3KD7A

Designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
102
structure length
102
Chain Sequence
NSAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a designed tetratricopeptide repeat module in complex with its peptide ligand.
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
molecule keywords CTPR390
total genus 41
structure length 102
sequence length 102
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3kd7A00
4KYOB 4KBQA 1IYGA 4I2ZA 5BT1A 3GZ2A 2FEZA 4I2WA 3QWPA 1IHGA 1QZ2A 2PQRA 3HYMB 2FF4A 4A1SA 1HH8A 4N3BA 3PDNA 2VSYA 3QDNA 4WUYA 3CKBA 3LCAA 3Q47B 2VQ2A 2V5FA 3Q4AB 4RG9A 5FZRA 5G05J 4BWRA 3UPVA 4HORA 1NA3A 4CDRA 4GPKA 4U07A 3KAEA 4U0UA 2PQNA 5AYWD 4EQFA 3ZHEA 4I17A 5JJ7A 4GZ3A 5CHEE 3CK9A 2HR2A 3LKUA 4G2VA 2KCKA 4HOSA 4I9EA 5G05C 2WQHA 5KJMA 5FJYA 5A6CA 4CGVA 4J0UA 2KC7A 4J8FA 4Y6WA 2LSVA 2FI7A 2XGOA 3CVQA 3LY8A 4GA1A 4H7YA 3SZ7A 4F3VA 3TGOA 2UY1B 4N2SA 3RO2A 2Y4UA 2YQ8A 3EDTB 2XPIA 1ZU2A 3N71A 3PE4A 3S7FA 4ABNA 4AIFA 5BNWA 4J8DA 2PL2A 5A7DB 3TG5A 2Y4TA 5FZSA 4APOA 3MKRA 4GZ5A 5JJTA 4WNFA 2XCCA 4G1TA 1XNFA 3ZFWA 4BT9A 3ZHEB 3IEGA 2VGXB 1P5QA 1HXIA 1Y8MA 5D0QD 1YA0A 3R9AB 3OXGA 1KT0A 2Q7FA 1HZ4A 3PE3A 5M72A 3RO3A 5C1DA 3K9IA 2XCBA 4AY6A 3CV0A 2KCVA 4N39A 4BTBA 4W9RA 1FCHA 3TG4A 4NRHB 2IFUA 2OOEA 3LPZA 2UWJG 4N3AA 5DBKA 5CCLA 4JHRA 3ASHA 3QWWA 5KJNA 1QQEA 3S7JA 5KJKA 4N2QA 4N3CA 3QWVA 3ZN3A 5HQ8A 2WPVA 4UI9J 4AM9A 1KLXA 2C2LA 2VGXA 4GCNA 4YNDA 1NA0A 3KS2A 3MA5A 4HOUA 4YVOA 2DBAA 1NZNA 2YHCA 2LSUA 3LYAA 3MV3B 3OXLA 3ESKA 3OXFA 3QKYA 4G26A 4GA2A 3CVLA 3O48A 4I9CA 4XIFA 3RIBA 3FFLA 3CEQA 2NC9A 4H7XA 3ZPJA 3Q15A 2P58C 3ASFA 3CK7A 3LY9A 2FBNA 3JYSA 2R5SA 1ELRA 4UQYA 3ULQA 4RG6A 3VTYA 1WAO1 2QFCA 4WNDA 3E4BA 5ARFA 5BW8C 5FT9A 5EX3A 3TAXA 3UQ3A 5KJLA 3GZ1A 3S7BA 3CKCA 4XI9A 3Q49B 4HOTA 4KXKB 2XGSA 3FP3A 1B89A 3ASGA 5HI7A 4BTAA 4WNEA 1A17A 3RJVA 2ONDA 4GYWA 4O6FA 2I6HA 3MEKA 1TJCA 4U0SA 4YVQC 4GA0A 4GCOA 1WM5A 3MV2B 4G24A 3RU0A 5EX0A 2AVPA 4U0ZA 2XEVA 3ZGQA 3Q5MA 3S7DA 5LCWJ 4Y6CA 2IF4A 2HO1A 3AS4A 2VGYA 3KD7A 3CK8A 4I1AA 2KATA 2UY1A 3VTXA 2LNIA 5D0OD 2XGMA 3UUXA 2VSNA 4UI9C 4LEUA 4XI0A 4BT8A 3BEEA 4CGWA 1E96B 3WXXA 2JLBA 4GYYA 4JA9A 4JA7A 2FO7A 3GYZA 5G04J 5CCMA 4U04A 4UQXA 4J8EA 4G25A 5ARGA 4HOQA 4B94A 2MHKA 3SF4A 3LY7A 3AS5A 4NQ0A 4UI9K 3RKVA 2C0MA 1W3BA 1KT1A 2L6JA 3FWVA 5LCWC 1ZBPA 2VYIA 5DIZA 2KCLA 4G23A 4WNGA 5FTPA 1ELWA 3GW4A 2HYZA 5FZQA 2C0LA 2J9QA 4ME2A 4N5CA 5JJ6A 2PZIA 3URZA 1OUVA 4GZ6A 3U4TA 3CVNA 4UQZA 1PC2A 2E2EA 3CVPA 4IN3B 3ASDA 3NF1A 4AY5A 2GW1A 4GYOA 2BUGA 4JL0A 3U3WA 5G04C 3QOUA 5EKQD 3AS8A
chains in the Genus database with same CATH superfamily
5AIJA 3NQPA 3FH8A 4ILGA 1IHGA 1QZ2A 2R03A 2DYRE 3Q7FA 1EPUA 3HDXA 4GTOA 1PY1A 1TN7A 5ENRD 3NOGD 4O1PA 1HF8A 3CVWA 2FO1E 4HNAD 3RRMB 3CSFA 3OXGA 1N52A 1A5EA 1BI7B 5ENPD 4CRWA 3SGHA 5KJKA 3APCA 1O1TA 2J08A 3TWRA 1FVHA 2X6FA 3DWLG 3RSEG 1D8DA 4BETA 4XI9A 4M7CA 1TJCA 4U63A 3Q78A 3FDHA 2PM7A 4LUNU 4CDMA 2JLBA 1EYHA 3D9NA 2EIKE 1KT1A 3PZ1A 4K0RA 4EHMA 2DZNA 4LNUD 1E8YA 1XGWA 1N94A 3CHPA 1SVXA 4A63B 3QOUA 3UT4A 4L7TA 1JUQA 2FEZA 3QWPA 4A1SA 2LXMA 2OV8A 3SNXA 4L2YA 4XZ4A 2P9NG 2EIJE 4U0UA 4GZ3A 4JW1A 2Y0BG 4F3VA 1V54E 4CYMD 2WXPA 3RO2A 3S7FA 5KCMA 2IJGX 3ZRHA 3FTZA 3DSTA 4JZYA 1YA0A 4AY6A 5DBKA 1G3NB 1K3ZD 2P9LG 3ASHA 1D8EA 2WPVA 4AM9A 1KLXA 1UG3A 2VGXA 1NL4A 4WAFA 3L16A 3IBEA 3CK7A 1ELRA 2A4ZA 4WNDA 3RRNB 3I3NA 2XRZA 4RLYA 3FP3A 2ONDA 5E75A 3J5PA 4J8YA 3TWQA 5LCWJ 3AG3E 2I1JA 4I1AA 2DWZA 4C0EA 1OWOA 4FLBA 3CHSA 4GMRA 2KZTA 4OAVB 4F6RD 5H7PA 1KZOA 2R2LA 2KCLA 4UWLA 1OWNA 2WXRA 4F53A 3CVPA 1MX2A 3BQOA 3ASDA 3NF1A 3TXMA 1HU3A 3CKBA 4RG9A 3CHRA 4BERA 4O60A 3KAEA 3DSUA 1U2VG 5G05C 5CEAA 4TRQA 3ZEFA 4KVMA 5KNHD 2YQ8A 3PEVB 2IQCA 4GTVA 3ML9A 4U8HA 1HXIA 5D0QD 3R9AB 4HBDA 5JHBA 1JCSA 3TJPA 3T8MA 4N2QA 3NB2A 2WB2A 3QNKA 2XS8A 3ESKA 3OXFA 4JHKA 3O48A 4A3TA 3HVEB 1OCRE 3JYSA 2R5SA 5ENNA 3UINC 3CKCA 5D2MC 3FTUA 2XHEA 3ASGA 4ATZD 4K5AB 4TXRA 4GA0A 3CR3A 1HX8A 2GROB 4BX9A 5AENA 4UWGA 3EU5A 2WQ6A 2EINE 2IF4A 3T5VA 3UUXA 2V4HC 1E96B 4CCAA 4B8AA 1HG2A 4O1OA 2ETAA 4UI9K 2C0MA 4LG6A 2WXJA 4FA6A 3E33A 3URZA 4N5CA 4HI8A 1SZAA 4ANVA 1N4PA 4J6IA 1LTXA 5B3SE 1BPOA 1EF1C 1INZA 4IRUA 2FF4A 3PDNA 3FTYA 1NA3A 3UIOC 5AYWD 2RD0A 4ANWA 2XQ0A 4PS7A 2I2OA 2DYSE 3TGOA 4I1OB 3U9WA 3SI5A 3FTVA 3TWWA 4N5QA 3JQ1A 3APFA 1TR4A 4AV7A 3L08A 3PUKA 3EUVA 3ZW3A 3UKRG 5EIBE 1HS6A 5HQ8A 2JEKA 3MA5A 3LYAA 4G26A 1SQMA 2AWIA 4J7WA 3I5PA 2P58C 2L6BA 3ZN3A 1TNOA 3EJNA 5AARA 3VTYA 1WAO1 1E7VA 4OVVA 3ZYLA 4I1MA 2IONA 3J5QB 3Q7AA 2I6HA 3L22A 3LDZA 4G24A 5E76A 2XGMA 4UI9C 4M3OA 4U8YD 2F8XK 4JA7A 3KSQA 1O1SA 3D9OA 3ESLA 5AQBA 3SF4A 2WM9A 4GTMA 3FEYA 4UQZA 1LF8A 2ZGGA 3B95A 3SFYA 1OCCE 2ZU6B 5G04C 3AS8A 4KBQA 4DRXE 1IYGA 4TXQA 3ZIMA 4XKCA 4YDWA 1TN6A 3I4GA 3UTMA 3LKUA 4J8FA 4Y6WA 3ZUVB 1MHQA 2X6KA 4ABNA 5A7DB 5KBAA 4MBGA 3D9LA 4WNFA 4BT9A 1X81A 3E30A 4GTQA 2IFUA 5CCLA 2P9UG 3IV0A 2GRQB 3ENEA 4YNDA 3ASOE 3FH5A 3DXKG 4AVXA 4YDEA 3TAXA 5FT9A 3C5RA 3ONLA 1IHBA 3S7BA 1MZCA 2GRLA 2J4DA 2GRRB 3HIZA 4O6FA 2RFMA 2XZDG 3Q79A 3UI2A 3RU0A 4U0ZA 1AWCB 2NXPA 4DI3A 1MX6A 2PM6A 2ZISA 5BXOA 5FQ6A 4MKTA 3SO8A 2FO7A 2VGEA 2MYOA 5FTPA 5AJLA 1N4SA 2GRMA 3G2WA 4GZ6A 3CHQA 1PC2A 5CBNA 4GYOA 1UW4B 2BUGA 3CHOA 3CHMA 2PQRA 5A23A 5G05J 2WXNA 4Q94A 4LSZE 2BKKB 4HRLA 4RQIA 2KCKA 3ZXSA 5FJYA 3KEZA 5T4YA 5A6CA 4I43A 3ML8A 2NYJA 1V55E 3SZ7A 4H7YA 4CT0A 3JXJA 2GGFA 3ZYMA 2I1KA 2XRYA 1OCOE 1FT1A 4APOA 4FLHA 1JCQA 3AG4E 3PUJA 1HZ4A 2X38A 3LS8A 1FCHA 3L17A 3V79K 4YVOA 2DBAA 5CBOA 4I9CA 3RIBA 2J4BA 2NC9A 2JABA 2AW6A 5EYLA 3GZ1A 4GTSA 4EBAG 3FUEA 4K03A 4JC8A 4R7LA 4ILHB 2DCPA 4GCOA 5C2YA 3KSLA 4Z68A 3I4RB 1HG5A 5FIOA 1GW6A 3FU3A 4DX6D 2LNIA 1U3DA 3R9MA 2MRIA 2HM8A 4UQXA 3G2TA 4HOQA 4OAUC 3ZNGA 1SW6A 3UXGA 2I9CA 4B0ZA 2VSOE 4C9BB 2HYZA 4G11A 1UJJA 4EBAA 2WVIA 2V0PA 2LUHA 4WWOA 3EHNA 4U8VD 5J90A 4N3BA 2A5EA 1OXJA 2X6IA 3CK9A 4I6JA 3FUHA 3L9TA 4Q96A 4J0UA 2KC7A 4MS6A 4B89A 1JWGA 1JWFA 4N2SA 4A1GA 3PE4A 4AIFA 3DEOA 2L0IA 4FC8A 1MYOA 2LAHA 2X6JA 3ZHEB 3IEGA 1UOHA 4Q69A 3PE3A 3ZYQA 3RO3A 4DX5D 3C3QA 5AQ7A 4WWPA 2CFUA 5FQ7A 2H6FA 2QZAA 3U66A 3TL5A 4DX2A 2C2LA 3KS2A 2ZXWE 3D3MA 4PDXA 3ULQA 4DPRA 4HOTA 1B89A 1FT2A 2BEDA 1N0QA 3CQGB 2B6CA 1ZB1A 3ZGQA 3E37A 3DXMG 3PVLA 3KD7A 3CK8A 1JPLA 2UY1A 4I6EA 4EZKA 1N11A 1TNZA 1BI8B 4U04A 4NQ0A 2QYUA 3V2XA 2RKKA 5LP0A 5JJ6A 4ME2A 2PZIA 1OUVA 3ULEG 1QBQA 2IO2C 5CRVA 4HI9A 5B1BE 3IKOB 1WY6A 3Q9UC 3UPVA 3CQCB 3EHMA 3ZKJA 3QJZA 5D66A 3PREA 1UN9A 3AAAC 5JA4D 4A3VA 3CVXA 4P29A 3S2AA 2AXUA 3TG5A 2OVFA 5FZSA 1E8WA 3MKRA 3B7UX 3ZFWA 2M63A 5JMND 5IY5E 1H6OA 1H19A 3UM2A 1S63A 2XCBA 4JXTA 2L0TB 4GU5A 1IXVA 3FU0A 4UI9J 2X6HA 3HRAA 5LOZA 4KZCA 5AQ9A 4B93B 2LAIA 5EILA 3IHVA 1KZPA 5HKPA 1TYQG 4DJAA 5EIDA 2P9PG 3L6AA 2MOWA 2IU1A 5B1AE 4DX1A 5BPPA 4NACA 1YCSB 3D9PA 5ITZF 4TV3A 4ILIA 5BT1A 4JPSA 4TUUA 4CT4A 5ENQD 1PAQA 3MKQA 4FHJA 5ANRA 3T5XA 2X3MA 4HXIA 3ABME 4BX8A 1KPSB 1N0RA 5FZQA 3NOCD 3CVNA 3E34A 2E2EA 2F0YA 5ENOD 2IOLA 3AG2E 2GRPB 3C3OA 1DC2A 3DRAA 3EIQC 3AJIA 4NURA 5BW8C 1BU9A 4BWRA 3CVYA 4HORA 3HXBA 4OYSA 4FJZA 4GPKA 2P9SG 5CHEE 2HR2A 2L9BA 3FUKA 1TN8A 2R17C 3FUFA 3QARA 4AXHA 3QC1A 2CHZA 1OT8A 3FTSA 3UMVA 2YNQA 3TXNA 2WXMA 1Y8MA 4XE0A 2WXIA 5CECB 3TG4A 2CFZA 1DCQA 3V30A 3FU6A 4G8LA 3OXLA 4GZDA 3T8KA 3UM1A 4BY6A 4U96D 3L54A 3UQ3A 5EX3A 4K5BA 3FULA 3R7RA 3Q9NC 4KVOA 4GTPA 4UUCA 3RJVA 1QNFA 4U0SA 3S7DA 2V5QC 3AS4A 4ZFHA 2ETCA 1O1RA 4JA9A 5G04J 2WXOA 3AS5A 1WDYA 1S70B 2ETBA 3B13A 5FQ8A 4CEMA 1HE8A 3OAWA 2C0LA 3W9GA 3FUIA 1E8ZA 3IHYA 1LD7A 1Q2ZA 3DSXA 3SQVA 3Q4AB 4G8KA 4CDRA 3NAWA 3RRUA 2XEHA 2WQHA 4HFGA 1Z3XA 2XGOA 2FI7A 3ABLE 3N71A 3G2VA 4F1SA 1E8XA 5BNWA 2PNNA 5CMYA 3APDA 1OCZE 3SFZA 3Q73A 2CG2A 1DNPA 2UWJG 3U64A 5ANLA 4N3CA 3QWVA 1NA0A 3VTXA 4DLOA 3D9HA 4BTAA 4UWHA 2AXZA 2XEEA 3FTXA 4L2LA 4LRZA 3Q49B 4FJYA 3O4ZA 4DX7D 1H0AA 1N4QA 2Y3AA 4CGWA 1EDUA 4ZHBA 3ONKA 2WXKA 5ARGA 2LO6A 3G2SA 3UIPC 1N9AA 2L6JA 4AOFA 3JCKC 3ZU7B 1ELWA 3IXEA 4URKA 3PZ3A 2XPYA 3U4TA 3E32A 3QB2A 4JL0A 5EKQD 3UM0A 4KYOB 3ZYKA 3GZ2A 2ILRA 4DUIA 1OY3D 4L23A 4HLLA 2OVBA 5KJNA 2XPIA 1ZU2A 1TNUA 2WXQA 1O5MA 1Y6IA 3PZDA 3HHMA 1H6KA 1KT0A 4UWKA 2EQXA 4EZLA 3LPZA 3B7SA 3DPYA 4C48B 4CDNA 4BESA 3AU5A 3ABKE 4U7EB 2YHCA 4GA2A 4JHJA 3FFLA 3CEQA 5FQ4A 1SZ9A 4FADA 3QAQA 2CG3A 4KZ0A 4B8CB 4CZ2D 1IQRA 3ISMC 1FPPA 3MZLB 2IOSA 2VTBB 4WNEA 1Z3YA 3Q5MA 4Y6CA 3RAUA 4I6GA 5KJMA 3UT7A 4LEUA 4XI0A 3BEEA 2H6GA 3D9JA 2IY0C 3MYVA 4QQIA 4TXPA 2F8YA 3FWVA 5LCWC 3EHQA 4WNGA 4LNGA 4JEHA 4XX5A 4GTRA 3JXIA 4F1PA 4GAAA 2VJ8A 1YMPA 2FULA 4PH4B 3HYMB 5CERB 3X2QE 2VSYA 4WUYA 5FZRA 3Q47B 3JQ0A 4FU3A 2PQNA 3ZHEA 1X5BA 4CGVA 3CVQA 2AXVA 3EDTB 1SA4A 3TWUA 3AU4A 3PEUB 3PZ2A 2WMOA 2B0OE 3C3RA 1TJFA 3PH0C 3MGBA 2KBXA 3VLEA 2Q7FA 3L13A 4BEPA 5BV1A 4BTBA 4E85A 1UN8A 4JVSA 3UKUG 4N3AA 2XZTG 2EIME 4HOUA 5AQAA 3CVLA 3EHRA 1NI1A 4GTTA 1K1BA 4EZJA 2QFCA 4EPZA 4IYPA 1U3CA 4NIKA 1RZ4A 4YVQC 1BD8A 3B7RL 2P9IG 2AVPA 2XEVA 4EECA 2IEJA 1JCRA 4GMJA 4JB8P 3MX3A 1MX4A 2AJAA 3TWTA 1D9SA 4J8EA 1HFAA 5T8IA 1IKND 4ANUA 3FUDA 1NP7A 3JUEA 3UX4A 1RW2A 3FY4A 5DIZA 4G23A 1N4RA 3B7TA 2J9QA 2BKGA 3T9KA 4GB9A 1L5JA 1MJ0A 4I2ZA 1MQSA 2LXLA 4I2WA 3HXFA 1Z6TA 3CVVA 3DPDA 4V3IA 2IO3C 5EX0A 4U07A 3LVRE 4MLPA 3BUAA 5FINA 4GA1A 4ANXA 1S64A 3BU8A 2HE0A 5AJDA 2Y69E 3AG1E 3LJNA 2PL2A 3EU9A 5LX8A 3QK0A 5EDSA 4HLEA 2XCCA 3W9FA 3SBSA 2WXLA 4HRMB 3K9IA 5EN5D 4BSXA 2J09A 4N39A 4GZCA 4W9RA 5BUZA 2OOEA 4AJWA 3LXUX 1QQEA 4GMLA 5CRUA 2V4LA 4WWNA 3MV3B 4FULA 3DEPA 2H6HA 3TWSA 3PNTB 2ZGDA 3Q15A 5EYPF 3ASFA 3LY9A 4X8QA 1E90A 3CSTA 1WG0A 3C72A 3FTWA 4AEZC 1N54A 3PS6A 5KNGA 4C0MA 3BG1B 1WM5A 1Z5SC 3PNLB 2HO1A 5AAOA 2VSNA 3OTNA 2CHWA 3NZUA 3EIJA 4HB5A 1YYHA 4OVUA 4B94A 3NZSA 5CEDB 2BTDA 1W3BA 1ZBPA 2ZIRA 4LNBA 3SY2A 5ENTD 2V8SE 4F7AA 3VLFA 4HVBA 2H6IA 2KZTB 4U95D 3F6QA 3TWVA 3Q75A 3MJWA 4JD2G 2XS1A 2VQ2A 2V5FA 1UJKA 5HRYA 2KXPC 1N95A 3WG7E 3CVUA 3D9KA 2RFAA 1H2VC 1S0PA 2VSXE 2Y4TA 4DLQA 1OWPA 1K1AA 1XNFA 3V31A 3ZVVA 2F37A 5M72A 2KCVA 1VDYA 4NRHB 3DSWA 4LERA 3FHEA 4HS2A 3QWWA 2QYJA 3SHFA 4UWFA 4PUCA 1E7UA 3B7BA 1OWLA 2LSUA 3QKYA 4XIFA 3HG0D 2DIWA 4H7XA 2FBNA 3SD5A 3KEAA 2P2CP 5ARFA 3P2BA 3HXDA 4KXKB 2XGSA 4ACLA 1A17A 3JUIA 4GYWA 3P1UA 3MEKA 2OEVA 3LJ3A 3PZ4A 1AP7A 1TEZA 1DVPA 4PS8A 3WXXA 2WQ7A 2GRNB 2WXGA 2VTBA 3GYZA 1HO8A 5CCMA 4BFRA 4DI4A 1DCEA 5HS0A 3FH7A 3LEWA 2A5UA 3CGHA 4GPMA 2YHEA 3V2OA 4AP2A 2QC9A 4ATGA 2GW1A 3BG0B 2R59A 4DK5A 1ELKA 1HH8A 3ZXPA 1QYMA 3LVQE 3UM3A 3VLDA 2J8SD 4IULA 3MKQB 4G2VA 4QFVA 4LCTA 4KMOA 3C98A 2WXHA 3LY8A 1LD8A 3FEXA 4J8DA 3ULYA 1BLXB 2OCCE 4GZ5A 5JJTA 4RSYA 2WMNA 2VGXB 1NFIE 3FUJA 2RG8A 3PRZA 2CHXA 3S7JA 1H2TC 4J8SA 5T3RA 4GCNA 4RVBA 4L9PA 3FU5A 2J07A 4PS3A 5G55A 2BF0X 3CIAA 4D10C 5HI7A 2XPZA 3HXEA 5CMWA 3MV2B 4JEUA 2KATA 4BT8A 1TNYA 4GYYA 3GZSA 3NBNB 5BXUA 2R02A 2WXFA 2MHKA 3RKVA 2P9KG 4E6HA 2EILE 3ZPJA 3GW4A 5KJLA 4YDYA 3SBTB 5FWQA 2J49A 4IN3B 4AY5A 3R7QA 3U3WA 4TUMA 4BSZB 4XEIG 5KWDA 3QDNA 4MRUA 2QY7A 3LCAA 4K5CA 1SA5A 4EQFA 4I17A 5JJ7A 4HOSA 4I9EA 2LSVA 2UY1B 4KT6B 2Y4UA 5AN8A 5ENSD 2DZOA 3HXCA 4FHKA 4G1TA 2YINA 5LFAA 2E0IA 1P5QA 2KM4A 1FVFA 1H2UA 3HVEA 5C1DA 3UT8A 3CV0A 4FP7A 4JHRA 3RK6A 1IQUA 3SFXA 4L1BA 5J08A 5JHAA 1NZNA 3D9IA 1TNBA 2OEWA 2Y1LE 2NSZA 3FUNA 3FUMA 4UQYA 4RG6A 3E4BA 4XKBA 3G2UA 3DBSA 4HQDA 4APFA 3D9MA 2DVWA 1K8KG 2VGYA 3L82A 5D0OD 4A55A 1OWMA 2XENA 3CLJA 5G2NA 4G25A 3DSVA 1H6PA 3LY7A 4YDOA 4HRNA 3DSSA 3MCXA 2VYIA 3ASNE 3TWXA 5BV0A 2R05A 4ACKA
chains in the Genus database with same CATH topology
2IOLA 4KBQA 1L5JA 5AIJA 1IYGA 3NQPA 4I2ZA 1MQSA 3ZIMA 4I2WA 3FH8A 4ILGA 1IHGA 1QZ2A 3EIQC 4NURA 1Z6TA 3CVVA 3DPDA 4V3IA 4XKCA 5EX0A 5BW8C 4BWRA 3CVYA 4HORA 4OYSA 1EPUA 4FJZA 4GPKA 4U07A 3HDXA 3LVRE 3I4GA 5CHEE 4MLPA 3LKUA 2HR2A 1PY1A 2L9BA 3FUKA 4J8FA 4Y6WA 4GA1A 4ANXA 2R17C 3FUFA 1MHQA 3QARA 1HF8A 5AJDA 4AXHA 2X6KA 3CVWA 4ABNA 3QC1A 2PL2A 5A7DB 5LX8A 3QK0A 2CHZA 3RRMB 3FTSA 3UMVA 5EDSA 2YNQA 3D9LA 2XCCA 3CSFA 4WNFA 2WXMA 3TXNA 4BT9A 4HLEA 3SBSA 2WXLA 1Y8MA 3OXGA 4XE0A 3K9IA 4BSXA 1N52A 2J09A 2WXIA 4N39A 4GZCA 4W9RA 3TG4A 4CRWA 2IFUA 2OOEA 5BUZA 5CCLA 2CFZA 4AJWA 3SGHA 3LXUX 5KJKA 1QQEA 4GMLA 3IV0A 3ENEA 2V4LA 3APCA 3FU6A 4YNDA 4WWNA 2J08A 1FVHA 2X6FA 3FH5A 3OXLA 3MV3B 4GZDA 4AVXA 4FULA 3PNTB 3Q15A 3ASFA 3LY9A 4BY6A 1E90A 3CSTA 3L54A 3TAXA 3UQ3A 5FT9A 5EX3A 3ONLA 3S7BA 3FTWA 3FULA 4XI9A 4AEZC 1N54A 3PS6A 2GRLA 2J4DA 3R7RA 4KVOA 4C0MA 3HIZA 3RJVA 4O6FA 1QNFA 1TJCA 3BG1B 4U0SA 1WM5A 4U63A 3PNLB 3RU0A 4U0ZA 2NXPA 3S7DA 3FDHA 4DI3A 2HO1A 3AS4A 2PM6A 2PM7A 4LUNU 5FQ6A 2VSNA 4MKTA 3OTNA 4CDMA 2JLBA 4JA9A 2CHWA 3NZUA 2FO7A 3EIJA 5G04J 1EYHA 2WXOA 4OVUA 4B94A 3NZSA 3D9NA 3AS5A 2BTDA 1W3BA 1KT1A 3B13A 1ZBPA 5FQ8A 4K0RA 5FTPA 5AJLA 1E8YA 4CEMA 1HE8A 1XGWA 2GRMA 2C0LA 3OAWA 3G2WA 3FUIA 4GZ6A 3CHQA 2V8SE 1E8ZA 1PC2A 4F7AA 3CHPA 4GYOA 1UW4B 2BUGA 3QOUA 3VLFA 4HVBA 3UT4A 3CHOA 2KZTB 3CHMA 4L7TA 1JUQA 3IHYA 2FEZA 3QWPA 4A1SA 2PQRA 3MJWA 5A23A 2OV8A 3SNXA 3Q4AB 2VQ2A 2V5FA 4L2YA 4XZ4A 5G05J 2WXNA 4Q94A 1UJKA 4CDRA 3CVUA 4U0UA 4GZ3A 3RRUA 2KCKA 3ZXSA 2WQHA 4JW1A 5FJYA 3KEZA 4HFGA 5T4YA 1Z3XA 5A6CA 4I43A 3ML8A 3D9KA 2XGOA 2FI7A 3SZ7A 1H2VC 4H7YA 4F3VA 2WXPA 1S0PA 3RO2A 3S7FA 2GGFA 4CT0A 3N71A 3ZYMA 3G2VA 4F1SA 1E8XA 5BNWA 2I1KA 2VSXE 2XRYA 2Y4TA 5CMYA 4APOA 5KCMA 3APDA 4DLQA 4FLHA 1OWPA 2IJGX 1XNFA 3ZRHA 3FTZA 3PUJA 3ZVVA 3SFZA 4JZYA 1YA0A 1HZ4A 5M72A 2X38A 4AY6A 3LS8A 2CG2A 1DNPA 2KCVA 1VDYA 1FCHA 3L17A 4NRHB 5DBKA 2UWJG 4LERA 3FHEA 3U64A 4HS2A 5ANLA 3ASHA 3QWWA 3SHFA 4N3CA 3QWVA 4UWFA 2WPVA 4PUCA 4AM9A 1KLXA 1UG3A 2VGXA 1E7UA 1NA0A 1OWLA 4YVOA 3VTXA 2DBAA 2LSUA 3QKYA 4DLOA 4I9CA 4WAFA 4XIFA 3RIBA 2J4BA 3L16A 2DIWA 3IBEA 2NC9A 4H7XA 4BTAA 3CK7A 4UWHA 2FBNA 3SD5A 1ELRA 2AW6A 2A4ZA 2AXZA 4WNDA 3P2BA 5ARFA 3FTXA 3RRNB 4L2LA 3GZ1A 4EBAG 3FUEA 4K03A 3I3NA 3Q49B 4LRZA 2XRZA 4JC8A 2XGSA 3FP3A 4FJYA 4KXKB 4R7LA 4ACLA 1A17A 3JUIA 2ONDA 3O4ZA 4GYWA 3P1UA 4ILHB 3MEKA 5E75A 2DCPA 1H0AA 3LJ3A 4GCOA 5C2YA 3I4RB 1HG5A 5LCWJ 1GW6A 2I1JA 2Y3AA 1TEZA 4I1AA 4CGWA 1DVPA 1EDUA 2LNIA 3FU3A 4C0EA 1OWOA 4FLBA 3CHSA 4PS8A 3WXXA 2WQ7A 2VTBA 2WXGA 1U3DA 3GYZA 2MRIA 1HO8A 5CCMA 2HM8A 2KZTA 3ONKA 3G2TA 2WXKA 4UQXA 2LO6A 4HOQA 5ARGA 4BFRA 3G2SA 4DI4A 3FH7A 2L6JA 3LEWA 2I9CA 2KCLA 4B0ZA 4AOFA 3JCKC 2A5UA 1ELWA 3CGHA 2VSOE 4C9BB 2HYZA 4URKA 4UWLA 2YHEA 4G11A 2XPYA 1UJJA 3U4TA 4AP2A 1OWNA 2WXRA 4EBAA 4F53A 3CVPA 4ATGA 2WVIA 3ASDA 3NF1A 2GW1A 3QB2A 4JL0A 2V0PA 3BG0B 5EKQD 4KYOB 4WWOA 2R59A 3EHNA 3TXMA 3ZYKA 4DK5A 3GZ2A 2ILRA 1HU3A 1ELKA 1HH8A 4N3BA 5J90A 3CKBA 4RG9A 3CHRA 3LVQE 3VLDA 3KAEA 4L23A 4IULA 2X6IA 3CK9A 4I6JA 3MKQB 4G2VA 3FUHA 4LCTA 4QFVA 5G05C 4KMOA 3C98A 4Q96A 4J0UA 2KC7A 4MS6A 2WXHA 4TRQA 4B89A 3ZEFA 3LY8A 4KVMA 1JWGA 1JWFA 4N2SA 2OVBA 2YQ8A 3PE4A 2XPIA 1ZU2A 4A1GA 4AIFA 5KJNA 2WXQA 3FEXA 4J8DA 2L0IA 3PEVB 2IQCA 4FC8A 4GZ5A 2LAHA 5JJTA 1Y6IA 4RSYA 2X6JA 2WMNA 3IEGA 2VGXB 3HHMA 3ML9A 3PZDA 3ZHEB 5LP0A 3FUJA 1HXIA 4U8HA 1H6KA 5D0QD 2RG8A 3R9AB 4Q69A 1KT0A 5JHBA 3PE3A 3ZYQA 4UWKA 2EQXA 3RO3A 3TJPA 3PRZA 4EZLA 4WWPA 2CFUA 2CHXA 3LPZA 3T8MA 5FQ7A 3B7SA 4N2QA 2WB2A 3S7JA 3U66A 1H2TC 3QNKA 3TL5A 4J8SA 5T3RA 4CDNA 2C2LA 4GCNA 4RVBA 3AU5A 3KS2A 2YHCA 4GA2A 3ESKA 3FU5A 3OXFA 4JHKA 4JHJA 3O48A 4A3TA 3FFLA 3CEQA 3D3MA 1SZ9A 2J07A 3HVEB 4PS3A 5FQ4A 4FADA 3QAQA 5G55A 2BF0X 2CG3A 3CIAA 4KZ0A 4B8CB 4PDXA 3JYSA 2R5SA 3ULQA 4DPRA 5ENNA 1IQRA 4D10C 3MZLB 2IOSA 2VTBB 3CKCA 4HOTA 3FTUA 1B89A 2XHEA 3ASGA 5HI7A 4WNEA 2XPZA 5CMWA 3CQGB 4GA0A 3CR3A 3MV2B 1Z3YA 1HX8A 4BX9A 3ZGQA 3Q5MA 4UWGA 5AENA 4Y6CA 2WQ6A 2IF4A 3PVLA 3KD7A 3CK8A 4JEUA 1JPLA 2KATA 2UY1A 4I6EA 4I6GA 3UT7A 3UUXA 5KJMA 4BT8A 4LEUA 4XI0A 4EZKA 3BEEA 1E96B 4GYYA 3GZSA 3D9JA 4CCAA 3MYVA 4U04A 4B8AA 1HG2A 2WXFA 2MHKA 4UI9K 4NQ0A 3RKVA 2C0MA 3FWVA 5LCWC 4E6HA 2WXJA 4WNGA 4FA6A 3T5VA 3GW4A 4JEHA 4XX5A 4ME2A 5JJ6A 4N5CA 3URZA 3SBTB 2PZIA 3ZPJA 1OUVA 1SZAA 5FWQA 4ANVA 5KJLA 2J49A 4J6IA 4IN3B 4AY5A 3R7QA 3U3WA 1BPOA 1EF1C 4GAAA 2VJ8A 2FULA 4PH4B 1INZA 3IKOB 1WY6A 4IRUA 3HYMB 2FF4A 3PDNA 2VSYA 3FTYA 3QDNA 2QY7A 3LCAA 3JQ0A 3Q47B 4MRUA 4WUYA 5FZRA 3UPVA 1NA3A 4FU3A 5AYWD 3CQCB 3EHMA 2PQNA 4EQFA 3ZHEA 4I17A 2RD0A 5JJ7A 3QJZA 3PREA 4HOSA 1X5BA 4ANWA 4I9EA 2XQ0A 1UN9A 4PS7A 4CGVA 2I2OA 2LSVA 3CVQA 3TGOA 4A3VA 2UY1B 4I1OB 3U9WA 4KT6B 2Y4UA 2AXVA 3EDTB 3SI5A 3CVXA 3FTVA 4P29A 3S2AA 2AXUA 3TG5A 3AU4A 3PEUB 2OVFA 5FZSA 1E8WA 4FHKA 3MKRA 2WMOA 3B7UX 4G1TA 2YINA 3ZFWA 2E0IA 5LFAA 2M63A 1TJFA 3PH0C 3MGBA 1P5QA 1H19A 2KM4A 3JQ1A 3VLEA 2Q7FA 3APFA 1FVFA 1H2UA 3HVEA 2XCBA 5C1DA 3L13A 3UT8A 4JXTA 3CV0A 4AV7A 5BV1A 2L0TB 3L08A 3PUKA 4BTBA 4E85A 1UN8A 4GU5A 4FP7A 4JVSA 4N3AA 3FU0A 4JHRA 3RK6A 3ZW3A 1IQUA 1HS6A 5HQ8A 2JEKA 4UI9J 4L1BA 2X6HA 5J08A 3MA5A 5LOZA 4HOUA 5JHAA 1NZNA 3LYAA 4KZCA 4G26A 2LAIA 3D9IA 3CVLA 1SQMA 2AWIA 3I5PA 3IHVA 2P58C 3ZN3A 4EZJA 2NSZA 3FUNA 3FUMA 4UQYA 4DJAA 3EJNA 4RG6A 3VTYA 1WAO1 2QFCA 1E7VA 3E4BA 4OVVA 3ZYLA 4XKBA 4I1MA 3G2UA 2IONA 3DBSA 3L6AA 4EPZA 2MOWA 2IU1A 5BPPA 4IYPA 1U3CA 2I6HA 3L22A 3LDZA 4YVQC 4NACA 4APFA 3B7RL 3D9MA 4G24A 5E76A 2AVPA 3D9PA 2XEVA 4TV3A 4EECA 4ILIA 2VGYA 5BT1A 4GMJA 5D0OD 2XGMA 4UI9C 4M3OA 3MX3A 4JPSA 4A55A 4JA7A 4TUUA 1OWMA 4CT4A 1PAQA 3D9OA 3MKQA 3CLJA 4J8EA 1HFAA 4G25A 4FHJA 3ESLA 5G2NA 5T8IA 5ANRA 3T5XA 3SF4A 3LY7A 4ANUA 3FUDA 1NP7A 2X3MA 2WM9A 3MCXA 3UX4A 2VYIA 3FY4A 4HXIA 5DIZA 4G23A 4BX8A 5BV0A 3B7TA 5FZQA 2J9QA 3FEYA 3CVNA 4UQZA 1LF8A 2E2EA 2ZU6B 5G04C 4ACKA 4GB9A 3AS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYO B;  4KBQ A;  1IYG A;  4I2Z A;  5BT1 A;  3GZ2 A;  2FEZ A;  4I2W A;  3QWP A;  1IHG A;  1QZ2 A;  2PQR A;  3HYM B;  2FF4 A;  4A1S A;  1HH8 A;  4N3B A;  3PDN A;  2VSY A;  3QDN A;  4WUY A;  3CKB A;  3LCA A;  3Q47 B;  2VQ2 A;  2V5F A;  3Q4A B;  4RG9 A;  5FZR A;  5G05 J;  4BWR A;  3UPV A;  4HOR A;  1NA3 A;  4CDR A;  4GPK A;  4U07 A;  3KAE A;  4U0U A;  2PQN A;  5AYW D;  4EQF A;  3ZHE A;  4I17 A;  5JJ7 A;  4GZ3 A;  5CHE E;  3CK9 A;  2HR2 A;  3LKU A;  4G2V A;  2KCK A;  4HOS A;  4I9E A;  5G05 C;  2WQH A;  5KJM A;  5FJY A;  5A6C A;  4CGV A;  4J0U A;  2KC7 A;  4J8F A;  4Y6W A;  2LSV A;  2FI7 A;  2XGO A;  3CVQ A;  3LY8 A;  4GA1 A;  4H7Y A;  3SZ7 A;  4F3V A;  3TGO A;  2UY1 B;  4N2S A;  3RO2 A;  2Y4U A;  2YQ8 A;  3EDT B;  2XPI A;  1ZU2 A;  3N71 A;  3PE4 A;  3S7F A;  4ABN A;  4AIF A;  5BNW A;  4J8D A;  2PL2 A;  5A7D B;  3TG5 A;  2Y4T A;  5FZS A;  4APO A;  3MKR A;  4GZ5 A;  5JJT A;  4WNF A;  2XCC A;  4G1T A;  1XNF A;  3ZFW A;  4BT9 A;  3ZHE B;  3IEG A;  2VGX B;  1P5Q A;  1HXI A;  1Y8M A;  5D0Q D;  1YA0 A;  3R9A B;  3OXG A;  1KT0 A;  2Q7F A;  1HZ4 A;  3PE3 A;  5M72 A;  3RO3 A;  5C1D A;  3K9I A;  2XCB A;  4AY6 A;  3CV0 A;  2KCV A;  4N39 A;  4BTB A;  4W9R A;  1FCH A;  3TG4 A;  4NRH B;  2IFU A;  2OOE A;  3LPZ A;  2UWJ G;  4N3A A;  5DBK A;  5CCL A;  4JHR A;  3ASH A;  3QWW A;  5KJN A;  1QQE A;  3S7J A;  5KJK A;  4N2Q A;  4N3C A;  3QWV A;  3ZN3 A;  5HQ8 A;  2WPV A;  4UI9 J;  4AM9 A;  1KLX A;  2C2L A;  2VGX A;  4GCN A;  4YND A;  1NA0 A;  3KS2 A;  3MA5 A;  4HOU A;  4YVO A;  2DBA A;  1NZN A;  2YHC A;  2LSU A;  3LYA A;  3MV3 B;  3OXL A;  3ESK A;  3OXF A;  3QKY A;  4G26 A;  4GA2 A;  3CVL A;  3O48 A;  4I9C A;  4XIF A;  3RIB A;  3FFL A;  3CEQ A;  2NC9 A;  4H7X A;  3ZPJ A;  3Q15 A;  2P58 C;  3ASF A;  3CK7 A;  3LY9 A;  2FBN A;  3JYS A;  2R5S A;  1ELR A;  4UQY A;  3ULQ A;  4RG6 A;  3VTY A;  1WAO 1;  2QFC A;  4WND A;  3E4B A;  5ARF A;  5BW8 C;  5FT9 A;  5EX3 A;  3TAX A;  3UQ3 A;  5KJL A;  3GZ1 A;  3S7B A;  3CKC A;  4XI9 A;  3Q49 B;  4HOT A;  4KXK B;  2XGS A;  3FP3 A;  1B89 A;  3ASG A;  5HI7 A;  4BTA A;  4WNE A;  1A17 A;  3RJV A;  2OND A;  4GYW A;  4O6F A;  2I6H A;  3MEK A;  1TJC A;  4U0S A;  4YVQ C;  4GA0 A;  4GCO A;  1WM5 A;  3MV2 B;  4G24 A;  3RU0 A;  5EX0 A;  2AVP A;  4U0Z A;  2XEV A;  3ZGQ A;  3Q5M A;  3S7D A;  5LCW J;  4Y6C A;  2IF4 A;  2HO1 A;  3AS4 A;  2VGY A;  3KD7 A;  3CK8 A;  4I1A A;  2KAT A;  2UY1 A;  3VTX A;  2LNI A;  5D0O D;  2XGM A;  3UUX A;  2VSN A;  4UI9 C;  4LEU A;  4XI0 A;  4BT8 A;  3BEE A;  4CGW A;  1E96 B;  3WXX A;  2JLB A;  4GYY A;  4JA9 A;  4JA7 A;  2FO7 A;  3GYZ A;  5G04 J;  5CCM A;  4U04 A;  4UQX A;  4J8E A;  4G25 A;  5ARG A;  4HOQ A;  4B94 A;  2MHK A;  3SF4 A;  3LY7 A;  3AS5 A;  4NQ0 A;  4UI9 K;  3RKV A;  2C0M A;  1W3B A;  1KT1 A;  2L6J A;  3FWV A;  5LCW C;  1ZBP A;  2VYI A;  5DIZ A;  2KCL A;  4G23 A;  4WNG A;  5FTP A;  1ELW A;  3GW4 A;  2HYZ A;  5FZQ A;  2C0L A;  2J9Q A;  4ME2 A;  4N5C A;  5JJ6 A;  2PZI A;  3URZ A;  1OUV A;  4GZ6 A;  3U4T A;  3CVN A;  4UQZ A;  1PC2 A;  2E2E A;  3CVP A;  4IN3 B;  3ASD A;  3NF1 A;  4AY5 A;  2GW1 A;  4GYO A;  2BUG A;  4JL0 A;  3U3W A;  5G04 C;  3QOU A;  5EKQ D;  3AS8 A; 
#chains in the Genus database with same CATH topology
 5AIJ A;  3NQP A;  3FH8 A;  4ILG A;  1IHG A;  1QZ2 A;  2R03 A;  2DYR E;  3Q7F A;  1EPU A;  3HDX A;  4GTO A;  1PY1 A;  1TN7 A;  5ENR D;  3NOG D;  4O1P A;  1HF8 A;  3CVW A;  2FO1 E;  4HNA D;  3RRM B;  3CSF A;  3OXG A;  1N52 A;  1A5E A;  1BI7 B;  5ENP D;  4CRW A;  3SGH A;  5KJK A;  3APC A;  1O1T A;  2J08 A;  3TWR A;  1FVH A;  2X6F A;  3DWL G;  3RSE G;  1D8D A;  4BET A;  4XI9 A;  4M7C A;  1TJC A;  4U63 A;  3Q78 A;  3FDH A;  2PM7 A;  4LUN U;  4CDM A;  2JLB A;  1EYH A;  3D9N A;  2EIK E;  1KT1 A;  3PZ1 A;  4K0R A;  4EHM A;  2DZN A;  4LNU D;  1E8Y A;  1XGW A;  1N94 A;  3CHP A;  1SVX A;  4A63 B;  3QOU A;  3UT4 A;  4L7T A;  1JUQ A;  2FEZ A;  3QWP A;  4A1S A;  2LXM A;  2OV8 A;  3SNX A;  4L2Y A;  4XZ4 A;  2P9N G;  2EIJ E;  4U0U A;  4GZ3 A;  4JW1 A;  2Y0B G;  4F3V A;  1V54 E;  4CYM D;  2WXP A;  3RO2 A;  3S7F A;  5KCM A;  2IJG X;  3ZRH A;  3FTZ A;  3DST A;  4JZY A;  1YA0 A;  4AY6 A;  5DBK A;  1G3N B;  1K3Z D;  2P9L G;  3ASH A;  1D8E A;  2WPV A;  4AM9 A;  1KLX A;  1UG3 A;  2VGX A;  1NL4 A;  4WAF A;  3L16 A;  3IBE A;  3CK7 A;  1ELR A;  2A4Z A;  4WND A;  3RRN B;  3I3N A;  2XRZ A;  4RLY A;  3FP3 A;  2OND A;  5E75 A;  3J5P A;  4J8Y A;  3TWQ A;  5LCW J;  3AG3 E;  2I1J A;  4I1A A;  2DWZ A;  4C0E A;  1OWO A;  4FLB A;  3CHS A;  4GMR A;  2KZT A;  4OAV B;  4F6R D;  5H7P A;  1KZO A;  2R2L A;  2KCL A;  4UWL A;  1OWN A;  2WXR A;  4F53 A;  3CVP A;  1MX2 A;  3BQO A;  3ASD A;  3NF1 A;  3TXM A;  1HU3 A;  3CKB A;  4RG9 A;  3CHR A;  4BER A;  4O60 A;  3KAE A;  3DSU A;  1U2V G;  5G05 C;  5CEA A;  4TRQ A;  3ZEF A;  4KVM A;  5KNH D;  2YQ8 A;  3PEV B;  2IQC A;  4GTV A;  3ML9 A;  4U8H A;  1HXI A;  5D0Q D;  3R9A B;  4HBD A;  5JHB A;  1JCS A;  3TJP A;  3T8M A;  4N2Q A;  3NB2 A;  2WB2 A;  3QNK A;  2XS8 A;  3ESK A;  3OXF A;  4JHK A;  3O48 A;  4A3T A;  3HVE B;  1OCR E;  3JYS A;  2R5S A;  5ENN A;  3UIN C;  3CKC A;  5D2M C;  3FTU A;  2XHE A;  3ASG A;  4ATZ D;  4K5A B;  4TXR A;  4GA0 A;  3CR3 A;  1HX8 A;  2GRO B;  4BX9 A;  5AEN A;  4UWG A;  3EU5 A;  2WQ6 A;  2EIN E;  2IF4 A;  3T5V A;  3UUX A;  2V4H C;  1E96 B;  4CCA A;  4B8A A;  1HG2 A;  4O1O A;  2ETA A;  4UI9 K;  2C0M A;  4LG6 A;  2WXJ A;  4FA6 A;  3E33 A;  3URZ A;  4N5C A;  4HI8 A;  1SZA A;  4ANV A;  1N4P A;  4J6I A;  1LTX A;  5B3S E;  1BPO A;  1EF1 C;  1INZ A;  4IRU A;  2FF4 A;  3PDN A;  3FTY A;  1NA3 A;  3UIO C;  5AYW D;  2RD0 A;  4ANW A;  2XQ0 A;  4PS7 A;  2I2O A;  2DYS E;  3TGO A;  4I1O B;  3U9W A;  3SI5 A;  3FTV A;  3TWW A;  4N5Q A;  3JQ1 A;  3APF A;  1TR4 A;  4AV7 A;  3L08 A;  3PUK A;  3EUV A;  3ZW3 A;  3UKR G;  5EIB E;  1HS6 A;  5HQ8 A;  2JEK A;  3MA5 A;  3LYA A;  4G26 A;  1SQM A;  2AWI A;  4J7W A;  3I5P A;  2P58 C;  2L6B A;  3ZN3 A;  1TNO A;  3EJN A;  5AAR A;  3VTY A;  1WAO 1;  1E7V A;  4OVV A;  3ZYL A;  4I1M A;  2ION A;  3J5Q B;  3Q7A A;  2I6H A;  3L22 A;  3LDZ A;  4G24 A;  5E76 A;  2XGM A;  4UI9 C;  4M3O A;  4U8Y D;  2F8X K;  4JA7 A;  3KSQ A;  1O1S A;  3D9O A;  3ESL A;  5AQB A;  3SF4 A;  2WM9 A;  4GTM A;  3FEY A;  4UQZ A;  1LF8 A;  2ZGG A;  3B95 A;  3SFY A;  1OCC E;  2ZU6 B;  5G04 C;  3AS8 A;  4KBQ A;  4DRX E;  1IYG A;  4TXQ A;  3ZIM A;  4XKC A;  4YDW A;  1TN6 A;  3I4G A;  3UTM A;  3LKU A;  4J8F A;  4Y6W A;  3ZUV B;  1MHQ A;  2X6K A;  4ABN A;  5A7D B;  5KBA A;  4MBG A;  3D9L A;  4WNF A;  4BT9 A;  1X81 A;  3E30 A;  4GTQ A;  2IFU A;  5CCL A;  2P9U G;  3IV0 A;  2GRQ B;  3ENE A;  4YND A;  3ASO E;  3FH5 A;  3DXK G;  4AVX A;  4YDE A;  3TAX A;  5FT9 A;  3C5R A;  3ONL A;  1IHB A;  3S7B A;  1MZC A;  2GRL A;  2J4D A;  2GRR B;  3HIZ A;  4O6F A;  2RFM A;  2XZD G;  3Q79 A;  3UI2 A;  3RU0 A;  4U0Z A;  1AWC B;  2NXP A;  4DI3 A;  1MX6 A;  2PM6 A;  2ZIS A;  5BXO A;  5FQ6 A;  4MKT A;  3SO8 A;  2FO7 A;  2VGE A;  2MYO A;  5FTP A;  5AJL A;  1N4S A;  2GRM A;  3G2W A;  4GZ6 A;  3CHQ A;  1PC2 A;  5CBN A;  4GYO A;  1UW4 B;  2BUG A;  3CHO A;  3CHM A;  2PQR A;  5A23 A;  5G05 J;  2WXN A;  4Q94 A;  4LSZ E;  2BKK B;  4HRL A;  4RQI A;  2KCK A;  3ZXS A;  5FJY A;  3KEZ A;  5T4Y A;  5A6C A;  4I43 A;  3ML8 A;  2NYJ A;  1V55 E;  3SZ7 A;  4H7Y A;  4CT0 A;  3JXJ A;  2GGF A;  3ZYM A;  2I1K A;  2XRY A;  1OCO E;  1FT1 A;  4APO A;  4FLH A;  1JCQ A;  3AG4 E;  3PUJ A;  1HZ4 A;  2X38 A;  3LS8 A;  1FCH A;  3L17 A;  3V79 K;  4YVO A;  2DBA A;  5CBO A;  4I9C A;  3RIB A;  2J4B A;  2NC9 A;  2JAB A;  2AW6 A;  5EYL A;  3GZ1 A;  4GTS A;  4EBA G;  3FUE A;  4K03 A;  4JC8 A;  4R7L A;  4ILH B;  2DCP A;  4GCO A;  5C2Y A;  3KSL A;  4Z68 A;  3I4R B;  1HG5 A;  5FIO A;  1GW6 A;  3FU3 A;  4DX6 D;  2LNI A;  1U3D A;  3R9M A;  2MRI A;  2HM8 A;  4UQX A;  3G2T A;  4HOQ A;  4OAU C;  3ZNG A;  1SW6 A;  3UXG A;  2I9C A;  4B0Z A;  2VSO E;  4C9B B;  2HYZ A;  4G11 A;  1UJJ A;  4EBA A;  2WVI A;  2V0P A;  2LUH A;  4WWO A;  3EHN A;  4U8V D;  5J90 A;  4N3B A;  2A5E A;  1OXJ A;  2X6I A;  3CK9 A;  4I6J A;  3FUH A;  3L9T A;  4Q96 A;  4J0U A;  2KC7 A;  4MS6 A;  4B89 A;  1JWG A;  1JWF A;  4N2S A;  4A1G A;  3PE4 A;  4AIF A;  3DEO A;  2L0I A;  4FC8 A;  1MYO A;  2LAH A;  2X6J A;  3ZHE B;  3IEG A;  1UOH A;  4Q69 A;  3PE3 A;  3ZYQ A;  3RO3 A;  4DX5 D;  3C3Q A;  5AQ7 A;  4WWP A;  2CFU A;  5FQ7 A;  2H6F A;  2QZA A;  3U66 A;  3TL5 A;  4DX2 A;  2C2L A;  3KS2 A;  2ZXW E;  3D3M A;  4PDX A;  3ULQ A;  4DPR A;  4HOT A;  1B89 A;  1FT2 A;  2BED A;  1N0Q A;  3CQG B;  2B6C A;  1ZB1 A;  3ZGQ A;  3E37 A;  3DXM G;  3PVL A;  3KD7 A;  3CK8 A;  1JPL A;  2UY1 A;  4I6E A;  4EZK A;  1N11 A;  1TNZ A;  1BI8 B;  4U04 A;  4NQ0 A;  2QYU A;  3V2X A;  2RKK A;  5LP0 A;  5JJ6 A;  4ME2 A;  2PZI A;  1OUV A;  3ULE G;  1QBQ A;  2IO2 C;  5CRV A;  4HI9 A;  5B1B E;  3IKO B;  1WY6 A;  3Q9U C;  3UPV A;  3CQC B;  3EHM A;  3ZKJ A;  3QJZ A;  5D66 A;  3PRE A;  1UN9 A;  3AAA C;  5JA4 D;  4A3V A;  3CVX A;  4P29 A;  3S2A A;  2AXU A;  3TG5 A;  2OVF A;  5FZS A;  1E8W A;  3MKR A;  3B7U X;  3ZFW A;  2M63 A;  5JMN D;  5IY5 E;  1H6O A;  1H19 A;  3UM2 A;  1S63 A;  2XCB A;  4JXT A;  2L0T B;  4GU5 A;  1IXV A;  3FU0 A;  4UI9 J;  2X6H A;  3HRA A;  5LOZ A;  4KZC A;  5AQ9 A;  4B93 B;  2LAI A;  5EIL A;  3IHV A;  1KZP A;  5HKP A;  1TYQ G;  4DJA A;  5EID A;  2P9P G;  3L6A A;  2MOW A;  2IU1 A;  5B1A E;  4DX1 A;  5BPP A;  4NAC A;  1YCS B;  3D9P A;  5ITZ F;  4TV3 A;  4ILI A;  5BT1 A;  4JPS A;  4TUU A;  4CT4 A;  5ENQ D;  1PAQ A;  3MKQ A;  4FHJ A;  5ANR A;  3T5X A;  2X3M A;  4HXI A;  3ABM E;  4BX8 A;  1KPS B;  1N0R A;  5FZQ A;  3NOC D;  3CVN A;  3E34 A;  2E2E A;  2F0Y A;  5ENO D;  2IOL A;  3AG2 E;  2GRP B;  3C3O A;  1DC2 A;  3DRA A;  3EIQ C;  3AJI A;  4NUR A;  5BW8 C;  1BU9 A;  4BWR A;  3CVY A;  4HOR A;  3HXB A;  4OYS A;  4FJZ A;  4GPK A;  2P9S G;  5CHE E;  2HR2 A;  2L9B A;  3FUK A;  1TN8 A;  2R17 C;  3FUF A;  3QAR A;  4AXH A;  3QC1 A;  2CHZ A;  1OT8 A;  3FTS A;  3UMV A;  2YNQ A;  3TXN A;  2WXM A;  1Y8M A;  4XE0 A;  2WXI A;  5CEC B;  3TG4 A;  2CFZ A;  1DCQ A;  3V30 A;  3FU6 A;  4G8L A;  3OXL A;  4GZD A;  3T8K A;  3UM1 A;  4BY6 A;  4U96 D;  3L54 A;  3UQ3 A;  5EX3 A;  4K5B A;  3FUL A;  3R7R A;  3Q9N C;  4KVO A;  4GTP A;  4UUC A;  3RJV A;  1QNF A;  4U0S A;  3S7D A;  2V5Q C;  3AS4 A;  4ZFH A;  2ETC A;  1O1R A;  4JA9 A;  5G04 J;  2WXO A;  3AS5 A;  1WDY A;  1S70 B;  2ETB A;  3B13 A;  5FQ8 A;  4CEM A;  1HE8 A;  3OAW A;  2C0L A;  3W9G A;  3FUI A;  1E8Z A;  3IHY A;  1LD7 A;  1Q2Z A;  3DSX A;  3SQV A;  3Q4A B;  4G8K A;  4CDR A;  3NAW A;  3RRU A;  2XEH A;  2WQH A;  4HFG A;  1Z3X A;  2XGO A;  2FI7 A;  3ABL E;  3N71 A;  3G2V A;  4F1S A;  1E8X A;  5BNW A;  2PNN A;  5CMY A;  3APD A;  1OCZ E;  3SFZ A;  3Q73 A;  2CG2 A;  1DNP A;  2UWJ G;  3U64 A;  5ANL A;  4N3C A;  3QWV A;  1NA0 A;  3VTX A;  4DLO A;  3D9H A;  4BTA A;  4UWH A;  2AXZ A;  2XEE A;  3FTX A;  4L2L A;  4LRZ A;  3Q49 B;  4FJY A;  3O4Z A;  4DX7 D;  1H0A A;  1N4Q A;  2Y3A A;  4CGW A;  1EDU A;  4ZHB A;  3ONK A;  2WXK A;  5ARG A;  2LO6 A;  3G2S A;  3UIP C;  1N9A A;  2L6J A;  4AOF A;  3JCK C;  3ZU7 B;  1ELW A;  3IXE A;  4URK A;  3PZ3 A;  2XPY A;  3U4T A;  3E32 A;  3QB2 A;  4JL0 A;  5EKQ D;  3UM0 A;  4KYO B;  3ZYK A;  3GZ2 A;  2ILR A;  4DUI A;  1OY3 D;  4L23 A;  4HLL A;  2OVB A;  5KJN A;  2XPI A;  1ZU2 A;  1TNU A;  2WXQ A;  1O5M A;  1Y6I A;  3PZD A;  3HHM A;  1H6K A;  1KT0 A;  4UWK A;  2EQX A;  4EZL A;  3LPZ A;  3B7S A;  3DPY A;  4C48 B;  4CDN A;  4BES A;  3AU5 A;  3ABK E;  4U7E B;  2YHC A;  4GA2 A;  4JHJ A;  3FFL A;  3CEQ A;  5FQ4 A;  1SZ9 A;  4FAD A;  3QAQ A;  2CG3 A;  4KZ0 A;  4B8C B;  4CZ2 D;  1IQR A;  3ISM C;  1FPP A;  3MZL B;  2IOS A;  2VTB B;  4WNE A;  1Z3Y A;  3Q5M A;  4Y6C A;  3RAU A;  4I6G A;  5KJM A;  3UT7 A;  4LEU A;  4XI0 A;  3BEE A;  2H6G A;  3D9J A;  2IY0 C;  3MYV A;  4QQI A;  4TXP A;  2F8Y A;  3FWV A;  5LCW C;  3EHQ A;  4WNG A;  4LNG A;  4JEH A;  4XX5 A;  4GTR A;  3JXI A;  4F1P A;  4GAA A;  2VJ8 A;  1YMP A;  2FUL A;  4PH4 B;  3HYM B;  5CER B;  3X2Q E;  2VSY A;  4WUY A;  5FZR A;  3Q47 B;  3JQ0 A;  4FU3 A;  2PQN A;  3ZHE A;  1X5B A;  4CGV A;  3CVQ A;  2AXV A;  3EDT B;  1SA4 A;  3TWU A;  3AU4 A;  3PEU B;  3PZ2 A;  2WMO A;  2B0O E;  3C3R A;  1TJF A;  3PH0 C;  3MGB A;  2KBX A;  3VLE A;  2Q7F A;  3L13 A;  4BEP A;  5BV1 A;  4BTB A;  4E85 A;  1UN8 A;  4JVS A;  3UKU G;  4N3A A;  2XZT G;  2EIM E;  4HOU A;  5AQA A;  3CVL A;  3EHR A;  1NI1 A;  4GTT A;  1K1B A;  4EZJ A;  2QFC A;  4EPZ A;  4IYP A;  1U3C A;  4NIK A;  1RZ4 A;  4YVQ C;  1BD8 A;  3B7R L;  2P9I G;  2AVP A;  2XEV A;  4EEC A;  2IEJ A;  1JCR A;  4GMJ A;  4JB8 P;  3MX3 A;  1MX4 A;  2AJA A;  3TWT A;  1D9S A;  4J8E A;  1HFA A;  5T8I A;  1IKN D;  4ANU A;  3FUD A;  1NP7 A;  3JUE A;  3UX4 A;  1RW2 A;  3FY4 A;  5DIZ A;  4G23 A;  1N4R A;  3B7T A;  2J9Q A;  2BKG A;  3T9K A;  4GB9 A;  1L5J A;  1MJ0 A;  4I2Z A;  1MQS A;  2LXL A;  4I2W A;  3HXF A;  1Z6T A;  3CVV A;  3DPD A;  4V3I A;  2IO3 C;  5EX0 A;  4U07 A;  3LVR E;  4MLP A;  3BUA A;  5FIN A;  4GA1 A;  4ANX A;  1S64 A;  3BU8 A;  2HE0 A;  5AJD A;  2Y69 E;  3AG1 E;  3LJN A;  2PL2 A;  3EU9 A;  5LX8 A;  3QK0 A;  5EDS A;  4HLE A;  2XCC A;  3W9F A;  3SBS A;  2WXL A;  4HRM B;  3K9I A;  5EN5 D;  4BSX A;  2J09 A;  4N39 A;  4GZC A;  4W9R A;  5BUZ A;  2OOE A;  4AJW A;  3LXU X;  1QQE A;  4GML A;  5CRU A;  2V4L A;  4WWN A;  3MV3 B;  4FUL A;  3DEP A;  2H6H A;  3TWS A;  3PNT B;  2ZGD A;  3Q15 A;  5EYP F;  3ASF A;  3LY9 A;  4X8Q A;  1E90 A;  3CST A;  1WG0 A;  3C72 A;  3FTW A;  4AEZ C;  1N54 A;  3PS6 A;  5KNG A;  4C0M A;  3BG1 B;  1WM5 A;  1Z5S C;  3PNL B;  2HO1 A;  5AAO A;  2VSN A;  3OTN A;  2CHW A;  3NZU A;  3EIJ A;  4HB5 A;  1YYH A;  4OVU A;  4B94 A;  3NZS A;  5CED B;  2BTD A;  1W3B A;  1ZBP A;  2ZIR A;  4LNB A;  3SY2 A;  5ENT D;  2V8S E;  4F7A A;  3VLF A;  4HVB A;  2H6I A;  2KZT B;  4U95 D;  3F6Q A;  3TWV A;  3Q75 A;  3MJW A;  4JD2 G;  2XS1 A;  2VQ2 A;  2V5F A;  1UJK A;  5HRY A;  2KXP C;  1N95 A;  3WG7 E;  3CVU A;  3D9K A;  2RFA A;  1H2V C;  1S0P A;  2VSX E;  2Y4T A;  4DLQ A;  1OWP A;  1K1A A;  1XNF A;  3V31 A;  3ZVV A;  2F37 A;  5M72 A;  2KCV A;  1VDY A;  4NRH B;  3DSW A;  4LER A;  3FHE A;  4HS2 A;  3QWW A;  2QYJ A;  3SHF A;  4UWF A;  4PUC A;  1E7U A;  3B7B A;  1OWL A;  2LSU A;  3QKY A;  4XIF A;  3HG0 D;  2DIW A;  4H7X A;  2FBN A;  3SD5 A;  3KEA A;  2P2C P;  5ARF A;  3P2B A;  3HXD A;  4KXK B;  2XGS A;  4ACL A;  1A17 A;  3JUI A;  4GYW A;  3P1U A;  3MEK A;  2OEV A;  3LJ3 A;  3PZ4 A;  1AP7 A;  1TEZ A;  1DVP A;  4PS8 A;  3WXX A;  2WQ7 A;  2GRN B;  2WXG A;  2VTB A;  3GYZ A;  1HO8 A;  5CCM A;  4BFR A;  4DI4 A;  1DCE A;  5HS0 A;  3FH7 A;  3LEW A;  2A5U A;  3CGH A;  4GPM A;  2YHE A;  3V2O A;  4AP2 A;  2QC9 A;  4ATG A;  2GW1 A;  3BG0 B;  2R59 A;  4DK5 A;  1ELK A;  1HH8 A;  3ZXP A;  1QYM A;  3LVQ E;  3UM3 A;  3VLD A;  2J8S D;  4IUL A;  3MKQ B;  4G2V A;  4QFV A;  4LCT A;  4KMO A;  3C98 A;  2WXH A;  3LY8 A;  1LD8 A;  3FEX A;  4J8D A;  3ULY A;  1BLX B;  2OCC E;  4GZ5 A;  5JJT A;  4RSY A;  2WMN A;  2VGX B;  1NFI E;  3FUJ A;  2RG8 A;  3PRZ A;  2CHX A;  3S7J A;  1H2T C;  4J8S A;  5T3R A;  4GCN A;  4RVB A;  4L9P A;  3FU5 A;  2J07 A;  4PS3 A;  5G55 A;  2BF0 X;  3CIA A;  4D10 C;  5HI7 A;  2XPZ A;  3HXE A;  5CMW A;  3MV2 B;  4JEU A;  2KAT A;  4BT8 A;  1TNY A;  4GYY A;  3GZS A;  3NBN B;  5BXU A;  2R02 A;  2WXF A;  2MHK A;  3RKV A;  2P9K G;  4E6H A;  2EIL E;  3ZPJ A;  3GW4 A;  5KJL A;  4YDY A;  3SBT B;  5FWQ A;  2J49 A;  4IN3 B;  4AY5 A;  3R7Q A;  3U3W A;  4TUM A;  4BSZ B;  4XEI G;  5KWD A;  3QDN A;  4MRU A;  2QY7 A;  3LCA A;  4K5C A;  1SA5 A;  4EQF A;  4I17 A;  5JJ7 A;  4HOS A;  4I9E A;  2LSV A;  2UY1 B;  4KT6 B;  2Y4U A;  5AN8 A;  5ENS D;  2DZO A;  3HXC A;  4FHK A;  4G1T A;  2YIN A;  5LFA A;  2E0I A;  1P5Q A;  2KM4 A;  1FVF A;  1H2U A;  3HVE A;  5C1D A;  3UT8 A;  3CV0 A;  4FP7 A;  4JHR A;  3RK6 A;  1IQU A;  3SFX A;  4L1B A;  5J08 A;  5JHA A;  1NZN A;  3D9I A;  1TNB A;  2OEW A;  2Y1L E;  2NSZ A;  3FUN A;  3FUM A;  4UQY A;  4RG6 A;  3E4B A;  4XKB A;  3G2U A;  3DBS A;  4HQD A;  4APF A;  3D9M A;  2DVW A;  1K8K G;  2VGY A;  3L82 A;  5D0O D;  4A55 A;  1OWM A;  2XEN A;  3CLJ A;  5G2N A;  4G25 A;  3DSV A;  1H6P A;  3LY7 A;  4YDO A;  4HRN A;  3DSS A;  3MCX A;  2VYI A;  3ASN E;  3TWX A;  5BV0 A;  2R05 A;  4ACK A; 
#chains in the Genus database with same CATH homology
 2IOL A;  4KBQ A;  1L5J A;  5AIJ A;  1IYG A;  3NQP A;  4I2Z A;  1MQS A;  3ZIM A;  4I2W A;  3FH8 A;  4ILG A;  1IHG A;  1QZ2 A;  3EIQ C;  4NUR A;  1Z6T A;  3CVV A;  3DPD A;  4V3I A;  4XKC A;  5EX0 A;  5BW8 C;  4BWR A;  3CVY A;  4HOR A;  4OYS A;  1EPU A;  4FJZ A;  4GPK A;  4U07 A;  3HDX A;  3LVR E;  3I4G A;  5CHE E;  4MLP A;  3LKU A;  2HR2 A;  1PY1 A;  2L9B A;  3FUK A;  4J8F A;  4Y6W A;  4GA1 A;  4ANX A;  2R17 C;  3FUF A;  1MHQ A;  3QAR A;  1HF8 A;  5AJD A;  4AXH A;  2X6K A;  3CVW A;  4ABN A;  3QC1 A;  2PL2 A;  5A7D B;  5LX8 A;  3QK0 A;  2CHZ A;  3RRM B;  3FTS A;  3UMV A;  5EDS A;  2YNQ A;  3D9L A;  2XCC A;  3CSF A;  4WNF A;  2WXM A;  3TXN A;  4BT9 A;  4HLE A;  3SBS A;  2WXL A;  1Y8M A;  3OXG A;  4XE0 A;  3K9I A;  4BSX A;  1N52 A;  2J09 A;  2WXI A;  4N39 A;  4GZC A;  4W9R A;  3TG4 A;  4CRW A;  2IFU A;  2OOE A;  5BUZ A;  5CCL A;  2CFZ A;  4AJW A;  3SGH A;  3LXU X;  5KJK A;  1QQE A;  4GML A;  3IV0 A;  3ENE A;  2V4L A;  3APC A;  3FU6 A;  4YND A;  4WWN A;  2J08 A;  1FVH A;  2X6F A;  3FH5 A;  3OXL A;  3MV3 B;  4GZD A;  4AVX A;  4FUL A;  3PNT B;  3Q15 A;  3ASF A;  3LY9 A;  4BY6 A;  1E90 A;  3CST A;  3L54 A;  3TAX A;  3UQ3 A;  5FT9 A;  5EX3 A;  3ONL A;  3S7B A;  3FTW A;  3FUL A;  4XI9 A;  4AEZ C;  1N54 A;  3PS6 A;  2GRL A;  2J4D A;  3R7R A;  4KVO A;  4C0M A;  3HIZ A;  3RJV A;  4O6F A;  1QNF A;  1TJC A;  3BG1 B;  4U0S A;  1WM5 A;  4U63 A;  3PNL B;  3RU0 A;  4U0Z A;  2NXP A;  3S7D A;  3FDH A;  4DI3 A;  2HO1 A;  3AS4 A;  2PM6 A;  2PM7 A;  4LUN U;  5FQ6 A;  2VSN A;  4MKT A;  3OTN A;  4CDM A;  2JLB A;  4JA9 A;  2CHW A;  3NZU A;  2FO7 A;  3EIJ A;  5G04 J;  1EYH A;  2WXO A;  4OVU A;  4B94 A;  3NZS A;  3D9N A;  3AS5 A;  2BTD A;  1W3B A;  1KT1 A;  3B13 A;  1ZBP A;  5FQ8 A;  4K0R A;  5FTP A;  5AJL A;  1E8Y A;  4CEM A;  1HE8 A;  1XGW A;  2GRM A;  2C0L A;  3OAW A;  3G2W A;  3FUI A;  4GZ6 A;  3CHQ A;  2V8S E;  1E8Z A;  1PC2 A;  4F7A A;  3CHP A;  4GYO A;  1UW4 B;  2BUG A;  3QOU A;  3VLF A;  4HVB A;  3UT4 A;  3CHO A;  2KZT B;  3CHM A;  4L7T A;  1JUQ A;  3IHY A;  2FEZ A;  3QWP A;  4A1S A;  2PQR A;  3MJW A;  5A23 A;  2OV8 A;  3SNX A;  3Q4A B;  2VQ2 A;  2V5F A;  4L2Y A;  4XZ4 A;  5G05 J;  2WXN A;  4Q94 A;  1UJK A;  4CDR A;  3CVU A;  4U0U A;  4GZ3 A;  3RRU A;  2KCK A;  3ZXS A;  2WQH A;  4JW1 A;  5FJY A;  3KEZ A;  4HFG A;  5T4Y A;  1Z3X A;  5A6C A;  4I43 A;  3ML8 A;  3D9K A;  2XGO A;  2FI7 A;  3SZ7 A;  1H2V C;  4H7Y A;  4F3V A;  2WXP A;  1S0P A;  3RO2 A;  3S7F A;  2GGF A;  4CT0 A;  3N71 A;  3ZYM A;  3G2V A;  4F1S A;  1E8X A;  5BNW A;  2I1K A;  2VSX E;  2XRY A;  2Y4T A;  5CMY A;  4APO A;  5KCM A;  3APD A;  4DLQ A;  4FLH A;  1OWP A;  2IJG X;  1XNF A;  3ZRH A;  3FTZ A;  3PUJ A;  3ZVV A;  3SFZ A;  4JZY A;  1YA0 A;  1HZ4 A;  5M72 A;  2X38 A;  4AY6 A;  3LS8 A;  2CG2 A;  1DNP A;  2KCV A;  1VDY A;  1FCH A;  3L17 A;  4NRH B;  5DBK A;  2UWJ G;  4LER A;  3FHE A;  3U64 A;  4HS2 A;  5ANL A;  3ASH A;  3QWW A;  3SHF A;  4N3C A;  3QWV A;  4UWF A;  2WPV A;  4PUC A;  4AM9 A;  1KLX A;  1UG3 A;  2VGX A;  1E7U A;  1NA0 A;  1OWL A;  4YVO A;  3VTX A;  2DBA A;  2LSU A;  3QKY A;  4DLO A;  4I9C A;  4WAF A;  4XIF A;  3RIB A;  2J4B A;  3L16 A;  2DIW A;  3IBE A;  2NC9 A;  4H7X A;  4BTA A;  3CK7 A;  4UWH A;  2FBN A;  3SD5 A;  1ELR A;  2AW6 A;  2A4Z A;  2AXZ A;  4WND A;  3P2B A;  5ARF A;  3FTX A;  3RRN B;  4L2L A;  3GZ1 A;  4EBA G;  3FUE A;  4K03 A;  3I3N A;  3Q49 B;  4LRZ A;  2XRZ A;  4JC8 A;  2XGS A;  3FP3 A;  4FJY A;  4KXK B;  4R7L A;  4ACL A;  1A17 A;  3JUI A;  2OND A;  3O4Z A;  4GYW A;  3P1U A;  4ILH B;  3MEK A;  5E75 A;  2DCP A;  1H0A A;  3LJ3 A;  4GCO A;  5C2Y A;  3I4R B;  1HG5 A;  5LCW J;  1GW6 A;  2I1J A;  2Y3A A;  1TEZ A;  4I1A A;  4CGW A;  1DVP A;  1EDU A;  2LNI A;  3FU3 A;  4C0E A;  1OWO A;  4FLB A;  3CHS A;  4PS8 A;  3WXX A;  2WQ7 A;  2VTB A;  2WXG A;  1U3D A;  3GYZ A;  2MRI A;  1HO8 A;  5CCM A;  2HM8 A;  2KZT A;  3ONK A;  3G2T A;  2WXK A;  4UQX A;  2LO6 A;  4HOQ A;  5ARG A;  4BFR A;  3G2S A;  4DI4 A;  3FH7 A;  2L6J A;  3LEW A;  2I9C A;  2KCL A;  4B0Z A;  4AOF A;  3JCK C;  2A5U A;  1ELW A;  3CGH A;  2VSO E;  4C9B B;  2HYZ A;  4URK A;  4UWL A;  2YHE A;  4G11 A;  2XPY A;  1UJJ A;  3U4T A;  4AP2 A;  1OWN A;  2WXR A;  4EBA A;  4F53 A;  3CVP A;  4ATG A;  2WVI A;  3ASD A;  3NF1 A;  2GW1 A;  3QB2 A;  4JL0 A;  2V0P A;  3BG0 B;  5EKQ D;  4KYO B;  4WWO A;  2R59 A;  3EHN A;  3TXM A;  3ZYK A;  4DK5 A;  3GZ2 A;  2ILR A;  1HU3 A;  1ELK A;  1HH8 A;  4N3B A;  5J90 A;  3CKB A;  4RG9 A;  3CHR A;  3LVQ E;  3VLD A;  3KAE A;  4L23 A;  4IUL A;  2X6I A;  3CK9 A;  4I6J A;  3MKQ B;  4G2V A;  3FUH A;  4LCT A;  4QFV A;  5G05 C;  4KMO A;  3C98 A;  4Q96 A;  4J0U A;  2KC7 A;  4MS6 A;  2WXH A;  4TRQ A;  4B89 A;  3ZEF A;  3LY8 A;  4KVM A;  1JWG A;  1JWF A;  4N2S A;  2OVB A;  2YQ8 A;  3PE4 A;  2XPI A;  1ZU2 A;  4A1G A;  4AIF A;  5KJN A;  2WXQ A;  3FEX A;  4J8D A;  2L0I A;  3PEV B;  2IQC A;  4FC8 A;  4GZ5 A;  2LAH A;  5JJT A;  1Y6I A;  4RSY A;  2X6J A;  2WMN A;  3IEG A;  2VGX B;  3HHM A;  3ML9 A;  3PZD A;  3ZHE B;  5LP0 A;  3FUJ A;  1HXI A;  4U8H A;  1H6K A;  5D0Q D;  2RG8 A;  3R9A B;  4Q69 A;  1KT0 A;  5JHB A;  3PE3 A;  3ZYQ A;  4UWK A;  2EQX A;  3RO3 A;  3TJP A;  3PRZ A;  4EZL A;  4WWP A;  2CFU A;  2CHX A;  3LPZ A;  3T8M A;  5FQ7 A;  3B7S A;  4N2Q A;  2WB2 A;  3S7J A;  3U66 A;  1H2T C;  3QNK A;  3TL5 A;  4J8S A;  5T3R A;  4CDN A;  2C2L A;  4GCN A;  4RVB A;  3AU5 A;  3KS2 A;  2YHC A;  4GA2 A;  3ESK A;  3FU5 A;  3OXF A;  4JHK A;  4JHJ A;  3O48 A;  4A3T A;  3FFL A;  3CEQ A;  3D3M A;  1SZ9 A;  2J07 A;  3HVE B;  4PS3 A;  5FQ4 A;  4FAD A;  3QAQ A;  5G55 A;  2BF0 X;  2CG3 A;  3CIA A;  4KZ0 A;  4B8C B;  4PDX A;  3JYS A;  2R5S A;  3ULQ A;  4DPR A;  5ENN A;  1IQR A;  4D10 C;  3MZL B;  2IOS A;  2VTB B;  3CKC A;  4HOT A;  3FTU A;  1B89 A;  2XHE A;  3ASG A;  5HI7 A;  4WNE A;  2XPZ A;  5CMW A;  3CQG B;  4GA0 A;  3CR3 A;  3MV2 B;  1Z3Y A;  1HX8 A;  4BX9 A;  3ZGQ A;  3Q5M A;  4UWG A;  5AEN A;  4Y6C A;  2WQ6 A;  2IF4 A;  3PVL A;  3KD7 A;  3CK8 A;  4JEU A;  1JPL A;  2KAT A;  2UY1 A;  4I6E A;  4I6G A;  3UT7 A;  3UUX A;  5KJM A;  4BT8 A;  4LEU A;  4XI0 A;  4EZK A;  3BEE A;  1E96 B;  4GYY A;  3GZS A;  3D9J A;  4CCA A;  3MYV A;  4U04 A;  4B8A A;  1HG2 A;  2WXF A;  2MHK A;  4UI9 K;  4NQ0 A;  3RKV A;  2C0M A;  3FWV A;  5LCW C;  4E6H A;  2WXJ A;  4WNG A;  4FA6 A;  3T5V A;  3GW4 A;  4JEH A;  4XX5 A;  4ME2 A;  5JJ6 A;  4N5C A;  3URZ A;  3SBT B;  2PZI A;  3ZPJ A;  1OUV A;  1SZA A;  5FWQ A;  4ANV A;  5KJL A;  2J49 A;  4J6I A;  4IN3 B;  4AY5 A;  3R7Q A;  3U3W A;  1BPO A;  1EF1 C;  4GAA A;  2VJ8 A;  2FUL A;  4PH4 B;  1INZ A;  3IKO B;  1WY6 A;  4IRU A;  3HYM B;  2FF4 A;  3PDN A;  2VSY A;  3FTY A;  3QDN A;  2QY7 A;  3LCA A;  3JQ0 A;  3Q47 B;  4MRU A;  4WUY A;  5FZR A;  3UPV A;  1NA3 A;  4FU3 A;  5AYW D;  3CQC B;  3EHM A;  2PQN A;  4EQF A;  3ZHE A;  4I17 A;  2RD0 A;  5JJ7 A;  3QJZ A;  3PRE A;  4HOS A;  1X5B A;  4ANW A;  4I9E A;  2XQ0 A;  1UN9 A;  4PS7 A;  4CGV A;  2I2O A;  2LSV A;  3CVQ A;  3TGO A;  4A3V A;  2UY1 B;  4I1O B;  3U9W A;  4KT6 B;  2Y4U A;  2AXV A;  3EDT B;  3SI5 A;  3CVX A;  3FTV A;  4P29 A;  3S2A A;  2AXU A;  3TG5 A;  3AU4 A;  3PEU B;  2OVF A;  5FZS A;  1E8W A;  4FHK A;  3MKR A;  2WMO A;  3B7U X;  4G1T A;  2YIN A;  3ZFW A;  2E0I A;  5LFA A;  2M63 A;  1TJF A;  3PH0 C;  3MGB A;  1P5Q A;  1H19 A;  2KM4 A;  3JQ1 A;  3VLE A;  2Q7F A;  3APF A;  1FVF A;  1H2U A;  3HVE A;  2XCB A;  5C1D A;  3L13 A;  3UT8 A;  4JXT A;  3CV0 A;  4AV7 A;  5BV1 A;  2L0T B;  3L08 A;  3PUK A;  4BTB A;  4E85 A;  1UN8 A;  4GU5 A;  4FP7 A;  4JVS A;  4N3A A;  3FU0 A;  4JHR A;  3RK6 A;  3ZW3 A;  1IQU A;  1HS6 A;  5HQ8 A;  2JEK A;  4UI9 J;  4L1B A;  2X6H A;  5J08 A;  3MA5 A;  5LOZ A;  4HOU A;  5JHA A;  1NZN A;  3LYA A;  4KZC A;  4G26 A;  2LAI A;  3D9I A;  3CVL A;  1SQM A;  2AWI A;  3I5P A;  3IHV A;  2P58 C;  3ZN3 A;  4EZJ A;  2NSZ A;  3FUN A;  3FUM A;  4UQY A;  4DJA A;  3EJN A;  4RG6 A;  3VTY A;  1WAO 1;  2QFC A;  1E7V A;  3E4B A;  4OVV A;  3ZYL A;  4XKB A;  4I1M A;  3G2U A;  2ION A;  3DBS A;  3L6A A;  4EPZ A;  2MOW A;  2IU1 A;  5BPP A;  4IYP A;  1U3C A;  2I6H A;  3L22 A;  3LDZ A;  4YVQ C;  4NAC A;  4APF A;  3B7R L;  3D9M A;  4G24 A;  5E76 A;  2AVP A;  3D9P A;  2XEV A;  4TV3 A;  4EEC A;  4ILI A;  2VGY A;  5BT1 A;  4GMJ A;  5D0O D;  2XGM A;  4UI9 C;  4M3O A;  3MX3 A;  4JPS A;  4A55 A;  4JA7 A;  4TUU A;  1OWM A;  4CT4 A;  1PAQ A;  3D9O A;  3MKQ A;  3CLJ A;  4J8E A;  1HFA A;  4G25 A;  4FHJ A;  3ESL A;  5G2N A;  5T8I A;  5ANR A;  3T5X A;  3SF4 A;  3LY7 A;  4ANU A;  3FUD A;  1NP7 A;  2X3M A;  2WM9 A;  3MCX A;  3UX4 A;  2VYI A;  3FY4 A;  4HXI A;  5DIZ A;  4G23 A;  4BX8 A;  5BV0 A;  3B7T A;  5FZQ A;  2J9Q A;  3FEY A;  3CVN A;  4UQZ A;  1LF8 A;  2E2E A;  2ZU6 B;  5G04 C;  4ACK A;  4GB9 A;  3AS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...