3Q78A

Cryptococcus neoformans protein farnesyltransferase in complex with fspp and ddptasacniq peptide
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
330
structure length
312
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTFPMPSLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase alpha subunit
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase
total genus 124
structure length 312
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q78A00
3SFYA 3HXBA 3PZ1A 1N9AA 2ZISA 1TN6A 4GTPA 4L9PA 1NI1A 1N4SA 1N4RA 3EU5A 1LTXA 1FT1A 4YDOA 3E33A 1D8EA 4GTVA 3DSWA 1DCEA 3Q73A 2ZIRA 3E34A 3DSSA 1LD8A 1LD7A 3Q79A 1FT2A 1N4PA 4LNBA 4MBGA 1TN8A 4GTMA 1QBQA 3HXCA 3Q78A 1TNOA 3DSUA 3DSTA 1S64A 1TN7A 1TNUA 1MZCA 1JCRA 4LNGA 3Q7FA 3DPYA 1O5MA 4EHMA 1N94A 2H6GA 2H6HA 3HXFA 4GTSA 3HXEA 4GTRA 1N4QA 1KZOA 2IEJA 1FPPA 1O1TA 2R2LA 1TNBA 3Q75A 2H6FA 2BEDA 3DRAA 1D8DA 3PZ2A 3C72A 4YDEA 3PZ4A 1S63A 3DSXA 1SA5A 1JCSA 4GTOA 1TNZA 1JCQA 3DSVA 3E37A 3KSQA 1O1RA 3EUVA 2F0YA 1N95A 4GTQA 3HXDA 3E32A 3Q7AA 1SA4A 1NL4A 4GTTA 2H6IA 3PZ3A 1TNYA 1X81A 1O1SA 3SFXA 3E30A 3KSLA 1KZPA
chains in the Genus database with same CATH superfamily
1UOHA 3TGOA 3SFYA 2BUGA 1DVPA 2Y0BG 1N9AA 5EKQD 2GROB 3EIQC 3JXJA 2M63A 2KCLA 1LTXA 5HS0A 3PUKA 4L2LA 5CERB 3MYVA 2ZIRA 1ELKA 2AXZA 4EQFA 3MCXA 2CFUA 4P29A 2I6HA 5JMND 3VTYA 3Q47B 5CEDB 2IU1A 3TWVA 2WXMA 3B13A 2UY1A 4JL0A 4N2QA 3D3MA 4EHMA 4N5QA 5FQ7A 2X3MA 4D10C 3LCAA 5AAOA 3B7SA 3L16A 4U0ZA 4N3AA 4FJYA 1S63A 5FJYA 3MEKA 5AJDA 1A5EA 2DBAA 3HDXA 4J8EA 1JCSA 2AW6A 3HIZA 2X6HA 4UQYA 1NZNA 5ARFA 3Q4AB 1H2UA 5T3RA 2VSNA 2DYRE 3IBEA 4BWRA 3T8KA 4M7CA 1K1BA 3CR3A 5KBAA 1EDUA 3T5VA 3FH8A 1K1AA 1HG2A 3SBSA 4FLHA 4HLLA 2ETAA 3ZHEA 5G2NA 3U9WA 2FO7A 4G24A 3CVYA 3ZRHA 3CSFA 2HM8A 5LCWJ 3PREA 4U8HA 5BPPA 2LAHA 4JB8P 3HHMA 2IQCA 4RLYA 2R59A 3PVLA 1JWFA 4XI0A 4AP2A 4K5AB 1WAO1 3D9IA 3FUNA 4A1SA 3TWWA 4B89A 1L5JA 4WWPA 2PM7A 1XNFA 4U96D 2VSXE 4HVBA 4O6FA 5HI7A 5FQ8A 3FUEA 1PC2A 1K8KG 4N5CA 2R2LA 1K3ZD 3RK6A 4EZKA 3RAUA 2XHEA 5LCWC 1OWNA 1MYOA 4ABNA 2DCPA 5JJTA 3FU6A 2YHEA 4O60A 3Q15A 3QKYA 4WWOA 3CHMA 2F8YA 2C0LA 3MJWA 2UY1B 1ZU2A 2VJ8A 4AVXA 3AG4E 5EX0A 1TYQG 4UWHA 3RJVA 2GRRB 3IXEA 3ZW3A 5EX3A 4BX9A 2KM4A 3KSLA 2WQ7A 4HXIA 2MYOA 4JZYA 3QDNA 1ELWA 3DXMG 4I2ZA 4BT8A 3S7BA 4XZ4A 3P2BA 5KNGA 3LY7A 3FUHA 4XEIG 5FZRA 3SZ7A 3RIBA 5LOZA 4HORA 1IKND 4HRLA 1HO8A 1IYGA 3ASFA 5BXOA 2ZGDA 1TNOA 5DIZA 1U2VG 2B6CA 1TR4A 2CHZA 4JD2G 1ELRA 5CMYA 2XEHA 4G8LA 5ENNA 3DPYA 3BEEA 2EQXA 2L0IA 3TWQA 5CEAA 4AXHA 1ZBPA 3DXKG 2VGXA 3ASOE 1E8WA 3UM3A 2LAIA 4FADA 3C72A 2EILE 3PNLB 3QNKA 4CGWA 5ENRD 4B0ZA 3E37A 3VLDA 2P2CP 2J9QA 1FCHA 2Y3AA 3CHPA 5LX8A 3IHVA 5J90A 2FF4A 1VDYA 4ILHB 2XCBA 1NA3A 2A4ZA 2FBNA 3PUJA 3G2VA 3FTXA 4BSXA 2J4DA 4W9RA 3EU5A 2J09A 2XPYA 4GPMA 2BKGA 4G8KA 4BESA 2XCCA 3B7RL 3UUXA 5T8IA 4YDOA 5G05C 3Q73A 3ULEG 3ZKJA 1LD7A 1TN8A 2LSVA 3RRNB 3SHFA 4LRZA 1EYHA 1QYMA 1BPOA 2VTBA 4APFA 4HNAD 3FTUA 3FUMA 2CHXA 4ANUA 4EBAG 4BTBA 4Y6CA 5KJLA 3LDZA 2H6FA 3APFA 4DLOA 4J8FA 1N54A 4YDEA 3KD7A 2EIKE 5AARA 2AXVA 4F6RD 3LVRE 4I1OB 3ULQA 1Z6TA 3D9KA 4L1BA 2IONA 4I1AA 3PEUB 2B0OE 3ASGA 2DZNA 2L9BA 4FHJA 3DSVA 5KNHD 2IJGX 1OWOA 3I3NA 1N95A 4GTQA 1MHQA 4I6GA 2LO6A 4K5CA 1H6KA 1HH8A 1U3CA 3SFXA 2HYZA 3RSEG 4RQIA 5BW8C 2WQ6A 3AAAC 3PH0C 3UM2A 2PNNA 5AQAA 3FUJA 4JVSA 3PE4A 4CDMA 4CZ2D 4GYOA 3GW4A 4U7EB 1HU3A 4HOUA 5FQ6A 1QZ2A 5CHEE 3OTNA 1DCEA 1NFIE 4U63A 3Q79A 2WPVA 4GA1A 2DYSE 3QJZA 5ENOD 2I1KA 2OCCE 3AG2E 1IXVA 2X6KA 3HYMB 4APOA 3QWWA 1H0AA 1OCRE 3TWUA 4I9CA 1H2VC 4BT9A 4DJAA 3EDTB 4HS2A 4JA7A 2YHCA 5D2MC 1O1TA 1E90A 2A5EA 3QAQA 3JYSA 4R7LA 1Z3XA 4KZCA 4A3TA 5AQBA 4FLBA 4BY6A 3ZGQA 4ANWA 3B7BA 2WQHA 4U8YD 2CHWA 1UW4B 4HFGA 5CCLA 4IULA 2V4LA 4GAAA 2R05A 4G25A 3CGHA 2IO2C 4U8VD 2P9PG 4GTTA 2VTBB 2P9IG 3ZIMA 4FHKA 1OWMA 4B8AA 3ASDA 1O1SA 3ZUVB 4KZ0A 3IHYA 3UT4A 2RKKA 3ZEFA 1HF8A 2XZDG 4F1SA 3Q49B 1HFAA 4MKTA 3CVNA 5G04C 4JEUA 2ZISA 3NZSA 4GTPA 3APDA 4YDWA 2FI7A 2OEVA 5AJLA 4GZ6A 3G2UA 2F37A 3KS2A 5A6CA 4CCAA 1E8ZA 4DX6D 4FP7A 3C5RA 3PDNA 4Z68A 4MLPA 4HOSA 2EINE 4ACKA 2XENA 4HRMB 3JQ1A 1N52A 1RZ4A 3AS5A 4TXPA 3D9MA 2V5QC 4PS8A 4FJZA 4URKA 1N94A 3AU4A 4ACLA 5C1DA 3U64A 3CLJA 1QNFA 3OAWA 4J6IA 4UI9J 3UTMA 2KZTB 3SBTB 3PZ4A 4BFRA 3WXXA 4OYSA 4ATZD 3N71A 4KBQA 3FDHA 3EJNA 3UX4A 1MX6A 4GTOA 5EYLA 4HOQA 4DI3A 2WXGA 3ESKA 4O1PA 1YA0A 3MKQB 4NQ0A 4XKBA 3LY8A 2CG2A 3ZU7B 5FZSA 2R03A 3OXFA 3HXDA 2AXUA 4IRUA 1E96B 2IOSA 2WVIA 2I2OA 4ZHBA 2CFZA 2WXRA 5ENQD 3DEOA 3CV0A 4GMRA 4DX2A 1EPUA 2WXHA 4UI9C 4DX1A 1TN6A 4Q94A 3J5PA 1RW2A 3CKBA 3BG0B 3D9LA 2J4BA 3MKRA 1HE8A 2R5SA 3VLEA 5FQ4A 3UIOC 3DSSA 1S0PA 1WY6A 3S7DA 5KWDA 1SZ9A 2DZOA 4UWFA 5FWQA 3KAEA 3HXCA 4JA9A 5EIBE 2UWJG 4N39A 3JQ0A 2NYJA 4ANVA 3RU0A 3UT7A 4YVQC 4QFVA 4BERA 1KZOA 4MRUA 4M3OA 5KJKA 4PH4B 4JC8A 2CG3A 3PEVB 4CT0A 5ARGA 3CK7A 5A7DB 3O48A 1JWGA 3SI5A 4I2WA 1Y6IA 3NF1A 3RKVA 1OCOE 5BV1A 4HQDA 1DCQA 4N3CA 3QWPA 3CVPA 3UKUG 1TNYA 1X81A 4Q69A 2Y4UA 3V79K 4UWGA 3R9AB 4HBDA 3PE3A 3I5PA 2GRMA 1N4SA 4XKCA 1IQRA 3Q9NC 5B1AE 3TWRA 3FWVA 3ZXSA 2WB2A 1B89A 3QC1A 2WXFA 4A1GA 4GA0A 4OVVA 2MRIA 3MGBA 1FT2A 1QBQA 4CDNA 3NAWA 4DRXE 4ME2A 1UG3A 4LNGA 2KBXA 4C9BB 3Q7FA 1DNPA 1SVXA 2L0TB 4F7AA 4PDXA 5T4YA 3UXGA 5CECB 3BU8A 1KT0A 2IEJA 4CGVA 2LXLA 3SY2A 2XGMA 4Q96A 4JHJA 4U0SA 3UMVA 4AJWA 3U3WA 5AN8A 3C3OA 4KVMA 5JA4D 3CSTA 3ASNE 4AEZC 3RO2A 5ENTD 3TG5A 3KSQA 2J49A 3L54A 5BNWA 4GA2A 2A5UA 3NBNB 3CHOA 2H6IA 4AIFA 1PY1A 2XEEA 3HVEA 3ZNGA 4TRQA 5HQ8A 3CHQA 2JEKA 1FVFA 3C3RA 3DBSA 3BQOA 5G05J 1Z3YA 3EHRA 3C3QA 3GZSA 1H6PA 5AQ7A 5CMWA 3FU5A 4WNDA 1N4RA 1BLXB 1X5BA 2V4HC 3W9FA 3ESLA 1UJJA 2Y1LE 3FY4A 4J7WA 3FU0A 2P9LG 3FULA 3E33A 3V2OA 1SQMA 3R9MA 4FC8A 3CVVA 4LNUD 2VSYA 4X8QA 3ML9A 4FULA 5D66A 3CVWA 2OVFA 4CEMA 4UI9K 2KXPC 4U95D 4I6EA 1O5MA 5AENA 2ZU6B 5FINA 4HB5A 4EZJA 1W3BA 5G55A 3EHQA 2J07A 4I9EA 1BI7B 4JW1A 3TAXA 2XRZA 1HG5A 3V31A 1IQUA 5FZQA 3RRUA 1MQSA 3OXGA 3JUEA 3CVLA 3BG1B 2IY0C 3D9OA 3G2TA 5HRYA 4I17A 4NIKA 5E75A 2ETCA 2JLBA 5D0QD 1EF1C 3ZVVA 4UUCA 4H7XA 2YQ8A 4C48B 3EHNA 3FTYA 4DUIA 1E8XA 1Q2ZA 4BX8A 2OEWA 2WXKA 4ATGA 5J08A 1OY3D 1UJKA 3GYZA 4G23A 3E34A 1KZPA 4ANXA 4GZ5A 4BEPA 3AG1E 4GCOA 1NA0A 3FEXA 2QYJA 1WM5A 3QOUA 4XI9A 3FH5A 3PNTB 1KPSB 1D8EA 2X6FA 3DSWA 4KVOA 4TXQA 2AJAA 2WMOA 3CK9A 4MBGA 4F53A 3TWTA 3FFLA 1MZCA 5KCMA 3PRZA 1D9SA 2RD0A 3HVEB 4J8YA 2XQ0A 3ULYA 4J8DA 3NQPA 3I4GA 2KZTA 4AM9A 4YNDA 2LSUA 2KCKA 3LPZA 2GW1A 3FUKA 3FUDA 2ZXWE 4PS3A 1N4QA 3ZFWA 1AWCB 2BEDA 3UQ3A 3MKQA 5A23A 4DPRA 1QQEA 4BSZB 2L6BA 3L82A 4XX5A 1NP7A 3ZPJA 3VTXA 1JPLA 3RO3A 4WNGA 1Z5SC 3UIPC 5LFAA 3ABME 4CYMD 4E85A 1INZA 3EUVA 3IV0A 3S2AA 1Y8MA 5G04J 5KJNA 3EIJA 2XRYA 3R7QA 3K9IA 5ANLA 1TJCA 1E8YA 5AYWD 2LUHA 2IO3C 1KT1A 3IEGA 2EIJE 4L7TA 3Q9UC 4O1OA 3ONLA 4KMOA 1FT1A 4AOFA 2IFUA 1OXJA 1LD8A 4DX7D 3AS8A 4UWKA 1HXIA 4RSYA 3Q78A 4B8CB 4HLEA 2WMNA 1N0QA 3FUIA 1UN9A 2XEVA 3ZXPA 4NACA 3HXFA 2Q7FA 4J8SA 2PL2A 4I6JA 2C2LA 4JHRA 4G2VA 2E2EA 3FTZA 2I1JA 4WUYA 3GZ2A 4MS6A 3UKRG 2ILRA 5ITZF 4OAVB 2QYUA 4OVUA 2L6JA 3JUIA 4JPSA 1LF8A 4HI9A 1OUVA 2ETBA 5BV0A 1NL4A 4K5BA 3UPVA 3E30A 2WXNA 2QC9A 3TJPA 4YVOA 3EU9A 4N3BA 5JJ7A 3HXBA 3PZ1A 4Y6WA 2QY7A 3AG3E 5ENPD 4XIFA 1PAQA 3CK8A 3LVQE 1V55E 2PM6A 4LEUA 3L13A 4GTVA 5BT1A 3L08A 2RFMA 3T5XA 2QFCA 1JUQA 5AQ9A 1IHGA 2DVWA 4PS7A 1TNUA 3QK0A 3X2QE 2I9CA 4U0UA 4GMLA 2Y69E 4RVBA 3CVQA 4JXTA 5E76A 4CT4A 1TJFA 3LY9A 2H6HA 2VSOE 2HR2A 1H2TC 3D9JA 3TWSA 2BTDA 4H7YA 4IYPA 4AY5A 5JHBA 1D8DA 4WNEA 1KLXA 2YNQA 1OWPA 5EILA 2X6IA 5LP0A 4A63B 4XE0A 4GZ3A 1SA5A 2YINA 5BUZA 1TNZA 1JCQA 2MOWA 4KYOB 5B3SE 3RRMB 4GU5A 4EBAA 2P9SG 2LNIA 4GYYA 1O1RA 3CQGB 1TEZA 1WG0A 3CIAA 3KEZA 3MZLB 1MJ0A 3ASHA 3ML8A 2GRNB 4U04A 3URZA 3ENEA 4A55A 3HG0D 3P1UA 3SD5A 4K0RA 2V0PA 3QARA 4EPZA 3CVUA 3PZDA 5CBOA 2NC9A 4AY6A 3W9GA 1BD8A 5JJ6A 4LERA 4L2YA 5C2YA 4LNBA 3UM0A 4DX5D 3DSUA 3DSTA 2GRQB 1E7VA 1SW6A 3MV3B 4G1TA 1OT8A 3PS6A 2PZIA 2XGSA 5JHAA 1HS6A 1OCZE 3UM1A 2GGFA 3EHMA 4GZDA 3SGHA 4WWNA 5AIJA 4GMJA 5D0OD 3V30A 3ABLE 3UT8A 2IOLA 3PZ2A 3AJIA 3FTVA 2FEZA 4KT6B 2R17C 4RG6A 4V3IA 4EECA 2NSZA 4YDYA 3U4TA 4E6HA 2BKKB 2WXIA 3D9NA 4L23A 4DK5A 3MA5A 2WXJA 4WAFA 3UINC 3Q7AA 2ONDA 3S7JA 4KXKB 2IF4A 5EN5D 3ZYMA 5EYPF 3NB2A 4J0UA 3TWXA 4OAUC 2V5FA 3B95A 3UI2A 4B94A 1FVHA 3F6QA 5H7PA 3T9KA 3Q5MA 3C98A 4WNFA 3FHEA 5B1BE 3ISMC 4JEHA 3DEPA 2R02A 4TV3A 3ZHEB 4CRWA 1SZAA 2GRPB 2WXOA 3J5QB 3LJNA 4UQZA 3KEAA 2V8SE 1N4PA 3MV2B 3B7TA 4G26A 2RFAA 4GTMA 2E0IA 4GB9A 5IY5E 1G3NB 5CBNA 4TUUA 3LEWA 3TXNA 2OV8A 5CRUA 5FIOA 4N2SA 1JCRA 3CEQA 4ILIA 5EDSA 3AU5A 3G2SA 1GW6A 2PQNA 2J08A 3B7UX 3HXEA 4GTRA 5DBKA 2KATA 4HRNA 2HO1A 1FPPA 3VLFA 3FP3A 3GZ1A 1HX8A 2WM9A 3CQCB 3IKOB 3CHRA 2P9NG 3L17A 5ANRA 2HE0A 4DI4A 5KJMA 3ZYKA 1MX4A 3AS4A 4FA6A 2KCVA 2F0YA 1A17A 2BF0X 4CDRA 3S7FA 4ZFHA 4F3VA 2X6JA 3TG4A 2P58C 5FT9A 4L9PA 3LJ3A 1DC2A 3L9TA 3L22A 1YMPA 2VGEA 2GRLA 3LXUX 3U66A 1U3DA 4GYWA 4A3VA 3FU3A 2XS1A 4DLQA 3MX3A 3ABKE 3ZYQA 3D9PA 3JCKC 3CVXA 2X38A 2DIWA 2WXPA 4I1MA 4IN3B 1TN7A 5M72A 4NRHB 3ONKA 4HOTA 3FEYA 2NXPA 3G2WA 3DPDA 3APCA 3TXMA 2PQRA 1TNBA 3Q75A 4G11A 3BUAA 5EIDA 3DRAA 3HRAA 1ZB1A 5HKPA 3QWVA 3R7RA 2VGYA 3WG7E 2AVPA 3LKUA 1N11A 3OXLA 2VGXB 2DWZA 1OCCE 4NURA 3DWLG 4LCTA 4GPKA 4B93B 3SFZA 2F8XK 3SF4A 1H6OA 3CKCA 2C0MA 3FTWA 2VQ2A 1BU9A 3CHSA 4RG9A 5ENSD 1H19A 4FU3A 3T8MA 2EIME 4C0EA 1NI1A 4TXRA 3ZYLA 1UN8A 4F1PA 3LYAA 1IHBA 5BXUA 4BTAA 2XPIA 5FTPA 3E4BA 2MHKA 4GZCA 2Y4TA 4JHKA 3FH7A 2KC7A 4I43A 3D9HA 2OOEA 2XPZA 4UQXA 1V54E 4QQIA 5CRVA 1S64A 1N0RA 1YYHA 1BI8B 1S70B 4AV7A 2LXMA 3L6AA 2QZAA 3SQVA 3JXIA 4GCNA 1XGWA 4K03A 2H6GA 4GTSA 4C0MA 3NOCD 3FUFA 2WXLA 2RG8A 3O4ZA 2ZGGA 2XGOA 3QB2A 1WDYA 2FULA 4PUCA 5CCMA 3DSXA 4EZLA 1YCSB 4LSZE 2VYIA 1MX2A 2XS8A 2OVBA 2WXQA 4BETA 3V2XA 3NZUA 4TUMA 4LUNU 3ZN3A 2P9UG 3TL5A 4HI8A 4LG6A 3NOGD 2FO1E 3SNXA 3LS8A 4UWLA 4U07A 1HZ4A 4ILGA 2AWIA 2XZTG 3E32A 1SA4A 1P5QA 1OWLA 3PZ3A 2P9KG 3SO8A 2J8SD 1AP7A 1E7UA 2JABA 3FTSA 3I4RB
chains in the Genus database with same CATH topology
3SFYA 3HXBA 3PZ1A 1N9AA 2ZISA 1TN6A 4GTPA 4L9PA 1NI1A 1N4SA 1N4RA 3EU5A 1LTXA 1FT1A 4YDOA 3E33A 1D8EA 4GTVA 3DSWA 1DCEA 3Q73A 2ZIRA 3E34A 3DSSA 1LD8A 1LD7A 3Q79A 1FT2A 1N4PA 4LNBA 4MBGA 1TN8A 4GTMA 1QBQA 3HXCA 3Q78A 1TNOA 3DSUA 3DSTA 1S64A 1TN7A 1TNUA 1MZCA 1JCRA 4LNGA 3Q7FA 3DPYA 1O5MA 4EHMA 1N94A 2H6GA 2H6HA 3HXFA 4GTSA 3HXEA 4GTRA 1N4QA 1KZOA 2IEJA 1FPPA 1O1TA 2R2LA 1TNBA 3Q75A 2H6FA 2BEDA 3DRAA 1D8DA 3PZ2A 3C72A 4YDEA 3PZ4A 1S63A 3DSXA 1SA5A 1JCSA 4GTOA 1TNZA 1JCQA 3DSVA 3E37A 3KSQA 1O1RA 3EUVA 2F0YA 1N95A 4GTQA 3HXDA 3E32A 3Q7AA 1SA4A 1NL4A 4GTTA 2H6IA 3PZ3A 1TNYA 1X81A 1O1SA 3SFXA 3E30A 3KSLA 1KZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFY A;  3HXB A;  3PZ1 A;  1N9A A;  2ZIS A;  1TN6 A;  4GTP A;  4L9P A;  1NI1 A;  1N4S A;  1N4R A;  3EU5 A;  1LTX A;  1FT1 A;  4YDO A;  3E33 A;  1D8E A;  4GTV A;  3DSW A;  1DCE A;  3Q73 A;  2ZIR A;  3E34 A;  3DSS A;  1LD8 A;  1LD7 A;  3Q79 A;  1FT2 A;  1N4P A;  4LNB A;  4MBG A;  1TN8 A;  4GTM A;  1QBQ A;  3HXC A;  3Q78 A;  1TNO A;  3DSU A;  3DST A;  1S64 A;  1TN7 A;  1TNU A;  1MZC A;  1JCR A;  4LNG A;  3Q7F A;  3DPY A;  1O5M A;  4EHM A;  1N94 A;  2H6G A;  2H6H A;  3HXF A;  4GTS A;  3HXE A;  4GTR A;  1N4Q A;  1KZO A;  2IEJ A;  1FPP A;  1O1T A;  2R2L A;  1TNB A;  3Q75 A;  2H6F A;  2BED A;  3DRA A;  1D8D A;  3PZ2 A;  3C72 A;  4YDE A;  3PZ4 A;  1S63 A;  3DSX A;  1SA5 A;  1JCS A;  4GTO A;  1TNZ A;  1JCQ A;  3DSV A;  3E37 A;  3KSQ A;  1O1R A;  3EUV A;  2F0Y A;  1N95 A;  4GTQ A;  3HXD A;  3E32 A;  3Q7A A;  1SA4 A;  1NL4 A;  4GTT A;  2H6I A;  3PZ3 A;  1TNY A;  1X81 A;  1O1S A;  3SFX A;  3E30 A;  3KSL A;  1KZP A; 
#chains in the Genus database with same CATH topology
 1UOH A;  3TGO A;  3SFY A;  2BUG A;  1DVP A;  2Y0B G;  1N9A A;  5EKQ D;  2GRO B;  3EIQ C;  3JXJ A;  2M63 A;  2KCL A;  1LTX A;  5HS0 A;  3PUK A;  4L2L A;  5CER B;  3MYV A;  2ZIR A;  1ELK A;  2AXZ A;  4EQF A;  3MCX A;  2CFU A;  4P29 A;  2I6H A;  5JMN D;  3VTY A;  3Q47 B;  5CED B;  2IU1 A;  3TWV A;  2WXM A;  3B13 A;  2UY1 A;  4JL0 A;  4N2Q A;  3D3M A;  4EHM A;  4N5Q A;  5FQ7 A;  2X3M A;  4D10 C;  3LCA A;  5AAO A;  3B7S A;  3L16 A;  4U0Z A;  4N3A A;  4FJY A;  1S63 A;  5FJY A;  3MEK A;  5AJD A;  1A5E A;  2DBA A;  3HDX A;  4J8E A;  1JCS A;  2AW6 A;  3HIZ A;  2X6H A;  4UQY A;  1NZN A;  5ARF A;  3Q4A B;  1H2U A;  5T3R A;  2VSN A;  2DYR E;  3IBE A;  4BWR A;  3T8K A;  4M7C A;  1K1B A;  3CR3 A;  5KBA A;  1EDU A;  3T5V A;  3FH8 A;  1K1A A;  1HG2 A;  3SBS A;  4FLH A;  4HLL A;  2ETA A;  3ZHE A;  5G2N A;  3U9W A;  2FO7 A;  4G24 A;  3CVY A;  3ZRH A;  3CSF A;  2HM8 A;  5LCW J;  3PRE A;  4U8H A;  5BPP A;  2LAH A;  4JB8 P;  3HHM A;  2IQC A;  4RLY A;  2R59 A;  3PVL A;  1JWF A;  4XI0 A;  4AP2 A;  4K5A B;  1WAO 1;  3D9I A;  3FUN A;  4A1S A;  3TWW A;  4B89 A;  1L5J A;  4WWP A;  2PM7 A;  1XNF A;  4U96 D;  2VSX E;  4HVB A;  4O6F A;  5HI7 A;  5FQ8 A;  3FUE A;  1PC2 A;  1K8K G;  4N5C A;  2R2L A;  1K3Z D;  3RK6 A;  4EZK A;  3RAU A;  2XHE A;  5LCW C;  1OWN A;  1MYO A;  4ABN A;  2DCP A;  5JJT A;  3FU6 A;  2YHE A;  4O60 A;  3Q15 A;  3QKY A;  4WWO A;  3CHM A;  2F8Y A;  2C0L A;  3MJW A;  2UY1 B;  1ZU2 A;  2VJ8 A;  4AVX A;  3AG4 E;  5EX0 A;  1TYQ G;  4UWH A;  3RJV A;  2GRR B;  3IXE A;  3ZW3 A;  5EX3 A;  4BX9 A;  2KM4 A;  3KSL A;  2WQ7 A;  4HXI A;  2MYO A;  4JZY A;  3QDN A;  1ELW A;  3DXM G;  4I2Z A;  4BT8 A;  3S7B A;  4XZ4 A;  3P2B A;  5KNG A;  3LY7 A;  3FUH A;  4XEI G;  5FZR A;  3SZ7 A;  3RIB A;  5LOZ A;  4HOR A;  1IKN D;  4HRL A;  1HO8 A;  1IYG A;  3ASF A;  5BXO A;  2ZGD A;  1TNO A;  5DIZ A;  1U2V G;  2B6C A;  1TR4 A;  2CHZ A;  4JD2 G;  1ELR A;  5CMY A;  2XEH A;  4G8L A;  5ENN A;  3DPY A;  3BEE A;  2EQX A;  2L0I A;  3TWQ A;  5CEA A;  4AXH A;  1ZBP A;  3DXK G;  2VGX A;  3ASO E;  1E8W A;  3UM3 A;  2LAI A;  4FAD A;  3C72 A;  2EIL E;  3PNL B;  3QNK A;  4CGW A;  5ENR D;  4B0Z A;  3E37 A;  3VLD A;  2P2C P;  2J9Q A;  1FCH A;  2Y3A A;  3CHP A;  5LX8 A;  3IHV A;  5J90 A;  2FF4 A;  1VDY A;  4ILH B;  2XCB A;  1NA3 A;  2A4Z A;  2FBN A;  3PUJ A;  3G2V A;  3FTX A;  4BSX A;  2J4D A;  4W9R A;  3EU5 A;  2J09 A;  2XPY A;  4GPM A;  2BKG A;  4G8K A;  4BES A;  2XCC A;  3B7R L;  3UUX A;  5T8I A;  4YDO A;  5G05 C;  3Q73 A;  3ULE G;  3ZKJ A;  1LD7 A;  1TN8 A;  2LSV A;  3RRN B;  3SHF A;  4LRZ A;  1EYH A;  1QYM A;  1BPO A;  2VTB A;  4APF A;  4HNA D;  3FTU A;  3FUM A;  2CHX A;  4ANU A;  4EBA G;  4BTB A;  4Y6C A;  5KJL A;  3LDZ A;  2H6F A;  3APF A;  4DLO A;  4J8F A;  1N54 A;  4YDE A;  3KD7 A;  2EIK E;  5AAR A;  2AXV A;  4F6R D;  3LVR E;  4I1O B;  3ULQ A;  1Z6T A;  3D9K A;  4L1B A;  2ION A;  4I1A A;  3PEU B;  2B0O E;  3ASG A;  2DZN A;  2L9B A;  4FHJ A;  3DSV A;  5KNH D;  2IJG X;  1OWO A;  3I3N A;  1N95 A;  4GTQ A;  1MHQ A;  4I6G A;  2LO6 A;  4K5C A;  1H6K A;  1HH8 A;  1U3C A;  3SFX A;  2HYZ A;  3RSE G;  4RQI A;  5BW8 C;  2WQ6 A;  3AAA C;  3PH0 C;  3UM2 A;  2PNN A;  5AQA A;  3FUJ A;  4JVS A;  3PE4 A;  4CDM A;  4CZ2 D;  4GYO A;  3GW4 A;  4U7E B;  1HU3 A;  4HOU A;  5FQ6 A;  1QZ2 A;  5CHE E;  3OTN A;  1DCE A;  1NFI E;  4U63 A;  3Q79 A;  2WPV A;  4GA1 A;  2DYS E;  3QJZ A;  5ENO D;  2I1K A;  2OCC E;  3AG2 E;  1IXV A;  2X6K A;  3HYM B;  4APO A;  3QWW A;  1H0A A;  1OCR E;  3TWU A;  4I9C A;  1H2V C;  4BT9 A;  4DJA A;  3EDT B;  4HS2 A;  4JA7 A;  2YHC A;  5D2M C;  1O1T A;  1E90 A;  2A5E A;  3QAQ A;  3JYS A;  4R7L A;  1Z3X A;  4KZC A;  4A3T A;  5AQB A;  4FLB A;  4BY6 A;  3ZGQ A;  4ANW A;  3B7B A;  2WQH A;  4U8Y D;  2CHW A;  1UW4 B;  4HFG A;  5CCL A;  4IUL A;  2V4L A;  4GAA A;  2R05 A;  4G25 A;  3CGH A;  2IO2 C;  4U8V D;  2P9P G;  4GTT A;  2VTB B;  2P9I G;  3ZIM A;  4FHK A;  1OWM A;  4B8A A;  3ASD A;  1O1S A;  3ZUV B;  4KZ0 A;  3IHY A;  3UT4 A;  2RKK A;  3ZEF A;  1HF8 A;  2XZD G;  4F1S A;  3Q49 B;  1HFA A;  4MKT A;  3CVN A;  5G04 C;  4JEU A;  2ZIS A;  3NZS A;  4GTP A;  3APD A;  4YDW A;  2FI7 A;  2OEV A;  5AJL A;  4GZ6 A;  3G2U A;  2F37 A;  3KS2 A;  5A6C A;  4CCA A;  1E8Z A;  4DX6 D;  4FP7 A;  3C5R A;  3PDN A;  4Z68 A;  4MLP A;  4HOS A;  2EIN E;  4ACK A;  2XEN A;  4HRM B;  3JQ1 A;  1N52 A;  1RZ4 A;  3AS5 A;  4TXP A;  3D9M A;  2V5Q C;  4PS8 A;  4FJZ A;  4URK A;  1N94 A;  3AU4 A;  4ACL A;  5C1D A;  3U64 A;  3CLJ A;  1QNF A;  3OAW A;  4J6I A;  4UI9 J;  3UTM A;  2KZT B;  3SBT B;  3PZ4 A;  4BFR A;  3WXX A;  4OYS A;  4ATZ D;  3N71 A;  4KBQ A;  3FDH A;  3EJN A;  3UX4 A;  1MX6 A;  4GTO A;  5EYL A;  4HOQ A;  4DI3 A;  2WXG A;  3ESK A;  4O1P A;  1YA0 A;  3MKQ B;  4NQ0 A;  4XKB A;  3LY8 A;  2CG2 A;  3ZU7 B;  5FZS A;  2R03 A;  3OXF A;  3HXD A;  2AXU A;  4IRU A;  1E96 B;  2IOS A;  2WVI A;  2I2O A;  4ZHB A;  2CFZ A;  2WXR A;  5ENQ D;  3DEO A;  3CV0 A;  4GMR A;  4DX2 A;  1EPU A;  2WXH A;  4UI9 C;  4DX1 A;  1TN6 A;  4Q94 A;  3J5P A;  1RW2 A;  3CKB A;  3BG0 B;  3D9L A;  2J4B A;  3MKR A;  1HE8 A;  2R5S A;  3VLE A;  5FQ4 A;  3UIO C;  3DSS A;  1S0P A;  1WY6 A;  3S7D A;  5KWD A;  1SZ9 A;  2DZO A;  4UWF A;  5FWQ A;  3KAE A;  3HXC A;  4JA9 A;  5EIB E;  2UWJ G;  4N39 A;  3JQ0 A;  2NYJ A;  4ANV A;  3RU0 A;  3UT7 A;  4YVQ C;  4QFV A;  4BER A;  1KZO A;  4MRU A;  4M3O A;  5KJK A;  4PH4 B;  4JC8 A;  2CG3 A;  3PEV B;  4CT0 A;  5ARG A;  3CK7 A;  5A7D B;  3O48 A;  1JWG A;  3SI5 A;  4I2W A;  1Y6I A;  3NF1 A;  3RKV A;  1OCO E;  5BV1 A;  4HQD A;  1DCQ A;  4N3C A;  3QWP A;  3CVP A;  3UKU G;  1TNY A;  1X81 A;  4Q69 A;  2Y4U A;  3V79 K;  4UWG A;  3R9A B;  4HBD A;  3PE3 A;  3I5P A;  2GRM A;  1N4S A;  4XKC A;  1IQR A;  3Q9N C;  5B1A E;  3TWR A;  3FWV A;  3ZXS A;  2WB2 A;  1B89 A;  3QC1 A;  2WXF A;  4A1G A;  4GA0 A;  4OVV A;  2MRI A;  3MGB A;  1FT2 A;  1QBQ A;  4CDN A;  3NAW A;  4DRX E;  4ME2 A;  1UG3 A;  4LNG A;  2KBX A;  4C9B B;  3Q7F A;  1DNP A;  1SVX A;  2L0T B;  4F7A A;  4PDX A;  5T4Y A;  3UXG A;  5CEC B;  3BU8 A;  1KT0 A;  2IEJ A;  4CGV A;  2LXL A;  3SY2 A;  2XGM A;  4Q96 A;  4JHJ A;  4U0S A;  3UMV A;  4AJW A;  3U3W A;  5AN8 A;  3C3O A;  4KVM A;  5JA4 D;  3CST A;  3ASN E;  4AEZ C;  3RO2 A;  5ENT D;  3TG5 A;  3KSQ A;  2J49 A;  3L54 A;  5BNW A;  4GA2 A;  2A5U A;  3NBN B;  3CHO A;  2H6I A;  4AIF A;  1PY1 A;  2XEE A;  3HVE A;  3ZNG A;  4TRQ A;  5HQ8 A;  3CHQ A;  2JEK A;  1FVF A;  3C3R A;  3DBS A;  3BQO A;  5G05 J;  1Z3Y A;  3EHR A;  3C3Q A;  3GZS A;  1H6P A;  5AQ7 A;  5CMW A;  3FU5 A;  4WND A;  1N4R A;  1BLX B;  1X5B A;  2V4H C;  3W9F A;  3ESL A;  1UJJ A;  2Y1L E;  3FY4 A;  4J7W A;  3FU0 A;  2P9L G;  3FUL A;  3E33 A;  3V2O A;  1SQM A;  3R9M A;  4FC8 A;  3CVV A;  4LNU D;  2VSY A;  4X8Q A;  3ML9 A;  4FUL A;  5D66 A;  3CVW A;  2OVF A;  4CEM A;  4UI9 K;  2KXP C;  4U95 D;  4I6E A;  1O5M A;  5AEN A;  2ZU6 B;  5FIN A;  4HB5 A;  4EZJ A;  1W3B A;  5G55 A;  3EHQ A;  2J07 A;  4I9E A;  1BI7 B;  4JW1 A;  3TAX A;  2XRZ A;  1HG5 A;  3V31 A;  1IQU A;  5FZQ A;  3RRU A;  1MQS A;  3OXG A;  3JUE A;  3CVL A;  3BG1 B;  2IY0 C;  3D9O A;  3G2T A;  5HRY A;  4I17 A;  4NIK A;  5E75 A;  2ETC A;  2JLB A;  5D0Q D;  1EF1 C;  3ZVV A;  4UUC A;  4H7X A;  2YQ8 A;  4C48 B;  3EHN A;  3FTY A;  4DUI A;  1E8X A;  1Q2Z A;  4BX8 A;  2OEW A;  2WXK A;  4ATG A;  5J08 A;  1OY3 D;  1UJK A;  3GYZ A;  4G23 A;  3E34 A;  1KZP A;  4ANX A;  4GZ5 A;  4BEP A;  3AG1 E;  4GCO A;  1NA0 A;  3FEX A;  2QYJ A;  1WM5 A;  3QOU A;  4XI9 A;  3FH5 A;  3PNT B;  1KPS B;  1D8E A;  2X6F A;  3DSW A;  4KVO A;  4TXQ A;  2AJA A;  2WMO A;  3CK9 A;  4MBG A;  4F53 A;  3TWT A;  3FFL A;  1MZC A;  5KCM A;  3PRZ A;  1D9S A;  2RD0 A;  3HVE B;  4J8Y A;  2XQ0 A;  3ULY A;  4J8D A;  3NQP A;  3I4G A;  2KZT A;  4AM9 A;  4YND A;  2LSU A;  2KCK A;  3LPZ A;  2GW1 A;  3FUK A;  3FUD A;  2ZXW E;  4PS3 A;  1N4Q A;  3ZFW A;  1AWC B;  2BED A;  3UQ3 A;  3MKQ A;  5A23 A;  4DPR A;  1QQE A;  4BSZ B;  2L6B A;  3L82 A;  4XX5 A;  1NP7 A;  3ZPJ A;  3VTX A;  1JPL A;  3RO3 A;  4WNG A;  1Z5S C;  3UIP C;  5LFA A;  3ABM E;  4CYM D;  4E85 A;  1INZ A;  3EUV A;  3IV0 A;  3S2A A;  1Y8M A;  5G04 J;  5KJN A;  3EIJ A;  2XRY A;  3R7Q A;  3K9I A;  5ANL A;  1TJC A;  1E8Y A;  5AYW D;  2LUH A;  2IO3 C;  1KT1 A;  3IEG A;  2EIJ E;  4L7T A;  3Q9U C;  4O1O A;  3ONL A;  4KMO A;  1FT1 A;  4AOF A;  2IFU A;  1OXJ A;  1LD8 A;  4DX7 D;  3AS8 A;  4UWK A;  1HXI A;  4RSY A;  3Q78 A;  4B8C B;  4HLE A;  2WMN A;  1N0Q A;  3FUI A;  1UN9 A;  2XEV A;  3ZXP A;  4NAC A;  3HXF A;  2Q7F A;  4J8S A;  2PL2 A;  4I6J A;  2C2L A;  4JHR A;  4G2V A;  2E2E A;  3FTZ A;  2I1J A;  4WUY A;  3GZ2 A;  4MS6 A;  3UKR G;  2ILR A;  5ITZ F;  4OAV B;  2QYU A;  4OVU A;  2L6J A;  3JUI A;  4JPS A;  1LF8 A;  4HI9 A;  1OUV A;  2ETB A;  5BV0 A;  1NL4 A;  4K5B A;  3UPV A;  3E30 A;  2WXN A;  2QC9 A;  3TJP A;  4YVO A;  3EU9 A;  4N3B A;  5JJ7 A;  3HXB A;  3PZ1 A;  4Y6W A;  2QY7 A;  3AG3 E;  5ENP D;  4XIF A;  1PAQ A;  3CK8 A;  3LVQ E;  1V55 E;  2PM6 A;  4LEU A;  3L13 A;  4GTV A;  5BT1 A;  3L08 A;  2RFM A;  3T5X A;  2QFC A;  1JUQ A;  5AQ9 A;  1IHG A;  2DVW A;  4PS7 A;  1TNU A;  3QK0 A;  3X2Q E;  2I9C A;  4U0U A;  4GML A;  2Y69 E;  4RVB A;  3CVQ A;  4JXT A;  5E76 A;  4CT4 A;  1TJF A;  3LY9 A;  2H6H A;  2VSO E;  2HR2 A;  1H2T C;  3D9J A;  3TWS A;  2BTD A;  4H7Y A;  4IYP A;  4AY5 A;  5JHB A;  1D8D A;  4WNE A;  1KLX A;  2YNQ A;  1OWP A;  5EIL A;  2X6I A;  5LP0 A;  4A63 B;  4XE0 A;  4GZ3 A;  1SA5 A;  2YIN A;  5BUZ A;  1TNZ A;  1JCQ A;  2MOW A;  4KYO B;  5B3S E;  3RRM B;  4GU5 A;  4EBA A;  2P9S G;  2LNI A;  4GYY A;  1O1R A;  3CQG B;  1TEZ A;  1WG0 A;  3CIA A;  3KEZ A;  3MZL B;  1MJ0 A;  3ASH A;  3ML8 A;  2GRN B;  4U04 A;  3URZ A;  3ENE A;  4A55 A;  3HG0 D;  3P1U A;  3SD5 A;  4K0R A;  2V0P A;  3QAR A;  4EPZ A;  3CVU A;  3PZD A;  5CBO A;  2NC9 A;  4AY6 A;  3W9G A;  1BD8 A;  5JJ6 A;  4LER A;  4L2Y A;  5C2Y A;  4LNB A;  3UM0 A;  4DX5 D;  3DSU A;  3DST A;  2GRQ B;  1E7V A;  1SW6 A;  3MV3 B;  4G1T A;  1OT8 A;  3PS6 A;  2PZI A;  2XGS A;  5JHA A;  1HS6 A;  1OCZ E;  3UM1 A;  2GGF A;  3EHM A;  4GZD A;  3SGH A;  4WWN A;  5AIJ A;  4GMJ A;  5D0O D;  3V30 A;  3ABL E;  3UT8 A;  2IOL A;  3PZ2 A;  3AJI A;  3FTV A;  2FEZ A;  4KT6 B;  2R17 C;  4RG6 A;  4V3I A;  4EEC A;  2NSZ A;  4YDY A;  3U4T A;  4E6H A;  2BKK B;  2WXI A;  3D9N A;  4L23 A;  4DK5 A;  3MA5 A;  2WXJ A;  4WAF A;  3UIN C;  3Q7A A;  2OND A;  3S7J A;  4KXK B;  2IF4 A;  5EN5 D;  3ZYM A;  5EYP F;  3NB2 A;  4J0U A;  3TWX A;  4OAU C;  2V5F A;  3B95 A;  3UI2 A;  4B94 A;  1FVH A;  3F6Q A;  5H7P A;  3T9K A;  3Q5M A;  3C98 A;  4WNF A;  3FHE A;  5B1B E;  3ISM C;  4JEH A;  3DEP A;  2R02 A;  4TV3 A;  3ZHE B;  4CRW A;  1SZA A;  2GRP B;  2WXO A;  3J5Q B;  3LJN A;  4UQZ A;  3KEA A;  2V8S E;  1N4P A;  3MV2 B;  3B7T A;  4G26 A;  2RFA A;  4GTM A;  2E0I A;  4GB9 A;  5IY5 E;  1G3N B;  5CBN A;  4TUU A;  3LEW A;  3TXN A;  2OV8 A;  5CRU A;  5FIO A;  4N2S A;  1JCR A;  3CEQ A;  4ILI A;  5EDS A;  3AU5 A;  3G2S A;  1GW6 A;  2PQN A;  2J08 A;  3B7U X;  3HXE A;  4GTR A;  5DBK A;  2KAT A;  4HRN A;  2HO1 A;  1FPP A;  3VLF A;  3FP3 A;  3GZ1 A;  1HX8 A;  2WM9 A;  3CQC B;  3IKO B;  3CHR A;  2P9N G;  3L17 A;  5ANR A;  2HE0 A;  4DI4 A;  5KJM A;  3ZYK A;  1MX4 A;  3AS4 A;  4FA6 A;  2KCV A;  2F0Y A;  1A17 A;  2BF0 X;  4CDR A;  3S7F A;  4ZFH A;  4F3V A;  2X6J A;  3TG4 A;  2P58 C;  5FT9 A;  4L9P A;  3LJ3 A;  1DC2 A;  3L9T A;  3L22 A;  1YMP A;  2VGE A;  2GRL A;  3LXU X;  3U66 A;  1U3D A;  4GYW A;  4A3V A;  3FU3 A;  2XS1 A;  4DLQ A;  3MX3 A;  3ABK E;  3ZYQ A;  3D9P A;  3JCK C;  3CVX A;  2X38 A;  2DIW A;  2WXP A;  4I1M A;  4IN3 B;  1TN7 A;  5M72 A;  4NRH B;  3ONK A;  4HOT A;  3FEY A;  2NXP A;  3G2W A;  3DPD A;  3APC A;  3TXM A;  2PQR A;  1TNB A;  3Q75 A;  4G11 A;  3BUA A;  5EID A;  3DRA A;  3HRA A;  1ZB1 A;  5HKP A;  3QWV A;  3R7R A;  2VGY A;  3WG7 E;  2AVP A;  3LKU A;  1N11 A;  3OXL A;  2VGX B;  2DWZ A;  1OCC E;  4NUR A;  3DWL G;  4LCT A;  4GPK A;  4B93 B;  3SFZ A;  2F8X K;  3SF4 A;  1H6O A;  3CKC A;  2C0M A;  3FTW A;  2VQ2 A;  1BU9 A;  3CHS A;  4RG9 A;  5ENS D;  1H19 A;  4FU3 A;  3T8M A;  2EIM E;  4C0E A;  1NI1 A;  4TXR A;  3ZYL A;  1UN8 A;  4F1P A;  3LYA A;  1IHB A;  5BXU A;  4BTA A;  2XPI A;  5FTP A;  3E4B A;  2MHK A;  4GZC A;  2Y4T A;  4JHK A;  3FH7 A;  2KC7 A;  4I43 A;  3D9H A;  2OOE A;  2XPZ A;  4UQX A;  1V54 E;  4QQI A;  5CRV A;  1S64 A;  1N0R A;  1YYH A;  1BI8 B;  1S70 B;  4AV7 A;  2LXM A;  3L6A A;  2QZA A;  3SQV A;  3JXI A;  4GCN A;  1XGW A;  4K03 A;  2H6G A;  4GTS A;  4C0M A;  3NOC D;  3FUF A;  2WXL A;  2RG8 A;  3O4Z A;  2ZGG A;  2XGO A;  3QB2 A;  1WDY A;  2FUL A;  4PUC A;  5CCM A;  3DSX A;  4EZL A;  1YCS B;  4LSZ E;  2VYI A;  1MX2 A;  2XS8 A;  2OVB A;  2WXQ A;  4BET A;  3V2X A;  3NZU A;  4TUM A;  4LUN U;  3ZN3 A;  2P9U G;  3TL5 A;  4HI8 A;  4LG6 A;  3NOG D;  2FO1 E;  3SNX A;  3LS8 A;  4UWL A;  4U07 A;  1HZ4 A;  4ILG A;  2AWI A;  2XZT G;  3E32 A;  1SA4 A;  1P5Q A;  1OWL A;  3PZ3 A;  2P9K G;  3SO8 A;  2J8S D;  1AP7 A;  1E7U A;  2JAB A;  3FTS A;  3I4R B; 
#chains in the Genus database with same CATH homology
 3SFY A;  3HXB A;  3PZ1 A;  1N9A A;  2ZIS A;  1TN6 A;  4GTP A;  4L9P A;  1NI1 A;  1N4S A;  1N4R A;  3EU5 A;  1LTX A;  1FT1 A;  4YDO A;  3E33 A;  1D8E A;  4GTV A;  3DSW A;  1DCE A;  3Q73 A;  2ZIR A;  3E34 A;  3DSS A;  1LD8 A;  1LD7 A;  3Q79 A;  1FT2 A;  1N4P A;  4LNB A;  4MBG A;  1TN8 A;  4GTM A;  1QBQ A;  3HXC A;  3Q78 A;  1TNO A;  3DSU A;  3DST A;  1S64 A;  1TN7 A;  1TNU A;  1MZC A;  1JCR A;  4LNG A;  3Q7F A;  3DPY A;  1O5M A;  4EHM A;  1N94 A;  2H6G A;  2H6H A;  3HXF A;  4GTS A;  3HXE A;  4GTR A;  1N4Q A;  1KZO A;  2IEJ A;  1FPP A;  1O1T A;  2R2L A;  1TNB A;  3Q75 A;  2H6F A;  2BED A;  3DRA A;  1D8D A;  3PZ2 A;  3C72 A;  4YDE A;  3PZ4 A;  1S63 A;  3DSX A;  1SA5 A;  1JCS A;  4GTO A;  1TNZ A;  1JCQ A;  3DSV A;  3E37 A;  3KSQ A;  1O1R A;  3EUV A;  2F0Y A;  1N95 A;  4GTQ A;  3HXD A;  3E32 A;  3Q7A A;  1SA4 A;  1NL4 A;  4GTT A;  2H6I A;  3PZ3 A;  1TNY A;  1X81 A;  1O1S A;  3SFX A;  3E30 A;  3KSL A;  1KZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...