5FZRA

Designed tpr protein m4n delta c (cf i)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
107
structure length
107
Chain Sequence
NSIKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNNIKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNNIKTLSNLAVLLAQEGKAEEAIKYMRKAVSLIDKAAKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DESIGNED TPR PROTEIN
publication title Origin of a folded repeat protein from an intrinsically disordered ancestor.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Unknown function
total genus 44
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5fzrA00
3ZPJA 2Q7FA 3Q49B 4KBQA 3CVQA 4GYWA 4U0SA 3URZA 2GW1A 2I6HA 4HOSA 3LY9A 5FJYA 3PDNA 3SZ7A 4G26A 2C0LA 2JLBA 3TG4A 3RO3A 4GA0A 2XGMA 3BEEA 4U0ZA 3GYZA 4JA9A 3VTYA 4NQ0A 4GCNA 3CV0A 4I1AA 4LEUA 4WUYA 4GYYA 3EDTB 1E96B 4ME2A 1WAO1 2VSYA 3LY7A 4NRHB 4XI0A 5ARGA 3U3WA 1ZBPA 1OUVA 3Q15A 4UQXA 3LPZA 2HO1A 4APOA 3CVPA 3S7FA 3MKRA 3K9IA 3AS8A 4ABNA 3ASGA 4W9RA 5EX3A 4I9EA 3ZN3A 3RU0A 1PC2A 3ZGQA 4KXKB 1WM5A 5FZSA 3KAEA 4I2ZA 3S7DA 5JJTA 5CHEE 4CGVA 3QKYA 5G04J 2HR2A 4AIFA 3ASDA 1KT0A 2PQNA 4UQYA 4YVOA 5EKQD 2VGXA 3VTXA 1P5QA 3RKVA 1XNFA 5ARFA 4RG6A 2FBNA 1IHGA 2LSVA 1NA0A 3LCAA 3LYAA 5D0QD 2LNIA 5JJ6A 2VQ2A 3PE4A 2KCVA 3CKBA 4HORA 3RO2A 3Q5MA 4HOQA 4N3BA 5CCMA 4UI9C 4JA7A 4UI9J 2WQHA 4F3VA 2FO7A 2IF4A 1KLXA 4J0UA 2QFCA 3MV3B 5KJNA 2C0MA 4JHRA 4JL0A 4H7XA 3MEKA 3SF4A 2XPIA 4G2VA 4BT8A 1ELRA 1W3BA 2MHKA 5KJLA 5FTPA 4CDRA 4WNFA 3MV2B 2VGXB 3LKUA 3CVLA 2UY1A 5LCWC 1NA3A 2V5FA 4AY6A 4HOTA 3OXLA 4Y6WA 5A6CA 2FF4A 2XEVA 2LSUA 2E2EA 5KJMA 3S7BA 2KCKA 5KJKA 4N3CA 3JYSA 1HH8A 1HZ4A 1IYGA 2FEZA 3CK9A 3ZHEB 3QDNA 3ESKA 3FP3A 3AS5A 3KS2A 3UUXA 4HOUA 3RJVA 2PL2A 4Y6CA 4G23A 5M72A 3ZFWA 3KD7A 2P58C 4WNDA 2UWJG 5BW8C 4YNDA 5A7DB 1QQEA 3Q4AB 4CGWA 2YQ8A 2PQRA 5BT1A 4XI9A 4GZ3A 1A17A 1YA0A 5AYWD 4GA2A 3R9AB 2PZIA 2Y4TA 3N71A 3QWWA 3FWVA 4G24A 3ULQA 3HYMB 3NF1A 4WNEA 3ZHEA 3GW4A 2AVPA 4A1SA 2VSNA 2ONDA 5DBKA 2UY1B 1HXIA 3UPVA 4BTAA 3TGOA 3O48A 3LY8A 3ASHA 3QWVA 1FCHA 5D0OD 2VYIA 4N5CA 2BUGA 4J8DA 4KYOB 4U04A 2KC7A 4J8EA 1QZ2A 3MA5A 5FZRA 1ZU2A 3E4BA 4BTBA 3RIBA 1B89A 4GPKA 4BWRA 4GA1A 3GZ2A 4IN3B 4U0UA 5BNWA 3CEQA 4UQZA 5DIZA 3QOUA 4N2QA 5LCWJ 4BT9A 3FFLA 4WNGA 3CK8A 4GZ5A 4AM9A 2OOEA 4J8FA 3AS4A 5CCLA 3UQ3A 2R5SA 4GCOA 4U07A 3QWPA 1ELWA 5HQ8A 2NC9A 4AY5A 4I2WA 3OXGA 5EX0A 5FT9A 3TAXA 3PE3A 2KATA 2IFUA 3GZ1A 3S7JA 3TG5A 5C1DA 3CK7A 2HYZA 3ASFA 4EQFA 4GZ6A 3CKCA 4I17A 1Y8MA 2C2LA 3OXFA 2XGOA 2DBAA 4G25A 3CVNA 5JJ7A 1KT1A 2Y4UA 5G04C 5FZQA 4B94A 4N39A 2XCBA 2YHCA 3U4TA 4O6FA 3WXXA 2J9QA 3IEGA 2WPVA 4RG9A 4XIFA 4YVQC 4UI9K 4GYOA 3Q47B 2L6JA 4I9CA 5HI7A 2VGYA 4G1TA 2XGSA 2KCLA 1NZNA 4N3AA 2FI7A 2XCCA 4N2SA 5G05C 1TJCA 5G05J 4H7YA
chains in the Genus database with same CATH superfamily
3ZPJA 1TNBA 3Q49B 5AJLA 4C0EA 2XZTG 3U9WA 5A23A 3CVQA 5LX8A 4GYWA 4U0SA 2GW1A 2I6HA 2JEKA 5FJYA 3ML9A 2EILE 3FUFA 4UWHA 3NZUA 1L5JA 2RKKA 4I1OB 2C0LA 3ESLA 3TG4A 2QYJA 4GTOA 4J8SA 3BEEA 3QC1A 4U0ZA 3GYZA 1K8KG 1DNPA 4DX2A 4LEUA 3CHOA 3EHNA 2WXKA 4GPMA 5AQ9A 1N0RA 2B0OE 3D9NA 4NRHB 1UOHA 3SBTB 3ZYMA 1OY3D 2WB2A 3HXCA 1ZBPA 1MX2A 3QJZA 4YDOA 1DCEA 1Z6TA 3JXJA 2HO1A 1RW2A 3CVPA 3S7FA 3EUVA 3TXMA 3ZXSA 4G8LA 3AS8A 4APFA 4TXPA 5KNGA 1LD8A 2A4ZA 3ASGA 2MYOA 3RU0A 5ANRA 1TNUA 4I2ZA 3ONKA 2OCCE 5CHEE 4BY6A 3QKYA 3Q78A 5G04J 1JCRA 5JMND 3MZLB 1P5QA 2VSXE 4GAAA 2P9UG 5BXUA 4TXQA 2WQ6A 2LNIA 5JJ6A 2VQ2A 2WXQA 3L9TA 4XX5A 2KCVA 3D9KA 3QB2A 2L6BA 3RO2A 2XRYA 2WMOA 4R7LA 3MX3A 5BUZA 4CT0A 4KZ0A 4QFVA 3FUKA 3IXEA 1AP7A 2FO7A 1MJ0A 1KLXA 1O1RA 2X38A 4Z68A 4I6JA 1HE8A 1HU3A 4XKBA 5BPPA 4CDNA 1EYHA 3SFYA 4FJZA 2F0YA 4YDEA 2R59A 2OEWA 4FJYA 5HS0A 4BT8A 3D9PA 1HG2A 1WY6A 3ZUVB 4WWPA 3ASOE 5ENPD 2R03A 1NA3A 3FH8A 4GTSA 2GROB 3HVEB 3RK6A 4B0ZA 4PUCA 1EF1C 4OYSA 1UG3A 3CHPA 2P9SG 2XS8A 4AV7A 5IY5E 2KCKA 3FU3A 2ETBA 4J8YA 4FU3A 4L9PA 4TRQA 3JYSA 1HH8A 2MRIA 4NIKA 3PZ3A 3CVYA 3S2AA 5LOZA 3FP3A 3TWSA 5FINA 4HOUA 3RJVA 4Y6CA 4G23A 1QNFA 2XZDG 4WNDA 4DLOA 2UWJG 3FDHA 3FUJA 1U3CA 2PQRA 1NFIE 3O4ZA 1YA0A 5AYWD 4GA2A 3R9AB 3PH0C 3QWWA 4FULA 5J08A 3UKRG 3UMVA 3UKUG 3NF1A 1JWFA 3UXGA 3I4GA 3SFXA 4ANVA 2VSNA 4OVUA 5DBKA 2UY1B 1HXIA 1IXVA 2P9IG 4LG6A 3FU0A 4I1MA 2RFMA 1AWCB 2CHWA 3QWVA 1LTXA 1G3NB 3DSWA 4XKCA 2V4LA 4JHJA 4J8EA 2XS1A 4K03A 3MA5A 5E75A 3Q75A 4L2YA 3CVXA 4GTPA 3RIBA 3ZIMA 5AAOA 2X6IA 1BI8B 2IO3C 3SI5A 3AJIA 4BWRA 1UJKA 4PH4B 1Y6IA 4CRWA 2P9LG 5T3RA 4U0UA 1H2TC 3CEQA 1YMPA 3CLJA 4HBDA 4N2QA 5E76A 5LCWJ 4BT9A 3UIPC 2QYUA 4GZ5A 3E32A 3DPDA 3NZSA 2OOEA 3UM2A 5BV0A 1OCZE 1E7VA 4DRXE 2DZNA 1OCOE 3SO8A 3I4RB 4E6HA 3LS8A 3QWPA 3ABME 4EZKA 3D9IA 1N4SA 1IQRA 3CHQA 3QARA 4I2WA 3OXGA 2ZGDA 3IKOB 5EX0A 4F1SA 4ZHBA 2KATA 4F53A 3GZ1A 3CK7A 3ASFA 3D9OA 3G2VA 3DSTA 4IYPA 3SFZA 3CKCA 4AXHA 2XGOA 3V30A 2R2LA 1KT1A 4N5QA 5G04C 3L6AA 1OWLA 2XCBA 3U4TA 4A63B 5ENNA 2J8SD 1A5EA 3LXUX 4UWFA 5KCMA 1DCQA 4HVBA 4K0RA 4YVQC 5ENOD 2M63A 4GYOA 2PNNA 3KEAA 4XEIG 4HI9A 3Q73A 3Q47B 1KPSB 4K5AB 3LEWA 3E33A 2L6JA 1SA4A 2CG3A 2XCCA 4A3VA 5G05C 5B1BE 2Q7FA 4A3TA 4F6RD 5AARA 3EJNA 1MZCA 3URZA 4HOSA 3DEPA 2ILRA 5BV1A 3PDNA 3SZ7A 2VJ8A 3MGBA 1IQUA 2V8SE 5T8IA 3RO3A 4DJAA 3FU6A 2XGMA 2MOWA 3B13A 4D10C 4K5BA 4XE0A 3UM1A 4I6GA 4PS3A 4JA9A 4P29A 2DZOA 4GZCA 4I1AA 1JWGA 1SVXA 3RAUA 4ILIA 3CVUA 4ME2A 3DPYA 2VSYA 1X5BA 4M7CA 2OVFA 3AG2E 4B89A 1TNZA 4HQDA 3U3WA 4JZYA 2H6IA 3HIZA 2WQ7A 5AN8A 3MKRA 1OWMA 3K9IA 2X6FA 4DPRA 3L82A 4W9RA 5EX3A 3R7RA 2J4DA 3UTMA 3SGHA 4GTVA 3ZN3A 1PC2A 3TWXA 3ZGQA 4KXKB 1WM5A 3S7DA 5FZSA 4LSZE 2KBXA 2WVIA 3TWQA 1PAQA 3EU9A 1SW6A 2EIME 3ASDA 4LERA 2PM6A 3FUHA 2J08A 3TWTA 4ILHB 3FTUA 3C3RA 4YVOA 2I1KA 2J07A 3RKVA 2J49A 2DIWA 4JEUA 5ARFA 4RG6A 2FBNA 1NL4A 3ZYQA 3FY4A 4JEHA 1HG5A 3LCAA 4E85A 3PEVB 1IHBA 3LYAA 3AAAC 4OAVB 3ONLA 3UT7A 4GB9A 5CRVA 3VLDA 2I2OA 4U63A 2BTDA 3LVQE 3L54A 3Q5MA 4HOQA 1UN8A 2WXFA 4UI9J 2CG2A 4IULA 4F3VA 2IF4A 3FH7A 3D9JA 4UWLA 4LNBA 1SZ9A 4EECA 5ENSD 1JCQA 2C0MA 4DUIA 4JHRA 1E7UA 4JL0A 3BQOA 3KEZA 1E8WA 2XEHA 2IONA 3SF4A 2AWIA 1H6KA 3TXNA 4GZDA 4BX8A 1KZOA 5LFAA 4M3OA 3ZNGA 4JPSA 4RVBA 3EIJA 4HXIA 4C9BB 5D2MC 3ZXPA 3U64A 2WXPA 5T4YA 3IV0A 2HE0A 3AG3E 3SY2A 3BUAA 2VGXB 2UY1A 3T9KA 5LCWC 3BG1B 5EN5D 5FQ8A 2X6KA 4GMRA 3AU4A 3RRMB 5A6CA 2E0IA 1VDYA 3UX4A 2NXPA 1O1SA 5KJMA 3APFA 4MLPA 4N3CA 3DRAA 2GRRB 2FEZA 2VTBB 4AEZC 3CK9A 3AG4E 3QDNA 3ESKA 2OV8A 4IRUA 1N95A 4U96D 3PZ2A 1Z3YA 3AS5A 3KS2A 3SQVA 4DX5D 4BSZB 3FTWA 2RD0A 5BW8C 4A55A 1QQEA 3Q4AB 3DXMG 4KVOA 5EDSA 4JXTA 3HXDA 3ABLE 4XI9A 4GZ3A 3WG7E 3GZSA 4OAUC 2Y4TA 3N71A 1FVHA 3FWVA 3ULQA 3HYMB 3ZHEA 5JHAA 1RZ4A 3GW4A 4A1SA 5EIDA 3UI2A 4LRZA 1WG0A 4BTAA 3TGOA 2LXMA 3LY8A 3ASHA 1FCHA 3APCA 2NSZA 3EIQC 4N5CA 4J8DA 4KYOB 3FEXA 4YDYA 4U04A 4PS8A 2KC7A 2FULA 3FUDA 3E4BA 3LVRE 5EILA 3FUNA 1MX6A 3FH5A 3TWVA 3ZYKA 5DIZA 3FFLA 3PZ4A 3I3NA 4AM9A 4NACA 4J8FA 3UM0A 5CCLA 2J4BA 2R5SA 3R9MA 3QK0A 3BU8A 5EIBE 4U07A 5HQ8A 2NC9A 4KT6B 4ANWA 2J09A 3RRUA 3FUIA 5AQ7A 2RG8A 4X8QA 1TJFA 3TWRA 3FU5A 4WWOA 4CCAA 3DSSA 2ZISA 2B6CA 2AJAA 4GZ6A 1Y8MA 2C2LA 4FC8A 1N4RA 2DBAA 3NAWA 3CVNA 5EYPF 2R05A 4B94A 4B8CB 2PM7A 4N39A 4PDXA 4ANXA 2LAHA 4MKTA 3HHMA 3MKQB 3WXXA 1MX4A 3IEGA 1H2UA 4RG9A 3P1UA 1DC2A 4RQIA 5AQBA 3PNTB 4XZ4A 2IEJA 1S0PA 5C2YA 2H6FA 2BF0X 5HKPA 5HI7A 4G8KA 4BSXA 2P9NG 3G2WA 4G1TA 2VGEA 2XGSA 2GRLA 2KCLA 4N2SA 1TJCA 2P2CP 4H7YA 4U7EB 4HRNA 5CEDB 2F8XK 1MHQA 1D9SA 3LY9A 3L22A 3NOGD 2XPYA 1PY1A 5CECB 3JXIA 1FPPA 3R7QA 1HS6A 2YHEA 4GA0A 4GTMA 2CHZA 5KWDA 4C0MA 2DYRE 3TL5A 3FULA 4JVSA 4NQ0A 4HRLA 4GCNA 3CV0A 4WUYA 2EIJE 3EDTB 4KVMA 2GRMA 4O1PA 3E30A 1WAO1 2L0TB 1E8YA 1OWPA 3FEYA 2OVBA 3CHRA 1JCSA 3Q15A 4UQXA 2QY7A 3LPZA 2BKKB 1E8XA 2IO2C 4CEMA 5G55A 2Y1LE 2R02A 4ABNA 4CDMA 3L08A 1D8EA 2GRPB 4RLYA 3C3QA 2XRZA 3KAEA 5JJTA 2Y69E 2HR2A 1SA5A 4AP2A 2PQNA 4UQYA 2VGXA 3PUJA 4B8AA 2KZTB 2X6HA 1XNFA 4LNUD 2DCPA 2LXLA 4EZJA 3SHFA 3ZRHA 3T5XA 5D0QD 3NBNB 1QYMA 1HFAA 4ACLA 4G11A 3G2SA 3DXKG 4HORA 4RSYA 3UIOC 1U3DA 3C98A 1SZAA 4FA6A 3CVWA 4JA7A 2XENA 4DK5A 1BPOA 4J0UA 2ETCA 3MV3B 4HFGA 2QC9A 1YYHA 5KJNA 4I6EA 4O60A 3DSXA 2H6GA 3U66A 3V2XA 2IU1A 4G2VA 1S70B 1UN9A 1OWOA 2BEDA 1ELRA 1W3BA 5FIOA 3DBSA 3L13A 4CDRA 4WNFA 2IOLA 4ILGA 1JUQA 3UINC 1FT1A 2FO1E 1V55E 2A5UA 3V79K 4HOTA 3OXLA 4ANUA 4J6IA 2FF4A 2XEVA 2DWZA 4BESA 4LCTA 2E2EA 2WXHA 2DYSE 4AOFA 1NP7A 1WDYA 5KJKA 3B7TA 3CSTA 4ZFHA 3ASNE 1HZ4A 3SNXA 1Z5SC 3BG0B 4C48B 2IY0C 3W9GA 2OEVA 3UUXA 3ZFWA 3LJNA 4FHKA 3PVLA 3X2QE 2F37A 5ANLA 3PEUB 4YNDA 3DSVA 4U95D 1EDUA 3V2OA 4CYMD 3HDXA 4BX9A 2YQ8A 4EHMA 4J7WA 1K1BA 3HVEA 3PREA 3JCKC 1OWNA 3PS6A 2QZAA 2CFUA 3E34A 2Y3AA 1N0QA 1N9AA 1H6PA 3DEOA 2Y0BG 5D66A 1Q2ZA 2ETAA 2ONDA 3AG1E 4HLEA 3Q7AA 1XGWA 5KNHD 2KXPC 1E8ZA 1BI7B 3O48A 5D0OD 2X6JA 1N54A 3D9LA 3DWLG 3OTNA 4FP7A 2EINE 1O1TA 4FLHA 3TWWA 4OVVA 3C3OA 1QZ2A 2H6HA 4BETA 4PS7A 3ZVVA 3ENEA 4JHKA 3MKQA 3RSEG 5J90A 4BTBA 1TNOA 2BKGA 4GPKA 4AVXA 4Q96A 1N11A 4GMJA 3B7UX 4HS2A 4KZCA 3GZ2A 5BNWA 4UQZA 5LP0A 1U2VG 3ZYLA 3QOUA 2XEEA 4FADA 3CIAA 4WNGA 4FLBA 3CK8A 1K1AA 1HX8A 2AXUA 4U8YD 1TYQG 3W9FA 5ITZF 3AS4A 4L7TA 3UQ3A 4DX1A 2IOSA 4GCOA 1ELWA 4AY5A 1EPUA 3TWUA 5FT9A 3AU5A 3MCXA 3S7JA 3TG5A 1TN7A 4F7AA 3QNKA 2HM8A 1LD7A 2WXGA 4JB8P 2LUHA 3ML8A 3OXFA 3FTZA 4G25A 4HLLA 4NURA 5JJ7A 4I43A 5CBOA 4HI8A 2VSOE 2YHCA 3T8KA 4WWNA 4O6FA 1OCRE 2J9QA 3T5VA 4TUUA 2LO6A 2ZXWE 5CMYA 2WMNA 5CEAA 5CBNA 4XIFA 4U8VD 2WXIA 4L1BA 5CERB 3ZW3A 4GU5A 4UI9K 2WXRA 3Q9UC 5KBAA 5H7PA 1JPLA 1NZNA 3JQ0A 1H6OA 4N3AA 4O1OA 5G05J 3EHMA 2GGFA 4V3IA 3UM3A 4KBQA 1H0AA 5JHBA 1OT8A 3UT8A 4MRUA 5BXOA 3V31A 2KZTA 4G26A 2F8YA 4GMLA 4JC8A 3E37A 2JLBA 1N4PA 2IJGX 3ZEFA 1BLXB 4ATZD 2GRQB 3APDA 1OCCE 3FTVA 1SQMA 3HG0D 3VTYA 3CQCB 3KSLA 4GYYA 1E96B 4FHJA 3IBEA 3LY7A 3FHEA 4XI0A 5ARGA 2XHEA 3UT4A 1OUVA 5AENA 4APOA 3NB2A 2XQ0A 2YNQA 4EBAG 4CT4A 4I9EA 2ZIRA 4LNGA 3L16A 1E90A 5AQAA 2A5EA 2I9CA 1ZB1A 4CGVA 1MYOA 3MJWA 3EHRA 4BEPA 4K5CA 3OAWA 2AXVA 4AIFA 1KT0A 5EKQD 5EYLA 3VTXA 3CHMA 1DVPA 1UJJA 1IHGA 2LSVA 1NA0A 2AXZA 4URKA 3PE4A 4HRMB 3CKBA 3B7BA 4BERA 1Z3XA 1TN8A 1HF8A 3VLEA 2JABA 4EBAA 5AJDA 3JUEA 4N3BA 5ENRD 1KZPA 5CCMA 1HO8A 4UI9C 3ULYA 1UW4B 2WQHA 3LJ3A 2QFCA 4B93B 4TV3A 2WXOA 5G2NA 3CGHA 4CZ2D 3ISMC 4H7XA 4TUMA 4Q94A 3MEKA 2V4HC 2XPIA 1QBQA 2IQCA 1S63A 1N4QA 3KSQA 2MHKA 5KJLA 4MBGA 5FTPA 3B7RL 2WXNA 3P2BA 3MV2B 3LKUA 3CVLA 1GW6A 3B7SA 2V5FA 4AY6A 2GRNB 4Y6WA 4HB5A 4UUCA 2LSUA 1OXJA 4EPZA 1H2VC 5HRYA 3S7BA 5B3SE 1IYGA 5JA4D 3FUMA 2V0PA 3ZHEB 2DVWA 1O5MA 2AW6A 4EZLA 4A1GA 3RRNB 1TNYA 1TR4A 4BFRA 4DLQA 4ACKA 1X81A 4U8HA 2PL2A 2KM4A 5M72A 4L2LA 3KD7A 2P58C 4L23A 4TXRA 1FT2A 5AIJA 4DX6D 3I5PA 3HXFA 5A7DB 4CGWA 3FTYA 3CQGB 3PZDA 4JW1A 4GTTA 1ELKA 5BT1A 2WXLA 1BU9A 1D8DA 1H19A 1A17A 1IKND 2PZIA 1TEZA 2P9PG 1BD8A 4G24A 3SBSA 2VTBA 2V5QC 4DX7D 3DSUA 4DI3A 4WNEA 3J5QB 2LAIA 3PRZA 4UWGA 3D9HA 2XPZA 3PNLB 3T8MA 2AVPA 4QQIA 1N94A 3UPVA 2ZGGA 4ATGA 2EIKE 3SD5A 5FQ6A 3ZKJA 4Q69A 3CSFA 1K3ZD 2VYIA 2BUGA 1LF8A 3CVVA 4GTQA 3PZ1A 3HXBA 5FZRA 1ZU2A 4F1PA 4AJWA 5FQ4A 1TN6A 1B89A 1FVFA 3ULEG 3JUIA 3MYVA 1NI1A 2R17C 4GA1A 3D3MA 4IN3B 1MQSA 2ZU6B 3QAQA 2P9KG 2RFAA 2WM9A 3CHSA 5FWQA 5ENQD 5ENTD 3FTSA 3NOCD 1N52A 3G2UA 3Q9NC 1S64A 3EHQA 2WXMA 3TAXA 3PE3A 2IFUA 4WAFA 3B95A 5C1DA 1INZA 2HYZA 4EQFA 1YCSB 3LDZA 3F6QA 3CR3A 4UWKA 3HXEA 4I17A 4GTRA 1V54E 5CRUA 4HNAD 2EQXA 5CMWA 3C72A 2Y4UA 5FZQA 2I1JA 4KMOA 2WXJA 4JD2G 3TJPA 3JQ1A 3D9MA 2WPVA 3ABKE 3IHVA 2L9BA 4DI4A 4LUNU 5B1AE 3VLFA 2L0IA 3NQPA 2X3MA 2CFZA 5FQ7A 3J5PA 3Q79A 3L17A 2CHXA 3HRAA 4YDWA 4I9CA 2VGYA 3IHYA 2NYJA 3FTXA 3Q7FA 4MS6A 3PUKA 2FI7A 3ZU7B 3EU5A 2YINA 3C5RA 3FUEA 3G2TA
chains in the Genus database with same CATH topology
3ZPJA 2GGFA 2Q7FA 3Q49B 5AJLA 4A3TA 4V3IA 4C0EA 3U9WA 5A23A 4KBQA 3EJNA 3CVQA 5LX8A 4GYWA 4U0SA 3URZA 1H0AA 2GW1A 2I6HA 1MHQA 5JHBA 4HOSA 3UT8A 3LY9A 2JEKA 2ILRA 3L22A 4MRUA 5FJYA 5BV1A 3ML9A 3FUFA 3PDNA 4UWHA 3NZUA 2KZTA 3SZ7A 4G26A 1L5JA 2VJ8A 2XPYA 3MGBA 4GMLA 1IQUA 4I1OB 1PY1A 2C0LA 4JC8A 3ESLA 2JLBA 2V8SE 5T8IA 2IJGX 3TG4A 3RO3A 3R7QA 3ZEFA 4DJAA 1HS6A 2YHEA 3FU6A 4GA0A 2XGMA 2MOWA 3B13A 4J8SA 2CHZA 4D10C 3BEEA 4XE0A 3QC1A 4U0ZA 4I6GA 4PS3A 3APDA 4C0MA 3TL5A 3FULA 3GYZA 3FTVA 1SQMA 1DNPA 4JA9A 4P29A 3VTYA 4JVSA 4GZCA 4NQ0A 4GCNA 3CV0A 4I1AA 1JWGA 3CQCB 4ILIA 4LEUA 4WUYA 4GYYA 3CHOA 3EHNA 3EDTB 2WXKA 4KVMA 2GRMA 3CVUA 1E96B 4ME2A 4FHJA 1WAO1 3IBEA 2VSYA 1X5BA 2L0TB 3D9NA 2OVFA 1E8YA 3LY7A 4NRHB 4B89A 1OWPA 3FHEA 4XI0A 3SBTB 5ARGA 3ZYMA 2XHEA 2OVBA 3FEYA 3U3WA 2WB2A 4JZYA 3UT4A 1ZBPA 1OUVA 3QJZA 3CHRA 3HIZA 3Q15A 4UQXA 5AENA 1Z6TA 2QY7A 3LPZA 2HO1A 1E8XA 4APOA 2WQ7A 3CVPA 4CEMA 2XQ0A 2YNQA 5G55A 4EBAG 3S7FA 3MKRA 3TXMA 3ZXSA 1OWMA 3K9IA 4CT4A 3AS8A 4APFA 2X6FA 4DPRA 4ABNA 4CDMA 2A4ZA 3ASGA 4W9RA 5EX3A 4I9EA 3R7RA 3L08A 2J4DA 3L16A 3SGHA 3ZN3A 3RU0A 5ANRA 1PC2A 2XRZA 3ZGQA 1E90A 4KXKB 1WM5A 5FZSA 3KAEA 4I2ZA 3ONKA 2I9CA 3S7DA 5JJTA 2WVIA 5CHEE 4CGVA 4BY6A 3MJWA 1PAQA 3QKYA 5G04J 2HR2A 3OAWA 2AXVA 4LERA 3ASDA 4AIFA 4AP2A 1KT0A 2PQNA 2PM6A 3FUHA 4UQYA 2J08A 4ILHB 3FTUA 4YVOA 5EKQD 2VGXA 3PUJA 4B8AA 2I1KA 2J07A 3MZLB 3VTXA 1P5QA 3RKVA 2VSXE 2J49A 2KZTB 2X6HA 1XNFA 2DIWA 4JEUA 3CHMA 5ARFA 4RG6A 2DCPA 1DVPA 2FBNA 4GAAA 4EZJA 3ZYQA 3SHFA 1UJJA 3FY4A 1HG5A 1IHGA 4JEHA 2LSVA 1NA0A 3T5XA 3ZRHA 3LCAA 2AXZA 4E85A 3PEVB 4URKA 3LYAA 2WQ6A 5D0QD 2LNIA 3ONLA 2VQ2A 3PE4A 5JJ6A 2WXQA 3UT7A 4GB9A 4XX5A 1HFAA 2KCVA 3CKBA 3D9KA 5D0OD 3VLDA 2I2OA 4U63A 1Z3XA 4ACLA 4G11A 2BTDA 3G2SA 3QB2A 4HORA 3RO2A 1HF8A 2XRYA 3VLEA 2WMOA 4RSYA 3LVQE 1U3DA 3L54A 4R7LA 4EBAA 3Q5MA 3C98A 1SZAA 4HOQA 5AJDA 3MX3A 4N3BA 1UN8A 5BUZA 5CCMA 4FA6A 1HO8A 4CT0A 4UI9C 2WXFA 4JA7A 4KZ0A 4QFVA 4UI9J 3CVWA 1UW4B 2WQHA 3FUKA 4DK5A 2CG2A 4IULA 1BPOA 3LJ3A 4F3VA 2FO7A 2IF4A 3FH7A 1KLXA 3D9JA 4UWLA 4J0UA 1SZ9A 2QFCA 4EECA 3MV3B 2X38A 4HFGA 4TV3A 2WXOA 5G2NA 3CGHA 4I6JA 5KJNA 4I6EA 1HE8A 2C0MA 1HU3A 4JHRA 4XKBA 5BPPA 1E7UA 4JL0A 4CDNA 3U66A 1EYHA 3KEZA 1E8WA 4H7XA 4Q94A 3MEKA 3SF4A 2IONA 4FJZA 2AWIA 2IU1A 2XPIA 1H6KA 3TXNA 4G2VA 4GZDA 1UN9A 2R59A 4BX8A 5LFAA 2IQCA 4FJYA 1OWOA 4M3OA 4BT8A 1ELRA 4JPSA 4RVBA 3EIJA 4HXIA 4C9BB 1W3BA 2MHKA 3DBSA 5KJLA 3D9PA 1HG2A 2WXPA 1WY6A 3L13A 3IV0A 5FTPA 5T4YA 3U64A 3B7RL 4CDRA 4WWPA 2WXNA 4WNFA 2IOLA 3P2BA 3MV2B 4ILGA 1JUQA 2VGXB 3LKUA 3CVLA 1GW6A 2UY1A 3B7SA 3BG1B 5LCWC 5FQ8A 1NA3A 2V5FA 2A5UA 4AY6A 4HOTA 2X6KA 3AU4A 3OXLA 4ANUA 3RRMB 4Y6WA 5A6CA 2E0IA 4J6IA 1VDYA 2FF4A 3FH8A 2XEVA 2LSUA 3UX4A 2NXPA 3HVEB 4LCTA 3RK6A 4B0ZA 2E2EA 2WXHA 4PUCA 4EPZA 1EF1C 4OYSA 4AOFA 5KJMA 1H2VC 1UG3A 3CHPA 1NP7A 4AV7A 3S7BA 2KCKA 3APFA 4MLPA 3FU3A 5KJKA 4N3CA 3B7TA 3CSTA 4FU3A 4TRQA 3JYSA 1HH8A 1HZ4A 2MRIA 3SNXA 2FEZA 2VTBB 1IYGA 4AEZC 3FUMA 2V0PA 3CK9A 3ZHEB 3QDNA 3CVYA 3S2AA 3ESKA 2OV8A 3BG0B 4IRUA 5LOZA 2AW6A 4EZLA 1Z3YA 3FP3A 4A1GA 3AS5A 3RRNB 3KS2A 4BFRA 4DLQA 4ACKA 3UUXA 4HOUA 4U8HA 3RJVA 2PL2A 2KM4A 4G23A 4Y6CA 5M72A 3ZFWA 1QNFA 4L2LA 3KD7A 2P58C 4FHKA 3PVLA 3FTWA 2RD0A 4L23A 4WNDA 5ANLA 5AIJA 4DLOA 2UWJG 3PEUB 5BW8C 4A55A 4YNDA 3I5PA 5A7DB 3FDHA 3FUJA 1QQEA 3Q4AB 1EDUA 4CGWA 3FTYA 4KVOA 3CQGB 3HDXA 4JXTA 5EDSA 4BX9A 3PZDA 1U3CA 4JW1A 2YQ8A 2PQRA 1ELKA 3HVEA 3PREA 3JCKC 3O4ZA 5BT1A 2WXLA 4XI9A 1OWNA 4GZ3A 3PS6A 1H19A 1A17A 1YA0A 5AYWD 3GZSA 4GA2A 3R9AB 2PZIA 3PH0C 2Y4TA 1TEZA 3N71A 3QWWA 2CFUA 4FULA 1FVHA 2Y3AA 5J08A 3FWVA 4G24A 3SBSA 3UMVA 3ULQA 3HYMB 3NF1A 2VTBA 1JWFA 4DI3A 4WNEA 3ZHEA 3I4GA 2LAIA 3PRZA 4UWGA 5JHAA 2XPZA 3PNLB 3GW4A 4ANVA 3T8MA 2AVPA 4A1SA 2VSNA 2ONDA 4OVUA 5DBKA 2UY1B 1HXIA 4HLEA 1XGWA 3UPVA 4LRZA 4ATGA 3SD5A 5FQ6A 4Q69A 1E8ZA 4BTAA 3FU0A 3CSFA 4I1MA 3TGOA 3O48A 2CHWA 3LY8A 3ASHA 3QWVA 1FCHA 2X6JA 1N54A 3D9LA 3OTNA 2VYIA 3APCA 4FP7A 2NSZA 3EIQC 4N5CA 4FLHA 2BUGA 4J8DA 4KYOB 1LF8A 3FEXA 3CVVA 4XKCA 4U04A 2V4LA 4OVVA 4JHJA 4PS8A 2KC7A 4J8EA 1QZ2A 2FULA 4PS7A 4K03A 3FUDA 3MA5A 5E75A 5FZRA 3ENEA 3ZVVA 1ZU2A 4L2YA 3CVXA 4JHKA 3E4BA 3LVRE 3MKQA 5FQ4A 5G05J 4AJWA 5J90A 4BTBA 3RIBA 3ZIMA 3FUNA 1B89A 1FVFA 2X6IA 3JUIA 3MYVA 4GPKA 3SI5A 4AVXA 4Q96A 4BWRA 1UJKA 4PH4B 1Y6IA 4GMJA 4CRWA 3B7UX 2R17C 4HS2A 4KZCA 4GA1A 3GZ2A 3D3MA 3FH5A 5T3RA 4IN3B 1MQSA 4U0UA 1H2TC 2ZU6B 5BNWA 3CEQA 3CLJA 3QAQA 3ZYKA 4UQZA 5DIZA 5LP0A 3ZYLA 3QOUA 4N2QA 5E76A 5LCWJ 4FADA 4BT9A 3CIAA 3FFLA 4WNGA 4FLBA 3CK8A 1HX8A 2AXUA 2WM9A 4GZ5A 3DPDA 3I3NA 3CHSA 3NZSA 4AM9A 4NACA 2OOEA 5FWQA 4J8FA 5BV0A 3AS4A 5CCLA 4L7TA 3UQ3A 1E7VA 2J4BA 2R5SA 3I4RB 4E6HA 3QK0A 2IOSA 4GCOA 3LS8A 4U07A 3QWPA 1ELWA 5HQ8A 2NC9A 4KT6B 4EZKA 3D9IA 4ANWA 1IQRA 3FTSA 2J09A 4AY5A 3CHQA 3RRUA 3QARA 1N52A 3G2UA 1EPUA 4I2WA 3FUIA 3OXGA 3IKOB 5EX0A 4F1SA 5FT9A 2RG8A 2WXMA 3AU5A 3TAXA 3PE3A 2KATA 2IFUA 4WAFA 1TJFA 3MCXA 4F53A 3GZ1A 3S7JA 3TG5A 5C1DA 1INZA 3CK7A 2HYZA 3ASFA 4F7AA 3D9OA 3FU5A 3G2VA 3QNKA 4WWOA 2HM8A 4CCAA 4EQFA 3LDZA 4IYPA 3CR3A 4UWKA 3SFZA 4GZ6A 3CKCA 4I17A 1Y8MA 2C2LA 2WXGA 4AXHA 3ML8A 3OXFA 4FC8A 2XGOA 2DBAA 3FTZA 4G25A 2EQXA 5CMWA 3CVNA 4NURA 5JJ7A 4I43A 1KT1A 2Y4UA 5G04C 5FZQA 4B94A 2I1JA 3L6AA 4B8CB 2VSOE 1OWLA 2PM7A 4KMOA 4N39A 4PDXA 2XCBA 2WXJA 2YHCA 3U4TA 4ANXA 4WWNA 2LAHA 4MKTA 3HHMA 4O6FA 3MKQB 3WXXA 3TJPA 3JQ1A 2J9QA 3D9MA 3T5VA 4TUUA 5ENNA 2LO6A 3IEGA 1H2UA 2WPVA 3LXUX 5CMYA 4UWFA 5KCMA 2WMNA 4RG9A 3P1UA 3IHVA 2L9BA 4DI4A 4LUNU 4HVBA 4XIFA 3VLFA 2L0IA 3NQPA 2X3MA 4K0RA 2WXIA 3PNTB 4L1BA 4XZ4A 4YVQC 2CFZA 5FQ7A 1S0PA 3ZW3A 3L17A 4GU5A 4UI9K 2M63A 4GYOA 2CHXA 5C2YA 3Q47B 2BF0X 3LEWA 2L6JA 4I9CA 5HI7A 2WXRA 2VGYA 4BSXA 3IHYA 3G2WA 2CG3A 3FTXA 4G1TA 2XGSA 2GRLA 4MS6A 1JPLA 1NZNA 2KCLA 3JQ0A 3PUKA 4N3AA 2FI7A 2XCCA 4A3VA 2YINA 4N2SA 3FUEA 3G2TA 5G05C 1TJCA 3EHMA 4H7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZPJ A;  2Q7F A;  3Q49 B;  4KBQ A;  3CVQ A;  4GYW A;  4U0S A;  3URZ A;  2GW1 A;  2I6H A;  4HOS A;  3LY9 A;  5FJY A;  3PDN A;  3SZ7 A;  4G26 A;  2C0L A;  2JLB A;  3TG4 A;  3RO3 A;  4GA0 A;  2XGM A;  3BEE A;  4U0Z A;  3GYZ A;  4JA9 A;  3VTY A;  4NQ0 A;  4GCN A;  3CV0 A;  4I1A A;  4LEU A;  4WUY A;  4GYY A;  3EDT B;  1E96 B;  4ME2 A;  1WAO 1;  2VSY A;  3LY7 A;  4NRH B;  4XI0 A;  5ARG A;  3U3W A;  1ZBP A;  1OUV A;  3Q15 A;  4UQX A;  3LPZ A;  2HO1 A;  4APO A;  3CVP A;  3S7F A;  3MKR A;  3K9I A;  3AS8 A;  4ABN A;  3ASG A;  4W9R A;  5EX3 A;  4I9E A;  3ZN3 A;  3RU0 A;  1PC2 A;  3ZGQ A;  4KXK B;  1WM5 A;  5FZS A;  3KAE A;  4I2Z A;  3S7D A;  5JJT A;  5CHE E;  4CGV A;  3QKY A;  5G04 J;  2HR2 A;  4AIF A;  3ASD A;  1KT0 A;  2PQN A;  4UQY A;  4YVO A;  5EKQ D;  2VGX A;  3VTX A;  1P5Q A;  3RKV A;  1XNF A;  5ARF A;  4RG6 A;  2FBN A;  1IHG A;  2LSV A;  1NA0 A;  3LCA A;  3LYA A;  5D0Q D;  2LNI A;  5JJ6 A;  2VQ2 A;  3PE4 A;  2KCV A;  3CKB A;  4HOR A;  3RO2 A;  3Q5M A;  4HOQ A;  4N3B A;  5CCM A;  4UI9 C;  4JA7 A;  4UI9 J;  2WQH A;  4F3V A;  2FO7 A;  2IF4 A;  1KLX A;  4J0U A;  2QFC A;  3MV3 B;  5KJN A;  2C0M A;  4JHR A;  4JL0 A;  4H7X A;  3MEK A;  3SF4 A;  2XPI A;  4G2V A;  4BT8 A;  1ELR A;  1W3B A;  2MHK A;  5KJL A;  5FTP A;  4CDR A;  4WNF A;  3MV2 B;  2VGX B;  3LKU A;  3CVL A;  2UY1 A;  5LCW C;  1NA3 A;  2V5F A;  4AY6 A;  4HOT A;  3OXL A;  4Y6W A;  5A6C A;  2FF4 A;  2XEV A;  2LSU A;  2E2E A;  5KJM A;  3S7B A;  2KCK A;  5KJK A;  4N3C A;  3JYS A;  1HH8 A;  1HZ4 A;  1IYG A;  2FEZ A;  3CK9 A;  3ZHE B;  3QDN A;  3ESK A;  3FP3 A;  3AS5 A;  3KS2 A;  3UUX A;  4HOU A;  3RJV A;  2PL2 A;  4Y6C A;  4G23 A;  5M72 A;  3ZFW A;  3KD7 A;  2P58 C;  4WND A;  2UWJ G;  5BW8 C;  4YND A;  5A7D B;  1QQE A;  3Q4A B;  4CGW A;  2YQ8 A;  2PQR A;  5BT1 A;  4XI9 A;  4GZ3 A;  1A17 A;  1YA0 A;  5AYW D;  4GA2 A;  3R9A B;  2PZI A;  2Y4T A;  3N71 A;  3QWW A;  3FWV A;  4G24 A;  3ULQ A;  3HYM B;  3NF1 A;  4WNE A;  3ZHE A;  3GW4 A;  2AVP A;  4A1S A;  2VSN A;  2OND A;  5DBK A;  2UY1 B;  1HXI A;  3UPV A;  4BTA A;  3TGO A;  3O48 A;  3LY8 A;  3ASH A;  3QWV A;  1FCH A;  5D0O D;  2VYI A;  4N5C A;  2BUG A;  4J8D A;  4KYO B;  4U04 A;  2KC7 A;  4J8E A;  1QZ2 A;  3MA5 A;  5FZR A;  1ZU2 A;  3E4B A;  4BTB A;  3RIB A;  1B89 A;  4GPK A;  4BWR A;  4GA1 A;  3GZ2 A;  4IN3 B;  4U0U A;  5BNW A;  3CEQ A;  4UQZ A;  5DIZ A;  3QOU A;  4N2Q A;  5LCW J;  4BT9 A;  3FFL A;  4WNG A;  3CK8 A;  4GZ5 A;  4AM9 A;  2OOE A;  4J8F A;  3AS4 A;  5CCL A;  3UQ3 A;  2R5S A;  4GCO A;  4U07 A;  3QWP A;  1ELW A;  5HQ8 A;  2NC9 A;  4AY5 A;  4I2W A;  3OXG A;  5EX0 A;  5FT9 A;  3TAX A;  3PE3 A;  2KAT A;  2IFU A;  3GZ1 A;  3S7J A;  3TG5 A;  5C1D A;  3CK7 A;  2HYZ A;  3ASF A;  4EQF A;  4GZ6 A;  3CKC A;  4I17 A;  1Y8M A;  2C2L A;  3OXF A;  2XGO A;  2DBA A;  4G25 A;  3CVN A;  5JJ7 A;  1KT1 A;  2Y4U A;  5G04 C;  5FZQ A;  4B94 A;  4N39 A;  2XCB A;  2YHC A;  3U4T A;  4O6F A;  3WXX A;  2J9Q A;  3IEG A;  2WPV A;  4RG9 A;  4XIF A;  4YVQ C;  4UI9 K;  4GYO A;  3Q47 B;  2L6J A;  4I9C A;  5HI7 A;  2VGY A;  4G1T A;  2XGS A;  2KCL A;  1NZN A;  4N3A A;  2FI7 A;  2XCC A;  4N2S A;  5G05 C;  1TJC A;  5G05 J;  4H7Y A; 
#chains in the Genus database with same CATH topology
 3ZPJ A;  1TNB A;  3Q49 B;  5AJL A;  4C0E A;  2XZT G;  3U9W A;  5A23 A;  3CVQ A;  5LX8 A;  4GYW A;  4U0S A;  2GW1 A;  2I6H A;  2JEK A;  5FJY A;  3ML9 A;  2EIL E;  3FUF A;  4UWH A;  3NZU A;  1L5J A;  2RKK A;  4I1O B;  2C0L A;  3ESL A;  3TG4 A;  2QYJ A;  4GTO A;  4J8S A;  3BEE A;  3QC1 A;  4U0Z A;  3GYZ A;  1K8K G;  1DNP A;  4DX2 A;  4LEU A;  3CHO A;  3EHN A;  2WXK A;  4GPM A;  5AQ9 A;  1N0R A;  2B0O E;  3D9N A;  4NRH B;  1UOH A;  3SBT B;  3ZYM A;  1OY3 D;  2WB2 A;  3HXC A;  1ZBP A;  1MX2 A;  3QJZ A;  4YDO A;  1DCE A;  1Z6T A;  3JXJ A;  2HO1 A;  1RW2 A;  3CVP A;  3S7F A;  3EUV A;  3TXM A;  3ZXS A;  4G8L A;  3AS8 A;  4APF A;  4TXP A;  5KNG A;  1LD8 A;  2A4Z A;  3ASG A;  2MYO A;  3RU0 A;  5ANR A;  1TNU A;  4I2Z A;  3ONK A;  2OCC E;  5CHE E;  4BY6 A;  3QKY A;  3Q78 A;  5G04 J;  1JCR A;  5JMN D;  3MZL B;  1P5Q A;  2VSX E;  4GAA A;  2P9U G;  5BXU A;  4TXQ A;  2WQ6 A;  2LNI A;  5JJ6 A;  2VQ2 A;  2WXQ A;  3L9T A;  4XX5 A;  2KCV A;  3D9K A;  3QB2 A;  2L6B A;  3RO2 A;  2XRY A;  2WMO A;  4R7L A;  3MX3 A;  5BUZ A;  4CT0 A;  4KZ0 A;  4QFV A;  3FUK A;  3IXE A;  1AP7 A;  2FO7 A;  1MJ0 A;  1KLX A;  1O1R A;  2X38 A;  4Z68 A;  4I6J A;  1HE8 A;  1HU3 A;  4XKB A;  5BPP A;  4CDN A;  1EYH A;  3SFY A;  4FJZ A;  2F0Y A;  4YDE A;  2R59 A;  2OEW A;  4FJY A;  5HS0 A;  4BT8 A;  3D9P A;  1HG2 A;  1WY6 A;  3ZUV B;  4WWP A;  3ASO E;  5ENP D;  2R03 A;  1NA3 A;  3FH8 A;  4GTS A;  2GRO B;  3HVE B;  3RK6 A;  4B0Z A;  4PUC A;  1EF1 C;  4OYS A;  1UG3 A;  3CHP A;  2P9S G;  2XS8 A;  4AV7 A;  5IY5 E;  2KCK A;  3FU3 A;  2ETB A;  4J8Y A;  4FU3 A;  4L9P A;  4TRQ A;  3JYS A;  1HH8 A;  2MRI A;  4NIK A;  3PZ3 A;  3CVY A;  3S2A A;  5LOZ A;  3FP3 A;  3TWS A;  5FIN A;  4HOU A;  3RJV A;  4Y6C A;  4G23 A;  1QNF A;  2XZD G;  4WND A;  4DLO A;  2UWJ G;  3FDH A;  3FUJ A;  1U3C A;  2PQR A;  1NFI E;  3O4Z A;  1YA0 A;  5AYW D;  4GA2 A;  3R9A B;  3PH0 C;  3QWW A;  4FUL A;  5J08 A;  3UKR G;  3UMV A;  3UKU G;  3NF1 A;  1JWF A;  3UXG A;  3I4G A;  3SFX A;  4ANV A;  2VSN A;  4OVU A;  5DBK A;  2UY1 B;  1HXI A;  1IXV A;  2P9I G;  4LG6 A;  3FU0 A;  4I1M A;  2RFM A;  1AWC B;  2CHW A;  3QWV A;  1LTX A;  1G3N B;  3DSW A;  4XKC A;  2V4L A;  4JHJ A;  4J8E A;  2XS1 A;  4K03 A;  3MA5 A;  5E75 A;  3Q75 A;  4L2Y A;  3CVX A;  4GTP A;  3RIB A;  3ZIM A;  5AAO A;  2X6I A;  1BI8 B;  2IO3 C;  3SI5 A;  3AJI A;  4BWR A;  1UJK A;  4PH4 B;  1Y6I A;  4CRW A;  2P9L G;  5T3R A;  4U0U A;  1H2T C;  3CEQ A;  1YMP A;  3CLJ A;  4HBD A;  4N2Q A;  5E76 A;  5LCW J;  4BT9 A;  3UIP C;  2QYU A;  4GZ5 A;  3E32 A;  3DPD A;  3NZS A;  2OOE A;  3UM2 A;  5BV0 A;  1OCZ E;  1E7V A;  4DRX E;  2DZN A;  1OCO E;  3SO8 A;  3I4R B;  4E6H A;  3LS8 A;  3QWP A;  3ABM E;  4EZK A;  3D9I A;  1N4S A;  1IQR A;  3CHQ A;  3QAR A;  4I2W A;  3OXG A;  2ZGD A;  3IKO B;  5EX0 A;  4F1S A;  4ZHB A;  2KAT A;  4F53 A;  3GZ1 A;  3CK7 A;  3ASF A;  3D9O A;  3G2V A;  3DST A;  4IYP A;  3SFZ A;  3CKC A;  4AXH A;  2XGO A;  3V30 A;  2R2L A;  1KT1 A;  4N5Q A;  5G04 C;  3L6A A;  1OWL A;  2XCB A;  3U4T A;  4A63 B;  5ENN A;  2J8S D;  1A5E A;  3LXU X;  4UWF A;  5KCM A;  1DCQ A;  4HVB A;  4K0R A;  4YVQ C;  5ENO D;  2M63 A;  4GYO A;  2PNN A;  3KEA A;  4XEI G;  4HI9 A;  3Q73 A;  3Q47 B;  1KPS B;  4K5A B;  3LEW A;  3E33 A;  2L6J A;  1SA4 A;  2CG3 A;  2XCC A;  4A3V A;  5G05 C;  5B1B E;  2Q7F A;  4A3T A;  4F6R D;  5AAR A;  3EJN A;  1MZC A;  3URZ A;  4HOS A;  3DEP A;  2ILR A;  5BV1 A;  3PDN A;  3SZ7 A;  2VJ8 A;  3MGB A;  1IQU A;  2V8S E;  5T8I A;  3RO3 A;  4DJA A;  3FU6 A;  2XGM A;  2MOW A;  3B13 A;  4D10 C;  4K5B A;  4XE0 A;  3UM1 A;  4I6G A;  4PS3 A;  4JA9 A;  4P29 A;  2DZO A;  4GZC A;  4I1A A;  1JWG A;  1SVX A;  3RAU A;  4ILI A;  3CVU A;  4ME2 A;  3DPY A;  2VSY A;  1X5B A;  4M7C A;  2OVF A;  3AG2 E;  4B89 A;  1TNZ A;  4HQD A;  3U3W A;  4JZY A;  2H6I A;  3HIZ A;  2WQ7 A;  5AN8 A;  3MKR A;  1OWM A;  3K9I A;  2X6F A;  4DPR A;  3L82 A;  4W9R A;  5EX3 A;  3R7R A;  2J4D A;  3UTM A;  3SGH A;  4GTV A;  3ZN3 A;  1PC2 A;  3TWX A;  3ZGQ A;  4KXK B;  1WM5 A;  3S7D A;  5FZS A;  4LSZ E;  2KBX A;  2WVI A;  3TWQ A;  1PAQ A;  3EU9 A;  1SW6 A;  2EIM E;  3ASD A;  4LER A;  2PM6 A;  3FUH A;  2J08 A;  3TWT A;  4ILH B;  3FTU A;  3C3R A;  4YVO A;  2I1K A;  2J07 A;  3RKV A;  2J49 A;  2DIW A;  4JEU A;  5ARF A;  4RG6 A;  2FBN A;  1NL4 A;  3ZYQ A;  3FY4 A;  4JEH A;  1HG5 A;  3LCA A;  4E85 A;  3PEV B;  1IHB A;  3LYA A;  3AAA C;  4OAV B;  3ONL A;  3UT7 A;  4GB9 A;  5CRV A;  3VLD A;  2I2O A;  4U63 A;  2BTD A;  3LVQ E;  3L54 A;  3Q5M A;  4HOQ A;  1UN8 A;  2WXF A;  4UI9 J;  2CG2 A;  4IUL A;  4F3V A;  2IF4 A;  3FH7 A;  3D9J A;  4UWL A;  4LNB A;  1SZ9 A;  4EEC A;  5ENS D;  1JCQ A;  2C0M A;  4DUI A;  4JHR A;  1E7U A;  4JL0 A;  3BQO A;  3KEZ A;  1E8W A;  2XEH A;  2ION A;  3SF4 A;  2AWI A;  1H6K A;  3TXN A;  4GZD A;  4BX8 A;  1KZO A;  5LFA A;  4M3O A;  3ZNG A;  4JPS A;  4RVB A;  3EIJ A;  4HXI A;  4C9B B;  5D2M C;  3ZXP A;  3U64 A;  2WXP A;  5T4Y A;  3IV0 A;  2HE0 A;  3AG3 E;  3SY2 A;  3BUA A;  2VGX B;  2UY1 A;  3T9K A;  5LCW C;  3BG1 B;  5EN5 D;  5FQ8 A;  2X6K A;  4GMR A;  3AU4 A;  3RRM B;  5A6C A;  2E0I A;  1VDY A;  3UX4 A;  2NXP A;  1O1S A;  5KJM A;  3APF A;  4MLP A;  4N3C A;  3DRA A;  2GRR B;  2FEZ A;  2VTB B;  4AEZ C;  3CK9 A;  3AG4 E;  3QDN A;  3ESK A;  2OV8 A;  4IRU A;  1N95 A;  4U96 D;  3PZ2 A;  1Z3Y A;  3AS5 A;  3KS2 A;  3SQV A;  4DX5 D;  4BSZ B;  3FTW A;  2RD0 A;  5BW8 C;  4A55 A;  1QQE A;  3Q4A B;  3DXM G;  4KVO A;  5EDS A;  4JXT A;  3HXD A;  3ABL E;  4XI9 A;  4GZ3 A;  3WG7 E;  3GZS A;  4OAU C;  2Y4T A;  3N71 A;  1FVH A;  3FWV A;  3ULQ A;  3HYM B;  3ZHE A;  5JHA A;  1RZ4 A;  3GW4 A;  4A1S A;  5EID A;  3UI2 A;  4LRZ A;  1WG0 A;  4BTA A;  3TGO A;  2LXM A;  3LY8 A;  3ASH A;  1FCH A;  3APC A;  2NSZ A;  3EIQ C;  4N5C A;  4J8D A;  4KYO B;  3FEX A;  4YDY A;  4U04 A;  4PS8 A;  2KC7 A;  2FUL A;  3FUD A;  3E4B A;  3LVR E;  5EIL A;  3FUN A;  1MX6 A;  3FH5 A;  3TWV A;  3ZYK A;  5DIZ A;  3FFL A;  3PZ4 A;  3I3N A;  4AM9 A;  4NAC A;  4J8F A;  3UM0 A;  5CCL A;  2J4B A;  2R5S A;  3R9M A;  3QK0 A;  3BU8 A;  5EIB E;  4U07 A;  5HQ8 A;  2NC9 A;  4KT6 B;  4ANW A;  2J09 A;  3RRU A;  3FUI A;  5AQ7 A;  2RG8 A;  4X8Q A;  1TJF A;  3TWR A;  3FU5 A;  4WWO A;  4CCA A;  3DSS A;  2ZIS A;  2B6C A;  2AJA A;  4GZ6 A;  1Y8M A;  2C2L A;  4FC8 A;  1N4R A;  2DBA A;  3NAW A;  3CVN A;  5EYP F;  2R05 A;  4B94 A;  4B8C B;  2PM7 A;  4N39 A;  4PDX A;  4ANX A;  2LAH A;  4MKT A;  3HHM A;  3MKQ B;  3WXX A;  1MX4 A;  3IEG A;  1H2U A;  4RG9 A;  3P1U A;  1DC2 A;  4RQI A;  5AQB A;  3PNT B;  4XZ4 A;  2IEJ A;  1S0P A;  5C2Y A;  2H6F A;  2BF0 X;  5HKP A;  5HI7 A;  4G8K A;  4BSX A;  2P9N G;  3G2W A;  4G1T A;  2VGE A;  2XGS A;  2GRL A;  2KCL A;  4N2S A;  1TJC A;  2P2C P;  4H7Y A;  4U7E B;  4HRN A;  5CED B;  2F8X K;  1MHQ A;  1D9S A;  3LY9 A;  3L22 A;  3NOG D;  2XPY A;  1PY1 A;  5CEC B;  3JXI A;  1FPP A;  3R7Q A;  1HS6 A;  2YHE A;  4GA0 A;  4GTM A;  2CHZ A;  5KWD A;  4C0M A;  2DYR E;  3TL5 A;  3FUL A;  4JVS A;  4NQ0 A;  4HRL A;  4GCN A;  3CV0 A;  4WUY A;  2EIJ E;  3EDT B;  4KVM A;  2GRM A;  4O1P A;  3E30 A;  1WAO 1;  2L0T B;  1E8Y A;  1OWP A;  3FEY A;  2OVB A;  3CHR A;  1JCS A;  3Q15 A;  4UQX A;  2QY7 A;  3LPZ A;  2BKK B;  1E8X A;  2IO2 C;  4CEM A;  5G55 A;  2Y1L E;  2R02 A;  4ABN A;  4CDM A;  3L08 A;  1D8E A;  2GRP B;  4RLY A;  3C3Q A;  2XRZ A;  3KAE A;  5JJT A;  2Y69 E;  2HR2 A;  1SA5 A;  4AP2 A;  2PQN A;  4UQY A;  2VGX A;  3PUJ A;  4B8A A;  2KZT B;  2X6H A;  1XNF A;  4LNU D;  2DCP A;  2LXL A;  4EZJ A;  3SHF A;  3ZRH A;  3T5X A;  5D0Q D;  3NBN B;  1QYM A;  1HFA A;  4ACL A;  4G11 A;  3G2S A;  3DXK G;  4HOR A;  4RSY A;  3UIO C;  1U3D A;  3C98 A;  1SZA A;  4FA6 A;  3CVW A;  4JA7 A;  2XEN A;  4DK5 A;  1BPO A;  4J0U A;  2ETC A;  3MV3 B;  4HFG A;  2QC9 A;  1YYH A;  5KJN A;  4I6E A;  4O60 A;  3DSX A;  2H6G A;  3U66 A;  3V2X A;  2IU1 A;  4G2V A;  1S70 B;  1UN9 A;  1OWO A;  2BED A;  1ELR A;  1W3B A;  5FIO A;  3DBS A;  3L13 A;  4CDR A;  4WNF A;  2IOL A;  4ILG A;  1JUQ A;  3UIN C;  1FT1 A;  2FO1 E;  1V55 E;  2A5U A;  3V79 K;  4HOT A;  3OXL A;  4ANU A;  4J6I A;  2FF4 A;  2XEV A;  2DWZ A;  4BES A;  4LCT A;  2E2E A;  2WXH A;  2DYS E;  4AOF A;  1NP7 A;  1WDY A;  5KJK A;  3B7T A;  3CST A;  4ZFH A;  3ASN E;  1HZ4 A;  3SNX A;  1Z5S C;  3BG0 B;  4C48 B;  2IY0 C;  3W9G A;  2OEV A;  3UUX A;  3ZFW A;  3LJN A;  4FHK A;  3PVL A;  3X2Q E;  2F37 A;  5ANL A;  3PEU B;  4YND A;  3DSV A;  4U95 D;  1EDU A;  3V2O A;  4CYM D;  3HDX A;  4BX9 A;  2YQ8 A;  4EHM A;  4J7W A;  1K1B A;  3HVE A;  3PRE A;  3JCK C;  1OWN A;  3PS6 A;  2QZA A;  2CFU A;  3E34 A;  2Y3A A;  1N0Q A;  1N9A A;  1H6P A;  3DEO A;  2Y0B G;  5D66 A;  1Q2Z A;  2ETA A;  2OND A;  3AG1 E;  4HLE A;  3Q7A A;  1XGW A;  5KNH D;  2KXP C;  1E8Z A;  1BI7 B;  3O48 A;  5D0O D;  2X6J A;  1N54 A;  3D9L A;  3DWL G;  3OTN A;  4FP7 A;  2EIN E;  1O1T A;  4FLH A;  3TWW A;  4OVV A;  3C3O A;  1QZ2 A;  2H6H A;  4BET A;  4PS7 A;  3ZVV A;  3ENE A;  4JHK A;  3MKQ A;  3RSE G;  5J90 A;  4BTB A;  1TNO A;  2BKG A;  4GPK A;  4AVX A;  4Q96 A;  1N11 A;  4GMJ A;  3B7U X;  4HS2 A;  4KZC A;  3GZ2 A;  5BNW A;  4UQZ A;  5LP0 A;  1U2V G;  3ZYL A;  3QOU A;  2XEE A;  4FAD A;  3CIA A;  4WNG A;  4FLB A;  3CK8 A;  1K1A A;  1HX8 A;  2AXU A;  4U8Y D;  1TYQ G;  3W9F A;  5ITZ F;  3AS4 A;  4L7T A;  3UQ3 A;  4DX1 A;  2IOS A;  4GCO A;  1ELW A;  4AY5 A;  1EPU A;  3TWU A;  5FT9 A;  3AU5 A;  3MCX A;  3S7J A;  3TG5 A;  1TN7 A;  4F7A A;  3QNK A;  2HM8 A;  1LD7 A;  2WXG A;  4JB8 P;  2LUH A;  3ML8 A;  3OXF A;  3FTZ A;  4G25 A;  4HLL A;  4NUR A;  5JJ7 A;  4I43 A;  5CBO A;  4HI8 A;  2VSO E;  2YHC A;  3T8K A;  4WWN A;  4O6F A;  1OCR E;  2J9Q A;  3T5V A;  4TUU A;  2LO6 A;  2ZXW E;  5CMY A;  2WMN A;  5CEA A;  5CBN A;  4XIF A;  4U8V D;  2WXI A;  4L1B A;  5CER B;  3ZW3 A;  4GU5 A;  4UI9 K;  2WXR A;  3Q9U C;  5KBA A;  5H7P A;  1JPL A;  1NZN A;  3JQ0 A;  1H6O A;  4N3A A;  4O1O A;  5G05 J;  3EHM A;  2GGF A;  4V3I A;  3UM3 A;  4KBQ A;  1H0A A;  5JHB A;  1OT8 A;  3UT8 A;  4MRU A;  5BXO A;  3V31 A;  2KZT A;  4G26 A;  2F8Y A;  4GML A;  4JC8 A;  3E37 A;  2JLB A;  1N4P A;  2IJG X;  3ZEF A;  1BLX B;  4ATZ D;  2GRQ B;  3APD A;  1OCC E;  3FTV A;  1SQM A;  3HG0 D;  3VTY A;  3CQC B;  3KSL A;  4GYY A;  1E96 B;  4FHJ A;  3IBE A;  3LY7 A;  3FHE A;  4XI0 A;  5ARG A;  2XHE A;  3UT4 A;  1OUV A;  5AEN A;  4APO A;  3NB2 A;  2XQ0 A;  2YNQ A;  4EBA G;  4CT4 A;  4I9E A;  2ZIR A;  4LNG A;  3L16 A;  1E90 A;  5AQA A;  2A5E A;  2I9C A;  1ZB1 A;  4CGV A;  1MYO A;  3MJW A;  3EHR A;  4BEP A;  4K5C A;  3OAW A;  2AXV A;  4AIF A;  1KT0 A;  5EKQ D;  5EYL A;  3VTX A;  3CHM A;  1DVP A;  1UJJ A;  1IHG A;  2LSV A;  1NA0 A;  2AXZ A;  4URK A;  3PE4 A;  4HRM B;  3CKB A;  3B7B A;  4BER A;  1Z3X A;  1TN8 A;  1HF8 A;  3VLE A;  2JAB A;  4EBA A;  5AJD A;  3JUE A;  4N3B A;  5ENR D;  1KZP A;  5CCM A;  1HO8 A;  4UI9 C;  3ULY A;  1UW4 B;  2WQH A;  3LJ3 A;  2QFC A;  4B93 B;  4TV3 A;  2WXO A;  5G2N A;  3CGH A;  4CZ2 D;  3ISM C;  4H7X A;  4TUM A;  4Q94 A;  3MEK A;  2V4H C;  2XPI A;  1QBQ A;  2IQC A;  1S63 A;  1N4Q A;  3KSQ A;  2MHK A;  5KJL A;  4MBG A;  5FTP A;  3B7R L;  2WXN A;  3P2B A;  3MV2 B;  3LKU A;  3CVL A;  1GW6 A;  3B7S A;  2V5F A;  4AY6 A;  2GRN B;  4Y6W A;  4HB5 A;  4UUC A;  2LSU A;  1OXJ A;  4EPZ A;  1H2V C;  5HRY A;  3S7B A;  5B3S E;  1IYG A;  5JA4 D;  3FUM A;  2V0P A;  3ZHE B;  2DVW A;  1O5M A;  2AW6 A;  4EZL A;  4A1G A;  3RRN B;  1TNY A;  1TR4 A;  4BFR A;  4DLQ A;  4ACK A;  1X81 A;  4U8H A;  2PL2 A;  2KM4 A;  5M72 A;  4L2L A;  3KD7 A;  2P58 C;  4L23 A;  4TXR A;  1FT2 A;  5AIJ A;  4DX6 D;  3I5P A;  3HXF A;  5A7D B;  4CGW A;  3FTY A;  3CQG B;  3PZD A;  4JW1 A;  4GTT A;  1ELK A;  5BT1 A;  2WXL A;  1BU9 A;  1D8D A;  1H19 A;  1A17 A;  1IKN D;  2PZI A;  1TEZ A;  2P9P G;  1BD8 A;  4G24 A;  3SBS A;  2VTB A;  2V5Q C;  4DX7 D;  3DSU A;  4DI3 A;  4WNE A;  3J5Q B;  2LAI A;  3PRZ A;  4UWG A;  3D9H A;  2XPZ A;  3PNL B;  3T8M A;  2AVP A;  4QQI A;  1N94 A;  3UPV A;  2ZGG A;  4ATG A;  2EIK E;  3SD5 A;  5FQ6 A;  3ZKJ A;  4Q69 A;  3CSF A;  1K3Z D;  2VYI A;  2BUG A;  1LF8 A;  3CVV A;  4GTQ A;  3PZ1 A;  3HXB A;  5FZR A;  1ZU2 A;  4F1P A;  4AJW A;  5FQ4 A;  1TN6 A;  1B89 A;  1FVF A;  3ULE G;  3JUI A;  3MYV A;  1NI1 A;  2R17 C;  4GA1 A;  3D3M A;  4IN3 B;  1MQS A;  2ZU6 B;  3QAQ A;  2P9K G;  2RFA A;  2WM9 A;  3CHS A;  5FWQ A;  5ENQ D;  5ENT D;  3FTS A;  3NOC D;  1N52 A;  3G2U A;  3Q9N C;  1S64 A;  3EHQ A;  2WXM A;  3TAX A;  3PE3 A;  2IFU A;  4WAF A;  3B95 A;  5C1D A;  1INZ A;  2HYZ A;  4EQF A;  1YCS B;  3LDZ A;  3F6Q A;  3CR3 A;  4UWK A;  3HXE A;  4I17 A;  4GTR A;  1V54 E;  5CRU A;  4HNA D;  2EQX A;  5CMW A;  3C72 A;  2Y4U A;  5FZQ A;  2I1J A;  4KMO A;  2WXJ A;  4JD2 G;  3TJP A;  3JQ1 A;  3D9M A;  2WPV A;  3ABK E;  3IHV A;  2L9B A;  4DI4 A;  4LUN U;  5B1A E;  3VLF A;  2L0I A;  3NQP A;  2X3M A;  2CFZ A;  5FQ7 A;  3J5P A;  3Q79 A;  3L17 A;  2CHX A;  3HRA A;  4YDW A;  4I9C A;  2VGY A;  3IHY A;  2NYJ A;  3FTX A;  3Q7F A;  4MS6 A;  3PUK A;  2FI7 A;  3ZU7 B;  3EU5 A;  2YIN A;  3C5R A;  3FUE A;  3G2T A; 
#chains in the Genus database with same CATH homology
 3ZPJ A;  2GGF A;  2Q7F A;  3Q49 B;  5AJL A;  4A3T A;  4V3I A;  4C0E A;  3U9W A;  5A23 A;  4KBQ A;  3EJN A;  3CVQ A;  5LX8 A;  4GYW A;  4U0S A;  3URZ A;  1H0A A;  2GW1 A;  2I6H A;  1MHQ A;  5JHB A;  4HOS A;  3UT8 A;  3LY9 A;  2JEK A;  2ILR A;  3L22 A;  4MRU A;  5FJY A;  5BV1 A;  3ML9 A;  3FUF A;  3PDN A;  4UWH A;  3NZU A;  2KZT A;  3SZ7 A;  4G26 A;  1L5J A;  2VJ8 A;  2XPY A;  3MGB A;  4GML A;  1IQU A;  4I1O B;  1PY1 A;  2C0L A;  4JC8 A;  3ESL A;  2JLB A;  2V8S E;  5T8I A;  2IJG X;  3TG4 A;  3RO3 A;  3R7Q A;  3ZEF A;  4DJA A;  1HS6 A;  2YHE A;  3FU6 A;  4GA0 A;  2XGM A;  2MOW A;  3B13 A;  4J8S A;  2CHZ A;  4D10 C;  3BEE A;  4XE0 A;  3QC1 A;  4U0Z A;  4I6G A;  4PS3 A;  3APD A;  4C0M A;  3TL5 A;  3FUL A;  3GYZ A;  3FTV A;  1SQM A;  1DNP A;  4JA9 A;  4P29 A;  3VTY A;  4JVS A;  4GZC A;  4NQ0 A;  4GCN A;  3CV0 A;  4I1A A;  1JWG A;  3CQC B;  4ILI A;  4LEU A;  4WUY A;  4GYY A;  3CHO A;  3EHN A;  3EDT B;  2WXK A;  4KVM A;  2GRM A;  3CVU A;  1E96 B;  4ME2 A;  4FHJ A;  1WAO 1;  3IBE A;  2VSY A;  1X5B A;  2L0T B;  3D9N A;  2OVF A;  1E8Y A;  3LY7 A;  4NRH B;  4B89 A;  1OWP A;  3FHE A;  4XI0 A;  3SBT B;  5ARG A;  3ZYM A;  2XHE A;  2OVB A;  3FEY A;  3U3W A;  2WB2 A;  4JZY A;  3UT4 A;  1ZBP A;  1OUV A;  3QJZ A;  3CHR A;  3HIZ A;  3Q15 A;  4UQX A;  5AEN A;  1Z6T A;  2QY7 A;  3LPZ A;  2HO1 A;  1E8X A;  4APO A;  2WQ7 A;  3CVP A;  4CEM A;  2XQ0 A;  2YNQ A;  5G55 A;  4EBA G;  3S7F A;  3MKR A;  3TXM A;  3ZXS A;  1OWM A;  3K9I A;  4CT4 A;  3AS8 A;  4APF A;  2X6F A;  4DPR A;  4ABN A;  4CDM A;  2A4Z A;  3ASG A;  4W9R A;  5EX3 A;  4I9E A;  3R7R A;  3L08 A;  2J4D A;  3L16 A;  3SGH A;  3ZN3 A;  3RU0 A;  5ANR A;  1PC2 A;  2XRZ A;  3ZGQ A;  1E90 A;  4KXK B;  1WM5 A;  5FZS A;  3KAE A;  4I2Z A;  3ONK A;  2I9C A;  3S7D A;  5JJT A;  2WVI A;  5CHE E;  4CGV A;  4BY6 A;  3MJW A;  1PAQ A;  3QKY A;  5G04 J;  2HR2 A;  3OAW A;  2AXV A;  4LER A;  3ASD A;  4AIF A;  4AP2 A;  1KT0 A;  2PQN A;  2PM6 A;  3FUH A;  4UQY A;  2J08 A;  4ILH B;  3FTU A;  4YVO A;  5EKQ D;  2VGX A;  3PUJ A;  4B8A A;  2I1K A;  2J07 A;  3MZL B;  3VTX A;  1P5Q A;  3RKV A;  2VSX E;  2J49 A;  2KZT B;  2X6H A;  1XNF A;  2DIW A;  4JEU A;  3CHM A;  5ARF A;  4RG6 A;  2DCP A;  1DVP A;  2FBN A;  4GAA A;  4EZJ A;  3ZYQ A;  3SHF A;  1UJJ A;  3FY4 A;  1HG5 A;  1IHG A;  4JEH A;  2LSV A;  1NA0 A;  3T5X A;  3ZRH A;  3LCA A;  2AXZ A;  4E85 A;  3PEV B;  4URK A;  3LYA A;  2WQ6 A;  5D0Q D;  2LNI A;  3ONL A;  2VQ2 A;  3PE4 A;  5JJ6 A;  2WXQ A;  3UT7 A;  4GB9 A;  4XX5 A;  1HFA A;  2KCV A;  3CKB A;  3D9K A;  5D0O D;  3VLD A;  2I2O A;  4U63 A;  1Z3X A;  4ACL A;  4G11 A;  2BTD A;  3G2S A;  3QB2 A;  4HOR A;  3RO2 A;  1HF8 A;  2XRY A;  3VLE A;  2WMO A;  4RSY A;  3LVQ E;  1U3D A;  3L54 A;  4R7L A;  4EBA A;  3Q5M A;  3C98 A;  1SZA A;  4HOQ A;  5AJD A;  3MX3 A;  4N3B A;  1UN8 A;  5BUZ A;  5CCM A;  4FA6 A;  1HO8 A;  4CT0 A;  4UI9 C;  2WXF A;  4JA7 A;  4KZ0 A;  4QFV A;  4UI9 J;  3CVW A;  1UW4 B;  2WQH A;  3FUK A;  4DK5 A;  2CG2 A;  4IUL A;  1BPO A;  3LJ3 A;  4F3V A;  2FO7 A;  2IF4 A;  3FH7 A;  1KLX A;  3D9J A;  4UWL A;  4J0U A;  1SZ9 A;  2QFC A;  4EEC A;  3MV3 B;  2X38 A;  4HFG A;  4TV3 A;  2WXO A;  5G2N A;  3CGH A;  4I6J A;  5KJN A;  4I6E A;  1HE8 A;  2C0M A;  1HU3 A;  4JHR A;  4XKB A;  5BPP A;  1E7U A;  4JL0 A;  4CDN A;  3U66 A;  1EYH A;  3KEZ A;  1E8W A;  4H7X A;  4Q94 A;  3MEK A;  3SF4 A;  2ION A;  4FJZ A;  2AWI A;  2IU1 A;  2XPI A;  1H6K A;  3TXN A;  4G2V A;  4GZD A;  1UN9 A;  2R59 A;  4BX8 A;  5LFA A;  2IQC A;  4FJY A;  1OWO A;  4M3O A;  4BT8 A;  1ELR A;  4JPS A;  4RVB A;  3EIJ A;  4HXI A;  4C9B B;  1W3B A;  2MHK A;  3DBS A;  5KJL A;  3D9P A;  1HG2 A;  2WXP A;  1WY6 A;  3L13 A;  3IV0 A;  5FTP A;  5T4Y A;  3U64 A;  3B7R L;  4CDR A;  4WWP A;  2WXN A;  4WNF A;  2IOL A;  3P2B A;  3MV2 B;  4ILG A;  1JUQ A;  2VGX B;  3LKU A;  3CVL A;  1GW6 A;  2UY1 A;  3B7S A;  3BG1 B;  5LCW C;  5FQ8 A;  1NA3 A;  2V5F A;  2A5U A;  4AY6 A;  4HOT A;  2X6K A;  3AU4 A;  3OXL A;  4ANU A;  3RRM B;  4Y6W A;  5A6C A;  2E0I A;  4J6I A;  1VDY A;  2FF4 A;  3FH8 A;  2XEV A;  2LSU A;  3UX4 A;  2NXP A;  3HVE B;  4LCT A;  3RK6 A;  4B0Z A;  2E2E A;  2WXH A;  4PUC A;  4EPZ A;  1EF1 C;  4OYS A;  4AOF A;  5KJM A;  1H2V C;  1UG3 A;  3CHP A;  1NP7 A;  4AV7 A;  3S7B A;  2KCK A;  3APF A;  4MLP A;  3FU3 A;  5KJK A;  4N3C A;  3B7T A;  3CST A;  4FU3 A;  4TRQ A;  3JYS A;  1HH8 A;  1HZ4 A;  2MRI A;  3SNX A;  2FEZ A;  2VTB B;  1IYG A;  4AEZ C;  3FUM A;  2V0P A;  3CK9 A;  3ZHE B;  3QDN A;  3CVY A;  3S2A A;  3ESK A;  2OV8 A;  3BG0 B;  4IRU A;  5LOZ A;  2AW6 A;  4EZL A;  1Z3Y A;  3FP3 A;  4A1G A;  3AS5 A;  3RRN B;  3KS2 A;  4BFR A;  4DLQ A;  4ACK A;  3UUX A;  4HOU A;  4U8H A;  3RJV A;  2PL2 A;  2KM4 A;  4G23 A;  4Y6C A;  5M72 A;  3ZFW A;  1QNF A;  4L2L A;  3KD7 A;  2P58 C;  4FHK A;  3PVL A;  3FTW A;  2RD0 A;  4L23 A;  4WND A;  5ANL A;  5AIJ A;  4DLO A;  2UWJ G;  3PEU B;  5BW8 C;  4A55 A;  4YND A;  3I5P A;  5A7D B;  3FDH A;  3FUJ A;  1QQE A;  3Q4A B;  1EDU A;  4CGW A;  3FTY A;  4KVO A;  3CQG B;  3HDX A;  4JXT A;  5EDS A;  4BX9 A;  3PZD A;  1U3C A;  4JW1 A;  2YQ8 A;  2PQR A;  1ELK A;  3HVE A;  3PRE A;  3JCK C;  3O4Z A;  5BT1 A;  2WXL A;  4XI9 A;  1OWN A;  4GZ3 A;  3PS6 A;  1H19 A;  1A17 A;  1YA0 A;  5AYW D;  3GZS A;  4GA2 A;  3R9A B;  2PZI A;  3PH0 C;  2Y4T A;  1TEZ A;  3N71 A;  3QWW A;  2CFU A;  4FUL A;  1FVH A;  2Y3A A;  5J08 A;  3FWV A;  4G24 A;  3SBS A;  3UMV A;  3ULQ A;  3HYM B;  3NF1 A;  2VTB A;  1JWF A;  4DI3 A;  4WNE A;  3ZHE A;  3I4G A;  2LAI A;  3PRZ A;  4UWG A;  5JHA A;  2XPZ A;  3PNL B;  3GW4 A;  4ANV A;  3T8M A;  2AVP A;  4A1S A;  2VSN A;  2OND A;  4OVU A;  5DBK A;  2UY1 B;  1HXI A;  4HLE A;  1XGW A;  3UPV A;  4LRZ A;  4ATG A;  3SD5 A;  5FQ6 A;  4Q69 A;  1E8Z A;  4BTA A;  3FU0 A;  3CSF A;  4I1M A;  3TGO A;  3O48 A;  2CHW A;  3LY8 A;  3ASH A;  3QWV A;  1FCH A;  2X6J A;  1N54 A;  3D9L A;  3OTN A;  2VYI A;  3APC A;  4FP7 A;  2NSZ A;  3EIQ C;  4N5C A;  4FLH A;  2BUG A;  4J8D A;  4KYO B;  1LF8 A;  3FEX A;  3CVV A;  4XKC A;  4U04 A;  2V4L A;  4OVV A;  4JHJ A;  4PS8 A;  2KC7 A;  4J8E A;  1QZ2 A;  2FUL A;  4PS7 A;  4K03 A;  3FUD A;  3MA5 A;  5E75 A;  5FZR A;  3ENE A;  3ZVV A;  1ZU2 A;  4L2Y A;  3CVX A;  4JHK A;  3E4B A;  3LVR E;  3MKQ A;  5FQ4 A;  5G05 J;  4AJW A;  5J90 A;  4BTB A;  3RIB A;  3ZIM A;  3FUN A;  1B89 A;  1FVF A;  2X6I A;  3JUI A;  3MYV A;  4GPK A;  3SI5 A;  4AVX A;  4Q96 A;  4BWR A;  1UJK A;  4PH4 B;  1Y6I A;  4GMJ A;  4CRW A;  3B7U X;  2R17 C;  4HS2 A;  4KZC A;  4GA1 A;  3GZ2 A;  3D3M A;  3FH5 A;  5T3R A;  4IN3 B;  1MQS A;  4U0U A;  1H2T C;  2ZU6 B;  5BNW A;  3CEQ A;  3CLJ A;  3QAQ A;  3ZYK A;  4UQZ A;  5DIZ A;  5LP0 A;  3ZYL A;  3QOU A;  4N2Q A;  5E76 A;  5LCW J;  4FAD A;  4BT9 A;  3CIA A;  3FFL A;  4WNG A;  4FLB A;  3CK8 A;  1HX8 A;  2AXU A;  2WM9 A;  4GZ5 A;  3DPD A;  3I3N A;  3CHS A;  3NZS A;  4AM9 A;  4NAC A;  2OOE A;  5FWQ A;  4J8F A;  5BV0 A;  3AS4 A;  5CCL A;  4L7T A;  3UQ3 A;  1E7V A;  2J4B A;  2R5S A;  3I4R B;  4E6H A;  3QK0 A;  2IOS A;  4GCO A;  3LS8 A;  4U07 A;  3QWP A;  1ELW A;  5HQ8 A;  2NC9 A;  4KT6 B;  4EZK A;  3D9I A;  4ANW A;  1IQR A;  3FTS A;  2J09 A;  4AY5 A;  3CHQ A;  3RRU A;  3QAR A;  1N52 A;  3G2U A;  1EPU A;  4I2W A;  3FUI A;  3OXG A;  3IKO B;  5EX0 A;  4F1S A;  5FT9 A;  2RG8 A;  2WXM A;  3AU5 A;  3TAX A;  3PE3 A;  2KAT A;  2IFU A;  4WAF A;  1TJF A;  3MCX A;  4F53 A;  3GZ1 A;  3S7J A;  3TG5 A;  5C1D A;  1INZ A;  3CK7 A;  2HYZ A;  3ASF A;  4F7A A;  3D9O A;  3FU5 A;  3G2V A;  3QNK A;  4WWO A;  2HM8 A;  4CCA A;  4EQF A;  3LDZ A;  4IYP A;  3CR3 A;  4UWK A;  3SFZ A;  4GZ6 A;  3CKC A;  4I17 A;  1Y8M A;  2C2L A;  2WXG A;  4AXH A;  3ML8 A;  3OXF A;  4FC8 A;  2XGO A;  2DBA A;  3FTZ A;  4G25 A;  2EQX A;  5CMW A;  3CVN A;  4NUR A;  5JJ7 A;  4I43 A;  1KT1 A;  2Y4U A;  5G04 C;  5FZQ A;  4B94 A;  2I1J A;  3L6A A;  4B8C B;  2VSO E;  1OWL A;  2PM7 A;  4KMO A;  4N39 A;  4PDX A;  2XCB A;  2WXJ A;  2YHC A;  3U4T A;  4ANX A;  4WWN A;  2LAH A;  4MKT A;  3HHM A;  4O6F A;  3MKQ B;  3WXX A;  3TJP A;  3JQ1 A;  2J9Q A;  3D9M A;  3T5V A;  4TUU A;  5ENN A;  2LO6 A;  3IEG A;  1H2U A;  2WPV A;  3LXU X;  5CMY A;  4UWF A;  5KCM A;  2WMN A;  4RG9 A;  3P1U A;  3IHV A;  2L9B A;  4DI4 A;  4LUN U;  4HVB A;  4XIF A;  3VLF A;  2L0I A;  3NQP A;  2X3M A;  4K0R A;  2WXI A;  3PNT B;  4L1B A;  4XZ4 A;  4YVQ C;  2CFZ A;  5FQ7 A;  1S0P A;  3ZW3 A;  3L17 A;  4GU5 A;  4UI9 K;  2M63 A;  4GYO A;  2CHX A;  5C2Y A;  3Q47 B;  2BF0 X;  3LEW A;  2L6J A;  4I9C A;  5HI7 A;  2WXR A;  2VGY A;  4BSX A;  3IHY A;  3G2W A;  2CG3 A;  3FTX A;  4G1T A;  2XGS A;  2GRL A;  4MS6 A;  1JPL A;  1NZN A;  2KCL A;  3JQ0 A;  3PUK A;  4N3A A;  2FI7 A;  2XCC A;  4A3V A;  2YIN A;  4N2S A;  3FUE A;  3G2T A;  5G05 C;  1TJC A;  3EHM A;  4H7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...