMN A;  3FUH A;  3TG4 A;  1X5B A;  3MKQ B;  3SO8 A;  3JCK C;  4F7A A;  4GPM A;  4FJZ A;  4G24 A;  2A5U A;  4UQY A;  4GZC A;  2GRN B;  3FH5 A;  3Q79 A;  1TN6 A;  3L13 A;  1FCH A;  4GMJ A;  3ZFW A;  5CHE E;  3ZN3 A;  4F6R D;  1TEZ A;  3IXE A;  4UI9 C;  3GW4 A;  4J8Y A;  3FH8 A;  4XE0 A;  3RO2 A;  3PNL B;  1N54 A;  3DEO A;  5C1D A;  2WXP A;  3FUE A;  1UW4 B;  4BET A;  3EU9 A;  2QFC A;  1TNO A;  3TGO A;  3AS8 A;  3RAU A;  2H6H A;  3LKU A;  4DI4 A;  3Q5M A;  4IRU A;  5G55 A;  2F8Y A;  4RQI A;  4DX5 D;  4GAA A;  1Z3Y A;  3FEX A;  4J0U A;  2IO2 C;  2P9P G;  3C3O A;  3S7D A;  4LSZ E;  2P58 C;  3C5R A;  4U04 A;  2IOL A;  4GB9 A;  5HKP A;  4ANV A;  2Y1L E;  4HXI A;  5EYL A;  1JPL A;  2IU1 A;  4O6F A;  2BUG A;  4BSX A;  4NAC A;  1S0P A;  1WAO 1;  3HXF A;  4GU5 A;  3MV2 B;  4RVB A;  5CCL A;  1ZBP A;  3JXI A;  3HG0 D;  4JEU A;  2IQC A;  4GYY A;  5D0O D;  4DLO A;  3HXB A;  5FQ4 A;  2J9Q A;  4N3A A;  2KCL A;  4HOQ A;  2KCK A;  4KVM A;  1H2U A;  5LCW J;  4HQD A;  5G04 C;  1RZ4 A;  4URK A;  3QKY A;  2WB2 A;  2Y69 E;  4R7L A;  2AXZ A;  2KAT A;  4I1M A;  3AU4 A;  3CVN A;  4K03 A;  4ME2 A;  3I4G A;  1HX8 A;  2IO3 C;  1DNP A;  3PZ3 A;  1EF1 C;  4AIF A;  2XEE A;  3RKV A;  2M63 A;  3NZU A;  3EHQ A;  2IY0 C;  2EIK E;  3S2A A;  3R7R A;  4BTB A;  3PEU B;  2IFU A;  4BER A;  3BG1 B;  2V0P A;  5FQ8 A;  2ZGG A;  5ARG A;  3CSF A;  2LAI A;  1U2V G;  2CHW A;  1AWC B;  2WXN A;  2LO6 A;  4ILG A;  5AQ7 A;  2DBA A;  3FHE A;  4FC8 A;  5ENR D;  2XRY A;  3LDZ A;  2QC9 A;  1B89 A;  4QQI A;  3PRE A;  4LNU D;  4M7C A;  4BFR A;  3CVW A;  3QC1 A;  5KBA A;  1EYH A;  3TJP A;  4E85 A;  4ANX A;  4I6E A; 
#chains in the Genus database with same CATH homology
 1KT1 A;  2YHC A;  4DLQ A;  2L9B A;  4AV7 A;  3TXN A;  5BUZ A;  2VGY A;  3CKC A;  3UPV A;  3L17 A;  3ML8 A;  2J49 A;  4AM9 A;  1A17 A;  3ZXS A;  4I1A A;  4I6G A;  4DI3 A;  3FTY A;  4XKB A;  2UY1 A;  2XPY A;  3D9J A;  3ONK A;  5EX0 A;  3L16 A;  3ZPJ A;  2X38 A;  3FEY A;  3WXX A;  3LCA A;  3ENE A;  4AXH A;  1HG2 A;  5BW8 C;  3FUJ A;  1U3C A;  1ELR A;  2X3M A;  5G05 J;  3PH0 C;  1HF8 A;  4MS6 A;  5FWQ A;  4WAF A;  3EHM A;  2LSV A;  4V3I A;  4YVO A;  4FHK A;  4XI9 A;  4A1G A;  5J08 A;  2J07 A;  1FVH A;  4JVS A;  2E0I A;  2VGX B;  5EDS A;  3FUF A;  5JJT A;  2RG8 A;  3RRU A;  4PS3 A;  4B89 A;  1Y8M A;  5BNW A;  2WXQ A;  2WXO A;  1WM5 A;  3G2S A;  3FTX A;  2MHK A;  2L0I A;  1ELW A;  3RK6 A;  3CVU A;  1H0A A;  4EPZ A;  3E4B A;  4UWL A;  3EHN A;  1HFA A;  3LEW A;  3PUJ A;  3K9I A;  3Q4A B;  3R9A B;  4FP7 A;  3LPZ A;  1SQM A;  3CQG B;  3PDN A;  5LP0 A;  2BF0 X;  4WND A;  4M3O A;  4G2V A;  3I3N A;  3HYM B;  3QDN A;  3L6A A;  3MX3 A;  4CDM A;  4LER A;  3MA5 A;  3QAQ A;  3O4Z A;  4JEH A;  5FJY A;  4JHR A;  4AEZ C;  4FJY A;  4N3C A;  1OWN A;  4AY6 A;  4XX5 A;  3IBE A;  1JWG A;  3FTS A;  3CHM A;  4U07 A;  3D9O A;  4ANW A;  4QFV A;  1HE8 A;  4GZD A;  5BV0 A;  3ESL A;  1E7U A;  4GZ3 A;  4KXK B;  2XRZ A;  4LEU A;  4JW1 A;  5KJM A;  3KS2 A;  3CVV A;  2WQ6 A;  4U0Z A;  1YA0 A;  1H2T C;  2KM4 A;  3LY9 A;  3MJW A;  4I2W A;  5KCM A;  3ZHE B;  4GPK A;  1LF8 A;  2WPV A;  2X6I A;  2WXL A;  3PRZ A;  4JHJ A;  2I2O A;  4EQF A;  1NZN A;  3KAE A;  3SZ7 A;  4ILI A;  1SZ9 A;  3T5V A;  4Q96 A;  3HVE B;  1HZ4 A;  3QB2 A;  1W3B A;  5JJ6 A;  2VSX E;  3ASD A;  3L08 A;  1JUQ A;  3MCX A;  3PE3 A;  4KZ0 A;  4NQ0 A;  5D0Q D;  4F1S A;  4KYO B;  1QZ2 A;  5CMY A;  3SBS A;  4NRH B;  3QWW A;  3ZYQ A;  1UN9 A;  3ULQ A;  3U66 A;  2XPI A;  3UQ3 A;  5A7D B;  3RU0 A;  4GYO A;  4U8H A;  3ZGQ A;  4N39 A;  4A1S A;  3RJV A;  3FP3 A;  3EIQ C;  2WXH A;  3QNK A;  4TRQ A;  5C2Y A;  2XGO A;  1XGW A;  2WQH A;  3QWP A;  4XKC A;  3VLF A;  4UWG A;  4WWP A;  1E96 B;  2KCV A;  2XPZ A;  2J4D A;  3UMV A;  3JQ1 A;  4I1O B;  4W9R A;  2VJ8 A;  2VQ2 A;  2R5S A;  4F53 A;  1HU3 A;  3PUK A;  1DVP A;  1HO8 A;  5G05 C;  1PY1 A;  2VTB A;  2I6H A;  3O48 A;  2V5F A;  3LVR E;  3PVL A;  2OV8 A;  4JHK A;  4JC8 A;  4CCA A;  4Q69 A;  2AWI A;  2NSZ A;  3T5X A;  1U3D A;  4DJA A;  4FHJ A;  4G25 A;  3LJ3 A;  4XI0 A;  4IUL A;  5M72 A;  2J08 A;  3BEE A;  2XGM A;  4BT9 A;  3CGH A;  3ZYK A;  2MRI A;  3CVL A;  4OVU A;  3FU0 A;  4WNG A;  3CV0 A;  3KEZ A;  3G2W A;  3B7T A;  5AEN A;  3N71 A;  5LCW C;  3LY7 A;  2I9C A;  3CHS A;  4RG6 A;  2FO7 A;  3IHY A;  5KJN A;  4GCN A;  4EEC A;  4AOF A;  5EX3 A;  3HHM A;  4MLP A;  4PH4 B;  2X6F A;  3D9P A;  1XNF A;  5CCM A;  4N2Q A;  2IOS A;  3UT7 A;  4FA6 A;  4NUR A;  4DPR A;  3ZW3 A;  3LXU X;  4ANU A;  2CG3 A;  3S7J A;  2ION A;  1HH8 A;  2FEZ A;  2XCB A;  4GA0 A;  2WXI A;  3JUI A;  4JXT A;  5T8I A;  3VLD A;  1UJJ A;  2X6H A;  1H6K A;  2JLB A;  3QWV A;  5FZS A;  4ACL A;  3ASF A;  3MEK A;  5ANR A;  5LOZ A;  4BX8 A;  3SBT B;  5BV1 A;  1HG5 A;  2R59 A;  3CK9 A;  3MKQ A;  1FVF A;  2VTB B;  3FDH A;  1TJC A;  4GCO A;  3UT8 A;  4APF A;  1MHQ A;  5AJD A;  2ILR A;  3GYZ A;  2KC7 A;  4GZ6 A;  2WQ7 A;  2EQX A;  1Z6T A;  3GZ2 A;  4BTA A;  3GZS A;  3PZD A;  3P1U A;  2RD0 A;  5LX8 A;  2OOE A;  4A55 A;  2IF4 A;  4KVO A;  5KJK A;  4WWN A;  3SD5 A;  5LFA A;  2Y3A A;  1KT0 A;  3S7F A;  3TXM A;  3UUX A;  4WNE A;  3CK8 A;  4PUC A;  3FUM A;  2JEK A;  4ATG A;  4FLH A;  5FT9 A;  3CKB A;  2XHE A;  2VSY A;  5J90 A;  3DPD A;  2YNQ A;  3PNT B;  3ASH A;  4EZK A;  1E7V A;  2FBN A;  3FUD A;  4N3B A;  4XIF A;  3ZRH A;  2NXP A;  1E8Y A;  3FTW A;  1UN8 A;  5FQ6 A;  1TJF A;  1OWM A;  2WXR A;  3APC A;  3HDX A;  2GRL A;  3CVQ A;  3SF4 A;  3FUL A;  1E8Z A;  3TAX A;  3ASG A;  4D10 C;  4KMO A;  1H19 A;  2WMN A;  3FUH A;  2NC9 A;  2I1K A;  4PDX A;  2PQR A;  4B8A A;  5T3R A;  4WWO A;  2KZT A;  2WXM A;  4MRU A;  4YND A;  5G2N A;  3TG4 A;  1X5B A;  3MKQ B;  2UY1 B;  4H7X A;  3ML9 A;  3L22 A;  1E8X A;  3NF1 A;  5BT1 A;  3AU5 A;  1EDU A;  3JCK C;  4F7A A;  4FJZ A;  4G24 A;  5DBK A;  2A5U A;  4UQY A;  3RRM B;  3T8M A;  4GZC A;  2FI7 A;  4UI9 K;  3KD7 A;  3FH5 A;  1OWL A;  3QJZ A;  4L2L A;  5E75 A;  4CRW A;  4IN3 B;  4XZ4 A;  3L13 A;  1FCH A;  4GMJ A;  4CGW A;  3SFZ A;  4WUY A;  3ZFW A;  5CHE E;  3QOU A;  4Q94 A;  2C0L A;  3ZN3 A;  5AYW D;  4ABN A;  3G2V A;  2CHX A;  2GW1 A;  3FWV A;  3FTU A;  4GA1 A;  2WM9 A;  2E2E A;  4TV3 A;  3ONL A;  1TEZ A;  2FF4 A;  1Y6I A;  3G2U A;  4L23 A;  2LNI A;  4UI9 C;  3GW4 A;  4PS7 A;  4I2Z A;  2AVP A;  2AXU A;  2VYI A;  3FH8 A;  4XE0 A;  3ZEF A;  2X6K A;  3RO2 A;  2HR2 A;  3PNL B;  4FU3 A;  1QQE A;  2J4B A;  2WVI A;  1N54 A;  3QK0 A;  4UWF A;  2WXP A;  5C1D A;  3FUE A;  1UW4 B;  2HYZ A;  3B7S A;  3NQP A;  1IHG A;  3Q15 A;  4AP2 A;  1UG3 A;  4A3V A;  2QFC A;  5DIZ A;  5FZR A;  1P5Q A;  4BT8 A;  2WXK A;  4F3V A;  2LAH A;  3BG0 B;  3IV0 A;  3IKO B;  4UWK A;  3VLE A;  2YIN A;  4HFG A;  3TGO A;  2OVF A;  3AS8 A;  4G1T A;  2V8S E;  3CEQ A;  4J8E A;  3LKU A;  3IEG A;  3CQC B;  3C98 A;  3R7Q A;  4DI4 A;  3Q5M A;  4IRU A;  5G04 J;  5G55 A;  5HQ8 A;  1E90 A;  4RG9 A;  4CT4 A;  1OWO A;  4N5C A;  4GAA A;  4EBA A;  1Z3Y A;  1Z3X A;  3FEX A;  5BPP A;  4FUL A;  1QNF A;  3PEV B;  4G11 A;  4PS8 A;  2DIW A;  3FU3 A;  3S7B A;  4J0U A;  5HI7 A;  4L7T A;  3EIJ A;  3APF A;  3SGH A;  4B8C B;  3S7D A;  1E8W A;  1NA3 A;  3FU6 A;  4JL0 A;  3RO3 A;  4AY5 A;  3CVP A;  3MYV A;  5AJL A;  5JHB A;  1PAQ A;  4UQX A;  4HVB A;  2P58 C;  1IQR A;  4U04 A;  1WY6 A;  4FLB A;  3QAR A;  2IOL A;  3JQ0 A;  3EJN A;  4GB9 A;  3UX4 A;  1L5J A;  3ZYL A;  3PS6 A;  2V4L A;  2LSU A;  2VGX A;  3FTZ A;  4I17 A;  2PL2 A;  2J09 A;  2PM7 A;  2XGS A;  4ANV A;  2VSO E;  2ZU6 B;  4L2Y A;  1PC2 A;  4HXI A;  3AS4 A;  4BY6 A;  3CST A;  1JPL A;  4RSY A;  2IU1 A;  1OWP A;  3APD A;  1VDY A;  2QY7 A;  3MGB A;  4O6F A;  2BUG A;  2XCC A;  4B0Z A;  2CHZ A;  3LY8 A;  2PM6 A;  4JPS A;  5E76 A;  3CK7 A;  3CVY A;  4BSX A;  1SZA A;  3B7R L;  1S0P A;  3DBS A;  4NAC A;  3RRN B;  3VTY A;  1WAO 1;  3MV3 B;  2MOW A;  4GU5 A;  3IHV A;  3MV2 B;  3RIB A;  4RVB A;  4APO A;  3LYA A;  3FUI A;  4OVV A;  1ZBP A;  4LCT A;  4U0U A;  2GGF A;  5EKQ D;  4JEU A;  5CCL A;  3FU5 A;  4KBQ A;  1NP7 A;  2UWJ G;  3U9W A;  3D9K A;  2CG2 A;  2IQC A;  4GYY A;  4LUN U;  3U4T A;  5D0O D;  4DLO A;  2I1J A;  3ZHE A;  5FQ4 A;  2J9Q A;  4C9B B;  1IYG A;  4CGV A;  5KJL A;  2CFZ A;  4I43 A;  3SI5 A;  1ELK A;  3D9M A;  3HVE A;  3AS5 A;  4I6J A;  4J8D A;  4TUU A;  3JYS A;  3ESK A;  4BWR A;  4N3A A;  4C0E A;  3U64 A;  2KCL A;  2DCP A;  3D9I A;  4HOQ A;  2WMO A;  5ENN A;  3CHP A;  4MKT A;  2KCK A;  1N52 A;  2XEV A;  5AIJ A;  5FQ7 A;  2YQ8 A;  3L54 A;  4EZJ A;  1GW6 A;  5A6C A;  4KVM A;  1H2U A;  5LCW J;  1JWF A;  4GML A;  2X6J A;  5G04 C;  1UJK A;  2HM8 A;  4URK A;  3QKY A;  2L0T B;  4KT6 B;  2WB2 A;  4G26 A;  3EDT B;  4I9C A;  4JA7 A;  4CEM A;  4R7L A;  4GZ5 A;  1BPO A;  2VSN A;  4I9E A;  3UT4 A;  3P2B A;  2AXZ A;  1IQU A;  2KAT A;  2PQN A;  2WXJ A;  4I1M A;  5JHA A;  4Y6C A;  3AU4 A;  5FTP A;  3CVN A;  2Y4T A;  2WXG A;  4J8F A;  2XQ0 A;  4HOU A;  4BX9 A;  2BTD A;  2IJG X;  4K03 A;  4ME2 A;  4ACK A;  3I4G A;  2OND A;  3OTN A;  3Q47 B;  1HX8 A;  4JZY A;  1HS6 A;  1DNP A;  2GRM A;  3CHQ A;  3D9L A;  1KLX A;  3OXF A;  4P29 A;  2Q7F A;  1EF1 C;  3FFL A;  5ANL A;  4AIF A;  4OYS A;  4HOT A;  4B94 A;  3OXG A;  4HOR A;  3RKV A;  3TL5 A;  5JJ7 A;  3TG5 A;  4EZL A;  3CR3 A;  2M63 A;  2PZI A;  4WNF A;  3NZU A;  3G2T A;  4IYP A;  4GYW A;  4UQZ A;  2A4Z A;  3CIA A;  3D3M A;  1H2V C;  2R17 C;  4DK5 A;  4HLE A;  3S2A A;  3R7R A;  4BTB A;  4G23 A;  3B13 A;  3PEU B;  4KZC A;  2KZT B;  4U0S A;  4C0M A;  2YHE A;  2IFU A;  3MKR A;  3BG1 B;  4AVX A;  1EPU A;  2V0P A;  5FQ8 A;  5A23 A;  4CT0 A;  4LRZ A;  5ARG A;  2WXF A;  3CSF A;  4EBA G;  4U63 A;  4J6I A;  2LAI A;  3FTV A;  4H7Y A;  2CHW A;  2AXV A;  3MZL B;  2WXN A;  2LO6 A;  4ILG A;  2DBA A;  3FHE A;  3SNX A;  4FC8 A;  3U3W A;  4FAD A;  3HIZ A;  2OVB A;  2XRY A;  4HOS A;  2FUL A;  3ZYM A;  4CDN A;  3CLJ A;  3LDZ A;  5ARF A;  3D9N A;  3CHR A;  3CHO A;  3ZVV A;  1B89 A;  3NZS A;  3VTX A;  3Q49 B;  4L1B A;  3FY4 A;  3FUN A;  3FUK A;  4Y6W A;  4CDR A;  3PRE A;  3OXL A;  3GZ1 A;  3LVQ E;  3PE4 A;  3ZIM A;  2AW6 A;  4BFR A;  4J8S A;  2CFU A;  2HO1 A;  3OAW A;  3CVX A;  3CVW A;  1HXI A;  1OUV A;  3QC1 A;  4ILH B;  4E6H A;  5FZQ A;  3B7U X;  4K0R A;  5T4Y A;  4JA9 A;  4YVQ C;  1MQS A;  4AJW A;  2L6J A;  2C2L A;  4GA2 A;  1EYH A;  1ZU2 A;  3TJP A;  5CMW A;  3URZ A;  4UWH A;  3SHF A;  3I5P A;  4E85 A;  3FH7 A;  4N2S A;  1INZ A;  4HS2 A;  3I4R B;  2Y4U A;  4A3T A;  3LS8 A;  4ANX A;  4UI9 J;  4I6E A;  2C0M A;  1NA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...