3KD7A

Designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
102
structure length
102
Chain Sequence
b'NSAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTPR390
publication title Crystal structure of a designed tetratricopeptide repeat module in complex with its peptide ligand.
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
total genus 41
structure length 102
sequence length 102
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3kd7A00
5A7DB 3SF4A 3Q15A 3ASHA 3EDTB 4UQXA 4WUYA 2KC7A 2MHKA 3VTYA 4G25A 2UY1A 1ZU2A 4HOTA 2LNIA 3S7JA 5ARFA 4JA7A 3LCAA 2Q7FA 4HOUA 5M72A 5BT1A 5JJ6A 5G04J 5EX3A 3TG5A 4I1AA 5FJYA 5KJMA 4F3VA 3S7FA 2QFCA 3ZN3A 4HORA 3ZPJA 3Q49B 1XNFA 4JL0A 4U04A 4WNEA 4XI9A 2XGOA 3RJVA 4RG9A 3MV2B 2PZIA 3E4BA 4AY6A 3RU0A 2JLBA 4N39A 2FEZA 3PE3A 3ASGA 2KCLA 2IFUA 3ESKA 3PDNA 5EX0A 1P5QA 3LYAA 4ABNA 4RG6A 4AIFA 3MKRA 3ASFA 3AS4A 4W9RA 2XCCA 4I9CA 5KJKA 3OXLA 2J9QA 4GCOA 2NC9A 4NRHB 3GZ2A 4Y6WA 3QOUA 1A17A 2KATA 4UI9K 1HZ4A 1QQEA 3QDNA 3ZGQA 2WQHA 3TGOA 3N71A 4N2QA 5JJ7A 2KCKA 2LSVA 3CV0A 4Y6CA 5G04C 3UUXA 3JYSA 1Y8MA 3ZHEA 3PE4A 4U0UA 3GZ1A 5FTPA 4O6FA 4U0ZA 3ULQA 3Q5MA 4GYOA 4UQZA 1PC2A 3CKCA 5FT9A 2L6JA 4UI9J 3FP3A 3QKYA 2XGSA 4I2ZA 1QZ2A 3KAEA 4KXKB 1WM5A 2R5SA 3TG4A 3LY9A 3IEGA 4G23A 4A1SA 5FZRA 4WNFA 4LEUA 3R9AB 2BUGA 4KBQA 1ELWA 1B89A 5LCWJ 4BTBA 3UQ3A 2OOEA 5FZQA 3CVPA 1YA0A 4U07A 2VSYA 2ONDA 4WNDA 3CK8A 4JA9A 3VTXA 4J8DA 3U3WA 2UWJG 4H7XA 3MV3B 4GCNA 4BTAA 1KLXA 2PQRA 3RKVA 2HR2A 2V5FA 4B94A 3QWWA 4N2SA 2FBNA 4UQYA 4JHRA 2FF4A 5G05J 3URZA 5BW8C 2HO1A 2VGYA 5D0QD 2PQNA 1TJCA 1NZNA 4N5CA 4CGVA 2IF4A 2AVPA 3RIBA 3U4TA 5D0OD 3ASDA 4GPKA 5DBKA 3LY8A 2YHCA 2XGMA 5KJLA 3ZHEB 1OUVA 2P58C 3Q4AB 1E96B 4J8FA 4UI9C 3CVQA 3SZ7A 5CCMA 2C0LA 3OXGA 2UY1B 3ZFWA 4XI0A 4J8EA 5CHEE 1W3BA 3FWVA 2VQ2A 4GYWA 2C2LA 3LKUA 4IN3B 4J0UA 3RO3A 2VSNA 3S7DA 4ME2A 4N3BA 2FI7A 4U0SA 5LCWC 3WXXA 5BNWA 4GZ3A 1NA3A 3QWPA 2E2EA 3TAXA 3GYZA 2VGXA 2Y4UA 2C0MA 1HH8A 2HYZA 4GA2A 4BT8A 2VYIA 2PL2A 3MEKA 5AYWD 3NF1A 1WAO1 5A6CA 4CGWA 3BEEA 3RO2A 4WNGA 3CKBA 1IHGA 4GA0A 4G1TA 4I17A 1FCHA 5G05C 3GW4A 1KT1A 1HXIA 2Y4TA 3CVLA 3LY7A 3K9IA 3KD7A 4AM9A 4N3AA 4YNDA 2XPIA 4NQ0A 1ZBPA 4GA1A 2XCBA 3AS5A 1NA0A 3CK7A 5KJNA 4H7YA 4BT9A 2I6HA 3S7BA 4GYYA 5EKQD 5CCLA 3KS2A 2KCVA 3HYMB 5HQ8A 4CDRA 4BWRA 4G26A 5FZSA 2LSUA 4APOA 3CEQA 2XEVA 4YVQC 4G2VA 3OXFA 3CVNA 4AY5A 4XIFA 4YVOA 3LPZA 5JJTA 1KT0A 2YQ8A 1ELRA 3QWVA 4GZ5A 3AS8A 4KYOB 4HOSA 4N3CA 4G24A 3O48A 3CK9A 3FFLA 4HOQA 3UPVA 2DBAA 2GW1A 2FO7A 3Q47B 2WPVA 2VGXB 4I9EA 4GZ6A 5HI7A 4EQFA 5C1DA 4I2WA 1IYGA 5ARGA 3MA5A 5DIZA
chains in the Genus database with same CATH superfamily
4CT0A 3HXEA 4UQXA 5BXUA 4WUYA 2KC7A 2M63A 2P9UG 2GRRB 3FH7A 4ANVA 4URKA 4M3OA 2BTDA 2XZTG 1TNZA 3S7JA 1NL4A 2Q7FA 4HOUA 4HQDA 3L6AA 4BX8A 5BT1A 4I43A 4RQIA 4RVBA 4HI9A 1HE8A 3SQVA 4I1AA 3TWTA 5E76A 5FJYA 2KXPC 4F3VA 3ZN3A 5CECB 3Q49B 4U04A 4FU3A 4WWPA 4J8YA 4XI9A 4CT4A 2FULA 3IKOB 3APCA 2IO2C 4N39A 2FEZA 3PE3A 4I6EA 2KCLA 1IHBA 2AXVA 4LG6A 4EHMA 4ABNA 3B13A 4LNUD 3ZUVB 4L2YA 1TNYA 1MZCA 1EF1C 5KNHD 3Q79A 3L9TA 3PZDA 2ZGDA 5AJDA 5KJKA 3EHQA 2NC9A 4FP7A 4Y6WA 5EDSA 3SFYA 1MYOA 2KATA 2P9PG 3T5XA 3AG2E 1HZ4A 1INZA 4J7WA 3SBTB 3ASNE 1OCCE 4EECA 1N0RA 4GTPA 3CVVA 2WQHA 4ATZD 3TGOA 3C3OA 2GRNB 1IXVA 3UT4A 4DX6D 3RSEG 4RSYA 3EHMA 3DSVA 4LCTA 4O6FA 3HXDA 5ENRD 2AXZA 1H2TC 3FDHA 4GYOA 4U95D 1TEZA 3CKCA 4DX2A 3PREA 3R9MA 3E37A 1QZ2A 1N95A 3KAEA 3OAWA 4JD2G 3SI5A 4DI3A 4HRMB 1VDYA 4B89A 3UM0A 3QB2A 3PZ1A 2ZXWE 1TNBA 4KBQA 1ELWA 4ILIA 3CVXA 3KEAA 4BTBA 2J07A 4A55A 4U07A 4K5BA 1S70B 2VSYA 4OAVB 4JEHA 3MGBA 2XEHA 1HF8A 1HG5A 4EPZA 3IHVA 2ZU6B 2HM8A 3U9WA 3FHEA 3E33A 1H2UA 2UWJG 4GCNA 4GMLA 3TXNA 2WQ6A 3QWWA 4N2SA 3UM3A 2FBNA 3ASOE 4FJYA 4HBDA 1H19A 4UQYA 2X38A 4YDEA 2HO1A 2VGYA 1TJCA 3D9JA 3FTWA 1NZNA 2GGFA 2IF4A 2XHEA 2AVPA 2PM6A 1O1TA 3PRZA 4MBGA 5DBKA 3VLEA 4TXRA 5FQ8A 2XGMA 1OUVA 3L82A 1Z5SC 2WXRA 3BQOA 5CCMA 1HFAA 3FH5A 3CVWA 4HRLA 1FVFA 3PNLB 4Q69A 1W3BA 2WMNA 4IN3B 3FH8A 4J0UA 3TWVA 5D66A 2FI7A 1MHQA 4BERA 1ZB1A 2L9BA 2WXKA 3I4GA 2C0MA 4O1OA 1HH8A 5CMWA 2HYZA 4L1BA 1SW6A 4GA2A 2CFZA 4BT8A 1WAO1 3P1UA 4CGWA 4FJZA 4WNGA 3C3QA 5B1BE 1JCSA 4GA0A 3EU9A 1QNFA 3RAUA 5LX8A 3GW4A 5LOZA 1KT1A 3D9MA 3LY7A 4A63B 4J6IA 3TWQA 3KD7A 4AM9A 5AENA 1JPLA 2LUHA 1X81A 4GPMA 4YNDA 3D9OA 1TNUA 1Q2ZA 4BFRA 2WXOA 1NA0A 3AS5A 2CFUA 2ETCA 4HLEA 3ESLA 3S7BA 3ZIMA 1U2VG 2GRPB 5FWQA 3AU4A 1YCSB 3CIAA 3FTZA 1V55E 4BWRA 5D2MC 4DX1A 5FZSA 2LSUA 3FTVA 4BX9A 4JZYA 1OT8A 2XEVA 4G2VA 5T3RA 3UM2A 1OWNA 4AY5A 3LVRE 3TWRA 2YQ8A 4JEUA 2GRQB 1FT1A 4YDOA 4QFVA 2GRLA 2IOLA 4MS6A 2X6KA 5T8IA 4AVXA 3Q47B 5AQ7A 2VGXB 3PEUB 3SGHA 1DNPA 5EIBE 2P9LG 4FADA 4I2WA 2OEVA 5ARGA 4QQIA 3MA5A 4XKBA 2MHKA 2P9SG 4O1PA 5BV1A 1K1BA 4BY6A 1H2VC 2CHWA 5ENSD 2WXPA 4I6GA 3V2XA 5ARFA 2DZNA 4PS7A 3QARA 1O5MA 3FUEA 3NZSA 4HLLA 1JUQA 5EN5D 1BPOA 2RD0A 3UX4A 2WXLA 4HORA 2AWIA 3BUAA 1E7VA 4DI4A 3AU5A 2LAHA 5IY5E 1GW6A 3MV2B 2PZIA 3FEXA 3PZ3A 4AY6A 2JLBA 3BG1B 1N4QA 3P2BA 2B6CA 3PDNA 5EX0A 4L7TA 2H6GA 2R03A 3B7UX 2WVIA 3TWXA 1N94A 4XE0A 4AIFA 4FULA 5FINA 1LD7A 3MKRA 1E7UA 3HXCA 3L13A 3ASFA 3ZXPA 3AS4A 3L22A 3FY4A 3JQ0A 3JXJA 5AQ9A 3CSTA 3FTXA 2J9QA 4GCOA 2Y1LE 1A17A 4L9PA 4UI9K 2IJGX 1U3CA 2HE0A 5ITZF 1QQEA 3VLFA 2V4HC 3D9IA 3AG3E 4UWFA 4AP2A 4UWKA 4DX7D 1KZPA 4N2QA 2DWZA 3DXKG 4YDYA 4GTRA 4HI8A 4KT6B 1TNOA 4ZHBA 3JYSA 1OCOE 3PE4A 2BKGA 5FTPA 3FU5A 1E8WA 2R2LA 3ULQA 3EIQC 3L17A 1Y6IA 2BKKB 4ANWA 4DUIA 2L0TB 1E90A 1UN9A 1YYHA 2R5SA 3UTMA 2CHXA 4G23A 5FZRA 1HO8A 3ZYLA 4L2LA 1SA5A 4G8LA 3R9AB 2BUGA 2P2CP 1K3ZD 1B89A 2LAIA 3G2VA 4U96D 3B7BA 3UQ3A 4A3VA 3CVPA 1YA0A 2ONDA 4WNDA 3HHMA 5BUZA 3DSUA 4JA9A 3X2QE 1H6PA 2XPZA 3C72A 4CZ2D 4HB5A 4OAUC 3RKVA 3TL5A 4KZ0A 1YMPA 2V5FA 3DWLG 4E85A 3KSLA 3LXUX 5AARA 4PDXA 2FF4A 2AJAA 2NSZA 2EIJE 5FQ4A 3SNXA 4CGVA 1WY6A 2X6IA 3LS8A 5AIJA 3RIBA 1TR4A 4E6HA 3U4TA 3L54A 3ZNGA 2LXLA 3UIOC 3QJZA 5ANLA 4HRNA 2YHCA 4YDWA 3ZHEB 4A1GA 5C2YA 1E96B 4G8KA 2XRZA 2XENA 1JWFA 2L6BA 4F6RD 2J08A 3CVQA 3RRUA 3I4RB 5ENQD 1TN8A 3OXGA 3EIJA 2XRYA 3ZFWA 4XI0A 4NIKA 4J8EA 1MX6A 5AJLA 5CHEE 3NZUA 3FWVA 3SFZA 4CRWA 3PEVB 4D10C 4I6JA 2CHZA 2J4DA 2WXGA 2F8XK 3CQGB 3S7DA 4UWLA 4ME2A 3LJ3A 1NA3A 4XEIG 3MZLB 3QWPA 2E2EA 3QNKA 2VGXA 3E32A 3HXBA 3LJNA 3O4ZA 4GZDA 4PH4B 3EUVA 4AV7A 5EILA 4B8CB 4XKCA 3QK0A 2VYIA 2PL2A 3MEKA 2MYOA 3LEWA 3KSQA 2V4LA 4CYMD 5A6CA 4FHKA 3T8KA 1H6OA 3U64A 3I5PA 3RK6A 1FCHA 4HS2A 3ML9A 1BD8A 5KCMA 2F8YA 3JQ1A 1HXIA 4Q94A 2Y4TA 2J4BA 3K9IA 4B0ZA 4JW1A 5BPPA 4GA1A 3Q9NC 4EBAG 4NURA 5AAOA 4CDNA 3CK7A 5KJNA 4H7YA 4WWOA 3V79K 4LERA 2XS1A 4IULA 5CCLA 3ZXSA 2IO3C 3C98A 1OWOA 3ZYKA 1AP7A 4G26A 5JMND 4APOA 3APDA 3CEQA 3NOCD 4BESA 3FUJA 2I1JA 1RZ4A 3UM1A 3OXFA 2WXNA 4B8AA 2EILE 3CVNA 1TYQG 3Q9UC 3JUIA 3QWVA 3AS8A 3PVLA 5H7PA 4N3CA 1IQUA 3W9GA 3AG4E 2B0OE 4AJWA 4GZCA 4HOQA 3TWWA 3UPVA 3APFA 2GW1A 1MX2A 4GTSA 4GTQA 1Z3YA 4I9EA 5CBOA 1JCRA 4GZ6A 4ACKA 3LDZA 2J8SD 5FQ6A 2ZGGA 3LVQE 1FPPA 5DIZA 5A7DB 1QYMA 2NXPA 2MRIA 2UY1A 3ULYA 3Q78A 4HOTA 4B93B 2LNIA 1X5BA 4MKTA 5M72A 3CHSA 2J09A 3MCXA 2LXMA 4JC8A 5A23A 5JJ6A 5G04J 4WWNA 2IU1A 5EX3A 3TG5A 2DIWA 2Y0BG 3CR3A 1QBQA 3SO8A 3UI2A 5KJMA 2JABA 3ZRHA 2E0IA 2EIKE 3IV0A 2IOSA 3MKQA 3G2SA 2XGOA 3CSFA 4RG9A 1N0QA 2R05A 3E4BA 1E8YA 5CMYA 2QYUA 3D3MA 4DRXE 3RU0A 1K1AA 3R7QA 3DEOA 3ASGA 2IFUA 3ESKA 1NFIE 4Z68A 3ABLE 2VSXE 3HRAA 4TV3A 3LYAA 1IQRA 4RG6A 1UJKA 2KBXA 4A3TA 4LUNU 3Q73A 1LD8A 4JHJA 3V30A 4W9RA 4HFGA 2XCCA 2A5UA 2ETAA 2IY0C 3NBNB 3SFXA 4NRHB 3Q7FA 3B7SA 5ANRA 2V0PA 3JXIA 3ML8A 3QDNA 3HIZA 3FU3A 4ILHB 4LNBA 4F7AA 3CHMA 1EDUA 3EHRA 3N71A 1PAQA 4DPRA 3PS6A 4Y6CA 4C48B 1OCRE 2EINE 4X8QA 3ZHEA 4C0EA 4U0ZA 4TUUA 1OY3D 1PY1A 1LTXA 1SZAA 4OYSA 1PC2A 4TXQA 5FT9A 4EZJA 2L6JA 4UI9J 1SVXA 3FP3A 3WG7E 2XGSA 5HS0A 3NOGD 3SBSA 4KXKB 3FTUA 4CEMA 1WM5A 5KNGA 3LY9A 2AXUA 4A1SA 5JHBA 1HG2A 4WNFA 2XZDG 2WXMA 2BF0X 3NQPA 4F1SA 5LCWJ 2RG8A 5BXOA 3QAQA 2OOEA 1SA4A 4ATGA 3PH0C 1AWCB 2PNNA 2VTBB 1BI8B 5ENTD 3CK8A 5JHAA 4I1MA 3SY2A 3VTXA 1D8EA 3ONKA 1TN6A 3ABME 3U3WA 4TRQA 1MJ0A 1KLXA 2PQRA 2HR2A 3AG1E 2Y69E 3DPDA 2WXHA 4OVUA 5G05J 1OWMA 4ANXA 3IBEA 5D0QD 1K8KG 2PQNA 4N5CA 2AW6A 4APFA 4M7CA 3G2TA 5D0OD 2DVWA 3ASDA 2ZIRA 4GPKA 2DYRE 3LY8A 2WXQA 1LF8A 2R17C 2P58C 3Q4AB 3TWSA 1G3NB 1HU3A 3DSWA 2C0LA 1S64A 2I9CA 2KZTA 2UY1B 4K03A 4JB8P 2XPYA 4GTOA 4UUCA 1FVHA 4KZCA 4AXHA 2C2LA 3OTNA 3ZVVA 3PUKA 4CCAA 3U66A 2R59A 1A5EA 3SD5A 5JA4D 2WXJA 3UKRG 3WXXA 5BNWA 3DSXA 4V3IA 5KBAA 2ILRA 3TAXA 2Y4UA 3MKQB 4ILGA 5AYWD 2RKKA 3JUEA 3BEEA 3CHRA 3RO2A 1H0AA 4GU5A 4FLHA 1IHGA 4KMOA 4PS3A 3AJIA 4HVBA 3PZ2A 1JCQA 2L0IA 2P9IG 3CVLA 3CVYA 4N3AA 3IHYA 4CDMA 2DYSE 2XCBA 4Q96A 3PZ4A 2YHEA 3D9PA 2OV8A 5J08A 3HDXA 5EYPF 1TJFA 2CG2A 2X6JA 3FU6A 1Z3XA 3D9LA 3B95A 5EKQD 2YNQA 2CG3A 3DBSA 3HYMB 3UIPC 4ZFHA 2X6HA 5HQ8A 2DZOA 4CDRA 3QC1A 3V2OA 3B7RL 2YINA 4PUCA 1N4SA 4FA6A 1ELKA 4XIFA 3LPZA 5JJTA 3ZYMA 1KT0A 1ELRA 4RLYA 5CRUA 4GZ5A 4U7EB 3T5VA 2PM7A 4KYOB 2A5EA 2X3MA 5B1AE 2BEDA 4F1PA 3O48A 4BEPA 3CK9A 3FFLA 5G55A 2WXFA 5EIDA 2F0YA 3MJWA 1H6KA 2KM4A 1E8ZA 2RFAA 4TXPA 4O60A 5HI7A 5ENPD 4LRZA 5C1DA 4K5CA 3CHQA 1EPUA 1IYGA 1WDYA 5BV0A 2XS8A 3JCKC 1N9AA 4GB9A 3SF4A 3Q15A 3ASHA 3EDTB 3VTYA 4G25A 5CRVA 4GTVA 4FC8A 1EYHA 1S0PA 3BU8A 4BSXA 4IRUA 1ZU2A 2J49A 1E8XA 2F37A 4JA7A 3LCAA 3ISMC 4DX5D 2OCCE 1TN7A 1MX4A 4K0RA 1UJJA 3FUKA 2FO1E 4EZLA 1BU9A 4EZKA 2WM9A 1D9SA 3S7FA 2QFCA 4GMJA 4AEZC 3ZPJA 1XNFA 4JL0A 4WNEA 3ABKE 3RJVA 5HRYA 3C5RA 3FTSA 4U8VD 5EYLA 3ZEFA 4JXTA 2RFMA 2H6HA 5FIOA 4N5QA 1Z6TA 3TJPA 4C9BB 5AQBA 3ZU7B 1P5QA 2VTBA 1WG0A 4XZ4A 2R02A 4BSZB 3ZYQA 2KZTB 4U8YD 4I9CA 1HS6A 3OXLA 1N11A 4JVSA 1DCQA 2VJ8A 3GZ2A 1KZOA 2OVFA 3RRNB 3FUNA 3QOUA 3HVEA 3CGHA 3ULEG 3FTYA 5ENNA 2LO6A 3CQCB 3DSTA 3G2WA 3ZGQA 2QYJA 2QC9A 1BLXB 5JJ7A 2KCKA 2LSVA 3CV0A 3NB2A 2I1KA 5G04C 4U8HA 3UUXA 1Y8MA 4G11A 4U0UA 5AQAA 3ZW3A 3GZ1A 3Q75A 3UMVA 2I2OA 3Q5MA 2V8SE 4PS8A 3PUJA 4L23A 5KWDA 4UQZA 3S2AA 1IKND 5CERB 3E30A 3J5PA 1OWPA 3QKYA 1DC2A 4I2ZA 5ENOD 1UN8A 3R7RA 3E34A 5T4YA 3G2UA 4GMRA 4K5AB 3Q7AA 3TG4A 4DLOA 3HXFA 3IEGA 1SQMA 4TUMA 1JWGA 2WMOA 5CBNA 2ZISA 4LEUA 1RW2A 4F53A 1UG3A 4MRUA 2QZAA 4JHKA 5FZQA 1N54A 1UOHA 5B3SE 4UWHA 3D9NA 5CEDB 3L08A 2V5QC 3HG0D 3W9FA 3B7TA 1L5JA 3T8MA 2H6FA 4J8DA 2OEWA 4H7XA 3MV3B 4BTAA 4ANUA 2VSOE 1DVPA 3IXEA 4B94A 1D8DA 2EQXA 3MYVA 4JHRA 3URZA 5BW8C 3D9HA 3UT7A 4KVOA 4DLQA 3GZSA 4BETA 4U63A 4OVVA 4KVMA 4AOFA 2GROB 3ZKJA 2IEJA 1FT2A 3FEYA 2P9NG 3L16A 5KJLA 2H6IA 5LP0A 4J8FA 4UI9C 3SZ7A 3EJNA 4WAFA 1DCEA 4ACLA 4HNAD 3TXMA 1BI7B 2VQ2A 3NAWA 3LKUA 4GYWA 3I3NA 3D9KA 3DEPA 3RO3A 2VSNA 3DSSA 4FHJA 1N52A 3SHFA 3RRMB 4N3BA 4LSZE 4U0SA 5LCWC 4LNGA 2GRMA 3UINC 4GZ3A 1XGWA 3FUIA 3GYZA 3BG0B 2XEEA 5E75A 1O1RA 4GTTA 4MLPA 4HXIA 3NF1A 1U3DA 2EIME 3CKBA 1S63A 4IYPA 2IQCA 4G1TA 4I17A 5FQ7A 2MOWA 2P9KG 4GAAA 3CHPA 5G05C 3CHOA 4GTMA 4NACA 4C0MA 3UXGA 3ONLA 2WB2A 2X6FA 5CEAA 4JPSA 3EHNA 3KEZA 2XPIA 4NQ0A 1ZBPA 3FUFA 1OCZE 1V54E 3FU0A 5LFAA 3HVEB 5HKPA 3AAAC 4I1OB 4BT9A 1O1SA 1KPSB 2I6HA 1N4RA 1N4PA 3FUHA 4GYYA 3KS2A 3FUMA 2NYJA 2KCVA 2WQ7A 1OWLA 2A4ZA 3V31A 3DRAA 4EBAA 1OXJA 1NP7A 3EU5A 4XX5A 2Y3AA 3UKUG 4R7LA 4FLBA 4YVQC 5J90A 2QY7A 4J8SA 3ENEA 4UWGA 3CVUA 3MX3A 1UW4B 5AN8A 1HX8A 4YVOA 3J5QB 2ETBA 2DCPA 2VGEA 2WXIA 3PNTB 3VLDA 5G2NA 4HOSA 3FUDA 3UT8A 3TWUA 4G24A 3DXMG 4P29A 3DPYA 1NI1A 2DBAA 2XQ0A 2FO7A 3FULA 2WPVA 3CLJA 3F6QA 4DJAA 2IONA 2JEKA 4EQFA 2OVBA 1MQSA 3T9KA 4DK5A 3C3RA 1SZ9A
chains in the Genus database with same CATH topology
5A7DB 4GB9A 4CT0A 3SF4A 2NXPA 3ASHA 3EDTB 2MRIA 3Q15A 2KC7A 2M63A 2MHKA 4UQXA 4WUYA 4XKBA 4G25A 3VTYA 3FH7A 4ANVA 5BV1A 4URKA 4FC8A 1EYHA 1S0PA 2UY1A 4BSXA 4BY6A 4M3OA 4IRUA 1H2VC 2BTDA 2CHWA 1ZU2A 2J49A 1E8XA 4HOTA 2WXPA 4I6GA 2LNIA 3S7JA 5ARFA 1X5BA 4JA7A 3LCAA 2Q7FA 4PS7A 3QARA 4HOUA 4MKTA 5M72A 3FUEA 3CHSA 3NZSA 2J09A 3L6AA 1JUQA 3MCXA 4BX8A 4JC8A 4I43A 5A23A 5BT1A 5JJ6A 4RVBA 5G04J 4WWNA 4K0RA 2IU1A 1HE8A 1UJJA 5EX3A 3TG5A 3FUKA 2DIWA 1BPOA 2RD0A 4EZLA 4I1AA 3UX4A 3CR3A 5E76A 5FJYA 5KJMA 4EZKA 2WM9A 2WXLA 4F3VA 3S7FA 2QFCA 3ZN3A 4HORA 4GMJA 2AWIA 3ZRHA 3ZPJA 4AEZC 1E7VA 3Q49B 1XNFA 2E0IA 3IV0A 4JL0A 4U04A 4WNEA 2IOSA 4DI4A 3MKQA 4FU3A 3G2SA 4WWPA 3AU5A 2LAHA 4XI9A 2XGOA 3RJVA 3CSFA 4CT4A 1GW6A 3MV2B 2PZIA 3E4BA 3FEXA 4RG9A 1E8YA 2FULA 3FTSA 3IKOB 5CMYA 3APCA 4AY6A 3D3MA 3RU0A 2JLBA 3ZEFA 4JXTA 4N39A 3R7QA 2FEZA 3PE3A 4I6EA 3ASGA 3BG1B 2KCLA 2IFUA 1Z6TA 3ESKA 3TJPA 4C9BB 2VSXE 2AXVA 3P2BA 3PDNA 5EX0A 1P5QA 4L7TA 4TV3A 2VTBA 3LYAA 3B7UX 2WVIA 4ABNA 3B13A 1IQRA 4RG6A 1UJKA 4XE0A 4A3TA 4LUNU 4AIFA 4FULA 4XZ4A 5DIZA 3MKRA 1E7UA 3L13A 3ASFA 4JHJA 3AS4A 3L22A 4W9RA 4HFGA 4L2YA 3ZYQA 3FY4A 2KZTB 2XCCA 1EF1C 3JQ0A 2A5UA 4I9CA 3PZDA 3CSTA 1HS6A 3FTXA 5AJDA 5KJKA 3OXLA 2J9QA 4JVSA 4GCOA 2NC9A 4NRHB 2VJ8A 3GZ2A 4FP7A 4Y6WA 5EDSA 2OVFA 3RRNB 3FUNA 3QOUA 3HVEA 1A17A 2KATA 3B7SA 3CGHA 4UI9K 5ANRA 2IJGX 1U3CA 2V0PA 3FTYA 5ENNA 3T5XA 2LO6A 3CQCB 1HZ4A 3G2WA 3ML8A 1QQEA 1INZA 3QDNA 3HIZA 3SBTB 3VLFA 3ZGQA 3FU3A 4ILHB 3D9IA 4UWFA 4F7AA 4EECA 4AP2A 3CHMA 3CVVA 2WQHA 1EDUA 3TGOA 4UWKA 3N71A 1PAQA 4DPRA 4N2QA 5JJ7A 2KCKA 2LSVA 3CV0A 3PS6A 3UT4A 4KT6B 4RSYA 2I1KA 4Y6CA 5G04C 3EHMA 4U8HA 3UUXA 3JYSA 4LCTA 1Y8MA 3ZHEA 3PE4A 4G11A 4U0UA 3ZW3A 3GZ1A 5FTPA 3FU5A 4O6FA 3UMVA 2I2OA 4C0EA 4U0ZA 1E8WA 4TUUA 2AXZA 3Q5MA 3ULQA 1H2TC 3EIQC 2V8SE 4PS8A 3PUJA 3FDHA 1PY1A 1SZAA 4GYOA 4L23A 4UQZA 4OYSA 1TEZA 1PC2A 3CKCA 3S2AA 3L17A 1Y6IA 3PREA 5FT9A 4EZJA 4ANWA 2L6JA 4UI9J 1OWPA 3FP3A 3QKYA 2XGSA 4I2ZA 1QZ2A 1UN8A 3SBSA 3R7RA 2L0TB 3FTUA 3KAEA 3OAWA 4KXKB 5T4YA 3G2UA 1E90A 4CEMA 3SI5A 4DI3A 1WM5A 1UN9A 1VDYA 2R5SA 3TG4A 3LY9A 4B89A 4DLOA 2AXUA 3IEGA 2CHXA 4G23A 1SQMA 4A1SA 5FZRA 5JHBA 1HG2A 4WNFA 1JWGA 1HO8A 3ZYLA 2WMOA 3QB2A 4L2LA 4LEUA 2WXMA 3R9AB 4F53A 2BF0X 2BUGA 4KBQA 1ELWA 3NQPA 4F1SA 1B89A 5LCWJ 2LAIA 4A55A 1UG3A 2RG8A 4ILIA 4MRUA 3CVXA 3G2VA 3QAQA 4BTBA 3UQ3A 2J07A 2OOEA 4JHKA 5FZQA 3CVPA 1N54A 4A3VA 1YA0A 4U07A 2VSYA 3PH0C 4ATGA 2ONDA 4UWHA 2VTBB 4WNDA 3HHMA 3CK8A 3D9NA 5BUZA 5JHAA 4I1MA 4JEHA 4JA9A 3MGBA 3L08A 1HF8A 3VTXA 1HG5A 3B7TA 4EPZA 1L5JA 3T8MA 3ONKA 3IHVA 2ZU6B 2HM8A 4J8DA 3U9WA 3FHEA 1H2UA 2XPZA 3U3WA 2UWJG 4H7XA 4TRQA 3MV3B 4GCNA 4BTAA 4GMLA 3TXNA 4ANUA 2VSOE 1KLXA 2PQRA 1DVPA 3RKVA 2HR2A 3TL5A 2WQ6A 4KZ0A 2V5FA 4B94A 4AXHA 3QWWA 4E85A 4N2SA 2EQXA 3LXUX 2FBNA 3DPDA 2WXHA 4FJYA 4PDXA 1H19A 3MYVA 4OVUA 4UQYA 4JHRA 2FF4A 2X38A 5G05J 1OWMA 2NSZA 3URZA 5BW8C 4ANXA 3IBEA 2HO1A 2VGYA 5D0QD 3UT7A 4KVOA 2PQNA 5FQ4A 4DLQA 1TJCA 3SNXA 3D9JA 3FTWA 1NZNA 3GZSA 4N5CA 2AW6A 2GGFA 4CGVA 4APFA 2IF4A 1WY6A 2X6IA 2XHEA 3LS8A 5AIJA 2AVPA 3RIBA 3G2TA 4U63A 2PM6A 3U4TA 4E6HA 5D0OD 3L54A 3ASDA 3QJZA 4OVVA 3PRZA 4KVMA 4GPKA 5DBKA 5ANLA 4AOFA 3LY8A 2WXQA 1LF8A 3VLEA 2YHCA 5FQ8A 3FEYA 2XGMA 3L16A 5KJLA 3ZHEB 1OUVA 2R17C 2P58C 3Q4AB 4A1GA 5C2YA 5LP0A 1E96B 2XRZA 1JWFA 4J8FA 1HU3A 4UI9C 2J08A 3CVQA 2WXRA 3RRUA 3I4RB 3SZ7A 3EJNA 5CCMA 2C0LA 4WAFA 1HFAA 3FH5A 3OXGA 3CVWA 2I9CA 2KZTA 2UY1B 3EIJA 4K03A 1FVFA 3PNLB 2XRYA 4Q69A 3ZFWA 4XI0A 4J8EA 4ACLA 2XPYA 5AJLA 5CHEE 3TXMA 3NZUA 1W3BA 1FVHA 4KZCA 2WMNA 3FWVA 3SFZA 2VQ2A 4GYWA 2C2LA 3LKUA 3I3NA 3FH8A 3OTNA 3D9KA 3PEVB 4IN3B 4J0UA 3RO3A 4I6JA 2CHZA 2VSNA 3ZVVA 4D10C 3PUKA 2J4DA 4CCAA 3U66A 2R59A 2WXGA 3CQGB 4FHJA 3S7DA 4UWLA 1N52A 3SD5A 3SHFA 4ME2A 2WXJA 3RRMB 4N3BA 2FI7A 3LJ3A 1MHQA 4U0SA 5LCWC 3WXXA 5BNWA 2GRMA 4V3IA 4GZ3A 1NA3A 3MZLB 3QWPA 1XGWA 2ILRA 2E2EA 3QNKA 3FUIA 3TAXA 3GYZA 2VGXA 3O4ZA 4GZDA 2L9BA 2Y4UA 2WXKA 3I4GA 2C0MA 4PH4B 1HH8A 3BG0B 4AV7A 5E75A 5CMWA 2HYZA 4L1BA 4B8CB 4XKCA 3QK0A 4GA2A 2CFZA 3MKQB 4BT8A 4ILGA 2VYIA 2PL2A 3MEKA 4MLPA 5AYWD 3LEWA 4HXIA 2V4LA 3NF1A 1WAO1 3P1UA 5A6CA 4FHKA 4CGWA 3BEEA 4FJZA 3CHRA 3RO2A 4WNGA 1H0AA 1U3DA 4GU5A 4FLHA 3CKBA 3U64A 1IHGA 4GA0A 4KMOA 3I5PA 4IYPA 3RK6A 2IQCA 4G1TA 4I17A 5FQ7A 1FCHA 2MOWA 4GAAA 4PS3A 1QNFA 3CHPA 5G05C 4HS2A 3CHOA 4NACA 4C0MA 5LX8A 4HVBA 3ML9A 3GW4A 5LOZA 5KCMA 1KT1A 3ONLA 3JQ1A 3D9MA 2WB2A 1HXIA 4Q94A 2Y4TA 2L0IA 2X6FA 3CVLA 3LY7A 4JPSA 2J4BA 3K9IA 4J6IA 4B0ZA 3EHNA 4JW1A 3KD7A 3CVYA 4AM9A 3KEZA 4N3AA 5AENA 1JPLA 4YNDA 5BPPA 2XPIA 4NQ0A 1ZBPA 3D9OA 3FUFA 4GA1A 3IHYA 4CDMA 4EBAG 3FU0A 4NURA 5LFAA 2XCBA 4CDNA 4BFRA 4Q96A 2WXOA 1NA0A 3AS5A 3CK7A 2YHEA 3D9PA 2OV8A 3HVEB 5J08A 5KJNA 4I1OB 3HDXA 4H7YA 4WWOA 4BT9A 1TJFA 2CFUA 2CG2A 4HLEA 2I6HA 3ESLA 3S7BA 2X6JA 4LERA 3FU6A 3ZIMA 1Z3XA 3D9LA 4CRWA 3FUHA 4GYYA 4IULA 5EKQD 5CCLA 5FWQA 3ZXSA 2YNQA 3KS2A 3FUMA 2CG3A 2KCVA 3AU4A 2WQ7A 1OWLA 3CIAA 2A4ZA 3DBSA 3HYMB 3C98A 2X6HA 5HQ8A 1OWOA 3ZYKA 4EBAA 3FTZA 4CDRA 4BWRA 1NP7A 3QC1A 4XX5A 4G26A 5FZSA 2Y3AA 3B7RL 2LSUA 3FTVA 2YINA 4FLBA 4R7LA 4APOA 3APDA 3CEQA 4JZYA 4BX9A 2XEVA 4PUCA 4YVQC 4G2VA 4FA6A 5J90A 3FUJA 2I1JA 2QY7A 3ENEA 4J8SA 4UWGA 5T3RA 3CVUA 3MX3A 3OXFA 2WXNA 4B8AA 1OWNA 1UW4B 1ELKA 3CVNA 4AY5A 4XIFA 1HX8A 4YVOA 3LVRE 3LPZA 5JJTA 3JUIA 3ZYMA 1KT0A 2DCPA 2YQ8A 2WXIA 4JEUA 1ELRA 3QWVA 4GZ5A 3PNTB 3AS8A 3VLDA 3T5VA 3PVLA 2PM7A 4KYOB 4QFVA 2X3MA 2GRLA 4N3CA 1IQUA 2IOLA 3FUDA 5G2NA 3UT8A 4HOSA 4G24A 4P29A 4AJWA 3O48A 4MS6A 4GZCA 3CK9A 2X6KA 3FFLA 4HOQA 3UPVA 2DBAA 5G55A 2XQ0A 3APFA 2GW1A 5T8IA 4AVXA 2FO7A 2WXFA 3Q47B 3FULA 2WPVA 2VGXB 1Z3YA 3MJWA 3CLJA 1H6KA 4I9EA 2KM4A 1E8ZA 3PEUB 3SGHA 4GZ6A 4DJAA 2IONA 5HI7A 4ACKA 1DNPA 2JEKA 3LDZA 5FQ6A 4LRZA 4EQFA 5C1DA 4FADA 2OVBA 4I2WA 1MQSA 3CHQA 3LVQE 1EPUA 1IYGA 5ARGA 5BV0A 4DK5A 3MA5A 3JCKC 1SZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A7D B;  3SF4 A;  3Q15 A;  3ASH A;  3EDT B;  4UQX A;  4WUY A;  2KC7 A;  2MHK A;  3VTY A;  4G25 A;  2UY1 A;  1ZU2 A;  4HOT A;  2LNI A;  3S7J A;  5ARF A;  4JA7 A;  3LCA A;  2Q7F A;  4HOU A;  5M72 A;  5BT1 A;  5JJ6 A;  5G04 J;  5EX3 A;  3TG5 A;  4I1A A;  5FJY A;  5KJM A;  4F3V A;  3S7F A;  2QFC A;  3ZN3 A;  4HOR A;  3ZPJ A;  3Q49 B;  1XNF A;  4JL0 A;  4U04 A;  4WNE A;  4XI9 A;  2XGO A;  3RJV A;  4RG9 A;  3MV2 B;  2PZI A;  3E4B A;  4AY6 A;  3RU0 A;  2JLB A;  4N39 A;  2FEZ A;  3PE3 A;  3ASG A;  2KCL A;  2IFU A;  3ESK A;  3PDN A;  5EX0 A;  1P5Q A;  3LYA A;  4ABN A;  4RG6 A;  4AIF A;  3MKR A;  3ASF A;  3AS4 A;  4W9R A;  2XCC A;  4I9C A;  5KJK A;  3OXL A;  2J9Q A;  4GCO A;  2NC9 A;  4NRH B;  3GZ2 A;  4Y6W A;  3QOU A;  1A17 A;  2KAT A;  4UI9 K;  1HZ4 A;  1QQE A;  3QDN A;  3ZGQ A;  2WQH A;  3TGO A;  3N71 A;  4N2Q A;  5JJ7 A;  2KCK A;  2LSV A;  3CV0 A;  4Y6C A;  5G04 C;  3UUX A;  3JYS A;  1Y8M A;  3ZHE A;  3PE4 A;  4U0U A;  3GZ1 A;  5FTP A;  4O6F A;  4U0Z A;  3ULQ A;  3Q5M A;  4GYO A;  4UQZ A;  1PC2 A;  3CKC A;  5FT9 A;  2L6J A;  4UI9 J;  3FP3 A;  3QKY A;  2XGS A;  4I2Z A;  1QZ2 A;  3KAE A;  4KXK B;  1WM5 A;  2R5S A;  3TG4 A;  3LY9 A;  3IEG A;  4G23 A;  4A1S A;  5FZR A;  4WNF A;  4LEU A;  3R9A B;  2BUG A;  4KBQ A;  1ELW A;  1B89 A;  5LCW J;  4BTB A;  3UQ3 A;  2OOE A;  5FZQ A;  3CVP A;  1YA0 A;  4U07 A;  2VSY A;  2OND A;  4WND A;  3CK8 A;  4JA9 A;  3VTX A;  4J8D A;  3U3W A;  2UWJ G;  4H7X A;  3MV3 B;  4GCN A;  4BTA A;  1KLX A;  2PQR A;  3RKV A;  2HR2 A;  2V5F A;  4B94 A;  3QWW A;  4N2S A;  2FBN A;  4UQY A;  4JHR A;  2FF4 A;  5G05 J;  3URZ A;  5BW8 C;  2HO1 A;  2VGY A;  5D0Q D;  2PQN A;  1TJC A;  1NZN A;  4N5C A;  4CGV A;  2IF4 A;  2AVP A;  3RIB A;  3U4T A;  5D0O D;  3ASD A;  4GPK A;  5DBK A;  3LY8 A;  2YHC A;  2XGM A;  5KJL A;  3ZHE B;  1OUV A;  2P58 C;  3Q4A B;  1E96 B;  4J8F A;  4UI9 C;  3CVQ A;  3SZ7 A;  5CCM A;  2C0L A;  3OXG A;  2UY1 B;  3ZFW A;  4XI0 A;  4J8E A;  5CHE E;  1W3B A;  3FWV A;  2VQ2 A;  4GYW A;  2C2L A;  3LKU A;  4IN3 B;  4J0U A;  3RO3 A;  2VSN A;  3S7D A;  4ME2 A;  4N3B A;  2FI7 A;  4U0S A;  5LCW C;  3WXX A;  5BNW A;  4GZ3 A;  1NA3 A;  3QWP A;  2E2E A;  3TAX A;  3GYZ A;  2VGX A;  2Y4U A;  2C0M A;  1HH8 A;  2HYZ A;  4GA2 A;  4BT8 A;  2VYI A;  2PL2 A;  3MEK A;  5AYW D;  3NF1 A;  1WAO 1;  5A6C A;  4CGW A;  3BEE A;  3RO2 A;  4WNG A;  3CKB A;  1IHG A;  4GA0 A;  4G1T A;  4I17 A;  1FCH A;  5G05 C;  3GW4 A;  1KT1 A;  1HXI A;  2Y4T A;  3CVL A;  3LY7 A;  3K9I A;  3KD7 A;  4AM9 A;  4N3A A;  4YND A;  2XPI A;  4NQ0 A;  1ZBP A;  4GA1 A;  2XCB A;  3AS5 A;  1NA0 A;  3CK7 A;  5KJN A;  4H7Y A;  4BT9 A;  2I6H A;  3S7B A;  4GYY A;  5EKQ D;  5CCL A;  3KS2 A;  2KCV A;  3HYM B;  5HQ8 A;  4CDR A;  4BWR A;  4G26 A;  5FZS A;  2LSU A;  4APO A;  3CEQ A;  2XEV A;  4YVQ C;  4G2V A;  3OXF A;  3CVN A;  4AY5 A;  4XIF A;  4YVO A;  3LPZ A;  5JJT A;  1KT0 A;  2YQ8 A;  1ELR A;  3QWV A;  4GZ5 A;  3AS8 A;  4KYO B;  4HOS A;  4N3C A;  4G24 A;  3O48 A;  3CK9 A;  3FFL A;  4HOQ A;  3UPV A;  2DBA A;  2GW1 A;  2FO7 A;  3Q47 B;  2WPV A;  2VGX B;  4I9E A;  4GZ6 A;  5HI7 A;  4EQF A;  5C1D A;  4I2W A;  1IYG A;  5ARG A;  3MA5 A;  5DIZ A; 
#chains in the Genus database with same CATH topology
 4CT0 A;  3HXE A;  4UQX A;  5BXU A;  4WUY A;  2KC7 A;  2M63 A;  2P9U G;  2GRR B;  3FH7 A;  4ANV A;  4URK A;  4M3O A;  2BTD A;  2XZT G;  1TNZ A;  3S7J A;  1NL4 A;  2Q7F A;  4HOU A;  4HQD A;  3L6A A;  4BX8 A;  5BT1 A;  4I43 A;  4RQI A;  4RVB A;  4HI9 A;  1HE8 A;  3SQV A;  4I1A A;  3TWT A;  5E76 A;  5FJY A;  2KXP C;  4F3V A;  3ZN3 A;  5CEC B;  3Q49 B;  4U04 A;  4FU3 A;  4WWP A;  4J8Y A;  4XI9 A;  4CT4 A;  2FUL A;  3IKO B;  3APC A;  2IO2 C;  4N39 A;  2FEZ A;  3PE3 A;  4I6E A;  2KCL A;  1IHB A;  2AXV A;  4LG6 A;  4EHM A;  4ABN A;  3B13 A;  4LNU D;  3ZUV B;  4L2Y A;  1TNY A;  1MZC A;  1EF1 C;  5KNH D;  3Q79 A;  3L9T A;  3PZD A;  2ZGD A;  5AJD A;  5KJK A;  3EHQ A;  2NC9 A;  4FP7 A;  4Y6W A;  5EDS A;  3SFY A;  1MYO A;  2KAT A;  2P9P G;  3T5X A;  3AG2 E;  1HZ4 A;  1INZ A;  4J7W A;  3SBT B;  3ASN E;  1OCC E;  4EEC A;  1N0R A;  4GTP A;  3CVV A;  2WQH A;  4ATZ D;  3TGO A;  3C3O A;  2GRN B;  1IXV A;  3UT4 A;  4DX6 D;  3RSE G;  4RSY A;  3EHM A;  3DSV A;  4LCT A;  4O6F A;  3HXD A;  5ENR D;  2AXZ A;  1H2T C;  3FDH A;  4GYO A;  4U95 D;  1TEZ A;  3CKC A;  4DX2 A;  3PRE A;  3R9M A;  3E37 A;  1QZ2 A;  1N95 A;  3KAE A;  3OAW A;  4JD2 G;  3SI5 A;  4DI3 A;  4HRM B;  1VDY A;  4B89 A;  3UM0 A;  3QB2 A;  3PZ1 A;  2ZXW E;  1TNB A;  4KBQ A;  1ELW A;  4ILI A;  3CVX A;  3KEA A;  4BTB A;  2J07 A;  4A55 A;  4U07 A;  4K5B A;  1S70 B;  2VSY A;  4OAV B;  4JEH A;  3MGB A;  2XEH A;  1HF8 A;  1HG5 A;  4EPZ A;  3IHV A;  2ZU6 B;  2HM8 A;  3U9W A;  3FHE A;  3E33 A;  1H2U A;  2UWJ G;  4GCN A;  4GML A;  3TXN A;  2WQ6 A;  3QWW A;  4N2S A;  3UM3 A;  2FBN A;  3ASO E;  4FJY A;  4HBD A;  1H19 A;  4UQY A;  2X38 A;  4YDE A;  2HO1 A;  2VGY A;  1TJC A;  3D9J A;  3FTW A;  1NZN A;  2GGF A;  2IF4 A;  2XHE A;  2AVP A;  2PM6 A;  1O1T A;  3PRZ A;  4MBG A;  5DBK A;  3VLE A;  4TXR A;  5FQ8 A;  2XGM A;  1OUV A;  3L82 A;  1Z5S C;  2WXR A;  3BQO A;  5CCM A;  1HFA A;  3FH5 A;  3CVW A;  4HRL A;  1FVF A;  3PNL B;  4Q69 A;  1W3B A;  2WMN A;  4IN3 B;  3FH8 A;  4J0U A;  3TWV A;  5D66 A;  2FI7 A;  1MHQ A;  4BER A;  1ZB1 A;  2L9B A;  2WXK A;  3I4G A;  2C0M A;  4O1O A;  1HH8 A;  5CMW A;  2HYZ A;  4L1B A;  1SW6 A;  4GA2 A;  2CFZ A;  4BT8 A;  1WAO 1;  3P1U A;  4CGW A;  4FJZ A;  4WNG A;  3C3Q A;  5B1B E;  1JCS A;  4GA0 A;  3EU9 A;  1QNF A;  3RAU A;  5LX8 A;  3GW4 A;  5LOZ A;  1KT1 A;  3D9M A;  3LY7 A;  4A63 B;  4J6I A;  3TWQ A;  3KD7 A;  4AM9 A;  5AEN A;  1JPL A;  2LUH A;  1X81 A;  4GPM A;  4YND A;  3D9O A;  1TNU A;  1Q2Z A;  4BFR A;  2WXO A;  1NA0 A;  3AS5 A;  2CFU A;  2ETC A;  4HLE A;  3ESL A;  3S7B A;  3ZIM A;  1U2V G;  2GRP B;  5FWQ A;  3AU4 A;  1YCS B;  3CIA A;  3FTZ A;  1V55 E;  4BWR A;  5D2M C;  4DX1 A;  5FZS A;  2LSU A;  3FTV A;  4BX9 A;  4JZY A;  1OT8 A;  2XEV A;  4G2V A;  5T3R A;  3UM2 A;  1OWN A;  4AY5 A;  3LVR E;  3TWR A;  2YQ8 A;  4JEU A;  2GRQ B;  1FT1 A;  4YDO A;  4QFV A;  2GRL A;  2IOL A;  4MS6 A;  2X6K A;  5T8I A;  4AVX A;  3Q47 B;  5AQ7 A;  2VGX B;  3PEU B;  3SGH A;  1DNP A;  5EIB E;  2P9L G;  4FAD A;  4I2W A;  2OEV A;  5ARG A;  4QQI A;  3MA5 A;  4XKB A;  2MHK A;  2P9S G;  4O1P A;  5BV1 A;  1K1B A;  4BY6 A;  1H2V C;  2CHW A;  5ENS D;  2WXP A;  4I6G A;  3V2X A;  5ARF A;  2DZN A;  4PS7 A;  3QAR A;  1O5M A;  3FUE A;  3NZS A;  4HLL A;  1JUQ A;  5EN5 D;  1BPO A;  2RD0 A;  3UX4 A;  2WXL A;  4HOR A;  2AWI A;  3BUA A;  1E7V A;  4DI4 A;  3AU5 A;  2LAH A;  5IY5 E;  1GW6 A;  3MV2 B;  2PZI A;  3FEX A;  3PZ3 A;  4AY6 A;  2JLB A;  3BG1 B;  1N4Q A;  3P2B A;  2B6C A;  3PDN A;  5EX0 A;  4L7T A;  2H6G A;  2R03 A;  3B7U X;  2WVI A;  3TWX A;  1N94 A;  4XE0 A;  4AIF A;  4FUL A;  5FIN A;  1LD7 A;  3MKR A;  1E7U A;  3HXC A;  3L13 A;  3ASF A;  3ZXP A;  3AS4 A;  3L22 A;  3FY4 A;  3JQ0 A;  3JXJ A;  5AQ9 A;  3CST A;  3FTX A;  2J9Q A;  4GCO A;  2Y1L E;  1A17 A;  4L9P A;  4UI9 K;  2IJG X;  1U3C A;  2HE0 A;  5ITZ F;  1QQE A;  3VLF A;  2V4H C;  3D9I A;  3AG3 E;  4UWF A;  4AP2 A;  4UWK A;  4DX7 D;  1KZP A;  4N2Q A;  2DWZ A;  3DXK G;  4YDY A;  4GTR A;  4HI8 A;  4KT6 B;  1TNO A;  4ZHB A;  3JYS A;  1OCO E;  3PE4 A;  2BKG A;  5FTP A;  3FU5 A;  1E8W A;  2R2L A;  3ULQ A;  3EIQ C;  3L17 A;  1Y6I A;  2BKK B;  4ANW A;  4DUI A;  2L0T B;  1E90 A;  1UN9 A;  1YYH A;  2R5S A;  3UTM A;  2CHX A;  4G23 A;  5FZR A;  1HO8 A;  3ZYL A;  4L2L A;  1SA5 A;  4G8L A;  3R9A B;  2BUG A;  2P2C P;  1K3Z D;  1B89 A;  2LAI A;  3G2V A;  4U96 D;  3B7B A;  3UQ3 A;  4A3V A;  3CVP A;  1YA0 A;  2OND A;  4WND A;  3HHM A;  5BUZ A;  3DSU A;  4JA9 A;  3X2Q E;  1H6P A;  2XPZ A;  3C72 A;  4CZ2 D;  4HB5 A;  4OAU C;  3RKV A;  3TL5 A;  4KZ0 A;  1YMP A;  2V5F A;  3DWL G;  4E85 A;  3KSL A;  3LXU X;  5AAR A;  4PDX A;  2FF4 A;  2AJA A;  2NSZ A;  2EIJ E;  5FQ4 A;  3SNX A;  4CGV A;  1WY6 A;  2X6I A;  3LS8 A;  5AIJ A;  3RIB A;  1TR4 A;  4E6H A;  3U4T A;  3L54 A;  3ZNG A;  2LXL A;  3UIO C;  3QJZ A;  5ANL A;  4HRN A;  2YHC A;  4YDW A;  3ZHE B;  4A1G A;  5C2Y A;  1E96 B;  4G8K A;  2XRZ A;  2XEN A;  1JWF A;  2L6B A;  4F6R D;  2J08 A;  3CVQ A;  3RRU A;  3I4R B;  5ENQ D;  1TN8 A;  3OXG A;  3EIJ A;  2XRY A;  3ZFW A;  4XI0 A;  4NIK A;  4J8E A;  1MX6 A;  5AJL A;  5CHE E;  3NZU A;  3FWV A;  3SFZ A;  4CRW A;  3PEV B;  4D10 C;  4I6J A;  2CHZ A;  2J4D A;  2WXG A;  2F8X K;  3CQG B;  3S7D A;  4UWL A;  4ME2 A;  3LJ3 A;  1NA3 A;  4XEI G;  3MZL B;  3QWP A;  2E2E A;  3QNK A;  2VGX A;  3E32 A;  3HXB A;  3LJN A;  3O4Z A;  4GZD A;  4PH4 B;  3EUV A;  4AV7 A;  5EIL A;  4B8C B;  4XKC A;  3QK0 A;  2VYI A;  2PL2 A;  3MEK A;  2MYO A;  3LEW A;  3KSQ A;  2V4L A;  4CYM D;  5A6C A;  4FHK A;  3T8K A;  1H6O A;  3U64 A;  3I5P A;  3RK6 A;  1FCH A;  4HS2 A;  3ML9 A;  1BD8 A;  5KCM A;  2F8Y A;  3JQ1 A;  1HXI A;  4Q94 A;  2Y4T A;  2J4B A;  3K9I A;  4B0Z A;  4JW1 A;  5BPP A;  4GA1 A;  3Q9N C;  4EBA G;  4NUR A;  5AAO A;  4CDN A;  3CK7 A;  5KJN A;  4H7Y A;  4WWO A;  3V79 K;  4LER A;  2XS1 A;  4IUL A;  5CCL A;  3ZXS A;  2IO3 C;  3C98 A;  1OWO A;  3ZYK A;  1AP7 A;  4G26 A;  5JMN D;  4APO A;  3APD A;  3CEQ A;  3NOC D;  4BES A;  3FUJ A;  2I1J A;  1RZ4 A;  3UM1 A;  3OXF A;  2WXN A;  4B8A A;  2EIL E;  3CVN A;  1TYQ G;  3Q9U C;  3JUI A;  3QWV A;  3AS8 A;  3PVL A;  5H7P A;  4N3C A;  1IQU A;  3W9G A;  3AG4 E;  2B0O E;  4AJW A;  4GZC A;  4HOQ A;  3TWW A;  3UPV A;  3APF A;  2GW1 A;  1MX2 A;  4GTS A;  4GTQ A;  1Z3Y A;  4I9E A;  5CBO A;  1JCR A;  4GZ6 A;  4ACK A;  3LDZ A;  2J8S D;  5FQ6 A;  2ZGG A;  3LVQ E;  1FPP A;  5DIZ A;  5A7D B;  1QYM A;  2NXP A;  2MRI A;  2UY1 A;  3ULY A;  3Q78 A;  4HOT A;  4B93 B;  2LNI A;  1X5B A;  4MKT A;  5M72 A;  3CHS A;  2J09 A;  3MCX A;  2LXM A;  4JC8 A;  5A23 A;  5JJ6 A;  5G04 J;  4WWN A;  2IU1 A;  5EX3 A;  3TG5 A;  2DIW A;  2Y0B G;  3CR3 A;  1QBQ A;  3SO8 A;  3UI2 A;  5KJM A;  2JAB A;  3ZRH A;  2E0I A;  2EIK E;  3IV0 A;  2IOS A;  3MKQ A;  3G2S A;  2XGO A;  3CSF A;  4RG9 A;  1N0Q A;  2R05 A;  3E4B A;  1E8Y A;  5CMY A;  2QYU A;  3D3M A;  4DRX E;  3RU0 A;  1K1A A;  3R7Q A;  3DEO A;  3ASG A;  2IFU A;  3ESK A;  1NFI E;  4Z68 A;  3ABL E;  2VSX E;  3HRA A;  4TV3 A;  3LYA A;  1IQR A;  4RG6 A;  1UJK A;  2KBX A;  4A3T A;  4LUN U;  3Q73 A;  1LD8 A;  4JHJ A;  3V30 A;  4W9R A;  4HFG A;  2XCC A;  2A5U A;  2ETA A;  2IY0 C;  3NBN B;  3SFX A;  4NRH B;  3Q7F A;  3B7S A;  5ANR A;  2V0P A;  3JXI A;  3ML8 A;  3QDN A;  3HIZ A;  3FU3 A;  4ILH B;  4LNB A;  4F7A A;  3CHM A;  1EDU A;  3EHR A;  3N71 A;  1PAQ A;  4DPR A;  3PS6 A;  4Y6C A;  4C48 B;  1OCR E;  2EIN E;  4X8Q A;  3ZHE A;  4C0E A;  4U0Z A;  4TUU A;  1OY3 D;  1PY1 A;  1LTX A;  1SZA A;  4OYS A;  1PC2 A;  4TXQ A;  5FT9 A;  4EZJ A;  2L6J A;  4UI9 J;  1SVX A;  3FP3 A;  3WG7 E;  2XGS A;  5HS0 A;  3NOG D;  3SBS A;  4KXK B;  3FTU A;  4CEM A;  1WM5 A;  5KNG A;  3LY9 A;  2AXU A;  4A1S A;  5JHB A;  1HG2 A;  4WNF A;  2XZD G;  2WXM A;  2BF0 X;  3NQP A;  4F1S A;  5LCW J;  2RG8 A;  5BXO A;  3QAQ A;  2OOE A;  1SA4 A;  4ATG A;  3PH0 C;  1AWC B;  2PNN A;  2VTB B;  1BI8 B;  5ENT D;  3CK8 A;  5JHA A;  4I1M A;  3SY2 A;  3VTX A;  1D8E A;  3ONK A;  1TN6 A;  3ABM E;  3U3W A;  4TRQ A;  1MJ0 A;  1KLX A;  2PQR A;  2HR2 A;  3AG1 E;  2Y69 E;  3DPD A;  2WXH A;  4OVU A;  5G05 J;  1OWM A;  4ANX A;  3IBE A;  5D0Q D;  1K8K G;  2PQN A;  4N5C A;  2AW6 A;  4APF A;  4M7C A;  3G2T A;  5D0O D;  2DVW A;  3ASD A;  2ZIR A;  4GPK A;  2DYR E;  3LY8 A;  2WXQ A;  1LF8 A;  2R17 C;  2P58 C;  3Q4A B;  3TWS A;  1G3N B;  1HU3 A;  3DSW A;  2C0L A;  1S64 A;  2I9C A;  2KZT A;  2UY1 B;  4K03 A;  4JB8 P;  2XPY A;  4GTO A;  4UUC A;  1FVH A;  4KZC A;  4AXH A;  2C2L A;  3OTN A;  3ZVV A;  3PUK A;  4CCA A;  3U66 A;  2R59 A;  1A5E A;  3SD5 A;  5JA4 D;  2WXJ A;  3UKR G;  3WXX A;  5BNW A;  3DSX A;  4V3I A;  5KBA A;  2ILR A;  3TAX A;  2Y4U A;  3MKQ B;  4ILG A;  5AYW D;  2RKK A;  3JUE A;  3BEE A;  3CHR A;  3RO2 A;  1H0A A;  4GU5 A;  4FLH A;  1IHG A;  4KMO A;  4PS3 A;  3AJI A;  4HVB A;  3PZ2 A;  1JCQ A;  2L0I A;  2P9I G;  3CVL A;  3CVY A;  4N3A A;  3IHY A;  4CDM A;  2DYS E;  2XCB A;  4Q96 A;  3PZ4 A;  2YHE A;  3D9P A;  2OV8 A;  5J08 A;  3HDX A;  5EYP F;  1TJF A;  2CG2 A;  2X6J A;  3FU6 A;  1Z3X A;  3D9L A;  3B95 A;  5EKQ D;  2YNQ A;  2CG3 A;  3DBS A;  3HYM B;  3UIP C;  4ZFH A;  2X6H A;  5HQ8 A;  2DZO A;  4CDR A;  3QC1 A;  3V2O A;  3B7R L;  2YIN A;  4PUC A;  1N4S A;  4FA6 A;  1ELK A;  4XIF A;  3LPZ A;  5JJT A;  3ZYM A;  1KT0 A;  1ELR A;  4RLY A;  5CRU A;  4GZ5 A;  4U7E B;  3T5V A;  2PM7 A;  4KYO B;  2A5E A;  2X3M A;  5B1A E;  2BED A;  4F1P A;  3O48 A;  4BEP A;  3CK9 A;  3FFL A;  5G55 A;  2WXF A;  5EID A;  2F0Y A;  3MJW A;  1H6K A;  2KM4 A;  1E8Z A;  2RFA A;  4TXP A;  4O60 A;  5HI7 A;  5ENP D;  4LRZ A;  5C1D A;  4K5C A;  3CHQ A;  1EPU A;  1IYG A;  1WDY A;  5BV0 A;  2XS8 A;  3JCK C;  1N9A A;  4GB9 A;  3SF4 A;  3Q15 A;  3ASH A;  3EDT B;  3VTY A;  4G25 A;  5CRV A;  4GTV A;  4FC8 A;  1EYH A;  1S0P A;  3BU8 A;  4BSX A;  4IRU A;  1ZU2 A;  2J49 A;  1E8X A;  2F37 A;  4JA7 A;  3LCA A;  3ISM C;  4DX5 D;  2OCC E;  1TN7 A;  1MX4 A;  4K0R A;  1UJJ A;  3FUK A;  2FO1 E;  4EZL A;  1BU9 A;  4EZK A;  2WM9 A;  1D9S A;  3S7F A;  2QFC A;  4GMJ A;  4AEZ C;  3ZPJ A;  1XNF A;  4JL0 A;  4WNE A;  3ABK E;  3RJV A;  5HRY A;  3C5R A;  3FTS A;  4U8V D;  5EYL A;  3ZEF A;  4JXT A;  2RFM A;  2H6H A;  5FIO A;  4N5Q A;  1Z6T A;  3TJP A;  4C9B B;  5AQB A;  3ZU7 B;  1P5Q A;  2VTB A;  1WG0 A;  4XZ4 A;  2R02 A;  4BSZ B;  3ZYQ A;  2KZT B;  4U8Y D;  4I9C A;  1HS6 A;  3OXL A;  1N11 A;  4JVS A;  1DCQ A;  2VJ8 A;  3GZ2 A;  1KZO A;  2OVF A;  3RRN B;  3FUN A;  3QOU A;  3HVE A;  3CGH A;  3ULE G;  3FTY A;  5ENN A;  2LO6 A;  3CQC B;  3DST A;  3G2W A;  3ZGQ A;  2QYJ A;  2QC9 A;  1BLX B;  5JJ7 A;  2KCK A;  2LSV A;  3CV0 A;  3NB2 A;  2I1K A;  5G04 C;  4U8H A;  3UUX A;  1Y8M A;  4G11 A;  4U0U A;  5AQA A;  3ZW3 A;  3GZ1 A;  3Q75 A;  3UMV A;  2I2O A;  3Q5M A;  2V8S E;  4PS8 A;  3PUJ A;  4L23 A;  5KWD A;  4UQZ A;  3S2A A;  1IKN D;  5CER B;  3E30 A;  3J5P A;  1OWP A;  3QKY A;  1DC2 A;  4I2Z A;  5ENO D;  1UN8 A;  3R7R A;  3E34 A;  5T4Y A;  3G2U A;  4GMR A;  4K5A B;  3Q7A A;  3TG4 A;  4DLO A;  3HXF A;  3IEG A;  1SQM A;  4TUM A;  1JWG A;  2WMO A;  5CBN A;  2ZIS A;  4LEU A;  1RW2 A;  4F53 A;  1UG3 A;  4MRU A;  2QZA A;  4JHK A;  5FZQ A;  1N54 A;  1UOH A;  5B3S E;  4UWH A;  3D9N A;  5CED B;  3L08 A;  2V5Q C;  3HG0 D;  3W9F A;  3B7T A;  1L5J A;  3T8M A;  2H6F A;  4J8D A;  2OEW A;  4H7X A;  3MV3 B;  4BTA A;  4ANU A;  2VSO E;  1DVP A;  3IXE A;  4B94 A;  1D8D A;  2EQX A;  3MYV A;  4JHR A;  3URZ A;  5BW8 C;  3D9H A;  3UT7 A;  4KVO A;  4DLQ A;  3GZS A;  4BET A;  4U63 A;  4OVV A;  4KVM A;  4AOF A;  2GRO B;  3ZKJ A;  2IEJ A;  1FT2 A;  3FEY A;  2P9N G;  3L16 A;  5KJL A;  2H6I A;  5LP0 A;  4J8F A;  4UI9 C;  3SZ7 A;  3EJN A;  4WAF A;  1DCE A;  4ACL A;  4HNA D;  3TXM A;  1BI7 B;  2VQ2 A;  3NAW A;  3LKU A;  4GYW A;  3I3N A;  3D9K A;  3DEP A;  3RO3 A;  2VSN A;  3DSS A;  4FHJ A;  1N52 A;  3SHF A;  3RRM B;  4N3B A;  4LSZ E;  4U0S A;  5LCW C;  4LNG A;  2GRM A;  3UIN C;  4GZ3 A;  1XGW A;  3FUI A;  3GYZ A;  3BG0 B;  2XEE A;  5E75 A;  1O1R A;  4GTT A;  4MLP A;  4HXI A;  3NF1 A;  1U3D A;  2EIM E;  3CKB A;  1S63 A;  4IYP A;  2IQC A;  4G1T A;  4I17 A;  5FQ7 A;  2MOW A;  2P9K G;  4GAA A;  3CHP A;  5G05 C;  3CHO A;  4GTM A;  4NAC A;  4C0M A;  3UXG A;  3ONL A;  2WB2 A;  2X6F A;  5CEA A;  4JPS A;  3EHN A;  3KEZ A;  2XPI A;  4NQ0 A;  1ZBP A;  3FUF A;  1OCZ E;  1V54 E;  3FU0 A;  5LFA A;  3HVE B;  5HKP A;  3AAA C;  4I1O B;  4BT9 A;  1O1S A;  1KPS B;  2I6H A;  1N4R A;  1N4P A;  3FUH A;  4GYY A;  3KS2 A;  3FUM A;  2NYJ A;  2KCV A;  2WQ7 A;  1OWL A;  2A4Z A;  3V31 A;  3DRA A;  4EBA A;  1OXJ A;  1NP7 A;  3EU5 A;  4XX5 A;  2Y3A A;  3UKU G;  4R7L A;  4FLB A;  4YVQ C;  5J90 A;  2QY7 A;  4J8S A;  3ENE A;  4UWG A;  3CVU A;  3MX3 A;  1UW4 B;  5AN8 A;  1HX8 A;  4YVO A;  3J5Q B;  2ETB A;  2DCP A;  2VGE A;  2WXI A;  3PNT B;  3VLD A;  5G2N A;  4HOS A;  3FUD A;  3UT8 A;  3TWU A;  4G24 A;  3DXM G;  4P29 A;  3DPY A;  1NI1 A;  2DBA A;  2XQ0 A;  2FO7 A;  3FUL A;  2WPV A;  3CLJ A;  3F6Q A;  4DJA A;  2ION A;  2JEK A;  4EQF A;  2OVB A;  1MQS A;  3T9K A;  4DK5 A;  3C3R A;  1SZ9 A; 
#chains in the Genus database with same CATH homology
 5A7D B;  4GB9 A;  4CT0 A;  3SF4 A;  2NXP A;  3ASH A;  3EDT B;  2MRI A;  3Q15 A;  2KC7 A;  2M63 A;  2MHK A;  4UQX A;  4WUY A;  4XKB A;  4G25 A;  3VTY A;  3FH7 A;  4ANV A;  5BV1 A;  4URK A;  4FC8 A;  1EYH A;  1S0P A;  2UY1 A;  4BSX A;  4BY6 A;  4M3O A;  4IRU A;  1H2V C;  2BTD A;  2CHW A;  1ZU2 A;  2J49 A;  1E8X A;  4HOT A;  2WXP A;  4I6G A;  2LNI A;  3S7J A;  5ARF A;  1X5B A;  4JA7 A;  3LCA A;  2Q7F A;  4PS7 A;  3QAR A;  4HOU A;  4MKT A;  5M72 A;  3FUE A;  3CHS A;  3NZS A;  2J09 A;  3L6A A;  1JUQ A;  3MCX A;  4BX8 A;  4JC8 A;  4I43 A;  5A23 A;  5BT1 A;  5JJ6 A;  4RVB A;  5G04 J;  4WWN A;  4K0R A;  2IU1 A;  1HE8 A;  1UJJ A;  5EX3 A;  3TG5 A;  3FUK A;  2DIW A;  1BPO A;  2RD0 A;  4EZL A;  4I1A A;  3UX4 A;  3CR3 A;  5E76 A;  5FJY A;  5KJM A;  4EZK A;  2WM9 A;  2WXL A;  4F3V A;  3S7F A;  2QFC A;  3ZN3 A;  4HOR A;  4GMJ A;  2AWI A;  3ZRH A;  3ZPJ A;  4AEZ C;  1E7V A;  3Q49 B;  1XNF A;  2E0I A;  3IV0 A;  4JL0 A;  4U04 A;  4WNE A;  2IOS A;  4DI4 A;  3MKQ A;  4FU3 A;  3G2S A;  4WWP A;  3AU5 A;  2LAH A;  4XI9 A;  2XGO A;  3RJV A;  3CSF A;  4CT4 A;  1GW6 A;  3MV2 B;  2PZI A;  3E4B A;  3FEX A;  4RG9 A;  1E8Y A;  2FUL A;  3FTS A;  3IKO B;  5CMY A;  3APC A;  4AY6 A;  3D3M A;  3RU0 A;  2JLB A;  3ZEF A;  4JXT A;  4N39 A;  3R7Q A;  2FEZ A;  3PE3 A;  4I6E A;  3ASG A;  3BG1 B;  2KCL A;  2IFU A;  1Z6T A;  3ESK A;  3TJP A;  4C9B B;  2VSX E;  2AXV A;  3P2B A;  3PDN A;  5EX0 A;  1P5Q A;  4L7T A;  4TV3 A;  2VTB A;  3LYA A;  3B7U X;  2WVI A;  4ABN A;  3B13 A;  1IQR A;  4RG6 A;  1UJK A;  4XE0 A;  4A3T A;  4LUN U;  4AIF A;  4FUL A;  4XZ4 A;  5DIZ A;  3MKR A;  1E7U A;  3L13 A;  3ASF A;  4JHJ A;  3AS4 A;  3L22 A;  4W9R A;  4HFG A;  4L2Y A;  3ZYQ A;  3FY4 A;  2KZT B;  2XCC A;  1EF1 C;  3JQ0 A;  2A5U A;  4I9C A;  3PZD A;  3CST A;  1HS6 A;  3FTX A;  5AJD A;  5KJK A;  3OXL A;  2J9Q A;  4JVS A;  4GCO A;  2NC9 A;  4NRH B;  2VJ8 A;  3GZ2 A;  4FP7 A;  4Y6W A;  5EDS A;  2OVF A;  3RRN B;  3FUN A;  3QOU A;  3HVE A;  1A17 A;  2KAT A;  3B7S A;  3CGH A;  4UI9 K;  5ANR A;  2IJG X;  1U3C A;  2V0P A;  3FTY A;  5ENN A;  3T5X A;  2LO6 A;  3CQC B;  1HZ4 A;  3G2W A;  3ML8 A;  1QQE A;  1INZ A;  3QDN A;  3HIZ A;  3SBT B;  3VLF A;  3ZGQ A;  3FU3 A;  4ILH B;  3D9I A;  4UWF A;  4F7A A;  4EEC A;  4AP2 A;  3CHM A;  3CVV A;  2WQH A;  1EDU A;  3TGO A;  4UWK A;  3N71 A;  1PAQ A;  4DPR A;  4N2Q A;  5JJ7 A;  2KCK A;  2LSV A;  3CV0 A;  3PS6 A;  3UT4 A;  4KT6 B;  4RSY A;  2I1K A;  4Y6C A;  5G04 C;  3EHM A;  4U8H A;  3UUX A;  3JYS A;  4LCT A;  1Y8M A;  3ZHE A;  3PE4 A;  4G11 A;  4U0U A;  3ZW3 A;  3GZ1 A;  5FTP A;  3FU5 A;  4O6F A;  3UMV A;  2I2O A;  4C0E A;  4U0Z A;  1E8W A;  4TUU A;  2AXZ A;  3Q5M A;  3ULQ A;  1H2T C;  3EIQ C;  2V8S E;  4PS8 A;  3PUJ A;  3FDH A;  1PY1 A;  1SZA A;  4GYO A;  4L23 A;  4UQZ A;  4OYS A;  1TEZ A;  1PC2 A;  3CKC A;  3S2A A;  3L17 A;  1Y6I A;  3PRE A;  5FT9 A;  4EZJ A;  4ANW A;  2L6J A;  4UI9 J;  1OWP A;  3FP3 A;  3QKY A;  2XGS A;  4I2Z A;  1QZ2 A;  1UN8 A;  3SBS A;  3R7R A;  2L0T B;  3FTU A;  3KAE A;  3OAW A;  4KXK B;  5T4Y A;  3G2U A;  1E90 A;  4CEM A;  3SI5 A;  4DI3 A;  1WM5 A;  1UN9 A;  1VDY A;  2R5S A;  3TG4 A;  3LY9 A;  4B89 A;  4DLO A;  2AXU A;  3IEG A;  2CHX A;  4G23 A;  1SQM A;  4A1S A;  5FZR A;  5JHB A;  1HG2 A;  4WNF A;  1JWG A;  1HO8 A;  3ZYL A;  2WMO A;  3QB2 A;  4L2L A;  4LEU A;  2WXM A;  3R9A B;  4F53 A;  2BF0 X;  2BUG A;  4KBQ A;  1ELW A;  3NQP A;  4F1S A;  1B89 A;  5LCW J;  2LAI A;  4A55 A;  1UG3 A;  2RG8 A;  4ILI A;  4MRU A;  3CVX A;  3G2V A;  3QAQ A;  4BTB A;  3UQ3 A;  2J07 A;  2OOE A;  4JHK A;  5FZQ A;  3CVP A;  1N54 A;  4A3V A;  1YA0 A;  4U07 A;  2VSY A;  3PH0 C;  4ATG A;  2OND A;  4UWH A;  2VTB B;  4WND A;  3HHM A;  3CK8 A;  3D9N A;  5BUZ A;  5JHA A;  4I1M A;  4JEH A;  4JA9 A;  3MGB A;  3L08 A;  1HF8 A;  3VTX A;  1HG5 A;  3B7T A;  4EPZ A;  1L5J A;  3T8M A;  3ONK A;  3IHV A;  2ZU6 B;  2HM8 A;  4J8D A;  3U9W A;  3FHE A;  1H2U A;  2XPZ A;  3U3W A;  2UWJ G;  4H7X A;  4TRQ A;  3MV3 B;  4GCN A;  4BTA A;  4GML A;  3TXN A;  4ANU A;  2VSO E;  1KLX A;  2PQR A;  1DVP A;  3RKV A;  2HR2 A;  3TL5 A;  2WQ6 A;  4KZ0 A;  2V5F A;  4B94 A;  4AXH A;  3QWW A;  4E85 A;  4N2S A;  2EQX A;  3LXU X;  2FBN A;  3DPD A;  2WXH A;  4FJY A;  4PDX A;  1H19 A;  3MYV A;  4OVU A;  4UQY A;  4JHR A;  2FF4 A;  2X38 A;  5G05 J;  1OWM A;  2NSZ A;  3URZ A;  5BW8 C;  4ANX A;  3IBE A;  2HO1 A;  2VGY A;  5D0Q D;  3UT7 A;  4KVO A;  2PQN A;  5FQ4 A;  4DLQ A;  1TJC A;  3SNX A;  3D9J A;  3FTW A;  1NZN A;  3GZS A;  4N5C A;  2AW6 A;  2GGF A;  4CGV A;  4APF A;  2IF4 A;  1WY6 A;  2X6I A;  2XHE A;  3LS8 A;  5AIJ A;  2AVP A;  3RIB A;  3G2T A;  4U63 A;  2PM6 A;  3U4T A;  4E6H A;  5D0O D;  3L54 A;  3ASD A;  3QJZ A;  4OVV A;  3PRZ A;  4KVM A;  4GPK A;  5DBK A;  5ANL A;  4AOF A;  3LY8 A;  2WXQ A;  1LF8 A;  3VLE A;  2YHC A;  5FQ8 A;  3FEY A;  2XGM A;  3L16 A;  5KJL A;  3ZHE B;  1OUV A;  2R17 C;  2P58 C;  3Q4A B;  4A1G A;  5C2Y A;  5LP0 A;  1E96 B;  2XRZ A;  1JWF A;  4J8F A;  1HU3 A;  4UI9 C;  2J08 A;  3CVQ A;  2WXR A;  3RRU A;  3I4R B;  3SZ7 A;  3EJN A;  5CCM A;  2C0L A;  4WAF A;  1HFA A;  3FH5 A;  3OXG A;  3CVW A;  2I9C A;  2KZT A;  2UY1 B;  3EIJ A;  4K03 A;  1FVF A;  3PNL B;  2XRY A;  4Q69 A;  3ZFW A;  4XI0 A;  4J8E A;  4ACL A;  2XPY A;  5AJL A;  5CHE E;  3TXM A;  3NZU A;  1W3B A;  1FVH A;  4KZC A;  2WMN A;  3FWV A;  3SFZ A;  2VQ2 A;  4GYW A;  2C2L A;  3LKU A;  3I3N A;  3FH8 A;  3OTN A;  3D9K A;  3PEV B;  4IN3 B;  4J0U A;  3RO3 A;  4I6J A;  2CHZ A;  2VSN A;  3ZVV A;  4D10 C;  3PUK A;  2J4D A;  4CCA A;  3U66 A;  2R59 A;  2WXG A;  3CQG B;  4FHJ A;  3S7D A;  4UWL A;  1N52 A;  3SD5 A;  3SHF A;  4ME2 A;  2WXJ A;  3RRM B;  4N3B A;  2FI7 A;  3LJ3 A;  1MHQ A;  4U0S A;  5LCW C;  3WXX A;  5BNW A;  2GRM A;  4V3I A;  4GZ3 A;  1NA3 A;  3MZL B;  3QWP A;  1XGW A;  2ILR A;  2E2E A;  3QNK A;  3FUI A;  3TAX A;  3GYZ A;  2VGX A;  3O4Z A;  4GZD A;  2L9B A;  2Y4U A;  2WXK A;  3I4G A;  2C0M A;  4PH4 B;  1HH8 A;  3BG0 B;  4AV7 A;  5E75 A;  5CMW A;  2HYZ A;  4L1B A;  4B8C B;  4XKC A;  3QK0 A;  4GA2 A;  2CFZ A;  3MKQ B;  4BT8 A;  4ILG A;  2VYI A;  2PL2 A;  3MEK A;  4MLP A;  5AYW D;  3LEW A;  4HXI A;  2V4L A;  3NF1 A;  1WAO 1;  3P1U A;  5A6C A;  4FHK A;  4CGW A;  3BEE A;  4FJZ A;  3CHR A;  3RO2 A;  4WNG A;  1H0A A;  1U3D A;  4GU5 A;  4FLH A;  3CKB A;  3U64 A;  1IHG A;  4GA0 A;  4KMO A;  3I5P A;  4IYP A;  3RK6 A;  2IQC A;  4G1T A;  4I17 A;  5FQ7 A;  1FCH A;  2MOW A;  4GAA A;  4PS3 A;  1QNF A;  3CHP A;  5G05 C;  4HS2 A;  3CHO A;  4NAC A;  4C0M A;  5LX8 A;  4HVB A;  3ML9 A;  3GW4 A;  5LOZ A;  5KCM A;  1KT1 A;  3ONL A;  3JQ1 A;  3D9M A;  2WB2 A;  1HXI A;  4Q94 A;  2Y4T A;  2L0I A;  2X6F A;  3CVL A;  3LY7 A;  4JPS A;  2J4B A;  3K9I A;  4J6I A;  4B0Z A;  3EHN A;  4JW1 A;  3KD7 A;  3CVY A;  4AM9 A;  3KEZ A;  4N3A A;  5AEN A;  1JPL A;  4YND A;  5BPP A;  2XPI A;  4NQ0 A;  1ZBP A;  3D9O A;  3FUF A;  4GA1 A;  3IHY A;  4CDM A;  4EBA G;  3FU0 A;  4NUR A;  5LFA A;  2XCB A;  4CDN A;  4BFR A;  4Q96 A;  2WXO A;  1NA0 A;  3AS5 A;  3CK7 A;  2YHE A;  3D9P A;  2OV8 A;  3HVE B;  5J08 A;  5KJN A;  4I1O B;  3HDX A;  4H7Y A;  4WWO A;  4BT9 A;  1TJF A;  2CFU A;  2CG2 A;  4HLE A;  2I6H A;  3ESL A;  3S7B A;  2X6J A;  4LER A;  3FU6 A;  3ZIM A;  1Z3X A;  3D9L A;  4CRW A;  3FUH A;  4GYY A;  4IUL A;  5EKQ D;  5CCL A;  5FWQ A;  3ZXS A;  2YNQ A;  3KS2 A;  3FUM A;  2CG3 A;  2KCV A;  3AU4 A;  2WQ7 A;  1OWL A;  3CIA A;  2A4Z A;  3DBS A;  3HYM B;  3C98 A;  2X6H A;  5HQ8 A;  1OWO A;  3ZYK A;  4EBA A;  3FTZ A;  4CDR A;  4BWR A;  1NP7 A;  3QC1 A;  4XX5 A;  4G26 A;  5FZS A;  2Y3A A;  3B7R L;  2LSU A;  3FTV A;  2YIN A;  4FLB A;  4R7L A;  4APO A;  3APD A;  3CEQ A;  4JZY A;  4BX9 A;  2XEV A;  4PUC A;  4YVQ C;  4G2V A;  4FA6 A;  5J90 A;  3FUJ A;  2I1J A;  2QY7 A;  3ENE A;  4J8S A;  4UWG A;  5T3R A;  3CVU A;  3MX3 A;  3OXF A;  2WXN A;  4B8A A;  1OWN A;  1UW4 B;  1ELK A;  3CVN A;  4AY5 A;  4XIF A;  1HX8 A;  4YVO A;  3LVR E;  3LPZ A;  5JJT A;  3JUI A;  3ZYM A;  1KT0 A;  2DCP A;  2YQ8 A;  2WXI A;  4JEU A;  1ELR A;  3QWV A;  4GZ5 A;  3PNT B;  3AS8 A;  3VLD A;  3T5V A;  3PVL A;  2PM7 A;  4KYO B;  4QFV A;  2X3M A;  2GRL A;  4N3C A;  1IQU A;  2IOL A;  3FUD A;  5G2N A;  3UT8 A;  4HOS A;  4G24 A;  4P29 A;  4AJW A;  3O48 A;  4MS6 A;  4GZC A;  3CK9 A;  2X6K A;  3FFL A;  4HOQ A;  3UPV A;  2DBA A;  5G55 A;  2XQ0 A;  3APF A;  2GW1 A;  5T8I A;  4AVX A;  2FO7 A;  2WXF A;  3Q47 B;  3FUL A;  2WPV A;  2VGX B;  1Z3Y A;  3MJW A;  3CLJ A;  1H6K A;  4I9E A;  2KM4 A;  1E8Z A;  3PEU B;  3SGH A;  4GZ6 A;  4DJA A;  2ION A;  5HI7 A;  4ACK A;  1DNP A;  2JEK A;  3LDZ A;  5FQ6 A;  4LRZ A;  4EQF A;  5C1D A;  4FAD A;  2OVB A;  4I2W A;  1MQS A;  3CHQ A;  3LVQ E;  1EPU A;  1IYG A;  5ARG A;  5BV0 A;  4DK5 A;  3MA5 A;  3JCK C;  1SZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...