3KD7A

Designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
102
structure length
102
Chain Sequence
NSAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTPR390
publication title Crystal structure of a designed tetratricopeptide repeat module in complex with its peptide ligand.
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
total genus 41
structure length 102
sequence length 102
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3kd7A00
2KC7A 3MV2B 3N71A 1HZ4A 3Q4AB 4AY5A 4YVOA 3FWVA 5JJ6A 2Q7FA 3ASFA 2VYIA 4GPKA 1ELRA 4UQZA 3SZ7A 2XCBA 4H7XA 5EX3A 3CVNA 3QOUA 1NA0A 2HO1A 2YQ8A 5BNWA 3GW4A 3S7JA 3UQ3A 2HYZA 3OXLA 4I1AA 3MEKA 2UY1A 3LCAA 1E96B 4KBQA 4XIFA 3QDNA 4UQXA 3Q5MA 4APOA 4CGWA 1PC2A 2IFUA 2C0MA 4YNDA 4GCNA 2DBAA 4UQYA 4HOQA 2VGXA 3LPZA 4LEUA 3LY8A 4AY6A 2VSYA 3CK8A 3ZHEB 4ME2A 5ARFA 1W3BA 4JHRA 4G24A 4WUYA 4U0SA 2LNIA 2L6JA 3S7BA 4N3CA 5BT1A 4BT9A 1ZBPA 5A7DB 4HOTA 5G05C 3MV3B 5JJTA 4F3VA 3EDTB 5D0QD 2V5FA 3MA5A 5JJ7A 2HR2A 5BW8C 2UY1B 4NRHB 3FFLA 4BTBA 3BEEA 1FCHA 4GZ6A 5CHEE 2KATA 3O48A 1B89A 5LCWC 4U07A 5G04C 3HYMB 1ZU2A 4GA0A 4GA1A 3CK9A 2YHCA 2C0LA 2VGXB 5HQ8A 4GCOA 4G26A 3QWWA 3URZA 4HORA 4J0UA 2LSUA 4IN3B 2I6HA 4G1TA 3VTXA 4N2QA 2VGYA 3CK7A 2XGMA 3VTYA 4J8EA 3CVQA 4U04A 4JA7A 5AYWD 2FF4A 2XCCA 1P5QA 4N39A 4WNGA 1KLXA 4UI9J 3PDNA 2WQHA 5KJMA 3UPVA 4G25A 3LY7A 3KAEA 5A6CA 5CCLA 4NQ0A 3RO2A 5D0OD 1QZ2A 4Y6CA 2P58C 4UI9K 1OUVA 4UI9C 4RG6A 2XEVA 4N2SA 2KCVA 3IEGA 1KT0A 3ASHA 2IF4A 4AM9A 3TAXA 5KJKA 3FP3A 4GA2A 3OXGA 2ONDA 3ULQA 3RU0A 4I17A 3Q47B 3QKYA 3K9IA 4CDRA 4B94A 3JYSA 4N3AA 1TJCA 2JLBA 2KCKA 5FJYA 4BTAA 5M72A 3Q15A 2XGSA 5EX0A 2KCLA 3GZ1A 4KXKB 3S7FA 3E4BA 4U0UA 4W9RA 3CVPA 3GYZA 3NF1A 3CKCA 3MKRA 2FO7A 5DBKA 3ASGA 4HOUA 5ARGA 4CGVA 1Y8MA 4JL0A 4J8DA 4I2ZA 3SF4A 3Q49B 4XI0A 5C1DA 1A17A 4JA9A 1YA0A 3RJVA 2E2EA 5FZQA 1QQEA 3PE3A 4KYOB 5CCMA 4EQFA 4ABNA 5KJLA 3RIBA 4O6FA 4G2VA 3QWVA 4GYOA 1IYGA 2R5SA 3KS2A 2VSNA 2XPIA 3AS5A 3QWPA 3TG4A 2PQNA 2BUGA 4U0ZA 2VQ2A 3CKBA 2PZIA 4HOSA 4WNEA 2Y4TA 1KT1A 3ZGQA 4N3BA 3ASDA 4RG9A 4BT8A 3PE4A 4GZ5A 5FTPA 4Y6WA 1IHGA 3LYAA 2PL2A 3KD7A 1NZNA 4J8FA 4I2WA 3ESKA 3RKVA 2FBNA 2OOEA 2UWJG 1HH8A 2NC9A 3U3WA 4N5CA 5EKQD 2GW1A 5G05J 3LKUA 5DIZA 4GZ3A 3UUXA 2Y4UA 1NA3A 4A1SA 3LY9A 4I9CA 4G23A 4XI9A 1XNFA 2WPVA 3CEQA 4AIFA 3S7DA 3CV0A 4BWRA 4YVQC 5FT9A 2LSVA 3ZFWA 3ZPJA 2MHKA 1WAO1 5KJNA 1ELWA 3AS8A 5LCWJ 2XGOA 5G04J 2AVPA 5FZRA 3ZN3A 4GYYA 5FZSA 3R9AB 5HI7A 3RO3A 4H7YA 3GZ2A 4I9EA 4GYWA 3OXFA 3AS4A 3WXXA 2QFCA 4WNDA 3U4TA 2J9QA 2PQRA 1HXIA 3ZHEA 2FEZA 4WNFA 1WM5A 3TG5A 3CVLA 2C2LA 2FI7A 3TGOA
chains in the Genus database with same CATH superfamily
3QARA 3MV2B 3N71A 1H2VC 1HZ4A 3Q4AB 1MHQA 3FEYA 4V3IA 4YVOA 2RFAA 3TWRA 4GPKA 3SZ7A 2WM9A 4H7XA 4GAAA 2YNQA 1HF8A 3CVNA 3FH8A 3QOUA 3APFA 5AARA 3L6AA 1H6OA 3UQ3A 4KZ0A 4R7LA 3ENEA 5ENOD 3LJNA 3LCAA 4KBQA 2XHEA 4FLHA 3QK0A 1U3CA 4GTSA 2R17C 1Z3YA 3Q5MA 4UQXA 4APOA 4CGWA 3ZU7B 4ILGA 2WVIA 4UQYA 4DPRA 2ZIRA 1UG3A 3RK6A 4MS6A 3FU0A 3EU5A 3U9WA 1INZA 3ZW3A 4AY6A 4ILIA 4G8LA 4L7TA 3SBTB 3ZHEB 5ARFA 4DRXE 2LNIA 2L6JA 5BT1A 3RRUA 1N94A 2NXPA 3ZNGA 5G05C 3NOGD 3MV3B 2RG8A 3B7BA 1LD7A 4F3VA 2GRLA 4XZ4A 1DCEA 2R05A 1TEZA 1ZB1A 4GTTA 3UT8A 4FLBA 4DUIA 3FHEA 3PH0C 4BTBA 5CHEE 2KATA 1EDUA 4JPSA 2L0TB 5LCWC 3FU5A 3LVQE 5HS0A 3HXBA 3TWXA 4B89A 4LG6A 4GA0A 4CDNA 5HQ8A 3MJWA 1O5MA 3AG3E 3JXIA 4U7EB 4HORA 4GTPA 1WDYA 3ABKE 2XS8A 2I6HA 5KBAA 3FUFA 3IKOB 4JXTA 4O1OA 1N0RA 1WG0A 3V31A 4OAUC 3EHRA 2VGYA 2A5UA 4JD2G 2PM6A 3I5PA 1TJFA 2GRNB 4GZDA 1HO8A 3JUIA 4O60A 5CRVA 4JEUA 4U04A 4MLPA 5AYWD 2ZXWE 2XCCA 4TXRA 2WXIA 4FJYA 4TRQA 3ML9A 4G25A 3SFYA 4HI9A 4QQIA 1OWMA 3ONLA 2WXNA 3TXNA 1QZ2A 2P9KG 3DSTA 3TL5A 1TNOA 3ABLE 5CEDB 5G2NA 3KEZA 3ULYA 4LNGA 2LUHA 2IF4A 5KJKA 4GA2A 4U8VD 3AU5A 2DCPA 4CT4A 3JYSA 4ACKA 4I6EA 4MKTA 1TJCA 3JUEA 2QYUA 3L82A 3AAAC 2WXQA 5AJLA 4BTAA 1D8EA 2H6GA 4JZYA 4ZFHA 4UWGA 3Q15A 3EIQC 4GTQA 1SA5A 4B93B 3GZ1A 5J90A 3S7FA 3PZ2A 3E4BA 3MX3A 4W9RA 3FUDA 2X38A 3NOCD 3TWUA 4E6HA 2WXMA 3V2XA 3HDXA 2ZISA 3ASGA 4FJZA 3MGBA 5ANRA 3G2UA 3FULA 3SF4A 1TNUA 5CBNA 5LX8A 4ANVA 3AG2E 3HVEB 2CG3A 3BG1B 1O1RA 5KNHD 1E8ZA 1FT1A 3DPYA 4KYOB 3G2TA 4BX9A 4F53A 5G55A 2VSXE 2VTBA 2AXUA 4G2VA 3FDHA 4GMRA 4BESA 4K5CA 4Z68A 4GYOA 4CZ2D 5KNGA 2R5SA 2MOWA 3ABME 5AQAA 3Q7FA 4PH4B 4JW1A 2VQ2A 1N4SA 2PZIA 3FY4A 3UMVA 4EZJA 3KSLA 1S64A 2XEEA 4WNEA 2Y4TA 2QYJA 4FULA 4HXIA 2HE0A 3PE4A 2Y1LE 1G3NB 4HB5A 2Y0BG 3D9MA 1N11A 5ENTD 3ULEG 1OWNA 3PNTB 2EILE 3FU6A 2J09A 1MQSA 1IHGA 3LYAA 4GMJA 3FUHA 4HS2A 4I6GA 1SQMA 3SGHA 4AXHA 4A63B 3ESKA 3EIJA 4A55A 4Q94A 2L9BA 4LNUD 2UWJG 1OWLA 4U96D 4LRZA 4CYMD 4DX2A 3CVXA 2WXJA 4HRLA 2H6HA 4GZ3A 1N4PA 3CHMA 2P9IG 3NZSA 3TXMA 3C98A 4F6RD 2BF0X 3CVVA 4HRMB 2X6HA 1RZ4A 3NB2A 2HM8A 4AIFA 4Q69A 1H0AA 4PS3A 5B3SE 1FPPA 3ZFWA 3WG7E 3UX4A 1O1SA 2MHKA 3J5PA 1WAO1 1ELWA 4XKBA 2WXGA 4GYYA 3CSFA 3CHOA 3R9AB 1E7UA 1IQRA 1BPOA 4GYWA 5AENA 3X2QE 3RRNB 4WNDA 3T5VA 5FIOA 2J9QA 4B8CB 4DJAA 4L2LA 3QAQA 2WXPA 3HXFA 4AY5A 3RRMB 4DX6D 3FWVA 1QNFA 1H2TC 4J7WA 3RAUA 3CHRA 4AOFA 5EX3A 4ATZD 1NA0A 2DIWA 4A3TA 3J5QB 5BNWA 3GW4A 4AEZC 3D9KA 4I1AA 3L16A 3TWWA 2UY1A 1BU9A 2OEWA 2B6CA 4LERA 1NP7A 1A5EA 1E96B 3MZLB 4LSZE 4XIFA 3QDNA 2IO3C 5EIBE 3C3RA 1H6KA 2IFUA 2C0MA 3HVEA 2OVBA 5BXUA 1JWFA 5IY5E 4YNDA 3L17A 4GCNA 2CFUA 3PZ3A 2IQCA 3L08A 2DBAA 3LXUX 4G11A 5AQ9A 4CT0A 3W9GA 3B13A 3EHNA 4LEUA 5CEAA 2V0PA 3B95A 5ANLA 1XGWA 1PAQA 4G24A 1Z6TA 1IQUA 3DSSA 4L2YA 1DCQA 4HOTA 2JABA 2MRIA 3CSTA 2I2OA 3MKQA 2X6KA 3EDTB 2WMNA 1EYHA 3UIOC 5D0QD 4WWNA 2RKKA 4B8AA 3QB2A 3PUJA 3LS8A 5BW8C 4YDYA 3FUKA 3BEEA 2E0IA 4GZ6A 3O48A 4U8HA 2IU1A 2M63A 2BKKB 4TUMA 1ZU2A 2KM4A 5JMND 2C0LA 2VGXB 1N52A 3URZA 3EUVA 4IULA 2WXRA 2LSUA 4G1TA 2XENA 1E8YA 1JPLA 5FINA 5ENSD 2GRQB 3CQGB 2RFMA 1H2UA 3C5RA 2FF4A 3IHYA 1P5QA 3UPVA 5LP0A 4C0MA 1SZ9A 3Q73A 3UM1A 1K8KG 1X5BA 4J6IA 4U63A 3EHMA 5A6CA 4NQ0A 4O1PA 2CHWA 3D9HA 2KZTB 4UI9K 1OUVA 4CDMA 2GROB 4UI9C 5JHAA 2OEVA 2KCVA 3B7TA 4BSXA 1OCCE 1TN6A 5AQBA 3P2BA 4AM9A 4X8QA 3TAXA 3PS6A 3DXMG 3FP3A 2ONDA 3ULQA 4I17A 3PUKA 4CDRA 4B94A 3PNLB 4HFGA 4GPMA 4N3AA 4TV3A 5FJYA 3I4RB 5ENPD 4YDEA 2J4BA 4BFRA 1N4RA 4FHKA 1N0QA 2YINA 1OCRE 4L9PA 4XE0A 3HXCA 2KXPC 1H6PA 3ZVVA 3GYZA 3NF1A 5EYLA 2R02A 5HRYA 2H6FA 4FC8A 4E85A 5ARGA 1Z5SC 4HNAD 4PDXA 2ZU6B 3DSXA 4CGVA 1Y8MA 2V8SE 4J8DA 3FUJA 3L22A 4JA9A 1YA0A 2R03A 3PE3A 2NSZA 2ETCA 2X6FA 4ABNA 3UM0A 2P2CP 1TNBA 1UJKA 1SA4A 1YYHA 2Y3AA 1L5JA 1YCSB 2CHZA 2IO2C 3R7RA 1DVPA 3ZRHA 2XPIA 3AS5A 3D9IA 3TG4A 1EF1C 4RVBA 2PQNA 4P29A 1MX4A 4NACA 4ACLA 1Q2ZA 4GMLA 4L23A 1UOHA 3IV0A 1LF8A 3U66A 3JCKC 4BERA 2AXZA 4N3BA 3B7RL 3ASDA 4M7CA 4GZ5A 3FUEA 3MCXA 4Q96A 2XQ0A 3PEVB 4ANXA 2DZNA 2WXOA 3G2VA 1SVXA 3JQ1A 3KD7A 1NZNA 2EINE 3V79K 4U8YD 3CVUA 3C72A 3NAWA 2DYRE 2XRZA 4RQIA 4N5CA 4I1OB 2GW1A 5J08A 4RSYA 3LKUA 5DIZA 3SNXA 5D2MC 4OVVA 1NA3A 4KMOA 4JHJA 3LY9A 3E32A 4PS7A 4WWPA 4I9CA 1HG2A 4XI9A 3L9TA 3AJIA 4ATGA 2J08A 3DPDA 2V4HC 3BU8A 3CV0A 5FQ6A 4BWRA 4YVQC 3L13A 4I6JA 1AP7A 3CHQA 3AS8A 2XGOA 3ZN3A 3E33A 1JCRA 5FZSA 2WXFA 5HI7A 4FADA 4YDWA 1HS6A 4KVOA 3OXFA 3AS4A 1OT8A 3DRAA 3U4TA 1HXIA 3FH7A 3ZHEA 2XPZA 3T8MA 1WM5A 1Y6IA 2AW6A 1PY1A 2C2LA 3TGOA 2KC7A 4GB9A 1IKND 3UXGA 2GRPB 2IONA 2DYSE 1O1TA 1FVHA 3LVRE 2VYIA 1ELRA 1NI1A 2LXLA 4XKCA 5AN8A 1LTXA 5CMWA 2YQ8A 2P9PG 4G8KA 3TWTA 3OXLA 1JCSA 3MEKA 4JC8A 3UT7A 3KSQA 4K0RA 1PC2A 1BD8A 1JCQA 3FUIA 2I1JA 3HG0D 4HOQA 5CECB 3LPZA 4UWHA 3LY8A 2CHXA 2VSYA 3Q79A 4ME2A 4I43A 1W3BA 4JHRA 4WUYA 2VSOE 5T8IA 3TJPA 3C3OA 3S7BA 2QZAA 1FT2A 3UTMA 3HRAA 5FQ8A 5A7DB 3DBSA 2A4ZA 3EHQA 4DI4A 3UT4A 1MX6A 3MYVA 2BTDA 2V5FA 5ENRD 4DX7D 1S0PA 4EHMA 1V54E 3MA5A 4HQDA 2HR2A 1TNYA 2AXVA 3F6QA 2ETBA 2GRMA 2X6IA 3FFLA 2LAIA 5CBOA 3I3NA 4RLYA 2P9SG 4GTOA 3FU3A 1SW6A 1JWGA 2V4LA 3JXJA 1UN9A 2JEKA 2DVWA 3CK9A 3RSEG 3T9KA 4GCOA 4G26A 4FU3A 2J8SD 1HU3A 4J0UA 1N9AA 3APDA 5FQ7A 2X3MA 2WB2A 2IY0C 4C9BB 3Q9UC 4CRWA 1HG5A 2XGMA 4DK5A 1UJJA 4JVSA 4LNBA 1LD8A 3CVQA 4JA7A 2IJGX 4WNGA 1KLXA 4UI9J 3UM3A 3PDNA 2R59A 2WQHA 4K5BA 4LCTA 5KJMA 3BG0B 4EECA 2ILRA 5LFAA 2XZTG 3KAEA 4JB8P 1BI8B 4HVBA 5ENNA 2A5EA 3PZ1A 4B0ZA 4RG6A 4N2SA 3IEGA 1UW4B 4U95D 1KT0A 3ASHA 4MBGA 4J8SA 5ITZF 2LXMA 3RU0A 3QKYA 4OYSA 3ESLA 4D10C 4N5QA 1X81A 3W9FA 2KCKA 2RD0A 3O4ZA 1QYMA 1E8XA 1IHBA 3HXDA 5M72A 5FQ4A 2CG2A 3ONKA 2WXLA 2R2LA 3FTWA 5EX0A 2KCLA 2QC9A 3UIPC 3SO8A 3DWLG 2FULA 1TYQG 3CVPA 4BY6A 2H6IA 3CKCA 4K5AB 2FO7A 3Q7AA 5CRUA 3ZYMA 4XEIG 3SFXA 1OY3D 4I2ZA 1DNPA 1E8WA 3NQPA 2ETAA 4A3VA 3CHPA 4XI0A 5JA4D 1MZCA 2F8XK 4GTMA 3RJVA 5FZQA 1QQEA 4URKA 2ZGGA 1Z3XA 3ISMC 5KJLA 3RIBA 4O6FA 3SY2A 4BETA 3FTSA 1IYGA 4KT6B 3QWPA 4DX5D 4TUUA 4WAFA 3G2SA 2BUGA 4U0ZA 3CVYA 3D9JA 2WXKA 1SZAA 4HOSA 3Q75A 5D66A 4HLEA 2LO6A 3ZGQA 3D3MA 3ZKJA 3ZXSA 2MYOA 1MX2A 4Y6WA 3B7SA 4UWLA 1NL4A 4HLLA 4TXQA 1UN8A 3R7QA 4HI8A 4J8YA 3SFZA 2I1KA 1MJ0A 3DEOA 2P9LG 2VGEA 3L54A 4I2WA 5T3RA 3RKVA 2FBNA 2OOEA 2QY7A 5KCMA 4JHKA 2NC9A 5EKQD 2XPYA 3LDZA 3AG1E 3UUXA 1WY6A 5ENQD 2Y4UA 2VTBB 1ELKA 4G23A 4CCAA 2L6BA 1HFAA 3DXKG 4LUNU 2F0YA 3S7DA 4C48B 3PZDA 2WMOA 3UM2A 3CLJA 3BQOA 5KJNA 2V5QC 3T5XA 4PUCA 5G04J 2AVPA 5FZRA 3R9MA 5KWDA 3D9LA 2WXHA 3HIZA 3RO3A 4H7YA 3GZ2A 3V30A 4IYPA 5AJDA 3EJNA 5C2YA 1YMPA 3WXXA 3ZYKA 4K03A 1OWPA 4AP2A 1U2VG 2PQRA 1OCOE 4BX8A 2FEZA 2EIJE 3FUNA 4HBDA 3TG5A 2FI7A 3KEAA 2AWIA 5FWQA 1TN7A 1K1BA 1JUQA 2XZDG 4EBAA 1VDYA 4M3OA 2VJ8A 5JJ6A 2KBXA 3SQVA 2Q7FA 3ASFA 4UQZA 2NYJA 2XCBA 3P1UA 5AIJA 4APFA 3Q78A 4UUCA 2B0OE 2HO1A 3ASOE 3ZIMA 3S7JA 1N4QA 2HYZA 3D9OA 4GTRA 4EZLA 4EBAG 3B7UX 3SI5A 4L1BA 1TR4A 2YHEA 5EDSA 3DEPA 5CMYA 2X6JA 3SD5A 4F1SA 4GZCA 1KZOA 2VGXA 5EILA 1OXJA 4C0EA 1OWOA 3V2OA 3CK8A 3E37A 5HKPA 2WQ7A 4U0SA 3FTVA 4EPZA 2EQXA 3UINC 4N3CA 4BT9A 3FEXA 1DC2A 3LEWA 1TNZA 1ZBPA 4PS8A 4HRNA 4BSZB 1OCZE 3UI2A 2GRRB 4WWOA 5JJTA 1E7VA 3CR3A 3IBEA 4ZHBA 2CFZA 3AU4A 5EIDA 3FUMA 3DSUA 5JJ7A 2P9UG 2KZTA 2XEHA 2PNNA 2UY1B 3NBNB 4NRHB 1BLXB 1EPUA 1FCHA 4KZCA 2DZOA 1B89A 4U07A 5G04C 5H7PA 4I1MA 3HYMB 3ZUVB 5BV0A 2F37A 3LJ3A 3D9PA 1FVFA 4GA1A 2WQ6A 2YHCA 5E76A 1S70B 3E34A 3ZEFA 2OCCE 3PRZA 3QWWA 2OV8A 3HHMA 4DLOA 2EIME 2J07A 4IN3B 1K3ZD 3AG4E 4GU5A 4UWFA 3CHSA 2AJAA 3VTXA 4N2QA 3CK7A 3VTYA 3DSWA 4J8EA 3CVWA 3E30A 2J49A 4N39A 3MKQB 3LY7A 2ZGDA 2P9NG 5BUZA 4NIKA 4CEMA 3CGHA 2F8YA 5CCLA 3RO2A 5D0OD 2FO1E 4Y6CA 1H19A 2P58C 5AQ7A 3PVLA 1E90A 2Y69E 2XEVA 3EU9A 4TXPA 2GGFA 3CQCB 4F7AA 3CIAA 5EYPF 3OXGA 2XS1A 3Q47B 2BEDA 3K9IA 2XRYA 3TWSA 3FTZA 4ILHB 5EN5D 1U3DA 4AV7A 4A1GA 2JLBA 3FTUA 1IXVA 3GZSA 5E75A 3VLEA 3VLFA 5BXOA 2L0IA 1N95A 2XGSA 4KXKB 4U0UA 3APCA 1TN8A 4NURA 4DX1A 4F1PA 3MKRA 3OTNA 5DBKA 1N54A 4XX5A 5B1BE 4HOUA 3T8KA 4UWKA 4JL0A 3Q9NC 3Q49B 2IEJA 5C1DA 1A17A 1BI7B 3ML8A 3TWVA 2BKGA 4GTVA 2E2EA 5CCMA 4EQFA 4ANUA 3SHFA 4EZKA 3QWVA 4QFVA 3KS2A 3PZ4A 2VSNA 3SBSA 4OAVB 4IRUA 1D9SA 2EIKE 4ANWA 5BV1A 1KPSB 4JEHA 3CKBA 3HXEA 3TWQA 4YDOA 1KT1A 1V55E 3VLDA 4RG9A 3C3QA 4BT8A 5AAOA 5FTPA 3QNKA 3U64A 1HE8A 1KZPA 2IOLA 3QC1A 3OAWA 2OVFA 4OVUA 4DLQA 3JQ0A 2PL2A 3PREA 3NZUA 5BPPA 4J8FA 3G2WA 3ZYQA 3FH5A 5B1AE 3D9NA 2DWZA 4FA6A 4DI3A 1HH8A 3U3WA 1MYOA 4FP7A 3PEUB 5G05J 3S2AA 1K1AA 2LAHA 4A1SA 1S63A 3ZXPA 5T4YA 5CERB 3ASNE 1XNFA 3IHVA 3DSVA 2WPVA 4AJWA 3FTXA 3CEQA 2J4DA 1QBQA 1HX8A 5FT9A 2LSVA 3ZPJA 4FHJA 4BEPA 5LCWJ 3I4GA 2PM7A 1AWCB 4KVMA 4AVXA 2I9CA 3IXEA 4I9EA 5LOZA 3QJZA 3BUAA 5A23A 5JHBA 1RW2A 2QFCA 1NFIE 3UKRG 3ZYLA 3UKUG 4WNFA 3CVLA 1GW6A 2IOSA 4MRUA 1D8DA 3FTYA
chains in the Genus database with same CATH topology
2AWIA 2KC7A 5FWQA 4GB9A 3QARA 3MV2B 3N71A 1H2VC 1HZ4A 1JUQA 3Q4AB 4EBAA 1MHQA 3FEYA 1VDYA 4V3IA 4AY5A 4YVOA 3RRMB 4M3OA 2IONA 3FWVA 1QNFA 2VJ8A 1H2TC 1FVHA 5JJ6A 3LVRE 2Q7FA 3ASFA 2VYIA 4GPKA 1ELRA 4UQZA 3SZ7A 2XCBA 2WM9A 3CHRA 4GAAA 4H7XA 4AOFA 5EX3A 2YNQA 3P1UA 4XKCA 1HF8A 3CVNA 5AIJA 3FH8A 3QOUA 3APFA 4APFA 1NA0A 5CMWA 2HO1A 2DIWA 2YQ8A 3L6AA 4A3TA 5BNWA 3ZIMA 3GW4A 4AEZC 3D9KA 3S7JA 3UQ3A 2HYZA 4KZ0A 3OXLA 3D9OA 4I1AA 4R7LA 3ENEA 3L16A 3MEKA 2UY1A 4EZLA 3LCAA 4LERA 4JC8A 1NP7A 4EBAG 1E96B 3B7UX 4KBQA 2XHEA 3MZLB 4FLHA 3UT7A 3QK0A 4XIFA 1U3CA 3QDNA 2R17C 3SI5A 1Z3YA 3Q5MA 4K0RA 4UQXA 1H6KA 4APOA 4AVXA 4CGWA 1PC2A 2IFUA 2C0MA 4L1BA 3HVEA 2OVBA 1JWFA 2YHEA 5EDSA 4YNDA 3L17A 4GCNA 2CFUA 3FUIA 2I1JA 2X6JA 2IQCA 5CMYA 3L08A 2DBAA 4ILGA 2WVIA 3LXUX 4G11A 4UQYA 4DPRA 3SD5A 1UG3A 4CT0A 3RK6A 4HOQA 4MS6A 4F1SA 4GZCA 2VGXA 3B13A 3EHNA 3FU0A 3LPZA 4LEUA 4UWHA 3U9WA 3LY8A 1INZA 2CHXA 3ZW3A 4AY6A 2VSYA 4C0EA 1OWOA 2V0PA 4ILIA 3CK8A 4L7TA 3SBTB 3ZHEB 4ME2A 5ANLA 1XGWA 1PAQA 5ARFA 4I43A 1W3BA 4JHRA 2WQ7A 4G24A 4WUYA 2VSOE 4U0SA 5T8IA 2LNIA 1Z6TA 3TJPA 2L6JA 3FTVA 4EPZA 1IQUA 2EQXA 3S7BA 4N3CA 5BT1A 4BT9A 3FEXA 3RRUA 3LEWA 4L2YA 1ZBPA 5FQ8A 5A7DB 2NXPA 4PS8A 4HOTA 5G05C 3DBSA 2MRIA 3MV3B 3CSTA 2I2OA 3MKQA 2RG8A 4WWOA 5JJTA 2A4ZA 1E7VA 2X6KA 3CR3A 4DI4A 3IBEA 3UT4A 4F3VA 2GRLA 3EDTB 4XZ4A 2CFZA 3MYVA 2WMNA 1EYHA 3AU4A 5D0QD 2BTDA 2V5FA 4WWNA 1S0PA 3FUMA 1TEZA 4B8AA 3MA5A 5JJ7A 2KZTA 2HR2A 3QB2A 3PUJA 2AXVA 3UT8A 3LS8A 4FLBA 5BW8C 3FHEA 2UY1B 2GRMA 3FUKA 2X6IA 3FFLA 4NRHB 3PH0C 4BTBA 3BEEA 1EPUA 1FCHA 2LAIA 2E0IA 4GZ6A 5CHEE 2KATA 3I3NA 3O48A 4KZCA 1B89A 1EDUA 4JPSA 2L0TB 5LCWC 4U07A 3FU5A 3LVQE 5G04C 4I1MA 3HYMB 4U8HA 5BV0A 4B89A 2IU1A 2M63A 3FU3A 3LJ3A 1JWGA 3D9PA 1FVFA 2V4LA 1UN9A 2JEKA 1ZU2A 4GA0A 2KM4A 4GA1A 3CK9A 2WQ6A 2YHCA 2C0LA 4CDNA 2VGXB 5E76A 5HQ8A 3ZEFA 3MJWA 4GCOA 4G26A 3PRZA 4FU3A 3QWWA 1N52A 3URZA 2OV8A 3HHMA 1HU3A 4DLOA 4HORA 4IULA 4J0UA 2J07A 2WXRA 2LSUA 4IN3B 2I6HA 3APDA 4G1TA 4GU5A 2X3MA 4UWFA 3CHSA 1E8YA 5FQ7A 3FUFA 3IKOB 1JPLA 4JXTA 4C9BB 2WB2A 3VTXA 4N2QA 4CRWA 2VGYA 3CK7A 2A5UA 3CQGB 2PM6A 1HG5A 1TJFA 3I5PA 2XGMA 3VTYA 4GZDA 1HO8A 1H2UA 3JUIA 4DK5A 4J8EA 1UJJA 4JVSA 4JEUA 3CVQA 4U04A 4JA7A 4MLPA 5AYWD 3CVWA 2FF4A 2XCCA 3IHYA 2J49A 1P5QA 2IJGX 4N39A 4WNGA 1KLXA 4UI9J 2WXIA 4FJYA 3MKQB 3PDNA 2R59A 2WQHA 4LCTA 4TRQA 3ML9A 5KJMA 3UPVA 5LP0A 4C0MA 3BG0B 1SZ9A 4G25A 3LY7A 4EECA 1OWMA 1X5BA 2ILRA 5BUZA 3ONLA 2WXNA 3TXNA 4CEMA 4J6IA 5LFAA 4U63A 3KAEA 3EHMA 5A6CA 3CGHA 4NQ0A 5CCLA 3RO2A 5D0OD 1QZ2A 4Y6CA 1H19A 2CHWA 2P58C 3TL5A 4HVBA 2KZTB 5ENNA 4UI9K 1OUVA 3PVLA 4CDMA 4B0ZA 1E90A 5G2NA 3KEZA 4UI9C 4RG6A 5JHAA 2XEVA 4N2SA 2KCVA 3IEGA 3B7TA 4BSXA 1UW4B 1KT0A 3P2BA 3ASHA 2IF4A 4J8SA 2GGFA 4AM9A 3CQCB 3TAXA 3PS6A 3CIAA 4F7AA 5KJKA 3FP3A 4GA2A 3OXGA 2ONDA 3ULQA 3RU0A 3AU5A 2DCPA 4I17A 3PUKA 3Q47B 3QKYA 3K9IA 4CDRA 4CT4A 2XRYA 4B94A 3JYSA 3PNLB 4OYSA 4ACKA 4I6EA 3ESLA 4HFGA 4MKTA 4D10C 3FTZA 4ILHB 4N3AA 1U3DA 4AV7A 4A1GA 4TV3A 1TJCA 2JLBA 3FTUA 2KCKA 3GZSA 2RD0A 3O4ZA 5E75A 1E8XA 5FJYA 3VLEA 2WXQA 3I4RB 5AJLA 3VLFA 4BTAA 2J4BA 4BFRA 4FHKA 5M72A 2L0IA 5FQ4A 2YINA 4JZYA 2CG2A 3ONKA 4UWGA 3Q15A 2WXLA 2XGSA 3EIQC 3FTWA 5EX0A 2KCLA 5J90A 3GZ1A 4KXKB 4XE0A 3S7FA 2FULA 3E4BA 3MX3A 4U0UA 4W9RA 3FUDA 3CVPA 3ZVVA 4BY6A 3GYZA 3APCA 3NF1A 2X38A 4NURA 3CKCA 4E6HA 2WXMA 3MKRA 2FO7A 3OTNA 5DBKA 4FC8A 3HDXA 1N54A 3ASGA 4XX5A 4E85A 4FJZA 4HOUA 3MGBA 5ARGA 4PDXA 2ZU6B 5ANRA 3ZYMA 4CGVA 1Y8MA 4UWKA 3G2UA 2V8SE 4J8DA 4JL0A 3FULA 4I2ZA 3SF4A 1DNPA 1E8WA 3Q49B 3NQPA 5LX8A 4ANVA 4A3VA 3CHPA 3HVEB 4XI0A 2CG3A 5C1DA 1A17A 3BG1B 3FUJA 3L22A 4JA9A 1YA0A 3ML8A 3RJVA 1E8ZA 2E2EA 5FZQA 1QQEA 4URKA 3PE3A 4KYOB 1Z3XA 5CCMA 2NSZA 2X6FA 4EQFA 3G2TA 4BX9A 4ABNA 5KJLA 3RIBA 4ANUA 1UJKA 4F53A 5G55A 3SHFA 4O6FA 2VSXE 2VTBA 2Y3AA 2AXUA 1L5JA 4EZKA 4G2VA 2CHZA 3FDHA 3QWVA 3FTSA 4GYOA 3R7RA 1IYGA 2R5SA 4QFVA 2MOWA 1DVPA 3KS2A 4KT6B 3ZRHA 2VSNA 2XPIA 3AS5A 3D9IA 3QWPA 3TG4A 4TUUA 1EF1C 4RVBA 2PQNA 4WAFA 3SBSA 3G2SA 2BUGA 4P29A 4IRUA 4PH4B 5BV1A 4ANWA 4JW1A 4NACA 4U0ZA 3CVYA 2VQ2A 4JEHA 4ACLA 3CKBA 3D9JA 2PZIA 2WXKA 1SZAA 3FY4A 4GMLA 3UMVA 4HOSA 4L23A 4EZJA 3IV0A 1LF8A 3U66A 4WNEA 4HLEA 2Y4TA 1KT1A 2LO6A 3JCKC 3ZGQA 3D3MA 2AXZA 4N3BA 3B7RL 4FULA 3ASDA 3VLDA 4HXIA 4RG9A 4BT8A 3PE4A 3ZXSA 4GZ5A 5FTPA 4Y6WA 3D9MA 3B7SA 3FUEA 3MCXA 3QNKA 2XQ0A 4Q96A 3PEVB 4UWLA 3U64A 4ANXA 1HE8A 2IOLA 3QC1A 1OWNA 3OAWA 2OVFA 3PNTB 2WXOA 3G2VA 3FU6A 1UN8A 4OVUA 3R7QA 4DLQA 2J09A 3SFZA 1MQSA 1IHGA 2I1KA 3JQ0A 3LYAA 4GMJA 2PL2A 3JQ1A 3KD7A 3PREA 3FUHA 1NZNA 3NZUA 4HS2A 4I6GA 5BPPA 4J8FA 1SQMA 3SGHA 3G2WA 3ZYQA 4AXHA 3L54A 4I2WA 3ESKA 3EIJA 4A55A 3CVUA 3FH5A 5T3RA 4Q94A 3RKVA 3D9NA 2FBNA 2L9BA 2OOEA 4FA6A 2UWJG 1OWLA 2QY7A 5KCMA 2XRZA 4DI3A 1HH8A 4JHKA 2NC9A 3U3WA 4N5CA 4LRZA 5EKQD 4FP7A 3CVXA 4I1OB 2WXJA 2GW1A 2XPYA 3LDZA 3PEUB 5G05J 5J08A 4RSYA 3S2AA 3LKUA 5DIZA 4GZ3A 3SNXA 3UUXA 3CHMA 1WY6A 3NZSA 4OVVA 2Y4UA 1NA3A 2LAHA 4KMOA 3TXMA 2VTBB 1ELKA 4JHJA 4A1SA 3LY9A 3C98A 4PS7A 4WWPA 4I9CA 1HG2A 4G23A 4XI9A 5T4YA 4CCAA 1XNFA 2BF0X 1HFAA 3CVVA 3IHVA 4ATGA 2X6HA 2J08A 3DPDA 2WPVA 4AJWA 3FTXA 2HM8A 3CEQA 4LUNU 4AIFA 3S7DA 3CV0A 5FQ6A 2J4DA 4BWRA 4Q69A 1HX8A 1H0AA 4YVQC 4PS3A 5FT9A 3L13A 3PZDA 4I6JA 2LSVA 3ZFWA 2WMOA 3UX4A 3ZPJA 2MHKA 3CLJA 1WAO1 5KJNA 1ELWA 4FHJA 3T5XA 3CHQA 3AS8A 4PUCA 5LCWJ 2XGOA 3I4GA 5G04J 2AVPA 2PM7A 5FZRA 4XKBA 3ZN3A 4KVMA 2WXGA 3D9LA 4GYYA 2WXHA 2I9CA 3CSFA 3CHOA 2WXFA 3HIZA 5FZSA 5HI7A 4H7YA 3R9AB 3GZ2A 3RO3A 1E7UA 4I9EA 4FADA 4IYPA 5LOZA 1BPOA 1IQRA 1HS6A 3QJZA 5AJDA 4GYWA 4KVOA 5A23A 5AENA 3OXFA 5JHBA 3AS4A 3EJNA 5C2YA 3WXXA 3ZYKA 4K03A 3RRNB 1OWPA 2QFCA 4WNDA 3U4TA 4AP2A 3T5VA 4B8CB 2J9QA 2PQRA 3ZYLA 4BX8A 1HXIA 3FH7A 2XPZA 2FEZA 3FUNA 4WNFA 3T8MA 1WM5A 3ZHEA 1Y6IA 3TG5A 3CVLA 2AW6A 1PY1A 2C2LA 4DJAA 2FI7A 1GW6A 2IOSA 4L2LA 3QAQA 4MRUA 3FTYA 2WXPA 3TGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KC7 A;  3MV2 B;  3N71 A;  1HZ4 A;  3Q4A B;  4AY5 A;  4YVO A;  3FWV A;  5JJ6 A;  2Q7F A;  3ASF A;  2VYI A;  4GPK A;  1ELR A;  4UQZ A;  3SZ7 A;  2XCB A;  4H7X A;  5EX3 A;  3CVN A;  3QOU A;  1NA0 A;  2HO1 A;  2YQ8 A;  5BNW A;  3GW4 A;  3S7J A;  3UQ3 A;  2HYZ A;  3OXL A;  4I1A A;  3MEK A;  2UY1 A;  3LCA A;  1E96 B;  4KBQ A;  4XIF A;  3QDN A;  4UQX A;  3Q5M A;  4APO A;  4CGW A;  1PC2 A;  2IFU A;  2C0M A;  4YND A;  4GCN A;  2DBA A;  4UQY A;  4HOQ A;  2VGX A;  3LPZ A;  4LEU A;  3LY8 A;  4AY6 A;  2VSY A;  3CK8 A;  3ZHE B;  4ME2 A;  5ARF A;  1W3B A;  4JHR A;  4G24 A;  4WUY A;  4U0S A;  2LNI A;  2L6J A;  3S7B A;  4N3C A;  5BT1 A;  4BT9 A;  1ZBP A;  5A7D B;  4HOT A;  5G05 C;  3MV3 B;  5JJT A;  4F3V A;  3EDT B;  5D0Q D;  2V5F A;  3MA5 A;  5JJ7 A;  2HR2 A;  5BW8 C;  2UY1 B;  4NRH B;  3FFL A;  4BTB A;  3BEE A;  1FCH A;  4GZ6 A;  5CHE E;  2KAT A;  3O48 A;  1B89 A;  5LCW C;  4U07 A;  5G04 C;  3HYM B;  1ZU2 A;  4GA0 A;  4GA1 A;  3CK9 A;  2YHC A;  2C0L A;  2VGX B;  5HQ8 A;  4GCO A;  4G26 A;  3QWW A;  3URZ A;  4HOR A;  4J0U A;  2LSU A;  4IN3 B;  2I6H A;  4G1T A;  3VTX A;  4N2Q A;  2VGY A;  3CK7 A;  2XGM A;  3VTY A;  4J8E A;  3CVQ A;  4U04 A;  4JA7 A;  5AYW D;  2FF4 A;  2XCC A;  1P5Q A;  4N39 A;  4WNG A;  1KLX A;  4UI9 J;  3PDN A;  2WQH A;  5KJM A;  3UPV A;  4G25 A;  3LY7 A;  3KAE A;  5A6C A;  5CCL A;  4NQ0 A;  3RO2 A;  5D0O D;  1QZ2 A;  4Y6C A;  2P58 C;  4UI9 K;  1OUV A;  4UI9 C;  4RG6 A;  2XEV A;  4N2S A;  2KCV A;  3IEG A;  1KT0 A;  3ASH A;  2IF4 A;  4AM9 A;  3TAX A;  5KJK A;  3FP3 A;  4GA2 A;  3OXG A;  2OND A;  3ULQ A;  3RU0 A;  4I17 A;  3Q47 B;  3QKY A;  3K9I A;  4CDR A;  4B94 A;  3JYS A;  4N3A A;  1TJC A;  2JLB A;  2KCK A;  5FJY A;  4BTA A;  5M72 A;  3Q15 A;  2XGS A;  5EX0 A;  2KCL A;  3GZ1 A;  4KXK B;  3S7F A;  3E4B A;  4U0U A;  4W9R A;  3CVP A;  3GYZ A;  3NF1 A;  3CKC A;  3MKR A;  2FO7 A;  5DBK A;  3ASG A;  4HOU A;  5ARG A;  4CGV A;  1Y8M A;  4JL0 A;  4J8D A;  4I2Z A;  3SF4 A;  3Q49 B;  4XI0 A;  5C1D A;  1A17 A;  4JA9 A;  1YA0 A;  3RJV A;  2E2E A;  5FZQ A;  1QQE A;  3PE3 A;  4KYO B;  5CCM A;  4EQF A;  4ABN A;  5KJL A;  3RIB A;  4O6F A;  4G2V A;  3QWV A;  4GYO A;  1IYG A;  2R5S A;  3KS2 A;  2VSN A;  2XPI A;  3AS5 A;  3QWP A;  3TG4 A;  2PQN A;  2BUG A;  4U0Z A;  2VQ2 A;  3CKB A;  2PZI A;  4HOS A;  4WNE A;  2Y4T A;  1KT1 A;  3ZGQ A;  4N3B A;  3ASD A;  4RG9 A;  4BT8 A;  3PE4 A;  4GZ5 A;  5FTP A;  4Y6W A;  1IHG A;  3LYA A;  2PL2 A;  3KD7 A;  1NZN A;  4J8F A;  4I2W A;  3ESK A;  3RKV A;  2FBN A;  2OOE A;  2UWJ G;  1HH8 A;  2NC9 A;  3U3W A;  4N5C A;  5EKQ D;  2GW1 A;  5G05 J;  3LKU A;  5DIZ A;  4GZ3 A;  3UUX A;  2Y4U A;  1NA3 A;  4A1S A;  3LY9 A;  4I9C A;  4G23 A;  4XI9 A;  1XNF A;  2WPV A;  3CEQ A;  4AIF A;  3S7D A;  3CV0 A;  4BWR A;  4YVQ C;  5FT9 A;  2LSV A;  3ZFW A;  3ZPJ A;  2MHK A;  1WAO 1;  5KJN A;  1ELW A;  3AS8 A;  5LCW J;  2XGO A;  5G04 J;  2AVP A;  5FZR A;  3ZN3 A;  4GYY A;  5FZS A;  3R9A B;  5HI7 A;  3RO3 A;  4H7Y A;  3GZ2 A;  4I9E A;  4GYW A;  3OXF A;  3AS4 A;  3WXX A;  2QFC A;  4WND A;  3U4T A;  2J9Q A;  2PQR A;  1HXI A;  3ZHE A;  2FEZ A;  4WNF A;  1WM5 A;  3TG5 A;  3CVL A;  2C2L A;  2FI7 A;  3TGO A; 
#chains in the Genus database with same CATH topology
 3QAR A;  3MV2 B;  3N71 A;  1H2V C;  1HZ4 A;  3Q4A B;  1MHQ A;  3FEY A;  4V3I A;  4YVO A;  2RFA A;  3TWR A;  4GPK A;  3SZ7 A;  2WM9 A;  4H7X A;  4GAA A;  2YNQ A;  1HF8 A;  3CVN A;  3FH8 A;  3QOU A;  3APF A;  5AAR A;  3L6A A;  1H6O A;  3UQ3 A;  4KZ0 A;  4R7L A;  3ENE A;  5ENO D;  3LJN A;  3LCA A;  4KBQ A;  2XHE A;  4FLH A;  3QK0 A;  1U3C A;  4GTS A;  2R17 C;  1Z3Y A;  3Q5M A;  4UQX A;  4APO A;  4CGW A;  3ZU7 B;  4ILG A;  2WVI A;  4UQY A;  4DPR A;  2ZIR A;  1UG3 A;  3RK6 A;  4MS6 A;  3FU0 A;  3EU5 A;  3U9W A;  1INZ A;  3ZW3 A;  4AY6 A;  4ILI A;  4G8L A;  4L7T A;  3SBT B;  3ZHE B;  5ARF A;  4DRX E;  2LNI A;  2L6J A;  5BT1 A;  3RRU A;  1N94 A;  2NXP A;  3ZNG A;  5G05 C;  3NOG D;  3MV3 B;  2RG8 A;  3B7B A;  1LD7 A;  4F3V A;  2GRL A;  4XZ4 A;  1DCE A;  2R05 A;  1TEZ A;  1ZB1 A;  4GTT A;  3UT8 A;  4FLB A;  4DUI A;  3FHE A;  3PH0 C;  4BTB A;  5CHE E;  2KAT A;  1EDU A;  4JPS A;  2L0T B;  5LCW C;  3FU5 A;  3LVQ E;  5HS0 A;  3HXB A;  3TWX A;  4B89 A;  4LG6 A;  4GA0 A;  4CDN A;  5HQ8 A;  3MJW A;  1O5M A;  3AG3 E;  3JXI A;  4U7E B;  4HOR A;  4GTP A;  1WDY A;  3ABK E;  2XS8 A;  2I6H A;  5KBA A;  3FUF A;  3IKO B;  4JXT A;  4O1O A;  1N0R A;  1WG0 A;  3V31 A;  4OAU C;  3EHR A;  2VGY A;  2A5U A;  4JD2 G;  2PM6 A;  3I5P A;  1TJF A;  2GRN B;  4GZD A;  1HO8 A;  3JUI A;  4O60 A;  5CRV A;  4JEU A;  4U04 A;  4MLP A;  5AYW D;  2ZXW E;  2XCC A;  4TXR A;  2WXI A;  4FJY A;  4TRQ A;  3ML9 A;  4G25 A;  3SFY A;  4HI9 A;  4QQI A;  1OWM A;  3ONL A;  2WXN A;  3TXN A;  1QZ2 A;  2P9K G;  3DST A;  3TL5 A;  1TNO A;  3ABL E;  5CED B;  5G2N A;  3KEZ A;  3ULY A;  4LNG A;  2LUH A;  2IF4 A;  5KJK A;  4GA2 A;  4U8V D;  3AU5 A;  2DCP A;  4CT4 A;  3JYS A;  4ACK A;  4I6E A;  4MKT A;  1TJC A;  3JUE A;  2QYU A;  3L82 A;  3AAA C;  2WXQ A;  5AJL A;  4BTA A;  1D8E A;  2H6G A;  4JZY A;  4ZFH A;  4UWG A;  3Q15 A;  3EIQ C;  4GTQ A;  1SA5 A;  4B93 B;  3GZ1 A;  5J90 A;  3S7F A;  3PZ2 A;  3E4B A;  3MX3 A;  4W9R A;  3FUD A;  2X38 A;  3NOC D;  3TWU A;  4E6H A;  2WXM A;  3V2X A;  3HDX A;  2ZIS A;  3ASG A;  4FJZ A;  3MGB A;  5ANR A;  3G2U A;  3FUL A;  3SF4 A;  1TNU A;  5CBN A;  5LX8 A;  4ANV A;  3AG2 E;  3HVE B;  2CG3 A;  3BG1 B;  1O1R A;  5KNH D;  1E8Z A;  1FT1 A;  3DPY A;  4KYO B;  3G2T A;  4BX9 A;  4F53 A;  5G55 A;  2VSX E;  2VTB A;  2AXU A;  4G2V A;  3FDH A;  4GMR A;  4BES A;  4K5C A;  4Z68 A;  4GYO A;  4CZ2 D;  5KNG A;  2R5S A;  2MOW A;  3ABM E;  5AQA A;  3Q7F A;  4PH4 B;  4JW1 A;  2VQ2 A;  1N4S A;  2PZI A;  3FY4 A;  3UMV A;  4EZJ A;  3KSL A;  1S64 A;  2XEE A;  4WNE A;  2Y4T A;  2QYJ A;  4FUL A;  4HXI A;  2HE0 A;  3PE4 A;  2Y1L E;  1G3N B;  4HB5 A;  2Y0B G;  3D9M A;  1N11 A;  5ENT D;  3ULE G;  1OWN A;  3PNT B;  2EIL E;  3FU6 A;  2J09 A;  1MQS A;  1IHG A;  3LYA A;  4GMJ A;  3FUH A;  4HS2 A;  4I6G A;  1SQM A;  3SGH A;  4AXH A;  4A63 B;  3ESK A;  3EIJ A;  4A55 A;  4Q94 A;  2L9B A;  4LNU D;  2UWJ G;  1OWL A;  4U96 D;  4LRZ A;  4CYM D;  4DX2 A;  3CVX A;  2WXJ A;  4HRL A;  2H6H A;  4GZ3 A;  1N4P A;  3CHM A;  2P9I G;  3NZS A;  3TXM A;  3C98 A;  4F6R D;  2BF0 X;  3CVV A;  4HRM B;  2X6H A;  1RZ4 A;  3NB2 A;  2HM8 A;  4AIF A;  4Q69 A;  1H0A A;  4PS3 A;  5B3S E;  1FPP A;  3ZFW A;  3WG7 E;  3UX4 A;  1O1S A;  2MHK A;  3J5P A;  1WAO 1;  1ELW A;  4XKB A;  2WXG A;  4GYY A;  3CSF A;  3CHO A;  3R9A B;  1E7U A;  1IQR A;  1BPO A;  4GYW A;  5AEN A;  3X2Q E;  3RRN B;  4WND A;  3T5V A;  5FIO A;  2J9Q A;  4B8C B;  4DJA A;  4L2L A;  3QAQ A;  2WXP A;  3HXF A;  4AY5 A;  3RRM B;  4DX6 D;  3FWV A;  1QNF A;  1H2T C;  4J7W A;  3RAU A;  3CHR A;  4AOF A;  5EX3 A;  4ATZ D;  1NA0 A;  2DIW A;  4A3T A;  3J5Q B;  5BNW A;  3GW4 A;  4AEZ C;  3D9K A;  4I1A A;  3L16 A;  3TWW A;  2UY1 A;  1BU9 A;  2OEW A;  2B6C A;  4LER A;  1NP7 A;  1A5E A;  1E96 B;  3MZL B;  4LSZ E;  4XIF A;  3QDN A;  2IO3 C;  5EIB E;  3C3R A;  1H6K A;  2IFU A;  2C0M A;  3HVE A;  2OVB A;  5BXU A;  1JWF A;  5IY5 E;  4YND A;  3L17 A;  4GCN A;  2CFU A;  3PZ3 A;  2IQC A;  3L08 A;  2DBA A;  3LXU X;  4G11 A;  5AQ9 A;  4CT0 A;  3W9G A;  3B13 A;  3EHN A;  4LEU A;  5CEA A;  2V0P A;  3B95 A;  5ANL A;  1XGW A;  1PAQ A;  4G24 A;  1Z6T A;  1IQU A;  3DSS A;  4L2Y A;  1DCQ A;  4HOT A;  2JAB A;  2MRI A;  3CST A;  2I2O A;  3MKQ A;  2X6K A;  3EDT B;  2WMN A;  1EYH A;  3UIO C;  5D0Q D;  4WWN A;  2RKK A;  4B8A A;  3QB2 A;  3PUJ A;  3LS8 A;  5BW8 C;  4YDY A;  3FUK A;  3BEE A;  2E0I A;  4GZ6 A;  3O48 A;  4U8H A;  2IU1 A;  2M63 A;  2BKK B;  4TUM A;  1ZU2 A;  2KM4 A;  5JMN D;  2C0L A;  2VGX B;  1N52 A;  3URZ A;  3EUV A;  4IUL A;  2WXR A;  2LSU A;  4G1T A;  2XEN A;  1E8Y A;  1JPL A;  5FIN A;  5ENS D;  2GRQ B;  3CQG B;  2RFM A;  1H2U A;  3C5R A;  2FF4 A;  3IHY A;  1P5Q A;  3UPV A;  5LP0 A;  4C0M A;  1SZ9 A;  3Q73 A;  3UM1 A;  1K8K G;  1X5B A;  4J6I A;  4U63 A;  3EHM A;  5A6C A;  4NQ0 A;  4O1P A;  2CHW A;  3D9H A;  2KZT B;  4UI9 K;  1OUV A;  4CDM A;  2GRO B;  4UI9 C;  5JHA A;  2OEV A;  2KCV A;  3B7T A;  4BSX A;  1OCC E;  1TN6 A;  5AQB A;  3P2B A;  4AM9 A;  4X8Q A;  3TAX A;  3PS6 A;  3DXM G;  3FP3 A;  2OND A;  3ULQ A;  4I17 A;  3PUK A;  4CDR A;  4B94 A;  3PNL B;  4HFG A;  4GPM A;  4N3A A;  4TV3 A;  5FJY A;  3I4R B;  5ENP D;  4YDE A;  2J4B A;  4BFR A;  1N4R A;  4FHK A;  1N0Q A;  2YIN A;  1OCR E;  4L9P A;  4XE0 A;  3HXC A;  2KXP C;  1H6P A;  3ZVV A;  3GYZ A;  3NF1 A;  5EYL A;  2R02 A;  5HRY A;  2H6F A;  4FC8 A;  4E85 A;  5ARG A;  1Z5S C;  4HNA D;  4PDX A;  2ZU6 B;  3DSX A;  4CGV A;  1Y8M A;  2V8S E;  4J8D A;  3FUJ A;  3L22 A;  4JA9 A;  1YA0 A;  2R03 A;  3PE3 A;  2NSZ A;  2ETC A;  2X6F A;  4ABN A;  3UM0 A;  2P2C P;  1TNB A;  1UJK A;  1SA4 A;  1YYH A;  2Y3A A;  1L5J A;  1YCS B;  2CHZ A;  2IO2 C;  3R7R A;  1DVP A;  3ZRH A;  2XPI A;  3AS5 A;  3D9I A;  3TG4 A;  1EF1 C;  4RVB A;  2PQN A;  4P29 A;  1MX4 A;  4NAC A;  4ACL A;  1Q2Z A;  4GML A;  4L23 A;  1UOH A;  3IV0 A;  1LF8 A;  3U66 A;  3JCK C;  4BER A;  2AXZ A;  4N3B A;  3B7R L;  3ASD A;  4M7C A;  4GZ5 A;  3FUE A;  3MCX A;  4Q96 A;  2XQ0 A;  3PEV B;  4ANX A;  2DZN A;  2WXO A;  3G2V A;  1SVX A;  3JQ1 A;  3KD7 A;  1NZN A;  2EIN E;  3V79 K;  4U8Y D;  3CVU A;  3C72 A;  3NAW A;  2DYR E;  2XRZ A;  4RQI A;  4N5C A;  4I1O B;  2GW1 A;  5J08 A;  4RSY A;  3LKU A;  5DIZ A;  3SNX A;  5D2M C;  4OVV A;  1NA3 A;  4KMO A;  4JHJ A;  3LY9 A;  3E32 A;  4PS7 A;  4WWP A;  4I9C A;  1HG2 A;  4XI9 A;  3L9T A;  3AJI A;  4ATG A;  2J08 A;  3DPD A;  2V4H C;  3BU8 A;  3CV0 A;  5FQ6 A;  4BWR A;  4YVQ C;  3L13 A;  4I6J A;  1AP7 A;  3CHQ A;  3AS8 A;  2XGO A;  3ZN3 A;  3E33 A;  1JCR A;  5FZS A;  2WXF A;  5HI7 A;  4FAD A;  4YDW A;  1HS6 A;  4KVO A;  3OXF A;  3AS4 A;  1OT8 A;  3DRA A;  3U4T A;  1HXI A;  3FH7 A;  3ZHE A;  2XPZ A;  3T8M A;  1WM5 A;  1Y6I A;  2AW6 A;  1PY1 A;  2C2L A;  3TGO A;  2KC7 A;  4GB9 A;  1IKN D;  3UXG A;  2GRP B;  2ION A;  2DYS E;  1O1T A;  1FVH A;  3LVR E;  2VYI A;  1ELR A;  1NI1 A;  2LXL A;  4XKC A;  5AN8 A;  1LTX A;  5CMW A;  2YQ8 A;  2P9P G;  4G8K A;  3TWT A;  3OXL A;  1JCS A;  3MEK A;  4JC8 A;  3UT7 A;  3KSQ A;  4K0R A;  1PC2 A;  1BD8 A;  1JCQ A;  3FUI A;  2I1J A;  3HG0 D;  4HOQ A;  5CEC B;  3LPZ A;  4UWH A;  3LY8 A;  2CHX A;  2VSY A;  3Q79 A;  4ME2 A;  4I43 A;  1W3B A;  4JHR A;  4WUY A;  2VSO E;  5T8I A;  3TJP A;  3C3O A;  3S7B A;  2QZA A;  1FT2 A;  3UTM A;  3HRA A;  5FQ8 A;  5A7D B;  3DBS A;  2A4Z A;  3EHQ A;  4DI4 A;  3UT4 A;  1MX6 A;  3MYV A;  2BTD A;  2V5F A;  5ENR D;  4DX7 D;  1S0P A;  4EHM A;  1V54 E;  3MA5 A;  4HQD A;  2HR2 A;  1TNY A;  2AXV A;  3F6Q A;  2ETB A;  2GRM A;  2X6I A;  3FFL A;  2LAI A;  5CBO A;  3I3N A;  4RLY A;  2P9S G;  4GTO A;  3FU3 A;  1SW6 A;  1JWG A;  2V4L A;  3JXJ A;  1UN9 A;  2JEK A;  2DVW A;  3CK9 A;  3RSE G;  3T9K A;  4GCO A;  4G26 A;  4FU3 A;  2J8S D;  1HU3 A;  4J0U A;  1N9A A;  3APD A;  5FQ7 A;  2X3M A;  2WB2 A;  2IY0 C;  4C9B B;  3Q9U C;  4CRW A;  1HG5 A;  2XGM A;  4DK5 A;  1UJJ A;  4JVS A;  4LNB A;  1LD8 A;  3CVQ A;  4JA7 A;  2IJG X;  4WNG A;  1KLX A;  4UI9 J;  3UM3 A;  3PDN A;  2R59 A;  2WQH A;  4K5B A;  4LCT A;  5KJM A;  3BG0 B;  4EEC A;  2ILR A;  5LFA A;  2XZT G;  3KAE A;  4JB8 P;  1BI8 B;  4HVB A;  5ENN A;  2A5E A;  3PZ1 A;  4B0Z A;  4RG6 A;  4N2S A;  3IEG A;  1UW4 B;  4U95 D;  1KT0 A;  3ASH A;  4MBG A;  4J8S A;  5ITZ F;  2LXM A;  3RU0 A;  3QKY A;  4OYS A;  3ESL A;  4D10 C;  4N5Q A;  1X81 A;  3W9F A;  2KCK A;  2RD0 A;  3O4Z A;  1QYM A;  1E8X A;  1IHB A;  3HXD A;  5M72 A;  5FQ4 A;  2CG2 A;  3ONK A;  2WXL A;  2R2L A;  3FTW A;  5EX0 A;  2KCL A;  2QC9 A;  3UIP C;  3SO8 A;  3DWL G;  2FUL A;  1TYQ G;  3CVP A;  4BY6 A;  2H6I A;  3CKC A;  4K5A B;  2FO7 A;  3Q7A A;  5CRU A;  3ZYM A;  4XEI G;  3SFX A;  1OY3 D;  4I2Z A;  1DNP A;  1E8W A;  3NQP A;  2ETA A;  4A3V A;  3CHP A;  4XI0 A;  5JA4 D;  1MZC A;  2F8X K;  4GTM A;  3RJV A;  5FZQ A;  1QQE A;  4URK A;  2ZGG A;  1Z3X A;  3ISM C;  5KJL A;  3RIB A;  4O6F A;  3SY2 A;  4BET A;  3FTS A;  1IYG A;  4KT6 B;  3QWP A;  4DX5 D;  4TUU A;  4WAF A;  3G2S A;  2BUG A;  4U0Z A;  3CVY A;  3D9J A;  2WXK A;  1SZA A;  4HOS A;  3Q75 A;  5D66 A;  4HLE A;  2LO6 A;  3ZGQ A;  3D3M A;  3ZKJ A;  3ZXS A;  2MYO A;  1MX2 A;  4Y6W A;  3B7S A;  4UWL A;  1NL4 A;  4HLL A;  4TXQ A;  1UN8 A;  3R7Q A;  4HI8 A;  4J8Y A;  3SFZ A;  2I1K A;  1MJ0 A;  3DEO A;  2P9L G;  2VGE A;  3L54 A;  4I2W A;  5T3R A;  3RKV A;  2FBN A;  2OOE A;  2QY7 A;  5KCM A;  4JHK A;  2NC9 A;  5EKQ D;  2XPY A;  3LDZ A;  3AG1 E;  3UUX A;  1WY6 A;  5ENQ D;  2Y4U A;  2VTB B;  1ELK A;  4G23 A;  4CCA A;  2L6B A;  1HFA A;  3DXK G;  4LUN U;  2F0Y A;  3S7D A;  4C48 B;  3PZD A;  2WMO A;  3UM2 A;  3CLJ A;  3BQO A;  5KJN A;  2V5Q C;  3T5X A;  4PUC A;  5G04 J;  2AVP A;  5FZR A;  3R9M A;  5KWD A;  3D9L A;  2WXH A;  3HIZ A;  3RO3 A;  4H7Y A;  3GZ2 A;  3V30 A;  4IYP A;  5AJD A;  3EJN A;  5C2Y A;  1YMP A;  3WXX A;  3ZYK A;  4K03 A;  1OWP A;  4AP2 A;  1U2V G;  2PQR A;  1OCO E;  4BX8 A;  2FEZ A;  2EIJ E;  3FUN A;  4HBD A;  3TG5 A;  2FI7 A;  3KEA A;  2AWI A;  5FWQ A;  1TN7 A;  1K1B A;  1JUQ A;  2XZD G;  4EBA A;  1VDY A;  4M3O A;  2VJ8 A;  5JJ6 A;  2KBX A;  3SQV A;  2Q7F A;  3ASF A;  4UQZ A;  2NYJ A;  2XCB A;  3P1U A;  5AIJ A;  4APF A;  3Q78 A;  4UUC A;  2B0O E;  2HO1 A;  3ASO E;  3ZIM A;  3S7J A;  1N4Q A;  2HYZ A;  3D9O A;  4GTR A;  4EZL A;  4EBA G;  3B7U X;  3SI5 A;  4L1B A;  1TR4 A;  2YHE A;  5EDS A;  3DEP A;  5CMY A;  2X6J A;  3SD5 A;  4F1S A;  4GZC A;  1KZO A;  2VGX A;  5EIL A;  1OXJ A;  4C0E A;  1OWO A;  3V2O A;  3CK8 A;  3E37 A;  5HKP A;  2WQ7 A;  4U0S A;  3FTV A;  4EPZ A;  2EQX A;  3UIN C;  4N3C A;  4BT9 A;  3FEX A;  1DC2 A;  3LEW A;  1TNZ A;  1ZBP A;  4PS8 A;  4HRN A;  4BSZ B;  1OCZ E;  3UI2 A;  2GRR B;  4WWO A;  5JJT A;  1E7V A;  3CR3 A;  3IBE A;  4ZHB A;  2CFZ A;  3AU4 A;  5EID A;  3FUM A;  3DSU A;  5JJ7 A;  2P9U G;  2KZT A;  2XEH A;  2PNN A;  2UY1 B;  3NBN B;  4NRH B;  1BLX B;  1EPU A;  1FCH A;  4KZC A;  2DZO A;  1B89 A;  4U07 A;  5G04 C;  5H7P A;  4I1M A;  3HYM B;  3ZUV B;  5BV0 A;  2F37 A;  3LJ3 A;  3D9P A;  1FVF A;  4GA1 A;  2WQ6 A;  2YHC A;  5E76 A;  1S70 B;  3E34 A;  3ZEF A;  2OCC E;  3PRZ A;  3QWW A;  2OV8 A;  3HHM A;  4DLO A;  2EIM E;  2J07 A;  4IN3 B;  1K3Z D;  3AG4 E;  4GU5 A;  4UWF A;  3CHS A;  2AJA A;  3VTX A;  4N2Q A;  3CK7 A;  3VTY A;  3DSW A;  4J8E A;  3CVW A;  3E30 A;  2J49 A;  4N39 A;  3MKQ B;  3LY7 A;  2ZGD A;  2P9N G;  5BUZ A;  4NIK A;  4CEM A;  3CGH A;  2F8Y A;  5CCL A;  3RO2 A;  5D0O D;  2FO1 E;  4Y6C A;  1H19 A;  2P58 C;  5AQ7 A;  3PVL A;  1E90 A;  2Y69 E;  2XEV A;  3EU9 A;  4TXP A;  2GGF A;  3CQC B;  4F7A A;  3CIA A;  5EYP F;  3OXG A;  2XS1 A;  3Q47 B;  2BED A;  3K9I A;  2XRY A;  3TWS A;  3FTZ A;  4ILH B;  5EN5 D;  1U3D A;  4AV7 A;  4A1G A;  2JLB A;  3FTU A;  1IXV A;  3GZS A;  5E75 A;  3VLE A;  3VLF A;  5BXO A;  2L0I A;  1N95 A;  2XGS A;  4KXK B;  4U0U A;  3APC A;  1TN8 A;  4NUR A;  4DX1 A;  4F1P A;  3MKR A;  3OTN A;  5DBK A;  1N54 A;  4XX5 A;  5B1B E;  4HOU A;  3T8K A;  4UWK A;  4JL0 A;  3Q9N C;  3Q49 B;  2IEJ A;  5C1D A;  1A17 A;  1BI7 B;  3ML8 A;  3TWV A;  2BKG A;  4GTV A;  2E2E A;  5CCM A;  4EQF A;  4ANU A;  3SHF A;  4EZK A;  3QWV A;  4QFV A;  3KS2 A;  3PZ4 A;  2VSN A;  3SBS A;  4OAV B;  4IRU A;  1D9S A;  2EIK E;  4ANW A;  5BV1 A;  1KPS B;  4JEH A;  3CKB A;  3HXE A;  3TWQ A;  4YDO A;  1KT1 A;  1V55 E;  3VLD A;  4RG9 A;  3C3Q A;  4BT8 A;  5AAO A;  5FTP A;  3QNK A;  3U64 A;  1HE8 A;  1KZP A;  2IOL A;  3QC1 A;  3OAW A;  2OVF A;  4OVU A;  4DLQ A;  3JQ0 A;  2PL2 A;  3PRE A;  3NZU A;  5BPP A;  4J8F A;  3G2W A;  3ZYQ A;  3FH5 A;  5B1A E;  3D9N A;  2DWZ A;  4FA6 A;  4DI3 A;  1HH8 A;  3U3W A;  1MYO A;  4FP7 A;  3PEU B;  5G05 J;  3S2A A;  1K1A A;  2LAH A;  4A1S A;  1S63 A;  3ZXP A;  5T4Y A;  5CER B;  3ASN E;  1XNF A;  3IHV A;  3DSV A;  2WPV A;  4AJW A;  3FTX A;  3CEQ A;  2J4D A;  1QBQ A;  1HX8 A;  5FT9 A;  2LSV A;  3ZPJ A;  4FHJ A;  4BEP A;  5LCW J;  3I4G A;  2PM7 A;  1AWC B;  4KVM A;  4AVX A;  2I9C A;  3IXE A;  4I9E A;  5LOZ A;  3QJZ A;  3BUA A;  5A23 A;  5JHB A;  1RW2 A;  2QFC A;  1NFI E;  3UKR G;  3ZYL A;  3UKU G;  4WNF A;  3CVL A;  1GW6 A;  2IOS A;  4MRU A;  1D8D A;  3FTY A; 
#chains in the Genus database with same CATH homology
 2AWI A;  2KC7 A;  5FWQ A;  4GB9 A;  3QAR A;  3MV2 B;  3N71 A;  1H2V C;  1HZ4 A;  1JUQ A;  3Q4A B;  4EBA A;  1MHQ A;  3FEY A;  1VDY A;  4V3I A;  4AY5 A;  4YVO A;  3RRM B;  4M3O A;  2ION A;  3FWV A;  1QNF A;  2VJ8 A;  1H2T C;  1FVH A;  5JJ6 A;  3LVR E;  2Q7F A;  3ASF A;  2VYI A;  4GPK A;  1ELR A;  4UQZ A;  3SZ7 A;  2XCB A;  2WM9 A;  3CHR A;  4GAA A;  4H7X A;  4AOF A;  5EX3 A;  2YNQ A;  3P1U A;  4XKC A;  1HF8 A;  3CVN A;  5AIJ A;  3FH8 A;  3QOU A;  3APF A;  4APF A;  1NA0 A;  5CMW A;  2HO1 A;  2DIW A;  2YQ8 A;  3L6A A;  4A3T A;  5BNW A;  3ZIM A;  3GW4 A;  4AEZ C;  3D9K A;  3S7J A;  3UQ3 A;  2HYZ A;  4KZ0 A;  3OXL A;  3D9O A;  4I1A A;  4R7L A;  3ENE A;  3L16 A;  3MEK A;  2UY1 A;  4EZL A;  3LCA A;  4LER A;  4JC8 A;  1NP7 A;  4EBA G;  1E96 B;  3B7U X;  4KBQ A;  2XHE A;  3MZL B;  4FLH A;  3UT7 A;  3QK0 A;  4XIF A;  1U3C A;  3QDN A;  2R17 C;  3SI5 A;  1Z3Y A;  3Q5M A;  4K0R A;  4UQX A;  1H6K A;  4APO A;  4AVX A;  4CGW A;  1PC2 A;  2IFU A;  2C0M A;  4L1B A;  3HVE A;  2OVB A;  1JWF A;  2YHE A;  5EDS A;  4YND A;  3L17 A;  4GCN A;  2CFU A;  3FUI A;  2I1J A;  2X6J A;  2IQC A;  5CMY A;  3L08 A;  2DBA A;  4ILG A;  2WVI A;  3LXU X;  4G11 A;  4UQY A;  4DPR A;  3SD5 A;  1UG3 A;  4CT0 A;  3RK6 A;  4HOQ A;  4MS6 A;  4F1S A;  4GZC A;  2VGX A;  3B13 A;  3EHN A;  3FU0 A;  3LPZ A;  4LEU A;  4UWH A;  3U9W A;  3LY8 A;  1INZ A;  2CHX A;  3ZW3 A;  4AY6 A;  2VSY A;  4C0E A;  1OWO A;  2V0P A;  4ILI A;  3CK8 A;  4L7T A;  3SBT B;  3ZHE B;  4ME2 A;  5ANL A;  1XGW A;  1PAQ A;  5ARF A;  4I43 A;  1W3B A;  4JHR A;  2WQ7 A;  4G24 A;  4WUY A;  2VSO E;  4U0S A;  5T8I A;  2LNI A;  1Z6T A;  3TJP A;  2L6J A;  3FTV A;  4EPZ A;  1IQU A;  2EQX A;  3S7B A;  4N3C A;  5BT1 A;  4BT9 A;  3FEX A;  3RRU A;  3LEW A;  4L2Y A;  1ZBP A;  5FQ8 A;  5A7D B;  2NXP A;  4PS8 A;  4HOT A;  5G05 C;  3DBS A;  2MRI A;  3MV3 B;  3CST A;  2I2O A;  3MKQ A;  2RG8 A;  4WWO A;  5JJT A;  2A4Z A;  1E7V A;  2X6K A;  3CR3 A;  4DI4 A;  3IBE A;  3UT4 A;  4F3V A;  2GRL A;  3EDT B;  4XZ4 A;  2CFZ A;  3MYV A;  2WMN A;  1EYH A;  3AU4 A;  5D0Q D;  2BTD A;  2V5F A;  4WWN A;  1S0P A;  3FUM A;  1TEZ A;  4B8A A;  3MA5 A;  5JJ7 A;  2KZT A;  2HR2 A;  3QB2 A;  3PUJ A;  2AXV A;  3UT8 A;  3LS8 A;  4FLB A;  5BW8 C;  3FHE A;  2UY1 B;  2GRM A;  3FUK A;  2X6I A;  3FFL A;  4NRH B;  3PH0 C;  4BTB A;  3BEE A;  1EPU A;  1FCH A;  2LAI A;  2E0I A;  4GZ6 A;  5CHE E;  2KAT A;  3I3N A;  3O48 A;  4KZC A;  1B89 A;  1EDU A;  4JPS A;  2L0T B;  5LCW C;  4U07 A;  3FU5 A;  3LVQ E;  5G04 C;  4I1M A;  3HYM B;  4U8H A;  5BV0 A;  4B89 A;  2IU1 A;  2M63 A;  3FU3 A;  3LJ3 A;  1JWG A;  3D9P A;  1FVF A;  2V4L A;  1UN9 A;  2JEK A;  1ZU2 A;  4GA0 A;  2KM4 A;  4GA1 A;  3CK9 A;  2WQ6 A;  2YHC A;  2C0L A;  4CDN A;  2VGX B;  5E76 A;  5HQ8 A;  3ZEF A;  3MJW A;  4GCO A;  4G26 A;  3PRZ A;  4FU3 A;  3QWW A;  1N52 A;  3URZ A;  2OV8 A;  3HHM A;  1HU3 A;  4DLO A;  4HOR A;  4IUL A;  4J0U A;  2J07 A;  2WXR A;  2LSU A;  4IN3 B;  2I6H A;  3APD A;  4G1T A;  4GU5 A;  2X3M A;  4UWF A;  3CHS A;  1E8Y A;  5FQ7 A;  3FUF A;  3IKO B;  1JPL A;  4JXT A;  4C9B B;  2WB2 A;  3VTX A;  4N2Q A;  4CRW A;  2VGY A;  3CK7 A;  2A5U A;  3CQG B;  2PM6 A;  1HG5 A;  1TJF A;  3I5P A;  2XGM A;  3VTY A;  4GZD A;  1HO8 A;  1H2U A;  3JUI A;  4DK5 A;  4J8E A;  1UJJ A;  4JVS A;  4JEU A;  3CVQ A;  4U04 A;  4JA7 A;  4MLP A;  5AYW D;  3CVW A;  2FF4 A;  2XCC A;  3IHY A;  2J49 A;  1P5Q A;  2IJG X;  4N39 A;  4WNG A;  1KLX A;  4UI9 J;  2WXI A;  4FJY A;  3MKQ B;  3PDN A;  2R59 A;  2WQH A;  4LCT A;  4TRQ A;  3ML9 A;  5KJM A;  3UPV A;  5LP0 A;  4C0M A;  3BG0 B;  1SZ9 A;  4G25 A;  3LY7 A;  4EEC A;  1OWM A;  1X5B A;  2ILR A;  5BUZ A;  3ONL A;  2WXN A;  3TXN A;  4CEM A;  4J6I A;  5LFA A;  4U63 A;  3KAE A;  3EHM A;  5A6C A;  3CGH A;  4NQ0 A;  5CCL A;  3RO2 A;  5D0O D;  1QZ2 A;  4Y6C A;  1H19 A;  2CHW A;  2P58 C;  3TL5 A;  4HVB A;  2KZT B;  5ENN A;  4UI9 K;  1OUV A;  3PVL A;  4CDM A;  4B0Z A;  1E90 A;  5G2N A;  3KEZ A;  4UI9 C;  4RG6 A;  5JHA A;  2XEV A;  4N2S A;  2KCV A;  3IEG A;  3B7T A;  4BSX A;  1UW4 B;  1KT0 A;  3P2B A;  3ASH A;  2IF4 A;  4J8S A;  2GGF A;  4AM9 A;  3CQC B;  3TAX A;  3PS6 A;  3CIA A;  4F7A A;  5KJK A;  3FP3 A;  4GA2 A;  3OXG A;  2OND A;  3ULQ A;  3RU0 A;  3AU5 A;  2DCP A;  4I17 A;  3PUK A;  3Q47 B;  3QKY A;  3K9I A;  4CDR A;  4CT4 A;  2XRY A;  4B94 A;  3JYS A;  3PNL B;  4OYS A;  4ACK A;  4I6E A;  3ESL A;  4HFG A;  4MKT A;  4D10 C;  3FTZ A;  4ILH B;  4N3A A;  1U3D A;  4AV7 A;  4A1G A;  4TV3 A;  1TJC A;  2JLB A;  3FTU A;  2KCK A;  3GZS A;  2RD0 A;  3O4Z A;  5E75 A;  1E8X A;  5FJY A;  3VLE A;  2WXQ A;  3I4R B;  5AJL A;  3VLF A;  4BTA A;  2J4B A;  4BFR A;  4FHK A;  5M72 A;  2L0I A;  5FQ4 A;  2YIN A;  4JZY A;  2CG2 A;  3ONK A;  4UWG A;  3Q15 A;  2WXL A;  2XGS A;  3EIQ C;  3FTW A;  5EX0 A;  2KCL A;  5J90 A;  3GZ1 A;  4KXK B;  4XE0 A;  3S7F A;  2FUL A;  3E4B A;  3MX3 A;  4U0U A;  4W9R A;  3FUD A;  3CVP A;  3ZVV A;  4BY6 A;  3GYZ A;  3APC A;  3NF1 A;  2X38 A;  4NUR A;  3CKC A;  4E6H A;  2WXM A;  3MKR A;  2FO7 A;  3OTN A;  5DBK A;  4FC8 A;  3HDX A;  1N54 A;  3ASG A;  4XX5 A;  4E85 A;  4FJZ A;  4HOU A;  3MGB A;  5ARG A;  4PDX A;  2ZU6 B;  5ANR A;  3ZYM A;  4CGV A;  1Y8M A;  4UWK A;  3G2U A;  2V8S E;  4J8D A;  4JL0 A;  3FUL A;  4I2Z A;  3SF4 A;  1DNP A;  1E8W A;  3Q49 B;  3NQP A;  5LX8 A;  4ANV A;  4A3V A;  3CHP A;  3HVE B;  4XI0 A;  2CG3 A;  5C1D A;  1A17 A;  3BG1 B;  3FUJ A;  3L22 A;  4JA9 A;  1YA0 A;  3ML8 A;  3RJV A;  1E8Z A;  2E2E A;  5FZQ A;  1QQE A;  4URK A;  3PE3 A;  4KYO B;  1Z3X A;  5CCM A;  2NSZ A;  2X6F A;  4EQF A;  3G2T A;  4BX9 A;  4ABN A;  5KJL A;  3RIB A;  4ANU A;  1UJK A;  4F53 A;  5G55 A;  3SHF A;  4O6F A;  2VSX E;  2VTB A;  2Y3A A;  2AXU A;  1L5J A;  4EZK A;  4G2V A;  2CHZ A;  3FDH A;  3QWV A;  3FTS A;  4GYO A;  3R7R A;  1IYG A;  2R5S A;  4QFV A;  2MOW A;  1DVP A;  3KS2 A;  4KT6 B;  3ZRH A;  2VSN A;  2XPI A;  3AS5 A;  3D9I A;  3QWP A;  3TG4 A;  4TUU A;  1EF1 C;  4RVB A;  2PQN A;  4WAF A;  3SBS A;  3G2S A;  2BUG A;  4P29 A;  4IRU A;  4PH4 B;  5BV1 A;  4ANW A;  4JW1 A;  4NAC A;  4U0Z A;  3CVY A;  2VQ2 A;  4JEH A;  4ACL A;  3CKB A;  3D9J A;  2PZI A;  2WXK A;  1SZA A;  3FY4 A;  4GML A;  3UMV A;  4HOS A;  4L23 A;  4EZJ A;  3IV0 A;  1LF8 A;  3U66 A;  4WNE A;  4HLE A;  2Y4T A;  1KT1 A;  2LO6 A;  3JCK C;  3ZGQ A;  3D3M A;  2AXZ A;  4N3B A;  3B7R L;  4FUL A;  3ASD A;  3VLD A;  4HXI A;  4RG9 A;  4BT8 A;  3PE4 A;  3ZXS A;  4GZ5 A;  5FTP A;  4Y6W A;  3D9M A;  3B7S A;  3FUE A;  3MCX A;  3QNK A;  2XQ0 A;  4Q96 A;  3PEV B;  4UWL A;  3U64 A;  4ANX A;  1HE8 A;  2IOL A;  3QC1 A;  1OWN A;  3OAW A;  2OVF A;  3PNT B;  2WXO A;  3G2V A;  3FU6 A;  1UN8 A;  4OVU A;  3R7Q A;  4DLQ A;  2J09 A;  3SFZ A;  1MQS A;  1IHG A;  2I1K A;  3JQ0 A;  3LYA A;  4GMJ A;  2PL2 A;  3JQ1 A;  3KD7 A;  3PRE A;  3FUH A;  1NZN A;  3NZU A;  4HS2 A;  4I6G A;  5BPP A;  4J8F A;  1SQM A;  3SGH A;  3G2W A;  3ZYQ A;  4AXH A;  3L54 A;  4I2W A;  3ESK A;  3EIJ A;  4A55 A;  3CVU A;  3FH5 A;  5T3R A;  4Q94 A;  3RKV A;  3D9N A;  2FBN A;  2L9B A;  2OOE A;  4FA6 A;  2UWJ G;  1OWL A;  2QY7 A;  5KCM A;  2XRZ A;  4DI3 A;  1HH8 A;  4JHK A;  2NC9 A;  3U3W A;  4N5C A;  4LRZ A;  5EKQ D;  4FP7 A;  3CVX A;  4I1O B;  2WXJ A;  2GW1 A;  2XPY A;  3LDZ A;  3PEU B;  5G05 J;  5J08 A;  4RSY A;  3S2A A;  3LKU A;  5DIZ A;  4GZ3 A;  3SNX A;  3UUX A;  3CHM A;  1WY6 A;  3NZS A;  4OVV A;  2Y4U A;  1NA3 A;  2LAH A;  4KMO A;  3TXM A;  2VTB B;  1ELK A;  4JHJ A;  4A1S A;  3LY9 A;  3C98 A;  4PS7 A;  4WWP A;  4I9C A;  1HG2 A;  4G23 A;  4XI9 A;  5T4Y A;  4CCA A;  1XNF A;  2BF0 X;  1HFA A;  3CVV A;  3IHV A;  4ATG A;  2X6H A;  2J08 A;  3DPD A;  2WPV A;  4AJW A;  3FTX A;  2HM8 A;  3CEQ A;  4LUN U;  4AIF A;  3S7D A;  3CV0 A;  5FQ6 A;  2J4D A;  4BWR A;  4Q69 A;  1HX8 A;  1H0A A;  4YVQ C;  4PS3 A;  5FT9 A;  3L13 A;  3PZD A;  4I6J A;  2LSV A;  3ZFW A;  2WMO A;  3UX4 A;  3ZPJ A;  2MHK A;  3CLJ A;  1WAO 1;  5KJN A;  1ELW A;  4FHJ A;  3T5X A;  3CHQ A;  3AS8 A;  4PUC A;  5LCW J;  2XGO A;  3I4G A;  5G04 J;  2AVP A;  2PM7 A;  5FZR A;  4XKB A;  3ZN3 A;  4KVM A;  2WXG A;  3D9L A;  4GYY A;  2WXH A;  2I9C A;  3CSF A;  3CHO A;  2WXF A;  3HIZ A;  5FZS A;  5HI7 A;  4H7Y A;  3R9A B;  3GZ2 A;  3RO3 A;  1E7U A;  4I9E A;  4FAD A;  4IYP A;  5LOZ A;  1BPO A;  1IQR A;  1HS6 A;  3QJZ A;  5AJD A;  4GYW A;  4KVO A;  5A23 A;  5AEN A;  3OXF A;  5JHB A;  3AS4 A;  3EJN A;  5C2Y A;  3WXX A;  3ZYK A;  4K03 A;  3RRN B;  1OWP A;  2QFC A;  4WND A;  3U4T A;  4AP2 A;  3T5V A;  4B8C B;  2J9Q A;  2PQR A;  3ZYL A;  4BX8 A;  1HXI A;  3FH7 A;  2XPZ A;  2FEZ A;  3FUN A;  4WNF A;  3T8M A;  1WM5 A;  3ZHE A;  1Y6I A;  3TG5 A;  3CVL A;  2AW6 A;  1PY1 A;  2C2L A;  4DJA A;  2FI7 A;  1GW6 A;  2IOS A;  4L2L A;  3QAQ A;  4MRU A;  3FTY A;  2WXP A;  3TGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...