3Q78A

Cryptococcus neoformans protein farnesyltransferase in complex with fspp and ddptasacniq peptide
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
330
structure length
312
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTFPMPSLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase alpha subunit
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase
total genus 124
structure length 312
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q78A00
1O1TA 1LD8A 1FT2A 4GTMA 1JCQA 1N4QA 3Q7AA 1KZPA 1N94A 1NI1A 2R2LA 2ZISA 3E33A 4GTSA 4LNGA 1LD7A 3DSVA 1QBQA 2H6GA 4GTVA 1SA5A 3HXEA 1TN7A 4GTPA 1O1RA 3HXCA 1FPPA 3E34A 4MBGA 3SFXA 1LTXA 1N4PA 1TN6A 3PZ1A 4YDOA 3DRAA 1MZCA 1N95A 1KZOA 3PZ2A 1SA4A 4GTQA 3HXBA 4LNBA 1JCSA 1X81A 2ZIRA 1N4RA 3HXFA 3PZ3A 2H6FA 3DSSA 1TN8A 3E37A 4EHMA 3E30A 1TNBA 3Q78A 1S64A 3EU5A 4GTRA 1O5MA 4GTOA 1TNZA 3DSTA 2BEDA 1NL4A 3DPYA 2IEJA 1DCEA 4GTTA 3KSQA 1O1SA 1FT1A 3DSXA 3PZ4A 4YDEA 1N9AA 1JCRA 3Q7FA 1D8EA 1S63A 2F0YA 3E32A 3KSLA 3C72A 3EUVA 2H6HA 3HXDA 1N4SA 4L9PA 3Q73A 3Q79A 3DSUA 3DSWA 3Q75A 1D8DA 2H6IA 1TNUA 1TNYA 3SFYA 1TNOA
chains in the Genus database with same CATH superfamily
3LY9A 5IY5E 1O1TA 2CHZA 2VGYA 2GRNB 4Q96A 2R03A 1WM5A 2L0TB 5FINA 2MHKA 2P9UG 4RSYA 1IQRA 1YA0A 4OVUA 3R9AB 2PNNA 2V4HC 1H2TC 3OAWA 2ILRA 4N3CA 1OCZE 3SQVA 4PS3A 4FC8A 4LSZE 1N0RA 4K5BA 3ML8A 3U64A 2C0LA 3OXFA 1KLXA 5D66A 3EJNA 4FLHA 3PDNA 2LSUA 5T3RA 3TWVA 4GCOA 3UT4A 4K5CA 2JEKA 3JYSA 3LPZA 4DX7D 2KBXA 5A7DB 3Q47B 3MJWA 4EZJA 4HORA 2CG2A 4GYOA 3TAXA 3FU0A 3T9KA 3EIJA 2R5SA 3PH0C 5ENSD 2XRZA 1TNZA 2XEVA 5ITZF 3SZ7A 3SGHA 1H2UA 4W9RA 4L1BA 3IXEA 3NAWA 3CEQA 4CYMD 3MV3B 1E7UA 2XPZA 4IRUA 5M72A 2FF4A 1OWNA 4ME2A 2R05A 3JQ0A 3FFLA 5JHBA 1HH8A 1HE8A 3SFYA 2LO6A 1NA0A 3BG1B 2NSZA 4ILIA 3RO2A 2Y4TA 1BD8A 3CK8A 5EILA 1K8KG 1Z3YA 2PM7A 3QB2A 3AG3E 4FJYA 2EIKE 1BI7B 3AG1E 5AJDA 3IV0A 3OTNA 2XZDG 3UIPC 2E0IA 3KD7A 1KPSB 4U8HA 3RAUA 3DPDA 3QAQA 4HLLA 4WUYA 3C3OA 4ANUA 3CQCB 4MBGA 3SFXA 2A5EA 3TWRA 1IKND 2GROB 3APFA 3ZNGA 4G8LA 2OV8A 4B89A 3CKCA 2YHCA 3DSSA 2AXVA 3AS4A 3HRAA 1TYQG 3Q78A 1S64A 5CMWA 4GTRA 4XZ4A 4U0SA 4HXIA 4IULA 3DSTA 3G2WA 3HG0D 5HRYA 2PQRA 2IO3C 3TWUA 4XKBA 2GRMA 3KSQA 4P29A 1FT1A 4DX6D 3B7RL 4AM9A 1FVFA 2AJAA 1TR4A 2MOWA 4XX5A 3CSTA 4R7LA 3L9TA 5CRUA 1MJ0A 4AJWA 2V5FA 2UY1B 3G2TA 3CVVA 4DUIA 5G05J 2L9BA 1YCSB 2IOLA 2DWZA 4NIKA 4N3AA 2ETAA 4APFA 3EHQA 4HOSA 3PUKA 2ZXWE 1ZB1A 1Y6IA 5ARFA 3NOCD 1S70B 1N52A 2X6HA 4URKA 3CHQA 4A63B 4A1SA 4I9EA 2WXJA 4GZ3A 4ILGA 2KZTB 3ZXSA 3V2OA 4K0RA 5LFAA 2QZAA 3PZ1A 2GW1A 1N95A 2VTBA 4V3IA 3NZUA 2ZIRA 4APOA 5BUZA 3ZYLA 1HU3A 1OXJA 2OOEA 4HI9A 3FEXA 3TWTA 3LCAA 4C0MA 2J4BA 5HS0A 3AS8A 4ATZD 2GRRB 3DEPA 2XS8A 5FZRA 3CK7A 4KYOB 3FTYA 4Z68A 1TJFA 4PS7A 5AQ7A 3FH8A 3CV0A 1G3NB 4DI4A 2XS1A 2AW6A 4YVQC 4G1TA 4CDRA 2EINE 4XI9A 4N3BA 5EIDA 1E8YA 4PDXA 5LX8A 3Q79A 4GA1A 3DSWA 1A5EA 3V2XA 1TNUA 1U3DA 4GZ5A 3PZDA 2L6JA 1W3BA 4BFRA 1KT0A 3FULA 5FZSA 5A23A 4AVXA 1N4QA 4MS6A 3F6QA 2IU1A 2BKKB 3U3WA 2L0IA 2ZU6B 5B1BE 3TWSA 3UX4A 3TXMA 4ATGA 3ZW3A 4HBDA 3AG2E 4H7XA 2QC9A 1RW2A 2J4DA 3ABME 4F3VA 1TN6A 2IQCA 5D0QD 2KXPC 3FP3A 3CK9A 1N54A 1X81A 5FJYA 4DX2A 4DX1A 3DEOA 4IN3B 3VLDA 1ELWA 5CEAA 5FIOA 3B7UX 1HX8A 1O5MA 4GA2A 3ZYQA 2WXGA 4KVOA 4UI9C 5H7PA 4ILHB 1D8EA 2F0YA 3LXUX 3NB2A 3MKQA 3CVWA 2WXQA 3Q9NC 4F1SA 5FTPA 2Q7FA 3D9JA 2YINA 5AENA 3HVEB 4HVBA 4HOQA 1FT2A 4GTMA 5G2NA 2WXRA 3IHVA 1RZ4A 4JZYA 2J07A 4U63A 3CHSA 4B94A 5G04J 5AQAA 3UINC 1U3CA 3FEYA 3CKBA 4M3OA 4F6RD 3CHRA 4C0EA 2XPIA 3L6AA 1OUVA 2WVIA 5ENRD 4KZCA 4CEMA 4FLBA 1H0AA 2CFZA 2WM9A 4KMOA 4FULA 4B93B 1IYGA 4AV7A 2I2OA 1VDYA 3ASHA 5HKPA 4U7EB 1UG3A 2P9IG 5CBOA 3FTZA 3QARA 1WDYA 2XPYA 3Q5MA 4J8SA 3ASGA 1MQSA 2OVBA 3EIQC 4I43A 1YMPA 2LXMA 1ZU2A 3K9IA 4UQYA 1OCOE 2CG3A 4JA7A 3KSLA 4I6GA 5J08A 2Y0BG 4FP7A 3JCKC 4TUUA 2B0OE 3ZEFA 1QQEA 2WQHA 3SY2A 5EDSA 2XEEA 1TNOA 4JA9A 5G55A 4TUMA 3T5XA 4O1OA 3QWPA 3FUKA 3Q7AA 4J8FA 3LY7A 3IKOB 1X5BA 3HIZA 2OEVA 4GCNA 4TXRA 4A3TA 1TN7A 3ASDA 4HI8A 2WXPA 1EYHA 3J5PA 4BTBA 3S7JA 4JPSA 1N4PA 1AWCB 3T8KA 3S2AA 4EECA 2VSYA 3L08A 4HRNA 3SHFA 2F8YA 2WPVA 3KEZA 4Q69A 3URZA 2YHEA 3PZ3A 3UTMA 3FTSA 1TN8A 3I3NA 5AYWD 2WXNA 2PQNA 4FA6A 4WNEA 3SO8A 4GAAA 2RKKA 1BPOA 3ZN3A 3ONKA 4EZLA 3IBEA 1E8ZA 5JHAA 1DCEA 4GTTA 2ETCA 4HOUA 5CCMA 2WXKA 1V55E 3ISMC 3D9IA 3RK6A 2P9KG 3X2QE 4F1PA 4G2VA 1L5JA 3GZ2A 4BX9A 1N4SA 1YYHA 4UWLA 3T5VA 3QWVA 4JVSA 3Q75A 2IJGX 4BESA 3FU6A 3LEWA 5ARGA 2AXUA 5BV1A 3QDNA 3D9HA 2C0MA 3SF4A 4JHKA 4UWFA 2HYZA 3PVLA 3CR3A 3CVXA 1KZPA 3IHYA 4GMLA 4L2LA 4MKTA 2KC7A 3ZGQA 2LAHA 1N11A 1SA5A 2WXMA 4J7WA 2X6IA 1H19A 3WG7E 1FPPA 4J8YA 3D9KA 2WXIA 4RQIA 2QYJA 2I6HA 4E85A 4I2WA 2HR2A 1UJKA 5LCWC 4I6JA 3FWVA 5LP0A 3BEEA 5BV0A 3UIOC 1SA4A 4GMRA 3FUNA 4LUNU 4YDWA 1HZ4A 3ZU7B 1PC2A 3RIBA 3CVUA 3PREA 2VGEA 4ANVA 3LS8A 3LYAA 3MKRA 1B89A 3J5QB 3ZRHA 4B8CB 2DBAA 3PE3A 4OAUC 1OWPA 3KAEA 2LAIA 5ANLA 3RU0A 4U95D 2IEJA 4UQZA 2IFUA 2ZGDA 1H6OA 3UXGA 1JCRA 3WXXA 2WB2A 3TWXA 3CVPA 3BQOA 3QK0A 1FCHA 2X38A 4WWOA 4L9PA 1NP7A 4CGWA 3DSUA 3KEAA 2V4LA 5BNWA 5ENNA 2RFAA 2H6IA 2LXLA 4G11A 2DVWA 3TXNA 4GPKA 5KCMA 2VYIA 4KXKB 3ZYMA 5BW8C 3T8MA 4BWRA 3JUIA 4B0ZA 3B95A 2BUGA 4RVBA 1HFAA 4F7AA 4BSXA 1WG0A 5DIZA 4BX8A 2WXOA 3PS6A 4J8EA 1O1RA 4M7CA 4I1AA 3ZHEB 3E34A 2BTDA 4LRZA 4CT0A 5DBKA 2XRYA 3NOGD 1HG2A 3FU5A 3Q9UC 3HYMB 3G2VA 4CT4A 2YQ8A 3CHOA 3FUIA 3ESLA 3JXIA 5C1DA 1SZ9A 3FTXA 1BU9A 3MYVA 5JA4D 3PNLB 3NF1A 3ENEA 2VGXA 5JJTA 3E37A 4GA0A 4A55A 5EYPF 4HFGA 2OVFA 2QYUA 5EKQD 4ANXA 2V0PA 2P2CP 3FUFA 5KJLA 3UPVA 3DPYA 4AY5A 4EZKA 1DNPA 3DSXA 2P58C 4YDEA 3QC1A 1QZ2A 5FT9A 3R7RA 4B8AA 2V5QC 3E32A 4JHJA 5KJKA 3EUVA 2H6HA 3EU9A 3FY4A 4ZHBA 3B7BA 3PE4A 2OCCE 2A4ZA 4ANWA 4RG6A 3CIAA 3PRZA 4AXHA 5CMYA 1LD8A 3V30A 4FJZA 3S7FA 2IONA 1BI8B 4HOTA 2EIME 1JWGA 3APDA 1ELKA 1UJJA 1N94A 2XGMA 3AAAC 4L7TA 2P9NG 2VSOE 3AU4A 3PEUB 3QOUA 4OAVB 3C5RA 4LEUA 1NFIE 2WQ6A 3U4TA 4DLQA 2BF0X 3EHRA 2Y1LE 4N39A 5BXOA 3EHNA 4D10C 3PZ2A 4CCAA 3MEKA 2CFUA 4I6EA 3U9WA 3LJNA 5EYLA 1Z3XA 2H6FA 5D0OD 4NQ0A 3TWQA 4DRXE 3FU3A 4EHMA 1TEZA 3L82A 2FBNA 4X8QA 3S7DA 2BEDA 5ENPD 4BTAA 1UOHA 4I1OB 2RFMA 4PS8A 5HI7A 4DJAA 3RRUA 1DVPA 3SFZA 5G05C 4HRMB 5E75A 3Q73A 4YNDA 3TJPA 2FULA 1D8DA 3CHMA 1TNYA 4OYSA 5KNGA 1OY3D 2QY7A 3QNKA 2XZTG 5E76A 3SBSA 1SZAA 2DYSE 4FHKA 1SVXA 3ASNE 3MGBA 4TXQA 2GGFA 5JMND 4I1MA 3TWWA 2P9SG 5JJ6A 1HF8A 2XHEA 2NYJA 3E4BA 4WAFA 2VJ8A 3RO3A 2PM6A 4XKCA 4AIFA 2BKGA 4WWPA 4O1PA 1JCSA 2V8SE 4PH4B 3GYZA 3MX3A 5CHEE 3QWWA 3R9MA 2UY1A 2NXPA 4G24A 3FH7A 2EIJE 3UQ3A 3IEGA 4HS2A 5EN5D 3UI2A 2WMOA 1E8XA 5EX0A 2AWIA 3B13A 1OCCE 3PZ4A 2ETBA 2WXFA 1N9AA 4XEIG 3FDHA 3ZYKA 5C2YA 1S63A 1N0QA 3UT8A 4EPZA 1UN9A 1H6PA 3GW4A 2VSXE 2KCVA 3FTUA 4UQXA 2KZTA 4GPMA 3OXLA 3FHEA 2MYOA 2GRPB 4BT9A 4FHJA 3JXJA 1EF1C 4GZDA 3U66A 5J90A 3UUXA 1OWOA 2MRIA 3NBNB 3JQ1A 4I17A 4ACLA 4I2ZA 2ONDA 3FTWA 2RG8A 4N5QA 5CBNA 4JB8P 5LOZA 5ENOD 2LUHA 2L6BA 4LNUD 3D9PA 2HO1A 5HQ8A 5FQ6A 2XENA 2P9PG 4CDNA 2J8SD 1TJCA 5CERB 1E8WA 5AQ9A 3NZSA 2JABA 3I5PA 3UM0A 4ZFHA 4BT8A 3DXKG 5CECB 3VTYA 1JWFA 3KS2A 4LNBA 5B3SE 2PL2A 3TG4A 3DBSA 3HXFA 3ZPJA 3L22A 3D9LA 4U8VD 5FZQA 3ABKE 3W9GA 3LJ3A 4C9BB 3RRNB 2NC9A 3SI5A 2XGOA 3N71A 4FADA 5BPPA 4Y6WA 2DZOA 2CHWA 3R7QA 4JC8A 5FQ4A 2IO2C 3LVRE 1MHQA 4TXPA 4HRLA 3GZSA 3CVYA 2WQ7A 5KJNA 3D9NA 4MRUA 2VTBB 4AY6A 2QFCA 3HHMA 4O6FA 1EDUA 2UWJG 5FQ7A 4JL0A 2IY0C 3DXMG 3EHMA 4F53A 5CEDB 2RD0A 4DK5A 4CDMA 5EIBE 4L23A 3B7TA 2C2LA 1QYMA 2OEWA 4UI9K 3O48A 5G04C 4RLYA 3UKRG 1Y8MA 4JEUA 1V54E 3MCXA 4RG9A 3E33A 2FO7A 3G2SA 1MYOA 3RSEG 1QBQA 4AOFA 3ABLE 2X3MA 2VQ2A 1E90A 3HXCA 4G23A 4ABNA 5T8IA 4J6IA 3NQPA 1WAO1 2EILE 3S7BA 3UM1A 4O60A 4CGVA 3UM2A 1K3ZD 4DLOA 3L54A 1ELRA 4HQDA 2M63A 3G2UA 3TL5A 4LERA 4UWHA 1WY6A 3E30A 3HVEA 5KBAA 3AS5A 3EU5A 4BERA 2PZIA 2X6JA 4EQFA 3BUAA 3V31A 1JPLA 3D9MA 4HNAD 5AIJA 4AP2A 3C72A 2HE0A 3HXDA 3ULEG 2KCLA 4G8KA 1EPUA 4A3VA 2FI7A 2R02A 4UWKA 3P1UA 4Q94A 3W9FA 4OVVA 3MZLB 1DCQA 2GRLA 1Z5SC 2WXLA 1IXVA 3ZVVA 4GTSA 3Q15A 1E7VA 4GTVA 4DPRA 3HXEA 1IQUA 3MKQB 3RRMB 2AXZA 3C3RA 4DX5D 3SBTB 5AQBA 3ZKJA 3SNXA 4EBAA 3CGHA 1LTXA 3CQGB 5KJMA 3DRAA 4WNFA 1KZOA 4BY6A 3DWLG 3Q4AB 3AU5A 2VSNA 3FUEA 3PEVB 5EX3A 2DZNA 1AP7A 3CVQA 3D9OA 3ASFA 4N5CA 1IHBA 1JUQA 1SQMA 3I4RB 4E6HA 3TGOA 3TG5A 1KT1A 5BXUA 4TV3A 5ANRA 5AARA 3O4ZA 4LG6A 1O1SA 4CZ2D 4DI3A 1UN8A 1FVHA 2DIWA 4UI9J 2I1KA 3UM3A 1UW4B 2A5UA 3I4GA 3ONLA 2Y4UA 2LSVA 3L16A 1HXIA 2X6FA 4XIFA 5BT1A 4JW1A 3PNTB 2J9QA 4GU5A 3LVQE 1JCQA 2I9CA 3ASOE 2F37A 4JXTA 1GW6A 4EBAG 3RJVA 3UT7A 2YNQA 2ZISA 2HM8A 2EQXA 2R17C 2XQ0A 4LNGA 4N2QA 4KT6B 5CRVA 3ZIMA 3FUJA 4GYYA 4J0UA 4FU3A 4PUCA 4WNDA 4XE0A 2J09A 2J08A 2J49A 3GZ1A 3PUJA 3ML9A 4YVOA 1MZCA 3BU8A 4UUCA 5FWQA 3FUMA 1NZNA 2DYRE 3CVNA 1XGWA 4GTQA 2GRQB 4UWGA 1HO8A 2XGSA 1PY1A 3ZFWA 2XCCA 4YDYA 3ZXPA 3UKUG 1BLXB 4KVMA 2B6CA 2CHXA 3P2BA 2DCPA 3FUHA 5AAOA 3FH5A 5D2MC 1K1BA 3VTXA 4QFVA 3C98A 5JJ7A 4U0ZA 2XEHA 3AJIA 1K1AA 4H7YA 3VLFA 4I9CA 3LKUA 2XCBA 2Y3AA 1A17A 3C3QA 1MX2A 2E2EA 2R59A 3LDZA 1LF8A 3FTVA 1NI1A 3BG0B 3MA5A 1PAQA 3VLEA 1LD7A 3DSVA 5AN8A 2H6GA 4LCTA 4K03A 2X6KA 4HLEA 4NRHB 4ACKA 3MV2B 4MLPA 3QKYA 2I1JA 4CRWA 4GB9A 3B7SA 4KBQA 4BEPA 3CVLA 5ENTD 3ESKA 1N4RA 4QQIA 1OT8A 1XNFA 1E96B 3ULQA 2KCKA 1TNBA 4U07A 5AJLA 5ENQD 2FEZA 4XI0A 3RKVA 2ZGGA 4AEZC 1Q2ZA 4G26A 3LY8A 1D9SA 1QNFA 1OCRE 2F8XK 4GZCA 2LNIA 3ZHEA 3CHPA 3CSFA 3UMVA 4U96D 1HG5A 3EDTB 4GZ6A 3QJZA 1MX6A 1H6KA 2KM4A 2Y69E 4JD2G 4JHRA 4Y6CA 4U8YD 2FO1E 2R2LA 4HB5A 1DC2A 3L13A 4U04A 2WXHA 4GMJA 3OXGA 4GTPA 5CCLA 3HDXA 4A1GA 5KNHD 4TRQA 5A6CA 1MX4A 2KATA 4N2SA 3FUDA 1OWMA 4G25A 2JLBA 4BSZB 4YDOA 4L2YA 2P9LG 3SD5A 3V79K 3ULYA 2IF4A 3APCA 1U2VG 3D3MA 3HXBA 3JUEA 2WMNA 4WWNA 5B1AE 1P5QA 1ZBPA 5LCWJ 4NURA 4J8DA 1IHGA 1NA3A 4WNGA 4IYPA 4JEHA 1S0PA 4GTOA 1NL4A 3L17A 3AG4E 4NACA 5T4YA 4KZ0A 4U0UA 5FQ8A 1HS6A 2AVPA 3Q7FA 5KWDA 4K5AB 1H2VC 4BETA 2IOSA 3Q49B 1Z6TA 4GYWA 1OWLA 1SW6A 3ZUVB 4C48B 1INZA 2VGXB 3CLJA
chains in the Genus database with same CATH topology
1O1TA 1LD8A 1FT2A 4GTMA 1JCQA 1N4QA 3Q7AA 1KZPA 1N94A 1NI1A 2R2LA 2ZISA 3E33A 4GTSA 4LNGA 1LD7A 3DSVA 1QBQA 2H6GA 4GTVA 1SA5A 3HXEA 1TN7A 4GTPA 1O1RA 3HXCA 1FPPA 3E34A 4MBGA 3SFXA 1LTXA 1N4PA 1TN6A 3PZ1A 4YDOA 3DRAA 1MZCA 1N95A 1KZOA 3PZ2A 1SA4A 4GTQA 3HXBA 4LNBA 1JCSA 1X81A 2ZIRA 1N4RA 3HXFA 3PZ3A 2H6FA 3DSSA 1TN8A 3E37A 4EHMA 3E30A 1TNBA 3Q78A 1S64A 3EU5A 4GTRA 1O5MA 4GTOA 1TNZA 3DSTA 2BEDA 1NL4A 3DPYA 2IEJA 1DCEA 4GTTA 3KSQA 1O1SA 1FT1A 3DSXA 3PZ4A 4YDEA 1N9AA 1JCRA 3Q7FA 1D8EA 1S63A 2F0YA 3E32A 3KSLA 3C72A 3EUVA 2H6HA 3HXDA 1N4SA 4L9PA 3Q73A 3Q79A 3DSUA 3DSWA 3Q75A 1D8DA 2H6IA 1TNUA 1TNYA 3SFYA 1TNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O1T A;  1LD8 A;  1FT2 A;  4GTM A;  1JCQ A;  1N4Q A;  3Q7A A;  1KZP A;  1N94 A;  1NI1 A;  2R2L A;  2ZIS A;  3E33 A;  4GTS A;  4LNG A;  1LD7 A;  3DSV A;  1QBQ A;  2H6G A;  4GTV A;  1SA5 A;  3HXE A;  1TN7 A;  4GTP A;  1O1R A;  3HXC A;  1FPP A;  3E34 A;  4MBG A;  3SFX A;  1LTX A;  1N4P A;  1TN6 A;  3PZ1 A;  4YDO A;  3DRA A;  1MZC A;  1N95 A;  1KZO A;  3PZ2 A;  1SA4 A;  4GTQ A;  3HXB A;  4LNB A;  1JCS A;  1X81 A;  2ZIR A;  1N4R A;  3HXF A;  3PZ3 A;  2H6F A;  3DSS A;  1TN8 A;  3E37 A;  4EHM A;  3E30 A;  1TNB A;  3Q78 A;  1S64 A;  3EU5 A;  4GTR A;  1O5M A;  4GTO A;  1TNZ A;  3DST A;  2BED A;  1NL4 A;  3DPY A;  2IEJ A;  1DCE A;  4GTT A;  3KSQ A;  1O1S A;  1FT1 A;  3DSX A;  3PZ4 A;  4YDE A;  1N9A A;  1JCR A;  3Q7F A;  1D8E A;  1S63 A;  2F0Y A;  3E32 A;  3KSL A;  3C72 A;  3EUV A;  2H6H A;  3HXD A;  1N4S A;  4L9P A;  3Q73 A;  3Q79 A;  3DSU A;  3DSW A;  3Q75 A;  1D8D A;  2H6I A;  1TNU A;  1TNY A;  3SFY A;  1TNO A; 
#chains in the Genus database with same CATH topology
 3LY9 A;  5IY5 E;  1O1T A;  2CHZ A;  2VGY A;  2GRN B;  4Q96 A;  2R03 A;  1WM5 A;  2L0T B;  5FIN A;  2MHK A;  2P9U G;  4RSY A;  1IQR A;  1YA0 A;  4OVU A;  3R9A B;  2PNN A;  2V4H C;  1H2T C;  3OAW A;  2ILR A;  4N3C A;  1OCZ E;  3SQV A;  4PS3 A;  4FC8 A;  4LSZ E;  1N0R A;  4K5B A;  3ML8 A;  3U64 A;  2C0L A;  3OXF A;  1KLX A;  5D66 A;  3EJN A;  4FLH A;  3PDN A;  2LSU A;  5T3R A;  3TWV A;  4GCO A;  3UT4 A;  4K5C A;  2JEK A;  3JYS A;  3LPZ A;  4DX7 D;  2KBX A;  5A7D B;  3Q47 B;  3MJW A;  4EZJ A;  4HOR A;  2CG2 A;  4GYO A;  3TAX A;  3FU0 A;  3T9K A;  3EIJ A;  2R5S A;  3PH0 C;  5ENS D;  2XRZ A;  1TNZ A;  2XEV A;  5ITZ F;  3SZ7 A;  3SGH A;  1H2U A;  4W9R A;  4L1B A;  3IXE A;  3NAW A;  3CEQ A;  4CYM D;  3MV3 B;  1E7U A;  2XPZ A;  4IRU A;  5M72 A;  2FF4 A;  1OWN A;  4ME2 A;  2R05 A;  3JQ0 A;  3FFL A;  5JHB A;  1HH8 A;  1HE8 A;  3SFY A;  2LO6 A;  1NA0 A;  3BG1 B;  2NSZ A;  4ILI A;  3RO2 A;  2Y4T A;  1BD8 A;  3CK8 A;  5EIL A;  1K8K G;  1Z3Y A;  2PM7 A;  3QB2 A;  3AG3 E;  4FJY A;  2EIK E;  1BI7 B;  3AG1 E;  5AJD A;  3IV0 A;  3OTN A;  2XZD G;  3UIP C;  2E0I A;  3KD7 A;  1KPS B;  4U8H A;  3RAU A;  3DPD A;  3QAQ A;  4HLL A;  4WUY A;  3C3O A;  4ANU A;  3CQC B;  4MBG A;  3SFX A;  2A5E A;  3TWR A;  1IKN D;  2GRO B;  3APF A;  3ZNG A;  4G8L A;  2OV8 A;  4B89 A;  3CKC A;  2YHC A;  3DSS A;  2AXV A;  3AS4 A;  3HRA A;  1TYQ G;  3Q78 A;  1S64 A;  5CMW A;  4GTR A;  4XZ4 A;  4U0S A;  4HXI A;  4IUL A;  3DST A;  3G2W A;  3HG0 D;  5HRY A;  2PQR A;  2IO3 C;  3TWU A;  4XKB A;  2GRM A;  3KSQ A;  4P29 A;  1FT1 A;  4DX6 D;  3B7R L;  4AM9 A;  1FVF A;  2AJA A;  1TR4 A;  2MOW A;  4XX5 A;  3CST A;  4R7L A;  3L9T A;  5CRU A;  1MJ0 A;  4AJW A;  2V5F A;  2UY1 B;  3G2T A;  3CVV A;  4DUI A;  5G05 J;  2L9B A;  1YCS B;  2IOL A;  2DWZ A;  4NIK A;  4N3A A;  2ETA A;  4APF A;  3EHQ A;  4HOS A;  3PUK A;  2ZXW E;  1ZB1 A;  1Y6I A;  5ARF A;  3NOC D;  1S70 B;  1N52 A;  2X6H A;  4URK A;  3CHQ A;  4A63 B;  4A1S A;  4I9E A;  2WXJ A;  4GZ3 A;  4ILG A;  2KZT B;  3ZXS A;  3V2O A;  4K0R A;  5LFA A;  2QZA A;  3PZ1 A;  2GW1 A;  1N95 A;  2VTB A;  4V3I A;  3NZU A;  2ZIR A;  4APO A;  5BUZ A;  3ZYL A;  1HU3 A;  1OXJ A;  2OOE A;  4HI9 A;  3FEX A;  3TWT A;  3LCA A;  4C0M A;  2J4B A;  5HS0 A;  3AS8 A;  4ATZ D;  2GRR B;  3DEP A;  2XS8 A;  5FZR A;  3CK7 A;  4KYO B;  3FTY A;  4Z68 A;  1TJF A;  4PS7 A;  5AQ7 A;  3FH8 A;  3CV0 A;  1G3N B;  4DI4 A;  2XS1 A;  2AW6 A;  4YVQ C;  4G1T A;  4CDR A;  2EIN E;  4XI9 A;  4N3B A;  5EID A;  1E8Y A;  4PDX A;  5LX8 A;  3Q79 A;  4GA1 A;  3DSW A;  1A5E A;  3V2X A;  1TNU A;  1U3D A;  4GZ5 A;  3PZD A;  2L6J A;  1W3B A;  4BFR A;  1KT0 A;  3FUL A;  5FZS A;  5A23 A;  4AVX A;  1N4Q A;  4MS6 A;  3F6Q A;  2IU1 A;  2BKK B;  3U3W A;  2L0I A;  2ZU6 B;  5B1B E;  3TWS A;  3UX4 A;  3TXM A;  4ATG A;  3ZW3 A;  4HBD A;  3AG2 E;  4H7X A;  2QC9 A;  1RW2 A;  2J4D A;  3ABM E;  4F3V A;  1TN6 A;  2IQC A;  5D0Q D;  2KXP C;  3FP3 A;  3CK9 A;  1N54 A;  1X81 A;  5FJY A;  4DX2 A;  4DX1 A;  3DEO A;  4IN3 B;  3VLD A;  1ELW A;  5CEA A;  5FIO A;  3B7U X;  1HX8 A;  1O5M A;  4GA2 A;  3ZYQ A;  2WXG A;  4KVO A;  4UI9 C;  5H7P A;  4ILH B;  1D8E A;  2F0Y A;  3LXU X;  3NB2 A;  3MKQ A;  3CVW A;  2WXQ A;  3Q9N C;  4F1S A;  5FTP A;  2Q7F A;  3D9J A;  2YIN A;  5AEN A;  3HVE B;  4HVB A;  4HOQ A;  1FT2 A;  4GTM A;  5G2N A;  2WXR A;  3IHV A;  1RZ4 A;  4JZY A;  2J07 A;  4U63 A;  3CHS A;  4B94 A;  5G04 J;  5AQA A;  3UIN C;  1U3C A;  3FEY A;  3CKB A;  4M3O A;  4F6R D;  3CHR A;  4C0E A;  2XPI A;  3L6A A;  1OUV A;  2WVI A;  5ENR D;  4KZC A;  4CEM A;  4FLB A;  1H0A A;  2CFZ A;  2WM9 A;  4KMO A;  4FUL A;  4B93 B;  1IYG A;  4AV7 A;  2I2O A;  1VDY A;  3ASH A;  5HKP A;  4U7E B;  1UG3 A;  2P9I G;  5CBO A;  3FTZ A;  3QAR A;  1WDY A;  2XPY A;  3Q5M A;  4J8S A;  3ASG A;  1MQS A;  2OVB A;  3EIQ C;  4I43 A;  1YMP A;  2LXM A;  1ZU2 A;  3K9I A;  4UQY A;  1OCO E;  2CG3 A;  4JA7 A;  3KSL A;  4I6G A;  5J08 A;  2Y0B G;  4FP7 A;  3JCK C;  4TUU A;  2B0O E;  3ZEF A;  1QQE A;  2WQH A;  3SY2 A;  5EDS A;  2XEE A;  1TNO A;  4JA9 A;  5G55 A;  4TUM A;  3T5X A;  4O1O A;  3QWP A;  3FUK A;  3Q7A A;  4J8F A;  3LY7 A;  3IKO B;  1X5B A;  3HIZ A;  2OEV A;  4GCN A;  4TXR A;  4A3T A;  1TN7 A;  3ASD A;  4HI8 A;  2WXP A;  1EYH A;  3J5P A;  4BTB A;  3S7J A;  4JPS A;  1N4P A;  1AWC B;  3T8K A;  3S2A A;  4EEC A;  2VSY A;  3L08 A;  4HRN A;  3SHF A;  2F8Y A;  2WPV A;  3KEZ A;  4Q69 A;  3URZ A;  2YHE A;  3PZ3 A;  3UTM A;  3FTS A;  1TN8 A;  3I3N A;  5AYW D;  2WXN A;  2PQN A;  4FA6 A;  4WNE A;  3SO8 A;  4GAA A;  2RKK A;  1BPO A;  3ZN3 A;  3ONK A;  4EZL A;  3IBE A;  1E8Z A;  5JHA A;  1DCE A;  4GTT A;  2ETC A;  4HOU A;  5CCM A;  2WXK A;  1V55 E;  3ISM C;  3D9I A;  3RK6 A;  2P9K G;  3X2Q E;  4F1P A;  4G2V A;  1L5J A;  3GZ2 A;  4BX9 A;  1N4S A;  1YYH A;  4UWL A;  3T5V A;  3QWV A;  4JVS A;  3Q75 A;  2IJG X;  4BES A;  3FU6 A;  3LEW A;  5ARG A;  2AXU A;  5BV1 A;  3QDN A;  3D9H A;  2C0M A;  3SF4 A;  4JHK A;  4UWF A;  2HYZ A;  3PVL A;  3CR3 A;  3CVX A;  1KZP A;  3IHY A;  4GML A;  4L2L A;  4MKT A;  2KC7 A;  3ZGQ A;  2LAH A;  1N11 A;  1SA5 A;  2WXM A;  4J7W A;  2X6I A;  1H19 A;  3WG7 E;  1FPP A;  4J8Y A;  3D9K A;  2WXI A;  4RQI A;  2QYJ A;  2I6H A;  4E85 A;  4I2W A;  2HR2 A;  1UJK A;  5LCW C;  4I6J A;  3FWV A;  5LP0 A;  3BEE A;  5BV0 A;  3UIO C;  1SA4 A;  4GMR A;  3FUN A;  4LUN U;  4YDW A;  1HZ4 A;  3ZU7 B;  1PC2 A;  3RIB A;  3CVU A;  3PRE A;  2VGE A;  4ANV A;  3LS8 A;  3LYA A;  3MKR A;  1B89 A;  3J5Q B;  3ZRH A;  4B8C B;  2DBA A;  3PE3 A;  4OAU C;  1OWP A;  3KAE A;  2LAI A;  5ANL A;  3RU0 A;  4U95 D;  2IEJ A;  4UQZ A;  2IFU A;  2ZGD A;  1H6O A;  3UXG A;  1JCR A;  3WXX A;  2WB2 A;  3TWX A;  3CVP A;  3BQO A;  3QK0 A;  1FCH A;  2X38 A;  4WWO A;  4L9P A;  1NP7 A;  4CGW A;  3DSU A;  3KEA A;  2V4L A;  5BNW A;  5ENN A;  2RFA A;  2H6I A;  2LXL A;  4G11 A;  2DVW A;  3TXN A;  4GPK A;  5KCM A;  2VYI A;  4KXK B;  3ZYM A;  5BW8 C;  3T8M A;  4BWR A;  3JUI A;  4B0Z A;  3B95 A;  2BUG A;  4RVB A;  1HFA A;  4F7A A;  4BSX A;  1WG0 A;  5DIZ A;  4BX8 A;  2WXO A;  3PS6 A;  4J8E A;  1O1R A;  4M7C A;  4I1A A;  3ZHE B;  3E34 A;  2BTD A;  4LRZ A;  4CT0 A;  5DBK A;  2XRY A;  3NOG D;  1HG2 A;  3FU5 A;  3Q9U C;  3HYM B;  3G2V A;  4CT4 A;  2YQ8 A;  3CHO A;  3FUI A;  3ESL A;  3JXI A;  5C1D A;  1SZ9 A;  3FTX A;  1BU9 A;  3MYV A;  5JA4 D;  3PNL B;  3NF1 A;  3ENE A;  2VGX A;  5JJT A;  3E37 A;  4GA0 A;  4A55 A;  5EYP F;  4HFG A;  2OVF A;  2QYU A;  5EKQ D;  4ANX A;  2V0P A;  2P2C P;  3FUF A;  5KJL A;  3UPV A;  3DPY A;  4AY5 A;  4EZK A;  1DNP A;  3DSX A;  2P58 C;  4YDE A;  3QC1 A;  1QZ2 A;  5FT9 A;  3R7R A;  4B8A A;  2V5Q C;  3E32 A;  4JHJ A;  5KJK A;  3EUV A;  2H6H A;  3EU9 A;  3FY4 A;  4ZHB A;  3B7B A;  3PE4 A;  2OCC E;  2A4Z A;  4ANW A;  4RG6 A;  3CIA A;  3PRZ A;  4AXH A;  5CMY A;  1LD8 A;  3V30 A;  4FJZ A;  3S7F A;  2ION A;  1BI8 B;  4HOT A;  2EIM E;  1JWG A;  3APD A;  1ELK A;  1UJJ A;  1N94 A;  2XGM A;  3AAA C;  4L7T A;  2P9N G;  2VSO E;  3AU4 A;  3PEU B;  3QOU A;  4OAV B;  3C5R A;  4LEU A;  1NFI E;  2WQ6 A;  3U4T A;  4DLQ A;  2BF0 X;  3EHR A;  2Y1L E;  4N39 A;  5BXO A;  3EHN A;  4D10 C;  3PZ2 A;  4CCA A;  3MEK A;  2CFU A;  4I6E A;  3U9W A;  3LJN A;  5EYL A;  1Z3X A;  2H6F A;  5D0O D;  4NQ0 A;  3TWQ A;  4DRX E;  3FU3 A;  4EHM A;  1TEZ A;  3L82 A;  2FBN A;  4X8Q A;  3S7D A;  2BED A;  5ENP D;  4BTA A;  1UOH A;  4I1O B;  2RFM A;  4PS8 A;  5HI7 A;  4DJA A;  3RRU A;  1DVP A;  3SFZ A;  5G05 C;  4HRM B;  5E75 A;  3Q73 A;  4YND A;  3TJP A;  2FUL A;  1D8D A;  3CHM A;  1TNY A;  4OYS A;  5KNG A;  1OY3 D;  2QY7 A;  3QNK A;  2XZT G;  5E76 A;  3SBS A;  1SZA A;  2DYS E;  4FHK A;  1SVX A;  3ASN E;  3MGB A;  4TXQ A;  2GGF A;  5JMN D;  4I1M A;  3TWW A;  2P9S G;  5JJ6 A;  1HF8 A;  2XHE A;  2NYJ A;  3E4B A;  4WAF A;  2VJ8 A;  3RO3 A;  2PM6 A;  4XKC A;  4AIF A;  2BKG A;  4WWP A;  4O1P A;  1JCS A;  2V8S E;  4PH4 B;  3GYZ A;  3MX3 A;  5CHE E;  3QWW A;  3R9M A;  2UY1 A;  2NXP A;  4G24 A;  3FH7 A;  2EIJ E;  3UQ3 A;  3IEG A;  4HS2 A;  5EN5 D;  3UI2 A;  2WMO A;  1E8X A;  5EX0 A;  2AWI A;  3B13 A;  1OCC E;  3PZ4 A;  2ETB A;  2WXF A;  1N9A A;  4XEI G;  3FDH A;  3ZYK A;  5C2Y A;  1S63 A;  1N0Q A;  3UT8 A;  4EPZ A;  1UN9 A;  1H6P A;  3GW4 A;  2VSX E;  2KCV A;  3FTU A;  4UQX A;  2KZT A;  4GPM A;  3OXL A;  3FHE A;  2MYO A;  2GRP B;  4BT9 A;  4FHJ A;  3JXJ A;  1EF1 C;  4GZD A;  3U66 A;  5J90 A;  3UUX A;  1OWO A;  2MRI A;  3NBN B;  3JQ1 A;  4I17 A;  4ACL A;  4I2Z A;  2OND A;  3FTW A;  2RG8 A;  4N5Q A;  5CBN A;  4JB8 P;  5LOZ A;  5ENO D;  2LUH A;  2L6B A;  4LNU D;  3D9P A;  2HO1 A;  5HQ8 A;  5FQ6 A;  2XEN A;  2P9P G;  4CDN A;  2J8S D;  1TJC A;  5CER B;  1E8W A;  5AQ9 A;  3NZS A;  2JAB A;  3I5P A;  3UM0 A;  4ZFH A;  4BT8 A;  3DXK G;  5CEC B;  3VTY A;  1JWF A;  3KS2 A;  4LNB A;  5B3S E;  2PL2 A;  3TG4 A;  3DBS A;  3HXF A;  3ZPJ A;  3L22 A;  3D9L A;  4U8V D;  5FZQ A;  3ABK E;  3W9G A;  3LJ3 A;  4C9B B;  3RRN B;  2NC9 A;  3SI5 A;  2XGO A;  3N71 A;  4FAD A;  5BPP A;  4Y6W A;  2DZO A;  2CHW A;  3R7Q A;  4JC8 A;  5FQ4 A;  2IO2 C;  3LVR E;  1MHQ A;  4TXP A;  4HRL A;  3GZS A;  3CVY A;  2WQ7 A;  5KJN A;  3D9N A;  4MRU A;  2VTB B;  4AY6 A;  2QFC A;  3HHM A;  4O6F A;  1EDU A;  2UWJ G;  5FQ7 A;  4JL0 A;  2IY0 C;  3DXM G;  3EHM A;  4F53 A;  5CED B;  2RD0 A;  4DK5 A;  4CDM A;  5EIB E;  4L23 A;  3B7T A;  2C2L A;  1QYM A;  2OEW A;  4UI9 K;  3O48 A;  5G04 C;  4RLY A;  3UKR G;  1Y8M A;  4JEU A;  1V54 E;  3MCX A;  4RG9 A;  3E33 A;  2FO7 A;  3G2S A;  1MYO A;  3RSE G;  1QBQ A;  4AOF A;  3ABL E;  2X3M A;  2VQ2 A;  1E90 A;  3HXC A;  4G23 A;  4ABN A;  5T8I A;  4J6I A;  3NQP A;  1WAO 1;  2EIL E;  3S7B A;  3UM1 A;  4O60 A;  4CGV A;  3UM2 A;  1K3Z D;  4DLO A;  3L54 A;  1ELR A;  4HQD A;  2M63 A;  3G2U A;  3TL5 A;  4LER A;  4UWH A;  1WY6 A;  3E30 A;  3HVE A;  5KBA A;  3AS5 A;  3EU5 A;  4BER A;  2PZI A;  2X6J A;  4EQF A;  3BUA A;  3V31 A;  1JPL A;  3D9M A;  4HNA D;  5AIJ A;  4AP2 A;  3C72 A;  2HE0 A;  3HXD A;  3ULE G;  2KCL A;  4G8K A;  1EPU A;  4A3V A;  2FI7 A;  2R02 A;  4UWK A;  3P1U A;  4Q94 A;  3W9F A;  4OVV A;  3MZL B;  1DCQ A;  2GRL A;  1Z5S C;  2WXL A;  1IXV A;  3ZVV A;  4GTS A;  3Q15 A;  1E7V A;  4GTV A;  4DPR A;  3HXE A;  1IQU A;  3MKQ B;  3RRM B;  2AXZ A;  3C3R A;  4DX5 D;  3SBT B;  5AQB A;  3ZKJ A;  3SNX A;  4EBA A;  3CGH A;  1LTX A;  3CQG B;  5KJM A;  3DRA A;  4WNF A;  1KZO A;  4BY6 A;  3DWL G;  3Q4A B;  3AU5 A;  2VSN A;  3FUE A;  3PEV B;  5EX3 A;  2DZN A;  1AP7 A;  3CVQ A;  3D9O A;  3ASF A;  4N5C A;  1IHB A;  1JUQ A;  1SQM A;  3I4R B;  4E6H A;  3TGO A;  3TG5 A;  1KT1 A;  5BXU A;  4TV3 A;  5ANR A;  5AAR A;  3O4Z A;  4LG6 A;  1O1S A;  4CZ2 D;  4DI3 A;  1UN8 A;  1FVH A;  2DIW A;  4UI9 J;  2I1K A;  3UM3 A;  1UW4 B;  2A5U A;  3I4G A;  3ONL A;  2Y4U A;  2LSV A;  3L16 A;  1HXI A;  2X6F A;  4XIF A;  5BT1 A;  4JW1 A;  3PNT B;  2J9Q A;  4GU5 A;  3LVQ E;  1JCQ A;  2I9C A;  3ASO E;  2F37 A;  4JXT A;  1GW6 A;  4EBA G;  3RJV A;  3UT7 A;  2YNQ A;  2ZIS A;  2HM8 A;  2EQX A;  2R17 C;  2XQ0 A;  4LNG A;  4N2Q A;  4KT6 B;  5CRV A;  3ZIM A;  3FUJ A;  4GYY A;  4J0U A;  4FU3 A;  4PUC A;  4WND A;  4XE0 A;  2J09 A;  2J08 A;  2J49 A;  3GZ1 A;  3PUJ A;  3ML9 A;  4YVO A;  1MZC A;  3BU8 A;  4UUC A;  5FWQ A;  3FUM A;  1NZN A;  2DYR E;  3CVN A;  1XGW A;  4GTQ A;  2GRQ B;  4UWG A;  1HO8 A;  2XGS A;  1PY1 A;  3ZFW A;  2XCC A;  4YDY A;  3ZXP A;  3UKU G;  1BLX B;  4KVM A;  2B6C A;  2CHX A;  3P2B A;  2DCP A;  3FUH A;  5AAO A;  3FH5 A;  5D2M C;  1K1B A;  3VTX A;  4QFV A;  3C98 A;  5JJ7 A;  4U0Z A;  2XEH A;  3AJI A;  1K1A A;  4H7Y A;  3VLF A;  4I9C A;  3LKU A;  2XCB A;  2Y3A A;  1A17 A;  3C3Q A;  1MX2 A;  2E2E A;  2R59 A;  3LDZ A;  1LF8 A;  3FTV A;  1NI1 A;  3BG0 B;  3MA5 A;  1PAQ A;  3VLE A;  1LD7 A;  3DSV A;  5AN8 A;  2H6G A;  4LCT A;  4K03 A;  2X6K A;  4HLE A;  4NRH B;  4ACK A;  3MV2 B;  4MLP A;  3QKY A;  2I1J A;  4CRW A;  4GB9 A;  3B7S A;  4KBQ A;  4BEP A;  3CVL A;  5ENT D;  3ESK A;  1N4R A;  4QQI A;  1OT8 A;  1XNF A;  1E96 B;  3ULQ A;  2KCK A;  1TNB A;  4U07 A;  5AJL A;  5ENQ D;  2FEZ A;  4XI0 A;  3RKV A;  2ZGG A;  4AEZ C;  1Q2Z A;  4G26 A;  3LY8 A;  1D9S A;  1QNF A;  1OCR E;  2F8X K;  4GZC A;  2LNI A;  3ZHE A;  3CHP A;  3CSF A;  3UMV A;  4U96 D;  1HG5 A;  3EDT B;  4GZ6 A;  3QJZ A;  1MX6 A;  1H6K A;  2KM4 A;  2Y69 E;  4JD2 G;  4JHR A;  4Y6C A;  4U8Y D;  2FO1 E;  2R2L A;  4HB5 A;  1DC2 A;  3L13 A;  4U04 A;  2WXH A;  4GMJ A;  3OXG A;  4GTP A;  5CCL A;  3HDX A;  4A1G A;  5KNH D;  4TRQ A;  5A6C A;  1MX4 A;  2KAT A;  4N2S A;  3FUD A;  1OWM A;  4G25 A;  2JLB A;  4BSZ B;  4YDO A;  4L2Y A;  2P9L G;  3SD5 A;  3V79 K;  3ULY A;  2IF4 A;  3APC A;  1U2V G;  3D3M A;  3HXB A;  3JUE A;  2WMN A;  4WWN A;  5B1A E;  1P5Q A;  1ZBP A;  5LCW J;  4NUR A;  4J8D A;  1IHG A;  1NA3 A;  4WNG A;  4IYP A;  4JEH A;  1S0P A;  4GTO A;  1NL4 A;  3L17 A;  3AG4 E;  4NAC A;  5T4Y A;  4KZ0 A;  4U0U A;  5FQ8 A;  1HS6 A;  2AVP A;  3Q7F A;  5KWD A;  4K5A B;  1H2V C;  4BET A;  2IOS A;  3Q49 B;  1Z6T A;  4GYW A;  1OWL A;  1SW6 A;  3ZUV B;  4C48 B;  1INZ A;  2VGX B;  3CLJ A; 
#chains in the Genus database with same CATH homology
 1O1T A;  1LD8 A;  1FT2 A;  4GTM A;  1JCQ A;  1N4Q A;  3Q7A A;  1KZP A;  1N94 A;  1NI1 A;  2R2L A;  2ZIS A;  3E33 A;  4GTS A;  4LNG A;  1LD7 A;  3DSV A;  1QBQ A;  2H6G A;  4GTV A;  1SA5 A;  3HXE A;  1TN7 A;  4GTP A;  1O1R A;  3HXC A;  1FPP A;  3E34 A;  4MBG A;  3SFX A;  1LTX A;  1N4P A;  1TN6 A;  3PZ1 A;  4YDO A;  3DRA A;  1MZC A;  1N95 A;  1KZO A;  3PZ2 A;  1SA4 A;  4GTQ A;  3HXB A;  4LNB A;  1JCS A;  1X81 A;  2ZIR A;  1N4R A;  3HXF A;  3PZ3 A;  2H6F A;  3DSS A;  1TN8 A;  3E37 A;  4EHM A;  3E30 A;  1TNB A;  3Q78 A;  1S64 A;  3EU5 A;  4GTR A;  1O5M A;  4GTO A;  1TNZ A;  3DST A;  2BED A;  1NL4 A;  3DPY A;  2IEJ A;  1DCE A;  4GTT A;  3KSQ A;  1O1S A;  1FT1 A;  3DSX A;  3PZ4 A;  4YDE A;  1N9A A;  1JCR A;  3Q7F A;  1D8E A;  1S63 A;  2F0Y A;  3E32 A;  3KSL A;  3C72 A;  3EUV A;  2H6H A;  3HXD A;  1N4S A;  4L9P A;  3Q73 A;  3Q79 A;  3DSU A;  3DSW A;  3Q75 A;  1D8D A;  2H6I A;  1TNU A;  1TNY A;  3SFY A;  1TNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...