3Q78A

Cryptococcus neoformans protein farnesyltransferase in complex with fspp and ddptasacniq peptide
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
330
structure length
312
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTFPMPSLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase
molecule keywords Farnesyltransferase alpha subunit
total genus 124
structure length 312
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q78A00
3Q79A 3SFXA 2F0YA 3DRAA 1N4SA 1NL4A 1O1SA 1FT1A 1FPPA 4GTPA 3E32A 4GTRA 1N4RA 4GTOA 1TNOA 4LNGA 1NI1A 1LD7A 3EU5A 3DPYA 2IEJA 1N9AA 2H6HA 1JCSA 1TN8A 3HXBA 3C72A 3PZ3A 3DSXA 3DSSA 3HXDA 1DCEA 4YDOA 1KZOA 1LD8A 3DSVA 1N95A 1D8EA 3Q73A 3E30A 4YDEA 1JCRA 3DSWA 1TNUA 3KSQA 2BEDA 1SA5A 1TN7A 1D8DA 2R2LA 2ZIRA 3PZ1A 3EUVA 1TN6A 1O5MA 1QBQA 3DSUA 4GTSA 4GTVA 3PZ4A 1KZPA 3HXFA 1O1RA 1TNBA 1TNZA 1LTXA 1S64A 1MZCA 3Q7AA 3Q7FA 1N4QA 1N4PA 3PZ2A 1N94A 3HXEA 3E37A 1SA4A 3Q75A 3HXCA 1TNYA 1FT2A 3E34A 4L9PA 3E33A 4LNBA 3Q78A 2ZISA 3DSTA 4GTTA 2H6IA 3SFYA 1JCQA 3KSLA 4GTMA 4GTQA 1X81A 2H6GA 4EHMA 1O1TA 2H6FA 1S63A 4MBGA
chains in the Genus database with same CATH superfamily
1PAQA 4JC8A 3LKUA 4AIFA 2WMNA 1FCHA 2EILE 5B1AE 4AV7A 4C48B 4GTPA 4APFA 4PS8A 3TWUA 4CDMA 3BU8A 5EYLA 5KWDA 1TN8A 5ARGA 3OTNA 5AQ9A 5AYWD 5D0QD 1MJ0A 1E8YA 1N54A 3FUFA 3DSVA 3UINC 4F53A 4TUMA 4K5CA 3ASFA 4GYOA 4ANVA 3E30A 5G04C 1BI7B 3DSWA 2F8YA 4C9BB 3ZW3A 3V31A 4GU5A 1TR4A 3S2AA 5J90A 4EBAA 4G23A 4K0RA 4WNFA 4HLLA 2XGOA 4GA2A 3P1UA 3SY2A 5JHAA 3ML9A 3PRZA 2L6BA 3NOCD 1SVXA 2WPVA 3RO2A 2GRRB 4BT9A 3AU5A 3PH0C 3VLFA 3SFYA 4NQ0A 1UN9A 2X6HA 3GZSA 4GZ6A 2VSYA 3P2BA 1NZNA 2H6FA 2DIWA 1H0AA 2CFZA 1ZB1A 5CMYA 3ABME 3G2SA 4HI8A 2RKKA 2ZGGA 4JD2G 4OYSA 4G11A 4CCAA 4BTBA 2YNQA 4E6HA 1HU3A 4V3IA 5D0OD 3CHRA 4BX8A 3S7JA 3ASOE 3RRMB 4ANUA 2AVPA 3QWVA 2XCBA 3Q9NC 2FBNA 2V4LA 1JUQA 4DI4A 5B3SE 2HE0A 2R2LA 2ZIRA 3CGHA 4RVBA 1TN6A 4LRZA 3JQ0A 5BV1A 5DIZA 4HQDA 3PZ4A 5T4YA 4GPMA 3EHMA 1AP7A 3FUKA 4UQYA 1SZ9A 3Q7AA 4LEUA 3Q7FA 2DYRE 3IKOB 5JJTA 4HFGA 5CEAA 4B93B 3RO3A 2BTDA 2J09A 3UM2A 3FUEA 4L9PA 3DBSA 2CFUA 3Q78A 1TEZA 3ZUVB 2AXZA 2DCPA 3FFLA 1OCCE 4GYWA 2XGMA 2NSZA 3UUXA 1N11A 3V2OA 1EF1C 1OWLA 4MBGA 1E7VA 4MRUA 3F6QA 4O60A 3IXEA 3Q15A 4UWLA 1OWMA 1E90A 2BKKB 3RK6A 3CHMA 4GCOA 2WQHA 3K9IA 2X38A 2NYJA 2VSNA 2PNNA 1ELRA 3MKQB 3MKQA 4CT4A 5HQ8A 2IJGX 2KCLA 4GPKA 4O6FA 3L17A 5JHBA 1ELWA 2C0LA 1UJKA 3G2TA 4YNDA 4I9CA 4A63B 3L16A 2KZTB 2KZTA 5G04J 4IRUA 4O1OA 5CEDB 3QB2A 4JVSA 3IV0A 5LCWJ 3ZFWA 3EJNA 3DSUA 5C2YA 5G05J 1DCQA 3WG7E 5AARA 4GZ5A 3QNKA 4BX9A 3JXJA 3OXLA 1Z3YA 3Q49B 3RKVA 4GMJA 4LCTA 5ENPD 1IHGA 5LCWC 3OXGA 1FT2A 2OEVA 3AU4A 3PVLA 1MYOA 3HRAA 4AY5A 4XEIG 2BUGA 4DJAA 4GTMA 5IY5E 3UTMA 2DBAA 4AEZC 1OCOE 5CCLA 2PQRA 3KAEA 2HO1A 1HXIA 3ZVVA 1YA0A 5CBOA 3QWPA 2HR2A 3L9TA 3MV2B 2R05A 1ZU2A 4AM9A 1MQSA 3HDXA 3MX3A 3E32A 2XPZA 2V4HC 2CHXA 3CR3A 1NI1A 2I9CA 3EU5A 4ILHB 3ZPJA 4B89A 5EILA 3VLDA 1MX2A 1ZBPA 2L0TB 3C3QA 3APCA 2LNIA 3MJWA 3PUJA 4PUCA 1U2VG 2VSOE 4L23A 1TNUA 1QYMA 1OY3D 3EDTB 4J8YA 4KZ0A 4AOFA 3R9MA 4G2VA 5CBNA 1NFIE 1TNBA 1JPLA 4J8FA 5EIDA 3FU3A 3PZDA 4DPRA 2WXMA 1DC2A 3FTWA 1N4QA 1N4PA 4NACA 4CEMA 3FU0A 5A7DB 1H2TC 3UT4A 5EDSA 5KCMA 3UT7A 4EBAG 1HH8A 4J0UA 4KVMA 5AN8A 4ATZD 5G55A 5CRVA 2WXKA 3SFXA 2F37A 1WY6A 3CVPA 3FUHA 4BEPA 4JXTA 4U7EB 5KJLA 4H7XA 3RJVA 4JEHA 3OAWA 4LNGA 4TXQA 5A23A 2UY1B 2UY1A 3FU6A 4U8YD 3L22A 5BPPA 2GRQB 3GZ2A 3LS8A 3UM1A 4KVOA 3DSXA 3ONKA 2OVBA 1IXVA 5ENRD 5KNGA 4MS6A 4GB9A 3IEGA 1D8EA 4N2SA 1E8ZA 3EU9A 1YCSB 4JW1A 2J08A 3HIZA 4HNAD 5EX0A 3BG1B 2WXJA 5BUZA 4BTAA 4L2YA 5D2MC 5ENTD 2P2CP 5D66A 1QBQA 2GGFA 3U9WA 1TYQG 4JPSA 4N3BA 4CT0A 2XS8A 5ANLA 2M63A 2KCKA 3PREA 1Z3XA 3LVRE 1JWGA 2UWJG 3W9GA 2QZAA 3NOGD 4HBDA 3HXCA 2WXPA 4TV3A 4KXKB 4LG6A 2ZISA 2P9IG 3BUAA 1FVFA 1X81A 3FTVA 2H6GA 4DI3A 1H6OA 3Q47B 3JQ1A 1MX6A 2LSUA 3Q79A 3UI2A 2F0YA 2F8XK 3CKCA 4UI9J 4PS3A 3PNTB 4ILGA 1O1SA 3LYAA 1FT1A 4GA1A 4HRNA 2FI7A 4U0ZA 1INZA 1N0QA 3ML8A 4K03A 3R7RA 1PC2A 4WUYA 3BQOA 3ZRHA 2RG8A 5BV0A 1OWNA 2RFMA 3CVVA 2IEJA 4GA0A 3VLEA 2HM8A 3TXMA 5EN5D 3T5VA 3NF1A 2RFAA 5CCMA 2XCCA 5FQ8A 4F1SA 3KD7A 3CKBA 3PDNA 4BETA 5J08A 3KSQA 2XRYA 2WXOA 1H19A 3ESLA 1K1BA 4IN3B 3EUVA 1OUVA 5EX3A 3D9MA 1AWCB 3L82A 2WXIA 3B7BA 5BT1A 2Y3AA 3EIQC 3ABKE 4FHKA 4A3VA 2DYSE 1HG2A 5JJ7A 1XGWA 2PQNA 5BW8C 3FP3A 4XKBA 4Y6WA 3AG2E 5FJYA 3ULQA 3ZYKA 3UPVA 4G1TA 1Z6TA 5KBAA 3S7BA 4KMOA 2R02A 5B1BE 4L2LA 2PM7A 5CHEE 2VTBB 2VTBA 4GTQA 2VGYA 1E96B 4TXRA 3D9HA 2OCCE 2B0OE 2QFCA 3TWVA 3ONLA 3BEEA 2Y69E 5JJ6A 1H6KA 4U63A 4YDYA 3ZGQA 2E0IA 1N4RA 3DXKG 3PE3A 1YMPA 3G2UA 3ZXPA 3SBTB 4F1PA 3CVNA 3QAQA 3UQ3A 1N9AA 2P9LG 1UN8A 2NXPA 3TWSA 3FH8A 1DCEA 2B6CA 3UIPC 4GYYA 3PEUB 2XHEA 4IYPA 3EHRA 2BEDA 3CK8A 2EINE 3G2WA 2XGSA 2YINA 5H7PA 4K5BA 4KBQA 3ASNE 3U64A 1OCRE 4RSYA 4FJZA 5HS0A 1RZ4A 3TWTA 3AS8A 3TJPA 3CV0A 1N94A 4LERA 1OT8A 2A4ZA 2JEKA 3PUKA 2Y0BG 4GZCA 3D9JA 3LJ3A 3U66A 3C5RA 2J49A 5ANRA 5FQ6A 5EKQD 4IULA 1NP7A 4CDNA 3BG0B 3KSLA 3FUIA 5HRYA 1NA3A 3LY7A 3UM0A 3J5PA 1H2UA 4FC8A 3ZYQA 4OVVA 5A6CA 4APOA 5ENQD 5KNHD 2LUHA 4WWPA 1P5QA 3NZUA 1N4SA 3S7FA 1V55E 1HS6A 1K8KG 2ONDA 4UWGA 1K1AA 1KT0A 3ASDA 4HI9A 5JMND 3MKRA 3UKRG 4HRLA 1ELKA 2H6HA 3TWQA 3HXBA 4GZDA 3C72A 2J9QA 3AG4E 3ULYA 3R7QA 2DZNA 2QYJA 5LFAA 1E7UA 3JUIA 2QYUA 4PDXA 3ZU7B 3X2QE 5T3RA 1N52A 5CERB 5EYPF 3ASGA 3ZXSA 4JEUA 3WXXA 4GTVA 4LUNU 1IQUA 4JZYA 4J8SA 3FEXA 3UT8A 1MZCA 3NQPA 2IQCA 3B7TA 3FHEA 2IY0C 2OEWA 4O1PA 5FWQA 3QJZA 4EZKA 2JABA 4X8QA 4CZ2D 2P9UG 4URKA 3ENEA 3TG4A 3QKYA 3D9LA 4YDWA 3CVYA 4GTTA 1JCQA 2PL2A 3JUEA 1RW2A 2WQ7A 4N3CA 3ZIMA 3FEYA 1Q2ZA 4ANWA 3D9PA 2MYOA 3EIJA 4M3OA 2QY7A 4CGVA 2J4BA 3RIBA 2RD0A 4CRWA 3ZHEA 3ZHEB 3NBNB 4BWRA 4NRHB 2PZIA 2EQXA 4ME2A 4A1SA 2YQ8A 3T8MA 4WNGA 3FWVA 4UI9K 3ZEFA 2CHWA 4FULA 3SD5A 3QK0A 3V30A 3LY8A 1LF8A 3O48A 3CVLA 2I1KA 3SQVA 5AIJA 5LP0A 2VGXA 2VGXB 3ULEG 4TXPA 2L6JA 4U07A 2C0MA 3DPDA 4J7WA 3NAWA 5E76A 3HXFA 1O1RA 3ZYLA 2R17C 1UJJA 3SBSA 4YVQC 1UG3A 4JB8P 2P9KG 2AXVA 2LSVA 3MV3B 4XZ4A 1TNYA 3I4GA 2WMOA 2NC9A 4OAUC 2A5UA 4EZLA 1PY1A 1L5JA 2H6IA 4UUCA 2DZOA 2XEHA 4AXHA 3SF4A 5CMWA 3CHPA 4ABNA 2KM4A 2I6HA 3UIOC 4U0SA 4L7TA 1S0PA 1JWFA 4TUUA 4XI9A 5FZSA 5E75A 3AAAC 3LDZA 3AG3E 1IHBA 1OCZE 1SQMA 4GTRA 4WAFA 2R59A 1EPUA 4GTOA 2XENA 3AG1E 1WDYA 3FTZA 5CECB 4JHKA 2GRPB 3HG0D 4DLOA 3T5XA 2J8SD 4Z68A 2OOEA 3HXDA 4RQIA 3ZN3A 4BESA 3SHFA 3CQCB 4UQXA 5LOZA 3N71A 4JL0A 1H2VC 3LCAA 5AAOA 4XI0A 2WXFA 2EIJE 2WXNA 1SW6A 2ETAA 1H6PA 4Q94A 4N39A 3FUJA 2DWZA 2OVFA 1Y6IA 2XZDG 4QQIA 4HOUA 2ILRA 3L08A 4HORA 4ANXA 5FINA 1K3ZD 4I6JA 4NIKA 3TG5A 2FF4A 2R03A 4RG6A 3QARA 2AWIA 3LJNA 3E33A 4RLYA 2WXQA 4MLPA 3MYVA 3QC1A 4U8HA 3FDHA 4ZFHA 3IBEA 3FTSA 4BFRA 4HB5A 2V8SE 5FIOA 3IHYA 5FT9A 1Y8MA 4DX2A 2WXLA 4FJYA 2E2EA 4HOQA 1EDUA 2X6IA 4ZHBA 1SZAA 3B7SA 3AJIA 3JCKC 1N0RA 2CG3A 3FTUA 3KS2A 4B8CB 2PM6A 3L6AA 3CVWA 1LD7A 2LAIA 2WXGA 3GZ1A 5ENSD 4DX7D 2MOWA 5FQ7A 5AQAA 4W9RA 5ARFA 4I6EA 3C3RA 4DX5D 1Z5SC 4FA6A 3DSSA 4YDOA 3LPZA 3FUNA 1LD8A 3FH7A 4JHJA 4FU3A 4M7CA 5FZQA 1OWOA 5BXUA 4R7LA 1HFAA 1W3BA 3FTXA 3SGHA 3URZA 4GZ3A 2BF0X 3PZ1A 1FVHA 4JHRA 4GAAA 4I6GA 1VDYA 1O5MA 4FHJA 4DK5A 3CSTA 1BLXB 1TNZA 4HRMB 3SO8A 3LEWA 2ETBA 4JA9A 4Q69A 3HXEA 5AQ7A 3CHQA 3B13A 1U3DA 3W9FA 4B0ZA 4OVUA 4H7YA 2XPIA 4J8DA 4DLQA 5ENOD 1KLXA 4DX1A 4BT8A 4LSZE 2XEVA 1S63A 3PEVB 3DRAA 4I2WA 3AS4A 2GRNB 4WNEA 1IQRA 3FY4A 5ITZF 2ETCA 4LNUD 2AXUA 4A1GA 3B7RL 4A3TA 5AQBA 4B8AA 3RU0A 3MA5A 1UOHA 3HVEA 3HVEB 4E85A 2EIME 3KEZA 3APDA 4WWNA 3UM3A 4TRQA 2IOSA 3HHMA 5LX8A 1BI8B 2FO7A 5CRUA 1JCRA 4PH4B 3VTXA 1D9SA 4FADA 3S7DA 3EHNA 3NZSA 2DVWA 2P9PG 5HKPA 4DRXE 5FQ4A 1KZPA 2AW6A 3B7UX 1QZ2A 3FU5A 2J4DA 2VGEA 1G3NB 2JLBA 4EECA 3PZ2A 4G26A 3DWLG 4U95D 4C0MA 4DUIA 2KBXA 2L9BA 4EQFA 3LVQE 4AY6A 5AJLA 1WAO1 3FTYA 1EYHA 4LNBA 4N3AA 1NA0A 3CK9A 4U0UA 4OAVB 2VYIA 3D9NA 2FO1E 5DBKA 4J8EA 3I4RB 4HVBA 3TWXA 4UQZA 4CGWA 4A55A 3RRNB 3CVUA 2L0IA 3L54A 4U04A 4B94A 3T8KA 1QQEA 2C2LA 5BXOA 2XRZA 5KJNA 3D9IA 1IYGA 1KPSB 1JCSA 2WXHA 2MHKA 2VQ2A 1DVPA 4HOTA 1XNFA 1N95A 4NURA 1HE8A 3PNLB 2LXLA 3Q73A 4CYMD 2WXRA 5FTPA 4YDEA 3CLJA 4UWFA 3CHOA 1D8DA 3ABLE 2EIKE 5AENA 4MKTA 3MGBA 3DEPA 1TJFA 2XEEA 1MHQA 4GMLA 2WM9A 3CVQA 4I9EA 2I2OA 1U3CA 2GW1A 1E8WA 4KT6B 2Q7FA 3Q4AB 5FZRA 4DX6D 4EZJA 4BERA 4F6RD 3CEQA 3CQGB 5EIBE 2V0PA 4D10C 3U4TA 2AJAA 4ACLA 5AJDA 4EHMA 3LXUX 4G8KA 2KATA 2XQ0A 3B95A 3UKUG 4FLHA 1E8XA 3JYSA 3GW4A 4GCNA 3ZYMA 3DEOA 4ATGA 3I5PA 5T8IA 2X6FA 1DNPA 2WVIA 2GROB 4WNDA 1UW4B 4UWHA 2IFUA 3PE4A 4GMRA 1TNOA 1BU9A 4G8LA 3UMVA 3NB2A 3DPYA 2BKGA 2V5FA 2IONA 3PZ3A 2IU1A 3PS6A 3C98A 3HYMB 3CVXA 3APFA 4I17A 3FULA 3QOUA 2A5EA 2P9NG 3MEKA 1TN7A 4J6IA 3J5QB 3ZKJA 4FLBA 1WM5A 2V5QC 4GTSA 1GW6A 1IKND 2YHEA 2IOLA 3RSEG 3E37A 4CDRA 4I2ZA 4WWOA 5C1DA 2FULA 4N5QA 3UX4A 4HXIA 5ENNA 1A5EA 1V54E 3FUDA 3Q5MA 3ZNGA 4C0EA 4U96D 4XE0A 4BSZB 3T9KA 2LO6A 4AP2A 2LXMA 5KJMA 3V2XA 3I3NA 1KT1A 1NL4A 3MCXA 3CIAA 1FPPA 3D3MA 4N2QA 1B89A 3QWWA 4YVOA 3DXMG 2MRIA 4ILIA 5KJKA 3ASHA 2FEZA 4F7AA 4ACKA 3U3WA 2OV8A 2XS1A 2ZXWE 3MZLB 3TWRA 4N5CA 2CG2A 3KEAA 2P9SG 4AVXA 1MX4A 2WB2A 3RAUA 2Y1LE 1KZOA 1YYHA 1WG0A 4KYOB 1BPOA 4FP7A 4Q96A 2ZGDA 3FH5A 3TWWA 1SA5A 3VTYA 1OWPA 2Y4TA 3ISMC 3ESKA 3CK7A 4F3VA 3FUMA 3QDNA 4AJWA 4I1OB 4K5AB 5BNWA 1BD8A 3SFZA 2ZU6B 4BSXA 4I43A 2Y4UA 2KCVA 2R5SA 1QNFA 3G2VA 1SA4A 4UI9C 3RRUA 4I1AA 2X6JA 4BY6A 3DSTA 3AS5A 2LAHA 1HF8A 4I1MA 1O1TA 4XIFA 4EPZA 4JA7A 2X3MA 2QC9A 2KXPC 2GRLA 2XPYA 2GRMA 3O4ZA 4PS7A 5JA4D 4L1BA 2YHCA 2J07A 1HO8A 4Y6CA 4HOSA 3TGOA 4G24A 3EHQA 5G05C 3V79K 1TJCA 3OXFA 4HS2A 1HZ4A 2KC7A 3CSFA 3TL5A 3GYZA 3SNXA 3L13A 1HX8A 3SI5A 2I1JA 2IF4A 5G2NA 3R9AB 2HYZA 3D9OA 4KZCA 4P29A 4G25A 2VJ8A 4HLEA 5HI7A 1OXJA 3UXGA 4RG9A 3D9KA 2XZTG 2CHZA 4XX5A 1LTXA 1S64A 3Q9UC 2X6KA 3LY9A 2WQ6A 2VSXE 3CHSA 1HG5A 4UWKA 3E4BA 2P58C 2IO2C 3Q75A 3TXNA 2IO3C 3E34A 3SZ7A 5M72A 1S70B 4U8VD 3C3OA 3JXIA 4XKCA 4QFVA 1A17A 3TAXA 1X5BA 3IHVA
chains in the Genus database with same CATH topology
3Q79A 3SFXA 2F0YA 3DRAA 1N4SA 1NL4A 1O1SA 1FT1A 1FPPA 4GTPA 3E32A 4GTRA 1N4RA 4GTOA 1TNOA 4LNGA 1NI1A 1LD7A 3EU5A 3DPYA 2IEJA 1N9AA 2H6HA 1JCSA 1TN8A 3HXBA 3C72A 3PZ3A 3DSXA 3DSSA 3HXDA 1DCEA 4YDOA 1KZOA 1LD8A 3DSVA 1N95A 1D8EA 3Q73A 3E30A 4YDEA 1JCRA 3DSWA 1TNUA 3KSQA 2BEDA 1SA5A 1TN7A 1D8DA 2R2LA 2ZIRA 3PZ1A 3EUVA 1TN6A 1O5MA 1QBQA 3DSUA 4GTSA 4GTVA 3PZ4A 1KZPA 3HXFA 1O1RA 1TNBA 1TNZA 1LTXA 1S64A 1MZCA 3Q7AA 3Q7FA 1N4QA 1N4PA 3PZ2A 1N94A 3HXEA 3E37A 1SA4A 3Q75A 3HXCA 1TNYA 1FT2A 3E34A 4L9PA 3E33A 4LNBA 3Q78A 2ZISA 3DSTA 4GTTA 2H6IA 3SFYA 1JCQA 3KSLA 4GTMA 4GTQA 1X81A 2H6GA 4EHMA 1O1TA 2H6FA 1S63A 4MBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q79 A;  3SFX A;  2F0Y A;  3DRA A;  1N4S A;  1NL4 A;  1O1S A;  1FT1 A;  1FPP A;  4GTP A;  3E32 A;  4GTR A;  1N4R A;  4GTO A;  1TNO A;  4LNG A;  1NI1 A;  1LD7 A;  3EU5 A;  3DPY A;  2IEJ A;  1N9A A;  2H6H A;  1JCS A;  1TN8 A;  3HXB A;  3C72 A;  3PZ3 A;  3DSX A;  3DSS A;  3HXD A;  1DCE A;  4YDO A;  1KZO A;  1LD8 A;  3DSV A;  1N95 A;  1D8E A;  3Q73 A;  3E30 A;  4YDE A;  1JCR A;  3DSW A;  1TNU A;  3KSQ A;  2BED A;  1SA5 A;  1TN7 A;  1D8D A;  2R2L A;  2ZIR A;  3PZ1 A;  3EUV A;  1TN6 A;  1O5M A;  1QBQ A;  3DSU A;  4GTS A;  4GTV A;  3PZ4 A;  1KZP A;  3HXF A;  1O1R A;  1TNB A;  1TNZ A;  1LTX A;  1S64 A;  1MZC A;  3Q7A A;  3Q7F A;  1N4Q A;  1N4P A;  3PZ2 A;  1N94 A;  3HXE A;  3E37 A;  1SA4 A;  3Q75 A;  3HXC A;  1TNY A;  1FT2 A;  3E34 A;  4L9P A;  3E33 A;  4LNB A;  3Q78 A;  2ZIS A;  3DST A;  4GTT A;  2H6I A;  3SFY A;  1JCQ A;  3KSL A;  4GTM A;  4GTQ A;  1X81 A;  2H6G A;  4EHM A;  1O1T A;  2H6F A;  1S63 A;  4MBG A; 
#chains in the Genus database with same CATH topology
 1PAQ A;  4JC8 A;  3LKU A;  4AIF A;  2WMN A;  1FCH A;  2EIL E;  5B1A E;  4AV7 A;  4C48 B;  4GTP A;  4APF A;  4PS8 A;  3TWU A;  4CDM A;  3BU8 A;  5EYL A;  5KWD A;  1TN8 A;  5ARG A;  3OTN A;  5AQ9 A;  5AYW D;  5D0Q D;  1MJ0 A;  1E8Y A;  1N54 A;  3FUF A;  3DSV A;  3UIN C;  4F53 A;  4TUM A;  4K5C A;  3ASF A;  4GYO A;  4ANV A;  3E30 A;  5G04 C;  1BI7 B;  3DSW A;  2F8Y A;  4C9B B;  3ZW3 A;  3V31 A;  4GU5 A;  1TR4 A;  3S2A A;  5J90 A;  4EBA A;  4G23 A;  4K0R A;  4WNF A;  4HLL A;  2XGO A;  4GA2 A;  3P1U A;  3SY2 A;  5JHA A;  3ML9 A;  3PRZ A;  2L6B A;  3NOC D;  1SVX A;  2WPV A;  3RO2 A;  2GRR B;  4BT9 A;  3AU5 A;  3PH0 C;  3VLF A;  3SFY A;  4NQ0 A;  1UN9 A;  2X6H A;  3GZS A;  4GZ6 A;  2VSY A;  3P2B A;  1NZN A;  2H6F A;  2DIW A;  1H0A A;  2CFZ A;  1ZB1 A;  5CMY A;  3ABM E;  3G2S A;  4HI8 A;  2RKK A;  2ZGG A;  4JD2 G;  4OYS A;  4G11 A;  4CCA A;  4BTB A;  2YNQ A;  4E6H A;  1HU3 A;  4V3I A;  5D0O D;  3CHR A;  4BX8 A;  3S7J A;  3ASO E;  3RRM B;  4ANU A;  2AVP A;  3QWV A;  2XCB A;  3Q9N C;  2FBN A;  2V4L A;  1JUQ A;  4DI4 A;  5B3S E;  2HE0 A;  2R2L A;  2ZIR A;  3CGH A;  4RVB A;  1TN6 A;  4LRZ A;  3JQ0 A;  5BV1 A;  5DIZ A;  4HQD A;  3PZ4 A;  5T4Y A;  4GPM A;  3EHM A;  1AP7 A;  3FUK A;  4UQY A;  1SZ9 A;  3Q7A A;  4LEU A;  3Q7F A;  2DYR E;  3IKO B;  5JJT A;  4HFG A;  5CEA A;  4B93 B;  3RO3 A;  2BTD A;  2J09 A;  3UM2 A;  3FUE A;  4L9P A;  3DBS A;  2CFU A;  3Q78 A;  1TEZ A;  3ZUV B;  2AXZ A;  2DCP A;  3FFL A;  1OCC E;  4GYW A;  2XGM A;  2NSZ A;  3UUX A;  1N11 A;  3V2O A;  1EF1 C;  1OWL A;  4MBG A;  1E7V A;  4MRU A;  3F6Q A;  4O60 A;  3IXE A;  3Q15 A;  4UWL A;  1OWM A;  1E90 A;  2BKK B;  3RK6 A;  3CHM A;  4GCO A;  2WQH A;  3K9I A;  2X38 A;  2NYJ A;  2VSN A;  2PNN A;  1ELR A;  3MKQ B;  3MKQ A;  4CT4 A;  5HQ8 A;  2IJG X;  2KCL A;  4GPK A;  4O6F A;  3L17 A;  5JHB A;  1ELW A;  2C0L A;  1UJK A;  3G2T A;  4YND A;  4I9C A;  4A63 B;  3L16 A;  2KZT B;  2KZT A;  5G04 J;  4IRU A;  4O1O A;  5CED B;  3QB2 A;  4JVS A;  3IV0 A;  5LCW J;  3ZFW A;  3EJN A;  3DSU A;  5C2Y A;  5G05 J;  1DCQ A;  3WG7 E;  5AAR A;  4GZ5 A;  3QNK A;  4BX9 A;  3JXJ A;  3OXL A;  1Z3Y A;  3Q49 B;  3RKV A;  4GMJ A;  4LCT A;  5ENP D;  1IHG A;  5LCW C;  3OXG A;  1FT2 A;  2OEV A;  3AU4 A;  3PVL A;  1MYO A;  3HRA A;  4AY5 A;  4XEI G;  2BUG A;  4DJA A;  4GTM A;  5IY5 E;  3UTM A;  2DBA A;  4AEZ C;  1OCO E;  5CCL A;  2PQR A;  3KAE A;  2HO1 A;  1HXI A;  3ZVV A;  1YA0 A;  5CBO A;  3QWP A;  2HR2 A;  3L9T A;  3MV2 B;  2R05 A;  1ZU2 A;  4AM9 A;  1MQS A;  3HDX A;  3MX3 A;  3E32 A;  2XPZ A;  2V4H C;  2CHX A;  3CR3 A;  1NI1 A;  2I9C A;  3EU5 A;  4ILH B;  3ZPJ A;  4B89 A;  5EIL A;  3VLD A;  1MX2 A;  1ZBP A;  2L0T B;  3C3Q A;  3APC A;  2LNI A;  3MJW A;  3PUJ A;  4PUC A;  1U2V G;  2VSO E;  4L23 A;  1TNU A;  1QYM A;  1OY3 D;  3EDT B;  4J8Y A;  4KZ0 A;  4AOF A;  3R9M A;  4G2V A;  5CBN A;  1NFI E;  1TNB A;  1JPL A;  4J8F A;  5EID A;  3FU3 A;  3PZD A;  4DPR A;  2WXM A;  1DC2 A;  3FTW A;  1N4Q A;  1N4P A;  4NAC A;  4CEM A;  3FU0 A;  5A7D B;  1H2T C;  3UT4 A;  5EDS A;  5KCM A;  3UT7 A;  4EBA G;  1HH8 A;  4J0U A;  4KVM A;  5AN8 A;  4ATZ D;  5G55 A;  5CRV A;  2WXK A;  3SFX A;  2F37 A;  1WY6 A;  3CVP A;  3FUH A;  4BEP A;  4JXT A;  4U7E B;  5KJL A;  4H7X A;  3RJV A;  4JEH A;  3OAW A;  4LNG A;  4TXQ A;  5A23 A;  2UY1 B;  2UY1 A;  3FU6 A;  4U8Y D;  3L22 A;  5BPP A;  2GRQ B;  3GZ2 A;  3LS8 A;  3UM1 A;  4KVO A;  3DSX A;  3ONK A;  2OVB A;  1IXV A;  5ENR D;  5KNG A;  4MS6 A;  4GB9 A;  3IEG A;  1D8E A;  4N2S A;  1E8Z A;  3EU9 A;  1YCS B;  4JW1 A;  2J08 A;  3HIZ A;  4HNA D;  5EX0 A;  3BG1 B;  2WXJ A;  5BUZ A;  4BTA A;  4L2Y A;  5D2M C;  5ENT D;  2P2C P;  5D66 A;  1QBQ A;  2GGF A;  3U9W A;  1TYQ G;  4JPS A;  4N3B A;  4CT0 A;  2XS8 A;  5ANL A;  2M63 A;  2KCK A;  3PRE A;  1Z3X A;  3LVR E;  1JWG A;  2UWJ G;  3W9G A;  2QZA A;  3NOG D;  4HBD A;  3HXC A;  2WXP A;  4TV3 A;  4KXK B;  4LG6 A;  2ZIS A;  2P9I G;  3BUA A;  1FVF A;  1X81 A;  3FTV A;  2H6G A;  4DI3 A;  1H6O A;  3Q47 B;  3JQ1 A;  1MX6 A;  2LSU A;  3Q79 A;  3UI2 A;  2F0Y A;  2F8X K;  3CKC A;  4UI9 J;  4PS3 A;  3PNT B;  4ILG A;  1O1S A;  3LYA A;  1FT1 A;  4GA1 A;  4HRN A;  2FI7 A;  4U0Z A;  1INZ A;  1N0Q A;  3ML8 A;  4K03 A;  3R7R A;  1PC2 A;  4WUY A;  3BQO A;  3ZRH A;  2RG8 A;  5BV0 A;  1OWN A;  2RFM A;  3CVV A;  2IEJ A;  4GA0 A;  3VLE A;  2HM8 A;  3TXM A;  5EN5 D;  3T5V A;  3NF1 A;  2RFA A;  5CCM A;  2XCC A;  5FQ8 A;  4F1S A;  3KD7 A;  3CKB A;  3PDN A;  4BET A;  5J08 A;  3KSQ A;  2XRY A;  2WXO A;  1H19 A;  3ESL A;  1K1B A;  4IN3 B;  3EUV A;  1OUV A;  5EX3 A;  3D9M A;  1AWC B;  3L82 A;  2WXI A;  3B7B A;  5BT1 A;  2Y3A A;  3EIQ C;  3ABK E;  4FHK A;  4A3V A;  2DYS E;  1HG2 A;  5JJ7 A;  1XGW A;  2PQN A;  5BW8 C;  3FP3 A;  4XKB A;  4Y6W A;  3AG2 E;  5FJY A;  3ULQ A;  3ZYK A;  3UPV A;  4G1T A;  1Z6T A;  5KBA A;  3S7B A;  4KMO A;  2R02 A;  5B1B E;  4L2L A;  2PM7 A;  5CHE E;  2VTB B;  2VTB A;  4GTQ A;  2VGY A;  1E96 B;  4TXR A;  3D9H A;  2OCC E;  2B0O E;  2QFC A;  3TWV A;  3ONL A;  3BEE A;  2Y69 E;  5JJ6 A;  1H6K A;  4U63 A;  4YDY A;  3ZGQ A;  2E0I A;  1N4R A;  3DXK G;  3PE3 A;  1YMP A;  3G2U A;  3ZXP A;  3SBT B;  4F1P A;  3CVN A;  3QAQ A;  3UQ3 A;  1N9A A;  2P9L G;  1UN8 A;  2NXP A;  3TWS A;  3FH8 A;  1DCE A;  2B6C A;  3UIP C;  4GYY A;  3PEU B;  2XHE A;  4IYP A;  3EHR A;  2BED A;  3CK8 A;  2EIN E;  3G2W A;  2XGS A;  2YIN A;  5H7P A;  4K5B A;  4KBQ A;  3ASN E;  3U64 A;  1OCR E;  4RSY A;  4FJZ A;  5HS0 A;  1RZ4 A;  3TWT A;  3AS8 A;  3TJP A;  3CV0 A;  1N94 A;  4LER A;  1OT8 A;  2A4Z A;  2JEK A;  3PUK A;  2Y0B G;  4GZC A;  3D9J A;  3LJ3 A;  3U66 A;  3C5R A;  2J49 A;  5ANR A;  5FQ6 A;  5EKQ D;  4IUL A;  1NP7 A;  4CDN A;  3BG0 B;  3KSL A;  3FUI A;  5HRY A;  1NA3 A;  3LY7 A;  3UM0 A;  3J5P A;  1H2U A;  4FC8 A;  3ZYQ A;  4OVV A;  5A6C A;  4APO A;  5ENQ D;  5KNH D;  2LUH A;  4WWP A;  1P5Q A;  3NZU A;  1N4S A;  3S7F A;  1V55 E;  1HS6 A;  1K8K G;  2OND A;  4UWG A;  1K1A A;  1KT0 A;  3ASD A;  4HI9 A;  5JMN D;  3MKR A;  3UKR G;  4HRL A;  1ELK A;  2H6H A;  3TWQ A;  3HXB A;  4GZD A;  3C72 A;  2J9Q A;  3AG4 E;  3ULY A;  3R7Q A;  2DZN A;  2QYJ A;  5LFA A;  1E7U A;  3JUI A;  2QYU A;  4PDX A;  3ZU7 B;  3X2Q E;  5T3R A;  1N52 A;  5CER B;  5EYP F;  3ASG A;  3ZXS A;  4JEU A;  3WXX A;  4GTV A;  4LUN U;  1IQU A;  4JZY A;  4J8S A;  3FEX A;  3UT8 A;  1MZC A;  3NQP A;  2IQC A;  3B7T A;  3FHE A;  2IY0 C;  2OEW A;  4O1P A;  5FWQ A;  3QJZ A;  4EZK A;  2JAB A;  4X8Q A;  4CZ2 D;  2P9U G;  4URK A;  3ENE A;  3TG4 A;  3QKY A;  3D9L A;  4YDW A;  3CVY A;  4GTT A;  1JCQ A;  2PL2 A;  3JUE A;  1RW2 A;  2WQ7 A;  4N3C A;  3ZIM A;  3FEY A;  1Q2Z A;  4ANW A;  3D9P A;  2MYO A;  3EIJ A;  4M3O A;  2QY7 A;  4CGV A;  2J4B A;  3RIB A;  2RD0 A;  4CRW A;  3ZHE A;  3ZHE B;  3NBN B;  4BWR A;  4NRH B;  2PZI A;  2EQX A;  4ME2 A;  4A1S A;  2YQ8 A;  3T8M A;  4WNG A;  3FWV A;  4UI9 K;  3ZEF A;  2CHW A;  4FUL A;  3SD5 A;  3QK0 A;  3V30 A;  3LY8 A;  1LF8 A;  3O48 A;  3CVL A;  2I1K A;  3SQV A;  5AIJ A;  5LP0 A;  2VGX A;  2VGX B;  3ULE G;  4TXP A;  2L6J A;  4U07 A;  2C0M A;  3DPD A;  4J7W A;  3NAW A;  5E76 A;  3HXF A;  1O1R A;  3ZYL A;  2R17 C;  1UJJ A;  3SBS A;  4YVQ C;  1UG3 A;  4JB8 P;  2P9K G;  2AXV A;  2LSV A;  3MV3 B;  4XZ4 A;  1TNY A;  3I4G A;  2WMO A;  2NC9 A;  4OAU C;  2A5U A;  4EZL A;  1PY1 A;  1L5J A;  2H6I A;  4UUC A;  2DZO A;  2XEH A;  4AXH A;  3SF4 A;  5CMW A;  3CHP A;  4ABN A;  2KM4 A;  2I6H A;  3UIO C;  4U0S A;  4L7T A;  1S0P A;  1JWF A;  4TUU A;  4XI9 A;  5FZS A;  5E75 A;  3AAA C;  3LDZ A;  3AG3 E;  1IHB A;  1OCZ E;  1SQM A;  4GTR A;  4WAF A;  2R59 A;  1EPU A;  4GTO A;  2XEN A;  3AG1 E;  1WDY A;  3FTZ A;  5CEC B;  4JHK A;  2GRP B;  3HG0 D;  4DLO A;  3T5X A;  2J8S D;  4Z68 A;  2OOE A;  3HXD A;  4RQI A;  3ZN3 A;  4BES A;  3SHF A;  3CQC B;  4UQX A;  5LOZ A;  3N71 A;  4JL0 A;  1H2V C;  3LCA A;  5AAO A;  4XI0 A;  2WXF A;  2EIJ E;  2WXN A;  1SW6 A;  2ETA A;  1H6P A;  4Q94 A;  4N39 A;  3FUJ A;  2DWZ A;  2OVF A;  1Y6I A;  2XZD G;  4QQI A;  4HOU A;  2ILR A;  3L08 A;  4HOR A;  4ANX A;  5FIN A;  1K3Z D;  4I6J A;  4NIK A;  3TG5 A;  2FF4 A;  2R03 A;  4RG6 A;  3QAR A;  2AWI A;  3LJN A;  3E33 A;  4RLY A;  2WXQ A;  4MLP A;  3MYV A;  3QC1 A;  4U8H A;  3FDH A;  4ZFH A;  3IBE A;  3FTS A;  4BFR A;  4HB5 A;  2V8S E;  5FIO A;  3IHY A;  5FT9 A;  1Y8M A;  4DX2 A;  2WXL A;  4FJY A;  2E2E A;  4HOQ A;  1EDU A;  2X6I A;  4ZHB A;  1SZA A;  3B7S A;  3AJI A;  3JCK C;  1N0R A;  2CG3 A;  3FTU A;  3KS2 A;  4B8C B;  2PM6 A;  3L6A A;  3CVW A;  1LD7 A;  2LAI A;  2WXG A;  3GZ1 A;  5ENS D;  4DX7 D;  2MOW A;  5FQ7 A;  5AQA A;  4W9R A;  5ARF A;  4I6E A;  3C3R A;  4DX5 D;  1Z5S C;  4FA6 A;  3DSS A;  4YDO A;  3LPZ A;  3FUN A;  1LD8 A;  3FH7 A;  4JHJ A;  4FU3 A;  4M7C A;  5FZQ A;  1OWO A;  5BXU A;  4R7L A;  1HFA A;  1W3B A;  3FTX A;  3SGH A;  3URZ A;  4GZ3 A;  2BF0 X;  3PZ1 A;  1FVH A;  4JHR A;  4GAA A;  4I6G A;  1VDY A;  1O5M A;  4FHJ A;  4DK5 A;  3CST A;  1BLX B;  1TNZ A;  4HRM B;  3SO8 A;  3LEW A;  2ETB A;  4JA9 A;  4Q69 A;  3HXE A;  5AQ7 A;  3CHQ A;  3B13 A;  1U3D A;  3W9F A;  4B0Z A;  4OVU A;  4H7Y A;  2XPI A;  4J8D A;  4DLQ A;  5ENO D;  1KLX A;  4DX1 A;  4BT8 A;  4LSZ E;  2XEV A;  1S63 A;  3PEV B;  3DRA A;  4I2W A;  3AS4 A;  2GRN B;  4WNE A;  1IQR A;  3FY4 A;  5ITZ F;  2ETC A;  4LNU D;  2AXU A;  4A1G A;  3B7R L;  4A3T A;  5AQB A;  4B8A A;  3RU0 A;  3MA5 A;  1UOH A;  3HVE A;  3HVE B;  4E85 A;  2EIM E;  3KEZ A;  3APD A;  4WWN A;  3UM3 A;  4TRQ A;  2IOS A;  3HHM A;  5LX8 A;  1BI8 B;  2FO7 A;  5CRU A;  1JCR A;  4PH4 B;  3VTX A;  1D9S A;  4FAD A;  3S7D A;  3EHN A;  3NZS A;  2DVW A;  2P9P G;  5HKP A;  4DRX E;  5FQ4 A;  1KZP A;  2AW6 A;  3B7U X;  1QZ2 A;  3FU5 A;  2J4D A;  2VGE A;  1G3N B;  2JLB A;  4EEC A;  3PZ2 A;  4G26 A;  3DWL G;  4U95 D;  4C0M A;  4DUI A;  2KBX A;  2L9B A;  4EQF A;  3LVQ E;  4AY6 A;  5AJL A;  1WAO 1;  3FTY A;  1EYH A;  4LNB A;  4N3A A;  1NA0 A;  3CK9 A;  4U0U A;  4OAV B;  2VYI A;  3D9N A;  2FO1 E;  5DBK A;  4J8E A;  3I4R B;  4HVB A;  3TWX A;  4UQZ A;  4CGW A;  4A55 A;  3RRN B;  3CVU A;  2L0I A;  3L54 A;  4U04 A;  4B94 A;  3T8K A;  1QQE A;  2C2L A;  5BXO A;  2XRZ A;  5KJN A;  3D9I A;  1IYG A;  1KPS B;  1JCS A;  2WXH A;  2MHK A;  2VQ2 A;  1DVP A;  4HOT A;  1XNF A;  1N95 A;  4NUR A;  1HE8 A;  3PNL B;  2LXL A;  3Q73 A;  4CYM D;  2WXR A;  5FTP A;  4YDE A;  3CLJ A;  4UWF A;  3CHO A;  1D8D A;  3ABL E;  2EIK E;  5AEN A;  4MKT A;  3MGB A;  3DEP A;  1TJF A;  2XEE A;  1MHQ A;  4GML A;  2WM9 A;  3CVQ A;  4I9E A;  2I2O A;  1U3C A;  2GW1 A;  1E8W A;  4KT6 B;  2Q7F A;  3Q4A B;  5FZR A;  4DX6 D;  4EZJ A;  4BER A;  4F6R D;  3CEQ A;  3CQG B;  5EIB E;  2V0P A;  4D10 C;  3U4T A;  2AJA A;  4ACL A;  5AJD A;  4EHM A;  3LXU X;  4G8K A;  2KAT A;  2XQ0 A;  3B95 A;  3UKU G;  4FLH A;  1E8X A;  3JYS A;  3GW4 A;  4GCN A;  3ZYM A;  3DEO A;  4ATG A;  3I5P A;  5T8I A;  2X6F A;  1DNP A;  2WVI A;  2GRO B;  4WND A;  1UW4 B;  4UWH A;  2IFU A;  3PE4 A;  4GMR A;  1TNO A;  1BU9 A;  4G8L A;  3UMV A;  3NB2 A;  3DPY A;  2BKG A;  2V5F A;  2ION A;  3PZ3 A;  2IU1 A;  3PS6 A;  3C98 A;  3HYM B;  3CVX A;  3APF A;  4I17 A;  3FUL A;  3QOU A;  2A5E A;  2P9N G;  3MEK A;  1TN7 A;  4J6I A;  3J5Q B;  3ZKJ A;  4FLB A;  1WM5 A;  2V5Q C;  4GTS A;  1GW6 A;  1IKN D;  2YHE A;  2IOL A;  3RSE G;  3E37 A;  4CDR A;  4I2Z A;  4WWO A;  5C1D A;  2FUL A;  4N5Q A;  3UX4 A;  4HXI A;  5ENN A;  1A5E A;  1V54 E;  3FUD A;  3Q5M A;  3ZNG A;  4C0E A;  4U96 D;  4XE0 A;  4BSZ B;  3T9K A;  2LO6 A;  4AP2 A;  2LXM A;  5KJM A;  3V2X A;  3I3N A;  1KT1 A;  1NL4 A;  3MCX A;  3CIA A;  1FPP A;  3D3M A;  4N2Q A;  1B89 A;  3QWW A;  4YVO A;  3DXM G;  2MRI A;  4ILI A;  5KJK A;  3ASH A;  2FEZ A;  4F7A A;  4ACK A;  3U3W A;  2OV8 A;  2XS1 A;  2ZXW E;  3MZL B;  3TWR A;  4N5C A;  2CG2 A;  3KEA A;  2P9S G;  4AVX A;  1MX4 A;  2WB2 A;  3RAU A;  2Y1L E;  1KZO A;  1YYH A;  1WG0 A;  4KYO B;  1BPO A;  4FP7 A;  4Q96 A;  2ZGD A;  3FH5 A;  3TWW A;  1SA5 A;  3VTY A;  1OWP A;  2Y4T A;  3ISM C;  3ESK A;  3CK7 A;  4F3V A;  3FUM A;  3QDN A;  4AJW A;  4I1O B;  4K5A B;  5BNW A;  1BD8 A;  3SFZ A;  2ZU6 B;  4BSX A;  4I43 A;  2Y4U A;  2KCV A;  2R5S A;  1QNF A;  3G2V A;  1SA4 A;  4UI9 C;  3RRU A;  4I1A A;  2X6J A;  4BY6 A;  3DST A;  3AS5 A;  2LAH A;  1HF8 A;  4I1M A;  1O1T A;  4XIF A;  4EPZ A;  4JA7 A;  2X3M A;  2QC9 A;  2KXP C;  2GRL A;  2XPY A;  2GRM A;  3O4Z A;  4PS7 A;  5JA4 D;  4L1B A;  2YHC A;  2J07 A;  1HO8 A;  4Y6C A;  4HOS A;  3TGO A;  4G24 A;  3EHQ A;  5G05 C;  3V79 K;  1TJC A;  3OXF A;  4HS2 A;  1HZ4 A;  2KC7 A;  3CSF A;  3TL5 A;  3GYZ A;  3SNX A;  3L13 A;  1HX8 A;  3SI5 A;  2I1J A;  2IF4 A;  5G2N A;  3R9A B;  2HYZ A;  3D9O A;  4KZC A;  4P29 A;  4G25 A;  2VJ8 A;  4HLE A;  5HI7 A;  1OXJ A;  3UXG A;  4RG9 A;  3D9K A;  2XZT G;  2CHZ A;  4XX5 A;  1LTX A;  1S64 A;  3Q9U C;  2X6K A;  3LY9 A;  2WQ6 A;  2VSX E;  3CHS A;  1HG5 A;  4UWK A;  3E4B A;  2P58 C;  2IO2 C;  3Q75 A;  3TXN A;  2IO3 C;  3E34 A;  3SZ7 A;  5M72 A;  1S70 B;  4U8V D;  3C3O A;  3JXI A;  4XKC A;  4QFV A;  1A17 A;  3TAX A;  1X5B A;  3IHV A; 
#chains in the Genus database with same CATH homology
 3Q79 A;  3SFX A;  2F0Y A;  3DRA A;  1N4S A;  1NL4 A;  1O1S A;  1FT1 A;  1FPP A;  4GTP A;  3E32 A;  4GTR A;  1N4R A;  4GTO A;  1TNO A;  4LNG A;  1NI1 A;  1LD7 A;  3EU5 A;  3DPY A;  2IEJ A;  1N9A A;  2H6H A;  1JCS A;  1TN8 A;  3HXB A;  3C72 A;  3PZ3 A;  3DSX A;  3DSS A;  3HXD A;  1DCE A;  4YDO A;  1KZO A;  1LD8 A;  3DSV A;  1N95 A;  1D8E A;  3Q73 A;  3E30 A;  4YDE A;  1JCR A;  3DSW A;  1TNU A;  3KSQ A;  2BED A;  1SA5 A;  1TN7 A;  1D8D A;  2R2L A;  2ZIR A;  3PZ1 A;  3EUV A;  1TN6 A;  1O5M A;  1QBQ A;  3DSU A;  4GTS A;  4GTV A;  3PZ4 A;  1KZP A;  3HXF A;  1O1R A;  1TNB A;  1TNZ A;  1LTX A;  1S64 A;  1MZC A;  3Q7A A;  3Q7F A;  1N4Q A;  1N4P A;  3PZ2 A;  1N94 A;  3HXE A;  3E37 A;  1SA4 A;  3Q75 A;  3HXC A;  1TNY A;  1FT2 A;  3E34 A;  4L9P A;  3E33 A;  4LNB A;  3Q78 A;  2ZIS A;  3DST A;  4GTT A;  2H6I A;  3SFY A;  1JCQ A;  3KSL A;  4GTM A;  4GTQ A;  1X81 A;  2H6G A;  4EHM A;  1O1T A;  2H6F A;  1S63 A;  4MBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...