3Q78A

Cryptococcus neoformans protein farnesyltransferase in complex with fspp and ddptasacniq peptide
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
330
structure length
312
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTFPMPSLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase
molecule keywords Farnesyltransferase alpha subunit
total genus 124
structure length 312
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q78A00
3C72A 1TN8A 1FT1A 4GTQA 1JCRA 3E30A 3DSUA 3HXFA 3PZ3A 3DSXA 3E32A 1S63A 2H6FA 3PZ4A 3SFYA 3EU5A 3Q78A 1TNUA 1S64A 1NI1A 3E37A 1TN7A 3DSVA 4GTMA 3PZ2A 3DSSA 4GTRA 1LTXA 1LD8A 1O1TA 3DSTA 1JCSA 1MZCA 1N4PA 3HXBA 4YDOA 3Q79A 3HXDA 1N94A 3Q7AA 1N4SA 1N4RA 1N9AA 1TNOA 1X81A 3HXCA 4GTVA 4EHMA 4GTSA 3KSQA 2ZISA 1O1RA 1JCQA 3Q75A 4YDEA 3DRAA 3EUVA 4LNBA 1KZOA 1NL4A 1O1SA 1D8EA 3KSLA 1N95A 2H6IA 4GTOA 1SA4A 1KZPA 2BEDA 3Q73A 4MBGA 2F0YA 3HXEA 3Q7FA 4LNGA 4L9PA 1TNZA 1SA5A 1TN6A 1D8DA 1DCEA 1N4QA 1TNBA 2IEJA 3E34A 4GTPA 2H6GA 3PZ1A 1LD7A 1FPPA 1O5MA 1TNYA 3DSWA 3DPYA 2H6HA 4GTTA 1QBQA 1FT2A 2R2LA 3SFXA 3E33A 2ZIRA
chains in the Genus database with same CATH superfamily
2BUGA 3EDTB 3FTXA 3LVQE 3CSTA 4IULA 2JABA 3W9FA 5EX0A 1HG2A 3PZ3A 4BTAA 3PZ4A 5CMWA 3Q5MA 1K1AA 3FUKA 2QZAA 3ULEG 2XCCA 4H7XA 5CRUA 4LUNU 3NAWA 4E6HA 2MHKA 1H6PA 4GTRA 5B1AE 3ZYLA 4EQFA 4YDWA 1HXIA 4UWGA 4G1TA 3L16A 1WDYA 3CVXA 2V8SE 4ME2A 1E8WA 3TWXA 2X6IA 1OWNA 3AJIA 3MKQB 4HS2A 4BWRA 3AG3E 2BKGA 1EDUA 5G04C 4YDEA 1HS6A 3MYVA 4CRWA 5ITZF 4KVMA 3UT4A 2XRZA 2QYJA 3TWQA 3FH7A 3ABME 2CFZA 3PH0C 3MX3A 3PDNA 1E7VA 3L08A 2Q7FA 4YVOA 1Z6TA 4N2SA 3LY9A 3D3MA 4WNFA 4BTBA 1FPPA 2LUHA 3NB2A 4KZ0A 3SFZA 3AG2E 4G2VA 2XEVA 2B6CA 2NC9A 1ELKA 2RD0A 1MHQA 2P9NG 4ATGA 4LEUA 5J90A 4TUMA 1S63A 2XGMA 2L6BA 1OWPA 3QAQA 4F1PA 4Q69A 4RSYA 3PUJA 3N71A 1TNUA 4BT9A 3R7RA 3LKUA 2WQHA 4MRUA 2Y4TA 4DX7D 5HS0A 2WMOA 3SY2A 4JB8P 3D9KA 3ZXSA 3UUXA 1B89A 3UKRG 3TWWA 4CYMD 3CVYA 1OUVA 4B8AA 4DK5A 5JJ7A 3MEKA 1EPUA 5ANLA 2BEDA 2ONDA 4JPSA 3CVWA 1SQMA 4BESA 2DYSE 2A4ZA 4O1OA 2X6KA 3B7RL 4RVBA 5ANRA 4YNDA 2A5UA 2XCBA 5KJKA 4F7AA 4HB5A 2ETCA 3U66A 2AJAA 3FTYA 3PEVB 4JC8A 3FDHA 3DSWA 3FUFA 1JPLA 3S7JA 4JVSA 3UI2A 1E8ZA 4Q94A 4JHKA 3ZUVB 4OAVB 3LVRE 3E33A 3ENEA 1HG5A 1TN8A 3VLDA 3CVPA 4GTQA 2FBNA 3TWVA 4WUYA 3AS5A 5EILA 2NYJA 4GYOA 4DPRA 3E32A 2GRQB 3FUDA 1N52A 1OCOE 4UWFA 4L23A 2KCVA 1IQRA 3SO8A 3T9KA 3L22A 3KD7A 1H19A 4FJZA 2L0IA 3Q49B 5EIBE 2DIWA 3E37A 3QNKA 2XHEA 3FWVA 3QDNA 1VDYA 3LYAA 1D9SA 4M7CA 2E0IA 3DSTA 1WY6A 4N2QA 4C0EA 4FULA 1UG3A 1TJFA 3D9MA 3CV0A 3JUEA 1N4SA 2VQ2A 4LG6A 3B7BA 3HIZA 4K5BA 3TXMA 2M63A 3HDXA 3MV2B 3ZHEB 3EJNA 4JXTA 4PS8A 2Y1LE 3IV0A 3NOCD 4BERA 4RLYA 1D8EA 4CDRA 1N95A 2H6IA 1SA4A 4EZLA 5EYLA 4NQ0A 4AXHA 3FU3A 3Q7FA 3JCKC 5LOZA 2C0LA 2LO6A 3CVNA 3R9MA 4ZHBA 2GROB 4JA7A 2B0OE 4G24A 2YHEA 1OWOA 3L17A 3ESKA 4FADA 3FH8A 1LD7A 2LXMA 3SHFA 3B7TA 3SQVA 4JA9A 4AP2A 4CDMA 3D9IA 2VGXA 2LAHA 4CDNA 3ASDA 3FTVA 4EZJA 4ATZD 1TEZA 3I5PA 3UQ3A 3I4RB 4HNAD 3E30A 2EIKE 4UWLA 3FUMA 4U7EB 2OCCE 2HYZA 4D10C 1E8YA 4TV3A 4PDXA 3IBEA 4N39A 2KM4A 2YINA 3CHRA 2V5QC 3CHSA 4GPMA 3TWSA 1XNFA 3ZIMA 5C2YA 4BT8A 5ENNA 3UIOC 3BU8A 4L2LA 4K5CA 5BV1A 3D9JA 4Y6WA 5AQ9A 1N4RA 2QYUA 3ZXPA 1SZ9A 1XGWA 5FINA 3ZFWA 2X6FA 4CT0A 4A3VA 2J8SD 5ENOD 5D66A 2VGXB 5FZSA 5BV0A 1N0QA 4E85A 4CGVA 5T3RA 1KZPA 4ACLA 2Y0BG 3IHVA 3C3RA 1SA5A 3C3QA 4GZ3A 4I2WA 5G2NA 2XS1A 3BG0B 3LEWA 1S0PA 2P9LG 2VGYA 3PE4A 3L13A 5AAOA 2I9CA 4U07A 4F1SA 4DI4A 1MQSA 3T8KA 3NF1A 3HRAA 4YVQC 4U0UA 5FTPA 1Z3YA 3QARA 1AP7A 3SZ7A 5LCWJ 3RAUA 4Z68A 3HVEB 1DVPA 2R5SA 2MOWA 3BUAA 4U8YD 4BSZB 4A1SA 4NURA 2EIJE 4AIFA 4A55A 4O60A 2P9SG 2XRYA 3EIQC 2DCPA 3QWVA 5EIDA 2V4HC 4FJYA 3D9OA 4HRNA 2GRPB 4O6FA 2HO1A 3L6AA 2OVFA 4W9RA 4I6GA 3RO2A 3CHOA 3RRUA 2LSVA 3G2VA 3G2WA 2FULA 4PUCA 1H2TC 3O4ZA 1O1SA 2WXPA 3FULA 3JUIA 3KEAA 2WXHA 2C2LA 2F0YA 3PS6A 1H6KA 4KMOA 4XEIG 1JWFA 2R59A 3CVLA 2X6HA 4BFRA 3FEYA 3EHQA 4N5CA 1MX2A 3CHQA 2MYOA 2CG2A 3K9IA 2WXLA 3ULQA 4FP7A 2P9IG 1HZ4A 3PE3A 4F6RD 3FUIA 3CQCB 4KZCA 3DSUA 2UWJG 4EZKA 3SNXA 2GRMA 1YMPA 3PEUB 2KCKA 3IKOB 3P2BA 2WPVA 2XPZA 3MZLB 4WNDA 3BG1B 2VGEA 4U0ZA 3FY4A 2QFCA 4KT6B 4NRHB 4HOTA 4XIFA 4B89A 3CQGB 2X6JA 1TN7A 2DZOA 1BU9A 1E8XA 4WNEA 3FTZA 4DJAA 5CCMA 2PL2A 1FCHA 2LNIA 3AU5A 3HXDA 3Q7AA 3CVVA 5CMYA 4HOSA 3AAAC 1H0AA 4FU3A 4GTSA 2I1JA 3QC1A 3ZKJA 3Q75A 4LNBA 1UN9A 1NL4A 3PVLA 1E96B 1H2VC 3V2OA 5CCLA 2ZXWE 3FHEA 2FI7A 4LNGA 1UOHA 2WXIA 4UI9J 3FU0A 2P9KG 3U9WA 1TJCA 4QFVA 1KT1A 4U8VD 3RK6A 2OEWA 1DCEA 3O48A 4I2ZA 1K1BA 3RJVA 2OEVA 1YYHA 3T5XA 2H6GA 3D9NA 3UKUG 2YHCA 5G05C 4EECA 1ELWA 2H6HA 2VJ8A 4BY6A 1QBQA 2NSZA 2AVPA 4LRZA 2ZIRA 3C72A 5ENTD 1MYOA 4ANXA 3ASHA 2ZGDA 3DSXA 1S70B 3CGHA 3WG7E 3HG0D 3VTXA 2KATA 3RKVA 5FQ7A 5AQBA 1MJ0A 4J8DA 2WQ7A 3GYZA 4OAUC 5C1DA 3U4TA 4G11A 4DRXE 1NA3A 2P2CP 3QOUA 3DXKG 2I6HA 3UINC 3LPZA 4GTMA 3UM3A 4KVOA 3RRMB 2IY0C 3LY7A 1Z3XA 4ZFHA 3TWTA 1U3CA 2WXOA 1X81A 1TNOA 4LERA 3RSEG 2YQ8A 3UTMA 2J4DA 4UI9C 4TRQA 4AV7A 3V79K 2FO1E 2WXNA 2PM7A 3OXGA 3MA5A 3KSLA 5HKPA 4CGWA 1Z5SC 3CKBA 3AS8A 2KXPC 4UI9K 4XKCA 4M3OA 2J49A 4HLEA 3LCAA 2DVWA 1TNZA 2WXKA 1N0RA 3V31A 3EHMA 5D2MC 5G05J 2IU1A 3EHNA 3HHMA 4K5AB 1IQUA 5EYPF 1DNPA 3DEOA 3C98A 4DLOA 1FVFA 2R02A 3URZA 4FC8A 4ILIA 4A1GA 4ANWA 3HVEA 1ZB1A 4JHRA 4LSZE 3TWRA 5FZQA 3LJNA 3B13A 4L2YA 4AEZC 4J6IA 3IEGA 4U95D 5AARA 5E75A 3ZRHA 4J8SA 2HR2A 3PNTB 4HFGA 3APFA 2HE0A 3AS4A 1JCSA 4PS3A 3LXUX 3Q9NC 2AXUA 5HQ8A 3LY8A 1TYQG 2XS8A 4GCNA 1H2UA 2P58C 2EIME 3OTNA 2BKKB 3KSQA 3V30A 4J8EA 1IHGA 4HBDA 5AQAA 2AWIA 2XQ0A 2RFAA 2IO3C 2PM6A 1NA0A 5EKQD 5KBAA 2X3MA 1G3NB 1OCRE 1IHBA 2IOSA 5AYWD 4R7LA 4GA2A 4HI9A 1ELRA 3P1UA 1UJKA 4UQXA 4JEHA 3C5RA 2GRLA 5D0QD 4ILHB 2IEJA 4BEPA 1PY1A 4I6EA 4Q96A 2DYRE 4A63B 5BNWA 2L6JA 3J5PA 2WXRA 1ZU2A 3TL5A 4EBAA 3SGHA 3DPYA 4GB9A 4HQDA 1FVHA 1FT2A 4ANUA 3L54A 1INZA 2IJGX 2CHWA 3DBSA 5FQ6A 2IF4A 4K03A 3ZYMA 3SFYA 3TXNA 1U2VG 4N3BA 4DLQA 2R03A 4LCTA 3FUEA 3Q47B 2Y69E 3ONKA 3MGBA 5CERB 3ASOE 2L0TB 2XEEA 4WWNA 5E76A 4I1MA 3QWWA 3Q79A 5A6CA 1QNFA 4JD2G 3HXCA 4A3TA 3PREA 4OVVA 3ZVVA 1K8KG 2PNNA 4L1BA 3APCA 5BT1A 4PH4B 3VLFA 2IQCA 3ZHEA 1HH8A 5FWQA 2RG8A 4U63A 4GZDA 3UT8A 4ACKA 4I43A 3LS8A 3S7BA 3QKYA 3CVQA 3FTWA 2J08A 4UQZA 4O1PA 3SD5A 2I1KA 1U3DA 1EF1C 2CG3A 1SVXA 1RW2A 4U04A 2AW6A 5KNGA 5B3SE 2KCLA 4IRUA 3PNLB 4BSXA 4FA6A 4GMLA 3ZNGA 2V4LA 4I9CA 1P5QA 4N3CA 2XGSA 1JUQA 3ML9A 1LF8A 3X2QE 5AENA 1GW6A 3AG4E 1OCZE 4GYYA 3QK0A 3TG4A 4WNGA 3Q78A 3CHPA 2LXLA 1NP7A 5KNHD 3CK9A 5EN5D 2R05A 4I17A 4I9EA 1OT8A 2DWZA 1OXJA 2WMNA 4HORA 4HI8A 4AOFA 4OVUA 3NQPA 5BUZA 1QZ2A 2QC9A 3CK7A 4GTVA 1V55E 1BD8A 2WVIA 4C0MA 5T4YA 3BQOA 1JCQA 4NIKA 5KJNA 2WQ6A 3JXIA 4JZYA 4GTOA 1WAO1 2BF0X 3KAEA 3G2TA 1AWCB 3ASNE 2R17C 4K0RA 5DBKA 3U64A 4G25A 5JHAA 2EQXA 4GMRA 3UM0A 4GCOA 3SF4A 4J8FA 1N11A 3TAXA 4GTPA 3PZ1A 5IY5E 4GPKA 2GRNB 5FQ8A 3B7SA 3CHMA 3ONLA 1UW4B 1HU3A 2FO7A 4DX2A 1WG0A 3IHYA 5EX3A 5ENRD 3HYMB 4HLLA 1NFIE 3TG5A 3ZEFA 3D9HA 2KZTA 3J5QB 4IYPA 4U96D 5ARFA 3AG1E 1OCCE 4FHKA 3B95A 4XX5A 4EBAG 3ABLE 4J7WA 2PQRA 3LJ3A 3JXJA 5A23A 3ZGQA 3Q9UC 1A17A 2CHZA 4DX6D 3IXEA 1PAQA 4YDOA 4RQIA 4C9BB 4GMJA 2WXFA 2MRIA 1O1RA 2KC7A 4IN3B 2AXVA 1Q2ZA 1HX8A 4BETA 3R7QA 3S7DA 2XPYA 3ZYQA 2J07A 3UM1A 5JJTA 4FLHA 1OY3D 5BXOA 3CSFA 3LDZA 2VTBA 1TN6A 4HXIA 1SW6A 4AM9A 4I6JA 5CBNA 2OOEA 1W3BA 3C3OA 3B7UX 1O5MA 3PRZA 2ZU6B 5AJDA 5HI7A 2JEKA 4DX5D 4MKTA 4APOA 5FIOA 1HO8A 4HOQA 3UT7A 1QYMA 3UMVA 1KT0A 2C0MA 3CKCA 2V0PA 5LCWC 2I2OA 2JLBA 4U0SA 4GYWA 3ZW3A 3APDA 3PZDA 3TJPA 3GZ2A 2XGOA 3I4GA 2LAIA 3ZU7B 5ARGA 4U8HA 2WM9A 3RO3A 5A7DB 1MZCA 4GZCA 5KWDA 1N9AA 4GA1A 3R9AB 3RRNB 4XI0A 5HRYA 4V3IA 4GU5A 5M72A 3AU4A 3FU5A 4BX9A 4I1OB 3FTSA 1UN8A 2DBAA 5KJLA 3JYSA 3F6QA 3FH5A 4B94A 4GAAA 3PUKA 3QJZA 2YNQA 1RZ4A 4QQIA 3VTYA 4CEMA 4WAFA 5CRVA 3CR3A 4HRLA 2NXPA 4BX8A 2R2LA 3SFXA 3ESLA 5B1BE 4URKA 3MV3B 4B0ZA 3W9GA 1JCRA 2ILRA 2VSNA 3HXFA 4AY6A 4AJWA 2E2EA 1JWGA 3ASGA 3QWPA 4FHJA 3TGOA 2IOLA 3GZ1A 4DX1A 1ZBPA 5G04J 1WM5A 2OV8A 5AQ7A 4WWOA 4LNUD 5FQ4A 2VYIA 3UM2A 1LD8A 4TXQA 4X8QA 3EHRA 3GW4A 1N94A 2KZTB 3NZUA 5G55A 4EHMA 2ZGGA 3TWUA 2UY1A 2V5FA 3ZYKA 3RU0A 5BXUA 3DPDA 4H7YA 4ABNA 5FZRA 1IXVA 2RKKA 4UUCA 5JA4D 4JW1A 4CT4A 2LSUA 1BI7B 3VLEA 4MBGA 2EILE 5AJLA 5AN8A 4G8KA 3DEPA 3CIAA 5T8IA 3EIJA 1X5BA 2WXGA 5BPPA 4DUIA 3OAWA 1MX6A 3L82A 4Y6CA 4DI3A 3ABKE 4WWPA 3D9LA 2X38A 5CBOA 3CEQA 4AY5A 4B93B 5ENQD 5ENSD 1SZAA 3FUHA 3MCXA 2F8XK 3UXGA 3ISMC 3EU5A 2WB2A 3FUNA 3UIPC 2OVBA 1NI1A 2XENA 1YA0A 3PZ2A 2WXJA 3OXLA 1LTXA 4AVXA 4I1AA 1KPSB 2IFUA 4GZ5A 4HVBA 3FU6A 3FTUA 2XEHA 3NBNB 2WXMA 3S7FA 5FJYA 1OWLA 2DZNA 4CZ2D 3DRAA 2RFMA 3EUVA 1BPOA 1KZOA 3ML8A 2F8YA 3Q73A 4HOUA 3Q15A 3HXEA 2VSOE 2AXZA 2XZTG 5JHBA 4XI9A 1V54E 1D8DA 3RIBA 4XZ4A 3E34A 2XPIA 3G2SA 2IONA 2L9BA 3BEEA 3CVUA 4MS6A 4UWHA 1H6OA 1KLXA 4PS7A 2GW1A 3V2XA 4L7TA 3ULYA 1DCQA 2BTDA 2FF4A 4J0UA 2PZIA 4C48B 4XE0A 4ANVA 4JL0A 4MLPA 5FT9A 5LP0A 3DWLG 2P9UG 3MJWA 3T5VA 3NOGD 1S64A 1MX4A 5CEDB 3MKQA 4TUUA 1O1TA 4XKBA 1Y8MA 3GZSA 3NZSA 1N4PA 1L5JA 3HXBA 3UX4A 3FFLA 4KBQA 4UQYA 4G23A 4OYSA 2J09A 5LX8A 2VSXE 3OXFA 2XZDG 3I3NA 4F3VA 2QY7A 5ENPD 1E7UA 5JJ6A 3UPVA 2UY1B 5LFAA 4L9PA 1QQEA 5CHEE 3S2AA 3Q4AB 2J4BA 4HRMB 4RG9A 2J9QA 5J08A 1NZNA 1BLXB 3CK8A 1TNYA 4KXKB 3KS2A 4FLBA 1DC2A 1HE8A 2GGFA 3EU9A 4ILGA 1N54A 1FT1A 5KJMA 4GA0A 3FUJA 3KEZA 3ZPJA 1HFAA 4EPZA 3SBTB 3JQ1A 4N3AA 2H6FA 3MKRA 1HF8A 4YDYA 4JEUA 3E4BA 2HM8A 2F37A 4GZ6A 3L9TA 2GRRB 1PC2A 4B8CB 2Y4UA 3DSVA 4G8LA 3SI5A 3U3WA 2EINE 3DSSA 4TXPA 4APFA 5CEAA 4RG6A 3DXMG 1IKND 4JHJA 2VTBB 4J8YA 2A5EA 5JMND 3T8MA 2FEZA 2PQNA 2ETAA 1E90A 2ETBA 3G2UA 3CLJA 5D0OD 4UWKA 2ZISA 1UJJA 2WXQA 5AIJA 1K3ZD 3FEXA 1IYGA 4P29A 3ZN3A 3SBSA 4NACA 5KCMA 1TR4A 2CFUA 4G26A 1Y6IA 5BW8C 3JQ0A 2IO2C 4KYOB 5CECB 3FP3A 4TXRA 1N4QA 1TNBA 4CCAA 5H7PA 3WXXA 3QB2A 2CHXA 1EYHA 2P9PG 2VSYA 2Y3AA 3D9PA 4N5QA 1OWMA 1YCSB 3ASFA 4F53A 5EDSA 4GTTA 5DIZA 1BI8B 1A5EA 2KBXA
chains in the Genus database with same CATH topology
3C72A 1TN8A 1FT1A 4GTQA 1JCRA 3E30A 3DSUA 3HXFA 3PZ3A 3DSXA 3E32A 1S63A 2H6FA 3PZ4A 3SFYA 3EU5A 3Q78A 1TNUA 1S64A 1NI1A 3E37A 1TN7A 3DSVA 4GTMA 3PZ2A 3DSSA 4GTRA 1LTXA 1LD8A 1O1TA 3DSTA 1JCSA 1MZCA 1N4PA 3HXBA 4YDOA 3Q79A 3HXDA 1N94A 3Q7AA 1N4SA 1N4RA 1N9AA 1TNOA 1X81A 3HXCA 4GTVA 4EHMA 4GTSA 3KSQA 2ZISA 1O1RA 1JCQA 3Q75A 4YDEA 3DRAA 3EUVA 4LNBA 1KZOA 1NL4A 1O1SA 1D8EA 3KSLA 1N95A 2H6IA 4GTOA 1SA4A 1KZPA 2BEDA 3Q73A 4MBGA 2F0YA 3HXEA 3Q7FA 4LNGA 4L9PA 1TNZA 1SA5A 1TN6A 1D8DA 1DCEA 1N4QA 1TNBA 2IEJA 3E34A 4GTPA 2H6GA 3PZ1A 1LD7A 1FPPA 1O5MA 1TNYA 3DSWA 3DPYA 2H6HA 4GTTA 1QBQA 1FT2A 2R2LA 3SFXA 3E33A 2ZIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C72 A;  1TN8 A;  1FT1 A;  4GTQ A;  1JCR A;  3E30 A;  3DSU A;  3HXF A;  3PZ3 A;  3DSX A;  3E32 A;  1S63 A;  2H6F A;  3PZ4 A;  3SFY A;  3EU5 A;  3Q78 A;  1TNU A;  1S64 A;  1NI1 A;  3E37 A;  1TN7 A;  3DSV A;  4GTM A;  3PZ2 A;  3DSS A;  4GTR A;  1LTX A;  1LD8 A;  1O1T A;  3DST A;  1JCS A;  1MZC A;  1N4P A;  3HXB A;  4YDO A;  3Q79 A;  3HXD A;  1N94 A;  3Q7A A;  1N4S A;  1N4R A;  1N9A A;  1TNO A;  1X81 A;  3HXC A;  4GTV A;  4EHM A;  4GTS A;  3KSQ A;  2ZIS A;  1O1R A;  1JCQ A;  3Q75 A;  4YDE A;  3DRA A;  3EUV A;  4LNB A;  1KZO A;  1NL4 A;  1O1S A;  1D8E A;  3KSL A;  1N95 A;  2H6I A;  4GTO A;  1SA4 A;  1KZP A;  2BED A;  3Q73 A;  4MBG A;  2F0Y A;  3HXE A;  3Q7F A;  4LNG A;  4L9P A;  1TNZ A;  1SA5 A;  1TN6 A;  1D8D A;  1DCE A;  1N4Q A;  1TNB A;  2IEJ A;  3E34 A;  4GTP A;  2H6G A;  3PZ1 A;  1LD7 A;  1FPP A;  1O5M A;  1TNY A;  3DSW A;  3DPY A;  2H6H A;  4GTT A;  1QBQ A;  1FT2 A;  2R2L A;  3SFX A;  3E33 A;  2ZIR A; 
#chains in the Genus database with same CATH topology
 2BUG A;  3EDT B;  3FTX A;  3LVQ E;  3CST A;  4IUL A;  2JAB A;  3W9F A;  5EX0 A;  1HG2 A;  3PZ3 A;  4BTA A;  3PZ4 A;  5CMW A;  3Q5M A;  1K1A A;  3FUK A;  2QZA A;  3ULE G;  2XCC A;  4H7X A;  5CRU A;  4LUN U;  3NAW A;  4E6H A;  2MHK A;  1H6P A;  4GTR A;  5B1A E;  3ZYL A;  4EQF A;  4YDW A;  1HXI A;  4UWG A;  4G1T A;  3L16 A;  1WDY A;  3CVX A;  2V8S E;  4ME2 A;  1E8W A;  3TWX A;  2X6I A;  1OWN A;  3AJI A;  3MKQ B;  4HS2 A;  4BWR A;  3AG3 E;  2BKG A;  1EDU A;  5G04 C;  4YDE A;  1HS6 A;  3MYV A;  4CRW A;  5ITZ F;  4KVM A;  3UT4 A;  2XRZ A;  2QYJ A;  3TWQ A;  3FH7 A;  3ABM E;  2CFZ A;  3PH0 C;  3MX3 A;  3PDN A;  1E7V A;  3L08 A;  2Q7F A;  4YVO A;  1Z6T A;  4N2S A;  3LY9 A;  3D3M A;  4WNF A;  4BTB A;  1FPP A;  2LUH A;  3NB2 A;  4KZ0 A;  3SFZ A;  3AG2 E;  4G2V A;  2XEV A;  2B6C A;  2NC9 A;  1ELK A;  2RD0 A;  1MHQ A;  2P9N G;  4ATG A;  4LEU A;  5J90 A;  4TUM A;  1S63 A;  2XGM A;  2L6B A;  1OWP A;  3QAQ A;  4F1P A;  4Q69 A;  4RSY A;  3PUJ A;  3N71 A;  1TNU A;  4BT9 A;  3R7R A;  3LKU A;  2WQH A;  4MRU A;  2Y4T A;  4DX7 D;  5HS0 A;  2WMO A;  3SY2 A;  4JB8 P;  3D9K A;  3ZXS A;  3UUX A;  1B89 A;  3UKR G;  3TWW A;  4CYM D;  3CVY A;  1OUV A;  4B8A A;  4DK5 A;  5JJ7 A;  3MEK A;  1EPU A;  5ANL A;  2BED A;  2OND A;  4JPS A;  3CVW A;  1SQM A;  4BES A;  2DYS E;  2A4Z A;  4O1O A;  2X6K A;  3B7R L;  4RVB A;  5ANR A;  4YND A;  2A5U A;  2XCB A;  5KJK A;  4F7A A;  4HB5 A;  2ETC A;  3U66 A;  2AJA A;  3FTY A;  3PEV B;  4JC8 A;  3FDH A;  3DSW A;  3FUF A;  1JPL A;  3S7J A;  4JVS A;  3UI2 A;  1E8Z A;  4Q94 A;  4JHK A;  3ZUV B;  4OAV B;  3LVR E;  3E33 A;  3ENE A;  1HG5 A;  1TN8 A;  3VLD A;  3CVP A;  4GTQ A;  2FBN A;  3TWV A;  4WUY A;  3AS5 A;  5EIL A;  2NYJ A;  4GYO A;  4DPR A;  3E32 A;  2GRQ B;  3FUD A;  1N52 A;  1OCO E;  4UWF A;  4L23 A;  2KCV A;  1IQR A;  3SO8 A;  3T9K A;  3L22 A;  3KD7 A;  1H19 A;  4FJZ A;  2L0I A;  3Q49 B;  5EIB E;  2DIW A;  3E37 A;  3QNK A;  2XHE A;  3FWV A;  3QDN A;  1VDY A;  3LYA A;  1D9S A;  4M7C A;  2E0I A;  3DST A;  1WY6 A;  4N2Q A;  4C0E A;  4FUL A;  1UG3 A;  1TJF A;  3D9M A;  3CV0 A;  3JUE A;  1N4S A;  2VQ2 A;  4LG6 A;  3B7B A;  3HIZ A;  4K5B A;  3TXM A;  2M63 A;  3HDX A;  3MV2 B;  3ZHE B;  3EJN A;  4JXT A;  4PS8 A;  2Y1L E;  3IV0 A;  3NOC D;  4BER A;  4RLY A;  1D8E A;  4CDR A;  1N95 A;  2H6I A;  1SA4 A;  4EZL A;  5EYL A;  4NQ0 A;  4AXH A;  3FU3 A;  3Q7F A;  3JCK C;  5LOZ A;  2C0L A;  2LO6 A;  3CVN A;  3R9M A;  4ZHB A;  2GRO B;  4JA7 A;  2B0O E;  4G24 A;  2YHE A;  1OWO A;  3L17 A;  3ESK A;  4FAD A;  3FH8 A;  1LD7 A;  2LXM A;  3SHF A;  3B7T A;  3SQV A;  4JA9 A;  4AP2 A;  4CDM A;  3D9I A;  2VGX A;  2LAH A;  4CDN A;  3ASD A;  3FTV A;  4EZJ A;  4ATZ D;  1TEZ A;  3I5P A;  3UQ3 A;  3I4R B;  4HNA D;  3E30 A;  2EIK E;  4UWL A;  3FUM A;  4U7E B;  2OCC E;  2HYZ A;  4D10 C;  1E8Y A;  4TV3 A;  4PDX A;  3IBE A;  4N39 A;  2KM4 A;  2YIN A;  3CHR A;  2V5Q C;  3CHS A;  4GPM A;  3TWS A;  1XNF A;  3ZIM A;  5C2Y A;  4BT8 A;  5ENN A;  3UIO C;  3BU8 A;  4L2L A;  4K5C A;  5BV1 A;  3D9J A;  4Y6W A;  5AQ9 A;  1N4R A;  2QYU A;  3ZXP A;  1SZ9 A;  1XGW A;  5FIN A;  3ZFW A;  2X6F A;  4CT0 A;  4A3V A;  2J8S D;  5ENO D;  5D66 A;  2VGX B;  5FZS A;  5BV0 A;  1N0Q A;  4E85 A;  4CGV A;  5T3R A;  1KZP A;  4ACL A;  2Y0B G;  3IHV A;  3C3R A;  1SA5 A;  3C3Q A;  4GZ3 A;  4I2W A;  5G2N A;  2XS1 A;  3BG0 B;  3LEW A;  1S0P A;  2P9L G;  2VGY A;  3PE4 A;  3L13 A;  5AAO A;  2I9C A;  4U07 A;  4F1S A;  4DI4 A;  1MQS A;  3T8K A;  3NF1 A;  3HRA A;  4YVQ C;  4U0U A;  5FTP A;  1Z3Y A;  3QAR A;  1AP7 A;  3SZ7 A;  5LCW J;  3RAU A;  4Z68 A;  3HVE B;  1DVP A;  2R5S A;  2MOW A;  3BUA A;  4U8Y D;  4BSZ B;  4A1S A;  4NUR A;  2EIJ E;  4AIF A;  4A55 A;  4O60 A;  2P9S G;  2XRY A;  3EIQ C;  2DCP A;  3QWV A;  5EID A;  2V4H C;  4FJY A;  3D9O A;  4HRN A;  2GRP B;  4O6F A;  2HO1 A;  3L6A A;  2OVF A;  4W9R A;  4I6G A;  3RO2 A;  3CHO A;  3RRU A;  2LSV A;  3G2V A;  3G2W A;  2FUL A;  4PUC A;  1H2T C;  3O4Z A;  1O1S A;  2WXP A;  3FUL A;  3JUI A;  3KEA A;  2WXH A;  2C2L A;  2F0Y A;  3PS6 A;  1H6K A;  4KMO A;  4XEI G;  1JWF A;  2R59 A;  3CVL A;  2X6H A;  4BFR A;  3FEY A;  3EHQ A;  4N5C A;  1MX2 A;  3CHQ A;  2MYO A;  2CG2 A;  3K9I A;  2WXL A;  3ULQ A;  4FP7 A;  2P9I G;  1HZ4 A;  3PE3 A;  4F6R D;  3FUI A;  3CQC B;  4KZC A;  3DSU A;  2UWJ G;  4EZK A;  3SNX A;  2GRM A;  1YMP A;  3PEU B;  2KCK A;  3IKO B;  3P2B A;  2WPV A;  2XPZ A;  3MZL B;  4WND A;  3BG1 B;  2VGE A;  4U0Z A;  3FY4 A;  2QFC A;  4KT6 B;  4NRH B;  4HOT A;  4XIF A;  4B89 A;  3CQG B;  2X6J A;  1TN7 A;  2DZO A;  1BU9 A;  1E8X A;  4WNE A;  3FTZ A;  4DJA A;  5CCM A;  2PL2 A;  1FCH A;  2LNI A;  3AU5 A;  3HXD A;  3Q7A A;  3CVV A;  5CMY A;  4HOS A;  3AAA C;  1H0A A;  4FU3 A;  4GTS A;  2I1J A;  3QC1 A;  3ZKJ A;  3Q75 A;  4LNB A;  1UN9 A;  1NL4 A;  3PVL A;  1E96 B;  1H2V C;  3V2O A;  5CCL A;  2ZXW E;  3FHE A;  2FI7 A;  4LNG A;  1UOH A;  2WXI A;  4UI9 J;  3FU0 A;  2P9K G;  3U9W A;  1TJC A;  4QFV A;  1KT1 A;  4U8V D;  3RK6 A;  2OEW A;  1DCE A;  3O48 A;  4I2Z A;  1K1B A;  3RJV A;  2OEV A;  1YYH A;  3T5X A;  2H6G A;  3D9N A;  3UKU G;  2YHC A;  5G05 C;  4EEC A;  1ELW A;  2H6H A;  2VJ8 A;  4BY6 A;  1QBQ A;  2NSZ A;  2AVP A;  4LRZ A;  2ZIR A;  3C72 A;  5ENT D;  1MYO A;  4ANX A;  3ASH A;  2ZGD A;  3DSX A;  1S70 B;  3CGH A;  3WG7 E;  3HG0 D;  3VTX A;  2KAT A;  3RKV A;  5FQ7 A;  5AQB A;  1MJ0 A;  4J8D A;  2WQ7 A;  3GYZ A;  4OAU C;  5C1D A;  3U4T A;  4G11 A;  4DRX E;  1NA3 A;  2P2C P;  3QOU A;  3DXK G;  2I6H A;  3UIN C;  3LPZ A;  4GTM A;  3UM3 A;  4KVO A;  3RRM B;  2IY0 C;  3LY7 A;  1Z3X A;  4ZFH A;  3TWT A;  1U3C A;  2WXO A;  1X81 A;  1TNO A;  4LER A;  3RSE G;  2YQ8 A;  3UTM A;  2J4D A;  4UI9 C;  4TRQ A;  4AV7 A;  3V79 K;  2FO1 E;  2WXN A;  2PM7 A;  3OXG A;  3MA5 A;  3KSL A;  5HKP A;  4CGW A;  1Z5S C;  3CKB A;  3AS8 A;  2KXP C;  4UI9 K;  4XKC A;  4M3O A;  2J49 A;  4HLE A;  3LCA A;  2DVW A;  1TNZ A;  2WXK A;  1N0R A;  3V31 A;  3EHM A;  5D2M C;  5G05 J;  2IU1 A;  3EHN A;  3HHM A;  4K5A B;  1IQU A;  5EYP F;  1DNP A;  3DEO A;  3C98 A;  4DLO A;  1FVF A;  2R02 A;  3URZ A;  4FC8 A;  4ILI A;  4A1G A;  4ANW A;  3HVE A;  1ZB1 A;  4JHR A;  4LSZ E;  3TWR A;  5FZQ A;  3LJN A;  3B13 A;  4L2Y A;  4AEZ C;  4J6I A;  3IEG A;  4U95 D;  5AAR A;  5E75 A;  3ZRH A;  4J8S A;  2HR2 A;  3PNT B;  4HFG A;  3APF A;  2HE0 A;  3AS4 A;  1JCS A;  4PS3 A;  3LXU X;  3Q9N C;  2AXU A;  5HQ8 A;  3LY8 A;  1TYQ G;  2XS8 A;  4GCN A;  1H2U A;  2P58 C;  2EIM E;  3OTN A;  2BKK B;  3KSQ A;  3V30 A;  4J8E A;  1IHG A;  4HBD A;  5AQA A;  2AWI A;  2XQ0 A;  2RFA A;  2IO3 C;  2PM6 A;  1NA0 A;  5EKQ D;  5KBA A;  2X3M A;  1G3N B;  1OCR E;  1IHB A;  2IOS A;  5AYW D;  4R7L A;  4GA2 A;  4HI9 A;  1ELR A;  3P1U A;  1UJK A;  4UQX A;  4JEH A;  3C5R A;  2GRL A;  5D0Q D;  4ILH B;  2IEJ A;  4BEP A;  1PY1 A;  4I6E A;  4Q96 A;  2DYR E;  4A63 B;  5BNW A;  2L6J A;  3J5P A;  2WXR A;  1ZU2 A;  3TL5 A;  4EBA A;  3SGH A;  3DPY A;  4GB9 A;  4HQD A;  1FVH A;  1FT2 A;  4ANU A;  3L54 A;  1INZ A;  2IJG X;  2CHW A;  3DBS A;  5FQ6 A;  2IF4 A;  4K03 A;  3ZYM A;  3SFY A;  3TXN A;  1U2V G;  4N3B A;  4DLQ A;  2R03 A;  4LCT A;  3FUE A;  3Q47 B;  2Y69 E;  3ONK A;  3MGB A;  5CER B;  3ASO E;  2L0T B;  2XEE A;  4WWN A;  5E76 A;  4I1M A;  3QWW A;  3Q79 A;  5A6C A;  1QNF A;  4JD2 G;  3HXC A;  4A3T A;  3PRE A;  4OVV A;  3ZVV A;  1K8K G;  2PNN A;  4L1B A;  3APC A;  5BT1 A;  4PH4 B;  3VLF A;  2IQC A;  3ZHE A;  1HH8 A;  5FWQ A;  2RG8 A;  4U63 A;  4GZD A;  3UT8 A;  4ACK A;  4I43 A;  3LS8 A;  3S7B A;  3QKY A;  3CVQ A;  3FTW A;  2J08 A;  4UQZ A;  4O1P A;  3SD5 A;  2I1K A;  1U3D A;  1EF1 C;  2CG3 A;  1SVX A;  1RW2 A;  4U04 A;  2AW6 A;  5KNG A;  5B3S E;  2KCL A;  4IRU A;  3PNL B;  4BSX A;  4FA6 A;  4GML A;  3ZNG A;  2V4L A;  4I9C A;  1P5Q A;  4N3C A;  2XGS A;  1JUQ A;  3ML9 A;  1LF8 A;  3X2Q E;  5AEN A;  1GW6 A;  3AG4 E;  1OCZ E;  4GYY A;  3QK0 A;  3TG4 A;  4WNG A;  3Q78 A;  3CHP A;  2LXL A;  1NP7 A;  5KNH D;  3CK9 A;  5EN5 D;  2R05 A;  4I17 A;  4I9E A;  1OT8 A;  2DWZ A;  1OXJ A;  2WMN A;  4HOR A;  4HI8 A;  4AOF A;  4OVU A;  3NQP A;  5BUZ A;  1QZ2 A;  2QC9 A;  3CK7 A;  4GTV A;  1V55 E;  1BD8 A;  2WVI A;  4C0M A;  5T4Y A;  3BQO A;  1JCQ A;  4NIK A;  5KJN A;  2WQ6 A;  3JXI A;  4JZY A;  4GTO A;  1WAO 1;  2BF0 X;  3KAE A;  3G2T A;  1AWC B;  3ASN E;  2R17 C;  4K0R A;  5DBK A;  3U64 A;  4G25 A;  5JHA A;  2EQX A;  4GMR A;  3UM0 A;  4GCO A;  3SF4 A;  4J8F A;  1N11 A;  3TAX A;  4GTP A;  3PZ1 A;  5IY5 E;  4GPK A;  2GRN B;  5FQ8 A;  3B7S A;  3CHM A;  3ONL A;  1UW4 B;  1HU3 A;  2FO7 A;  4DX2 A;  1WG0 A;  3IHY A;  5EX3 A;  5ENR D;  3HYM B;  4HLL A;  1NFI E;  3TG5 A;  3ZEF A;  3D9H A;  2KZT A;  3J5Q B;  4IYP A;  4U96 D;  5ARF A;  3AG1 E;  1OCC E;  4FHK A;  3B95 A;  4XX5 A;  4EBA G;  3ABL E;  4J7W A;  2PQR A;  3LJ3 A;  3JXJ A;  5A23 A;  3ZGQ A;  3Q9U C;  1A17 A;  2CHZ A;  4DX6 D;  3IXE A;  1PAQ A;  4YDO A;  4RQI A;  4C9B B;  4GMJ A;  2WXF A;  2MRI A;  1O1R A;  2KC7 A;  4IN3 B;  2AXV A;  1Q2Z A;  1HX8 A;  4BET A;  3R7Q A;  3S7D A;  2XPY A;  3ZYQ A;  2J07 A;  3UM1 A;  5JJT A;  4FLH A;  1OY3 D;  5BXO A;  3CSF A;  3LDZ A;  2VTB A;  1TN6 A;  4HXI A;  1SW6 A;  4AM9 A;  4I6J A;  5CBN A;  2OOE A;  1W3B A;  3C3O A;  3B7U X;  1O5M A;  3PRZ A;  2ZU6 B;  5AJD A;  5HI7 A;  2JEK A;  4DX5 D;  4MKT A;  4APO A;  5FIO A;  1HO8 A;  4HOQ A;  3UT7 A;  1QYM A;  3UMV A;  1KT0 A;  2C0M A;  3CKC A;  2V0P A;  5LCW C;  2I2O A;  2JLB A;  4U0S A;  4GYW A;  3ZW3 A;  3APD A;  3PZD A;  3TJP A;  3GZ2 A;  2XGO A;  3I4G A;  2LAI A;  3ZU7 B;  5ARG A;  4U8H A;  2WM9 A;  3RO3 A;  5A7D B;  1MZC A;  4GZC A;  5KWD A;  1N9A A;  4GA1 A;  3R9A B;  3RRN B;  4XI0 A;  5HRY A;  4V3I A;  4GU5 A;  5M72 A;  3AU4 A;  3FU5 A;  4BX9 A;  4I1O B;  3FTS A;  1UN8 A;  2DBA A;  5KJL A;  3JYS A;  3F6Q A;  3FH5 A;  4B94 A;  4GAA A;  3PUK A;  3QJZ A;  2YNQ A;  1RZ4 A;  4QQI A;  3VTY A;  4CEM A;  4WAF A;  5CRV A;  3CR3 A;  4HRL A;  2NXP A;  4BX8 A;  2R2L A;  3SFX A;  3ESL A;  5B1B E;  4URK A;  3MV3 B;  4B0Z A;  3W9G A;  1JCR A;  2ILR A;  2VSN A;  3HXF A;  4AY6 A;  4AJW A;  2E2E A;  1JWG A;  3ASG A;  3QWP A;  4FHJ A;  3TGO A;  2IOL A;  3GZ1 A;  4DX1 A;  1ZBP A;  5G04 J;  1WM5 A;  2OV8 A;  5AQ7 A;  4WWO A;  4LNU D;  5FQ4 A;  2VYI A;  3UM2 A;  1LD8 A;  4TXQ A;  4X8Q A;  3EHR A;  3GW4 A;  1N94 A;  2KZT B;  3NZU A;  5G55 A;  4EHM A;  2ZGG A;  3TWU A;  2UY1 A;  2V5F A;  3ZYK A;  3RU0 A;  5BXU A;  3DPD A;  4H7Y A;  4ABN A;  5FZR A;  1IXV A;  2RKK A;  4UUC A;  5JA4 D;  4JW1 A;  4CT4 A;  2LSU A;  1BI7 B;  3VLE A;  4MBG A;  2EIL E;  5AJL A;  5AN8 A;  4G8K A;  3DEP A;  3CIA A;  5T8I A;  3EIJ A;  1X5B A;  2WXG A;  5BPP A;  4DUI A;  3OAW A;  1MX6 A;  3L82 A;  4Y6C A;  4DI3 A;  3ABK E;  4WWP A;  3D9L A;  2X38 A;  5CBO A;  3CEQ A;  4AY5 A;  4B93 B;  5ENQ D;  5ENS D;  1SZA A;  3FUH A;  3MCX A;  2F8X K;  3UXG A;  3ISM C;  3EU5 A;  2WB2 A;  3FUN A;  3UIP C;  2OVB A;  1NI1 A;  2XEN A;  1YA0 A;  3PZ2 A;  2WXJ A;  3OXL A;  1LTX A;  4AVX A;  4I1A A;  1KPS B;  2IFU A;  4GZ5 A;  4HVB A;  3FU6 A;  3FTU A;  2XEH A;  3NBN B;  2WXM A;  3S7F A;  5FJY A;  1OWL A;  2DZN A;  4CZ2 D;  3DRA A;  2RFM A;  3EUV A;  1BPO A;  1KZO A;  3ML8 A;  2F8Y A;  3Q73 A;  4HOU A;  3Q15 A;  3HXE A;  2VSO E;  2AXZ A;  2XZT G;  5JHB A;  4XI9 A;  1V54 E;  1D8D A;  3RIB A;  4XZ4 A;  3E34 A;  2XPI A;  3G2S A;  2ION A;  2L9B A;  3BEE A;  3CVU A;  4MS6 A;  4UWH A;  1H6O A;  1KLX A;  4PS7 A;  2GW1 A;  3V2X A;  4L7T A;  3ULY A;  1DCQ A;  2BTD A;  2FF4 A;  4J0U A;  2PZI A;  4C48 B;  4XE0 A;  4ANV A;  4JL0 A;  4MLP A;  5FT9 A;  5LP0 A;  3DWL G;  2P9U G;  3MJW A;  3T5V A;  3NOG D;  1S64 A;  1MX4 A;  5CED B;  3MKQ A;  4TUU A;  1O1T A;  4XKB A;  1Y8M A;  3GZS A;  3NZS A;  1N4P A;  1L5J A;  3HXB A;  3UX4 A;  3FFL A;  4KBQ A;  4UQY A;  4G23 A;  4OYS A;  2J09 A;  5LX8 A;  2VSX E;  3OXF A;  2XZD G;  3I3N A;  4F3V A;  2QY7 A;  5ENP D;  1E7U A;  5JJ6 A;  3UPV A;  2UY1 B;  5LFA A;  4L9P A;  1QQE A;  5CHE E;  3S2A A;  3Q4A B;  2J4B A;  4HRM B;  4RG9 A;  2J9Q A;  5J08 A;  1NZN A;  1BLX B;  3CK8 A;  1TNY A;  4KXK B;  3KS2 A;  4FLB A;  1DC2 A;  1HE8 A;  2GGF A;  3EU9 A;  4ILG A;  1N54 A;  1FT1 A;  5KJM A;  4GA0 A;  3FUJ A;  3KEZ A;  3ZPJ A;  1HFA A;  4EPZ A;  3SBT B;  3JQ1 A;  4N3A A;  2H6F A;  3MKR A;  1HF8 A;  4YDY A;  4JEU A;  3E4B A;  2HM8 A;  2F37 A;  4GZ6 A;  3L9T A;  2GRR B;  1PC2 A;  4B8C B;  2Y4U A;  3DSV A;  4G8L A;  3SI5 A;  3U3W A;  2EIN E;  3DSS A;  4TXP A;  4APF A;  5CEA A;  4RG6 A;  3DXM G;  1IKN D;  4JHJ A;  2VTB B;  4J8Y A;  2A5E A;  5JMN D;  3T8M A;  2FEZ A;  2PQN A;  2ETA A;  1E90 A;  2ETB A;  3G2U A;  3CLJ A;  5D0O D;  4UWK A;  2ZIS A;  1UJJ A;  2WXQ A;  5AIJ A;  1K3Z D;  3FEX A;  1IYG A;  4P29 A;  3ZN3 A;  3SBS A;  4NAC A;  5KCM A;  1TR4 A;  2CFU A;  4G26 A;  1Y6I A;  5BW8 C;  3JQ0 A;  2IO2 C;  4KYO B;  5CEC B;  3FP3 A;  4TXR A;  1N4Q A;  1TNB A;  4CCA A;  5H7P A;  3WXX A;  3QB2 A;  2CHX A;  1EYH A;  2P9P G;  2VSY A;  2Y3A A;  3D9P A;  4N5Q A;  1OWM A;  1YCS B;  3ASF A;  4F53 A;  5EDS A;  4GTT A;  5DIZ A;  1BI8 B;  1A5E A;  2KBX A; 
#chains in the Genus database with same CATH homology
 3C72 A;  1TN8 A;  1FT1 A;  4GTQ A;  1JCR A;  3E30 A;  3DSU A;  3HXF A;  3PZ3 A;  3DSX A;  3E32 A;  1S63 A;  2H6F A;  3PZ4 A;  3SFY A;  3EU5 A;  3Q78 A;  1TNU A;  1S64 A;  1NI1 A;  3E37 A;  1TN7 A;  3DSV A;  4GTM A;  3PZ2 A;  3DSS A;  4GTR A;  1LTX A;  1LD8 A;  1O1T A;  3DST A;  1JCS A;  1MZC A;  1N4P A;  3HXB A;  4YDO A;  3Q79 A;  3HXD A;  1N94 A;  3Q7A A;  1N4S A;  1N4R A;  1N9A A;  1TNO A;  1X81 A;  3HXC A;  4GTV A;  4EHM A;  4GTS A;  3KSQ A;  2ZIS A;  1O1R A;  1JCQ A;  3Q75 A;  4YDE A;  3DRA A;  3EUV A;  4LNB A;  1KZO A;  1NL4 A;  1O1S A;  1D8E A;  3KSL A;  1N95 A;  2H6I A;  4GTO A;  1SA4 A;  1KZP A;  2BED A;  3Q73 A;  4MBG A;  2F0Y A;  3HXE A;  3Q7F A;  4LNG A;  4L9P A;  1TNZ A;  1SA5 A;  1TN6 A;  1D8D A;  1DCE A;  1N4Q A;  1TNB A;  2IEJ A;  3E34 A;  4GTP A;  2H6G A;  3PZ1 A;  1LD7 A;  1FPP A;  1O5M A;  1TNY A;  3DSW A;  3DPY A;  2H6H A;  4GTT A;  1QBQ A;  1FT2 A;  2R2L A;  3SFX A;  3E33 A;  2ZIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...