3KD7A

Designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
102
structure length
102
Chain Sequence
NSAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords CTPR390
publication title Crystal structure of a designed tetratricopeptide repeat module in complex with its peptide ligand.
pubmed doi rcsb
source organism Unidentified
total genus 41
structure length 102
sequence length 102
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3kd7A00
4U0SA 3U4TA 4J0UA 5G05J 4UI9C 5KJKA 4GYWA 4JA9A 5M72A 4J8DA 3KD7A 3QKYA 2KATA 3URZA 2OOEA 5HQ8A 4J8FA 3ASFA 5JJ6A 4NRHB 1OUVA 5DBKA 3O48A 4BT8A 3FFLA 4G24A 3CVPA 4GCOA 2QFCA 3PE3A 4Y6CA 2Y4TA 3ASHA 3Q4AB 4WNEA 4H7XA 5G04J 4KBQA 1WAO1 3ZHEB 2GW1A 1HH8A 4GA1A 2J9QA 4GZ5A 4AY6A 3LYAA 2KCKA 3Q47B 4I9EA 5FJYA 3VTXA 2PQNA 2LNIA 4UQYA 4GA2A 3OXFA 2XGMA 2PL2A 3EDTB 1PC2A 3CEQA 2KCVA 1Y8MA 2LSVA 2FEZA 3PE4A 4J8EA 5EX0A 5FTPA 2JLBA 3S7FA 2I6HA 3RO2A 4N2QA 3CVQA 2Q7FA 3CK8A 5KJMA 4APOA 3CKBA 5CCMA 5FZRA 3R9AB 5JJTA 1HZ4A 2XCCA 4RG6A 3OXLA 3ZHEA 4EQFA 1HXIA 3IEGA 1FCHA 2VGYA 3QWVA 3Q5MA 2WPVA 3CV0A 3AS5A 1XNFA 3SZ7A 5D0OD 3LY8A 2PQRA 2E2EA 4GYOA 3CVLA 2AVPA 2LSUA 4U0UA 2NC9A 4JL0A 4W9RA 4Y6WA 4ABNA 3AS8A 4U0ZA 1YA0A 4N3AA 1IHGA 4H7YA 3E4BA 3LPZA 3RJVA 4NQ0A 3KAEA 1NA0A 5BW8C 3GYZA 3FWVA 3UQ3A 3HYMB 4N39A 2FO7A 5CCLA 4U04A 3LKUA 4CDRA 3MV2B 1ELWA 4G26A 4N5CA 2ONDA 3U3WA 2VGXB 2VYIA 3Q15A 3GZ2A 3FP3A 4G1TA 2C0LA 2HR2A 5LCWJ 4XIFA 5A7DB 4XI0A 3RKVA 4KYOB 4XI9A 4HORA 3ZN3A 5FZSA 4N3CA 4N2SA 4CGWA 4KXKB 4GPKA 3GW4A 4JHRA 4HOTA 3Q49B 4UQXA 3QOUA 5FZQA 3UUXA 2L6JA 4HOQA 5G05C 3ULQA 5BNWA 4I9CA 1IYGA 4BWRA 2XGSA 5JJ7A 3QWPA 3SF4A 3ZGQA 4I1AA 3JYSA 2UWJG 2R5SA 4AY5A 3RO3A 4I2WA 3ASDA 5AYWD 4UI9J 4WNFA 3LCAA 5ARGA 2VGXA 5FT9A 4AIFA 3MKRA 1TJCA 3N71A 3S7DA 5BT1A 2PZIA 5ARFA 4O6FA 4LEUA 1KLXA 1KT1A 4F3VA 1ZU2A 1ZBPA 5G04C 4BTBA 2P58C 2KC7A 3S7BA 4ME2A 3ZPJA 5DIZA 5HI7A 4GZ3A 5KJLA 3K9IA 3CK9A 3TG5A 2HO1A 1KT0A 4AM9A 4GYYA 5CHEE 2HYZA 3GZ1A 4BTAA 2BUGA 2VSYA 2MHKA 3QWWA 4WNGA 4G25A 3TGOA 4I17A 3MA5A 2UY1B 1E96B 4IN3B 2XCBA 3WXXA 3UPVA 4YVOA 3VTYA 1A17A 1NZNA 3NF1A 5D0QD 3S7JA 3MV3B 4CGVA 1NA3A 3BEEA 2VSNA 3CK7A 2FF4A 4B94A 2FBNA 2YQ8A 3LY7A 3ASGA 5EKQD 3CKCA 3ESKA 1B89A 3ZFWA 3RU0A 4HOSA 2C2LA 4U07A 2UY1A 4JA7A 2DBAA 4GA0A 4WNDA 2XGOA 2Y4UA 4A1SA 2IF4A 3QDNA 3TAXA 1W3BA 1P5QA 4GCNA 3RIBA 4BT9A 2FI7A 2YHCA 2V5FA 3TG4A 4GZ6A 2KCLA 3CVNA 4I2ZA 2XEVA 4G2VA 5LCWC 5KJNA 5A6CA 3OXGA 4N3BA 1QQEA 4HOUA 5EX3A 3PDNA 4G23A 2IFUA 2C0MA 3LY9A 4YVQC 2XPIA 3MEKA 4RG9A 4WUYA 2WQHA 1WM5A 3AS4A 5C1DA 3KS2A 4UI9K 1QZ2A 4UQZA 2VQ2A 1ELRA 4YNDA
chains in the Genus database with same CATH superfamily
4U0SA 3NOCD 4XKCA 4BERA 4BFRA 4GMRA 4I6GA 4DI3A 4J0UA 4UI9C 4GYWA 4JA9A 4PH4B 3HXEA 3KD7A 4HI8A 3HVEB 2KATA 1D9SA 3Q7AA 2YINA 3DSSA 4OVVA 4YDWA 2OOEA 4J8FA 2P9IG 4HQDA 3ASFA 3PZDA 2VTBB 3SI5A 1H2VC 5JJ6A 3P1UA 3B7BA 3IXEA 3JUIA 1K1AA 1Z3XA 3NZUA 5JMND 3FTZA 2QZAA 3FFLA 4BESA 5ENSD 3CVPA 1U2VG 4CDMA 3CVVA 4URKA 1BI7B 2L9BA 3UM0A 2QFCA 2ZIRA 4PS8A 2LXLA 4WNEA 1MHQA 4H7XA 5G04J 4KBQA 2AJAA 3ZHEB 2J9QA 2DWZA 4AY6A 4JHKA 1TNOA 5B3SE 4AP2A 3HXCA 4I43A 1OXJA 1HS6A 3VTXA 4LCTA 4BX8A 3HVEA 4AXHA 2WB2A 3EHQA 1PAQA 3E30A 4HVBA 2WXPA 4CEMA 5T4YA 3IBEA 1OWPA 3CLJA 2IJGX 3BQOA 4FC8A 4L2LA 1DCQA 2LUHA 2Y1LE 3FH7A 2BKGA 4DUIA 5FZRA 1N4SA 1HZ4A 1SZAA 3MX3A 4U8VD 1E7UA 5CERB 2H6IA 2VGEA 3ZHEA 4DX6D 1D8DA 2P9NG 2XHEA 3CV0A 3AS5A 1XNFA 5J90A 2HE0A 2RD0A 4O1OA 4UWLA 3LY8A 3CVYA 4EECA 4DX2A 4K5CA 3F6QA 3RAUA 2NC9A 1K3ZD 4N3AA 4UUCA 5ENRD 3UI2A 3E4BA 2GRPB 3RJVA 3KAEA 4IULA 5BW8C 3EIQC 3UQ3A 2M63A 3CHPA 2VJ8A 4APFA 4U04A 4KT6B 3MV2B 2V5QC 1N11A 2J49A 3AU4A 3L17A 1H0AA 3Q15A 1TNBA 2ILRA 2WXOA 3DRAA 5LCWJ 2OEWA 4XI0A 4CZ2D 3RKVA 2Y3AA 4YDOA 3ZN3A 4N3CA 4CGWA 3GW4A 4JHRA 2L0IA 4UQXA 3QOUA 5FZQA 3UUXA 2L6JA 4HOQA 1E90A 3ZYQA 5G05C 1Z6TA 4DRXE 2MOWA 3L13A 4B0ZA 1IYGA 1H19A 1JWGA 1N4PA 4OAUC 4UWFA 3MZLB 1MYOA 2EIME 3FU0A 1X5BA 2CHWA 2DVWA 3ZGQA 3JYSA 4E85A 2UWJG 3G2VA 4JB8P 1JWFA 1HU3A 1HO8A 3ASDA 5AYWD 1Q2ZA 3KEAA 4CT0A 3Q73A 4FHKA 3TWXA 3MKRA 1TJCA 2KZTA 3HG0D 3S7DA 3LEWA 5ARFA 3B7TA 1ZBPA 2P58C 2KC7A 1TJFA 4XEIG 5HI7A 3LVRE 4J7WA 3ULEG 2IONA 3DSVA 4DX1A 3TG5A 5T8IA 2OV8A 3I4GA 1KT0A 3CHMA 4GU5A 2DCPA 4G8KA 5ENOD 4BTAA 4Q96A 1UOHA 2VSYA 1N52A 2A4ZA 1N4QA 3TJPA 1OWLA 2P9LG 2UY1B 3TWTA 4Q69A 2XS8A 3EHMA 4GAAA 2WQ7A 4LRZA 5AQ7A 4MLPA 2XENA 1JCRA 1LF8A 3WXXA 5T3RA 1OWOA 4I1OB 3UPVA 4IYPA 3AU5A 3PNTB 3PH0C 4X8QA 3C72A 4GTQA 3G2TA 3HXFA 3MYVA 2QYUA 3NQPA 3E34A 4CGVA 3FUNA 1N0RA 3Q9NC 3EHRA 2FO1E 4EZJA 5AENA 1G3NB 2VSNA 3PNLB 2YQ8A 3LY7A 3AAAC 4CRWA 4HS2A 3UIOC 5EILA 3LJ3A 4XX5A 3NB2A 2IOSA 2RFAA 5CRVA 5KWDA 4C0EA 2UY1A 4JA7A 5BXUA 1FT1A 3T5XA 3HRAA 3FEYA 2IF4A 2R59A 1BD8A 1W3BA 3PZ3A 5FINA 1OT8A 3FTWA 4WWPA 3CHRA 4G11A 3T8MA 4B8CB 5CEAA 3CVNA 5AIJA 3UIPC 1BLXB 2XEVA 3G2SA 2HM8A 4GTSA 4TUMA 5G2NA 3SD5A 3E32A 5H7PA 2L6BA 4OVUA 5D66A 2OVBA 4DK5A 1DNPA 4ANUA 3PDNA 3FU5A 4G23A 4YVQC 1K1BA 4HI9A 4TV3A 5G55A 3J5QB 4FU3A 2WMOA 2CG3A 2OVFA 4AJWA 3D3MA 2WVIA 3FH5A 4JXTA 1EPUA 3Q75A 4J8DA 1DC2A 2EIJE 4JC8A 5HQ8A 2YNQA 3RK6A 2H6GA 4ILHB 3ASNE 3ZYKA 4U8HA 4TXQA 3D9JA 4B89A 3SHFA 3C98A 2F0YA 4NACA 4ATZD 3O48A 4G24A 2YHEA 4Y6CA 2AXVA 2L0TB 4C0MA 4JVSA 3MJWA 4J6IA 5E76A 2GW1A 2IU1A 1HH8A 3DSTA 2DYRE 1HE8A 4GTVA 1QNFA 4A3VA 5ANRA 2PQNA 4UQYA 3QAQA 2LAIA 4F1SA 1HG2A 3OXFA 5JA4D 2XGMA 2PL2A 3EDTB 1KZPA 5HS0A 2FEZA 3R7RA 2J4DA 4CDNA 1IKND 2XRZA 1E8WA 1MZCA 1MX2A 3S7FA 5KBAA 4N2QA 3CVQA 5ENNA 1UW4B 2Q7FA 2GROB 4APOA 4EHMA 3CKBA 2LO6A 3DEPA 2A5EA 4LNGA 3SFXA 1WY6A 4UWGA 3SBTB 2CFZA 4OAVB 2X6KA 5IY5E 4F6RD 2KXPC 3ZU7B 5JJTA 5FQ4A 4HLLA 2JABA 3D9PA 2KM4A 1KPSB 3ZYLA 3FTXA 3UT4A 1LD7A 4M3OA 3TWSA 3SZ7A 3RRMB 2XPZA 3S2AA 2LSUA 2RG8A 3X2QE 3EUVA 3E37A 4I6EA 3L6AA 4U95D 3B7RL 1Z5SC 1IHGA 3SFYA 3LPZA 1K8KG 5CBOA 1MX6A 3JCKC 3GYZA 3FWVA 3QARA 1H6KA 4TUUA 3FUJA 4N5CA 3UXGA 3FUMA 5KCMA 3UTMA 3JUEA 2VYIA 5EDSA 3GZ2A 3FP3A 4G1TA 4KVMA 1EDUA 4MRUA 1DCEA 2P9PG 3DPYA 1WG0A 4FJZA 2ZU6B 4QQIA 4U8YD 5BUZA 4PUCA 4XI9A 1NFIE 4L7TA 4XE0A 5FZSA 3D9HA 3UX4A 4WWOA 3CQGB 5BV0A 4KXKB 2A5UA 2V8SE 3CIAA 4XZ4A 3FUDA 5ENTD 2P9SG 3ONLA 3L82A 2BEDA 3FTVA 3R7QA 4LSZE 1OCZE 5KNHD 2ZGDA 5LOZA 1OCOE 4FLBA 4JHJA 3FDHA 2R5SA 2VTBA 2EINE 4UI9J 1FPPA 3MGBA 3LCAA 4ILGA 5ARGA 2IEJA 3T8KA 2EQXA 2XQ0A 2ETBA 2XZTG 4O6FA 4LEUA 2QYJA 4ME2A 2RFMA 2I1KA 5AJDA 4BEPA 3NAWA 2HO1A 2X6FA 1V54E 3OTNA 3OAWA 1BPOA 2WXQA 5CHEE 2BUGA 3VLEA 3BUAA 3C3QA 3PUKA 4PS7A 1HFAA 4ZHBA 3FY4A 4I17A 2XS1A 5BV1A 3R9MA 5FQ8A 1NL4A 1SW6A 1GW6A 3NOGD 1MX4A 3FU6A 4I6JA 1SZ9A 1E8ZA 4GZCA 4L2YA 1A17A 1NZNA 1UJKA 3NF1A 5D0QD 4IRUA 5EYLA 1D8EA 3MV3B 4GTOA 1NA3A 1AWCB 1SA5A 5KNGA 3CK7A 2FF4A 4B94A 4BSZB 3ASGA 2R2LA 1H6OA 1B89A 4KMOA 3P2BA 3FUEA 1FT2A 3ZFWA 3CVXA 2Y0BG 2QY7A 4U07A 1NI1A 3V2OA 4GA0A 3UMVA 4A1SA 1HX8A 5CEDB 4XKBA 5AN8A 3EU9A 3BU8A 3RIBA 2WXJA 1N94A 1U3DA 2V5FA 2KCLA 3DPDA 3FTSA 2XRYA 4I2ZA 1DVPA 4HRMB 2H6FA 4DX7D 4LG6A 3D9NA 1VDYA 3JQ0A 4B93B 4HOUA 3W9FA 3QNKA 1UN9A 2P2CP 5CBNA 2IFUA 2WXGA 2BF0X 3JQ1A 3MEKA 4RG9A 3T5VA 5C1DA 4ACKA 4UI9K 2X6HA 4DX5D 3LS8A 4RSYA 3L54A 2CHXA 3SBSA 3U4TA 4DLQA 2GRRB 5G05J 1S64A 5M72A 3APCA 3QKYA 3ZXSA 3URZA 3W9GA 2F8XK 3APFA 3FEXA 3PEVB 1OY3D 1SQMA 2DYSE 3TWRA 4NRHB 3CSTA 2J08A 3Q7FA 3AG1E 2I2OA 4EZKA 4GMLA 3PE3A 1Y6IA 5BPPA 1S0PA 1E8XA 5J08A 4F1PA 5ANLA 4U63A 3VLDA 3ZXPA 2WXHA 1QBQA 3SY2A 4EPZA 5B1AE 2WXKA 3HDXA 4J8SA 4I9EA 5FJYA 2LNIA 2ZISA 3FHEA 3CVUA 1PC2A 1Y8MA 3PE4A 3I4RB 2MYOA 3FUIA 2X38A 5FTPA 2JLBA 2XEHA 2I6HA 3RO2A 4E6HA 4K0RA 3HXBA 1TEZA 3V30A 3ZYMA 4DPRA 3CHOA 4LUNU 3WG7E 3QJZA 2XCCA 2WXFA 4QFVA 3HXDA 4EBAA 4RG6A 3OXLA 4EQFA 3PEUB 3QWVA 2VGYA 4GZDA 3ZIMA 3ISMC 3J5PA 4BSXA 4TXPA 2E2EA 2DZOA 4NIKA 4GYOA 1SA4A 3B7SA 2IO3C 4U0UA 4W9RA 4KZ0A 3AS8A 5ENQD 4RLYA 4NQ0A 4GPMA 4TRQA 1NA0A 3ZUVB 4G8LA 4U7EB 3HYMB 4JD2G 1TNYA 3AJIA 1L5JA 1E7VA 4N39A 2FO7A 5E75A 3LKUA 2Y69E 4CDRA 4G26A 2J8SD 2AWIA 1FVHA 2VGXB 2BTDA 3CVWA 1OWNA 3DWLG 2C0LA 5FIOA 3ULYA 5LP0A 1TR4A 4FHJA 3PZ2A 1O5MA 2X6IA 4OYSA 2GRQB 2E0IA 4C9BB 4N2SA 1UJJA 2OEVA 3ZNGA 2P9KG 4HOTA 3Q49B 4BETA 4I9CA 5HRYA 1O1TA 4CYMD 2I1JA 5JJ7A 3SF4A 3UT7A 3Q78A 3D9OA 3FTUA 4FJYA 5FQ7A 4AY5A 1JCSA 4GTRA 1N95A 3RRUA 3RO3A 5D2MC 3LXUX 4LNUD 2H6HA 3FU3A 1XGWA 2NYJA 3AG2E 2VGXA 5FT9A 2PM7A 4AIFA 2GGFA 3BG1B 5FWQA 5BT1A 2PZIA 1KLXA 4HB5A 4F3VA 5G04C 3E33A 3S7BA 3ZPJA 2AXUA 1IQUA 2AW6A 5KJLA 1SVXA 3MCXA 1EYHA 3PVLA 5AQBA 3TXMA 2R05A 5AQAA 1TYQG 2WXIA 4BX9A 4AM9A 5AQ9A 4GYYA 1BI8B 5LX8A 2R17C 3GZ1A 3I5PA 2WM9A 1MJ0A 4A63B 3GZSA 2X6JA 3TGOA 1V55E 4GMJA 3JXJA 4YDYA 3C3OA 2ZGGA 3D9KA 2XCBA 2F8YA 2CFUA 2X3MA 3QK0A 3MKQB 2R02A 3HHMA 4YVOA 2ETAA 3L08A 3I3NA 3L16A 5ITZF 3TWQA 2XPYA 1H2TC 3TXNA 4CCAA 5FQ6A 3JXIA 3DSXA 4U96D 4WWNA 2J4BA 3BEEA 3BG0B 4HBDA 2VSXE 1N9AA 3FULA 4DLOA 3ZVVA 3CHSA 4JPSA 3CKCA 4YDEA 4DI4A 4KVOA 2WXRA 5A23A 3V79K 2I9CA 4ANWA 2V4HC 4K5BA 3ABLE 2C2LA 3KEZA 1ZB1A 4ATGA 3V31A 3DBSA 2WXNA 2Y4UA 1ELKA 4JEUA 5AARA 3QDNA 3TAXA 2FI7A 3MKQA 3D9MA 4A1GA 3FTYA 4HRNA 3TG4A 3G2UA 4A3TA 3CSFA 5LCWC 4FLHA 2MRIA 5A6CA 2P9UG 5AAOA 1TNUA 1RZ4A 5ENPD 1IXVA 3CQCB 3OXGA 4L1BA 4N3BA 1OCCE 3ML9A 5EX3A 4Q94A 2XPIA 1UG3A 2XEEA 4WUYA 5HKPA 3C3RA 3SO8A 2WQHA 2CG2A 4AV7A 1YCSB 3L22A 3AS4A 3HIZA 5CECB 3DXMG 1TN7A 1Z3YA 5AJLA 3UKRG 2B6CA 4YNDA 2GRLA 3FUFA 2PNNA 5KJKA 3FUHA 4UWKA 4FP7A 4AOFA 2EILE 4V3IA 1WDYA 2IQCA 3U9WA 2KBXA 1QYMA 4O60A 1KZOA 3UKUG 1JCQA 1YMPA 4AEZC 4FA6A 1OUVA 5DBKA 4BT8A 4PDXA 2KZTB 3RRNB 4GCOA 5C2YA 4FADA 2Y4TA 3ASHA 3Q4AB 1E8YA 1TN8A 3PZ1A 1WAO1 4ANXA 2RKKA 2WQ6A 4GA1A 4GZ5A 4AVXA 3LYAA 2XZDG 3QB2A 3Q79A 2KCKA 3LDZA 3Q47B 3UM1A 3EU5A 3DEOA 4O1PA 4ANVA 3EIJA 4GA2A 4JZYA 3C5RA 3CEQA 2KCVA 3ZRHA 1TN6A 2LSVA 3ONKA 1PY1A 3ESLA 4KZCA 1X81A 4K5AB 4J8EA 5EX0A 4FULA 2QC9A 3B95A 4L23A 3CK8A 5KJMA 2IY0C 5CCMA 4L9PA 4C48B 5CRUA 4MKTA 3ZW3A 1IHBA 3V2XA 3R9AB 4EBAG 2DIWA 2BKKB 4N5QA 1U3CA 2OCCE 1HXIA 3IEGA 1FCHA 3UINC 2GRMA 5CMWA 1JUQA 3Q5MA 2WPVA 3U64A 1INZA 3FH8A 2R03A 1N54A 2IO2C 5D0OD 4BY6A 2PQRA 3CVLA 2AVPA 3D9IA 3IV0A 4JL0A 4Y6WA 3UM2A 4ABNA 4U0ZA 1YA0A 3VLFA 2IOLA 4H7YA 4MBGA 2V4LA 3ENEA 3NZSA 4HXIA 1A5EA 5CCLA 4HFGA 2EIKE 1BU9A 1ELWA 3TL5A 2ONDA 3U3WA 2F37A 5EIBE 3SQVA 2HR2A 1LTXA 4TXRA 4M7CA 1OWMA 5JHAA 4XIFA 5A7DB 3FUKA 2DZNA 5BXOA 4KYOB 4HORA 3PUJA 1IQRA 3SFZA 3O4ZA 4GPKA 5EN5D 4NURA 4HRLA 2GRNB 3CHQA 5CMYA 3ULQA 1NP7A 5BNWA 4GTMA 2B0OE 4BWRA 2XGSA 3L9TA 3QWPA 4K03A 4I1AA 3LJNA 2ZXWE 3DXKG 4I2WA 3ABME 3RSEG 4DJAA 4WNFA 3KSLA 3AG3E 3EHNA 2WMNA 3CGHA 1O1SA 1JPLA 1OCRE 3N71A 4ACLA 3TWUA 3SGHA 1KT1A 1ZU2A 2NXPA 3EJNA 3D9LA 4Z68A 4GTPA 4BTBA 5DIZA 4P29A 4GZ3A 2WXLA 3K9IA 1S70B 3CK9A 2V0PA 2CHZA 5LFAA 3PRZA 4MS6A 2VSOE 2ETCA 3Q9UC 2NSZA 3TWVA 3DSWA 4ILIA 1H2UA 2HYZA 1S63A 4GTTA 2JEKA 2J07A 2MHKA 1O1RA 3TWWA 3IHVA 3QWWA 4WNGA 4G25A 4PS3A 3MA5A 1HG5A 1YYHA 1E96B 1MQSA 4IN3B 4A55A 1HF8A 4HLEA 2LXMA 1FVFA 1AP7A 3PS6A 3ML8A 3IKOB 3G2WA 3SNXA 2LAHA 3KSQA 2J09A 3VTYA 3ASOE 4F7AA 1UN8A 2PM6A 3APDA 3S7JA 4B8AA 4F53A 4UWHA 4ZFHA 4JW1A 2FBNA 1N4RA 4CT4A 3B13A 5EIDA 5EKQD 4EZLA 4I1MA 2WXMA 3ESKA 3PREA 1RW2A 4RVBA 3RU0A 4HOSA 3U66A 1TNZA 4R7LA 3B7UX 1N0QA 4WAFA 2DBAA 3IHYA 4WNDA 2XGOA 4GB9A 4RQIA 1P5QA 4GCNA 3LVQE 4BT9A 2AXZA 4J8YA 2YHCA 1H6PA 3DSUA 4GZ6A 3NBNB 4LERA 3ZKJA 1EF1C 4G2VA 4HNAD 3T9KA 5KJNA 4D10C 2FULA 3ABKE 3ZEFA 1LD8A 1QQEA 3CR3A 3AG4E 2C0MA 3LY9A 3UT8A 3UM3A 5EYPF 4JEHA 3PZ4A 5B1BE 4LNBA 1WM5A 3KS2A 3QC1A 5JHBA 1QZ2A 4UQZA 2VQ2A 1ELRA
chains in the Genus database with same CATH topology
4U0SA 4RSYA 2GRLA 2WVIA 3L54A 2CHXA 3FH5A 4JXTA 4XKCA 3SBSA 3U4TA 3FUFA 4BFRA 4I6GA 4DI3A 4DLQA 4J0UA 5G05J 4UI9C 5KJKA 4GYWA 4JA9A 3FUHA 4UWKA 5M72A 4FP7A 1EPUA 4PH4B 4AOFA 4V3IA 3APCA 4J8DA 3KD7A 3HVEB 3QKYA 2KATA 3ZXSA 3URZA 4JC8A 2YINA 4OVVA 3APFA 3FEXA 2IQCA 2OOEA 5HQ8A 3PEVB 4J8FA 3ASFA 3PZDA 3U9WA 2YNQA 3RK6A 2VTBB 3SI5A 1H2VC 4ILHB 1SQMA 5JJ6A 3P1UA 3ZYKA 4NRHB 4U8HA 3JUIA 4AEZC 3D9JA 3CSTA 1Z3XA 4B89A 3NZUA 3SHFA 3C98A 3FTZA 4NACA 2J08A 4FA6A 1OUVA 5DBKA 3O48A 4BT8A 3FFLA 4G24A 3CVPA 2I2OA 2YHEA 4PDXA 4CDMA 4EZKA 3CVVA 4GMLA 2L9BA 2KZTB 4URKA 3RRNB 4GCOA 2QFCA 5C2YA 3PE3A 1Y6IA 2AXVA 4PS8A 2L0TB 4Y6CA 4FADA 5BPPA 1S0PA 2Y4TA 3ASHA 3Q4AB 4WNEA 1MHQA 4H7XA 5G04J 4KBQA 1E8YA 4C0MA 1E8XA 5J08A 4JVSA 3MJWA 1WAO1 4J6IA 5E76A 4ANXA 3ZHEB 2GW1A 2IU1A 5ANLA 1HH8A 4U63A 4GA1A 2J9QA 3VLDA 2WXHA 4GZ5A 2WQ6A 4AVXA 4AY6A 4JHKA 3LYAA 3QB2A 1HE8A 4AP2A 4I43A 2KCKA 3LDZA 4EPZA 3Q47B 2WXKA 3HDXA 4J8SA 4I9EA 1QNFA 1HS6A 5FJYA 5ANRA 4LCTA 2PQNA 3VTXA 4A3VA 3HVEA 4BX8A 4ANVA 2LNIA 4UQYA 3EIJA 3QAQA 4GA2A 4JZYA 4AXHA 2WB2A 2LAIA 3FHEA 1HG2A 3OXFA 4F1SA 2XGMA 2PL2A 3EDTB 3CVUA 1PC2A 3CEQA 2KCVA 1PAQA 3ZRHA 1Y8MA 2LSVA 4HVBA 2FEZA 3ONKA 3PE4A 1PY1A 3R7RA 3ESLA 2WXPA 4CEMA 4KZCA 3I4RB 2J4DA 4CDNA 3FUIA 3IBEA 5T4YA 2XRZA 2X38A 1E8WA 4J8EA 5EX0A 5FTPA 2JLBA 3S7FA 4FULA 1OWPA 2I6HA 3RO2A 4N2QA 3CVQA 5ENNA 3CLJA 2IJGX 4L23A 1UW4B 2Q7FA 3CK8A 4E6HA 5KJMA 4APOA 4K0RA 3CKBA 4FC8A 4L2LA 2LO6A 5CCMA 1TEZA 3FH7A 3ZYMA 1WY6A 4UWGA 3SBTB 4DPRA 2CFZA 3CHOA 2X6KA 4LUNU 4MKTA 5FZRA 3R9AB 3ZW3A 5JJTA 3QJZA 1HZ4A 1SZAA 4EBAG 2DIWA 2XCCA 3MX3A 2WXFA 1E7UA 5FQ4A 4QFVA 4EBAA 4RG6A 3OXLA 3D9PA 2KM4A 3ZHEA 3ZYLA 4EQFA 3PEUB 1U3CA 1HXIA 3IEGA 3FTXA 3UT4A 1FCHA 2VGYA 3QWVA 4GZDA 3ZIMA 2GRMA 5CMWA 1JUQA 3Q5MA 2WPVA 3U64A 1INZA 2XHEA 3CV0A 3FH8A 3AS5A 1XNFA 4M3OA 5J90A 1N54A 3SZ7A 4BSXA 3RRMB 2RD0A 4UWLA 5D0OD 3LY8A 4BY6A 2XPZA 2PQRA 2E2EA 3S2AA 4EECA 3CVYA 4GYOA 3CVLA 2AVPA 2LSUA 2RG8A 3D9IA 3B7SA 3IV0A 4I6EA 2NC9A 4JL0A 4U0UA 4W9RA 4Y6WA 3L6AA 3AS8A 4KZ0A 4U0ZA 4ABNA 1YA0A 3B7RL 3VLFA 4N3AA 2IOLA 1IHGA 4H7YA 3E4BA 3LPZA 3RJVA 4NQ0A 2V4LA 4TRQA 3ENEA 3KAEA 4IULA 3JCKC 1NA0A 5BW8C 3EIQC 2M63A 3FWVA 3GYZA 3HYMB 3QARA 3UQ3A 3CHPA 2VJ8A 3NZSA 4HXIA 1L5JA 1E7VA 4N39A 1H6KA 4TUUA 4APFA 2FO7A 5CCLA 4HFGA 5E75A 4U04A 3LKUA 4KT6B 4CDRA 3FUJA 3MV2B 1ELWA 4G26A 4N5CA 3TL5A 3FUMA 2ONDA 2J49A 3AU4A 2AWIA 5KCMA 1FVHA 3L17A 3U3WA 2VGXB 2BTDA 3CVWA 1OWNA 1H0AA 2VYIA 3Q15A 3GZ2A 3FP3A 4G1TA 5EDSA 2C0LA 4KVMA 2HR2A 2ILRA 5LP0A 1EDUA 2WXOA 4MRUA 4FHJA 5LCWJ 1OWMA 5JHAA 4XIFA 5A7DB 3FUKA 4XI0A 4FJZA 2ZU6B 3RKVA 5BUZA 4PUCA 2X6IA 2Y3AA 4KYOB 4OYSA 4XI9A 4L7TA 4HORA 4XE0A 2E0IA 5FZSA 3UX4A 4N3CA 3ZN3A 3PUJA 4C9BB 4N2SA 4WWOA 1UJJA 4CGWA 3CQGB 5BV0A 4KXKB 1IQRA 3SFZA 3O4ZA 4GPKA 2A5UA 3GW4A 4JHRA 2V8SE 3Q49B 4HOTA 2L0IA 3CIAA 4UQXA 4NURA 4XZ4A 3FUDA 3ONLA 3QOUA 5FZQA 3UUXA 3FTVA 3R7QA 2L6JA 4HOQA 1E90A 3ZYQA 3CHQA 5CMYA 5G05C 3ULQA 1Z6TA 1NP7A 5BNWA 2MOWA 3L13A 4B0ZA 4I9CA 1IYGA 1H19A 1JWGA 4UWFA 3MZLB 2I1JA 2XGSA 5LOZA 4BWRA 5JJ7A 3QWPA 3FU0A 3SF4A 1X5BA 2CHWA 3UT7A 4K03A 4I1AA 3ZGQA 3JYSA 4FLBA 4JHJA 4E85A 2UWJG 3D9OA 3FTUA 3FDHA 3G2VA 4FJYA 1JWFA 2R5SA 5FQ7A 4AY5A 1HU3A 2VTBA 3RRUA 3RO3A 3LXUX 1HO8A 4I2WA 3ASDA 5AYWD 4DJAA 3FU3A 4UI9J 4WNFA 1XGWA 4CT0A 3MGBA 3LCAA 4ILGA 5ARGA 2VGXA 5FT9A 2PM7A 3EHNA 2WMNA 4FHKA 4AIFA 3MKRA 1TJCA 2KZTA 2GGFA 3CGHA 3BG1B 1JPLA 2EQXA 3N71A 5FWQA 3S7DA 5BT1A 2XQ0A 2PZIA 4ACLA 3LEWA 3SGHA 5ARFA 4O6FA 4LEUA 1KLXA 3B7TA 1KT1A 4F3VA 1ZU2A 2NXPA 3EJNA 3D9LA 1ZBPA 5G04C 4BTBA 2P58C 2KC7A 3S7BA 1TJFA 4ME2A 3ZPJA 5DIZA 2AXUA 5HI7A 1IQUA 4P29A 3LVRE 2AW6A 2I1KA 4GZ3A 5KJLA 2WXLA 3K9IA 3CK9A 2IONA 2V0PA 3MCXA 2CHZA 5LFAA 1EYHA 3PVLA 3PRZA 4MS6A 5AJDA 3TXMA 2VSOE 3TG5A 5T8IA 2HO1A 2OV8A 3I4GA 2X6FA 1KT0A 2WXIA 2NSZA 4BX9A 4AM9A 3OTNA 3CHMA 4GU5A 4GYYA 3OAWA 2DCPA 1BPOA 4ILIA 2WXQA 1H2UA 5CHEE 5LX8A 2HYZA 2R17C 3GZ1A 3I5PA 4BTAA 2BUGA 3VLEA 2JEKA 2WM9A 3GZSA 4Q96A 2X6JA 2J07A 2VSYA 1N52A 2MHKA 3PUKA 2A4ZA 3IHVA 3QWWA 4PS7A 1HFAA 4WNGA 4G25A 3TGOA 3FY4A 4PS3A 4I17A 3TJPA 3MA5A 5AJLA 1OWLA 2UY1B 4GMJA 1HG5A 5BV1A 1E96B 4Q69A 1MQSA 5FQ8A 3EHMA 4GAAA 4IN3B 3D9KA 2XCBA 4A55A 2CFUA 2WQ7A 4LRZA 1GW6A 1HF8A 4HLEA 1FVFA 4MLPA 1LF8A 3PS6A 2X3MA 3FU6A 3ML8A 5T3RA 3IKOB 3QK0A 3WXXA 1OWOA 4I6JA 3G2WA 3MKQB 4I1OB 1SZ9A 3HHMA 3UPVA 1E8ZA 3SNXA 4IYPA 3AU5A 3PNTB 3PH0C 2LAHA 4YVOA 3L08A 4GZCA 3I3NA 3L16A 4L2YA 2J09A 3VTYA 2XPYA 1H2TC 3TXNA 4F7AA 1A17A 1UN8A 1NZNA 1UJKA 2PM6A 3G2TA 3NF1A 5D0QD 5FQ6A 4CCAA 3APDA 3MYVA 4IRUA 3S7JA 3NQPA 3MV3B 4WWNA 4CGVA 1NA3A 2J4BA 3BEEA 3BG0B 3FUNA 4B8AA 2VSXE 4EZJA 5AENA 2VSNA 4F53A 4UWHA 3FULA 3CK7A 4JW1A 2FF4A 3PNLB 2FBNA 4B94A 2YQ8A 3LY7A 4CT4A 4CRWA 3ASGA 3B13A 4HS2A 4DLOA 3ZVVA 3CHSA 4JPSA 5EKQD 4EZLA 3CKCA 4I1MA 2WXMA 3ESKA 4DI4A 1B89A 3LJ3A 4KMOA 4KVOA 2WXRA 3PREA 4XX5A 3P2BA 3FUEA 3ZFWA 5A23A 3CVXA 2I9CA 4RVBA 3RU0A 4ANWA 4HOSA 2QY7A 3U66A 2C2LA 2IOSA 4R7LA 3KEZA 4U07A 4ATGA 3B7UX 4C0EA 2UY1A 4WAFA 4JA7A 2DBAA 3IHYA 4GA0A 3DBSA 4WNDA 2WXNA 2XGOA 3UMVA 2Y4UA 3T5XA 4A1SA 1ELKA 3FEYA 2IF4A 2R59A 4GB9A 1HX8A 4JEUA 3QDNA 4XKBA 1W3BA 3TAXA 1P5QA 4GCNA 3LVQE 3FTWA 4WWPA 3RIBA 4BT9A 2AXZA 2FI7A 3CHRA 2WXJA 4G11A 3MKQA 3D9MA 3T8MA 4B8CB 2YHCA 4A1GA 1U3DA 2V5FA 3FTYA 3TG4A 4GZ6A 2KCLA 3DPDA 3CVNA 3G2UA 4A3TA 5AIJA 4LERA 3FTSA 1EF1C 2XRYA 3CSFA 2XEVA 4G2VA 4I2ZA 5LCWC 3G2SA 2HM8A 2MRIA 4FLHA 1DVPA 5KJNA 5A6CA 4D10C 2FULA 5G2NA 3SD5A 3CQCB 3OXGA 4OVUA 4L1BA 3ZEFA 4N3BA 2OVBA 4DK5A 1DNPA 3D9NA 1VDYA 3JQ0A 1QQEA 3CR3A 4ANUA 3ML9A 4HOUA 3PDNA 3FU5A 3QNKA 1UN9A 4G23A 5EX3A 4Q94A 2IFUA 2C0MA 3LY9A 3UT8A 4YVQC 2XPIA 1UG3A 4JEHA 2WXGA 2BF0X 3JQ1A 3MEKA 4RG9A 4WUYA 2WQHA 4TV3A 5G55A 2CG2A 4AV7A 3L22A 4FU3A 2WMOA 1WM5A 2CG3A 3AS4A 5C1DA 3HIZA 3T5VA 3KS2A 3QC1A 4ACKA 5JHBA 4UI9K 1QZ2A 4UQZA 2X6HA 2VQ2A 2OVFA 3LS8A 4AJWA 1Z3YA 1ELRA 3D3MA 4YNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0S A;  3U4T A;  4J0U A;  5G05 J;  4UI9 C;  5KJK A;  4GYW A;  4JA9 A;  5M72 A;  4J8D A;  3KD7 A;  3QKY A;  2KAT A;  3URZ A;  2OOE A;  5HQ8 A;  4J8F A;  3ASF A;  5JJ6 A;  4NRH B;  1OUV A;  5DBK A;  3O48 A;  4BT8 A;  3FFL A;  4G24 A;  3CVP A;  4GCO A;  2QFC A;  3PE3 A;  4Y6C A;  2Y4T A;  3ASH A;  3Q4A B;  4WNE A;  4H7X A;  5G04 J;  4KBQ A;  1WAO 1;  3ZHE B;  2GW1 A;  1HH8 A;  4GA1 A;  2J9Q A;  4GZ5 A;  4AY6 A;  3LYA A;  2KCK A;  3Q47 B;  4I9E A;  5FJY A;  3VTX A;  2PQN A;  2LNI A;  4UQY A;  4GA2 A;  3OXF A;  2XGM A;  2PL2 A;  3EDT B;  1PC2 A;  3CEQ A;  2KCV A;  1Y8M A;  2LSV A;  2FEZ A;  3PE4 A;  4J8E A;  5EX0 A;  5FTP A;  2JLB A;  3S7F A;  2I6H A;  3RO2 A;  4N2Q A;  3CVQ A;  2Q7F A;  3CK8 A;  5KJM A;  4APO A;  3CKB A;  5CCM A;  5FZR A;  3R9A B;  5JJT A;  1HZ4 A;  2XCC A;  4RG6 A;  3OXL A;  3ZHE A;  4EQF A;  1HXI A;  3IEG A;  1FCH A;  2VGY A;  3QWV A;  3Q5M A;  2WPV A;  3CV0 A;  3AS5 A;  1XNF A;  3SZ7 A;  5D0O D;  3LY8 A;  2PQR A;  2E2E A;  4GYO A;  3CVL A;  2AVP A;  2LSU A;  4U0U A;  2NC9 A;  4JL0 A;  4W9R A;  4Y6W A;  4ABN A;  3AS8 A;  4U0Z A;  1YA0 A;  4N3A A;  1IHG A;  4H7Y A;  3E4B A;  3LPZ A;  3RJV A;  4NQ0 A;  3KAE A;  1NA0 A;  5BW8 C;  3GYZ A;  3FWV A;  3UQ3 A;  3HYM B;  4N39 A;  2FO7 A;  5CCL A;  4U04 A;  3LKU A;  4CDR A;  3MV2 B;  1ELW A;  4G26 A;  4N5C A;  2OND A;  3U3W A;  2VGX B;  2VYI A;  3Q15 A;  3GZ2 A;  3FP3 A;  4G1T A;  2C0L A;  2HR2 A;  5LCW J;  4XIF A;  5A7D B;  4XI0 A;  3RKV A;  4KYO B;  4XI9 A;  4HOR A;  3ZN3 A;  5FZS A;  4N3C A;  4N2S A;  4CGW A;  4KXK B;  4GPK A;  3GW4 A;  4JHR A;  4HOT A;  3Q49 B;  4UQX A;  3QOU A;  5FZQ A;  3UUX A;  2L6J A;  4HOQ A;  5G05 C;  3ULQ A;  5BNW A;  4I9C A;  1IYG A;  4BWR A;  2XGS A;  5JJ7 A;  3QWP A;  3SF4 A;  3ZGQ A;  4I1A A;  3JYS A;  2UWJ G;  2R5S A;  4AY5 A;  3RO3 A;  4I2W A;  3ASD A;  5AYW D;  4UI9 J;  4WNF A;  3LCA A;  5ARG A;  2VGX A;  5FT9 A;  4AIF A;  3MKR A;  1TJC A;  3N71 A;  3S7D A;  5BT1 A;  2PZI A;  5ARF A;  4O6F A;  4LEU A;  1KLX A;  1KT1 A;  4F3V A;  1ZU2 A;  1ZBP A;  5G04 C;  4BTB A;  2P58 C;  2KC7 A;  3S7B A;  4ME2 A;  3ZPJ A;  5DIZ A;  5HI7 A;  4GZ3 A;  5KJL A;  3K9I A;  3CK9 A;  3TG5 A;  2HO1 A;  1KT0 A;  4AM9 A;  4GYY A;  5CHE E;  2HYZ A;  3GZ1 A;  4BTA A;  2BUG A;  2VSY A;  2MHK A;  3QWW A;  4WNG A;  4G25 A;  3TGO A;  4I17 A;  3MA5 A;  2UY1 B;  1E96 B;  4IN3 B;  2XCB A;  3WXX A;  3UPV A;  4YVO A;  3VTY A;  1A17 A;  1NZN A;  3NF1 A;  5D0Q D;  3S7J A;  3MV3 B;  4CGV A;  1NA3 A;  3BEE A;  2VSN A;  3CK7 A;  2FF4 A;  4B94 A;  2FBN A;  2YQ8 A;  3LY7 A;  3ASG A;  5EKQ D;  3CKC A;  3ESK A;  1B89 A;  3ZFW A;  3RU0 A;  4HOS A;  2C2L A;  4U07 A;  2UY1 A;  4JA7 A;  2DBA A;  4GA0 A;  4WND A;  2XGO A;  2Y4U A;  4A1S A;  2IF4 A;  3QDN A;  3TAX A;  1W3B A;  1P5Q A;  4GCN A;  3RIB A;  4BT9 A;  2FI7 A;  2YHC A;  2V5F A;  3TG4 A;  4GZ6 A;  2KCL A;  3CVN A;  4I2Z A;  2XEV A;  4G2V A;  5LCW C;  5KJN A;  5A6C A;  3OXG A;  4N3B A;  1QQE A;  4HOU A;  5EX3 A;  3PDN A;  4G23 A;  2IFU A;  2C0M A;  3LY9 A;  4YVQ C;  2XPI A;  3MEK A;  4RG9 A;  4WUY A;  2WQH A;  1WM5 A;  3AS4 A;  5C1D A;  3KS2 A;  4UI9 K;  1QZ2 A;  4UQZ A;  2VQ2 A;  1ELR A;  4YND A; 
#chains in the Genus database with same CATH topology
 4U0S A;  3NOC D;  4XKC A;  4BER A;  4BFR A;  4GMR A;  4I6G A;  4DI3 A;  4J0U A;  4UI9 C;  4GYW A;  4JA9 A;  4PH4 B;  3HXE A;  3KD7 A;  4HI8 A;  3HVE B;  2KAT A;  1D9S A;  3Q7A A;  2YIN A;  3DSS A;  4OVV A;  4YDW A;  2OOE A;  4J8F A;  2P9I G;  4HQD A;  3ASF A;  3PZD A;  2VTB B;  3SI5 A;  1H2V C;  5JJ6 A;  3P1U A;  3B7B A;  3IXE A;  3JUI A;  1K1A A;  1Z3X A;  3NZU A;  5JMN D;  3FTZ A;  2QZA A;  3FFL A;  4BES A;  5ENS D;  3CVP A;  1U2V G;  4CDM A;  3CVV A;  4URK A;  1BI7 B;  2L9B A;  3UM0 A;  2QFC A;  2ZIR A;  4PS8 A;  2LXL A;  4WNE A;  1MHQ A;  4H7X A;  5G04 J;  4KBQ A;  2AJA A;  3ZHE B;  2J9Q A;  2DWZ A;  4AY6 A;  4JHK A;  1TNO A;  5B3S E;  4AP2 A;  3HXC A;  4I43 A;  1OXJ A;  1HS6 A;  3VTX A;  4LCT A;  4BX8 A;  3HVE A;  4AXH A;  2WB2 A;  3EHQ A;  1PAQ A;  3E30 A;  4HVB A;  2WXP A;  4CEM A;  5T4Y A;  3IBE A;  1OWP A;  3CLJ A;  2IJG X;  3BQO A;  4FC8 A;  4L2L A;  1DCQ A;  2LUH A;  2Y1L E;  3FH7 A;  2BKG A;  4DUI A;  5FZR A;  1N4S A;  1HZ4 A;  1SZA A;  3MX3 A;  4U8V D;  1E7U A;  5CER B;  2H6I A;  2VGE A;  3ZHE A;  4DX6 D;  1D8D A;  2P9N G;  2XHE A;  3CV0 A;  3AS5 A;  1XNF A;  5J90 A;  2HE0 A;  2RD0 A;  4O1O A;  4UWL A;  3LY8 A;  3CVY A;  4EEC A;  4DX2 A;  4K5C A;  3F6Q A;  3RAU A;  2NC9 A;  1K3Z D;  4N3A A;  4UUC A;  5ENR D;  3UI2 A;  3E4B A;  2GRP B;  3RJV A;  3KAE A;  4IUL A;  5BW8 C;  3EIQ C;  3UQ3 A;  2M63 A;  3CHP A;  2VJ8 A;  4APF A;  4U04 A;  4KT6 B;  3MV2 B;  2V5Q C;  1N11 A;  2J49 A;  3AU4 A;  3L17 A;  1H0A A;  3Q15 A;  1TNB A;  2ILR A;  2WXO A;  3DRA A;  5LCW J;  2OEW A;  4XI0 A;  4CZ2 D;  3RKV A;  2Y3A A;  4YDO A;  3ZN3 A;  4N3C A;  4CGW A;  3GW4 A;  4JHR A;  2L0I A;  4UQX A;  3QOU A;  5FZQ A;  3UUX A;  2L6J A;  4HOQ A;  1E90 A;  3ZYQ A;  5G05 C;  1Z6T A;  4DRX E;  2MOW A;  3L13 A;  4B0Z A;  1IYG A;  1H19 A;  1JWG A;  1N4P A;  4OAU C;  4UWF A;  3MZL B;  1MYO A;  2EIM E;  3FU0 A;  1X5B A;  2CHW A;  2DVW A;  3ZGQ A;  3JYS A;  4E85 A;  2UWJ G;  3G2V A;  4JB8 P;  1JWF A;  1HU3 A;  1HO8 A;  3ASD A;  5AYW D;  1Q2Z A;  3KEA A;  4CT0 A;  3Q73 A;  4FHK A;  3TWX A;  3MKR A;  1TJC A;  2KZT A;  3HG0 D;  3S7D A;  3LEW A;  5ARF A;  3B7T A;  1ZBP A;  2P58 C;  2KC7 A;  1TJF A;  4XEI G;  5HI7 A;  3LVR E;  4J7W A;  3ULE G;  2ION A;  3DSV A;  4DX1 A;  3TG5 A;  5T8I A;  2OV8 A;  3I4G A;  1KT0 A;  3CHM A;  4GU5 A;  2DCP A;  4G8K A;  5ENO D;  4BTA A;  4Q96 A;  1UOH A;  2VSY A;  1N52 A;  2A4Z A;  1N4Q A;  3TJP A;  1OWL A;  2P9L G;  2UY1 B;  3TWT A;  4Q69 A;  2XS8 A;  3EHM A;  4GAA A;  2WQ7 A;  4LRZ A;  5AQ7 A;  4MLP A;  2XEN A;  1JCR A;  1LF8 A;  3WXX A;  5T3R A;  1OWO A;  4I1O B;  3UPV A;  4IYP A;  3AU5 A;  3PNT B;  3PH0 C;  4X8Q A;  3C72 A;  4GTQ A;  3G2T A;  3HXF A;  3MYV A;  2QYU A;  3NQP A;  3E34 A;  4CGV A;  3FUN A;  1N0R A;  3Q9N C;  3EHR A;  2FO1 E;  4EZJ A;  5AEN A;  1G3N B;  2VSN A;  3PNL B;  2YQ8 A;  3LY7 A;  3AAA C;  4CRW A;  4HS2 A;  3UIO C;  5EIL A;  3LJ3 A;  4XX5 A;  3NB2 A;  2IOS A;  2RFA A;  5CRV A;  5KWD A;  4C0E A;  2UY1 A;  4JA7 A;  5BXU A;  1FT1 A;  3T5X A;  3HRA A;  3FEY A;  2IF4 A;  2R59 A;  1BD8 A;  1W3B A;  3PZ3 A;  5FIN A;  1OT8 A;  3FTW A;  4WWP A;  3CHR A;  4G11 A;  3T8M A;  4B8C B;  5CEA A;  3CVN A;  5AIJ A;  3UIP C;  1BLX B;  2XEV A;  3G2S A;  2HM8 A;  4GTS A;  4TUM A;  5G2N A;  3SD5 A;  3E32 A;  5H7P A;  2L6B A;  4OVU A;  5D66 A;  2OVB A;  4DK5 A;  1DNP A;  4ANU A;  3PDN A;  3FU5 A;  4G23 A;  4YVQ C;  1K1B A;  4HI9 A;  4TV3 A;  5G55 A;  3J5Q B;  4FU3 A;  2WMO A;  2CG3 A;  2OVF A;  4AJW A;  3D3M A;  2WVI A;  3FH5 A;  4JXT A;  1EPU A;  3Q75 A;  4J8D A;  1DC2 A;  2EIJ E;  4JC8 A;  5HQ8 A;  2YNQ A;  3RK6 A;  2H6G A;  4ILH B;  3ASN E;  3ZYK A;  4U8H A;  4TXQ A;  3D9J A;  4B89 A;  3SHF A;  3C98 A;  2F0Y A;  4NAC A;  4ATZ D;  3O48 A;  4G24 A;  2YHE A;  4Y6C A;  2AXV A;  2L0T B;  4C0M A;  4JVS A;  3MJW A;  4J6I A;  5E76 A;  2GW1 A;  2IU1 A;  1HH8 A;  3DST A;  2DYR E;  1HE8 A;  4GTV A;  1QNF A;  4A3V A;  5ANR A;  2PQN A;  4UQY A;  3QAQ A;  2LAI A;  4F1S A;  1HG2 A;  3OXF A;  5JA4 D;  2XGM A;  2PL2 A;  3EDT B;  1KZP A;  5HS0 A;  2FEZ A;  3R7R A;  2J4D A;  4CDN A;  1IKN D;  2XRZ A;  1E8W A;  1MZC A;  1MX2 A;  3S7F A;  5KBA A;  4N2Q A;  3CVQ A;  5ENN A;  1UW4 B;  2Q7F A;  2GRO B;  4APO A;  4EHM A;  3CKB A;  2LO6 A;  3DEP A;  2A5E A;  4LNG A;  3SFX A;  1WY6 A;  4UWG A;  3SBT B;  2CFZ A;  4OAV B;  2X6K A;  5IY5 E;  4F6R D;  2KXP C;  3ZU7 B;  5JJT A;  5FQ4 A;  4HLL A;  2JAB A;  3D9P A;  2KM4 A;  1KPS B;  3ZYL A;  3FTX A;  3UT4 A;  1LD7 A;  4M3O A;  3TWS A;  3SZ7 A;  3RRM B;  2XPZ A;  3S2A A;  2LSU A;  2RG8 A;  3X2Q E;  3EUV A;  3E37 A;  4I6E A;  3L6A A;  4U95 D;  3B7R L;  1Z5S C;  1IHG A;  3SFY A;  3LPZ A;  1K8K G;  5CBO A;  1MX6 A;  3JCK C;  3GYZ A;  3FWV A;  3QAR A;  1H6K A;  4TUU A;  3FUJ A;  4N5C A;  3UXG A;  3FUM A;  5KCM A;  3UTM A;  3JUE A;  2VYI A;  5EDS A;  3GZ2 A;  3FP3 A;  4G1T A;  4KVM A;  1EDU A;  4MRU A;  1DCE A;  2P9P G;  3DPY A;  1WG0 A;  4FJZ A;  2ZU6 B;  4QQI A;  4U8Y D;  5BUZ A;  4PUC A;  4XI9 A;  1NFI E;  4L7T A;  4XE0 A;  5FZS A;  3D9H A;  3UX4 A;  4WWO A;  3CQG B;  5BV0 A;  4KXK B;  2A5U A;  2V8S E;  3CIA A;  4XZ4 A;  3FUD A;  5ENT D;  2P9S G;  3ONL A;  3L82 A;  2BED A;  3FTV A;  3R7Q A;  4LSZ E;  1OCZ E;  5KNH D;  2ZGD A;  5LOZ A;  1OCO E;  4FLB A;  4JHJ A;  3FDH A;  2R5S A;  2VTB A;  2EIN E;  4UI9 J;  1FPP A;  3MGB A;  3LCA A;  4ILG A;  5ARG A;  2IEJ A;  3T8K A;  2EQX A;  2XQ0 A;  2ETB A;  2XZT G;  4O6F A;  4LEU A;  2QYJ A;  4ME2 A;  2RFM A;  2I1K A;  5AJD A;  4BEP A;  3NAW A;  2HO1 A;  2X6F A;  1V54 E;  3OTN A;  3OAW A;  1BPO A;  2WXQ A;  5CHE E;  2BUG A;  3VLE A;  3BUA A;  3C3Q A;  3PUK A;  4PS7 A;  1HFA A;  4ZHB A;  3FY4 A;  4I17 A;  2XS1 A;  5BV1 A;  3R9M A;  5FQ8 A;  1NL4 A;  1SW6 A;  1GW6 A;  3NOG D;  1MX4 A;  3FU6 A;  4I6J A;  1SZ9 A;  1E8Z A;  4GZC A;  4L2Y A;  1A17 A;  1NZN A;  1UJK A;  3NF1 A;  5D0Q D;  4IRU A;  5EYL A;  1D8E A;  3MV3 B;  4GTO A;  1NA3 A;  1AWC B;  1SA5 A;  5KNG A;  3CK7 A;  2FF4 A;  4B94 A;  4BSZ B;  3ASG A;  2R2L A;  1H6O A;  1B89 A;  4KMO A;  3P2B A;  3FUE A;  1FT2 A;  3ZFW A;  3CVX A;  2Y0B G;  2QY7 A;  4U07 A;  1NI1 A;  3V2O A;  4GA0 A;  3UMV A;  4A1S A;  1HX8 A;  5CED B;  4XKB A;  5AN8 A;  3EU9 A;  3BU8 A;  3RIB A;  2WXJ A;  1N94 A;  1U3D A;  2V5F A;  2KCL A;  3DPD A;  3FTS A;  2XRY A;  4I2Z A;  1DVP A;  4HRM B;  2H6F A;  4DX7 D;  4LG6 A;  3D9N A;  1VDY A;  3JQ0 A;  4B93 B;  4HOU A;  3W9F A;  3QNK A;  1UN9 A;  2P2C P;  5CBN A;  2IFU A;  2WXG A;  2BF0 X;  3JQ1 A;  3MEK A;  4RG9 A;  3T5V A;  5C1D A;  4ACK A;  4UI9 K;  2X6H A;  4DX5 D;  3LS8 A;  4RSY A;  3L54 A;  2CHX A;  3SBS A;  3U4T A;  4DLQ A;  2GRR B;  5G05 J;  1S64 A;  5M72 A;  3APC A;  3QKY A;  3ZXS A;  3URZ A;  3W9G A;  2F8X K;  3APF A;  3FEX A;  3PEV B;  1OY3 D;  1SQM A;  2DYS E;  3TWR A;  4NRH B;  3CST A;  2J08 A;  3Q7F A;  3AG1 E;  2I2O A;  4EZK A;  4GML A;  3PE3 A;  1Y6I A;  5BPP A;  1S0P A;  1E8X A;  5J08 A;  4F1P A;  5ANL A;  4U63 A;  3VLD A;  3ZXP A;  2WXH A;  1QBQ A;  3SY2 A;  4EPZ A;  5B1A E;  2WXK A;  3HDX A;  4J8S A;  4I9E A;  5FJY A;  2LNI A;  2ZIS A;  3FHE A;  3CVU A;  1PC2 A;  1Y8M A;  3PE4 A;  3I4R B;  2MYO A;  3FUI A;  2X38 A;  5FTP A;  2JLB A;  2XEH A;  2I6H A;  3RO2 A;  4E6H A;  4K0R A;  3HXB A;  1TEZ A;  3V30 A;  3ZYM A;  4DPR A;  3CHO A;  4LUN U;  3WG7 E;  3QJZ A;  2XCC A;  2WXF A;  4QFV A;  3HXD A;  4EBA A;  4RG6 A;  3OXL A;  4EQF A;  3PEU B;  3QWV A;  2VGY A;  4GZD A;  3ZIM A;  3ISM C;  3J5P A;  4BSX A;  4TXP A;  2E2E A;  2DZO A;  4NIK A;  4GYO A;  1SA4 A;  3B7S A;  2IO3 C;  4U0U A;  4W9R A;  4KZ0 A;  3AS8 A;  5ENQ D;  4RLY A;  4NQ0 A;  4GPM A;  4TRQ A;  1NA0 A;  3ZUV B;  4G8L A;  4U7E B;  3HYM B;  4JD2 G;  1TNY A;  3AJI A;  1L5J A;  1E7V A;  4N39 A;  2FO7 A;  5E75 A;  3LKU A;  2Y69 E;  4CDR A;  4G26 A;  2J8S D;  2AWI A;  1FVH A;  2VGX B;  2BTD A;  3CVW A;  1OWN A;  3DWL G;  2C0L A;  5FIO A;  3ULY A;  5LP0 A;  1TR4 A;  4FHJ A;  3PZ2 A;  1O5M A;  2X6I A;  4OYS A;  2GRQ B;  2E0I A;  4C9B B;  4N2S A;  1UJJ A;  2OEV A;  3ZNG A;  2P9K G;  4HOT A;  3Q49 B;  4BET A;  4I9C A;  5HRY A;  1O1T A;  4CYM D;  2I1J A;  5JJ7 A;  3SF4 A;  3UT7 A;  3Q78 A;  3D9O A;  3FTU A;  4FJY A;  5FQ7 A;  4AY5 A;  1JCS A;  4GTR A;  1N95 A;  3RRU A;  3RO3 A;  5D2M C;  3LXU X;  4LNU D;  2H6H A;  3FU3 A;  1XGW A;  2NYJ A;  3AG2 E;  2VGX A;  5FT9 A;  2PM7 A;  4AIF A;  2GGF A;  3BG1 B;  5FWQ A;  5BT1 A;  2PZI A;  1KLX A;  4HB5 A;  4F3V A;  5G04 C;  3E33 A;  3S7B A;  3ZPJ A;  2AXU A;  1IQU A;  2AW6 A;  5KJL A;  1SVX A;  3MCX A;  1EYH A;  3PVL A;  5AQB A;  3TXM A;  2R05 A;  5AQA A;  1TYQ G;  2WXI A;  4BX9 A;  4AM9 A;  5AQ9 A;  4GYY A;  1BI8 B;  5LX8 A;  2R17 C;  3GZ1 A;  3I5P A;  2WM9 A;  1MJ0 A;  4A63 B;  3GZS A;  2X6J A;  3TGO A;  1V55 E;  4GMJ A;  3JXJ A;  4YDY A;  3C3O A;  2ZGG A;  3D9K A;  2XCB A;  2F8Y A;  2CFU A;  2X3M A;  3QK0 A;  3MKQ B;  2R02 A;  3HHM A;  4YVO A;  2ETA A;  3L08 A;  3I3N A;  3L16 A;  5ITZ F;  3TWQ A;  2XPY A;  1H2T C;  3TXN A;  4CCA A;  5FQ6 A;  3JXI A;  3DSX A;  4U96 D;  4WWN A;  2J4B A;  3BEE A;  3BG0 B;  4HBD A;  2VSX E;  1N9A A;  3FUL A;  4DLO A;  3ZVV A;  3CHS A;  4JPS A;  3CKC A;  4YDE A;  4DI4 A;  4KVO A;  2WXR A;  5A23 A;  3V79 K;  2I9C A;  4ANW A;  2V4H C;  4K5B A;  3ABL E;  2C2L A;  3KEZ A;  1ZB1 A;  4ATG A;  3V31 A;  3DBS A;  2WXN A;  2Y4U A;  1ELK A;  4JEU A;  5AAR A;  3QDN A;  3TAX A;  2FI7 A;  3MKQ A;  3D9M A;  4A1G A;  3FTY A;  4HRN A;  3TG4 A;  3G2U A;  4A3T A;  3CSF A;  5LCW C;  4FLH A;  2MRI A;  5A6C A;  2P9U G;  5AAO A;  1TNU A;  1RZ4 A;  5ENP D;  1IXV A;  3CQC B;  3OXG A;  4L1B A;  4N3B A;  1OCC E;  3ML9 A;  5EX3 A;  4Q94 A;  2XPI A;  1UG3 A;  2XEE A;  4WUY A;  5HKP A;  3C3R A;  3SO8 A;  2WQH A;  2CG2 A;  4AV7 A;  1YCS B;  3L22 A;  3AS4 A;  3HIZ A;  5CEC B;  3DXM G;  1TN7 A;  1Z3Y A;  5AJL A;  3UKR G;  2B6C A;  4YND A;  2GRL A;  3FUF A;  2PNN A;  5KJK A;  3FUH A;  4UWK A;  4FP7 A;  4AOF A;  2EIL E;  4V3I A;  1WDY A;  2IQC A;  3U9W A;  2KBX A;  1QYM A;  4O60 A;  1KZO A;  3UKU G;  1JCQ A;  1YMP A;  4AEZ C;  4FA6 A;  1OUV A;  5DBK A;  4BT8 A;  4PDX A;  2KZT B;  3RRN B;  4GCO A;  5C2Y A;  4FAD A;  2Y4T A;  3ASH A;  3Q4A B;  1E8Y A;  1TN8 A;  3PZ1 A;  1WAO 1;  4ANX A;  2RKK A;  2WQ6 A;  4GA1 A;  4GZ5 A;  4AVX A;  3LYA A;  2XZD G;  3QB2 A;  3Q79 A;  2KCK A;  3LDZ A;  3Q47 B;  3UM1 A;  3EU5 A;  3DEO A;  4O1P A;  4ANV A;  3EIJ A;  4GA2 A;  4JZY A;  3C5R A;  3CEQ A;  2KCV A;  3ZRH A;  1TN6 A;  2LSV A;  3ONK A;  1PY1 A;  3ESL A;  4KZC A;  1X81 A;  4K5A B;  4J8E A;  5EX0 A;  4FUL A;  2QC9 A;  3B95 A;  4L23 A;  3CK8 A;  5KJM A;  2IY0 C;  5CCM A;  4L9P A;  4C48 B;  5CRU A;  4MKT A;  3ZW3 A;  1IHB A;  3V2X A;  3R9A B;  4EBA G;  2DIW A;  2BKK B;  4N5Q A;  1U3C A;  2OCC E;  1HXI A;  3IEG A;  1FCH A;  3UIN C;  2GRM A;  5CMW A;  1JUQ A;  3Q5M A;  2WPV A;  3U64 A;  1INZ A;  3FH8 A;  2R03 A;  1N54 A;  2IO2 C;  5D0O D;  4BY6 A;  2PQR A;  3CVL A;  2AVP A;  3D9I A;  3IV0 A;  4JL0 A;  4Y6W A;  3UM2 A;  4ABN A;  4U0Z A;  1YA0 A;  3VLF A;  2IOL A;  4H7Y A;  4MBG A;  2V4L A;  3ENE A;  3NZS A;  4HXI A;  1A5E A;  5CCL A;  4HFG A;  2EIK E;  1BU9 A;  1ELW A;  3TL5 A;  2OND A;  3U3W A;  2F37 A;  5EIB E;  3SQV A;  2HR2 A;  1LTX A;  4TXR A;  4M7C A;  1OWM A;  5JHA A;  4XIF A;  5A7D B;  3FUK A;  2DZN A;  5BXO A;  4KYO B;  4HOR A;  3PUJ A;  1IQR A;  3SFZ A;  3O4Z A;  4GPK A;  5EN5 D;  4NUR A;  4HRL A;  2GRN B;  3CHQ A;  5CMY A;  3ULQ A;  1NP7 A;  5BNW A;  4GTM A;  2B0O E;  4BWR A;  2XGS A;  3L9T A;  3QWP A;  4K03 A;  4I1A A;  3LJN A;  2ZXW E;  3DXK G;  4I2W A;  3ABM E;  3RSE G;  4DJA A;  4WNF A;  3KSL A;  3AG3 E;  3EHN A;  2WMN A;  3CGH A;  1O1S A;  1JPL A;  1OCR E;  3N71 A;  4ACL A;  3TWU A;  3SGH A;  1KT1 A;  1ZU2 A;  2NXP A;  3EJN A;  3D9L A;  4Z68 A;  4GTP A;  4BTB A;  5DIZ A;  4P29 A;  4GZ3 A;  2WXL A;  3K9I A;  1S70 B;  3CK9 A;  2V0P A;  2CHZ A;  5LFA A;  3PRZ A;  4MS6 A;  2VSO E;  2ETC A;  3Q9U C;  2NSZ A;  3TWV A;  3DSW A;  4ILI A;  1H2U A;  2HYZ A;  1S63 A;  4GTT A;  2JEK A;  2J07 A;  2MHK A;  1O1R A;  3TWW A;  3IHV A;  3QWW A;  4WNG A;  4G25 A;  4PS3 A;  3MA5 A;  1HG5 A;  1YYH A;  1E96 B;  1MQS A;  4IN3 B;  4A55 A;  1HF8 A;  4HLE A;  2LXM A;  1FVF A;  1AP7 A;  3PS6 A;  3ML8 A;  3IKO B;  3G2W A;  3SNX A;  2LAH A;  3KSQ A;  2J09 A;  3VTY A;  3ASO E;  4F7A A;  1UN8 A;  2PM6 A;  3APD A;  3S7J A;  4B8A A;  4F53 A;  4UWH A;  4ZFH A;  4JW1 A;  2FBN A;  1N4R A;  4CT4 A;  3B13 A;  5EID A;  5EKQ D;  4EZL A;  4I1M A;  2WXM A;  3ESK A;  3PRE A;  1RW2 A;  4RVB A;  3RU0 A;  4HOS A;  3U66 A;  1TNZ A;  4R7L A;  3B7U X;  1N0Q A;  4WAF A;  2DBA A;  3IHY A;  4WND A;  2XGO A;  4GB9 A;  4RQI A;  1P5Q A;  4GCN A;  3LVQ E;  4BT9 A;  2AXZ A;  4J8Y A;  2YHC A;  1H6P A;  3DSU A;  4GZ6 A;  3NBN B;  4LER A;  3ZKJ A;  1EF1 C;  4G2V A;  4HNA D;  3T9K A;  5KJN A;  4D10 C;  2FUL A;  3ABK E;  3ZEF A;  1LD8 A;  1QQE A;  3CR3 A;  3AG4 E;  2C0M A;  3LY9 A;  3UT8 A;  3UM3 A;  5EYP F;  4JEH A;  3PZ4 A;  5B1B E;  4LNB A;  1WM5 A;  3KS2 A;  3QC1 A;  5JHB A;  1QZ2 A;  4UQZ A;  2VQ2 A;  1ELR A; 
#chains in the Genus database with same CATH homology
 4U0S A;  4RSY A;  2GRL A;  2WVI A;  3L54 A;  2CHX A;  3FH5 A;  4JXT A;  4XKC A;  3SBS A;  3U4T A;  3FUF A;  4BFR A;  4I6G A;  4DI3 A;  4DLQ A;  4J0U A;  5G05 J;  4UI9 C;  5KJK A;  4GYW A;  4JA9 A;  3FUH A;  4UWK A;  5M72 A;  4FP7 A;  1EPU A;  4PH4 B;  4AOF A;  4V3I A;  3APC A;  4J8D A;  3KD7 A;  3HVE B;  3QKY A;  2KAT A;  3ZXS A;  3URZ A;  4JC8 A;  2YIN A;  4OVV A;  3APF A;  3FEX A;  2IQC A;  2OOE A;  5HQ8 A;  3PEV B;  4J8F A;  3ASF A;  3PZD A;  3U9W A;  2YNQ A;  3RK6 A;  2VTB B;  3SI5 A;  1H2V C;  4ILH B;  1SQM A;  5JJ6 A;  3P1U A;  3ZYK A;  4NRH B;  4U8H A;  3JUI A;  4AEZ C;  3D9J A;  3CST A;  1Z3X A;  4B89 A;  3NZU A;  3SHF A;  3C98 A;  3FTZ A;  4NAC A;  2J08 A;  4FA6 A;  1OUV A;  5DBK A;  3O48 A;  4BT8 A;  3FFL A;  4G24 A;  3CVP A;  2I2O A;  2YHE A;  4PDX A;  4CDM A;  4EZK A;  3CVV A;  4GML A;  2L9B A;  2KZT B;  4URK A;  3RRN B;  4GCO A;  2QFC A;  5C2Y A;  3PE3 A;  1Y6I A;  2AXV A;  4PS8 A;  2L0T B;  4Y6C A;  4FAD A;  5BPP A;  1S0P A;  2Y4T A;  3ASH A;  3Q4A B;  4WNE A;  1MHQ A;  4H7X A;  5G04 J;  4KBQ A;  1E8Y A;  4C0M A;  1E8X A;  5J08 A;  4JVS A;  3MJW A;  1WAO 1;  4J6I A;  5E76 A;  4ANX A;  3ZHE B;  2GW1 A;  2IU1 A;  5ANL A;  1HH8 A;  4U63 A;  4GA1 A;  2J9Q A;  3VLD A;  2WXH A;  4GZ5 A;  2WQ6 A;  4AVX A;  4AY6 A;  4JHK A;  3LYA A;  3QB2 A;  1HE8 A;  4AP2 A;  4I43 A;  2KCK A;  3LDZ A;  4EPZ A;  3Q47 B;  2WXK A;  3HDX A;  4J8S A;  4I9E A;  1QNF A;  1HS6 A;  5FJY A;  5ANR A;  4LCT A;  2PQN A;  3VTX A;  4A3V A;  3HVE A;  4BX8 A;  4ANV A;  2LNI A;  4UQY A;  3EIJ A;  3QAQ A;  4GA2 A;  4JZY A;  4AXH A;  2WB2 A;  2LAI A;  3FHE A;  1HG2 A;  3OXF A;  4F1S A;  2XGM A;  2PL2 A;  3EDT B;  3CVU A;  1PC2 A;  3CEQ A;  2KCV A;  1PAQ A;  3ZRH A;  1Y8M A;  2LSV A;  4HVB A;  2FEZ A;  3ONK A;  3PE4 A;  1PY1 A;  3R7R A;  3ESL A;  2WXP A;  4CEM A;  4KZC A;  3I4R B;  2J4D A;  4CDN A;  3FUI A;  3IBE A;  5T4Y A;  2XRZ A;  2X38 A;  1E8W A;  4J8E A;  5EX0 A;  5FTP A;  2JLB A;  3S7F A;  4FUL A;  1OWP A;  2I6H A;  3RO2 A;  4N2Q A;  3CVQ A;  5ENN A;  3CLJ A;  2IJG X;  4L23 A;  1UW4 B;  2Q7F A;  3CK8 A;  4E6H A;  5KJM A;  4APO A;  4K0R A;  3CKB A;  4FC8 A;  4L2L A;  2LO6 A;  5CCM A;  1TEZ A;  3FH7 A;  3ZYM A;  1WY6 A;  4UWG A;  3SBT B;  4DPR A;  2CFZ A;  3CHO A;  2X6K A;  4LUN U;  4MKT A;  5FZR A;  3R9A B;  3ZW3 A;  5JJT A;  3QJZ A;  1HZ4 A;  1SZA A;  4EBA G;  2DIW A;  2XCC A;  3MX3 A;  2WXF A;  1E7U A;  5FQ4 A;  4QFV A;  4EBA A;  4RG6 A;  3OXL A;  3D9P A;  2KM4 A;  3ZHE A;  3ZYL A;  4EQF A;  3PEU B;  1U3C A;  1HXI A;  3IEG A;  3FTX A;  3UT4 A;  1FCH A;  2VGY A;  3QWV A;  4GZD A;  3ZIM A;  2GRM A;  5CMW A;  1JUQ A;  3Q5M A;  2WPV A;  3U64 A;  1INZ A;  2XHE A;  3CV0 A;  3FH8 A;  3AS5 A;  1XNF A;  4M3O A;  5J90 A;  1N54 A;  3SZ7 A;  4BSX A;  3RRM B;  2RD0 A;  4UWL A;  5D0O D;  3LY8 A;  4BY6 A;  2XPZ A;  2PQR A;  2E2E A;  3S2A A;  4EEC A;  3CVY A;  4GYO A;  3CVL A;  2AVP A;  2LSU A;  2RG8 A;  3D9I A;  3B7S A;  3IV0 A;  4I6E A;  2NC9 A;  4JL0 A;  4U0U A;  4W9R A;  4Y6W A;  3L6A A;  3AS8 A;  4KZ0 A;  4U0Z A;  4ABN A;  1YA0 A;  3B7R L;  3VLF A;  4N3A A;  2IOL A;  1IHG A;  4H7Y A;  3E4B A;  3LPZ A;  3RJV A;  4NQ0 A;  2V4L A;  4TRQ A;  3ENE A;  3KAE A;  4IUL A;  3JCK C;  1NA0 A;  5BW8 C;  3EIQ C;  2M63 A;  3FWV A;  3GYZ A;  3HYM B;  3QAR A;  3UQ3 A;  3CHP A;  2VJ8 A;  3NZS A;  4HXI A;  1L5J A;  1E7V A;  4N39 A;  1H6K A;  4TUU A;  4APF A;  2FO7 A;  5CCL A;  4HFG A;  5E75 A;  4U04 A;  3LKU A;  4KT6 B;  4CDR A;  3FUJ A;  3MV2 B;  1ELW A;  4G26 A;  4N5C A;  3TL5 A;  3FUM A;  2OND A;  2J49 A;  3AU4 A;  2AWI A;  5KCM A;  1FVH A;  3L17 A;  3U3W A;  2VGX B;  2BTD A;  3CVW A;  1OWN A;  1H0A A;  2VYI A;  3Q15 A;  3GZ2 A;  3FP3 A;  4G1T A;  5EDS A;  2C0L A;  4KVM A;  2HR2 A;  2ILR A;  5LP0 A;  1EDU A;  2WXO A;  4MRU A;  4FHJ A;  5LCW J;  1OWM A;  5JHA A;  4XIF A;  5A7D B;  3FUK A;  4XI0 A;  4FJZ A;  2ZU6 B;  3RKV A;  5BUZ A;  4PUC A;  2X6I A;  2Y3A A;  4KYO B;  4OYS A;  4XI9 A;  4L7T A;  4HOR A;  4XE0 A;  2E0I A;  5FZS A;  3UX4 A;  4N3C A;  3ZN3 A;  3PUJ A;  4C9B B;  4N2S A;  4WWO A;  1UJJ A;  4CGW A;  3CQG B;  5BV0 A;  4KXK B;  1IQR A;  3SFZ A;  3O4Z A;  4GPK A;  2A5U A;  3GW4 A;  4JHR A;  2V8S E;  3Q49 B;  4HOT A;  2L0I A;  3CIA A;  4UQX A;  4NUR A;  4XZ4 A;  3FUD A;  3ONL A;  3QOU A;  5FZQ A;  3UUX A;  3FTV A;  3R7Q A;  2L6J A;  4HOQ A;  1E90 A;  3ZYQ A;  3CHQ A;  5CMY A;  5G05 C;  3ULQ A;  1Z6T A;  1NP7 A;  5BNW A;  2MOW A;  3L13 A;  4B0Z A;  4I9C A;  1IYG A;  1H19 A;  1JWG A;  4UWF A;  3MZL B;  2I1J A;  2XGS A;  5LOZ A;  4BWR A;  5JJ7 A;  3QWP A;  3FU0 A;  3SF4 A;  1X5B A;  2CHW A;  3UT7 A;  4K03 A;  4I1A A;  3ZGQ A;  3JYS A;  4FLB A;  4JHJ A;  4E85 A;  2UWJ G;  3D9O A;  3FTU A;  3FDH A;  3G2V A;  4FJY A;  1JWF A;  2R5S A;  5FQ7 A;  4AY5 A;  1HU3 A;  2VTB A;  3RRU A;  3RO3 A;  3LXU X;  1HO8 A;  4I2W A;  3ASD A;  5AYW D;  4DJA A;  3FU3 A;  4UI9 J;  4WNF A;  1XGW A;  4CT0 A;  3MGB A;  3LCA A;  4ILG A;  5ARG A;  2VGX A;  5FT9 A;  2PM7 A;  3EHN A;  2WMN A;  4FHK A;  4AIF A;  3MKR A;  1TJC A;  2KZT A;  2GGF A;  3CGH A;  3BG1 B;  1JPL A;  2EQX A;  3N71 A;  5FWQ A;  3S7D A;  5BT1 A;  2XQ0 A;  2PZI A;  4ACL A;  3LEW A;  3SGH A;  5ARF A;  4O6F A;  4LEU A;  1KLX A;  3B7T A;  1KT1 A;  4F3V A;  1ZU2 A;  2NXP A;  3EJN A;  3D9L A;  1ZBP A;  5G04 C;  4BTB A;  2P58 C;  2KC7 A;  3S7B A;  1TJF A;  4ME2 A;  3ZPJ A;  5DIZ A;  2AXU A;  5HI7 A;  1IQU A;  4P29 A;  3LVR E;  2AW6 A;  2I1K A;  4GZ3 A;  5KJL A;  2WXL A;  3K9I A;  3CK9 A;  2ION A;  2V0P A;  3MCX A;  2CHZ A;  5LFA A;  1EYH A;  3PVL A;  3PRZ A;  4MS6 A;  5AJD A;  3TXM A;  2VSO E;  3TG5 A;  5T8I A;  2HO1 A;  2OV8 A;  3I4G A;  2X6F A;  1KT0 A;  2WXI A;  2NSZ A;  4BX9 A;  4AM9 A;  3OTN A;  3CHM A;  4GU5 A;  4GYY A;  3OAW A;  2DCP A;  1BPO A;  4ILI A;  2WXQ A;  1H2U A;  5CHE E;  5LX8 A;  2HYZ A;  2R17 C;  3GZ1 A;  3I5P A;  4BTA A;  2BUG A;  3VLE A;  2JEK A;  2WM9 A;  3GZS A;  4Q96 A;  2X6J A;  2J07 A;  2VSY A;  1N52 A;  2MHK A;  3PUK A;  2A4Z A;  3IHV A;  3QWW A;  4PS7 A;  1HFA A;  4WNG A;  4G25 A;  3TGO A;  3FY4 A;  4PS3 A;  4I17 A;  3TJP A;  3MA5 A;  5AJL A;  1OWL A;  2UY1 B;  4GMJ A;  1HG5 A;  5BV1 A;  1E96 B;  4Q69 A;  1MQS A;  5FQ8 A;  3EHM A;  4GAA A;  4IN3 B;  3D9K A;  2XCB A;  4A55 A;  2CFU A;  2WQ7 A;  4LRZ A;  1GW6 A;  1HF8 A;  4HLE A;  1FVF A;  4MLP A;  1LF8 A;  3PS6 A;  2X3M A;  3FU6 A;  3ML8 A;  5T3R A;  3IKO B;  3QK0 A;  3WXX A;  1OWO A;  4I6J A;  3G2W A;  3MKQ B;  4I1O B;  1SZ9 A;  3HHM A;  3UPV A;  1E8Z A;  3SNX A;  4IYP A;  3AU5 A;  3PNT B;  3PH0 C;  2LAH A;  4YVO A;  3L08 A;  4GZC A;  3I3N A;  3L16 A;  4L2Y A;  2J09 A;  3VTY A;  2XPY A;  1H2T C;  3TXN A;  4F7A A;  1A17 A;  1UN8 A;  1NZN A;  1UJK A;  2PM6 A;  3G2T A;  3NF1 A;  5D0Q D;  5FQ6 A;  4CCA A;  3APD A;  3MYV A;  4IRU A;  3S7J A;  3NQP A;  3MV3 B;  4WWN A;  4CGV A;  1NA3 A;  2J4B A;  3BEE A;  3BG0 B;  3FUN A;  4B8A A;  2VSX E;  4EZJ A;  5AEN A;  2VSN A;  4F53 A;  4UWH A;  3FUL A;  3CK7 A;  4JW1 A;  2FF4 A;  3PNL B;  2FBN A;  4B94 A;  2YQ8 A;  3LY7 A;  4CT4 A;  4CRW A;  3ASG A;  3B13 A;  4HS2 A;  4DLO A;  3ZVV A;  3CHS A;  4JPS A;  5EKQ D;  4EZL A;  3CKC A;  4I1M A;  2WXM A;  3ESK A;  4DI4 A;  1B89 A;  3LJ3 A;  4KMO A;  4KVO A;  2WXR A;  3PRE A;  4XX5 A;  3P2B A;  3FUE A;  3ZFW A;  5A23 A;  3CVX A;  2I9C A;  4RVB A;  3RU0 A;  4ANW A;  4HOS A;  2QY7 A;  3U66 A;  2C2L A;  2IOS A;  4R7L A;  3KEZ A;  4U07 A;  4ATG A;  3B7U X;  4C0E A;  2UY1 A;  4WAF A;  4JA7 A;  2DBA A;  3IHY A;  4GA0 A;  3DBS A;  4WND A;  2WXN A;  2XGO A;  3UMV A;  2Y4U A;  3T5X A;  4A1S A;  1ELK A;  3FEY A;  2IF4 A;  2R59 A;  4GB9 A;  1HX8 A;  4JEU A;  3QDN A;  4XKB A;  1W3B A;  3TAX A;  1P5Q A;  4GCN A;  3LVQ E;  3FTW A;  4WWP A;  3RIB A;  4BT9 A;  2AXZ A;  2FI7 A;  3CHR A;  2WXJ A;  4G11 A;  3MKQ A;  3D9M A;  3T8M A;  4B8C B;  2YHC A;  4A1G A;  1U3D A;  2V5F A;  3FTY A;  3TG4 A;  4GZ6 A;  2KCL A;  3DPD A;  3CVN A;  3G2U A;  4A3T A;  5AIJ A;  4LER A;  3FTS A;  1EF1 C;  2XRY A;  3CSF A;  2XEV A;  4G2V A;  4I2Z A;  5LCW C;  3G2S A;  2HM8 A;  2MRI A;  4FLH A;  1DVP A;  5KJN A;  5A6C A;  4D10 C;  2FUL A;  5G2N A;  3SD5 A;  3CQC B;  3OXG A;  4OVU A;  4L1B A;  3ZEF A;  4N3B A;  2OVB A;  4DK5 A;  1DNP A;  3D9N A;  1VDY A;  3JQ0 A;  1QQE A;  3CR3 A;  4ANU A;  3ML9 A;  4HOU A;  3PDN A;  3FU5 A;  3QNK A;  1UN9 A;  4G23 A;  5EX3 A;  4Q94 A;  2IFU A;  2C0M A;  3LY9 A;  3UT8 A;  4YVQ C;  2XPI A;  1UG3 A;  4JEH A;  2WXG A;  2BF0 X;  3JQ1 A;  3MEK A;  4RG9 A;  4WUY A;  2WQH A;  4TV3 A;  5G55 A;  2CG2 A;  4AV7 A;  3L22 A;  4FU3 A;  2WMO A;  1WM5 A;  2CG3 A;  3AS4 A;  5C1D A;  3HIZ A;  3T5V A;  3KS2 A;  3QC1 A;  4ACK A;  5JHB A;  4UI9 K;  1QZ2 A;  4UQZ A;  2X6H A;  2VQ2 A;  2OVF A;  3LS8 A;  4AJW A;  1Z3Y A;  1ELR A;  3D3M A;  4YND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...