3Q78A

Cryptococcus neoformans protein farnesyltransferase in complex with fspp and ddptasacniq peptide
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
330
structure length
312
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTFPMPSLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Farnesyltransferase alpha subunit
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
total genus 124
structure length 312
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q78A00
1LD8A 3Q75A 4GTOA 1TNZA 2H6GA 3E34A 3HXCA 3DSTA 1TNOA 3DRAA 2R2LA 1LTXA 1NI1A 2ZIRA 4EHMA 1FT2A 1N95A 3EUVA 1TN7A 1S63A 4YDEA 3KSQA 1TN6A 1N4RA 3DSWA 3HXFA 1KZPA 1SA5A 3E32A 3Q7FA 1N94A 3PZ2A 3DSUA 4GTPA 4GTVA 1O5MA 1N4PA 1JCSA 1N4SA 1FT1A 3HXDA 1D8EA 2BEDA 3DSSA 3DSXA 4L9PA 4MBGA 1O1RA 3Q78A 1MZCA 4GTQA 3Q79A 3Q73A 4LNBA 3PZ1A 1NL4A 4GTMA 1O1SA 1JCRA 1S64A 2H6FA 4LNGA 1SA4A 2F0YA 1N4QA 3E30A 2IEJA 1TNUA 1TN8A 1DCEA 1LD7A 1O1TA 1TNYA 3PZ3A 1FPPA 1D8DA 3E33A 3HXBA 2H6HA 4GTSA 4YDOA 3HXEA 1N9AA 3E37A 3EU5A 4GTRA 3DSVA 1X81A 3DPYA 3Q7AA 3SFYA 3PZ4A 1QBQA 2ZISA 1KZOA 3KSLA 1TNBA 1JCQA 3C72A 2H6IA 4GTTA 3SFXA
chains in the Genus database with same CATH superfamily
5JHBA 1IHGA 3FHEA 3FEXA 3NBNB 2J4BA 3HVEA 4OYSA 2J9QA 5CCLA 1DNPA 4V3IA 2WB2A 5CBNA 4HRNA 3CQGB 1TN6A 2F37A 3C5RA 3J5QB 2X6FA 3HDXA 4HI8A 4NURA 3SQVA 3BQOA 3D9MA 5KWDA 4EPZA 3ONLA 4GMJA 1N94A 5D0OD 1B89A 1JPLA 4AXHA 4XIFA 4HRLA 1FT1A 4NACA 2WXFA 2VQ2A 3DSXA 3AG1E 4GU5A 4WWOA 4GYOA 3Q78A 1BI8B 3DEOA 2WXIA 1DC2A 4JD2G 4HQDA 3HIZA 4HB5A 4WAFA 3EHNA 1K8KG 2ETAA 1BLXB 4HLLA 2IONA 3LCAA 3L16A 5KNGA 3V2XA 2HR2A 1WM5A 3TXNA 3SBTB 5KBAA 3RIBA 4W9RA 2WXKA 2ZGDA 3AJIA 4GTSA 4WNDA 2X3MA 3QOUA 4FC8A 3CVWA 4OVUA 3LS8A 5BPPA 2ETBA 4LNUD 2CG2A 5A6CA 3NOGD 4BT8A 4HOQA 1HX8A 2XGMA 3CQCB 4NRHB 4Z68A 2LSVA 1OWNA 2X6KA 3SNXA 4APOA 3AG2E 4HS2A 3U3WA 5FQ6A 3ABLE 3L17A 3LY7A 1OT8A 3J5PA 3EUVA 2P9UG 2Y4TA 3QWWA 3Q4AB 5G55A 1WDYA 4J0UA 4BTBA 3DSWA 4XX5A 1HS6A 3FDHA 1H0AA 5HQ8A 2R59A 4AY6A 4BX9A 3FTSA 3QDNA 3IV0A 3Q47B 2ZU6B 2XZTG 2RG8A 1OWLA 3D9NA 4UI9K 3ZYKA 1RZ4A 3FU0A 4LEUA 4CYMD 1E8XA 5CBOA 3D3MA 4APFA 4F53A 4I17A 4AY5A 2DBAA 4IULA 4G2VA 3LKUA 3TWRA 3G2WA 3FWVA 3P2BA 2C0MA 4ILGA 5BXOA 5C1DA 3PZ3A 4ACKA 2Y3AA 3ASFA 1N9AA 2XRYA 2F8YA 4ABNA 3V2OA 3T5XA 3C72A 4JVSA 3L54A 2FULA 1OCOE 3ASGA 4WWNA 3K9IA 5FQ8A 3DSTA 1TNOA 4UQYA 3CVUA 2KATA 3G2VA 4Q96A 4TUMA 3C3OA 2AXUA 2L9BA 3V79K 4BERA 2OOEA 5AQAA 3ZXSA 5HI7A 5CRUA 4ZFHA 3MV3B 3BG1B 3U64A 4CCAA 2CHWA 3EHMA 2QY7A 3NAWA 2ILRA 1H2UA 1GW6A 5KJMA 3PEVB 3RSEG 4DK5A 4BY6A 4HOSA 3CSTA 1ZB1A 4N3CA 2VGEA 2J08A 2A5EA 4DLQA 3D9KA 2BTDA 1U2VG 2UY1A 2YQ8A 1ZU2A 2DWZA 2GRQB 4F3VA 2VJ8A 3D9PA 5D0QD 2WXJA 2I9CA 3I3NA 2IU1A 2XRZA 2IO2C 3CIAA 4ILHB 3FH7A 5FQ4A 4A1SA 4MLPA 4C0EA 1KZOA 3TGOA 4TV3A 4GTTA 4HVBA 4LCTA 3IHVA 2R2LA 3GYZA 3ML8A 4AVXA 4U0ZA 4U63A 3MKQB 3LXUX 4DPRA 4RSYA 3GZ1A 5ARGA 2P9PG 4YDEA 3LY8A 3UTMA 4CT4A 2LNIA 1Y6IA 2V5FA 4DRXE 3FUDA 3CV0A 2AWIA 4RLYA 2L6BA 1ELRA 3WXXA 3TWUA 3ZGQA 4BSXA 3X2QE 5G04J 1YYHA 3ZHEB 1W3BA 1YMPA 3LEWA 4WUYA 1NP7A 3UMVA 4MBGA 4GPMA 4F1PA 5JHAA 1O1RA 2JLBA 2VYIA 4GMLA 1YA0A 3OXGA 2H6FA 2GRPB 2VSXE 3C3QA 4HXIA 4TXQA 4B0ZA 2XEEA 2UWJG 4DLOA 5CRVA 1WAO1 3ONKA 4H7XA 3FTXA 2IOLA 3DSVA 1UJJA 3UT7A 2L6JA 3B95A 2YHEA 3WG7E 2RD0A 4ANUA 3UUXA 2WPVA 2Y4UA 4DX5D 3HXCA 4I43A 3RKVA 2XHEA 2GRNB 5CEDB 3LPZA 3FEYA 4GZ5A 1XGWA 2KXPC 3ZIMA 2AJAA 4GMRA 4A1GA 4EHMA 4E6HA 2AXZA 2WQ7A 4LG6A 3ZW3A 4GB9A 1N95A 3QJZA 3JQ1A 3D9HA 5AQ7A 4K5BA 4DJAA 2KCKA 3LJ3A 3QARA 2GW1A 4UQZA 3VTXA 2QFCA 3SI5A 2A4ZA 3F6QA 2F8XK 1ZBPA 4G24A 5LOZA 3UKRG 5ENPD 3ZU7B 2VSOE 2VGYA 3FFLA 4XI0A 4BSZB 1JCRA 1TJCA 2RFAA 3UT8A 1N4QA 1KT0A 2OVFA 4BESA 1MHQA 4BFRA 2XQ0A 1DCEA 4LSZE 4UWHA 4CDNA 4WNEA 4AEZC 1NA0A 4JHJA 4HNAD 2Y1LE 2XGSA 4IYPA 4XKCA 3PE3A 4O1PA 3G2UA 4RVBA 3ZN3A 4M3OA 3IHYA 4AJWA 4TUUA 4HFGA 1IYGA 4AV7A 1JCQA 3EHQA 4G1TA 2JEKA 1E8ZA 4A63B 4XI9A 3FU6A 4K5AB 1MX6A 5BV0A 4UI9C 5AQ9A 3FUMA 5LCWC 4CGVA 2R5SA 1Y8MA 3T8MA 3SFZA 1TN7A 4G11A 2XZDG 4J8FA 4ANXA 3OTNA 3JUEA 1QYMA 3KS2A 3PNLB 5FJYA 1D9SA 4FJYA 5A7DB 3G2SA 1O5MA 1N4PA 1JCSA 3L08A 4HOTA 4KZ0A 1D8EA 3TL5A 4XZ4A 1OWMA 3ASDA 1HFAA 1MZCA 4L1BA 3L9TA 5G05C 4AM9A 1N0QA 5EX0A 4JPSA 4KXKB 1N54A 2WXPA 3JYSA 1IQRA 3EIJA 3KEAA 2Y0BG 3ASHA 4WNFA 2V4LA 4Q69A 2H6HA 2FEZA 2FO1E 1ELWA 2XEHA 4JHKA 3CLJA 3FH8A 3Q49B 4JZYA 3ZNGA 4JB8P 2V5QC 3W9GA 2WXOA 3ULEG 2LAIA 2VTBB 3S7DA 3BEEA 2M63A 3CKBA 3QC1A 4HOUA 4UWKA 4K5CA 4EBAG 5A23A 2IFUA 2IY0C 1NFIE 1IHBA 1UN8A 4BEPA 2ONDA 4I1OB 4MRUA 5LFAA 3T5VA 4K03A 5AJDA 1H2TC 4U0UA 3HHMA 5D2MC 2PQRA 3DBSA 3JXJA 3FY4A 1OCZE 4UQXA 4HLEA 3D9IA 3ESLA 1SA5A 4I9CA 4ACLA 3ISMC 5BNWA 3NB2A 5CECB 3JXIA 2LSUA 1HZ4A 1Q2ZA 2LXMA 5FT9A 1FVFA 1H6KA 4J8EA 1QQEA 1Z5SC 2VGXA 1N52A 5EDSA 4ATZD 3FUNA 4EZLA 3SF4A 1MX2A 4I6GA 1O1SA 1VDYA 4CDMA 2DYRE 3UXGA 4A3TA 2KCLA 3FUFA 2F0YA 2YINA 3PUJA 1TNUA 5ENTD 1Z6TA 4I6JA 1EPUA 2V8SE 1G3NB 3SHFA 3E37A 4I6EA 2YNQA 1S70B 1X81A 3DPYA 3PZ4A 4BTAA 4U8YD 2XENA 4P29A 4DX2A 2HO1A 5AYWD 2P9LG 4GYWA 5ENQD 3Q75A 1A17A 1DCQA 4TRQA 2KZTA 3ABKE 2DCPA 1SQMA 3U4TA 5AQBA 5AAOA 4J8YA 4LERA 3HG0D 1BI7B 3S7FA 2BKGA 3UM2A 2RFMA 3UX4A 3FTYA 3ULYA 3FTVA 1L5JA 4JXTA 3SY2A 5FZRA 4A3VA 5T8IA 5HS0A 2JABA 4BX8A 3FUKA 4QQIA 3P1UA 3R9MA 1E7VA 4CT0A 3Q7FA 1EF1C 2XEVA 3PZ2A 3DSUA 5ITZF 5LX8A 2I1KA 1X5BA 1WY6A 1K1AA 2QYUA 3CVXA 5JMND 2C0LA 2KCVA 4KYOB 5ENNA 2DYSE 2NSZA 3AS5A 3TXMA 4GA1A 3RRMB 1P5QA 4B94A 4TXRA 2MRIA 5AN8A 4ME2A 3ENEA 3I4GA 3KAEA 4OVVA 3RO2A 1TN8A 3ZFWA 2KC7A 2IF4A 3KD7A 4DX7D 1H2VC 2V4HC 4K0RA 4JHRA 2IJGX 3EU5A 3CR3A 5B3SE 1QBQA 1SVXA 3GZ2A 3MA5A 5ARFA 3UM0A 1EYHA 5EX3A 5BXUA 3D9LA 1TNZA 4JW1A 5KJNA 4M7CA 1INZA 3SBSA 3UIPC 3QWVA 4JC8A 1OCCE 4NIKA 3AS8A 3FH5A 3GZSA 1HF8A 1IQUA 1E96B 2WXQA 4GYYA 3ZVVA 2NXPA 2QC9A 5B1AE 5KNHD 3CK8A 3BG0B 2DZOA 3ZYMA 1DVPA 3DXMG 3OXLA 1OCRE 4GTVA 4FA6A 1N4SA 2I2OA 4JA7A 4U95D 4FHKA 5EIDA 3CVLA 3MJWA 2MYOA 3W9FA 3IEGA 3QAQA 1Z3XA 3N71A 1UOHA 1JWGA 1TYQG 2EIME 2MOWA 1KLXA 4G8KA 2AXVA 3APCA 2C2LA 4AP2A 4I1AA 3UQ3A 1FPPA 2P58C 3HVEB 3MX3A 2R02A 2DVWA 2LXLA 3AAAC 3L13A 3DPDA 4PS7A 4PS3A 3D9JA 3EJNA 2OV8A 2R05A 3LJNA 5JJ7A 4FJZA 1TNBA 4I9EA 1UN9A 4XEIG 3ASOE 4DX6D 3U66A 2KBXA 2E0IA 3LVRE 3DEPA 4UWLA 4HORA 3DXKG 1FT2A 4BWRA 4CEMA 3C98A 1PAQA 5FIOA 1U3DA 4E85A 1UG3A 2AVPA 3CHSA 4KT6B 3B7UX 3E32A 2X6JA 1BD8A 2X6HA 4GTPA 4LUNU 3HXDA 2ZXWE 4N2SA 5ENOD 3PUKA 3APDA 2P9NG 4L9PA 2CHXA 3V31A 2QYJA 1SZ9A 3SGHA 1S64A 3RK6A 1E7UA 4L7TA 1E8WA 2P2CP 4FLBA 4CZ2D 4KMOA 1K1BA 2RKKA 4C0MA 3CVVA 3ESKA 4F7AA 3FU5A 3JQ0A 2IOSA 1TEZA 4FULA 4G8LA 4FP7A 3L82A 2OEVA 5FWQA 5AJLA 4F6RD 1YCSB 4Y6WA 3O4ZA 4B89A 3SZ7A 3KSLA 2MHKA 1AP7A 1RW2A 2WMNA 3SFXA 4L2YA 1LD8A 2X6IA 2XCCA 2ZGGA 3B7TA 2HE0A 3MKRA 4LRZA 1HH8A 3RO3A 2FI7A 5BT1A 4C9BB 3MV2B 4PDXA 4L23A 4JEHA 3AS4A 5EILA 3TJPA 4MKTA 3AG3E 3S7BA 3CVYA 3B13A 1OXJA 5CCMA 2LO6A 4FHJA 4DI3A 3Q9UC 3TWXA 2P9KG 2VSNA 4I2WA 3APFA 3GW4A 2KM4A 3D9OA 4JEUA 4AIFA 3TWSA 4B8CB 3MKQA 4G26A 4L2LA 2BEDA 5FTPA 3S7JA 4J8SA 5ENSD 2XPYA 4URKA 2BUGA 4X8QA 3BUAA 5DIZA 3Q79A 4LNBA 3C3RA 5HKPA 1MJ0A 2A5UA 3UKUG 3RJVA 1U3CA 1SA4A 3NQPA 3ZHEA 3JCKC 4B93B 2HYZA 4NQ0A 3Q9NC 3V30A 4PH4B 3E33A 4BT9A 4RQIA 2NYJA 3TWVA 3VLFA 1TJFA 4R7LA 3UM3A 4ATGA 4YDYA 5D66A 3ZUVB 4DUIA 1ELKA 4YNDA 5FZQA 3UT4A 1AWCB 3MGBA 3UINC 4N3BA 3PNTB 2OVBA 4FU3A 2R03A 4GTOA 2H6GA 4U8HA 1PY1A 3QKYA 3FU3A 3VLEA 1JWFA 2ZIRA 2GGFA 1V54E 2AW6A 3FUHA 5G2NA 5JA4D 5J90A 3IBEA 2WMOA 3OAWA 3CGHA 4MS6A 2YHCA 2J8SD 2Q7FA 2PM7A 4GA0A 3ZPJA 3PVLA 5C2YA 3CVNA 5JJ6A 3UPVA 1IXVA 3CHMA 4EZJA 3FTWA 5CERB 4N5QA 1NA3A 1OWOA 2FBNA 3IXEA 1HO8A 4CGWA 2LUHA 1QNFA 2UY1B 4ANVA 3PZDA 3B7SA 3CHOA 3I5PA 3CVQA 3NF1A 1H6PA 4Y6CA 1HU3A 5EKQD 4G23A 3TWTA 3MZLB 2EQXA 1Z3YA 3AG4E 2XPIA 3CK7A 5AIJA 3FUEA 2IQCA 1E90A 5G04C 4CRWA 3FTZA 2WXRA 1TR4A 5JJTA 5T4YA 3Q7AA 3SFYA 1LF8A 3L22A 2DZNA 2E2EA 1BU9A 3R9AB 1HG5A 2B6CA 3ZYQA 4J8DA 4KVMA 4GTRA 4N2QA 5CMYA 5CMWA 3RRNB 4DX1A 3U9WA 1SZAA 1NI1A 3RAUA 1OUVA 2WQHA 4DI4A 2HM8A 1KPSB 4UWFA 2OEWA 2J49A 3MEKA 2PL2A 1OY3D 3ABME 3O48A 4KBQA 4UUCA 2R17C 3AU4A 3QWPA 3ML9A 1N4RA 4G25A 4TXPA 3CK9A 2CHZA 3RU0A 3S2AA 5CHEE 3T8KA 3KEZA 3PREA 5IY5E 2WXGA 1XNFA 3ZRHA 4N39A 2DIWA 5E75A 3ZYLA 3PZ1A 4BETA 4CDRA 3FUIA 4F1SA 5BW8C 2XS1A 4LNGA 4UI9J 4XKBA 3QK0A 3B7RL 2I1JA 4U7EB 5LCWJ 3QB2A 4GCOA 4U07A 4YDOA 3HXEA 3VTYA 4C48B 3R7RA 4ILIA 4UWGA 3UM1A 2CFUA 4EECA 2XS8A 5EIBE 2GRRB 3G2TA 4N3AA 2WQ6A 5M72A 3ZEFA 2GRLA 5FINA 3JUIA 4ANWA 3ZKJA 4GA2A 1HXIA 4YDWA 1LTXA 4XE0A 2QZAA 2L0TB 5G05J 3MYVA 4GZDA 1FVHA 3KSQA 2WXLA 4EBAA 3FTUA 1SW6A 5EYPF 3EIQC 3PS6A 2VTBA 3QNKA 1A5EA 2V0PA 2FO7A 1MQSA 4YVQC 3CKCA 2PQNA 1KT1A 2PNNA 4U96D 1MX4A 1HG2A 4GTQA 2XCBA 3RRUA 3SO8A 3Q73A 4OAUC 1EDUA 3HYMB 4RG9A 2WXMA 4N5CA 3IKOB 5EYLA 1K3ZD 5EN5D 3E30A 3CHRA 2P9IG 1UJKA 4JA9A 2WM9A 3TWWA 4U8VD 1LD7A 4U0SA 5J08A 4U04A 1O1TA 3B7BA 5LP0A 3EHRA 3Q15A 5AENA 5H7PA 1OWPA 1S0PA 4O6FA 5B1BE 5E76A 2ZISA 4WNGA 2XGOA 3PRZA 2H6IA 3ASNE 1UW4B 1WG0A 2J4DA 3E34A 1PC2A 2GROB 4D10C 4GZ3A 2GRMA 5BUZA 3PH0C 4GCNA 4YVOA 4A55A 3CHPA 3UI2A 5AARA 3URZA 5BV1A 3PEUB 5T3RA 2P9SG 2EIKE 1JUQA 1H6OA 3TWQA 1V55E 2L0IA 2OCCE 5FQ7A 2J07A 3BU8A 2EIJE 5HRYA 4FLHA 3UIOC 4H7YA 1MYOA 3CSFA 3FUJA 3AU5A 2IO3C 2WVIA 4O1OA 5ANRA 1NL4A 4QFVA 4I1MA 4GTMA 4GZCA 3TAXA 3CHQA 4GPKA 3PDNA 1H19A 3PE4A 3TG5A 2IEJA 4J7WA 3TG4A 3NZUA 3MCXA 1QZ2A 3Q5MA 1E8YA 3ZXPA 3VLDA 1TNYA 4WWPA 2Y69E 3HXBA 2J09A 4HBDA 5ANLA 3L6AA 2B0OE 5KCMA 4KVOA 3E4BA 4B8AA 3LY9A 4ZHBA 4EQFA 2CG3A 3CEQA 4GAAA 3SD5A 4OAVB 4HI9A 2BKKB 4PS8A 2PM6A 4KZCA 2XPZA 3DRAA 3EDTB 3ULQA 3T9KA 1IKND 1N0RA 1NZNA 3I4RB 2VGXB 1N11A 3LYAA 5KJLA 4RG6A 2I6HA 1S63A 2X38A 3OXFA 4Q94A 4FADA 4HRMB 1BPOA 3HXFA 4IRUA 1KZPA 5CEAA 5ENRD 3FULA 4O60A 2LAHA 5FZSA 5KJKA 4EZKA 2BF0X 3DSSA 2EILE 3DWLG 3NOCD 3FP3A 3HRAA 2VSYA 4IN3B 5DBKA 2FF4A 2ETCA 3EU9A 4JL0A 3NZSA 1FCHA 4PUCA 2WXNA 2EINE 1HE8A 4AOFA 1D8DA 2KZTB 3R7QA 2WXHA 4GZ6A 3LVQE 2NC9A 3CVPA 2PZIA 3LDZA 4J6IA 2CFZA 4I2ZA
chains in the Genus database with same CATH topology
1LD8A 3Q75A 4GTOA 1TNZA 2H6GA 3E34A 3HXCA 3DSTA 1TNOA 3DRAA 2R2LA 1LTXA 1NI1A 2ZIRA 4EHMA 1FT2A 1N95A 3EUVA 1TN7A 1S63A 4YDEA 3KSQA 1TN6A 1N4RA 3DSWA 3HXFA 1KZPA 1SA5A 3E32A 3Q7FA 1N94A 3PZ2A 3DSUA 4GTPA 4GTVA 1O5MA 1N4PA 1JCSA 1N4SA 1FT1A 3HXDA 1D8EA 2BEDA 3DSSA 3DSXA 4L9PA 4MBGA 1O1RA 3Q78A 1MZCA 4GTQA 3Q79A 3Q73A 4LNBA 3PZ1A 1NL4A 4GTMA 1O1SA 1JCRA 1S64A 2H6FA 4LNGA 1SA4A 2F0YA 1N4QA 3E30A 2IEJA 1TNUA 1TN8A 1DCEA 1LD7A 1O1TA 1TNYA 3PZ3A 1FPPA 1D8DA 3E33A 3HXBA 2H6HA 4GTSA 4YDOA 3HXEA 1N9AA 3E37A 3EU5A 4GTRA 3DSVA 1X81A 3DPYA 3Q7AA 3SFYA 3PZ4A 1QBQA 2ZISA 1KZOA 3KSLA 1TNBA 1JCQA 3C72A 2H6IA 4GTTA 3SFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LD8 A;  3Q75 A;  4GTO A;  1TNZ A;  2H6G A;  3E34 A;  3HXC A;  3DST A;  1TNO A;  3DRA A;  2R2L A;  1LTX A;  1NI1 A;  2ZIR A;  4EHM A;  1FT2 A;  1N95 A;  3EUV A;  1TN7 A;  1S63 A;  4YDE A;  3KSQ A;  1TN6 A;  1N4R A;  3DSW A;  3HXF A;  1KZP A;  1SA5 A;  3E32 A;  3Q7F A;  1N94 A;  3PZ2 A;  3DSU A;  4GTP A;  4GTV A;  1O5M A;  1N4P A;  1JCS A;  1N4S A;  1FT1 A;  3HXD A;  1D8E A;  2BED A;  3DSS A;  3DSX A;  4L9P A;  4MBG A;  1O1R A;  3Q78 A;  1MZC A;  4GTQ A;  3Q79 A;  3Q73 A;  4LNB A;  3PZ1 A;  1NL4 A;  4GTM A;  1O1S A;  1JCR A;  1S64 A;  2H6F A;  4LNG A;  1SA4 A;  2F0Y A;  1N4Q A;  3E30 A;  2IEJ A;  1TNU A;  1TN8 A;  1DCE A;  1LD7 A;  1O1T A;  1TNY A;  3PZ3 A;  1FPP A;  1D8D A;  3E33 A;  3HXB A;  2H6H A;  4GTS A;  4YDO A;  3HXE A;  1N9A A;  3E37 A;  3EU5 A;  4GTR A;  3DSV A;  1X81 A;  3DPY A;  3Q7A A;  3SFY A;  3PZ4 A;  1QBQ A;  2ZIS A;  1KZO A;  3KSL A;  1TNB A;  1JCQ A;  3C72 A;  2H6I A;  4GTT A;  3SFX A; 
#chains in the Genus database with same CATH topology
 5JHB A;  1IHG A;  3FHE A;  3FEX A;  3NBN B;  2J4B A;  3HVE A;  4OYS A;  2J9Q A;  5CCL A;  1DNP A;  4V3I A;  2WB2 A;  5CBN A;  4HRN A;  3CQG B;  1TN6 A;  2F37 A;  3C5R A;  3J5Q B;  2X6F A;  3HDX A;  4HI8 A;  4NUR A;  3SQV A;  3BQO A;  3D9M A;  5KWD A;  4EPZ A;  3ONL A;  4GMJ A;  1N94 A;  5D0O D;  1B89 A;  1JPL A;  4AXH A;  4XIF A;  4HRL A;  1FT1 A;  4NAC A;  2WXF A;  2VQ2 A;  3DSX A;  3AG1 E;  4GU5 A;  4WWO A;  4GYO A;  3Q78 A;  1BI8 B;  3DEO A;  2WXI A;  1DC2 A;  4JD2 G;  4HQD A;  3HIZ A;  4HB5 A;  4WAF A;  3EHN A;  1K8K G;  2ETA A;  1BLX B;  4HLL A;  2ION A;  3LCA A;  3L16 A;  5KNG A;  3V2X A;  2HR2 A;  1WM5 A;  3TXN A;  3SBT B;  5KBA A;  3RIB A;  4W9R A;  2WXK A;  2ZGD A;  3AJI A;  4GTS A;  4WND A;  2X3M A;  3QOU A;  4FC8 A;  3CVW A;  4OVU A;  3LS8 A;  5BPP A;  2ETB A;  4LNU D;  2CG2 A;  5A6C A;  3NOG D;  4BT8 A;  4HOQ A;  1HX8 A;  2XGM A;  3CQC B;  4NRH B;  4Z68 A;  2LSV A;  1OWN A;  2X6K A;  3SNX A;  4APO A;  3AG2 E;  4HS2 A;  3U3W A;  5FQ6 A;  3ABL E;  3L17 A;  3LY7 A;  1OT8 A;  3J5P A;  3EUV A;  2P9U G;  2Y4T A;  3QWW A;  3Q4A B;  5G55 A;  1WDY A;  4J0U A;  4BTB A;  3DSW A;  4XX5 A;  1HS6 A;  3FDH A;  1H0A A;  5HQ8 A;  2R59 A;  4AY6 A;  4BX9 A;  3FTS A;  3QDN A;  3IV0 A;  3Q47 B;  2ZU6 B;  2XZT G;  2RG8 A;  1OWL A;  3D9N A;  4UI9 K;  3ZYK A;  1RZ4 A;  3FU0 A;  4LEU A;  4CYM D;  1E8X A;  5CBO A;  3D3M A;  4APF A;  4F53 A;  4I17 A;  4AY5 A;  2DBA A;  4IUL A;  4G2V A;  3LKU A;  3TWR A;  3G2W A;  3FWV A;  3P2B A;  2C0M A;  4ILG A;  5BXO A;  5C1D A;  3PZ3 A;  4ACK A;  2Y3A A;  3ASF A;  1N9A A;  2XRY A;  2F8Y A;  4ABN A;  3V2O A;  3T5X A;  3C72 A;  4JVS A;  3L54 A;  2FUL A;  1OCO E;  3ASG A;  4WWN A;  3K9I A;  5FQ8 A;  3DST A;  1TNO A;  4UQY A;  3CVU A;  2KAT A;  3G2V A;  4Q96 A;  4TUM A;  3C3O A;  2AXU A;  2L9B A;  3V79 K;  4BER A;  2OOE A;  5AQA A;  3ZXS A;  5HI7 A;  5CRU A;  4ZFH A;  3MV3 B;  3BG1 B;  3U64 A;  4CCA A;  2CHW A;  3EHM A;  2QY7 A;  3NAW A;  2ILR A;  1H2U A;  1GW6 A;  5KJM A;  3PEV B;  3RSE G;  4DK5 A;  4BY6 A;  4HOS A;  3CST A;  1ZB1 A;  4N3C A;  2VGE A;  2J08 A;  2A5E A;  4DLQ A;  3D9K A;  2BTD A;  1U2V G;  2UY1 A;  2YQ8 A;  1ZU2 A;  2DWZ A;  2GRQ B;  4F3V A;  2VJ8 A;  3D9P A;  5D0Q D;  2WXJ A;  2I9C A;  3I3N A;  2IU1 A;  2XRZ A;  2IO2 C;  3CIA A;  4ILH B;  3FH7 A;  5FQ4 A;  4A1S A;  4MLP A;  4C0E A;  1KZO A;  3TGO A;  4TV3 A;  4GTT A;  4HVB A;  4LCT A;  3IHV A;  2R2L A;  3GYZ A;  3ML8 A;  4AVX A;  4U0Z A;  4U63 A;  3MKQ B;  3LXU X;  4DPR A;  4RSY A;  3GZ1 A;  5ARG A;  2P9P G;  4YDE A;  3LY8 A;  3UTM A;  4CT4 A;  2LNI A;  1Y6I A;  2V5F A;  4DRX E;  3FUD A;  3CV0 A;  2AWI A;  4RLY A;  2L6B A;  1ELR A;  3WXX A;  3TWU A;  3ZGQ A;  4BSX A;  3X2Q E;  5G04 J;  1YYH A;  3ZHE B;  1W3B A;  1YMP A;  3LEW A;  4WUY A;  1NP7 A;  3UMV A;  4MBG A;  4GPM A;  4F1P A;  5JHA A;  1O1R A;  2JLB A;  2VYI A;  4GML A;  1YA0 A;  3OXG A;  2H6F A;  2GRP B;  2VSX E;  3C3Q A;  4HXI A;  4TXQ A;  4B0Z A;  2XEE A;  2UWJ G;  4DLO A;  5CRV A;  1WAO 1;  3ONK A;  4H7X A;  3FTX A;  2IOL A;  3DSV A;  1UJJ A;  3UT7 A;  2L6J A;  3B95 A;  2YHE A;  3WG7 E;  2RD0 A;  4ANU A;  3UUX A;  2WPV A;  2Y4U A;  4DX5 D;  3HXC A;  4I43 A;  3RKV A;  2XHE A;  2GRN B;  5CED B;  3LPZ A;  3FEY A;  4GZ5 A;  1XGW A;  2KXP C;  3ZIM A;  2AJA A;  4GMR A;  4A1G A;  4EHM A;  4E6H A;  2AXZ A;  2WQ7 A;  4LG6 A;  3ZW3 A;  4GB9 A;  1N95 A;  3QJZ A;  3JQ1 A;  3D9H A;  5AQ7 A;  4K5B A;  4DJA A;  2KCK A;  3LJ3 A;  3QAR A;  2GW1 A;  4UQZ A;  3VTX A;  2QFC A;  3SI5 A;  2A4Z A;  3F6Q A;  2F8X K;  1ZBP A;  4G24 A;  5LOZ A;  3UKR G;  5ENP D;  3ZU7 B;  2VSO E;  2VGY A;  3FFL A;  4XI0 A;  4BSZ B;  1JCR A;  1TJC A;  2RFA A;  3UT8 A;  1N4Q A;  1KT0 A;  2OVF A;  4BES A;  1MHQ A;  4BFR A;  2XQ0 A;  1DCE A;  4LSZ E;  4UWH A;  4CDN A;  4WNE A;  4AEZ C;  1NA0 A;  4JHJ A;  4HNA D;  2Y1L E;  2XGS A;  4IYP A;  4XKC A;  3PE3 A;  4O1P A;  3G2U A;  4RVB A;  3ZN3 A;  4M3O A;  3IHY A;  4AJW A;  4TUU A;  4HFG A;  1IYG A;  4AV7 A;  1JCQ A;  3EHQ A;  4G1T A;  2JEK A;  1E8Z A;  4A63 B;  4XI9 A;  3FU6 A;  4K5A B;  1MX6 A;  5BV0 A;  4UI9 C;  5AQ9 A;  3FUM A;  5LCW C;  4CGV A;  2R5S A;  1Y8M A;  3T8M A;  3SFZ A;  1TN7 A;  4G11 A;  2XZD G;  4J8F A;  4ANX A;  3OTN A;  3JUE A;  1QYM A;  3KS2 A;  3PNL B;  5FJY A;  1D9S A;  4FJY A;  5A7D B;  3G2S A;  1O5M A;  1N4P A;  1JCS A;  3L08 A;  4HOT A;  4KZ0 A;  1D8E A;  3TL5 A;  4XZ4 A;  1OWM A;  3ASD A;  1HFA A;  1MZC A;  4L1B A;  3L9T A;  5G05 C;  4AM9 A;  1N0Q A;  5EX0 A;  4JPS A;  4KXK B;  1N54 A;  2WXP A;  3JYS A;  1IQR A;  3EIJ A;  3KEA A;  2Y0B G;  3ASH A;  4WNF A;  2V4L A;  4Q69 A;  2H6H A;  2FEZ A;  2FO1 E;  1ELW A;  2XEH A;  4JHK A;  3CLJ A;  3FH8 A;  3Q49 B;  4JZY A;  3ZNG A;  4JB8 P;  2V5Q C;  3W9G A;  2WXO A;  3ULE G;  2LAI A;  2VTB B;  3S7D A;  3BEE A;  2M63 A;  3CKB A;  3QC1 A;  4HOU A;  4UWK A;  4K5C A;  4EBA G;  5A23 A;  2IFU A;  2IY0 C;  1NFI E;  1IHB A;  1UN8 A;  4BEP A;  2OND A;  4I1O B;  4MRU A;  5LFA A;  3T5V A;  4K03 A;  5AJD A;  1H2T C;  4U0U A;  3HHM A;  5D2M C;  2PQR A;  3DBS A;  3JXJ A;  3FY4 A;  1OCZ E;  4UQX A;  4HLE A;  3D9I A;  3ESL A;  1SA5 A;  4I9C A;  4ACL A;  3ISM C;  5BNW A;  3NB2 A;  5CEC B;  3JXI A;  2LSU A;  1HZ4 A;  1Q2Z A;  2LXM A;  5FT9 A;  1FVF A;  1H6K A;  4J8E A;  1QQE A;  1Z5S C;  2VGX A;  1N52 A;  5EDS A;  4ATZ D;  3FUN A;  4EZL A;  3SF4 A;  1MX2 A;  4I6G A;  1O1S A;  1VDY A;  4CDM A;  2DYR E;  3UXG A;  4A3T A;  2KCL A;  3FUF A;  2F0Y A;  2YIN A;  3PUJ A;  1TNU A;  5ENT D;  1Z6T A;  4I6J A;  1EPU A;  2V8S E;  1G3N B;  3SHF A;  3E37 A;  4I6E A;  2YNQ A;  1S70 B;  1X81 A;  3DPY A;  3PZ4 A;  4BTA A;  4U8Y D;  2XEN A;  4P29 A;  4DX2 A;  2HO1 A;  5AYW D;  2P9L G;  4GYW A;  5ENQ D;  3Q75 A;  1A17 A;  1DCQ A;  4TRQ A;  2KZT A;  3ABK E;  2DCP A;  1SQM A;  3U4T A;  5AQB A;  5AAO A;  4J8Y A;  4LER A;  3HG0 D;  1BI7 B;  3S7F A;  2BKG A;  3UM2 A;  2RFM A;  3UX4 A;  3FTY A;  3ULY A;  3FTV A;  1L5J A;  4JXT A;  3SY2 A;  5FZR A;  4A3V A;  5T8I A;  5HS0 A;  2JAB A;  4BX8 A;  3FUK A;  4QQI A;  3P1U A;  3R9M A;  1E7V A;  4CT0 A;  3Q7F A;  1EF1 C;  2XEV A;  3PZ2 A;  3DSU A;  5ITZ F;  5LX8 A;  2I1K A;  1X5B A;  1WY6 A;  1K1A A;  2QYU A;  3CVX A;  5JMN D;  2C0L A;  2KCV A;  4KYO B;  5ENN A;  2DYS E;  2NSZ A;  3AS5 A;  3TXM A;  4GA1 A;  3RRM B;  1P5Q A;  4B94 A;  4TXR A;  2MRI A;  5AN8 A;  4ME2 A;  3ENE A;  3I4G A;  3KAE A;  4OVV A;  3RO2 A;  1TN8 A;  3ZFW A;  2KC7 A;  2IF4 A;  3KD7 A;  4DX7 D;  1H2V C;  2V4H C;  4K0R A;  4JHR A;  2IJG X;  3EU5 A;  3CR3 A;  5B3S E;  1QBQ A;  1SVX A;  3GZ2 A;  3MA5 A;  5ARF A;  3UM0 A;  1EYH A;  5EX3 A;  5BXU A;  3D9L A;  1TNZ A;  4JW1 A;  5KJN A;  4M7C A;  1INZ A;  3SBS A;  3UIP C;  3QWV A;  4JC8 A;  1OCC E;  4NIK A;  3AS8 A;  3FH5 A;  3GZS A;  1HF8 A;  1IQU A;  1E96 B;  2WXQ A;  4GYY A;  3ZVV A;  2NXP A;  2QC9 A;  5B1A E;  5KNH D;  3CK8 A;  3BG0 B;  2DZO A;  3ZYM A;  1DVP A;  3DXM G;  3OXL A;  1OCR E;  4GTV A;  4FA6 A;  1N4S A;  2I2O A;  4JA7 A;  4U95 D;  4FHK A;  5EID A;  3CVL A;  3MJW A;  2MYO A;  3W9F A;  3IEG A;  3QAQ A;  1Z3X A;  3N71 A;  1UOH A;  1JWG A;  1TYQ G;  2EIM E;  2MOW A;  1KLX A;  4G8K A;  2AXV A;  3APC A;  2C2L A;  4AP2 A;  4I1A A;  3UQ3 A;  1FPP A;  2P58 C;  3HVE B;  3MX3 A;  2R02 A;  2DVW A;  2LXL A;  3AAA C;  3L13 A;  3DPD A;  4PS7 A;  4PS3 A;  3D9J A;  3EJN A;  2OV8 A;  2R05 A;  3LJN A;  5JJ7 A;  4FJZ A;  1TNB A;  4I9E A;  1UN9 A;  4XEI G;  3ASO E;  4DX6 D;  3U66 A;  2KBX A;  2E0I A;  3LVR E;  3DEP A;  4UWL A;  4HOR A;  3DXK G;  1FT2 A;  4BWR A;  4CEM A;  3C98 A;  1PAQ A;  5FIO A;  1U3D A;  4E85 A;  1UG3 A;  2AVP A;  3CHS A;  4KT6 B;  3B7U X;  3E32 A;  2X6J A;  1BD8 A;  2X6H A;  4GTP A;  4LUN U;  3HXD A;  2ZXW E;  4N2S A;  5ENO D;  3PUK A;  3APD A;  2P9N G;  4L9P A;  2CHX A;  3V31 A;  2QYJ A;  1SZ9 A;  3SGH A;  1S64 A;  3RK6 A;  1E7U A;  4L7T A;  1E8W A;  2P2C P;  4FLB A;  4CZ2 D;  4KMO A;  1K1B A;  2RKK A;  4C0M A;  3CVV A;  3ESK A;  4F7A A;  3FU5 A;  3JQ0 A;  2IOS A;  1TEZ A;  4FUL A;  4G8L A;  4FP7 A;  3L82 A;  2OEV A;  5FWQ A;  5AJL A;  4F6R D;  1YCS B;  4Y6W A;  3O4Z A;  4B89 A;  3SZ7 A;  3KSL A;  2MHK A;  1AP7 A;  1RW2 A;  2WMN A;  3SFX A;  4L2Y A;  1LD8 A;  2X6I A;  2XCC A;  2ZGG A;  3B7T A;  2HE0 A;  3MKR A;  4LRZ A;  1HH8 A;  3RO3 A;  2FI7 A;  5BT1 A;  4C9B B;  3MV2 B;  4PDX A;  4L23 A;  4JEH A;  3AS4 A;  5EIL A;  3TJP A;  4MKT A;  3AG3 E;  3S7B A;  3CVY A;  3B13 A;  1OXJ A;  5CCM A;  2LO6 A;  4FHJ A;  4DI3 A;  3Q9U C;  3TWX A;  2P9K G;  2VSN A;  4I2W A;  3APF A;  3GW4 A;  2KM4 A;  3D9O A;  4JEU A;  4AIF A;  3TWS A;  4B8C B;  3MKQ A;  4G26 A;  4L2L A;  2BED A;  5FTP A;  3S7J A;  4J8S A;  5ENS D;  2XPY A;  4URK A;  2BUG A;  4X8Q A;  3BUA A;  5DIZ A;  3Q79 A;  4LNB A;  3C3R A;  5HKP A;  1MJ0 A;  2A5U A;  3UKU G;  3RJV A;  1U3C A;  1SA4 A;  3NQP A;  3ZHE A;  3JCK C;  4B93 B;  2HYZ A;  4NQ0 A;  3Q9N C;  3V30 A;  4PH4 B;  3E33 A;  4BT9 A;  4RQI A;  2NYJ A;  3TWV A;  3VLF A;  1TJF A;  4R7L A;  3UM3 A;  4ATG A;  4YDY A;  5D66 A;  3ZUV B;  4DUI A;  1ELK A;  4YND A;  5FZQ A;  3UT4 A;  1AWC B;  3MGB A;  3UIN C;  4N3B A;  3PNT B;  2OVB A;  4FU3 A;  2R03 A;  4GTO A;  2H6G A;  4U8H A;  1PY1 A;  3QKY A;  3FU3 A;  3VLE A;  1JWF A;  2ZIR A;  2GGF A;  1V54 E;  2AW6 A;  3FUH A;  5G2N A;  5JA4 D;  5J90 A;  3IBE A;  2WMO A;  3OAW A;  3CGH A;  4MS6 A;  2YHC A;  2J8S D;  2Q7F A;  2PM7 A;  4GA0 A;  3ZPJ A;  3PVL A;  5C2Y A;  3CVN A;  5JJ6 A;  3UPV A;  1IXV A;  3CHM A;  4EZJ A;  3FTW A;  5CER B;  4N5Q A;  1NA3 A;  1OWO A;  2FBN A;  3IXE A;  1HO8 A;  4CGW A;  2LUH A;  1QNF A;  2UY1 B;  4ANV A;  3PZD A;  3B7S A;  3CHO A;  3I5P A;  3CVQ A;  3NF1 A;  1H6P A;  4Y6C A;  1HU3 A;  5EKQ D;  4G23 A;  3TWT A;  3MZL B;  2EQX A;  1Z3Y A;  3AG4 E;  2XPI A;  3CK7 A;  5AIJ A;  3FUE A;  2IQC A;  1E90 A;  5G04 C;  4CRW A;  3FTZ A;  2WXR A;  1TR4 A;  5JJT A;  5T4Y A;  3Q7A A;  3SFY A;  1LF8 A;  3L22 A;  2DZN A;  2E2E A;  1BU9 A;  3R9A B;  1HG5 A;  2B6C A;  3ZYQ A;  4J8D A;  4KVM A;  4GTR A;  4N2Q A;  5CMY A;  5CMW A;  3RRN B;  4DX1 A;  3U9W A;  1SZA A;  1NI1 A;  3RAU A;  1OUV A;  2WQH A;  4DI4 A;  2HM8 A;  1KPS B;  4UWF A;  2OEW A;  2J49 A;  3MEK A;  2PL2 A;  1OY3 D;  3ABM E;  3O48 A;  4KBQ A;  4UUC A;  2R17 C;  3AU4 A;  3QWP A;  3ML9 A;  1N4R A;  4G25 A;  4TXP A;  3CK9 A;  2CHZ A;  3RU0 A;  3S2A A;  5CHE E;  3T8K A;  3KEZ A;  3PRE A;  5IY5 E;  2WXG A;  1XNF A;  3ZRH A;  4N39 A;  2DIW A;  5E75 A;  3ZYL A;  3PZ1 A;  4BET A;  4CDR A;  3FUI A;  4F1S A;  5BW8 C;  2XS1 A;  4LNG A;  4UI9 J;  4XKB A;  3QK0 A;  3B7R L;  2I1J A;  4U7E B;  5LCW J;  3QB2 A;  4GCO A;  4U07 A;  4YDO A;  3HXE A;  3VTY A;  4C48 B;  3R7R A;  4ILI A;  4UWG A;  3UM1 A;  2CFU A;  4EEC A;  2XS8 A;  5EIB E;  2GRR B;  3G2T A;  4N3A A;  2WQ6 A;  5M72 A;  3ZEF A;  2GRL A;  5FIN A;  3JUI A;  4ANW A;  3ZKJ A;  4GA2 A;  1HXI A;  4YDW A;  1LTX A;  4XE0 A;  2QZA A;  2L0T B;  5G05 J;  3MYV A;  4GZD A;  1FVH A;  3KSQ A;  2WXL A;  4EBA A;  3FTU A;  1SW6 A;  5EYP F;  3EIQ C;  3PS6 A;  2VTB A;  3QNK A;  1A5E A;  2V0P A;  2FO7 A;  1MQS A;  4YVQ C;  3CKC A;  2PQN A;  1KT1 A;  2PNN A;  4U96 D;  1MX4 A;  1HG2 A;  4GTQ A;  2XCB A;  3RRU A;  3SO8 A;  3Q73 A;  4OAU C;  1EDU A;  3HYM B;  4RG9 A;  2WXM A;  4N5C A;  3IKO B;  5EYL A;  1K3Z D;  5EN5 D;  3E30 A;  3CHR A;  2P9I G;  1UJK A;  4JA9 A;  2WM9 A;  3TWW A;  4U8V D;  1LD7 A;  4U0S A;  5J08 A;  4U04 A;  1O1T A;  3B7B A;  5LP0 A;  3EHR A;  3Q15 A;  5AEN A;  5H7P A;  1OWP A;  1S0P A;  4O6F A;  5B1B E;  5E76 A;  2ZIS A;  4WNG A;  2XGO A;  3PRZ A;  2H6I A;  3ASN E;  1UW4 B;  1WG0 A;  2J4D A;  3E34 A;  1PC2 A;  2GRO B;  4D10 C;  4GZ3 A;  2GRM A;  5BUZ A;  3PH0 C;  4GCN A;  4YVO A;  4A55 A;  3CHP A;  3UI2 A;  5AAR A;  3URZ A;  5BV1 A;  3PEU B;  5T3R A;  2P9S G;  2EIK E;  1JUQ A;  1H6O A;  3TWQ A;  1V55 E;  2L0I A;  2OCC E;  5FQ7 A;  2J07 A;  3BU8 A;  2EIJ E;  5HRY A;  4FLH A;  3UIO C;  4H7Y A;  1MYO A;  3CSF A;  3FUJ A;  3AU5 A;  2IO3 C;  2WVI A;  4O1O A;  5ANR A;  1NL4 A;  4QFV A;  4I1M A;  4GTM A;  4GZC A;  3TAX A;  3CHQ A;  4GPK A;  3PDN A;  1H19 A;  3PE4 A;  3TG5 A;  2IEJ A;  4J7W A;  3TG4 A;  3NZU A;  3MCX A;  1QZ2 A;  3Q5M A;  1E8Y A;  3ZXP A;  3VLD A;  1TNY A;  4WWP A;  2Y69 E;  3HXB A;  2J09 A;  4HBD A;  5ANL A;  3L6A A;  2B0O E;  5KCM A;  4KVO A;  3E4B A;  4B8A A;  3LY9 A;  4ZHB A;  4EQF A;  2CG3 A;  3CEQ A;  4GAA A;  3SD5 A;  4OAV B;  4HI9 A;  2BKK B;  4PS8 A;  2PM6 A;  4KZC A;  2XPZ A;  3DRA A;  3EDT B;  3ULQ A;  3T9K A;  1IKN D;  1N0R A;  1NZN A;  3I4R B;  2VGX B;  1N11 A;  3LYA A;  5KJL A;  4RG6 A;  2I6H A;  1S63 A;  2X38 A;  3OXF A;  4Q94 A;  4FAD A;  4HRM B;  1BPO A;  3HXF A;  4IRU A;  1KZP A;  5CEA A;  5ENR D;  3FUL A;  4O60 A;  2LAH A;  5FZS A;  5KJK A;  4EZK A;  2BF0 X;  3DSS A;  2EIL E;  3DWL G;  3NOC D;  3FP3 A;  3HRA A;  2VSY A;  4IN3 B;  5DBK A;  2FF4 A;  2ETC A;  3EU9 A;  4JL0 A;  3NZS A;  1FCH A;  4PUC A;  2WXN A;  2EIN E;  1HE8 A;  4AOF A;  1D8D A;  2KZT B;  3R7Q A;  2WXH A;  4GZ6 A;  3LVQ E;  2NC9 A;  3CVP A;  2PZI A;  3LDZ A;  4J6I A;  2CFZ A;  4I2Z A; 
#chains in the Genus database with same CATH homology
 1LD8 A;  3Q75 A;  4GTO A;  1TNZ A;  2H6G A;  3E34 A;  3HXC A;  3DST A;  1TNO A;  3DRA A;  2R2L A;  1LTX A;  1NI1 A;  2ZIR A;  4EHM A;  1FT2 A;  1N95 A;  3EUV A;  1TN7 A;  1S63 A;  4YDE A;  3KSQ A;  1TN6 A;  1N4R A;  3DSW A;  3HXF A;  1KZP A;  1SA5 A;  3E32 A;  3Q7F A;  1N94 A;  3PZ2 A;  3DSU A;  4GTP A;  4GTV A;  1O5M A;  1N4P A;  1JCS A;  1N4S A;  1FT1 A;  3HXD A;  1D8E A;  2BED A;  3DSS A;  3DSX A;  4L9P A;  4MBG A;  1O1R A;  3Q78 A;  1MZC A;  4GTQ A;  3Q79 A;  3Q73 A;  4LNB A;  3PZ1 A;  1NL4 A;  4GTM A;  1O1S A;  1JCR A;  1S64 A;  2H6F A;  4LNG A;  1SA4 A;  2F0Y A;  1N4Q A;  3E30 A;  2IEJ A;  1TNU A;  1TN8 A;  1DCE A;  1LD7 A;  1O1T A;  1TNY A;  3PZ3 A;  1FPP A;  1D8D A;  3E33 A;  3HXB A;  2H6H A;  4GTS A;  4YDO A;  3HXE A;  1N9A A;  3E37 A;  3EU5 A;  4GTR A;  3DSV A;  1X81 A;  3DPY A;  3Q7A A;  3SFY A;  3PZ4 A;  1QBQ A;  2ZIS A;  1KZO A;  3KSL A;  1TNB A;  1JCQ A;  3C72 A;  2H6I A;  4GTT A;  3SFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...