3KD7A

Designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
102
structure length
102
Chain Sequence
NSAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTPR390
publication title Crystal structure of a designed tetratricopeptide repeat module in complex with its peptide ligand.
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
total genus 41
structure length 102
sequence length 102
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3kd7A00
3S7FA 2L6JA 4I1AA 3CVPA 3S7JA 4GCNA 3PDNA 1IHGA 3SF4A 4WNFA 4U0ZA 3IEGA 4H7YA 5FTPA 3ZGQA 4RG6A 3KS2A 3PE3A 1ELWA 1HZ4A 3ASFA 3ASGA 4O6FA 5M72A 4WNDA 4I9CA 3QDNA 1P5QA 3PE4A 4APOA 3ZPJA 4Y6CA 4HOTA 1QZ2A 3BEEA 2XEVA 2PQRA 4HOQA 5D0OD 4HOUA 3LYAA 3ASDA 3SZ7A 2FO7A 4G1TA 5FZSA 2Y4UA 3ZN3A 4KYOB 5LCWJ 3CVQA 3K9IA 3RJVA 3Q47B 4YVQC 3TAXA 4F3VA 5EKQD 3E4BA 1WAO1 3CK8A 3KD7A 3LCAA 4AY5A 3WXXA 4HORA 4KXKB 4BT9A 1NZNA 5BT1A 2E2EA 5CCLA 4N3CA 3Q4AB 2XGOA 3HYMB 5FZRA 2FI7A 2KCVA 4GA1A 2PL2A 3UUXA 1TJCA 5DIZA 1ZU2A 4I17A 5A7DB 2FEZA 3AS5A 1XNFA 3TG4A 1KLXA 2AVPA 5KJKA 2DBAA 4N3AA 5FT9A 3ASHA 3EDTB 4G2VA 5EX3A 3KAEA 5AYWD 2LNIA 2PZIA 5CHEE 1E96B 4J8EA 4IN3B 5KJNA 3URZA 5LCWC 3QWVA 5EX0A 2C0LA 2IFUA 3RIBA 3FFLA 3GW4A 4GYYA 3GZ1A 3RO3A 3OXGA 5FZQA 3CKCA 3ESKA 4N5CA 3LY8A 5HI7A 3S7BA 2ONDA 1B89A 2LSUA 3O48A 3U4TA 2IF4A 2HO1A 2YHCA 1Y8MA 4U04A 2OOEA 5FJYA 5KJMA 4I2ZA 4N39A 2JLBA 5CCMA 4UQXA 4BTBA 4UQYA 1A17A 3GYZA 1ELRA 2FBNA 4YNDA 3FWVA 2VYIA 4GYOA 3MEKA 4NQ0A 5DBKA 3QOUA 4LEUA 4UI9K 1HH8A 5G05J 3UQ3A 2XGMA 4YVOA 2KATA 1WM5A 3OXFA 3RKVA 2XGSA 2PQNA 2C2LA 2WPVA 4N3BA 4W9RA 4J8DA 4G25A 4BWRA 4JL0A 4GA0A 2R5SA 3JYSA 4J0UA 4EQFA 2P58C 2HYZA 1NA0A 3QWWA 4WNEA 1IYGA 4G24A 5D0QD 4U07A 4KBQA 4CGVA 4U0UA 4XI9A 4NRHB 4J8FA 2VQ2A 4Y6WA 2YQ8A 4BT8A 2GW1A 5G05C 4GZ5A 5BW8C 3VTXA 3VTYA 3ZHEA 1HXIA 3S7DA 4JA7A 5JJ7A 2MHKA 4RG9A 3R9AB 2WQHA 3LKUA 3TG5A 4WUYA 3ZFWA 5KJLA 3CVNA 1KT1A 5A6CA 2VGYA 2Q7FA 2XPIA 3NF1A 1NA3A 4GA2A 4I2WA 3ULQA 1PC2A 5JJTA 3ZHEB 4G26A 2XCCA 2C0MA 4U0SA 5HQ8A 4ABNA 3AS8A 1W3BA 3CKBA 3Q5MA 3N71A 3Q49B 3CEQA 5G04J 3CVLA 2QFCA 4WNGA 5BNWA 2KCLA 1YA0A 1QQEA 3FP3A 3LY7A 4CGWA 4JHRA 4AM9A 5C1DA 2UWJG 3MKRA 4GZ3A 4ME2A 2LSVA 3QKYA 4GYWA 2FF4A 4CDRA 1ZBPA 3MV2B 2V5FA 4UQZA 4UI9C 3TGOA 4N2QA 4AY6A 4N2SA 4XIFA 2BUGA 4H7XA 4JA9A 3UPVA 4AIFA 4GPKA 4I9EA 2VGXA 3CV0A 3LY9A 2HR2A 3U3WA 2NC9A 3OXLA 2Y4TA 5ARFA 5JJ6A 3MA5A 3RO2A 4BTAA 3QWPA 3Q15A 2UY1A 4B94A 3AS4A 2VSYA 4G23A 2I6HA 1OUVA 3CK9A 3MV3B 5G04C 1FCHA 3GZ2A 3LPZA 4HOSA 2J9QA 2KCKA 4XI0A 2VGXB 4GCOA 2XCBA 3CK7A 1KT0A 2KC7A 2VSNA 4A1SA 3RU0A 4UI9J 4GZ6A 5ARGA 2UY1B
chains in the Genus database with same CATH superfamily
4DX1A 3C72A 1TJFA 3S7JA 4KZ0A 3PDNA 1DCQA 3B7RL 3I4RB 4TV3A 3SF4A 3PS6A 4QFVA 4U0ZA 2NSZA 3JUEA 3ZGQA 3KS2A 4ATGA 3PE3A 4TUMA 5FWQA 5HKPA 1H6KA 3FHEA 4O1OA 2MOWA 2Y69E 3ASGA 4DX2A 1P5QA 3ZYLA 1FT1A 3ZPJA 3MKQA 4Y6CA 5BPPA 1FT2A 4LUNU 4O60A 3T5VA 3LYAA 2L9BA 3ASDA 3SZ7A 2F0YA 2Y4UA 3NOCD 4F53A 4IYPA 3CVQA 5AJLA 3RK6A 4L1BA 1MJ0A 3B7UX 4F3VA 3FTUA 3SQVA 2AWIA 3KD7A 1HG2A 3TWQA 4AY5A 4TXPA 3PUJA 2WXNA 1N0RA 1IXVA 3HIZA 3T9KA 3APCA 3QK0A 4U96D 1TNBA 3FUKA 3Q9UC 4I6GA 4CT4A 4FJZA 3UIPC 5CCLA 4ILHB 1O1RA 2F8YA 1X81A 5FZRA 2P9LG 2J07A 2WB2A 1OY3D 4LERA 3SHFA 2DZOA 1TJCA 3D9HA 1ZU2A 4UWHA 4I17A 4FP7A 3TG4A 1H0AA 2DBAA 1D9SA 3EDTB 5EX3A 3JQ0A 2LXMA 4IN3B 3C3QA 2VTBA 3FTSA 3PREA 2C0LA 1TEZA 2CHWA 2GRRB 3GW4A 4F1SA 3GZ1A 1SA5A 4MRUA 5ENOD 2RKKA 5LP0A 3ESKA 1K1AA 4BSZB 4GTTA 3LY8A 1B89A 2LSUA 1Z3XA 3O48A 4Q94A 2HO1A 1MYOA 3T8MA 4NURA 2IQCA 4N39A 5CCMA 3R9MA 3CVWA 1N4RA 2IU1A 4YNDA 3FWVA 2Y0BG 4JHJA 3HDXA 4L9PA 3G2WA 2V8SE 3RRNB 3D3MA 3MEKA 4HFGA 4I6JA 5EYPF 5DBKA 4OAVB 3V2OA 4DX6D 5G05J 5ANLA 4KVOA 2WXFA 4WWPA 4DRXE 3SFXA 2PQNA 2C2LA 3D9JA 1EPUA 3LS8A 2KZTA 1HG5A 5EILA 5AENA 3T5XA 3E34A 4JL0A 3BU8A 4GA0A 1KZOA 5LOZA 1Z3YA 3EHMA 4JD2G 4J0UA 5ENNA 3L82A 1NA0A 4M7CA 4C0EA 4JB8P 4DK5A 5D0QD 2JABA 4KBQA 1S0PA 3NZUA 3ZXPA 3ZYMA 3ZRHA 2CHZA 2XEEA 3J5QB 1WDYA 2YQ8A 2WXQA 1N11A 4HBDA 3DEOA 2GW1A 5G05C 2ZGDA 1O1TA 3VTXA 2P9PG 1RZ4A 4HLEA 5JJ7A 3ZNGA 3CIAA 3OTNA 3UKRG 3UM1A 4PS3A 2WQHA 4EHMA 4V3IA 2MYOA 3ZFWA 3AAAC 2X6FA 4U95D 3MJWA 5LX8A 3NOGD 2V5QC 1EDUA 3L17A 1LD7A 2X38A 4FJYA 2Q7FA 4EECA 5FQ7A 1NA3A 1BPOA 1OWOA 1PY1A 3ZYKA 1N4SA 2AXZA 5G55A 3ZVVA 4U0SA 1OCCE 4LG6A 3ZW3A 5HQ8A 3MYVA 1PAQA 4FLHA 3FU6A 2QZAA 4EZLA 4A3VA 1MQSA 3SBSA 3FP3A 2QYUA 3CVVA 4EPZA 3ABME 2I2OA 2VSOE 3UXGA 3AG1E 5B3SE 4AV7A 3E33A 4XEIG 2FF4A 4ANXA 1ZBPA 4B93B 4ZHBA 4GTOA 3MV2B 2V5FA 4N2QA 5E75A 3HXBA 4U63A 4CZ2D 1N95A 4RSYA 4H7XA 1EF1C 3CQCB 3D9KA 1OXJA 3LY9A 4LCTA 4G11A 1NFIE 3V79K 4U8YD 3PEUB 3CVUA 3KEAA 3JCKC 3ESLA 4GAAA 4IRUA 4G23A 2VSYA 4JC8A 5ENPD 1H19A 1OUVA 1KZPA 4BETA 2IEJA 3OAWA 4HOSA 1U3CA 4FC8A 1EYHA 2VGXB 4GCOA 3UX4A 2KM4A 4ACLA 5EIDA 1RW2A 2XCBA 1MZCA 1KT0A 4CCAA 1H6PA 4E85A 2OV8A 4UI9J 3FEXA 2XHEA 1JCQA 5ENQD 3SGHA 2UY1B 1BI7B 3S7FA 5KJKA 4I1AA 1N9AA 4GCNA 1YMPA 3HXDA 4C9BB 3JUIA 4TXQA 2A5UA 3QC1A 2WMOA 4DI4A 1BD8A 2VGEA 4GTQA 3R7RA 3W9FA 4A55A 5JA4D 2FO1E 1ELWA 2XS8A 3C3RA 5M72A 3QDNA 3CHPA 2P2CP 4MLPA 2XEVA 1UN9A 5IY5E 4XE0A 4HOQA 5D0OD 4HOUA 2DVWA 3RSEG 3EHQA 4G1TA 3PZ1A 5FZSA 2J49A 3PNTB 3ZN3A 4KYOB 3ISMC 3RJVA 3Q47B 4U8HA 3UIOC 3TAXA 3ZU7B 4K5CA 1D8DA 3E4BA 3UT8A 3DSUA 3MKQB 3CK8A 5AARA 1NL4A 1N4PA 1TR4A 2X3MA 5BV1A 3WXXA 2XZDG 3Q78A 5T4YA 3SFYA 1V54E 4NACA 1NZNA 3D9OA 5CBNA 5CEAA 2WXIA 4WWNA 3Q4AB 3HYMB 4I1OB 2FI7A 4BX9A 2KCVA 3VLEA 2PL2A 1WG0A 1U2VG 1ZB1A 2J08A 2WMNA 3SI5A 3HVEA 1KLXA 4UWKA 2Y3AA 3G2TA 4APFA 3BUAA 5FT9A 2LO6A 4G2VA 4B8CB 5CHEE 2DWZA 5KJNA 2AXUA 1NP7A 3URZA 3C98A 4FA6A 4GMJA 2OVBA 2IFUA 3JXIA 4GYYA 3RO3A 3CKCA 4N5CA 3S7BA 2E0IA 1UG3A 4BERA 2IY0C 3LJNA 4B8AA 5LFAA 4JEUA 5AQBA 2L0TB 1OWPA 3NBNB 4XX5A 4GZCA 1E8YA 2VTBB 4I2ZA 2JLBA 3HG0D 5H7PA 4NIKA 2I1KA 4FADA 3LVQE 3LJ3A 3DSTA 4BTBA 1A17A 2GRLA 4K03A 2VYIA 4GYOA 2EINE 5A23A 1XGWA 4NQ0A 1N0QA 4YDYA 4U8VD 2B6CA 1SVXA 2XGMA 3L9TA 2XPYA 2KATA 4GTRA 5AAOA 1WM5A 2DCPA 2XGSA 4N3BA 2H6HA 2V0PA 3ASNE 1K8KG 2KBXA 1DNPA 3PZDA 2P9KG 2WQ7A 3FH5A 2EIKE 4L2LA 3C3OA 3E30A 2P58C 4F6RD 1TNOA 3QWWA 4HRNA 1OWNA 3ENEA 1LD8A 3Q75A 3Q7FA 3DSSA 4U0UA 2KZTB 2GROB 2M63A 3CR3A 5AIJA 4CT0A 2VQ2A 4RQIA 4L2YA 2XRZA 5FQ4A 1SW6A 4GZ5A 3L6AA 3JXJA 3C5RA 3VTYA 4DX7D 3ZHEA 2MRIA 3PRZA 1TN8A 3S7DA 4HNAD 1E8WA 3R9AB 5AQ9A 1UW4B 2NYJA 3LKUA 3TG5A 3EJNA 3D9LA 3CQGB 3CVNA 3V31A 2WXKA 3ABLE 5A6CA 2WXRA 4HS2A 5C2YA 1H2VC 4EZKA 3AJIA 1KPSB 1JWGA 4ANUA 3FU3A 5HS0A 5JJTA 2XCCA 3MCXA 2JEKA 4ABNA 1W3BA 3CKBA 5B1AE 3L08A 2XEHA 4UWFA 3N71A 3Q49B 3MGBA 3CEQA 5G04J 3CVLA 2DYRE 5BNWA 2KCLA 1YA0A 4GTSA 4GMRA 5E76A 3UT4A 2GRNB 4ILGA 5ENSD 4DX5D 5D66A 3G2VA 3W9GA 2LSVA 4OAUC 4DPRA 2PM6A 3AG2E 1O5MA 4JA9A 4GMLA 4GPKA 2L0IA 2KXPC 4FHJA 4HRMB 3U3WA 5ARFA 5JJ6A 3MA5A 3FTVA 2I9CA 3RO2A 2YNQA 4K5BA 5EYLA 4B94A 5CRUA 3IKOB 5FQ6A 4OVVA 3MV3B 5G04C 5CBOA 3I3NA 3AG4E 4J6IA 5J90A 3FUEA 3KSQA 4UUCA 5AQ7A 1S64A 5EN5D 3HHMA 2WXHA 3FUJA 3IHVA 3V30A 1E8ZA 3ASOE 1JUQA 1QBQA 3L13A 2F8XK 2L6JA 4J8SA 2GGFA 2AJAA 2ZISA 4F1PA 4HXIA 4WNFA 3IEGA 5FTPA 1TNYA 3FU5A 4A63B 1BI8B 2J8SD 3B7SA 2WQ6A 4GPMA 3ONLA 5D2MC 2DIWA 3HRAA 2AW6A 3ASFA 3JQ1A 4O6FA 4WNDA 4I9CA 3QARA 4WAFA 3ZEFA 1QZ2A 2IOLA 3UKUG 2PQRA 3L22A 1TNZA 2FO7A 3PH0C 1MX6A 5LCWJ 3UM2A 3BG0B 4ZFHA 5CRVA 4FULA 1OCRE 5EKQD 1WAO1 5JMND 1HX8A 3TWRA 3LCAA 4XKCA 3ZKJA 2ZGGA 3ABKE 5AN8A 3DSVA 3APFA 5ANRA 1SZAA 4EBAA 5BT1A 2E2EA 2YINA 4N3CA 2ZXWE 1U3DA 4WWOA 2XGOA 1N94A 2F37A 2BEDA 1E7UA 4GA1A 3TWVA 3CHSA 4YDOA 1ELKA 3QB2A 5DIZA 5A7DB 2FEZA 3AS5A 2LXLA 2QY7A 2AVPA 4N3AA 3Q79A 3KAEA 1E96B 4TUUA 2WXOA 2R02A 5LCWC 5CMWA 5EX0A 1JCRA 2YHEA 4N5QA 3CVXA 4PH4B 3RIBA 3FFLA 3TXNA 2IO3C 2ZIRA 4DUIA 3HXFA 2RD0A 4I1MA 4PS7A 5HI7A 1QYMA 4DLQA 4LNGA 3SBTB 4BESA 3FY4A 2YHCA 1Y8MA 4U04A 2J4BA 2R03A 4PDXA 4HQDA 1HF8A 3TL5A 4I6EA 5FJYA 5KJMA 1V55E 1H2TC 4KVMA 4UQYA 1BU9A 1E90A 4GU5A 1H6OA 2DZNA 3QOUA 4LEUA 4UI9K 3FUHA 3DWLG 3ML9A 2P9IG 3UQ3A 3IV0A 4XZ4A 3FUDA 1GW6A 4KZCA 3RKVA 4P29A 2WPVA 5HRYA 4LNBA 3UM3A 4W9RA 1E8XA 4J8DA 3D9IA 3HXCA 2X6IA 3U9WA 4DJAA 3FU0A 3JYSA 1HFAA 4AOFA 2BKKB 2HYZA 1OCZE 2CG2A 4WNEA 3IHYA 4A3TA 1A5EA 2RFAA 3EIJA 3U66A 2CFUA 2OCCE 4EBAG 1X5BA 3NAWA 1DC2A 2I1JA 4Y6WA 1K3ZD 4A1GA 5AJDA 4MKTA 3RRMB 3UM0A 2B0OE 1TN6A 3F6QA 3SFZA 3EUVA 3APDA 4R7LA 4JA7A 3CHRA 3B95A 2MHKA 1MX2A 3ZYQA 4J8YA 5KJLA 1YCSB 5KWDA 5FQ8A 4KMOA 4B89A 1KT1A 3DXMG 1IKND 2WXMA 1MHQA 3UT7A 2XS1A 3V2XA 3NF1A 5J08A 3UTMA 4GA2A 4I2WA 4C48B 3ZHEB 4G26A 2OEVA 4AJWA 2PM7A 1UOHA 2BKGA 2C0MA 3TWXA 5ITZF 4U7EB 2WXGA 3Q5MA 3FUMA 2EQXA 3FULA 2GRPB 4HI9A 4GZDA 4E6HA 3AU5A 3T8KA 5BUZA 4HVBA 2LUHA 1QQEA 2AXVA 3LY7A 4G8KA 3Q7AA 4CGWA 2WM9A 2HM8A 4LNUD 4UWLA 2R05A 4AM9A 5C1DA 4OVUA 1FVFA 2ETAA 2UWJG 3E37A 3I4GA 4FU3A 1OT8A 1O1SA 4J7WA 3FEYA 3J5PA 3HXEA 4CDRA 4BX8A 1MX4A 3PZ2A 3DBSA 2QYJA 4UQZA 4AVXA 3TGOA 4AY6A 4N2SA 4M3OA 3DXKG 2BUGA 4BSXA 3UPVA 4AIFA 4URKA 4I9EA 4PS8A 5ENTD 3CLJA 3CV0A 3TWSA 3QAQA 2NC9A 3DPDA 3DRAA 1LTXA 1K1BA 4BTAA 3FH8A 3QWPA 4D10C 3Q15A 2IOSA 3B13A 2I6HA 4O1PA 3CK9A 4Z68A 4L7TA 5KNHD 2IO2C 1FCHA 4F7AA 2EILE 3TWWA 3CSFA 1WY6A 3FDHA 1S70B 2KCKA 4GTMA 3Q73A 4CYMD 5EIBE 3CK7A 5ENRD 1IQUA 3FTXA 2H6IA 3FUNA 2OEWA 3RU0A 3ZXSA 5ARGA 2L6BA 4BEPA 2R59A 3SNXA 4Q96A 3B7BA 3BG1B 5KNGA 3B7TA 4PUCA 3CVPA 2EIJE 1JCSA 5CERB 2DYSE 3CSTA 1IHGA 2ZU6B 3IBEA 4C0MA 3QJZA 4H7YA 4CEMA 4X8QA 5EDSA 3DSWA 3D9NA 1N4QA 4RG6A 4QQIA 2CFZA 1Z5SC 1Q2ZA 1Y6IA 4RVBA 3R7QA 1HZ4A 3FUIA 4BFRA 3PE4A 4APOA 3EHRA 3RRUA 4HOTA 3NB2A 3BEEA 4FHKA 4JVSA 1E7VA 4CDNA 1G3NB 4JW1A 3ONKA 4JPSA 3PNLB 3RAUA 2A4ZA 4L23A 3K9IA 2IONA 4AXHA 4YVQC 2BF0X 2R2LA 5FIOA 1HU3A 3CHOA 3LXUX 4K5AB 1N54A 3SY2A 1HE8A 3KEZA 3FUFA 3TWUA 3WG7E 4HORA 3MX3A 4KXKB 4BT9A 3FTYA 1OWLA 2XQ0A 5CECB 1SQMA 3TWTA 3O4ZA 3DSXA 2VSXE 3UUXA 1IHBA 2GRMA 3BQOA 2BTDA 2NXPA 3L16A 1XNFA 1TN7A 2GRQB 3ASHA 1INZA 5AYWD 2LNIA 2PZIA 4J8EA 4JEHA 4IULA 3G2UA 3QWVA 5T3RA 1AWCB 2P9UG 2ETBA 3IXEA 1JWFA 2OVFA 1N52A 3OXGA 5FZQA 3GZSA 4JHKA 5BXOA 2H6GA 2ONDA 3LVRE 2J4DA 3PZ4A 2IF4A 3U4TA 1HO8A 3P2BA 4GTPA 2OOEA 1OWMA 3ML8A 1SA4A 3FTWA 4YDEA 3Q9NC 4UQXA 3GYZA 1ELRA 2FBNA 5B1BE 4MBGA 4LSZE 3CVYA 1HH8A 3UI2A 3CHMA 3EIQC 3ULEG 2ILRA 2WXJA 4YVOA 5AQAA 3EU9A 3OXFA 4AEZC 3MZLB 3D9MA 2EIME 4KT6B 3KSLA 1D8EA 2VJ8A 3G2SA 1UJKA 2QC9A 5G2NA 4G25A 2CG3A 3ZIMA 4HB5A 4BWRA 4ANVA 3E32A 2R5SA 4RLYA 4CDMA 4EQFA 4Q69A 2RG8A 3EHNA 4OYSA 4GTVA 3I5PA 3DEPA 3SO8A 1IYGA 4G24A 4U07A 5KCMA 4CGVA 4HRLA 4XI9A 4NRHB 2A5EA 2PNNA 3PVLA 4J8FA 1SZ9A 4BT8A 2H6FA 3NQPA 2V4HC 4MS6A 3L54A 1FPPA 1OCOE 3CHQA 4GB9A 2X6HA 3LEWA 2IJGX 5BW8C 3EU5A 3FH7A 5CMYA 4BY6A 4B0ZA 1HXIA 4RG9A 2XENA 3HVEB 1YYHA 3FTZA 4WUYA 4YDWA 3PZ3A 5CEDB 3AU4A 2XPZA 2VGYA 1HS6A 2XPIA 5JHBA 1IQRA 3D9PA 4K0RA 1BLXB 3SD5A 3ULQA 1PC2A 1FVHA 1H2UA 5KBAA 3NZSA 1LF8A 4HLLA 4ATZD 1Z6TA 2V4LA 4JXTA 1TNUA 2CHXA 2R17C 1S63A 3AS8A 4ACKA 4TRQA 5T8IA 4LRZA 2XRYA 3UMVA 2QFCA 4WNGA 4ANWA 2HE0A 4G8LA 4JHRA 4UWGA 3MKRA 4EZJA 2FULA 2LAIA 4ILIA 4DI3A 4GZ3A 3UINC 4AP2A 4ME2A 3QKYA 2RFMA 1QNFA 2P9NG 4GYWA 1UN8A 3DPYA 3P1UA 2X6KA 2P9SG 1UJJA 1JPLA 2WVIA 4TXRA 5FINA 4UI9C 3LDZA 3TJPA 4XIFA 1DVPA 4XKBA 1VDYA 2WXLA 2VGXA 3AG3E 3PEVB 2HR2A 4FLBA 2Y1LE 4CRWA 5JHAA 3CGHA 2XZTG 3OXLA 2Y4TA 1AP7A 5BXUA 2UY1A 3AS4A 4DLOA 3ULYA 3PUKA 3S2AA 3GZ2A 3LPZA 4I43A 2J09A 4HI8A 3VLFA 1L5JA 2ETCA 2J9QA 3QNKA 3TXMA 4XI0A 1DCEA 2WXPA 3ZUVB 3U64A 2KC7A 1TYQG 2VSNA 5BV0A 4A1SA 2X6JA 4GZ6A 3X2QE 1NI1A 2LAHA 3VLDA 4JZYA
chains in the Genus database with same CATH topology
3BG1B 3S7FA 2L6JA 3B7TA 4J8SA 4PUCA 4I1AA 1TJFA 2GGFA 3CVPA 3S7JA 4GCNA 4KZ0A 3PDNA 4C9BB 3JUIA 2A5UA 3QC1A 3B7RL 3I4RB 4HXIA 4TV3A 2WMOA 3CSTA 1IHGA 3SF4A 4WNFA 3PS6A 4QFVA 2ZU6B 3IBEA 4U0ZA 4C0MA 3IEGA 3QJZA 4H7YA 2NSZA 5FTPA 4CEMA 4DI4A 3FU5A 5EDSA 3B7SA 3ZGQA 3D9NA 3R7RA 4RG6A 4A55A 3KS2A 2CFZA 4ATGA 2WQ6A 3PE3A 3ONLA 2DIWA 1Y6IA 4RVBA 5FWQA 1ELWA 3R7QA 2AW6A 1H6KA 1HZ4A 3ASFA 3FHEA 2MOWA 3FUIA 3ASGA 3JQ1A 4O6FA 5M72A 4WNDA 4I9CA 3QDNA 1P5QA 3CHPA 3PE4A 3ZYLA 4BFRA 4APOA 3QARA 4WAFA 3ZPJA 3MKQA 4Y6CA 5BPPA 3RRUA 3ZEFA 4HOTA 1QZ2A 3BEEA 2IOLA 4FHKA 4JVSA 4MLPA 2XEVA 1UN9A 1E7VA 4XE0A 2PQRA 4HOQA 5D0OD 4LUNU 3L22A 4CDNA 4HOUA 3T5VA 3LYAA 2L9BA 3ASDA 4JW1A 3SZ7A 2FO7A 3ONKA 4G1TA 4JPSA 5FZSA 3PNLB 3PH0C 2Y4UA 2A4ZA 2J49A 3PNTB 3ZN3A 4F53A 4KYOB 4IYPA 3BG0B 5LCWJ 4L23A 3CVQA 5AJLA 3K9IA 3RJVA 2IONA 3RK6A 4AXHA 3Q47B 4U8HA 4YVQC 4L1BA 3TAXA 3B7UX 2BF0X 4FULA 4F3VA 5EKQD 3FTUA 3E4BA 1WAO1 2AWIA 3UT8A 1HU3A 1HX8A 3MKQB 3CHOA 3CK8A 3KD7A 3LXUX 1HG2A 1N54A 3LCAA 4AY5A 4XKCA 3PUJA 1HE8A 2X3MA 3KEZA 5BV1A 2WXNA 3FUFA 3WXXA 3HIZA 4HORA 3MX3A 4KXKB 3APFA 3APCA 4BT9A 5ANRA 3QK0A 3FUKA 3FTYA 5T4YA 1SZAA 4NACA 2XQ0A 1NZNA 1OWLA 3D9OA 2WXIA 4I6GA 4EBAA 2E2EA 5BT1A 2YINA 4FJZA 4CT4A 4N3CA 5CCLA 4WWNA 4ILHB 1U3DA 1SQMA 4WWOA 3Q4AB 2XGOA 3HYMB 4I1OB 5FZRA 2J07A 2FI7A 4BX9A 2KCVA 1E7UA 3VLEA 4GA1A 3O4ZA 2WB2A 3CHSA 2VSXE 2PL2A 4LERA 3SHFA 3UUXA 1ELKA 1TJCA 2GRMA 3QB2A 4UWHA 1ZU2A 5DIZA 4I17A 2J08A 5A7DB 2FEZA 2BTDA 2NXPA 2WMNA 3AS5A 3L16A 4FP7A 3SI5A 1XNFA 1H0AA 1KLXA 2QY7A 2AVPA 3HVEA 4UWKA 3TG4A 5KJKA 2Y3AA 2DBAA 4N3AA 3G2TA 4APFA 5FT9A 3ASHA 1INZA 2LO6A 3EDTB 4G2VA 5EX3A 3KAEA 5AYWD 2LNIA 3JQ0A 4B8CB 2PZIA 5CHEE 1E96B 4J8EA 4IN3B 4TUUA 4JEHA 5KJNA 2AXUA 2WXOA 4IULA 1NP7A 3URZA 3G2UA 5LCWC 3C98A 4FA6A 2VTBA 4GMJA 3QWVA 5CMWA 5EX0A 2YHEA 3FTSA 5T3RA 3PREA 3CVXA 2C0LA 4PH4B 2OVBA 1TEZA 2CHWA 2IFUA 3RIBA 4BTBA 3FFLA 3GW4A 3TXNA 4F1SA 4GYYA 2RD0A 3GZ1A 4MRUA 1JWFA 2OVFA 3RO3A 1N52A 3OXGA 5FZQA 3CKCA 4I1MA 5LP0A 3ESKA 4N5CA 3GZSA 4JHKA 4PS7A 3LY8A 5HI7A 3S7BA 4DLQA 2ONDA 1B89A 2E0IA 3SBTB 1UG3A 3LVRE 2J4DA 2LSUA 1Z3XA 3O48A 2IF4A 4Q94A 3U4TA 2HO1A 4B8AA 1HO8A 5LFAA 4JEUA 3FY4A 2YHCA 1Y8MA 2L0TB 1OWPA 3P2BA 4NURA 3T8MA 4U04A 2J4BA 4PDXA 2OOEA 4XX5A 4GZCA 1E8YA 1HF8A 1OWMA 2IQCA 3ML8A 4I6EA 5FJYA 3TL5A 4I2ZA 4N39A 2JLBA 5CCMA 3FTWA 5KJMA 3CVWA 2I1KA 4UQXA 4FADA 1H2TC 3LVQE 3LJ3A 2IU1A 4KVMA 1A17A 1E90A 2GRLA 3GYZA 1ELRA 2FBNA 4UQYA 4YNDA 3FWVA 4K03A 2VYIA 4GU5A 4JHJA 3HDXA 4GYOA 3G2WA 2V8SE 3RRNB 3D3MA 3MEKA 1XGWA 5A23A 4HFGA 4I6JA 4NQ0A 5DBKA 3QOUA 3CVYA 4LEUA 4UI9K 1HH8A 3FUHA 5G05J 5ANLA 3CHMA 3ML9A 3EIQC 4KVOA 3UQ3A 3IV0A 2ILRA 2XGMA 4XZ4A 2WXJA 3FUDA 1GW6A 2XPYA 4YVOA 2WXFA 4WWPA 2KATA 4KZCA 1WM5A 3OXFA 4AEZC 2DCPA 3RKVA 2XGSA 3MZLB 2PQNA 3D9MA 4KT6B 4P29A 2C2LA 2WPVA 3D9JA 1EPUA 4N3BA 3LS8A 2V0PA 4W9RA 1E8XA 2VJ8A 3G2SA 2KZTA 1HG5A 1UJKA 4J8DA 3D9IA 4G25A 2CG3A 5G2NA 1DNPA 3PZDA 3ZIMA 5AENA 4JZYA 3T5XA 2X6IA 4JL0A 4BWRA 4GA0A 3U9WA 4ANVA 2WQ7A 4DJAA 3FH5A 5LOZA 2R5SA 1Z3YA 3EHMA 3FU0A 3JYSA 4J0UA 4CDMA 1HFAA 4EQFA 4L2LA 4AOFA 4Q69A 5ENNA 2RG8A 2P58C 2HYZA 2CG2A 3EHNA 4OYSA 1NA0A 3I5PA 4C0EA 3QWWA 4WNEA 3IHYA 4A3TA 1IYGA 4DK5A 4G24A 5D0QD 1OWNA 3ENEA 3EIJA 4U07A 5KCMA 4KBQA 4CGVA 4U0UA 2KZTB 3U66A 1S0PA 4XI9A 2CFUA 3NZUA 4NRHB 4EBAG 1X5BA 3ZYMA 3PVLA 2M63A 3SNXA 3CR3A 5AIJA 3ZRHA 2CHZA 4J8FA 2I1JA 2VQ2A 4CT0A 4L2YA 4Y6WA 1SZ9A 2YQ8A 2WXQA 2XRZA 4BT8A 4A1GA 5AJDA 3NQPA 4MS6A 3L54A 4MKTA 5FQ4A 3RRMB 3CHQA 4GB9A 2GW1A 2X6HA 5G05C 4GZ5A 3L6AA 3LEWA 2IJGX 5BW8C 3VTXA 3VTYA 3SFZA 3FH7A 2MRIA 3PRZA 3ZHEA 5CMYA 4BY6A 3APDA 4B0ZA 4R7LA 1HXIA 3S7DA 4JA7A 4HLEA 5JJ7A 3CHRA 3CIAA 3OTNA 1E8WA 2MHKA 4RG9A 3R9AB 3HVEB 4PS3A 2WQHA 1UW4B 3LKUA 3FTZA 3ZYQA 3TG5A 4V3IA 4WUYA 3ZFWA 3EJNA 5KJLA 2X6FA 3D9LA 3CQGB 5FQ8A 3CVNA 3MJWA 5LX8A 2WXKA 4KMOA 4B89A 1KT1A 5A6CA 2WXRA 4HS2A 1EDUA 5C2YA 3AU4A 2WXMA 3L17A 1H2VC 2X38A 4EZKA 4FJYA 1MHQA 2XPZA 2VGYA 2Q7FA 1HS6A 2XPIA 3UT7A 1IQRA 3D9PA 4EECA 5JHBA 4K0RA 5FQ7A 3NF1A 1JWGA 1NA3A 1BPOA 1OWOA 4ANUA 5J08A 3FU3A 4GA2A 4I2WA 3SD5A 3ULQA 1PY1A 1PC2A 1FVHA 3ZYKA 5JJTA 1H2UA 2AXZA 5G55A 3NZSA 3ZHEB 4G26A 3ZVVA 2XCCA 3MCXA 1LF8A 4AJWA 2JEKA 1Z6TA 2PM7A 2V4LA 2C0MA 4U0SA 4JXTA 2CHXA 3ZW3A 2R17C 5HQ8A 4ABNA 3AS8A 1W3BA 3CKBA 3MYVA 2WXGA 3Q5MA 3L08A 4ACKA 1PAQA 4FLHA 3N71A 4UWFA 2VTBB 4TRQA 3FUMA 3Q49B 2EQXA 3MGBA 4LRZA 3CEQA 5G04J 5T8IA 3FULA 3FU6A 2XRYA 3UMVA 3CVLA 2QFCA 4WNGA 5BNWA 4GZDA 4ANWA 4E6HA 2KCLA 4EZLA 3AU5A 1YA0A 3SGHA 4A3VA 5BUZA 1MQSA 4HVBA 1QQEA 3FP3A 5E76A 2AXVA 3LY7A 3SBSA 3UT4A 4ILGA 4CGWA 4JHRA 2WM9A 2HM8A 3CVVA 4UWLA 4AM9A 5C1DA 4OVUA 1FVFA 4EPZA 2UWJG 4UWGA 3MKRA 2I2OA 2VSOE 3I4GA 4EZJA 4FU3A 2FULA 2LAIA 4ILIA 3G2VA 4DI3A 4GZ3A 4AP2A 4ME2A 2LSVA 3QKYA 4AV7A 1QNFA 3FEYA 4GYWA 1UN8A 2FF4A 4ANXA 4CDRA 3P1UA 2X6KA 4DPRA 1ZBPA 1UJJA 2PM6A 1JPLA 4BX8A 2WVIA 3MV2B 2V5FA 3DBSA 4UQZA 4UI9C 3LDZA 4AVXA 3TGOA 5E75A 4N2QA 4AY6A 4N2SA 4U63A 3TJPA 4M3OA 4XIFA 2BUGA 4RSYA 4H7XA 4BSXA 4JA9A 3UPVA 4GMLA 4AIFA 4URKA 4GPKA 1DVPA 2L0IA 4XKBA 1EF1C 4I9EA 3CQCB 4PS8A 1VDYA 3D9KA 3CLJA 2WXLA 2VGXA 3CV0A 3LY9A 3PEVB 4LCTA 2HR2A 4G11A 4FLBA 4FHJA 3QAQA 4CRWA 5JHAA 3PEUB 3CGHA 3CVUA 3U3WA 2NC9A 3DPDA 2Y4TA 3OXLA 5ARFA 3MA5A 5JJ6A 3JCKC 3FTVA 2I9CA 3RO2A 2YNQA 3ESLA 4BTAA 3FH8A 3QWPA 4GAAA 4D10C 3Q15A 2UY1A 4B94A 3IKOB 4IRUA 3AS4A 2VSYA 4G23A 4JC8A 2IOSA 3B13A 5FQ6A 4DLOA 1H19A 2I6HA 1OUVA 4OVVA 3CK9A 3MV3B 4L7TA 5G04C 3I3NA 1FCHA 3PUKA 3GZ2A 3LPZA 3OAWA 4I43A 3S2AA 2J09A 4F7AA 3VLFA 1L5JA 2J9QA 4HOSA 4J6IA 3CSFA 1WY6A 1U3CA 4FC8A 5J90A 3FUEA 3FDHA 1EYHA 3QNKA 3TXMA 2KCKA 4XI0A 2VGXB 4GCOA 3UX4A 2KM4A 4ACLA 2XCBA 3HHMA 2WXHA 3CK7A 1KT0A 2WXPA 4CCAA 1IQUA 3FTXA 2KC7A 2VSNA 3FUJA 3IHVA 3FUNA 3U64A 4E85A 2OV8A 5BV0A 4A1SA 1E8ZA 3RU0A 4UI9J 3FEXA 2X6JA 3ZXSA 4GZ6A 2LAHA 2XHEA 5ARGA 3VLDA 1JUQA 4Q96A 2R59A 2UY1B 3L13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7F A;  2L6J A;  4I1A A;  3CVP A;  3S7J A;  4GCN A;  3PDN A;  1IHG A;  3SF4 A;  4WNF A;  4U0Z A;  3IEG A;  4H7Y A;  5FTP A;  3ZGQ A;  4RG6 A;  3KS2 A;  3PE3 A;  1ELW A;  1HZ4 A;  3ASF A;  3ASG A;  4O6F A;  5M72 A;  4WND A;  4I9C A;  3QDN A;  1P5Q A;  3PE4 A;  4APO A;  3ZPJ A;  4Y6C A;  4HOT A;  1QZ2 A;  3BEE A;  2XEV A;  2PQR A;  4HOQ A;  5D0O D;  4HOU A;  3LYA A;  3ASD A;  3SZ7 A;  2FO7 A;  4G1T A;  5FZS A;  2Y4U A;  3ZN3 A;  4KYO B;  5LCW J;  3CVQ A;  3K9I A;  3RJV A;  3Q47 B;  4YVQ C;  3TAX A;  4F3V A;  5EKQ D;  3E4B A;  1WAO 1;  3CK8 A;  3KD7 A;  3LCA A;  4AY5 A;  3WXX A;  4HOR A;  4KXK B;  4BT9 A;  1NZN A;  5BT1 A;  2E2E A;  5CCL A;  4N3C A;  3Q4A B;  2XGO A;  3HYM B;  5FZR A;  2FI7 A;  2KCV A;  4GA1 A;  2PL2 A;  3UUX A;  1TJC A;  5DIZ A;  1ZU2 A;  4I17 A;  5A7D B;  2FEZ A;  3AS5 A;  1XNF A;  3TG4 A;  1KLX A;  2AVP A;  5KJK A;  2DBA A;  4N3A A;  5FT9 A;  3ASH A;  3EDT B;  4G2V A;  5EX3 A;  3KAE A;  5AYW D;  2LNI A;  2PZI A;  5CHE E;  1E96 B;  4J8E A;  4IN3 B;  5KJN A;  3URZ A;  5LCW C;  3QWV A;  5EX0 A;  2C0L A;  2IFU A;  3RIB A;  3FFL A;  3GW4 A;  4GYY A;  3GZ1 A;  3RO3 A;  3OXG A;  5FZQ A;  3CKC A;  3ESK A;  4N5C A;  3LY8 A;  5HI7 A;  3S7B A;  2OND A;  1B89 A;  2LSU A;  3O48 A;  3U4T A;  2IF4 A;  2HO1 A;  2YHC A;  1Y8M A;  4U04 A;  2OOE A;  5FJY A;  5KJM A;  4I2Z A;  4N39 A;  2JLB A;  5CCM A;  4UQX A;  4BTB A;  4UQY A;  1A17 A;  3GYZ A;  1ELR A;  2FBN A;  4YND A;  3FWV A;  2VYI A;  4GYO A;  3MEK A;  4NQ0 A;  5DBK A;  3QOU A;  4LEU A;  4UI9 K;  1HH8 A;  5G05 J;  3UQ3 A;  2XGM A;  4YVO A;  2KAT A;  1WM5 A;  3OXF A;  3RKV A;  2XGS A;  2PQN A;  2C2L A;  2WPV A;  4N3B A;  4W9R A;  4J8D A;  4G25 A;  4BWR A;  4JL0 A;  4GA0 A;  2R5S A;  3JYS A;  4J0U A;  4EQF A;  2P58 C;  2HYZ A;  1NA0 A;  3QWW A;  4WNE A;  1IYG A;  4G24 A;  5D0Q D;  4U07 A;  4KBQ A;  4CGV A;  4U0U A;  4XI9 A;  4NRH B;  4J8F A;  2VQ2 A;  4Y6W A;  2YQ8 A;  4BT8 A;  2GW1 A;  5G05 C;  4GZ5 A;  5BW8 C;  3VTX A;  3VTY A;  3ZHE A;  1HXI A;  3S7D A;  4JA7 A;  5JJ7 A;  2MHK A;  4RG9 A;  3R9A B;  2WQH A;  3LKU A;  3TG5 A;  4WUY A;  3ZFW A;  5KJL A;  3CVN A;  1KT1 A;  5A6C A;  2VGY A;  2Q7F A;  2XPI A;  3NF1 A;  1NA3 A;  4GA2 A;  4I2W A;  3ULQ A;  1PC2 A;  5JJT A;  3ZHE B;  4G26 A;  2XCC A;  2C0M A;  4U0S A;  5HQ8 A;  4ABN A;  3AS8 A;  1W3B A;  3CKB A;  3Q5M A;  3N71 A;  3Q49 B;  3CEQ A;  5G04 J;  3CVL A;  2QFC A;  4WNG A;  5BNW A;  2KCL A;  1YA0 A;  1QQE A;  3FP3 A;  3LY7 A;  4CGW A;  4JHR A;  4AM9 A;  5C1D A;  2UWJ G;  3MKR A;  4GZ3 A;  4ME2 A;  2LSV A;  3QKY A;  4GYW A;  2FF4 A;  4CDR A;  1ZBP A;  3MV2 B;  2V5F A;  4UQZ A;  4UI9 C;  3TGO A;  4N2Q A;  4AY6 A;  4N2S A;  4XIF A;  2BUG A;  4H7X A;  4JA9 A;  3UPV A;  4AIF A;  4GPK A;  4I9E A;  2VGX A;  3CV0 A;  3LY9 A;  2HR2 A;  3U3W A;  2NC9 A;  3OXL A;  2Y4T A;  5ARF A;  5JJ6 A;  3MA5 A;  3RO2 A;  4BTA A;  3QWP A;  3Q15 A;  2UY1 A;  4B94 A;  3AS4 A;  2VSY A;  4G23 A;  2I6H A;  1OUV A;  3CK9 A;  3MV3 B;  5G04 C;  1FCH A;  3GZ2 A;  3LPZ A;  4HOS A;  2J9Q A;  2KCK A;  4XI0 A;  2VGX B;  4GCO A;  2XCB A;  3CK7 A;  1KT0 A;  2KC7 A;  2VSN A;  4A1S A;  3RU0 A;  4UI9 J;  4GZ6 A;  5ARG A;  2UY1 B; 
#chains in the Genus database with same CATH topology
 4DX1 A;  3C72 A;  1TJF A;  3S7J A;  4KZ0 A;  3PDN A;  1DCQ A;  3B7R L;  3I4R B;  4TV3 A;  3SF4 A;  3PS6 A;  4QFV A;  4U0Z A;  2NSZ A;  3JUE A;  3ZGQ A;  3KS2 A;  4ATG A;  3PE3 A;  4TUM A;  5FWQ A;  5HKP A;  1H6K A;  3FHE A;  4O1O A;  2MOW A;  2Y69 E;  3ASG A;  4DX2 A;  1P5Q A;  3ZYL A;  1FT1 A;  3ZPJ A;  3MKQ A;  4Y6C A;  5BPP A;  1FT2 A;  4LUN U;  4O60 A;  3T5V A;  3LYA A;  2L9B A;  3ASD A;  3SZ7 A;  2F0Y A;  2Y4U A;  3NOC D;  4F53 A;  4IYP A;  3CVQ A;  5AJL A;  3RK6 A;  4L1B A;  1MJ0 A;  3B7U X;  4F3V A;  3FTU A;  3SQV A;  2AWI A;  3KD7 A;  1HG2 A;  3TWQ A;  4AY5 A;  4TXP A;  3PUJ A;  2WXN A;  1N0R A;  1IXV A;  3HIZ A;  3T9K A;  3APC A;  3QK0 A;  4U96 D;  1TNB A;  3FUK A;  3Q9U C;  4I6G A;  4CT4 A;  4FJZ A;  3UIP C;  5CCL A;  4ILH B;  1O1R A;  2F8Y A;  1X81 A;  5FZR A;  2P9L G;  2J07 A;  2WB2 A;  1OY3 D;  4LER A;  3SHF A;  2DZO A;  1TJC A;  3D9H A;  1ZU2 A;  4UWH A;  4I17 A;  4FP7 A;  3TG4 A;  1H0A A;  2DBA A;  1D9S A;  3EDT B;  5EX3 A;  3JQ0 A;  2LXM A;  4IN3 B;  3C3Q A;  2VTB A;  3FTS A;  3PRE A;  2C0L A;  1TEZ A;  2CHW A;  2GRR B;  3GW4 A;  4F1S A;  3GZ1 A;  1SA5 A;  4MRU A;  5ENO D;  2RKK A;  5LP0 A;  3ESK A;  1K1A A;  4BSZ B;  4GTT A;  3LY8 A;  1B89 A;  2LSU A;  1Z3X A;  3O48 A;  4Q94 A;  2HO1 A;  1MYO A;  3T8M A;  4NUR A;  2IQC A;  4N39 A;  5CCM A;  3R9M A;  3CVW A;  1N4R A;  2IU1 A;  4YND A;  3FWV A;  2Y0B G;  4JHJ A;  3HDX A;  4L9P A;  3G2W A;  2V8S E;  3RRN B;  3D3M A;  3MEK A;  4HFG A;  4I6J A;  5EYP F;  5DBK A;  4OAV B;  3V2O A;  4DX6 D;  5G05 J;  5ANL A;  4KVO A;  2WXF A;  4WWP A;  4DRX E;  3SFX A;  2PQN A;  2C2L A;  3D9J A;  1EPU A;  3LS8 A;  2KZT A;  1HG5 A;  5EIL A;  5AEN A;  3T5X A;  3E34 A;  4JL0 A;  3BU8 A;  4GA0 A;  1KZO A;  5LOZ A;  1Z3Y A;  3EHM A;  4JD2 G;  4J0U A;  5ENN A;  3L82 A;  1NA0 A;  4M7C A;  4C0E A;  4JB8 P;  4DK5 A;  5D0Q D;  2JAB A;  4KBQ A;  1S0P A;  3NZU A;  3ZXP A;  3ZYM A;  3ZRH A;  2CHZ A;  2XEE A;  3J5Q B;  1WDY A;  2YQ8 A;  2WXQ A;  1N11 A;  4HBD A;  3DEO A;  2GW1 A;  5G05 C;  2ZGD A;  1O1T A;  3VTX A;  2P9P G;  1RZ4 A;  4HLE A;  5JJ7 A;  3ZNG A;  3CIA A;  3OTN A;  3UKR G;  3UM1 A;  4PS3 A;  2WQH A;  4EHM A;  4V3I A;  2MYO A;  3ZFW A;  3AAA C;  2X6F A;  4U95 D;  3MJW A;  5LX8 A;  3NOG D;  2V5Q C;  1EDU A;  3L17 A;  1LD7 A;  2X38 A;  4FJY A;  2Q7F A;  4EEC A;  5FQ7 A;  1NA3 A;  1BPO A;  1OWO A;  1PY1 A;  3ZYK A;  1N4S A;  2AXZ A;  5G55 A;  3ZVV A;  4U0S A;  1OCC E;  4LG6 A;  3ZW3 A;  5HQ8 A;  3MYV A;  1PAQ A;  4FLH A;  3FU6 A;  2QZA A;  4EZL A;  4A3V A;  1MQS A;  3SBS A;  3FP3 A;  2QYU A;  3CVV A;  4EPZ A;  3ABM E;  2I2O A;  2VSO E;  3UXG A;  3AG1 E;  5B3S E;  4AV7 A;  3E33 A;  4XEI G;  2FF4 A;  4ANX A;  1ZBP A;  4B93 B;  4ZHB A;  4GTO A;  3MV2 B;  2V5F A;  4N2Q A;  5E75 A;  3HXB A;  4U63 A;  4CZ2 D;  1N95 A;  4RSY A;  4H7X A;  1EF1 C;  3CQC B;  3D9K A;  1OXJ A;  3LY9 A;  4LCT A;  4G11 A;  1NFI E;  3V79 K;  4U8Y D;  3PEU B;  3CVU A;  3KEA A;  3JCK C;  3ESL A;  4GAA A;  4IRU A;  4G23 A;  2VSY A;  4JC8 A;  5ENP D;  1H19 A;  1OUV A;  1KZP A;  4BET A;  2IEJ A;  3OAW A;  4HOS A;  1U3C A;  4FC8 A;  1EYH A;  2VGX B;  4GCO A;  3UX4 A;  2KM4 A;  4ACL A;  5EID A;  1RW2 A;  2XCB A;  1MZC A;  1KT0 A;  4CCA A;  1H6P A;  4E85 A;  2OV8 A;  4UI9 J;  3FEX A;  2XHE A;  1JCQ A;  5ENQ D;  3SGH A;  2UY1 B;  1BI7 B;  3S7F A;  5KJK A;  4I1A A;  1N9A A;  4GCN A;  1YMP A;  3HXD A;  4C9B B;  3JUI A;  4TXQ A;  2A5U A;  3QC1 A;  2WMO A;  4DI4 A;  1BD8 A;  2VGE A;  4GTQ A;  3R7R A;  3W9F A;  4A55 A;  5JA4 D;  2FO1 E;  1ELW A;  2XS8 A;  3C3R A;  5M72 A;  3QDN A;  3CHP A;  2P2C P;  4MLP A;  2XEV A;  1UN9 A;  5IY5 E;  4XE0 A;  4HOQ A;  5D0O D;  4HOU A;  2DVW A;  3RSE G;  3EHQ A;  4G1T A;  3PZ1 A;  5FZS A;  2J49 A;  3PNT B;  3ZN3 A;  4KYO B;  3ISM C;  3RJV A;  3Q47 B;  4U8H A;  3UIO C;  3TAX A;  3ZU7 B;  4K5C A;  1D8D A;  3E4B A;  3UT8 A;  3DSU A;  3MKQ B;  3CK8 A;  5AAR A;  1NL4 A;  1N4P A;  1TR4 A;  2X3M A;  5BV1 A;  3WXX A;  2XZD G;  3Q78 A;  5T4Y A;  3SFY A;  1V54 E;  4NAC A;  1NZN A;  3D9O A;  5CBN A;  5CEA A;  2WXI A;  4WWN A;  3Q4A B;  3HYM B;  4I1O B;  2FI7 A;  4BX9 A;  2KCV A;  3VLE A;  2PL2 A;  1WG0 A;  1U2V G;  1ZB1 A;  2J08 A;  2WMN A;  3SI5 A;  3HVE A;  1KLX A;  4UWK A;  2Y3A A;  3G2T A;  4APF A;  3BUA A;  5FT9 A;  2LO6 A;  4G2V A;  4B8C B;  5CHE E;  2DWZ A;  5KJN A;  2AXU A;  1NP7 A;  3URZ A;  3C98 A;  4FA6 A;  4GMJ A;  2OVB A;  2IFU A;  3JXI A;  4GYY A;  3RO3 A;  3CKC A;  4N5C A;  3S7B A;  2E0I A;  1UG3 A;  4BER A;  2IY0 C;  3LJN A;  4B8A A;  5LFA A;  4JEU A;  5AQB A;  2L0T B;  1OWP A;  3NBN B;  4XX5 A;  4GZC A;  1E8Y A;  2VTB B;  4I2Z A;  2JLB A;  3HG0 D;  5H7P A;  4NIK A;  2I1K A;  4FAD A;  3LVQ E;  3LJ3 A;  3DST A;  4BTB A;  1A17 A;  2GRL A;  4K03 A;  2VYI A;  4GYO A;  2EIN E;  5A23 A;  1XGW A;  4NQ0 A;  1N0Q A;  4YDY A;  4U8V D;  2B6C A;  1SVX A;  2XGM A;  3L9T A;  2XPY A;  2KAT A;  4GTR A;  5AAO A;  1WM5 A;  2DCP A;  2XGS A;  4N3B A;  2H6H A;  2V0P A;  3ASN E;  1K8K G;  2KBX A;  1DNP A;  3PZD A;  2P9K G;  2WQ7 A;  3FH5 A;  2EIK E;  4L2L A;  3C3O A;  3E30 A;  2P58 C;  4F6R D;  1TNO A;  3QWW A;  4HRN A;  1OWN A;  3ENE A;  1LD8 A;  3Q75 A;  3Q7F A;  3DSS A;  4U0U A;  2KZT B;  2GRO B;  2M63 A;  3CR3 A;  5AIJ A;  4CT0 A;  2VQ2 A;  4RQI A;  4L2Y A;  2XRZ A;  5FQ4 A;  1SW6 A;  4GZ5 A;  3L6A A;  3JXJ A;  3C5R A;  3VTY A;  4DX7 D;  3ZHE A;  2MRI A;  3PRZ A;  1TN8 A;  3S7D A;  4HNA D;  1E8W A;  3R9A B;  5AQ9 A;  1UW4 B;  2NYJ A;  3LKU A;  3TG5 A;  3EJN A;  3D9L A;  3CQG B;  3CVN A;  3V31 A;  2WXK A;  3ABL E;  5A6C A;  2WXR A;  4HS2 A;  5C2Y A;  1H2V C;  4EZK A;  3AJI A;  1KPS B;  1JWG A;  4ANU A;  3FU3 A;  5HS0 A;  5JJT A;  2XCC A;  3MCX A;  2JEK A;  4ABN A;  1W3B A;  3CKB A;  5B1A E;  3L08 A;  2XEH A;  4UWF A;  3N71 A;  3Q49 B;  3MGB A;  3CEQ A;  5G04 J;  3CVL A;  2DYR E;  5BNW A;  2KCL A;  1YA0 A;  4GTS A;  4GMR A;  5E76 A;  3UT4 A;  2GRN B;  4ILG A;  5ENS D;  4DX5 D;  5D66 A;  3G2V A;  3W9G A;  2LSV A;  4OAU C;  4DPR A;  2PM6 A;  3AG2 E;  1O5M A;  4JA9 A;  4GML A;  4GPK A;  2L0I A;  2KXP C;  4FHJ A;  4HRM B;  3U3W A;  5ARF A;  5JJ6 A;  3MA5 A;  3FTV A;  2I9C A;  3RO2 A;  2YNQ A;  4K5B A;  5EYL A;  4B94 A;  5CRU A;  3IKO B;  5FQ6 A;  4OVV A;  3MV3 B;  5G04 C;  5CBO A;  3I3N A;  3AG4 E;  4J6I A;  5J90 A;  3FUE A;  3KSQ A;  4UUC A;  5AQ7 A;  1S64 A;  5EN5 D;  3HHM A;  2WXH A;  3FUJ A;  3IHV A;  3V30 A;  1E8Z A;  3ASO E;  1JUQ A;  1QBQ A;  3L13 A;  2F8X K;  2L6J A;  4J8S A;  2GGF A;  2AJA A;  2ZIS A;  4F1P A;  4HXI A;  4WNF A;  3IEG A;  5FTP A;  1TNY A;  3FU5 A;  4A63 B;  1BI8 B;  2J8S D;  3B7S A;  2WQ6 A;  4GPM A;  3ONL A;  5D2M C;  2DIW A;  3HRA A;  2AW6 A;  3ASF A;  3JQ1 A;  4O6F A;  4WND A;  4I9C A;  3QAR A;  4WAF A;  3ZEF A;  1QZ2 A;  2IOL A;  3UKU G;  2PQR A;  3L22 A;  1TNZ A;  2FO7 A;  3PH0 C;  1MX6 A;  5LCW J;  3UM2 A;  3BG0 B;  4ZFH A;  5CRV A;  4FUL A;  1OCR E;  5EKQ D;  1WAO 1;  5JMN D;  1HX8 A;  3TWR A;  3LCA A;  4XKC A;  3ZKJ A;  2ZGG A;  3ABK E;  5AN8 A;  3DSV A;  3APF A;  5ANR A;  1SZA A;  4EBA A;  5BT1 A;  2E2E A;  2YIN A;  4N3C A;  2ZXW E;  1U3D A;  4WWO A;  2XGO A;  1N94 A;  2F37 A;  2BED A;  1E7U A;  4GA1 A;  3TWV A;  3CHS A;  4YDO A;  1ELK A;  3QB2 A;  5DIZ A;  5A7D B;  2FEZ A;  3AS5 A;  2LXL A;  2QY7 A;  2AVP A;  4N3A A;  3Q79 A;  3KAE A;  1E96 B;  4TUU A;  2WXO A;  2R02 A;  5LCW C;  5CMW A;  5EX0 A;  1JCR A;  2YHE A;  4N5Q A;  3CVX A;  4PH4 B;  3RIB A;  3FFL A;  3TXN A;  2IO3 C;  2ZIR A;  4DUI A;  3HXF A;  2RD0 A;  4I1M A;  4PS7 A;  5HI7 A;  1QYM A;  4DLQ A;  4LNG A;  3SBT B;  4BES A;  3FY4 A;  2YHC A;  1Y8M A;  4U04 A;  2J4B A;  2R03 A;  4PDX A;  4HQD A;  1HF8 A;  3TL5 A;  4I6E A;  5FJY A;  5KJM A;  1V55 E;  1H2T C;  4KVM A;  4UQY A;  1BU9 A;  1E90 A;  4GU5 A;  1H6O A;  2DZN A;  3QOU A;  4LEU A;  4UI9 K;  3FUH A;  3DWL G;  3ML9 A;  2P9I G;  3UQ3 A;  3IV0 A;  4XZ4 A;  3FUD A;  1GW6 A;  4KZC A;  3RKV A;  4P29 A;  2WPV A;  5HRY A;  4LNB A;  3UM3 A;  4W9R A;  1E8X A;  4J8D A;  3D9I A;  3HXC A;  2X6I A;  3U9W A;  4DJA A;  3FU0 A;  3JYS A;  1HFA A;  4AOF A;  2BKK B;  2HYZ A;  1OCZ E;  2CG2 A;  4WNE A;  3IHY A;  4A3T A;  1A5E A;  2RFA A;  3EIJ A;  3U66 A;  2CFU A;  2OCC E;  4EBA G;  1X5B A;  3NAW A;  1DC2 A;  2I1J A;  4Y6W A;  1K3Z D;  4A1G A;  5AJD A;  4MKT A;  3RRM B;  3UM0 A;  2B0O E;  1TN6 A;  3F6Q A;  3SFZ A;  3EUV A;  3APD A;  4R7L A;  4JA7 A;  3CHR A;  3B95 A;  2MHK A;  1MX2 A;  3ZYQ A;  4J8Y A;  5KJL A;  1YCS B;  5KWD A;  5FQ8 A;  4KMO A;  4B89 A;  1KT1 A;  3DXM G;  1IKN D;  2WXM A;  1MHQ A;  3UT7 A;  2XS1 A;  3V2X A;  3NF1 A;  5J08 A;  3UTM A;  4GA2 A;  4I2W A;  4C48 B;  3ZHE B;  4G26 A;  2OEV A;  4AJW A;  2PM7 A;  1UOH A;  2BKG A;  2C0M A;  3TWX A;  5ITZ F;  4U7E B;  2WXG A;  3Q5M A;  3FUM A;  2EQX A;  3FUL A;  2GRP B;  4HI9 A;  4GZD A;  4E6H A;  3AU5 A;  3T8K A;  5BUZ A;  4HVB A;  2LUH A;  1QQE A;  2AXV A;  3LY7 A;  4G8K A;  3Q7A A;  4CGW A;  2WM9 A;  2HM8 A;  4LNU D;  4UWL A;  2R05 A;  4AM9 A;  5C1D A;  4OVU A;  1FVF A;  2ETA A;  2UWJ G;  3E37 A;  3I4G A;  4FU3 A;  1OT8 A;  1O1S A;  4J7W A;  3FEY A;  3J5P A;  3HXE A;  4CDR A;  4BX8 A;  1MX4 A;  3PZ2 A;  3DBS A;  2QYJ A;  4UQZ A;  4AVX A;  3TGO A;  4AY6 A;  4N2S A;  4M3O A;  3DXK G;  2BUG A;  4BSX A;  3UPV A;  4AIF A;  4URK A;  4I9E A;  4PS8 A;  5ENT D;  3CLJ A;  3CV0 A;  3TWS A;  3QAQ A;  2NC9 A;  3DPD A;  3DRA A;  1LTX A;  1K1B A;  4BTA A;  3FH8 A;  3QWP A;  4D10 C;  3Q15 A;  2IOS A;  3B13 A;  2I6H A;  4O1P A;  3CK9 A;  4Z68 A;  4L7T A;  5KNH D;  2IO2 C;  1FCH A;  4F7A A;  2EIL E;  3TWW A;  3CSF A;  1WY6 A;  3FDH A;  1S70 B;  2KCK A;  4GTM A;  3Q73 A;  4CYM D;  5EIB E;  3CK7 A;  5ENR D;  1IQU A;  3FTX A;  2H6I A;  3FUN A;  2OEW A;  3RU0 A;  3ZXS A;  5ARG A;  2L6B A;  4BEP A;  2R59 A;  3SNX A;  4Q96 A;  3B7B A;  3BG1 B;  5KNG A;  3B7T A;  4PUC A;  3CVP A;  2EIJ E;  1JCS A;  5CER B;  2DYS E;  3CST A;  1IHG A;  2ZU6 B;  3IBE A;  4C0M A;  3QJZ A;  4H7Y A;  4CEM A;  4X8Q A;  5EDS A;  3DSW A;  3D9N A;  1N4Q A;  4RG6 A;  4QQI A;  2CFZ A;  1Z5S C;  1Q2Z A;  1Y6I A;  4RVB A;  3R7Q A;  1HZ4 A;  3FUI A;  4BFR A;  3PE4 A;  4APO A;  3EHR A;  3RRU A;  4HOT A;  3NB2 A;  3BEE A;  4FHK A;  4JVS A;  1E7V A;  4CDN A;  1G3N B;  4JW1 A;  3ONK A;  4JPS A;  3PNL B;  3RAU A;  2A4Z A;  4L23 A;  3K9I A;  2ION A;  4AXH A;  4YVQ C;  2BF0 X;  2R2L A;  5FIO A;  1HU3 A;  3CHO A;  3LXU X;  4K5A B;  1N54 A;  3SY2 A;  1HE8 A;  3KEZ A;  3FUF A;  3TWU A;  3WG7 E;  4HOR A;  3MX3 A;  4KXK B;  4BT9 A;  3FTY A;  1OWL A;  2XQ0 A;  5CEC B;  1SQM A;  3TWT A;  3O4Z A;  3DSX A;  2VSX E;  3UUX A;  1IHB A;  2GRM A;  3BQO A;  2BTD A;  2NXP A;  3L16 A;  1XNF A;  1TN7 A;  2GRQ B;  3ASH A;  1INZ A;  5AYW D;  2LNI A;  2PZI A;  4J8E A;  4JEH A;  4IUL A;  3G2U A;  3QWV A;  5T3R A;  1AWC B;  2P9U G;  2ETB A;  3IXE A;  1JWF A;  2OVF A;  1N52 A;  3OXG A;  5FZQ A;  3GZS A;  4JHK A;  5BXO A;  2H6G A;  2OND A;  3LVR E;  2J4D A;  3PZ4 A;  2IF4 A;  3U4T A;  1HO8 A;  3P2B A;  4GTP A;  2OOE A;  1OWM A;  3ML8 A;  1SA4 A;  3FTW A;  4YDE A;  3Q9N C;  4UQX A;  3GYZ A;  1ELR A;  2FBN A;  5B1B E;  4MBG A;  4LSZ E;  3CVY A;  1HH8 A;  3UI2 A;  3CHM A;  3EIQ C;  3ULE G;  2ILR A;  2WXJ A;  4YVO A;  5AQA A;  3EU9 A;  3OXF A;  4AEZ C;  3MZL B;  3D9M A;  2EIM E;  4KT6 B;  3KSL A;  1D8E A;  2VJ8 A;  3G2S A;  1UJK A;  2QC9 A;  5G2N A;  4G25 A;  2CG3 A;  3ZIM A;  4HB5 A;  4BWR A;  4ANV A;  3E32 A;  2R5S A;  4RLY A;  4CDM A;  4EQF A;  4Q69 A;  2RG8 A;  3EHN A;  4OYS A;  4GTV A;  3I5P A;  3DEP A;  3SO8 A;  1IYG A;  4G24 A;  4U07 A;  5KCM A;  4CGV A;  4HRL A;  4XI9 A;  4NRH B;  2A5E A;  2PNN A;  3PVL A;  4J8F A;  1SZ9 A;  4BT8 A;  2H6F A;  3NQP A;  2V4H C;  4MS6 A;  3L54 A;  1FPP A;  1OCO E;  3CHQ A;  4GB9 A;  2X6H A;  3LEW A;  2IJG X;  5BW8 C;  3EU5 A;  3FH7 A;  5CMY A;  4BY6 A;  4B0Z A;  1HXI A;  4RG9 A;  2XEN A;  3HVE B;  1YYH A;  3FTZ A;  4WUY A;  4YDW A;  3PZ3 A;  5CED B;  3AU4 A;  2XPZ A;  2VGY A;  1HS6 A;  2XPI A;  5JHB A;  1IQR A;  3D9P A;  4K0R A;  1BLX B;  3SD5 A;  3ULQ A;  1PC2 A;  1FVH A;  1H2U A;  5KBA A;  3NZS A;  1LF8 A;  4HLL A;  4ATZ D;  1Z6T A;  2V4L A;  4JXT A;  1TNU A;  2CHX A;  2R17 C;  1S63 A;  3AS8 A;  4ACK A;  4TRQ A;  5T8I A;  4LRZ A;  2XRY A;  3UMV A;  2QFC A;  4WNG A;  4ANW A;  2HE0 A;  4G8L A;  4JHR A;  4UWG A;  3MKR A;  4EZJ A;  2FUL A;  2LAI A;  4ILI A;  4DI3 A;  4GZ3 A;  3UIN C;  4AP2 A;  4ME2 A;  3QKY A;  2RFM A;  1QNF A;  2P9N G;  4GYW A;  1UN8 A;  3DPY A;  3P1U A;  2X6K A;  2P9S G;  1UJJ A;  1JPL A;  2WVI A;  4TXR A;  5FIN A;  4UI9 C;  3LDZ A;  3TJP A;  4XIF A;  1DVP A;  4XKB A;  1VDY A;  2WXL A;  2VGX A;  3AG3 E;  3PEV B;  2HR2 A;  4FLB A;  2Y1L E;  4CRW A;  5JHA A;  3CGH A;  2XZT G;  3OXL A;  2Y4T A;  1AP7 A;  5BXU A;  2UY1 A;  3AS4 A;  4DLO A;  3ULY A;  3PUK A;  3S2A A;  3GZ2 A;  3LPZ A;  4I43 A;  2J09 A;  4HI8 A;  3VLF A;  1L5J A;  2ETC A;  2J9Q A;  3QNK A;  3TXM A;  4XI0 A;  1DCE A;  2WXP A;  3ZUV B;  3U64 A;  2KC7 A;  1TYQ G;  2VSN A;  5BV0 A;  4A1S A;  2X6J A;  4GZ6 A;  3X2Q E;  1NI1 A;  2LAH A;  3VLD A;  4JZY A; 
#chains in the Genus database with same CATH homology
 3BG1 B;  3S7F A;  2L6J A;  3B7T A;  4J8S A;  4PUC A;  4I1A A;  1TJF A;  2GGF A;  3CVP A;  3S7J A;  4GCN A;  4KZ0 A;  3PDN A;  4C9B B;  3JUI A;  2A5U A;  3QC1 A;  3B7R L;  3I4R B;  4HXI A;  4TV3 A;  2WMO A;  3CST A;  1IHG A;  3SF4 A;  4WNF A;  3PS6 A;  4QFV A;  2ZU6 B;  3IBE A;  4U0Z A;  4C0M A;  3IEG A;  3QJZ A;  4H7Y A;  2NSZ A;  5FTP A;  4CEM A;  4DI4 A;  3FU5 A;  5EDS A;  3B7S A;  3ZGQ A;  3D9N A;  3R7R A;  4RG6 A;  4A55 A;  3KS2 A;  2CFZ A;  4ATG A;  2WQ6 A;  3PE3 A;  3ONL A;  2DIW A;  1Y6I A;  4RVB A;  5FWQ A;  1ELW A;  3R7Q A;  2AW6 A;  1H6K A;  1HZ4 A;  3ASF A;  3FHE A;  2MOW A;  3FUI A;  3ASG A;  3JQ1 A;  4O6F A;  5M72 A;  4WND A;  4I9C A;  3QDN A;  1P5Q A;  3CHP A;  3PE4 A;  3ZYL A;  4BFR A;  4APO A;  3QAR A;  4WAF A;  3ZPJ A;  3MKQ A;  4Y6C A;  5BPP A;  3RRU A;  3ZEF A;  4HOT A;  1QZ2 A;  3BEE A;  2IOL A;  4FHK A;  4JVS A;  4MLP A;  2XEV A;  1UN9 A;  1E7V A;  4XE0 A;  2PQR A;  4HOQ A;  5D0O D;  4LUN U;  3L22 A;  4CDN A;  4HOU A;  3T5V A;  3LYA A;  2L9B A;  3ASD A;  4JW1 A;  3SZ7 A;  2FO7 A;  3ONK A;  4G1T A;  4JPS A;  5FZS A;  3PNL B;  3PH0 C;  2Y4U A;  2A4Z A;  2J49 A;  3PNT B;  3ZN3 A;  4F53 A;  4KYO B;  4IYP A;  3BG0 B;  5LCW J;  4L23 A;  3CVQ A;  5AJL A;  3K9I A;  3RJV A;  2ION A;  3RK6 A;  4AXH A;  3Q47 B;  4U8H A;  4YVQ C;  4L1B A;  3TAX A;  3B7U X;  2BF0 X;  4FUL A;  4F3V A;  5EKQ D;  3FTU A;  3E4B A;  1WAO 1;  2AWI A;  3UT8 A;  1HU3 A;  1HX8 A;  3MKQ B;  3CHO A;  3CK8 A;  3KD7 A;  3LXU X;  1HG2 A;  1N54 A;  3LCA A;  4AY5 A;  4XKC A;  3PUJ A;  1HE8 A;  2X3M A;  3KEZ A;  5BV1 A;  2WXN A;  3FUF A;  3WXX A;  3HIZ A;  4HOR A;  3MX3 A;  4KXK B;  3APF A;  3APC A;  4BT9 A;  5ANR A;  3QK0 A;  3FUK A;  3FTY A;  5T4Y A;  1SZA A;  4NAC A;  2XQ0 A;  1NZN A;  1OWL A;  3D9O A;  2WXI A;  4I6G A;  4EBA A;  2E2E A;  5BT1 A;  2YIN A;  4FJZ A;  4CT4 A;  4N3C A;  5CCL A;  4WWN A;  4ILH B;  1U3D A;  1SQM A;  4WWO A;  3Q4A B;  2XGO A;  3HYM B;  4I1O B;  5FZR A;  2J07 A;  2FI7 A;  4BX9 A;  2KCV A;  1E7U A;  3VLE A;  4GA1 A;  3O4Z A;  2WB2 A;  3CHS A;  2VSX E;  2PL2 A;  4LER A;  3SHF A;  3UUX A;  1ELK A;  1TJC A;  2GRM A;  3QB2 A;  4UWH A;  1ZU2 A;  5DIZ A;  4I17 A;  2J08 A;  5A7D B;  2FEZ A;  2BTD A;  2NXP A;  2WMN A;  3AS5 A;  3L16 A;  4FP7 A;  3SI5 A;  1XNF A;  1H0A A;  1KLX A;  2QY7 A;  2AVP A;  3HVE A;  4UWK A;  3TG4 A;  5KJK A;  2Y3A A;  2DBA A;  4N3A A;  3G2T A;  4APF A;  5FT9 A;  3ASH A;  1INZ A;  2LO6 A;  3EDT B;  4G2V A;  5EX3 A;  3KAE A;  5AYW D;  2LNI A;  3JQ0 A;  4B8C B;  2PZI A;  5CHE E;  1E96 B;  4J8E A;  4IN3 B;  4TUU A;  4JEH A;  5KJN A;  2AXU A;  2WXO A;  4IUL A;  1NP7 A;  3URZ A;  3G2U A;  5LCW C;  3C98 A;  4FA6 A;  2VTB A;  4GMJ A;  3QWV A;  5CMW A;  5EX0 A;  2YHE A;  3FTS A;  5T3R A;  3PRE A;  3CVX A;  2C0L A;  4PH4 B;  2OVB A;  1TEZ A;  2CHW A;  2IFU A;  3RIB A;  4BTB A;  3FFL A;  3GW4 A;  3TXN A;  4F1S A;  4GYY A;  2RD0 A;  3GZ1 A;  4MRU A;  1JWF A;  2OVF A;  3RO3 A;  1N52 A;  3OXG A;  5FZQ A;  3CKC A;  4I1M A;  5LP0 A;  3ESK A;  4N5C A;  3GZS A;  4JHK A;  4PS7 A;  3LY8 A;  5HI7 A;  3S7B A;  4DLQ A;  2OND A;  1B89 A;  2E0I A;  3SBT B;  1UG3 A;  3LVR E;  2J4D A;  2LSU A;  1Z3X A;  3O48 A;  2IF4 A;  4Q94 A;  3U4T A;  2HO1 A;  4B8A A;  1HO8 A;  5LFA A;  4JEU A;  3FY4 A;  2YHC A;  1Y8M A;  2L0T B;  1OWP A;  3P2B A;  4NUR A;  3T8M A;  4U04 A;  2J4B A;  4PDX A;  2OOE A;  4XX5 A;  4GZC A;  1E8Y A;  1HF8 A;  1OWM A;  2IQC A;  3ML8 A;  4I6E A;  5FJY A;  3TL5 A;  4I2Z A;  4N39 A;  2JLB A;  5CCM A;  3FTW A;  5KJM A;  3CVW A;  2I1K A;  4UQX A;  4FAD A;  1H2T C;  3LVQ E;  3LJ3 A;  2IU1 A;  4KVM A;  1A17 A;  1E90 A;  2GRL A;  3GYZ A;  1ELR A;  2FBN A;  4UQY A;  4YND A;  3FWV A;  4K03 A;  2VYI A;  4GU5 A;  4JHJ A;  3HDX A;  4GYO A;  3G2W A;  2V8S E;  3RRN B;  3D3M A;  3MEK A;  1XGW A;  5A23 A;  4HFG A;  4I6J A;  4NQ0 A;  5DBK A;  3QOU A;  3CVY A;  4LEU A;  4UI9 K;  1HH8 A;  3FUH A;  5G05 J;  5ANL A;  3CHM A;  3ML9 A;  3EIQ C;  4KVO A;  3UQ3 A;  3IV0 A;  2ILR A;  2XGM A;  4XZ4 A;  2WXJ A;  3FUD A;  1GW6 A;  2XPY A;  4YVO A;  2WXF A;  4WWP A;  2KAT A;  4KZC A;  1WM5 A;  3OXF A;  4AEZ C;  2DCP A;  3RKV A;  2XGS A;  3MZL B;  2PQN A;  3D9M A;  4KT6 B;  4P29 A;  2C2L A;  2WPV A;  3D9J A;  1EPU A;  4N3B A;  3LS8 A;  2V0P A;  4W9R A;  1E8X A;  2VJ8 A;  3G2S A;  2KZT A;  1HG5 A;  1UJK A;  4J8D A;  3D9I A;  4G25 A;  2CG3 A;  5G2N A;  1DNP A;  3PZD A;  3ZIM A;  5AEN A;  4JZY A;  3T5X A;  2X6I A;  4JL0 A;  4BWR A;  4GA0 A;  3U9W A;  4ANV A;  2WQ7 A;  4DJA A;  3FH5 A;  5LOZ A;  2R5S A;  1Z3Y A;  3EHM A;  3FU0 A;  3JYS A;  4J0U A;  4CDM A;  1HFA A;  4EQF A;  4L2L A;  4AOF A;  4Q69 A;  5ENN A;  2RG8 A;  2P58 C;  2HYZ A;  2CG2 A;  3EHN A;  4OYS A;  1NA0 A;  3I5P A;  4C0E A;  3QWW A;  4WNE A;  3IHY A;  4A3T A;  1IYG A;  4DK5 A;  4G24 A;  5D0Q D;  1OWN A;  3ENE A;  3EIJ A;  4U07 A;  5KCM A;  4KBQ A;  4CGV A;  4U0U A;  2KZT B;  3U66 A;  1S0P A;  4XI9 A;  2CFU A;  3NZU A;  4NRH B;  4EBA G;  1X5B A;  3ZYM A;  3PVL A;  2M63 A;  3SNX A;  3CR3 A;  5AIJ A;  3ZRH A;  2CHZ A;  4J8F A;  2I1J A;  2VQ2 A;  4CT0 A;  4L2Y A;  4Y6W A;  1SZ9 A;  2YQ8 A;  2WXQ A;  2XRZ A;  4BT8 A;  4A1G A;  5AJD A;  3NQP A;  4MS6 A;  3L54 A;  4MKT A;  5FQ4 A;  3RRM B;  3CHQ A;  4GB9 A;  2GW1 A;  2X6H A;  5G05 C;  4GZ5 A;  3L6A A;  3LEW A;  2IJG X;  5BW8 C;  3VTX A;  3VTY A;  3SFZ A;  3FH7 A;  2MRI A;  3PRZ A;  3ZHE A;  5CMY A;  4BY6 A;  3APD A;  4B0Z A;  4R7L A;  1HXI A;  3S7D A;  4JA7 A;  4HLE A;  5JJ7 A;  3CHR A;  3CIA A;  3OTN A;  1E8W A;  2MHK A;  4RG9 A;  3R9A B;  3HVE B;  4PS3 A;  2WQH A;  1UW4 B;  3LKU A;  3FTZ A;  3ZYQ A;  3TG5 A;  4V3I A;  4WUY A;  3ZFW A;  3EJN A;  5KJL A;  2X6F A;  3D9L A;  3CQG B;  5FQ8 A;  3CVN A;  3MJW A;  5LX8 A;  2WXK A;  4KMO A;  4B89 A;  1KT1 A;  5A6C A;  2WXR A;  4HS2 A;  1EDU A;  5C2Y A;  3AU4 A;  2WXM A;  3L17 A;  1H2V C;  2X38 A;  4EZK A;  4FJY A;  1MHQ A;  2XPZ A;  2VGY A;  2Q7F A;  1HS6 A;  2XPI A;  3UT7 A;  1IQR A;  3D9P A;  4EEC A;  5JHB A;  4K0R A;  5FQ7 A;  3NF1 A;  1JWG A;  1NA3 A;  1BPO A;  1OWO A;  4ANU A;  5J08 A;  3FU3 A;  4GA2 A;  4I2W A;  3SD5 A;  3ULQ A;  1PY1 A;  1PC2 A;  1FVH A;  3ZYK A;  5JJT A;  1H2U A;  2AXZ A;  5G55 A;  3NZS A;  3ZHE B;  4G26 A;  3ZVV A;  2XCC A;  3MCX A;  1LF8 A;  4AJW A;  2JEK A;  1Z6T A;  2PM7 A;  2V4L A;  2C0M A;  4U0S A;  4JXT A;  2CHX A;  3ZW3 A;  2R17 C;  5HQ8 A;  4ABN A;  3AS8 A;  1W3B A;  3CKB A;  3MYV A;  2WXG A;  3Q5M A;  3L08 A;  4ACK A;  1PAQ A;  4FLH A;  3N71 A;  4UWF A;  2VTB B;  4TRQ A;  3FUM A;  3Q49 B;  2EQX A;  3MGB A;  4LRZ A;  3CEQ A;  5G04 J;  5T8I A;  3FUL A;  3FU6 A;  2XRY A;  3UMV A;  3CVL A;  2QFC A;  4WNG A;  5BNW A;  4GZD A;  4ANW A;  4E6H A;  2KCL A;  4EZL A;  3AU5 A;  1YA0 A;  3SGH A;  4A3V A;  5BUZ A;  1MQS A;  4HVB A;  1QQE A;  3FP3 A;  5E76 A;  2AXV A;  3LY7 A;  3SBS A;  3UT4 A;  4ILG A;  4CGW A;  4JHR A;  2WM9 A;  2HM8 A;  3CVV A;  4UWL A;  4AM9 A;  5C1D A;  4OVU A;  1FVF A;  4EPZ A;  2UWJ G;  4UWG A;  3MKR A;  2I2O A;  2VSO E;  3I4G A;  4EZJ A;  4FU3 A;  2FUL A;  2LAI A;  4ILI A;  3G2V A;  4DI3 A;  4GZ3 A;  4AP2 A;  4ME2 A;  2LSV A;  3QKY A;  4AV7 A;  1QNF A;  3FEY A;  4GYW A;  1UN8 A;  2FF4 A;  4ANX A;  4CDR A;  3P1U A;  2X6K A;  4DPR A;  1ZBP A;  1UJJ A;  2PM6 A;  1JPL A;  4BX8 A;  2WVI A;  3MV2 B;  2V5F A;  3DBS A;  4UQZ A;  4UI9 C;  3LDZ A;  4AVX A;  3TGO A;  5E75 A;  4N2Q A;  4AY6 A;  4N2S A;  4U63 A;  3TJP A;  4M3O A;  4XIF A;  2BUG A;  4RSY A;  4H7X A;  4BSX A;  4JA9 A;  3UPV A;  4GML A;  4AIF A;  4URK A;  4GPK A;  1DVP A;  2L0I A;  4XKB A;  1EF1 C;  4I9E A;  3CQC B;  4PS8 A;  1VDY A;  3D9K A;  3CLJ A;  2WXL A;  2VGX A;  3CV0 A;  3LY9 A;  3PEV B;  4LCT A;  2HR2 A;  4G11 A;  4FLB A;  4FHJ A;  3QAQ A;  4CRW A;  5JHA A;  3PEU B;  3CGH A;  3CVU A;  3U3W A;  2NC9 A;  3DPD A;  2Y4T A;  3OXL A;  5ARF A;  3MA5 A;  5JJ6 A;  3JCK C;  3FTV A;  2I9C A;  3RO2 A;  2YNQ A;  3ESL A;  4BTA A;  3FH8 A;  3QWP A;  4GAA A;  4D10 C;  3Q15 A;  2UY1 A;  4B94 A;  3IKO B;  4IRU A;  3AS4 A;  2VSY A;  4G23 A;  4JC8 A;  2IOS A;  3B13 A;  5FQ6 A;  4DLO A;  1H19 A;  2I6H A;  1OUV A;  4OVV A;  3CK9 A;  3MV3 B;  4L7T A;  5G04 C;  3I3N A;  1FCH A;  3PUK A;  3GZ2 A;  3LPZ A;  3OAW A;  4I43 A;  3S2A A;  2J09 A;  4F7A A;  3VLF A;  1L5J A;  2J9Q A;  4HOS A;  4J6I A;  3CSF A;  1WY6 A;  1U3C A;  4FC8 A;  5J90 A;  3FUE A;  3FDH A;  1EYH A;  3QNK A;  3TXM A;  2KCK A;  4XI0 A;  2VGX B;  4GCO A;  3UX4 A;  2KM4 A;  4ACL A;  2XCB A;  3HHM A;  2WXH A;  3CK7 A;  1KT0 A;  2WXP A;  4CCA A;  1IQU A;  3FTX A;  2KC7 A;  2VSN A;  3FUJ A;  3IHV A;  3FUN A;  3U64 A;  4E85 A;  2OV8 A;  5BV0 A;  4A1S A;  1E8Z A;  3RU0 A;  4UI9 J;  3FEX A;  2X6J A;  3ZXS A;  4GZ6 A;  2LAH A;  2XHE A;  5ARG A;  3VLD A;  1JUQ A;  4Q96 A;  2R59 A;  2UY1 B;  3L13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...