3Q78A

Cryptococcus neoformans protein farnesyltransferase in complex with fspp and ddptasacniq peptide
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
330
structure length
312
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTFPMPSLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase
molecule keywords Farnesyltransferase alpha subunit
total genus 124
structure length 312
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q78A00
4MBGA 3DSTA 3HXDA 3DSXA 1JCRA 1S64A 1X81A 1KZPA 1TN7A 1TNBA 3E32A 3KSLA 3E34A 1TNUA 4YDOA 3EU5A 3HXBA 4GTPA 1TN6A 3E37A 1KZOA 1LTXA 2BEDA 1TNYA 3PZ1A 1O1SA 1O1TA 2IEJA 1D8DA 4GTVA 1N94A 1D8EA 2ZIRA 1N4RA 3Q7AA 1N4SA 1SA5A 3HXCA 4L9PA 4GTMA 3C72A 3DSWA 3DSUA 2H6IA 3Q79A 3PZ4A 3E33A 2H6GA 1TNOA 1FPPA 4YDEA 3HXEA 3Q73A 1JCQA 4GTTA 4LNBA 1O5MA 3DSSA 3PZ2A 1FT1A 4GTOA 1N4PA 2H6FA 3PZ3A 1SA4A 2H6HA 1NL4A 2R2LA 4GTQA 1DCEA 1MZCA 4EHMA 1LD7A 1QBQA 3SFYA 3EUVA 1LD8A 3Q78A 1N4QA 3DSVA 2F0YA 1N9AA 4GTSA 3DPYA 1NI1A 3E30A 3HXFA 1N95A 4LNGA 4GTRA 3Q7FA 1TN8A 3SFXA 3KSQA 1JCSA 1TNZA 2ZISA 3Q75A 1O1RA 3DRAA 1FT2A 1S63A
chains in the Genus database with same CATH superfamily
3MA5A 3B7RL 3SBTB 1PAQA 3LJ3A 3JQ0A 5CCLA 4N3BA 5T8IA 4GYWA 1OXJA 2YNQA 3HDXA 3ONKA 5FZSA 3WG7E 3QKYA 3DXMG 4MKTA 2BEDA 1IXVA 3PDNA 1WG0A 4GTVA 1TEZA 1SQMA 3HG0D 5AQ7A 4ANVA 1E8YA 1N4SA 3D9IA 1HXIA 2PL2A 4B89A 2FI7A 5ANLA 1Z3YA 4JA9A 4C0EA 5FQ8A 1BI8B 1FVFA 2XHEA 3V79K 1A17A 2CHXA 4N5QA 4ILGA 5IY5E 3AU4A 3EHQA 2YINA 1TJCA 5BV0A 1MQSA 2BTDA 3IHVA 2P58C 3C98A 4EZJA 3FY4A 1QBQA 1E8WA 2WQ6A 4BFRA 2V4LA 1N4QA 2WPVA 3JUIA 3MCXA 1NI1A 4G24A 4GZ3A 3CVNA 2VGXB 3PH0C 4GTRA 3Q7FA 3RRUA 3UM1A 2WM9A 1PY1A 1E8ZA 3V2XA 3BUAA 3L9TA 1HO8A 4WWPA 1DCQA 1Y8MA 2WXNA 3P1UA 2RD0A 5DIZA 5CRVA 4JVSA 1OWOA 4EBAA 1TN6A 3CVVA 4BTBA 1OCZE 3L16A 3MJWA 3FEXA 3S2AA 4BETA 5C1DA 2CHZA 3PZDA 3DSWA 4J6IA 5AQ9A 3SHFA 3L08A 2AXUA 1JCQA 3SZ7A 3VLEA 2M63A 5AQBA 3LJNA 3PZ2A 2VTBB 4A63B 3CVLA 4XE0A 3Q49B 2P2CP 3BEEA 1NL4A 5DBKA 4FULA 3I3NA 5KJMA 3TG5A 3FDHA 5CMYA 4DI3A 2J4BA 3Q78A 1H6OA 2I2OA 4KZCA 4J8FA 2AVPA 5LOZA 4WWOA 4GCNA 3SFXA 3C3QA 3B7BA 2VTBA 2C0LA 3TWRA 2AXVA 4G2VA 2DCPA 4GZDA 3HVEB 5B1BE 4JA7A 3RSEG 2ETBA 2P9SG 4LG6A 3Q5MA 4F3VA 1Z6TA 3FUKA 4HLLA 5ENNA 3CLJA 3PUJA 1LTXA 5A6CA 3I4GA 4FLHA 3ZU7B 3ENEA 1QYMA 3D9LA 1E90A 4F7AA 3URZA 1NA3A 3LS8A 1IHBA 3E33A 3ZYQA 2J8SD 3TXNA 3NOGD 4HOTA 4CGWA 2FEZA 1N54A 2VSXE 1JPLA 1Z5SC 4KBQA 4ACLA 1MX4A 3LDZA 4GTOA 2QYUA 1WM5A 1OCRE 3UQ3A 4L7TA 4U0UA 4CYMD 3ZIMA 5BUZA 2NXPA 2OV8A 5LX8A 1DCEA 3CEQA 1MZCA 2IOSA 5JHAA 1OWNA 4KVMA 3ABME 1SW6A 3CQGB 4U8HA 4AXHA 2F0YA 4ANWA 2WXHA 4BTAA 4G11A 4OAVB 2HO1A 3SF4A 4GU5A 3CHQA 3RU0A 5EN5D 3HIZA 3E4BA 4JZYA 4XZ4A 2DYSE 3CKCA 4G1TA 2GRLA 4GMRA 3IV0A 4JD2G 4RQIA 1HFAA 3BG1B 1S63A 2IU1A 4HI8A 3DSXA 3IXEA 2EIKE 4G8LA 3PEUB 3LCAA 3FTSA 4KVOA 1OCCE 3D9NA 3D9PA 3CHOA 4HQDA 2WXMA 3AG1E 3UIPC 3LPZA 3T9KA 4MS6A 3FU3A 2XZTG 3E37A 5FZRA 4PUCA 3Q15A 2X6HA 3MEKA 3CSFA 5M72A 4ZFHA 4U0SA 1SA5A 1BU9A 1H2VC 4GCOA 4L23A 5LCWJ 3SNXA 5EILA 2JLBA 1MX6A 4FHKA 3RIBA 4PS3A 4BY6A 4K0RA 4I17A 1OWLA 5HRYA 2PQNA 3IBEA 4CDNA 1UN8A 2H6FA 3PNLB 2IFUA 4CT0A 3UMVA 3AG2E 3CVQA 2LXLA 3APCA 1WAO1 4GTQA 3AS8A 3QWPA 3I4RB 2DZOA 3FUIA 4N2SA 2PM7A 4YVQC 2P9LG 3RKVA 4GTSA 1FCHA 2CG3A 5BPPA 1UW4B 1BLXB 3B7TA 2AJAA 4GZ5A 4YDWA 5KNHD 3ML8A 2AWIA 3TWXA 3CVYA 3DRAA 1MHQA 1FT2A 4XKCA 5FQ4A 5G2NA 2GRPB 1E96B 4N39A 3EHNA 4LUNU 3ONLA 3SFZA 3B13A 3R9AB 3E34A 2MYOA 4BERA 4N2QA 4OYSA 3V30A 1N11A 1TNYA 1YYHA 3CVWA 3V2OA 3AG3E 2ONDA 1H0AA 4GB9A 1H19A 3BG0B 5ARFA 2RKKA 2AW6A 2A4ZA 2H6GA 4YDEA 3EU9A 3TWVA 1HZ4A 5ITZF 3MZLB 2WXOA 4DUIA 1ZBPA 4CDMA 3ABKE 4J7WA 2Y4TA 5FJYA 3QAQA 2H6HA 2WXQA 3BU8A 3MGBA 4FU3A 4GA2A 2XCBA 1H2UA 1OY3D 1LD8A 5AENA 4NURA 5CBNA 1IQRA 5JJTA 5KNGA 1G3NB 4G23A 4HRNA 4BT9A 2J09A 3L13A 2GRMA 4H7XA 4ATGA 1N95A 3AS5A 1L5JA 2R03A 1LF8A 5KCMA 4QQIA 3C3OA 5BXUA 3TG4A 1HF8A 3Q47B 1WDYA 5JJ7A 3UIOC 2GRNB 1H6PA 3ZGQA 3S7DA 3OTNA 5FT9A 5EYLA 4BX8A 3LYAA 1A5EA 3DWLG 3ASNE 1NZNA 3E32A 5KBAA 4TXRA 1B89A 1MYOA 2P9IG 3SGHA 4BX9A 4EPZA 3CK7A 4I6GA 4O1OA 5EIBE 2JEKA 4UWGA 3S7BA 4WWNA 3KEAA 3ZYKA 1TYQG 2IOLA 3CQCB 4U8YD 2C0MA 4WAFA 2X3MA 1E7UA 1EYHA 1PC2A 2GW1A 4YVOA 4GPKA 5D0QD 3D9OA 4GTTA 3TGOA 2KBXA 3N71A 3FTVA 1NA0A 1FT1A 3EHRA 1JUQA 4G8KA 4FADA 3FH7A 3CK8A 2LO6A 5BT1A 2PZIA 1HU3A 4B93B 2XQ0A 4XEIG 5G04J 4FA6A 2YHEA 4J8DA 1Q2ZA 3SFYA 2CHWA 3I5PA 5JA4D 3CR3A 3ML9A 5H7PA 4EZLA 2XGSA 4PS8A 1ZB1A 1HG2A 3PRZA 3OXFA 2V5QC 4ME2A 3U3WA 4UUCA 3APFA 1U3DA 2E2EA 3NF1A 5AIJA 1AP7A 1KLXA 4UQXA 1OT8A 4F6RD 1GW6A 5LP0A 4GMLA 2VYIA 4RG6A 2I1KA 3LVRE 3UT8A 3PS6A 2ETAA 2AXZA 4JPSA 2WQ7A 3L22A 3FP3A 2WXIA 1VDYA 3ZVVA 3CHRA 4E6HA 3HXBA 2BKKB 5CEDB 2DVWA 5D66A 4IULA 3ASOE 2L6JA 5FINA 3SO8A 1V54E 1MX2A 1N4RA 3TL5A 4AJWA 4C9BB 3FTXA 3LVQE 5CMWA 5G05J 3FWVA 3UX4A 4AOFA 3FUDA 3SBSA 4K03A 2HR2A 4AY6A 3R7RA 4O1PA 3TWQA 1UN9A 1N0QA 4HFGA 1N4PA 2XEHA 3PZ3A 5HKPA 1K1AA 2MRIA 5ENOD 2R2LA 4I6JA 2MHKA 4KXKB 4OAUC 1BPOA 3CGHA 4V3IA 1OWPA 2QYJA 4DI4A 3MKQA 2XS8A 4PDXA 3LY8A 5AJLA 1H2TC 2L0TB 3NQPA 5CECB 3UI2A 3FHEA 3ZUVB 3ESKA 2KATA 3ZYLA 4E85A 1JCRA 5FIOA 4LRZA 4BEPA 2F8YA 1HS6A 3KEZA 5AAOA 3G2VA 2UWJG 2DYRE 5CERB 1KZOA 2KZTA 2L9BA 4XI0A 1D8DA 2IEJA 1E8XA 1UJKA 2FULA 2VSYA 4HS2A 3Q7AA 4NACA 1UJJA 2V8SE 4UQYA 2R17C 3Q79A 2R5SA 3S7FA 4UI9C 2XZDG 3Q73A 4GMJA 2HE0A 4DX1A 3QNKA 3ZFWA 4DX6D 1QZ2A 3UM0A 5EKQD 4IYPA 1KT1A 2Y3AA 2XENA 2WMOA 4Q69A 2XRYA 3ASGA 4WNDA 2VGYA 5E75A 2CFZA 3GZ1A 4TUMA 4I6EA 3EIJA 2RFMA 3NBNB 2P9PG 3UM2A 4WNGA 3VLFA 3SY2A 2V4HC 3E30A 1MJ0A 5CHEE 3TWUA 2FF4A 2F37A 3CVXA 3FH5A 3DEOA 3UKUG 3CKBA 3GZ2A 3GYZA 4EBAG 5G04C 2OVFA 2Y4UA 2ETCA 4Z68A 2J4DA 3IKOB 2VSOE 4K5AB 4JW1A 2BF0X 3TWSA 3ZXSA 3MV2B 5JHBA 1U2VG 2X6JA 5ENQD 3CV0A 1ELKA 1N94A 1YMPA 4K5BA 4C48B 1IHGA 4U07A 2KCVA 3MYVA 2P9KG 3K9IA 4L2LA 1OCOE 1SZAA 3RAUA 4HI9A 5EDSA 3AAAC 3S7JA 5HI7A 4CDRA 5EIDA 4DRXE 5B1AE 1H6KA 1ELWA 5HS0A 5FQ6A 4U7EB 3DXKG 3IEGA 2R02A 3EDTB 2EIJE 5G05C 3FU6A 5BW8C 2V5FA 5B3SE 2LAIA 3JQ1A 4G26A 1EF1C 2J49A 4EHMA 5FZQA 2E0IA 4UI9J 2BKGA 4JHRA 4JXTA 3D3MA 4HB5A 4XI9A 1TN8A 3RRMB 4UWHA 3LY9A 1JCSA 3PE4A 3O48A 2IO2C 5T3RA 3RO3A 1YA0A 4M3OA 2IJGX 4I9CA 3R9MA 3AJIA 4HORA 2LNIA 3NZSA 3CHPA 3KSLA 1BI7B 4DX2A 1TNUA 3LY7A 4YDOA 4AIFA 4APOA 3G2SA 3L82A 3FH8A 2HM8A 1QNFA 4U0ZA 1O1TA 1TJFA 4Y6WA 1KT0A 3QK0A 4EQFA 2XPZA 3FUJA 3TWTA 3FULA 4J8SA 2GGFA 3C72A 3NB2A 4B8CB 1ELRA 4DX5D 3ZPJA 1S0PA 4F1SA 3SD5A 4UWLA 2XGOA 4ABNA 2L6BA 5ENRD 3U4TA 3UTMA 3QARA 4BSZB 4DLOA 3UXGA 3FUHA 2P9UG 2WQHA 1ZU2A 2IQCA 4M7CA 4P29A 1TR4A 2FO1E 2KXPC 4JHJA 4I2WA 1OUVA 1KPSB 5EX0A 4ILHB 2JABA 4I1MA 5ENTD 2NSZA 4HRLA 4B0ZA 3T5XA 2MOWA 3MX3A 4JB8P 2LSUA 3L54A 1HH8A 5D2MC 5CCMA 1FVHA 3FTZA 2KCLA 4XKBA 4LEUA 2WXJA 3EIQC 1KZPA 4ZHBA 3EHMA 4LSZE 1BD8A 3CHMA 2QFCA 1N52A 2WXPA 2EILE 5KJKA 1RZ4A 4K5CA 4TXQA 5BV1A 1O1SA 4H7YA 3UKRG 3UUXA 4XX5A 2A5EA 4FC8A 2IY0C 3LXUX 4I2ZA 5LCWC 3PVLA 2XCCA 4DJAA 4URKA 4UWFA 4L2YA 4U95D 4Q94A 3ULEG 2WXFA 5CBOA 4HRMB 1E7VA 5FTPA 4GTMA 3QC1A 2OOEA 2A5UA 3C3RA 1EDUA 4IRUA 3DSSA 5JJ6A 3CVUA 2I9CA 3RK6A 3AS4A 3QOUA 4ATZD 2LSVA 3B95A 2GROB 2VQ2A 2Q7FA 2WXKA 3RJVA 1IKND 1NP7A 5AYWD 2WMNA 3CHSA 2I1JA 1WY6A 2WXLA 4EECA 1INZA 3ULQA 3J5PA 2PQRA 3D9JA 4CGVA 4LERA 3RO2A 1D9SA 3DSVA 2WXGA 4MRUA 1UG3A 4CT4A 1K3ZD 3ZN3A 3FUNA 3FUFA 2GRQB 4Q96A 2IO3C 2OEWA 1P5QA 4LNGA 4JEUA 2C2LA 1HG5A 3PEVB 2J9QA 1EPUA 1RW2A 3UT4A 1XGWA 4MBGA 3HXDA 3LEWA 3U9WA 2NC9A 3JYSA 4HLEA 3O4ZA 5J90A 2GRRB 1Z3XA 3D9HA 4WNFA 5CRUA 3J5QB 3HHMA 3JUEA 4FP7A 3HYMB 3APDA 2CFUA 2J08A 5A23A 2YHCA 2LUHA 5ENPD 4UQZA 1TNOA 3HXEA 3B7SA 3GW4A 3AG4E 4LNBA 2WB2A 4NQ0A 2X6IA 5JMND 3ZXPA 5KJLA 5BNWA 4AV7A 1JWGA 1SA4A 3BQOA 3CIAA 3QWVA 5ARGA 4U04A 4OVVA 3VLDA 4G25A 3JCKC 4JC8A 4YDYA 4FJYA 3DPYA 4A55A 2Y0BG 2DZNA 2XS1A 4BSXA 2DIWA 2DBAA 2VSNA 3ZW3A 1YCSB 5C2YA 3UM3A 4F53A 2UY1B 5AQAA 4A3VA 4R7LA 4WNEA 3Q75A 3DSTA 3T5VA 4BESA 3WXXA 4D10C 4DX7D 4N3AA 4GZCA 2IONA 2LAHA 1TNBA 2QC9A 1U3CA 3U64A 3FEYA 1N0RA 2FBNA 3FUEA 5LFAA 1S70B 3PZ1A 2WVIA 3QDNA 4EZKA 2ZIRA 3OXGA 4X8QA 4DPRA 3HXCA 3UPVA 3FTWA 4L9PA 4OVUA 3Q9UC 3PZ4A 1W3BA 5T4YA 3G2UA 2XPYA 1FPPA 2ZGDA 4ACKA 1OWMA 4UWKA 4IN3B 3FUMA 3Q4AB 4FJZA 3T8KA 3ABLE 4I1OB 3ZHEA 5FQ7A 4L1BA 2Y1LE 3V31A 5AJDA 3TJPA 3FU5A 3ZEFA 3MV3B 4ANUA 3UINC 3PE3A 4O60A 2KC7A 1LD7A 3FU0A 3EUVA 3FFLA 3GZSA 1SZ9A 1Y6IA 3AU5A 3LKUA 3C5RA 4TUUA 2WXRA 2L0IA 4RLYA 3JXIA 2OCCE 3HXFA 3ASDA 1QQEA 3T8MA 1X5BA 3KSQA 4KMOA 3W9GA 2ZISA 5FWQA 1O1RA 4F1PA 1XNFA 2RG8A 3D9MA 4JEHA 3VTYA 2X38A 2XEEA 2QZAA 4GA1A 1S64A 1X81A 3QJZA 3NAWA 3CSTA 4NIKA 3PREA 2Y69E 3RRNB 3Q9NC 1JWFA 2PM6A 4RSYA 3OXLA 5J08A 3ASHA 2ILRA 3ZNGA 3P2BA 2IF4A 2EIME 2FO7A 2H6IA 4KZ0A 3KD7A 1O5MA 1AWCB 3JXJA 2VJ8A 3MKQB 4I9EA 3TWWA 3KS2A 1DC2A 3OAWA 3G2TA 4GZ6A 4CZ2D 2BUGA 2B0OE 3G2WA 2KZTB 4A3TA 3EJNA 4BT8A 3ZYMA 4U63A 4A1SA 3NOCD 4ANXA 4HOUA 5KJNA 4J8EA 1N9AA 4HXIA 3QB2A 3NZUA 4B8AA 2UY1A 4U96D 2RFAA 5CEAA 5BXOA 2J07A 3ULYA 1V55E 5ENSD 1DVPA 2XPIA 4NRHB 3X2QE 1K8KG 4APFA 4PH4B 2XEVA 3L17A 1TN7A 3L6AA 5HQ8A 2X6FA 4GYYA 3CVPA 2YQ8A 3F6QA 4AM9A 3EU5A 2XRZA 2V0PA 3VTXA 4N5CA 2NYJA 2R59A 3SQVA 1D8EA 2HYZA 2P9NG 2R05A 4W9RA 3D9KA 4O6FA 1IYGA 2B6CA 3KAEA 4RG9A 3DSUA 1HE8A 5AARA 4MLPA 2LXMA 2EINE 3HVEA 4BWRA 4B94A 1DNPA 5D0OD 4C0MA 4QFVA 4A1GA 3PUKA 2VGEA 1IQUA 4HVBA 2I6HA 3R7QA 4TRQA 4TV3A 3ASFA 3CK9A 5A7DB 4LCTA 4HNAD 2F8XK 3SI5A 5EX3A 4DK5A 2QY7A 3TXMA 4YNDA 4GA0A 3DPDA 4KT6B 4FHJA 4AY5A 1TNZA 3DBSA 3TAXA 4GAAA 4N3CA 3QWWA 3U66A 4FLBA 5AN8A 2ZGGA 4HOQA 4U8VD 3UT7A 3DEPA 2XGMA 2KM4A 4GTPA 3B7UX 4I1AA 4LNUD 4CCAA 2ZU6B 1UOHA 4RVBA 3ZKJA 5KWDA 4KYOB 4GYOA 2DWZA 2EQXA 2OEVA 1K1BA 2ZXWE 4JHKA 4Y6CA 4AP2A 3W9FA 3MKRA 3FTUA 4CEMA 4AVXA 3ISMC 2PNNA 2X6KA 5EYPF 3ESLA 3ZHEB 4JL0A 2VGXA 4PS7A 4J0UA 1HX8A 4DLQA 5E76A 4UI9K 4XIFA 4HOSA 1NFIE 4I43A 2CG2A 2KCKA 3PNTB 4HBDA 5ANRA 3IHYA 3FTYA 4J8YA 5G55A 3HRAA 4CRWA 4WUYA 2OVBA 4AEZC 4TXPA 3ZRHA 4GPMA 4ILIA 1SVXA
chains in the Genus database with same CATH topology
4MBGA 3DSTA 3HXDA 3DSXA 1JCRA 1S64A 1X81A 1KZPA 1TN7A 1TNBA 3E32A 3KSLA 3E34A 1TNUA 4YDOA 3EU5A 3HXBA 4GTPA 1TN6A 3E37A 1KZOA 1LTXA 2BEDA 1TNYA 3PZ1A 1O1SA 1O1TA 2IEJA 1D8DA 4GTVA 1N94A 1D8EA 2ZIRA 1N4RA 3Q7AA 1N4SA 1SA5A 3HXCA 4L9PA 4GTMA 3C72A 3DSWA 3DSUA 2H6IA 3Q79A 3PZ4A 3E33A 2H6GA 1TNOA 1FPPA 4YDEA 3HXEA 3Q73A 1JCQA 4GTTA 4LNBA 1O5MA 3DSSA 3PZ2A 1FT1A 4GTOA 1N4PA 2H6FA 3PZ3A 1SA4A 2H6HA 1NL4A 2R2LA 4GTQA 1DCEA 1MZCA 4EHMA 1LD7A 1QBQA 3SFYA 3EUVA 1LD8A 3Q78A 1N4QA 3DSVA 2F0YA 1N9AA 4GTSA 3DPYA 1NI1A 3E30A 3HXFA 1N95A 4LNGA 4GTRA 3Q7FA 1TN8A 3SFXA 3KSQA 1JCSA 1TNZA 2ZISA 3Q75A 1O1RA 3DRAA 1FT2A 1S63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MBG A;  3DST A;  3HXD A;  3DSX A;  1JCR A;  1S64 A;  1X81 A;  1KZP A;  1TN7 A;  1TNB A;  3E32 A;  3KSL A;  3E34 A;  1TNU A;  4YDO A;  3EU5 A;  3HXB A;  4GTP A;  1TN6 A;  3E37 A;  1KZO A;  1LTX A;  2BED A;  1TNY A;  3PZ1 A;  1O1S A;  1O1T A;  2IEJ A;  1D8D A;  4GTV A;  1N94 A;  1D8E A;  2ZIR A;  1N4R A;  3Q7A A;  1N4S A;  1SA5 A;  3HXC A;  4L9P A;  4GTM A;  3C72 A;  3DSW A;  3DSU A;  2H6I A;  3Q79 A;  3PZ4 A;  3E33 A;  2H6G A;  1TNO A;  1FPP A;  4YDE A;  3HXE A;  3Q73 A;  1JCQ A;  4GTT A;  4LNB A;  1O5M A;  3DSS A;  3PZ2 A;  1FT1 A;  4GTO A;  1N4P A;  2H6F A;  3PZ3 A;  1SA4 A;  2H6H A;  1NL4 A;  2R2L A;  4GTQ A;  1DCE A;  1MZC A;  4EHM A;  1LD7 A;  1QBQ A;  3SFY A;  3EUV A;  1LD8 A;  3Q78 A;  1N4Q A;  3DSV A;  2F0Y A;  1N9A A;  4GTS A;  3DPY A;  1NI1 A;  3E30 A;  3HXF A;  1N95 A;  4LNG A;  4GTR A;  3Q7F A;  1TN8 A;  3SFX A;  3KSQ A;  1JCS A;  1TNZ A;  2ZIS A;  3Q75 A;  1O1R A;  3DRA A;  1FT2 A;  1S63 A; 
#chains in the Genus database with same CATH topology
 3MA5 A;  3B7R L;  3SBT B;  1PAQ A;  3LJ3 A;  3JQ0 A;  5CCL A;  4N3B A;  5T8I A;  4GYW A;  1OXJ A;  2YNQ A;  3HDX A;  3ONK A;  5FZS A;  3WG7 E;  3QKY A;  3DXM G;  4MKT A;  2BED A;  1IXV A;  3PDN A;  1WG0 A;  4GTV A;  1TEZ A;  1SQM A;  3HG0 D;  5AQ7 A;  4ANV A;  1E8Y A;  1N4S A;  3D9I A;  1HXI A;  2PL2 A;  4B89 A;  2FI7 A;  5ANL A;  1Z3Y A;  4JA9 A;  4C0E A;  5FQ8 A;  1BI8 B;  1FVF A;  2XHE A;  3V79 K;  1A17 A;  2CHX A;  4N5Q A;  4ILG A;  5IY5 E;  3AU4 A;  3EHQ A;  2YIN A;  1TJC A;  5BV0 A;  1MQS A;  2BTD A;  3IHV A;  2P58 C;  3C98 A;  4EZJ A;  3FY4 A;  1QBQ A;  1E8W A;  2WQ6 A;  4BFR A;  2V4L A;  1N4Q A;  2WPV A;  3JUI A;  3MCX A;  1NI1 A;  4G24 A;  4GZ3 A;  3CVN A;  2VGX B;  3PH0 C;  4GTR A;  3Q7F A;  3RRU A;  3UM1 A;  2WM9 A;  1PY1 A;  1E8Z A;  3V2X A;  3BUA A;  3L9T A;  1HO8 A;  4WWP A;  1DCQ A;  1Y8M A;  2WXN A;  3P1U A;  2RD0 A;  5DIZ A;  5CRV A;  4JVS A;  1OWO A;  4EBA A;  1TN6 A;  3CVV A;  4BTB A;  1OCZ E;  3L16 A;  3MJW A;  3FEX A;  3S2A A;  4BET A;  5C1D A;  2CHZ A;  3PZD A;  3DSW A;  4J6I A;  5AQ9 A;  3SHF A;  3L08 A;  2AXU A;  1JCQ A;  3SZ7 A;  3VLE A;  2M63 A;  5AQB A;  3LJN A;  3PZ2 A;  2VTB B;  4A63 B;  3CVL A;  4XE0 A;  3Q49 B;  2P2C P;  3BEE A;  1NL4 A;  5DBK A;  4FUL A;  3I3N A;  5KJM A;  3TG5 A;  3FDH A;  5CMY A;  4DI3 A;  2J4B A;  3Q78 A;  1H6O A;  2I2O A;  4KZC A;  4J8F A;  2AVP A;  5LOZ A;  4WWO A;  4GCN A;  3SFX A;  3C3Q A;  3B7B A;  2VTB A;  2C0L A;  3TWR A;  2AXV A;  4G2V A;  2DCP A;  4GZD A;  3HVE B;  5B1B E;  4JA7 A;  3RSE G;  2ETB A;  2P9S G;  4LG6 A;  3Q5M A;  4F3V A;  1Z6T A;  3FUK A;  4HLL A;  5ENN A;  3CLJ A;  3PUJ A;  1LTX A;  5A6C A;  3I4G A;  4FLH A;  3ZU7 B;  3ENE A;  1QYM A;  3D9L A;  1E90 A;  4F7A A;  3URZ A;  1NA3 A;  3LS8 A;  1IHB A;  3E33 A;  3ZYQ A;  2J8S D;  3TXN A;  3NOG D;  4HOT A;  4CGW A;  2FEZ A;  1N54 A;  2VSX E;  1JPL A;  1Z5S C;  4KBQ A;  4ACL A;  1MX4 A;  3LDZ A;  4GTO A;  2QYU A;  1WM5 A;  1OCR E;  3UQ3 A;  4L7T A;  4U0U A;  4CYM D;  3ZIM A;  5BUZ A;  2NXP A;  2OV8 A;  5LX8 A;  1DCE A;  3CEQ A;  1MZC A;  2IOS A;  5JHA A;  1OWN A;  4KVM A;  3ABM E;  1SW6 A;  3CQG B;  4U8H A;  4AXH A;  2F0Y A;  4ANW A;  2WXH A;  4BTA A;  4G11 A;  4OAV B;  2HO1 A;  3SF4 A;  4GU5 A;  3CHQ A;  3RU0 A;  5EN5 D;  3HIZ A;  3E4B A;  4JZY A;  4XZ4 A;  2DYS E;  3CKC A;  4G1T A;  2GRL A;  4GMR A;  3IV0 A;  4JD2 G;  4RQI A;  1HFA A;  3BG1 B;  1S63 A;  2IU1 A;  4HI8 A;  3DSX A;  3IXE A;  2EIK E;  4G8L A;  3PEU B;  3LCA A;  3FTS A;  4KVO A;  1OCC E;  3D9N A;  3D9P A;  3CHO A;  4HQD A;  2WXM A;  3AG1 E;  3UIP C;  3LPZ A;  3T9K A;  4MS6 A;  3FU3 A;  2XZT G;  3E37 A;  5FZR A;  4PUC A;  3Q15 A;  2X6H A;  3MEK A;  3CSF A;  5M72 A;  4ZFH A;  4U0S A;  1SA5 A;  1BU9 A;  1H2V C;  4GCO A;  4L23 A;  5LCW J;  3SNX A;  5EIL A;  2JLB A;  1MX6 A;  4FHK A;  3RIB A;  4PS3 A;  4BY6 A;  4K0R A;  4I17 A;  1OWL A;  5HRY A;  2PQN A;  3IBE A;  4CDN A;  1UN8 A;  2H6F A;  3PNL B;  2IFU A;  4CT0 A;  3UMV A;  3AG2 E;  3CVQ A;  2LXL A;  3APC A;  1WAO 1;  4GTQ A;  3AS8 A;  3QWP A;  3I4R B;  2DZO A;  3FUI A;  4N2S A;  2PM7 A;  4YVQ C;  2P9L G;  3RKV A;  4GTS A;  1FCH A;  2CG3 A;  5BPP A;  1UW4 B;  1BLX B;  3B7T A;  2AJA A;  4GZ5 A;  4YDW A;  5KNH D;  3ML8 A;  2AWI A;  3TWX A;  3CVY A;  3DRA A;  1MHQ A;  1FT2 A;  4XKC A;  5FQ4 A;  5G2N A;  2GRP B;  1E96 B;  4N39 A;  3EHN A;  4LUN U;  3ONL A;  3SFZ A;  3B13 A;  3R9A B;  3E34 A;  2MYO A;  4BER A;  4N2Q A;  4OYS A;  3V30 A;  1N11 A;  1TNY A;  1YYH A;  3CVW A;  3V2O A;  3AG3 E;  2OND A;  1H0A A;  4GB9 A;  1H19 A;  3BG0 B;  5ARF A;  2RKK A;  2AW6 A;  2A4Z A;  2H6G A;  4YDE A;  3EU9 A;  3TWV A;  1HZ4 A;  5ITZ F;  3MZL B;  2WXO A;  4DUI A;  1ZBP A;  4CDM A;  3ABK E;  4J7W A;  2Y4T A;  5FJY A;  3QAQ A;  2H6H A;  2WXQ A;  3BU8 A;  3MGB A;  4FU3 A;  4GA2 A;  2XCB A;  1H2U A;  1OY3 D;  1LD8 A;  5AEN A;  4NUR A;  5CBN A;  1IQR A;  5JJT A;  5KNG A;  1G3N B;  4G23 A;  4HRN A;  4BT9 A;  2J09 A;  3L13 A;  2GRM A;  4H7X A;  4ATG A;  1N95 A;  3AS5 A;  1L5J A;  2R03 A;  1LF8 A;  5KCM A;  4QQI A;  3C3O A;  5BXU A;  3TG4 A;  1HF8 A;  3Q47 B;  1WDY A;  5JJ7 A;  3UIO C;  2GRN B;  1H6P A;  3ZGQ A;  3S7D A;  3OTN A;  5FT9 A;  5EYL A;  4BX8 A;  3LYA A;  1A5E A;  3DWL G;  3ASN E;  1NZN A;  3E32 A;  5KBA A;  4TXR A;  1B89 A;  1MYO A;  2P9I G;  3SGH A;  4BX9 A;  4EPZ A;  3CK7 A;  4I6G A;  4O1O A;  5EIB E;  2JEK A;  4UWG A;  3S7B A;  4WWN A;  3KEA A;  3ZYK A;  1TYQ G;  2IOL A;  3CQC B;  4U8Y D;  2C0M A;  4WAF A;  2X3M A;  1E7U A;  1EYH A;  1PC2 A;  2GW1 A;  4YVO A;  4GPK A;  5D0Q D;  3D9O A;  4GTT A;  3TGO A;  2KBX A;  3N71 A;  3FTV A;  1NA0 A;  1FT1 A;  3EHR A;  1JUQ A;  4G8K A;  4FAD A;  3FH7 A;  3CK8 A;  2LO6 A;  5BT1 A;  2PZI A;  1HU3 A;  4B93 B;  2XQ0 A;  4XEI G;  5G04 J;  4FA6 A;  2YHE A;  4J8D A;  1Q2Z A;  3SFY A;  2CHW A;  3I5P A;  5JA4 D;  3CR3 A;  3ML9 A;  5H7P A;  4EZL A;  2XGS A;  4PS8 A;  1ZB1 A;  1HG2 A;  3PRZ A;  3OXF A;  2V5Q C;  4ME2 A;  3U3W A;  4UUC A;  3APF A;  1U3D A;  2E2E A;  3NF1 A;  5AIJ A;  1AP7 A;  1KLX A;  4UQX A;  1OT8 A;  4F6R D;  1GW6 A;  5LP0 A;  4GML A;  2VYI A;  4RG6 A;  2I1K A;  3LVR E;  3UT8 A;  3PS6 A;  2ETA A;  2AXZ A;  4JPS A;  2WQ7 A;  3L22 A;  3FP3 A;  2WXI A;  1VDY A;  3ZVV A;  3CHR A;  4E6H A;  3HXB A;  2BKK B;  5CED B;  2DVW A;  5D66 A;  4IUL A;  3ASO E;  2L6J A;  5FIN A;  3SO8 A;  1V54 E;  1MX2 A;  1N4R A;  3TL5 A;  4AJW A;  4C9B B;  3FTX A;  3LVQ E;  5CMW A;  5G05 J;  3FWV A;  3UX4 A;  4AOF A;  3FUD A;  3SBS A;  4K03 A;  2HR2 A;  4AY6 A;  3R7R A;  4O1P A;  3TWQ A;  1UN9 A;  1N0Q A;  4HFG A;  1N4P A;  2XEH A;  3PZ3 A;  5HKP A;  1K1A A;  2MRI A;  5ENO D;  2R2L A;  4I6J A;  2MHK A;  4KXK B;  4OAU C;  1BPO A;  3CGH A;  4V3I A;  1OWP A;  2QYJ A;  4DI4 A;  3MKQ A;  2XS8 A;  4PDX A;  3LY8 A;  5AJL A;  1H2T C;  2L0T B;  3NQP A;  5CEC B;  3UI2 A;  3FHE A;  3ZUV B;  3ESK A;  2KAT A;  3ZYL A;  4E85 A;  1JCR A;  5FIO A;  4LRZ A;  4BEP A;  2F8Y A;  1HS6 A;  3KEZ A;  5AAO A;  3G2V A;  2UWJ G;  2DYR E;  5CER B;  1KZO A;  2KZT A;  2L9B A;  4XI0 A;  1D8D A;  2IEJ A;  1E8X A;  1UJK A;  2FUL A;  2VSY A;  4HS2 A;  3Q7A A;  4NAC A;  1UJJ A;  2V8S E;  4UQY A;  2R17 C;  3Q79 A;  2R5S A;  3S7F A;  4UI9 C;  2XZD G;  3Q73 A;  4GMJ A;  2HE0 A;  4DX1 A;  3QNK A;  3ZFW A;  4DX6 D;  1QZ2 A;  3UM0 A;  5EKQ D;  4IYP A;  1KT1 A;  2Y3A A;  2XEN A;  2WMO A;  4Q69 A;  2XRY A;  3ASG A;  4WND A;  2VGY A;  5E75 A;  2CFZ A;  3GZ1 A;  4TUM A;  4I6E A;  3EIJ A;  2RFM A;  3NBN B;  2P9P G;  3UM2 A;  4WNG A;  3VLF A;  3SY2 A;  2V4H C;  3E30 A;  1MJ0 A;  5CHE E;  3TWU A;  2FF4 A;  2F37 A;  3CVX A;  3FH5 A;  3DEO A;  3UKU G;  3CKB A;  3GZ2 A;  3GYZ A;  4EBA G;  5G04 C;  2OVF A;  2Y4U A;  2ETC A;  4Z68 A;  2J4D A;  3IKO B;  2VSO E;  4K5A B;  4JW1 A;  2BF0 X;  3TWS A;  3ZXS A;  3MV2 B;  5JHB A;  1U2V G;  2X6J A;  5ENQ D;  3CV0 A;  1ELK A;  1N94 A;  1YMP A;  4K5B A;  4C48 B;  1IHG A;  4U07 A;  2KCV A;  3MYV A;  2P9K G;  3K9I A;  4L2L A;  1OCO E;  1SZA A;  3RAU A;  4HI9 A;  5EDS A;  3AAA C;  3S7J A;  5HI7 A;  4CDR A;  5EID A;  4DRX E;  5B1A E;  1H6K A;  1ELW A;  5HS0 A;  5FQ6 A;  4U7E B;  3DXK G;  3IEG A;  2R02 A;  3EDT B;  2EIJ E;  5G05 C;  3FU6 A;  5BW8 C;  2V5F A;  5B3S E;  2LAI A;  3JQ1 A;  4G26 A;  1EF1 C;  2J49 A;  4EHM A;  5FZQ A;  2E0I A;  4UI9 J;  2BKG A;  4JHR A;  4JXT A;  3D3M A;  4HB5 A;  4XI9 A;  1TN8 A;  3RRM B;  4UWH A;  3LY9 A;  1JCS A;  3PE4 A;  3O48 A;  2IO2 C;  5T3R A;  3RO3 A;  1YA0 A;  4M3O A;  2IJG X;  4I9C A;  3R9M A;  3AJI A;  4HOR A;  2LNI A;  3NZS A;  3CHP A;  3KSL A;  1BI7 B;  4DX2 A;  1TNU A;  3LY7 A;  4YDO A;  4AIF A;  4APO A;  3G2S A;  3L82 A;  3FH8 A;  2HM8 A;  1QNF A;  4U0Z A;  1O1T A;  1TJF A;  4Y6W A;  1KT0 A;  3QK0 A;  4EQF A;  2XPZ A;  3FUJ A;  3TWT A;  3FUL A;  4J8S A;  2GGF A;  3C72 A;  3NB2 A;  4B8C B;  1ELR A;  4DX5 D;  3ZPJ A;  1S0P A;  4F1S A;  3SD5 A;  4UWL A;  2XGO A;  4ABN A;  2L6B A;  5ENR D;  3U4T A;  3UTM A;  3QAR A;  4BSZ B;  4DLO A;  3UXG A;  3FUH A;  2P9U G;  2WQH A;  1ZU2 A;  2IQC A;  4M7C A;  4P29 A;  1TR4 A;  2FO1 E;  2KXP C;  4JHJ A;  4I2W A;  1OUV A;  1KPS B;  5EX0 A;  4ILH B;  2JAB A;  4I1M A;  5ENT D;  2NSZ A;  4HRL A;  4B0Z A;  3T5X A;  2MOW A;  3MX3 A;  4JB8 P;  2LSU A;  3L54 A;  1HH8 A;  5D2M C;  5CCM A;  1FVH A;  3FTZ A;  2KCL A;  4XKB A;  4LEU A;  2WXJ A;  3EIQ C;  1KZP A;  4ZHB A;  3EHM A;  4LSZ E;  1BD8 A;  3CHM A;  2QFC A;  1N52 A;  2WXP A;  2EIL E;  5KJK A;  1RZ4 A;  4K5C A;  4TXQ A;  5BV1 A;  1O1S A;  4H7Y A;  3UKR G;  3UUX A;  4XX5 A;  2A5E A;  4FC8 A;  2IY0 C;  3LXU X;  4I2Z A;  5LCW C;  3PVL A;  2XCC A;  4DJA A;  4URK A;  4UWF A;  4L2Y A;  4U95 D;  4Q94 A;  3ULE G;  2WXF A;  5CBO A;  4HRM B;  1E7V A;  5FTP A;  4GTM A;  3QC1 A;  2OOE A;  2A5U A;  3C3R A;  1EDU A;  4IRU A;  3DSS A;  5JJ6 A;  3CVU A;  2I9C A;  3RK6 A;  3AS4 A;  3QOU A;  4ATZ D;  2LSV A;  3B95 A;  2GRO B;  2VQ2 A;  2Q7F A;  2WXK A;  3RJV A;  1IKN D;  1NP7 A;  5AYW D;  2WMN A;  3CHS A;  2I1J A;  1WY6 A;  2WXL A;  4EEC A;  1INZ A;  3ULQ A;  3J5P A;  2PQR A;  3D9J A;  4CGV A;  4LER A;  3RO2 A;  1D9S A;  3DSV A;  2WXG A;  4MRU A;  1UG3 A;  4CT4 A;  1K3Z D;  3ZN3 A;  3FUN A;  3FUF A;  2GRQ B;  4Q96 A;  2IO3 C;  2OEW A;  1P5Q A;  4LNG A;  4JEU A;  2C2L A;  1HG5 A;  3PEV B;  2J9Q A;  1EPU A;  1RW2 A;  3UT4 A;  1XGW A;  4MBG A;  3HXD A;  3LEW A;  3U9W A;  2NC9 A;  3JYS A;  4HLE A;  3O4Z A;  5J90 A;  2GRR B;  1Z3X A;  3D9H A;  4WNF A;  5CRU A;  3J5Q B;  3HHM A;  3JUE A;  4FP7 A;  3HYM B;  3APD A;  2CFU A;  2J08 A;  5A23 A;  2YHC A;  2LUH A;  5ENP D;  4UQZ A;  1TNO A;  3HXE A;  3B7S A;  3GW4 A;  3AG4 E;  4LNB A;  2WB2 A;  4NQ0 A;  2X6I A;  5JMN D;  3ZXP A;  5KJL A;  5BNW A;  4AV7 A;  1JWG A;  1SA4 A;  3BQO A;  3CIA A;  3QWV A;  5ARG A;  4U04 A;  4OVV A;  3VLD A;  4G25 A;  3JCK C;  4JC8 A;  4YDY A;  4FJY A;  3DPY A;  4A55 A;  2Y0B G;  2DZN A;  2XS1 A;  4BSX A;  2DIW A;  2DBA A;  2VSN A;  3ZW3 A;  1YCS B;  5C2Y A;  3UM3 A;  4F53 A;  2UY1 B;  5AQA A;  4A3V A;  4R7L A;  4WNE A;  3Q75 A;  3DST A;  3T5V A;  4BES A;  3WXX A;  4D10 C;  4DX7 D;  4N3A A;  4GZC A;  2ION A;  2LAH A;  1TNB A;  2QC9 A;  1U3C A;  3U64 A;  3FEY A;  1N0R A;  2FBN A;  3FUE A;  5LFA A;  1S70 B;  3PZ1 A;  2WVI A;  3QDN A;  4EZK A;  2ZIR A;  3OXG A;  4X8Q A;  4DPR A;  3HXC A;  3UPV A;  3FTW A;  4L9P A;  4OVU A;  3Q9U C;  3PZ4 A;  1W3B A;  5T4Y A;  3G2U A;  2XPY A;  1FPP A;  2ZGD A;  4ACK A;  1OWM A;  4UWK A;  4IN3 B;  3FUM A;  3Q4A B;  4FJZ A;  3T8K A;  3ABL E;  4I1O B;  3ZHE A;  5FQ7 A;  4L1B A;  2Y1L E;  3V31 A;  5AJD A;  3TJP A;  3FU5 A;  3ZEF A;  3MV3 B;  4ANU A;  3UIN C;  3PE3 A;  4O60 A;  2KC7 A;  1LD7 A;  3FU0 A;  3EUV A;  3FFL A;  3GZS A;  1SZ9 A;  1Y6I A;  3AU5 A;  3LKU A;  3C5R A;  4TUU A;  2WXR A;  2L0I A;  4RLY A;  3JXI A;  2OCC E;  3HXF A;  3ASD A;  1QQE A;  3T8M A;  1X5B A;  3KSQ A;  4KMO A;  3W9G A;  2ZIS A;  5FWQ A;  1O1R A;  4F1P A;  1XNF A;  2RG8 A;  3D9M A;  4JEH A;  3VTY A;  2X38 A;  2XEE A;  2QZA A;  4GA1 A;  1S64 A;  1X81 A;  3QJZ A;  3NAW A;  3CST A;  4NIK A;  3PRE A;  2Y69 E;  3RRN B;  3Q9N C;  1JWF A;  2PM6 A;  4RSY A;  3OXL A;  5J08 A;  3ASH A;  2ILR A;  3ZNG A;  3P2B A;  2IF4 A;  2EIM E;  2FO7 A;  2H6I A;  4KZ0 A;  3KD7 A;  1O5M A;  1AWC B;  3JXJ A;  2VJ8 A;  3MKQ B;  4I9E A;  3TWW A;  3KS2 A;  1DC2 A;  3OAW A;  3G2T A;  4GZ6 A;  4CZ2 D;  2BUG A;  2B0O E;  3G2W A;  2KZT B;  4A3T A;  3EJN A;  4BT8 A;  3ZYM A;  4U63 A;  4A1S A;  3NOC D;  4ANX A;  4HOU A;  5KJN A;  4J8E A;  1N9A A;  4HXI A;  3QB2 A;  3NZU A;  4B8A A;  2UY1 A;  4U96 D;  2RFA A;  5CEA A;  5BXO A;  2J07 A;  3ULY A;  1V55 E;  5ENS D;  1DVP A;  2XPI A;  4NRH B;  3X2Q E;  1K8K G;  4APF A;  4PH4 B;  2XEV A;  3L17 A;  1TN7 A;  3L6A A;  5HQ8 A;  2X6F A;  4GYY A;  3CVP A;  2YQ8 A;  3F6Q A;  4AM9 A;  3EU5 A;  2XRZ A;  2V0P A;  3VTX A;  4N5C A;  2NYJ A;  2R59 A;  3SQV A;  1D8E A;  2HYZ A;  2P9N G;  2R05 A;  4W9R A;  3D9K A;  4O6F A;  1IYG A;  2B6C A;  3KAE A;  4RG9 A;  3DSU A;  1HE8 A;  5AAR A;  4MLP A;  2LXM A;  2EIN E;  3HVE A;  4BWR A;  4B94 A;  1DNP A;  5D0O D;  4C0M A;  4QFV A;  4A1G A;  3PUK A;  2VGE A;  1IQU A;  4HVB A;  2I6H A;  3R7Q A;  4TRQ A;  4TV3 A;  3ASF A;  3CK9 A;  5A7D B;  4LCT A;  4HNA D;  2F8X K;  3SI5 A;  5EX3 A;  4DK5 A;  2QY7 A;  3TXM A;  4YND A;  4GA0 A;  3DPD A;  4KT6 B;  4FHJ A;  4AY5 A;  1TNZ A;  3DBS A;  3TAX A;  4GAA A;  4N3C A;  3QWW A;  3U66 A;  4FLB A;  5AN8 A;  2ZGG A;  4HOQ A;  4U8V D;  3UT7 A;  3DEP A;  2XGM A;  2KM4 A;  4GTP A;  3B7U X;  4I1A A;  4LNU D;  4CCA A;  2ZU6 B;  1UOH A;  4RVB A;  3ZKJ A;  5KWD A;  4KYO B;  4GYO A;  2DWZ A;  2EQX A;  2OEV A;  1K1B A;  2ZXW E;  4JHK A;  4Y6C A;  4AP2 A;  3W9F A;  3MKR A;  3FTU A;  4CEM A;  4AVX A;  3ISM C;  2PNN A;  2X6K A;  5EYP F;  3ESL A;  3ZHE B;  4JL0 A;  2VGX A;  4PS7 A;  4J0U A;  1HX8 A;  4DLQ A;  5E76 A;  4UI9 K;  4XIF A;  4HOS A;  1NFI E;  4I43 A;  2CG2 A;  2KCK A;  3PNT B;  4HBD A;  5ANR A;  3IHY A;  3FTY A;  4J8Y A;  5G55 A;  3HRA A;  4CRW A;  4WUY A;  2OVB A;  4AEZ C;  4TXP A;  3ZRH A;  4GPM A;  4ILI A;  1SVX A; 
#chains in the Genus database with same CATH homology
 4MBG A;  3DST A;  3HXD A;  3DSX A;  1JCR A;  1S64 A;  1X81 A;  1KZP A;  1TN7 A;  1TNB A;  3E32 A;  3KSL A;  3E34 A;  1TNU A;  4YDO A;  3EU5 A;  3HXB A;  4GTP A;  1TN6 A;  3E37 A;  1KZO A;  1LTX A;  2BED A;  1TNY A;  3PZ1 A;  1O1S A;  1O1T A;  2IEJ A;  1D8D A;  4GTV A;  1N94 A;  1D8E A;  2ZIR A;  1N4R A;  3Q7A A;  1N4S A;  1SA5 A;  3HXC A;  4L9P A;  4GTM A;  3C72 A;  3DSW A;  3DSU A;  2H6I A;  3Q79 A;  3PZ4 A;  3E33 A;  2H6G A;  1TNO A;  1FPP A;  4YDE A;  3HXE A;  3Q73 A;  1JCQ A;  4GTT A;  4LNB A;  1O5M A;  3DSS A;  3PZ2 A;  1FT1 A;  4GTO A;  1N4P A;  2H6F A;  3PZ3 A;  1SA4 A;  2H6H A;  1NL4 A;  2R2L A;  4GTQ A;  1DCE A;  1MZC A;  4EHM A;  1LD7 A;  1QBQ A;  3SFY A;  3EUV A;  1LD8 A;  3Q78 A;  1N4Q A;  3DSV A;  2F0Y A;  1N9A A;  4GTS A;  3DPY A;  1NI1 A;  3E30 A;  3HXF A;  1N95 A;  4LNG A;  4GTR A;  3Q7F A;  1TN8 A;  3SFX A;  3KSQ A;  1JCS A;  1TNZ A;  2ZIS A;  3Q75 A;  1O1R A;  3DRA A;  1FT2 A;  1S63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...