3KD7A

Designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
102
structure length
102
Chain Sequence
NSAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a designed tetratricopeptide repeat module in complex with its peptide ligand.
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
molecule keywords CTPR390
total genus 41
structure length 102
sequence length 102
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3kd7A00
2IFUA 3LKUA 2KCKA 4JL0A 1ELRA 2C0LA 1P5QA 2HO1A 3ESKA 4XI0A 4BTAA 3CK8A 2ONDA 3CVNA 3Q4AB 3OXLA 4U0UA 4H7YA 3TGOA 3CVQA 5D0QD 2P58C 2YHCA 2YQ8A 2C0MA 3QDNA 4GYYA 4U0ZA 3RO3A 1E96B 3Q49B 3SZ7A 4YNDA 5AYWD 1NA0A 4WNDA 2V5FA 4J8FA 2PQNA 3GYZA 3QWPA 3KAEA 3PE4A 4I2WA 2Q7FA 3GZ1A 4UQZA 4N2QA 4G25A 4GPKA 3LPZA 1QZ2A 3OXGA 2FF4A 4GCOA 4IN3B 4I1AA 3O48A 5FZSA 3K9IA 1Y8MA 3KD7A 3RKVA 4XIFA 2C2LA 2MHKA 3U4TA 2WPVA 5LCWC 3FFLA 3IEGA 4WUYA 3UPVA 1ZBPA 2Y4UA 3URZA 3JYSA 3TG5A 2FEZA 2KCVA 4KYOB 3UUXA 1NA3A 5BW8C 3S7FA 5KJKA 4I9CA 3Q5MA 4CDRA 5M72A 2XCBA 4RG6A 3Q15A 5CCMA 4APOA 3TAXA 1XNFA 3MA5A 4UI9J 3BEEA 4Y6CA 5JJ6A 2HYZA 3CKCA 3R9AB 5C1DA 3UQ3A 3EDTB 2KC7A 2XGMA 5ARGA 3LY8A 3VTYA 1NZNA 2FO7A 4WNFA 4AY5A 1KLXA 3FP3A 4J8EA 4UQYA 4XI9A 2I6HA 2XGOA 3QOUA 1IYGA 1HH8A 3ZPJA 4BTBA 2VSYA 3MV3B 4I2ZA 2UWJG 2XPIA 1W3BA 3N71A 2J9QA 2E2EA 4G26A 4N3CA 3AS8A 1FCHA 4F3VA 4GZ3A 5G05J 2KATA 4WNEA 4KXKB 4U07A 5FZQA 1IHGA 2GW1A 3RIBA 3ASDA 2QFCA 3ASHA 3CV0A 4KBQA 4AM9A 5BNWA 4I17A 4GYOA 4ME2A 4ABNA 3PDNA 3Q47B 3QWWA 3WXXA 4A1SA 4BT8A 3S7JA 4BWRA 3S7DA 5HI7A 4CGVA 5A7DB 1KT0A 4N5CA 3MEKA 4UI9C 3CKBA 4GA0A 4NRHB 5DBKA 5LCWJ 1HZ4A 5HQ8A 3ASGA 4N39A 1QQEA 4WNGA 4CGWA 2R5SA 3OXFA 3CK7A 4JA9A 4RG9A 1KT1A 3ULQA 5EX3A 3FWVA 4G24A 3ASFA 3ZGQA 2PZIA 3GW4A 5A6CA 1WAO1 5FT9A 2PL2A 2XEVA 3HYMB 4AY6A 3RO2A 3E4BA 2BUGA 2UY1B 2VGXB 2VYIA 4GA1A 5G04C 3RU0A 5CHEE 5KJMA 3AS5A 3PE3A 4GCNA 3MV2B 4GZ6A 4LEUA 5JJTA 2XGSA 3AS4A 2IF4A 2OOEA 2VSNA 3U3WA 4W9RA 3LY7A 4UI9K 4HOQA 2LNIA 2JLBA 5FJYA 4Y6WA 3KS2A 4N2SA 2LSUA 2VGYA 4U0SA 2XCCA 2NC9A 3RJVA 1ELWA 3SF4A 5G05C 3QKYA 3GZ2A 5FZRA 2KCLA 3LYAA 4HOUA 4J0UA 3VTXA 5FTPA 2VQ2A 2HR2A 4HORA 2LSVA 4YVQC 4HOTA 1ZU2A 3CVLA 3QWVA 2Y4TA 1B89A 2FBNA 4G23A 1A17A 4UQXA 2DBAA 5JJ7A 3TG4A 4G1TA 2UY1A 2VGXA 4N3AA 4J8DA 5EX0A 4U04A 4HOSA 3ZN3A 3CEQA 3LCAA 1YA0A 3LY9A 4GYWA 4GZ5A 4I9EA 5D0OD 5G04J 4B94A 2PQRA 4EQFA 5BT1A 4N3BA 3MKRA 4AIFA 5ARFA 4NQ0A 5EKQD 3CVPA 2L6JA 4BT9A 3ZHEB 2FI7A 1OUVA 1TJCA 3CK9A 4G2VA 5KJLA 4JA7A 5CCLA 3ZHEA 1PC2A 4O6FA 5KJNA 5DIZA 3ZFWA 4GA2A 1WM5A 4JHRA 4YVOA 3NF1A 2WQHA 1HXIA 3S7BA 2AVPA 4H7XA
chains in the Genus database with same CATH superfamily
2C0LA 3OXLA 2J09A 4OVUA 4GTMA 3SBSA 2RFMA 4LUNU 1TNYA 2WB2A 4N2QA 3R7QA 4EHMA 1E7UA 4GPKA 3CHSA 2FF4A 4DUIA 1HG5A 4IN3B 4B0ZA 3Q5MA 3CQGB 4GTSA 5JJ6A 5CMWA 3CKCA 4FC8A 3UQ3A 2IOLA 3QJZA 5ARGA 3T8MA 1NZNA 4BX8A 4AVXA 3ZW3A 3CV0A 1O1RA 4BSZB 3B7UX 2XQ0A 3TJPA 4Z68A 1N54A 4GB9A 4K03A 5KBAA 3DBSA 4GAAA 3LXUX 3Q73A 5LCWJ 4J7WA 1HF8A 1N95A 3QK0A 3CVXA 1UG3A 5JJTA 1WDYA 5KWDA 2GRNB 3FH5A 2VSNA 2WXOA 1HX8A 3HRAA 4F1SA 3KSLA 3LYAA 1N94A 1VDYA 5FTPA 2EIJE 1U3CA 5H7PA 5JJ7A 4NIKA 1HG2A 4RVBA 3AU5A 4AIFA 1IQRA 1DC2A 3E37A 3CVPA 4TXRA 3VLDA 2P9UG 3T5VA 3C3QA 4PH4B 2WQHA 1O1SA 4HVBA 4JL0A 5EIBE 1TN7A 1SVXA 3CVNA 4PS8A 3FTVA 3OAWA 1TNBA 4OYSA 3IXEA 3J5QB 2PQNA 3GYZA 3PE4A 3AAAC 4CDMA 4G25A 4MKTA 5B3SE 3PNTB 2V4HC 2P9KG 3KD7A 3ZYQA 2XHEA 3IEGA 2EIKE 4A3TA 3TG5A 4EBAG 5BW8C 5CMYA 2XCBA 3HIZA 2JABA 2WVIA 3B7SA 5IY5E 4CRWA 3PZ2A 1E7VA 2IONA 3MV3B 4ANVA 2UWJG 2E2EA 1TR4A 2LXMA 2QY7A 3D9IA 2KXPC 1QNFA 3EU9A 3HHMA 4CEMA 2J08A 3APCA 3DEOA 1O5MA 2WXRA 5FQ4A 3ASGA 1QQEA 3QB2A 3S2AA 2XEVA 4AY6A 3ABKE 5KCMA 3TXNA 2OOEA 5G55A 1DNPA 3C5RA 3BU8A 3RRMB 4GZDA 2LSUA 2B6CA 5G05C 1HO8A 2P9SG 3DPYA 2J49A 3L6AA 4U8VD 4GYWA 3LY9A 2WXIA 4G8KA 3D9KA 1WG0A 4PS3A 3UKUG 2FI7A 2XRYA 2OVBA 4L2YA 3JUEA 4O6FA 3I5PA 3V30A 4B89A 3ZNGA 2XENA 1BPOA 2IFUA 4ANXA 2HO1A 4BSXA 2V5QC 2XS8A 3CSTA 1SA4A 3ZEFA 2YQ8A 5T3RA 5EILA 3CVYA 2DWZA 3K9IA 3NQPA 3FY4A 4DI3A 2PNNA 2FEZA 4O1PA 1MYOA 4I9CA 2HYZA 5T4YA 3LY8A 3HVEB 1OWOA 3JCKC 4I2ZA 4L2LA 1BD8A 5ENQD 4J6IA 4GYOA 3B7TA 4U8YD 5AARA 2NYJA 3PVLA 4LRZA 2LO6A 3ISMC 2VYIA 4JPSA 5KJMA 2J4BA 1Q2ZA 4ILHB 3RJVA 2XCCA 2NC9A 5LOZA 2I2OA 3JXJA 1QBQA 4PS7A 3EHNA 4B94A 4HNAD 4APFA 3NOCD 4BFRA 4ATGA 2B0OE 2L6JA 2KZTB 3SO8A 3D9MA 3L82A 3HXDA 1OWNA 3TWRA 5ENOD 4YVOA 5ANLA 2HM8A 2WMOA 1OCZE 4LCTA 3CVQA 4GYYA 1E96B 4AP2A 4WAFA 4HBDA 3D9HA 1QZ2A 2BTDA 3PNLB 2I9CA 1MJ0A 1BLXB 3NB2A 3UI2A 4CDRA 4RG6A 5CCMA 3UIOC 1XGWA 3R9AB 3FEYA 1KLXA 2A5EA 1N0QA 2VSYA 2XPIA 2J9QA 4WWNA 1H2VC 5LFAA 1E90A 1SQMA 3S7DA 4CGVA 4TUUA 1K1BA 2V4LA 2PM6A 1HZ4A 4TV3A 1NI1A 4B93B 3DXMG 4FU3A 3Q78A 3RU0A 3FTZA 1IKND 1E8XA 3JXIA 3LY7A 3SF4A 2M63A 5FZRA 3UM0A 5BXOA 4LNBA 4DX6D 4O1OA 4G1TA 1Z6TA 4TRQA 2QC9A 2R02A 4EPZA 3TWSA 3TWUA 1UJKA 2IU1A 2OCCE 3LVRE 3L22A 3LS8A 3FEXA 4XKBA 2F8YA 1JWGA 1OCCE 2GRQB 3SBTB 4ATZD 5CEDB 5KNGA 3RK6A 1U3DA 2EIME 4GCOA 4BX9A 2Y1LE 3RSEG 3UPVA 3CLJA 3CQCB 1ZBPA 3Q15A 2QZAA 3T9KA 3FP3A 3ZPJA 1N11A 2MYOA 2KM4A 4KXKB 4Q94A 5AQ9A 1HU3A 3FU0A 3DPDA 5HKPA 2OVFA 3AG3E 4RQIA 4AJWA 5HQ8A 4G11A 1N9AA 3HXFA 4OAUC 3B7BA 3ASFA 3ZGQA 5AN8A 1TNOA 3ZUVB 3ULEG 5CERB 2IF4A 2R17C 2WXFA 4GTTA 2V0PA 1NL4A 4O60A 4FULA 5ENSD 3HDXA 2ZU6B 3QAQA 1B89A 4TXPA 2LAIA 2WXHA 2R2LA 2VGXA 4U8HA 3TL5A 4J8DA 2YNQA 3CR3A 3LCAA 5D0OD 2XZTG 5BT1A 2PQRA 4N3BA 1FVFA 3UXGA 1MX6A 3CHRA 1HXIA 3TWVA 4H7XA 1LF8A 2IOSA 3E30A 4BTAA 2A5UA 4ILIA 4U95D 4NURA 2YHCA 3QDNA 4U0ZA 4YNDA 5AYWD 3UM1A 1Z3YA 5FINA 1N4RA 2FO1E 3U4TA 3JYSA 1H2TC 3AG4E 1INZA 4FADA 4MS6A 3CHOA 1UJJA 5EYPF 2CFUA 3QOUA 4N5CA 3LJNA 4GZ3A 2J8SD 4WWOA 3V2XA 4UI9C 4GA0A 2R5SA 4JXTA 5J08A 1Z3XA 4WWPA 3GW4A 2P9LG 3AG2E 3UIPC 3DWLG 4W9RA 2IJGX 3PUKA 1BI8B 2CHZA 2WXGA 5JHBA 1Y6IA 5ENNA 3T5XA 4URKA 4JEHA 3SFZA 3FUIA 2FBNA 3IHVA 1AWCB 4TUMA 3KEAA 4I6GA 3HVEA 3O4ZA 2X6IA 4GTPA 2DCPA 2GRLA 1BU9A 4JA7A 3ZHEA 4B8CB 1BI7B 4DLQA 1V54E 3IV0A 3ESLA 3MGBA 1X81A 3CHMA 3Q49B 2V5FA 3KAEA 5FZSA 3PUJA 3FH8A 4HLLA 2WXNA 5M72A 5T8IA 3G2SA 1FT2A 4HRLA 3RAUA 4IULA 2XGMA 1IQUA 2A4ZA 4HXIA 2FO7A 4XI9A 3R9MA 1HH8A 3RRUA 5DBKA 1FT1A 3FTUA 1JPLA 4XZ4A 4E6HA 4A55A 5BNWA 4ABNA 2CG3A 3QWWA 3PZ1A 4ACKA 3Q75A 3CHPA 1LD7A 3TWWA 1E8YA 2VGXB 4GA1A 4UWHA 5J90A 2J4DA 4ANUA 3QNKA 1ELWA 1UN8A 3GZ2A 1TNUA 3CIAA 3PH0C 3F6QA 2LSVA 4HORA 3CVLA 4UQXA 4JVSA 3UINC 2AXZA 4U04A 4IRUA 3DXKG 4FJZA 4KZCA 4ZHBA 3G2TA 3UT8A 3U64A 4TXQA 1S0PA 4XKCA 1JCQA 1OCRE 3O48A 1K8KG 3FU3A 2BKGA 5CRVA 3B95A 4GPMA 4UWKA 2X6KA 3D9OA 4OVVA 2Q7FA 1S63A 1KZPA 2ZXWE 3OXGA 4EZKA 3CSFA 3L08A 2L0TB 2OEVA 4DRXE 4CCAA 1OXJA 2IO3C 3FH7A 3TWTA 3EDTB 4AXHA 4MLPA 4WNFA 2WXJA 2XGOA 4MBGA 3LJ3A 1PY1A 4ACLA 4CGWA 1W3BA 3N71A 2VJ8A 5G05J 5FZQA 2GW1A 3PZ3A 3VLFA 2RKKA 3AG1E 3PREA 4BWRA 1KT0A 3MEKA 3B13A 3T8KA 3JQ1A 3QARA 1ELKA 3FWVA 4BERA 5A6CA 1UOHA 1S64A 1H2UA 1L5JA 3LEWA 3MKQA 3AS4A 3FULA 2GROB 4C48B 3CVUA 5HS0A 3SQVA 2WXPA 3SNXA 1SZAA 2DYSE 4YVQC 3W9GA 3FTSA 4G23A 4HOSA 3ONLA 4RLYA 3SFYA 4BT9A 3EU5A 2BKKB 4M3OA 1TJCA 3CK9A 4FJYA 3S7BA 2AVPA 1P5QA 3UMVA 2VSOE 5D2MC 3Q7AA 3B7RL 5JA4D 4MRUA 1Y8MA 4U96D 3ONKA 4I1MA 1MHQA 2NXPA 2P9IG 2X6HA 2KCVA 4I6EA 1QYMA 3BUAA 3BEEA 3DSUA 5BV1A 1FPPA 3RRNB 2I6HA 4HFGA 1OT8A 4G26A 1G3NB 4N3CA 3HXEA 1U2VG 1DCQA 1N4QA 4B8AA 3P2BA 4M7CA 3Q47B 2L0IA 4DX7D 3ABME 3FTXA 4FLBA 1TN8A 4JA9A 5FT9A 1HFAA 5G04C 3PE3A 2XGSA 4CT4A 4L9PA 4K5AB 4BESA 4BEPA 2QYJA 2VQ2A 3TXMA 1ZU2A 2Y4TA 5AJLA 2RD0A 1H6KA 3CEQA 1TEZA 1FVHA 5JHAA 4GMRA 3SFXA 4JC8A 2JEKA 4KVOA 4HQDA 2AXUA 2DIWA 5JMND 3FUHA 2DVWA 5ITZF 4XI0A 3CVWA 4JHJA 4JW1A 3CK8A 2ONDA 2WXLA 5D66A 1NA0A 2V8SE 3APDA 1H19A 2LAHA 2X3MA 2P2CP 1OWPA 3UM2A 3AJIA 3NZSA 4GMJA 3EHMA 4DJAA 2F0YA 5AENA 2GGFA 1XNFA 3MA5A 1IHBA 2CHXA 1KPSB 4AY5A 5E76A 2XEEA 3Q79A 1FCHA 4AOFA 1OCOE 4K0RA 4HI8A 4Q96A 1N4PA 3CGHA 4PDXA 3W9FA 3FUEA 2ILRA 4N39A 4JZYA 5KNHD 3HYMB 4OAVB 3E4BA 4CDNA 3AS5A 4GCNA 4HOQA 2LNIA 2P9NG 4N2SA 4DX1A 2KCLA 4J0UA 4L23A 1HE8A 5BUZA 3MYVA 1JUQA 2DYRE 4R7LA 2YINA 3I4GA 1SW6A 2H6GA 5EIDA 4N5QA 3DSWA 4GA2A 3NF1A 4PUCA 2I1KA 3ZYKA 1S70B 2KCKA 4Q69A 3UM3A 4JD2G 5D0QD 2C0MA 4DX2A 3C3OA 4WNDA 3Q9NC 4I2WA 4C9BB 1LTXA 3APFA 3PZDA 3U66A 4E85A 3DSXA 4XIFA 2WPVA 2GRRB 4X8QA 2ETBA 3FDHA 1NA3A 5KJKA 3NBNB 3IHYA 5C1DA 4UI9J 4Y6CA 2XPYA 3NAWA 3DSVA 2F37A 3EHQA 4DI4A 2ZGDA 4UQYA 4IYPA 3PRZA 5CECB 4F3VA 3BG1B 5EYLA 4ANWA 3ASHA 3FUKA 4ME2A 5A7DB 4I1OB 3L16A 3JQ0A 4NRHB 1WY6A 3FUFA 4RG9A 2WM9A 4YDWA 5C2YA 2PL2A 3RO2A 2WXKA 2VTBA 4EECA 4AV7A 1DCEA 2MOWA 3PZ4A 5ENTD 3LDZA 3FTYA 3EIQC 4RSYA 1SA5A 3D9NA 2XRZA 2VGYA 2ZIRA 5BPPA 2HR2A 4HRMB 3TWQA 3ZXSA 2DBAA 3IKOB 4ZFHA 2GRMA 2EINE 3UX4A 3UTMA 2RG8A 3ENEA 5DIZA 3ZFWA 3KEZA 1E8ZA 4YDOA 4HOTA 3MZLB 3LKUA 4LERA 4K5BA 3RO3A 1H0AA 4P29A 2H6HA 3GZ1A 2CHWA 5B1AE 3URZA 1D9SA 1YYHA 4DPRA 3C72A 3R7RA 2X6FA 3E33A 4HLEA 1TNZA 1SZ9A 3AS8A 1N4SA 2KATA 4F53A 2J07A 3L54A 3FHEA 2GRPB 3BQOA 4A1SA 4GTVA 4G8LA 1MX4A 1H6OA 2RFAA 4J8YA 4K5CA 3ZKJA 1K3ZD 3OXFA 4XX5A 4GU5A 4G24A 2PZIA 2LXLA 1TJFA 5CHEE 3MV2B 4LEUA 3L17A 3HXBA 2H6IA 3ZVVA 1HS6A 2IQCA 2DZOA 3ZRHA 3EUVA 5BV0A 2UY1A 3MX3A 3FTWA 3ZN3A 4EQFA 2R05A 3Q7FA 5EKQD 5ENPD 4L7TA 3EHRA 3ML8A 4G2VA 4I43A 1ELRA 2IY0C 4U7EB 3ASOE 3TGOA 2P58C 1JCSA 4JHKA 3I3NA 4AEZC 1NFIE 4UQZA 2E0IA 2H6FA 3LPZA 1MX2A 4YDYA 3RKVA 5CBOA 3CHQA 3FFLA 2XPZA 4CT0A 2Y4UA 3MJWA 2WQ6A 3TAXA 3U9WA 5FQ8A 2IEJA 2WXMA 3ZXPA 1MQSA 3ZYLA 3NOGD 3UUXA 4FHJA 4U07A 3ASDA 5CEAA 4GTRA 1N0RA 3WXXA 5FWQA 4UWLA 2P9PG 1D8EA 4F7AA 3CVVA 4FLHA 2ZISA 4QQIA 3C3RA 3HG0D 2YHEA 3TWXA 5AQAA 2QYUA 1JCRA 4UI9K 4EZLA 2Y3AA 5FJYA 4Y6WA 1TN6A 3UT7A 4HI9A 3FUNA 3E32A 3VTXA 4A63B 1EYHA 4KVMA 5AQ7A 4I6JA 1A17A 1RZ4A 4ILGA 2OEWA 3MKRA 3PEVB 4C0MA 3ZHEB 1OUVA 4JEUA 4UUCA 5G2NA 5CCLA 2NSZA 4KT6B 5AAOA 1PAQA 2WMNA 4CYMD 4LNGA 3X2QE 4D10C 3ESKA 3DSSA 4HRNA 3QWPA 3EJNA 4UWGA 3QC1A 1JWFA 5ANRA 2AJAA 4DK5A 4KZ0A 2C2LA 2MHKA 4A3VA 3JUIA 3S7FA 2KC7A 3I4RB 5AJDA 3IBEA 4BTBA 2OV8A 1TYQG 2QFCA 4KBQA 3MCXA 2X6JA 4L1BA 3DEPA 2ETAA 3D9LA 4FHKA 3G2VA 1OWLA 3ULQA 2XEHA 2WQ7A 2BUGA 2UY1B 4HS2A 4GZ6A 1EDUA 3ZIMA 1A5EA 2EILE 3KS2A 4U0SA 2BEDA 1AP7A 3QKYA 4LG6A 3QWVA 1MZCA 3OTNA 4N3AA 4GTOA 5EX0A 1UN9A 4GZ5A 2PM7A 3FU5A 2VTBB 1V55E 5AQBA 4U63A 4DLOA 1Z5SC 2AWIA 1PC2A 5KJNA 2ZGGA 4LNUD 3Q4AB 2KBXA 5EN5D 3SZ7A 5BXUA 5CRUA 4J8FA 3ASNE 1LD8A 4YDEA 1K1AA 4I1AA 5FQ6A 5B1BE 5LCWC 4WUYA 3D9PA 4FA6A 3PEUB 3GZSA 4XE0A 4FP7A 3SD5A 2MRIA 3VTYA 2AXVA 2I1JA 1GW6A 1IYGA 2VSXE 3FUMA 3SGHA 3NZUA 3BG0B 4WNEA 4C0EA 1IHGA 3RIBA 4XEIG 5HRYA 4QFVA 3UKRG 2LUHA 2BF0X 3ML9A 2WXQA 2Y69E 3CKBA 2XZDG 1KZOA 4CZ2D 3CK7A 1KT1A 5EX3A 3C98A 1EF1C 1H6PA 3E34A 2CFZA 3L13A 3EIJA 3V31A 1EPUA 4HB5A 2XS1A 3MKQB 4HOUA 1E8WA 4KMOA 3J5PA 4F1PA 4BY6A 1X5BA 2L6BA 1ZB1A 4I9EA 3WG7E 3PS6A 2R03A 3ULYA 3KSQA 3DSTA 1UW4B 3FU6A 3V2OA 3FUDA 3ABLE 1WM5A 4JHRA 3VLEA 4GZCA 4JB8P 3DRAA 3L9TA 4V3IA 2DZNA 4A1GA 3D9JA 4U0UA 3ZYMA 4H7YA 4APOA 5EDSA 4EBAA 4GTQA 1OY3D 4F6RD 2IO2C 1D8DA 4KYOB 4DX5D 3G2WA 3G2UA 2HE0A 1O1TA 3HXCA 2L9BA 3FUJA 2EQXA 4J8EA 5AIJA 5CBNA 2R59A 3ZU7B 4EZJA 5LX8A 3LVQE 5ENRD 3AU4A 2KZTA 4I17A 4BT8A 2FULA 3PDNA 3S7JA 5HI7A 5E75A 2F8XK 4LSZE 3SI5A 1IXVA 2Y0BG 4WNGA 3D3MA 3SY2A 3P1UA 1YCSB 1N52A 1WAO1 1NP7A 5FQ7A 3U3WA 2JLBA 2X38A 4BETA 5LP0A 1RW2A 2VGEA 4GMLA 5A23A 4UWFA 2ETCA 3UT4A 3TG4A 4NACA 3V79K 5FIOA 5G04J 1YA0A 3Q9UC 2AW6A 5ARFA 4NQ0A 1DVPA 1YMPA 4J8SA 1OWMA 2CG2A 5KJLA 3SHFA 4AM9A
chains in the Genus database with same CATH topology
3LVRE 1ELRA 2C0LA 1P5QA 3L22A 3LS8A 3FEXA 4XKBA 3OXLA 1JWGA 2J09A 4OVUA 3UMVA 3SBTB 3TGOA 2P58C 3SBSA 4JHKA 2VSOE 4LUNU 3I3NA 3B7RL 2WB2A 4AEZC 4UQZA 3R7QA 4N2QA 2E0IA 1E7UA 3LPZA 3RK6A 4GPKA 1U3DA 3CHSA 2FF4A 4GCOA 1HG5A 4IN3B 4B0ZA 4BX9A 4MRUA 1Y8MA 3RKVA 3CHQA 3ONKA 4I1MA 1MHQA 2NXPA 3UPVA 3FFLA 2XPZA 3CLJA 3CQCB 4CT0A 1ZBPA 2X6HA 2Y4UA 2KCVA 3MJWA 3Q5MA 4I6EA 2WQ6A 3CQGB 3Q15A 3TAXA 3U9WA 3BEEA 5FQ8A 5JJ6A 5CMWA 3CKCA 2WXMA 4FC8A 3UQ3A 1MQSA 2IOLA 3QJZA 5ARGA 3T8MA 5BV1A 1NZNA 3ZYLA 4BX8A 3FP3A 3RRNB 2I6HA 4HFGA 4AVXA 3ZPJA 3UUXA 4G26A 4N3CA 3ZW3A 2KM4A 4FHJA 4KXKB 4U07A 3ASDA 3CV0A 4B8AA 4Q94A 3P2BA 3Q47B 3WXXA 2L0IA 1HU3A 3B7UX 3FU0A 3DPDA 2XQ0A 3TJPA 2OVFA 1N54A 4GB9A 3FTXA 4FLBA 4K03A 3DBSA 4GAAA 3LXUX 4UWLA 5FWQA 5LCWJ 4AJWA 5HQ8A 4F7AA 4JA9A 3CVVA 4FLHA 4G11A 1HF8A 3ASFA 3ZGQA 3QK0A 5FT9A 3CVXA 1HFAA 5G04C 2YHEA 1UG3A 3PE3A 5JJTA 2XGSA 2IF4A 3FH5A 2VSNA 2WXOA 1HX8A 2R17C 4CT4A 4UI9K 4EZLA 2WXFA 2Y3AA 5FJYA 4Y6WA 2V0PA 4F1SA 3UT7A 3FUNA 3LYAA 4FULA 1VDYA 3HDXA 3VTXA 5FTPA 2VQ2A 3TXMA 1U3CA 1EYHA 2ZU6B 4KVMA 1ZU2A 3QAQA 2Y4TA 1B89A 4I6JA 5AJLA 1A17A 2RD0A 2LAIA 5JJ7A 2WXHA 1H6KA 2VGXA 4U8HA 3TL5A 4J8DA 2YNQA 3CR3A 4ILGA 3CEQA 1HG2A 3LCAA 5D0OD 1TEZA 1FVHA 5BT1A 2PQRA 4RVBA 4N3BA 3AU5A 3MKRA 4AIFA 1IQRA 3PEVB 5JHAA 4C0MA 1FVFA 3CVPA 3ZHEB 1OUVA 3CHRA 4JEUA 4JC8A 2JEKA 3VLDA 5G2NA 3T5VA 5CCLA 4KVOA 2AXUA 2DIWA 2NSZA 4KT6B 4PH4B 2WQHA 1HXIA 1PAQA 4H7XA 1LF8A 2IOSA 3FUHA 4HVBA 2WMNA 4JL0A 3CVWA 4XI0A 3ESKA 4BTAA 2A5UA 4ILIA 3CK8A 2ONDA 3CVNA 4JHJA 4JW1A 4NURA 4PS8A 3FTVA 2WXLA 2YHCA 3QDNA 4U0ZA 3OAWA 4YNDA 5AYWD 1NA0A 1Z3YA 2V8SE 3APDA 1H19A 4OYSA 2PQNA 2LAHA 3GYZA 3PE4A 2X3MA 3QWPA 4CDMA 4G25A 3EJNA 4MKTA 1OWPA 3QC1A 4UWGA 1JWFA 3PNTB 5ANRA 4DK5A 3KD7A 4KZ0A 2C2LA 2MHKA 3U4TA 3ZYQA 4A3VA 2XHEA 3IEGA 3JUIA 3NZSA 3JYSA 4GMJA 3TG5A 3EHMA 4A3TA 1H2TC 4DJAA 4EBAG 5BW8C 3S7FA 5CMYA 1INZA 2XCBA 3HIZA 5AENA 4FADA 2GGFA 1XNFA 2WVIA 3B7SA 3MA5A 4MS6A 4CRWA 2CHXA 3CHOA 1E7VA 2KC7A 1UJJA 3I4RB 5AJDA 4AY5A 2CFUA 3QOUA 5E76A 3IBEA 2VTBA 2IONA 4BTBA 3MV3B 4N5CA 4ANVA 2UWJG 2E2EA 1FCHA 4GZ3A 4AOFA 2OV8A 4AM9A 2QFCA 4KBQA 2QY7A 3D9IA 3MCXA 4WWOA 1QNFA 4K0RA 4Q96A 2X6JA 4L1BA 3CGHA 3HHMA 4CEMA 2J08A 3APCA 4PDXA 3D9LA 4FHKA 4GA0A 4UI9C 3G2VA 1OWLA 2WXRA 5FQ4A 3FUEA 2ILRA 3ASGA 1QQEA 4N39A 2R5SA 3QB2A 4JXTA 3S2AA 3ULQA 5J08A 1Z3XA 4JZYA 4WWPA 3GW4A 2WQ7A 2XEVA 3HYMB 4AY6A 3E4BA 2BUGA 2UY1B 4CDNA 4HS2A 5KCMA 3TXNA 3AS5A 4GCNA 4GZ6A 1EDUA 3ZIMA 2OOEA 5G55A 4W9RA 1DNPA 4HOQA 2IJGX 2LNIA 3RRMB 3PUKA 4GZDA 3KS2A 4N2SA 2LSUA 4U0SA 2CHZA 2WXGA 5JHBA 5G05C 3QKYA 1Y6IA 2KCLA 5ENNA 4J0UA 3T5XA 4L23A 1HO8A 1HE8A 4JEHA 4URKA 3SFZA 2J49A 3QWVA 3FUIA 3L6AA 2FBNA 5BUZA 3IHVA 3OTNA 3MYVA 4I6GA 1JUQA 3HVEA 3O4ZA 4N3AA 5EX0A 1UN9A 4GZ5A 4GYWA 3LY9A 4R7LA 2WXIA 2X6IA 2PM7A 3D9KA 3FU5A 2YINA 2DCPA 4PS3A 2VTBB 2GRLA 3I4GA 2FI7A 2XRYA 2OVBA 4U63A 4DLOA 2AWIA 4L2YA 4JA7A 3ZHEA 1PC2A 4O6FA 3I5PA 5KJNA 4B8CB 4B89A 4GA2A 3NF1A 4DLQA 3IV0A 4PUCA 2I1KA 3ZYKA 1BPOA 2IFUA 2KCKA 4ANXA 2HO1A 4BSXA 4Q69A 3Q4AB 3CSTA 3ESLA 3MGBA 3ZEFA 3CHMA 5D0QD 2YQ8A 2C0MA 3Q49B 3SZ7A 4WNDA 5T3RA 2V5FA 4J8FA 4I2WA 4C9BB 3KAEA 3APFA 3PZDA 3U66A 3CVYA 5FZSA 4E85A 4I1AA 5FQ6A 3PUJA 3K9IA 3NQPA 3FY4A 4XIFA 2WPVA 4DI3A 3FH8A 4WUYA 5LCWC 3D9PA 2WXNA 2FEZA 3FDHA 1NA3A 4FA6A 5KJKA 3PEUB 4I9CA 5M72A 5T8IA 3G2SA 3IHYA 3GZSA 4XE0A 5C1DA 4UI9J 4FP7A 4Y6CA 2HYZA 5T4YA 2XPYA 3SD5A 2MRIA 4IULA 2XGMA 3LY8A 1IQUA 2A4ZA 2AXVA 2I1JA 2FO7A 4HXIA 3VTYA 4DI4A 3HVEB 1OWOA 4UQYA 4XI9A 1GW6A 1IYGA 1HH8A 3JCKC 3PRZA 4IYPA 4I2ZA 2VSXE 3FUMA 5DBKA 3RRUA 3SGHA 3FTUA 4F3VA 3BG1B 3NZUA 3BG0B 4L2LA 1JPLA 4XZ4A 4WNEA 4ANWA 4C0EA 1IHGA 4J6IA 3RIBA 3ASHA 3FUKA 4A55A 4E6HA 5BNWA 4QFVA 4GYOA 4ME2A 2CG3A 4ABNA 3QWWA 3B7TA 2BF0X 3ML9A 4ACKA 5A7DB 4I1OB 2WXQA 3L16A 3CKBA 3JQ0A 3PVLA 4NRHB 1WY6A 4LRZA 3FUFA 3CHPA 3CK7A 4RG9A 1KT1A 2WM9A 2LO6A 5EX3A 3C98A 5C2YA 1EF1C 2PL2A 3RO2A 1E8YA 2VGXB 2VYIA 2WXKA 4GA1A 4JPSA 4EECA 2CFZA 3L13A 4AV7A 4UWHA 5KJMA 2MOWA 3EIJA 3LDZA 2J4BA 3FTYA 5J90A 1EPUA 3EIQC 4RSYA 4ILHB 2J4DA 3D9NA 2XRZA 4ANUA 2VGYA 3MKQB 2XCCA 2NC9A 3RJVA 3QNKA 1ELWA 1UN8A 5LOZA 3GZ2A 4HOUA 1E8WA 3CIAA 5BPPA 3PH0C 2HR2A 4HORA 2LSVA 3CVLA 4KMOA 3ZXSA 4UQXA 2I2OA 2DBAA 4JVSA 2AXZA 4BY6A 1X5BA 4U04A 4IRUA 3IKOB 4FJZA 4PS7A 3EHNA 4B94A 4I9EA 4KZCA 2GRMA 4APFA 3PS6A 3G2TA 4BFRA 4ATGA 3UT8A 3U64A 2L6JA 2KZTB 3UX4A 1UW4B 2RG8A 3D9MA 1OWNA 3FU6A 3FUDA 1S0PA 3ENEA 4XKCA 5DIZA 3ZFWA 4YVOA 1WM5A 4JHRA 5ANLA 3KEZA 1E8ZA 3VLEA 2HM8A 2WMOA 3O48A 4GZCA 4HOTA 3MZLB 3LKUA 4V3IA 4D10C 4A1GA 3D9JA 4U0UA 4LCTA 4H7YA 3ZYMA 4LERA 3CVQA 4APOA 4GYYA 3FU3A 3RO3A 1E96B 5EDSA 4AP2A 4WAFA 4UWKA 1H0AA 2X6KA 3D9OA 4P29A 4OVVA 2Q7FA 3GZ1A 4EBAA 1QZ2A 2BTDA 3OXGA 4EZKA 3PNLB 2I9CA 3CSFA 3L08A 2CHWA 2L0TB 3URZA 4KYOB 4CCAA 4CDRA 4RG6A 4DPRA 5CCMA 3G2WA 1XGWA 3FH7A 3R9AB 3R7RA 3EDTB 3G2UA 4AXHA 3FEYA 4MLPA 2X6FA 4WNFA 2WXJA 2L9BA 1KLXA 3FUJA 2EQXA 4J8EA 5AIJA 4HLEA 2XGOA 3LJ3A 1PY1A 2VSYA 4ACLA 4CGWA 1SZ9A 1W3BA 2XPIA 2J9QA 2R59A 3N71A 3AS8A 4WWNA 2VJ8A 5G05J 2KATA 4EZJA 5LX8A 1H2VC 3LVQE 4F53A 5FZQA 2GW1A 2J07A 3AU4A 3FHEA 2KZTA 3L54A 4I17A 2FULA 3VLFA 3PDNA 4A1SA 4BT8A 1E90A 3PREA 5LFAA 1SQMA 3S7JA 4BWRA 3S7DA 5HI7A 4CGVA 5E75A 1KT0A 3MEKA 3B13A 4TUUA 2V4LA 3SI5A 2PM6A 1HZ4A 4WNGA 3JQ1A 3OXFA 4XX5A 3QARA 1ELKA 3D3MA 4TV3A 4GU5A 3FWVA 4G24A 4FU3A 3P1UA 5A6CA 2PZIA 1N52A 1WAO1 1NP7A 3RU0A 1TJFA 3FTZA 3LEWA 1H2UA 1L5JA 5CHEE 3MKQA 3MV2B 4LEUA 3AS4A 3L17A 1E8XA 3FULA 5FQ7A 3U3WA 3LY7A 2JLBA 2X38A 3CVUA 5LP0A 3ZVVA 1HS6A 2IQCA 3SF4A 2M63A 5FZRA 4GMLA 2WXPA 3SNXA 5A23A 1SZAA 4UWFA 4YVQC 3FTSA 4G23A 3ZRHA 3UT4A 3TG4A 5BV0A 4G1TA 2UY1A 3MX3A 4NACA 4HOSA 3FTWA 3ZN3A 5G04J 1YA0A 3ONLA 4EQFA 1Z6TA 2AW6A 4TRQA 5ARFA 4NQ0A 1DVPA 5EKQD 4J8SA 4BT9A 1OWMA 4L7TA 4M3OA 1TJCA 3CK9A 3ML8A 4G2VA 2CG2A 5KJLA 4EPZA 1UJKA 4FJYA 4I43A 2IU1A 3S7BA 3SHFA 2AVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IFU A;  3LKU A;  2KCK A;  4JL0 A;  1ELR A;  2C0L A;  1P5Q A;  2HO1 A;  3ESK A;  4XI0 A;  4BTA A;  3CK8 A;  2OND A;  3CVN A;  3Q4A B;  3OXL A;  4U0U A;  4H7Y A;  3TGO A;  3CVQ A;  5D0Q D;  2P58 C;  2YHC A;  2YQ8 A;  2C0M A;  3QDN A;  4GYY A;  4U0Z A;  3RO3 A;  1E96 B;  3Q49 B;  3SZ7 A;  4YND A;  5AYW D;  1NA0 A;  4WND A;  2V5F A;  4J8F A;  2PQN A;  3GYZ A;  3QWP A;  3KAE A;  3PE4 A;  4I2W A;  2Q7F A;  3GZ1 A;  4UQZ A;  4N2Q A;  4G25 A;  4GPK A;  3LPZ A;  1QZ2 A;  3OXG A;  2FF4 A;  4GCO A;  4IN3 B;  4I1A A;  3O48 A;  5FZS A;  3K9I A;  1Y8M A;  3KD7 A;  3RKV A;  4XIF A;  2C2L A;  2MHK A;  3U4T A;  2WPV A;  5LCW C;  3FFL A;  3IEG A;  4WUY A;  3UPV A;  1ZBP A;  2Y4U A;  3URZ A;  3JYS A;  3TG5 A;  2FEZ A;  2KCV A;  4KYO B;  3UUX A;  1NA3 A;  5BW8 C;  3S7F A;  5KJK A;  4I9C A;  3Q5M A;  4CDR A;  5M72 A;  2XCB A;  4RG6 A;  3Q15 A;  5CCM A;  4APO A;  3TAX A;  1XNF A;  3MA5 A;  4UI9 J;  3BEE A;  4Y6C A;  5JJ6 A;  2HYZ A;  3CKC A;  3R9A B;  5C1D A;  3UQ3 A;  3EDT B;  2KC7 A;  2XGM A;  5ARG A;  3LY8 A;  3VTY A;  1NZN A;  2FO7 A;  4WNF A;  4AY5 A;  1KLX A;  3FP3 A;  4J8E A;  4UQY A;  4XI9 A;  2I6H A;  2XGO A;  3QOU A;  1IYG A;  1HH8 A;  3ZPJ A;  4BTB A;  2VSY A;  3MV3 B;  4I2Z A;  2UWJ G;  2XPI A;  1W3B A;  3N71 A;  2J9Q A;  2E2E A;  4G26 A;  4N3C A;  3AS8 A;  1FCH A;  4F3V A;  4GZ3 A;  5G05 J;  2KAT A;  4WNE A;  4KXK B;  4U07 A;  5FZQ A;  1IHG A;  2GW1 A;  3RIB A;  3ASD A;  2QFC A;  3ASH A;  3CV0 A;  4KBQ A;  4AM9 A;  5BNW A;  4I17 A;  4GYO A;  4ME2 A;  4ABN A;  3PDN A;  3Q47 B;  3QWW A;  3WXX A;  4A1S A;  4BT8 A;  3S7J A;  4BWR A;  3S7D A;  5HI7 A;  4CGV A;  5A7D B;  1KT0 A;  4N5C A;  3MEK A;  4UI9 C;  3CKB A;  4GA0 A;  4NRH B;  5DBK A;  5LCW J;  1HZ4 A;  5HQ8 A;  3ASG A;  4N39 A;  1QQE A;  4WNG A;  4CGW A;  2R5S A;  3OXF A;  3CK7 A;  4JA9 A;  4RG9 A;  1KT1 A;  3ULQ A;  5EX3 A;  3FWV A;  4G24 A;  3ASF A;  3ZGQ A;  2PZI A;  3GW4 A;  5A6C A;  1WAO 1;  5FT9 A;  2PL2 A;  2XEV A;  3HYM B;  4AY6 A;  3RO2 A;  3E4B A;  2BUG A;  2UY1 B;  2VGX B;  2VYI A;  4GA1 A;  5G04 C;  3RU0 A;  5CHE E;  5KJM A;  3AS5 A;  3PE3 A;  4GCN A;  3MV2 B;  4GZ6 A;  4LEU A;  5JJT A;  2XGS A;  3AS4 A;  2IF4 A;  2OOE A;  2VSN A;  3U3W A;  4W9R A;  3LY7 A;  4UI9 K;  4HOQ A;  2LNI A;  2JLB A;  5FJY A;  4Y6W A;  3KS2 A;  4N2S A;  2LSU A;  2VGY A;  4U0S A;  2XCC A;  2NC9 A;  3RJV A;  1ELW A;  3SF4 A;  5G05 C;  3QKY A;  3GZ2 A;  5FZR A;  2KCL A;  3LYA A;  4HOU A;  4J0U A;  3VTX A;  5FTP A;  2VQ2 A;  2HR2 A;  4HOR A;  2LSV A;  4YVQ C;  4HOT A;  1ZU2 A;  3CVL A;  3QWV A;  2Y4T A;  1B89 A;  2FBN A;  4G23 A;  1A17 A;  4UQX A;  2DBA A;  5JJ7 A;  3TG4 A;  4G1T A;  2UY1 A;  2VGX A;  4N3A A;  4J8D A;  5EX0 A;  4U04 A;  4HOS A;  3ZN3 A;  3CEQ A;  3LCA A;  1YA0 A;  3LY9 A;  4GYW A;  4GZ5 A;  4I9E A;  5D0O D;  5G04 J;  4B94 A;  2PQR A;  4EQF A;  5BT1 A;  4N3B A;  3MKR A;  4AIF A;  5ARF A;  4NQ0 A;  5EKQ D;  3CVP A;  2L6J A;  4BT9 A;  3ZHE B;  2FI7 A;  1OUV A;  1TJC A;  3CK9 A;  4G2V A;  5KJL A;  4JA7 A;  5CCL A;  3ZHE A;  1PC2 A;  4O6F A;  5KJN A;  5DIZ A;  3ZFW A;  4GA2 A;  1WM5 A;  4JHR A;  4YVO A;  3NF1 A;  2WQH A;  1HXI A;  3S7B A;  2AVP A;  4H7X A; 
#chains in the Genus database with same CATH topology
 2C0L A;  3OXL A;  2J09 A;  4OVU A;  4GTM A;  3SBS A;  2RFM A;  4LUN U;  1TNY A;  2WB2 A;  4N2Q A;  3R7Q A;  4EHM A;  1E7U A;  4GPK A;  3CHS A;  2FF4 A;  4DUI A;  1HG5 A;  4IN3 B;  4B0Z A;  3Q5M A;  3CQG B;  4GTS A;  5JJ6 A;  5CMW A;  3CKC A;  4FC8 A;  3UQ3 A;  2IOL A;  3QJZ A;  5ARG A;  3T8M A;  1NZN A;  4BX8 A;  4AVX A;  3ZW3 A;  3CV0 A;  1O1R A;  4BSZ B;  3B7U X;  2XQ0 A;  3TJP A;  4Z68 A;  1N54 A;  4GB9 A;  4K03 A;  5KBA A;  3DBS A;  4GAA A;  3LXU X;  3Q73 A;  5LCW J;  4J7W A;  1HF8 A;  1N95 A;  3QK0 A;  3CVX A;  1UG3 A;  5JJT A;  1WDY A;  5KWD A;  2GRN B;  3FH5 A;  2VSN A;  2WXO A;  1HX8 A;  3HRA A;  4F1S A;  3KSL A;  3LYA A;  1N94 A;  1VDY A;  5FTP A;  2EIJ E;  1U3C A;  5H7P A;  5JJ7 A;  4NIK A;  1HG2 A;  4RVB A;  3AU5 A;  4AIF A;  1IQR A;  1DC2 A;  3E37 A;  3CVP A;  4TXR A;  3VLD A;  2P9U G;  3T5V A;  3C3Q A;  4PH4 B;  2WQH A;  1O1S A;  4HVB A;  4JL0 A;  5EIB E;  1TN7 A;  1SVX A;  3CVN A;  4PS8 A;  3FTV A;  3OAW A;  1TNB A;  4OYS A;  3IXE A;  3J5Q B;  2PQN A;  3GYZ A;  3PE4 A;  3AAA C;  4CDM A;  4G25 A;  4MKT A;  5B3S E;  3PNT B;  2V4H C;  2P9K G;  3KD7 A;  3ZYQ A;  2XHE A;  3IEG A;  2EIK E;  4A3T A;  3TG5 A;  4EBA G;  5BW8 C;  5CMY A;  2XCB A;  3HIZ A;  2JAB A;  2WVI A;  3B7S A;  5IY5 E;  4CRW A;  3PZ2 A;  1E7V A;  2ION A;  3MV3 B;  4ANV A;  2UWJ G;  2E2E A;  1TR4 A;  2LXM A;  2QY7 A;  3D9I A;  2KXP C;  1QNF A;  3EU9 A;  3HHM A;  4CEM A;  2J08 A;  3APC A;  3DEO A;  1O5M A;  2WXR A;  5FQ4 A;  3ASG A;  1QQE A;  3QB2 A;  3S2A A;  2XEV A;  4AY6 A;  3ABK E;  5KCM A;  3TXN A;  2OOE A;  5G55 A;  1DNP A;  3C5R A;  3BU8 A;  3RRM B;  4GZD A;  2LSU A;  2B6C A;  5G05 C;  1HO8 A;  2P9S G;  3DPY A;  2J49 A;  3L6A A;  4U8V D;  4GYW A;  3LY9 A;  2WXI A;  4G8K A;  3D9K A;  1WG0 A;  4PS3 A;  3UKU G;  2FI7 A;  2XRY A;  2OVB A;  4L2Y A;  3JUE A;  4O6F A;  3I5P A;  3V30 A;  4B89 A;  3ZNG A;  2XEN A;  1BPO A;  2IFU A;  4ANX A;  2HO1 A;  4BSX A;  2V5Q C;  2XS8 A;  3CST A;  1SA4 A;  3ZEF A;  2YQ8 A;  5T3R A;  5EIL A;  3CVY A;  2DWZ A;  3K9I A;  3NQP A;  3FY4 A;  4DI3 A;  2PNN A;  2FEZ A;  4O1P A;  1MYO A;  4I9C A;  2HYZ A;  5T4Y A;  3LY8 A;  3HVE B;  1OWO A;  3JCK C;  4I2Z A;  4L2L A;  1BD8 A;  5ENQ D;  4J6I A;  4GYO A;  3B7T A;  4U8Y D;  5AAR A;  2NYJ A;  3PVL A;  4LRZ A;  2LO6 A;  3ISM C;  2VYI A;  4JPS A;  5KJM A;  2J4B A;  1Q2Z A;  4ILH B;  3RJV A;  2XCC A;  2NC9 A;  5LOZ A;  2I2O A;  3JXJ A;  1QBQ A;  4PS7 A;  3EHN A;  4B94 A;  4HNA D;  4APF A;  3NOC D;  4BFR A;  4ATG A;  2B0O E;  2L6J A;  2KZT B;  3SO8 A;  3D9M A;  3L82 A;  3HXD A;  1OWN A;  3TWR A;  5ENO D;  4YVO A;  5ANL A;  2HM8 A;  2WMO A;  1OCZ E;  4LCT A;  3CVQ A;  4GYY A;  1E96 B;  4AP2 A;  4WAF A;  4HBD A;  3D9H A;  1QZ2 A;  2BTD A;  3PNL B;  2I9C A;  1MJ0 A;  1BLX B;  3NB2 A;  3UI2 A;  4CDR A;  4RG6 A;  5CCM A;  3UIO C;  1XGW A;  3R9A B;  3FEY A;  1KLX A;  2A5E A;  1N0Q A;  2VSY A;  2XPI A;  2J9Q A;  4WWN A;  1H2V C;  5LFA A;  1E90 A;  1SQM A;  3S7D A;  4CGV A;  4TUU A;  1K1B A;  2V4L A;  2PM6 A;  1HZ4 A;  4TV3 A;  1NI1 A;  4B93 B;  3DXM G;  4FU3 A;  3Q78 A;  3RU0 A;  3FTZ A;  1IKN D;  1E8X A;  3JXI A;  3LY7 A;  3SF4 A;  2M63 A;  5FZR A;  3UM0 A;  5BXO A;  4LNB A;  4DX6 D;  4O1O A;  4G1T A;  1Z6T A;  4TRQ A;  2QC9 A;  2R02 A;  4EPZ A;  3TWS A;  3TWU A;  1UJK A;  2IU1 A;  2OCC E;  3LVR E;  3L22 A;  3LS8 A;  3FEX A;  4XKB A;  2F8Y A;  1JWG A;  1OCC E;  2GRQ B;  3SBT B;  4ATZ D;  5CED B;  5KNG A;  3RK6 A;  1U3D A;  2EIM E;  4GCO A;  4BX9 A;  2Y1L E;  3RSE G;  3UPV A;  3CLJ A;  3CQC B;  1ZBP A;  3Q15 A;  2QZA A;  3T9K A;  3FP3 A;  3ZPJ A;  1N11 A;  2MYO A;  2KM4 A;  4KXK B;  4Q94 A;  5AQ9 A;  1HU3 A;  3FU0 A;  3DPD A;  5HKP A;  2OVF A;  3AG3 E;  4RQI A;  4AJW A;  5HQ8 A;  4G11 A;  1N9A A;  3HXF A;  4OAU C;  3B7B A;  3ASF A;  3ZGQ A;  5AN8 A;  1TNO A;  3ZUV B;  3ULE G;  5CER B;  2IF4 A;  2R17 C;  2WXF A;  4GTT A;  2V0P A;  1NL4 A;  4O60 A;  4FUL A;  5ENS D;  3HDX A;  2ZU6 B;  3QAQ A;  1B89 A;  4TXP A;  2LAI A;  2WXH A;  2R2L A;  2VGX A;  4U8H A;  3TL5 A;  4J8D A;  2YNQ A;  3CR3 A;  3LCA A;  5D0O D;  2XZT G;  5BT1 A;  2PQR A;  4N3B A;  1FVF A;  3UXG A;  1MX6 A;  3CHR A;  1HXI A;  3TWV A;  4H7X A;  1LF8 A;  2IOS A;  3E30 A;  4BTA A;  2A5U A;  4ILI A;  4U95 D;  4NUR A;  2YHC A;  3QDN A;  4U0Z A;  4YND A;  5AYW D;  3UM1 A;  1Z3Y A;  5FIN A;  1N4R A;  2FO1 E;  3U4T A;  3JYS A;  1H2T C;  3AG4 E;  1INZ A;  4FAD A;  4MS6 A;  3CHO A;  1UJJ A;  5EYP F;  2CFU A;  3QOU A;  4N5C A;  3LJN A;  4GZ3 A;  2J8S D;  4WWO A;  3V2X A;  4UI9 C;  4GA0 A;  2R5S A;  4JXT A;  5J08 A;  1Z3X A;  4WWP A;  3GW4 A;  2P9L G;  3AG2 E;  3UIP C;  3DWL G;  4W9R A;  2IJG X;  3PUK A;  1BI8 B;  2CHZ A;  2WXG A;  5JHB A;  1Y6I A;  5ENN A;  3T5X A;  4URK A;  4JEH A;  3SFZ A;  3FUI A;  2FBN A;  3IHV A;  1AWC B;  4TUM A;  3KEA A;  4I6G A;  3HVE A;  3O4Z A;  2X6I A;  4GTP A;  2DCP A;  2GRL A;  1BU9 A;  4JA7 A;  3ZHE A;  4B8C B;  1BI7 B;  4DLQ A;  1V54 E;  3IV0 A;  3ESL A;  3MGB A;  1X81 A;  3CHM A;  3Q49 B;  2V5F A;  3KAE A;  5FZS A;  3PUJ A;  3FH8 A;  4HLL A;  2WXN A;  5M72 A;  5T8I A;  3G2S A;  1FT2 A;  4HRL A;  3RAU A;  4IUL A;  2XGM A;  1IQU A;  2A4Z A;  4HXI A;  2FO7 A;  4XI9 A;  3R9M A;  1HH8 A;  3RRU A;  5DBK A;  1FT1 A;  3FTU A;  1JPL A;  4XZ4 A;  4E6H A;  4A55 A;  5BNW A;  4ABN A;  2CG3 A;  3QWW A;  3PZ1 A;  4ACK A;  3Q75 A;  3CHP A;  1LD7 A;  3TWW A;  1E8Y A;  2VGX B;  4GA1 A;  4UWH A;  5J90 A;  2J4D A;  4ANU A;  3QNK A;  1ELW A;  1UN8 A;  3GZ2 A;  1TNU A;  3CIA A;  3PH0 C;  3F6Q A;  2LSV A;  4HOR A;  3CVL A;  4UQX A;  4JVS A;  3UIN C;  2AXZ A;  4U04 A;  4IRU A;  3DXK G;  4FJZ A;  4KZC A;  4ZHB A;  3G2T A;  3UT8 A;  3U64 A;  4TXQ A;  1S0P A;  4XKC A;  1JCQ A;  1OCR E;  3O48 A;  1K8K G;  3FU3 A;  2BKG A;  5CRV A;  3B95 A;  4GPM A;  4UWK A;  2X6K A;  3D9O A;  4OVV A;  2Q7F A;  1S63 A;  1KZP A;  2ZXW E;  3OXG A;  4EZK A;  3CSF A;  3L08 A;  2L0T B;  2OEV A;  4DRX E;  4CCA A;  1OXJ A;  2IO3 C;  3FH7 A;  3TWT A;  3EDT B;  4AXH A;  4MLP A;  4WNF A;  2WXJ A;  2XGO A;  4MBG A;  3LJ3 A;  1PY1 A;  4ACL A;  4CGW A;  1W3B A;  3N71 A;  2VJ8 A;  5G05 J;  5FZQ A;  2GW1 A;  3PZ3 A;  3VLF A;  2RKK A;  3AG1 E;  3PRE A;  4BWR A;  1KT0 A;  3MEK A;  3B13 A;  3T8K A;  3JQ1 A;  3QAR A;  1ELK A;  3FWV A;  4BER A;  5A6C A;  1UOH A;  1S64 A;  1H2U A;  1L5J A;  3LEW A;  3MKQ A;  3AS4 A;  3FUL A;  2GRO B;  4C48 B;  3CVU A;  5HS0 A;  3SQV A;  2WXP A;  3SNX A;  1SZA A;  2DYS E;  4YVQ C;  3W9G A;  3FTS A;  4G23 A;  4HOS A;  3ONL A;  4RLY A;  3SFY A;  4BT9 A;  3EU5 A;  2BKK B;  4M3O A;  1TJC A;  3CK9 A;  4FJY A;  3S7B A;  2AVP A;  1P5Q A;  3UMV A;  2VSO E;  5D2M C;  3Q7A A;  3B7R L;  5JA4 D;  4MRU A;  1Y8M A;  4U96 D;  3ONK A;  4I1M A;  1MHQ A;  2NXP A;  2P9I G;  2X6H A;  2KCV A;  4I6E A;  1QYM A;  3BUA A;  3BEE A;  3DSU A;  5BV1 A;  1FPP A;  3RRN B;  2I6H A;  4HFG A;  1OT8 A;  4G26 A;  1G3N B;  4N3C A;  3HXE A;  1U2V G;  1DCQ A;  1N4Q A;  4B8A A;  3P2B A;  4M7C A;  3Q47 B;  2L0I A;  4DX7 D;  3ABM E;  3FTX A;  4FLB A;  1TN8 A;  4JA9 A;  5FT9 A;  1HFA A;  5G04 C;  3PE3 A;  2XGS A;  4CT4 A;  4L9P A;  4K5A B;  4BES A;  4BEP A;  2QYJ A;  2VQ2 A;  3TXM A;  1ZU2 A;  2Y4T A;  5AJL A;  2RD0 A;  1H6K A;  3CEQ A;  1TEZ A;  1FVH A;  5JHA A;  4GMR A;  3SFX A;  4JC8 A;  2JEK A;  4KVO A;  4HQD A;  2AXU A;  2DIW A;  5JMN D;  3FUH A;  2DVW A;  5ITZ F;  4XI0 A;  3CVW A;  4JHJ A;  4JW1 A;  3CK8 A;  2OND A;  2WXL A;  5D66 A;  1NA0 A;  2V8S E;  3APD A;  1H19 A;  2LAH A;  2X3M A;  2P2C P;  1OWP A;  3UM2 A;  3AJI A;  3NZS A;  4GMJ A;  3EHM A;  4DJA A;  2F0Y A;  5AEN A;  2GGF A;  1XNF A;  3MA5 A;  1IHB A;  2CHX A;  1KPS B;  4AY5 A;  5E76 A;  2XEE A;  3Q79 A;  1FCH A;  4AOF A;  1OCO E;  4K0R A;  4HI8 A;  4Q96 A;  1N4P A;  3CGH A;  4PDX A;  3W9F A;  3FUE A;  2ILR A;  4N39 A;  4JZY A;  5KNH D;  3HYM B;  4OAV B;  3E4B A;  4CDN A;  3AS5 A;  4GCN A;  4HOQ A;  2LNI A;  2P9N G;  4N2S A;  4DX1 A;  2KCL A;  4J0U A;  4L23 A;  1HE8 A;  5BUZ A;  3MYV A;  1JUQ A;  2DYR E;  4R7L A;  2YIN A;  3I4G A;  1SW6 A;  2H6G A;  5EID A;  4N5Q A;  3DSW A;  4GA2 A;  3NF1 A;  4PUC A;  2I1K A;  3ZYK A;  1S70 B;  2KCK A;  4Q69 A;  3UM3 A;  4JD2 G;  5D0Q D;  2C0M A;  4DX2 A;  3C3O A;  4WND A;  3Q9N C;  4I2W A;  4C9B B;  1LTX A;  3APF A;  3PZD A;  3U66 A;  4E85 A;  3DSX A;  4XIF A;  2WPV A;  2GRR B;  4X8Q A;  2ETB A;  3FDH A;  1NA3 A;  5KJK A;  3NBN B;  3IHY A;  5C1D A;  4UI9 J;  4Y6C A;  2XPY A;  3NAW A;  3DSV A;  2F37 A;  3EHQ A;  4DI4 A;  2ZGD A;  4UQY A;  4IYP A;  3PRZ A;  5CEC B;  4F3V A;  3BG1 B;  5EYL A;  4ANW A;  3ASH A;  3FUK A;  4ME2 A;  5A7D B;  4I1O B;  3L16 A;  3JQ0 A;  4NRH B;  1WY6 A;  3FUF A;  4RG9 A;  2WM9 A;  4YDW A;  5C2Y A;  2PL2 A;  3RO2 A;  2WXK A;  2VTB A;  4EEC A;  4AV7 A;  1DCE A;  2MOW A;  3PZ4 A;  5ENT D;  3LDZ A;  3FTY A;  3EIQ C;  4RSY A;  1SA5 A;  3D9N A;  2XRZ A;  2VGY A;  2ZIR A;  5BPP A;  2HR2 A;  4HRM B;  3TWQ A;  3ZXS A;  2DBA A;  3IKO B;  4ZFH A;  2GRM A;  2EIN E;  3UX4 A;  3UTM A;  2RG8 A;  3ENE A;  5DIZ A;  3ZFW A;  3KEZ A;  1E8Z A;  4YDO A;  4HOT A;  3MZL B;  3LKU A;  4LER A;  4K5B A;  3RO3 A;  1H0A A;  4P29 A;  2H6H A;  3GZ1 A;  2CHW A;  5B1A E;  3URZ A;  1D9S A;  1YYH A;  4DPR A;  3C72 A;  3R7R A;  2X6F A;  3E33 A;  4HLE A;  1TNZ A;  1SZ9 A;  3AS8 A;  1N4S A;  2KAT A;  4F53 A;  2J07 A;  3L54 A;  3FHE A;  2GRP B;  3BQO A;  4A1S A;  4GTV A;  4G8L A;  1MX4 A;  1H6O A;  2RFA A;  4J8Y A;  4K5C A;  3ZKJ A;  1K3Z D;  3OXF A;  4XX5 A;  4GU5 A;  4G24 A;  2PZI A;  2LXL A;  1TJF A;  5CHE E;  3MV2 B;  4LEU A;  3L17 A;  3HXB A;  2H6I A;  3ZVV A;  1HS6 A;  2IQC A;  2DZO A;  3ZRH A;  3EUV A;  5BV0 A;  2UY1 A;  3MX3 A;  3FTW A;  3ZN3 A;  4EQF A;  2R05 A;  3Q7F A;  5EKQ D;  5ENP D;  4L7T A;  3EHR A;  3ML8 A;  4G2V A;  4I43 A;  1ELR A;  2IY0 C;  4U7E B;  3ASO E;  3TGO A;  2P58 C;  1JCS A;  4JHK A;  3I3N A;  4AEZ C;  1NFI E;  4UQZ A;  2E0I A;  2H6F A;  3LPZ A;  1MX2 A;  4YDY A;  3RKV A;  5CBO A;  3CHQ A;  3FFL A;  2XPZ A;  4CT0 A;  2Y4U A;  3MJW A;  2WQ6 A;  3TAX A;  3U9W A;  5FQ8 A;  2IEJ A;  2WXM A;  3ZXP A;  1MQS A;  3ZYL A;  3NOG D;  3UUX A;  4FHJ A;  4U07 A;  3ASD A;  5CEA A;  4GTR A;  1N0R A;  3WXX A;  5FWQ A;  4UWL A;  2P9P G;  1D8E A;  4F7A A;  3CVV A;  4FLH A;  2ZIS A;  4QQI A;  3C3R A;  3HG0 D;  2YHE A;  3TWX A;  5AQA A;  2QYU A;  1JCR A;  4UI9 K;  4EZL A;  2Y3A A;  5FJY A;  4Y6W A;  1TN6 A;  3UT7 A;  4HI9 A;  3FUN A;  3E32 A;  3VTX A;  4A63 B;  1EYH A;  4KVM A;  5AQ7 A;  4I6J A;  1A17 A;  1RZ4 A;  4ILG A;  2OEW A;  3MKR A;  3PEV B;  4C0M A;  3ZHE B;  1OUV A;  4JEU A;  4UUC A;  5G2N A;  5CCL A;  2NSZ A;  4KT6 B;  5AAO A;  1PAQ A;  2WMN A;  4CYM D;  4LNG A;  3X2Q E;  4D10 C;  3ESK A;  3DSS A;  4HRN A;  3QWP A;  3EJN A;  4UWG A;  3QC1 A;  1JWF A;  5ANR A;  2AJA A;  4DK5 A;  4KZ0 A;  2C2L A;  2MHK A;  4A3V A;  3JUI A;  3S7F A;  2KC7 A;  3I4R B;  5AJD A;  3IBE A;  4BTB A;  2OV8 A;  1TYQ G;  2QFC A;  4KBQ A;  3MCX A;  2X6J A;  4L1B A;  3DEP A;  2ETA A;  3D9L A;  4FHK A;  3G2V A;  1OWL A;  3ULQ A;  2XEH A;  2WQ7 A;  2BUG A;  2UY1 B;  4HS2 A;  4GZ6 A;  1EDU A;  3ZIM A;  1A5E A;  2EIL E;  3KS2 A;  4U0S A;  2BED A;  1AP7 A;  3QKY A;  4LG6 A;  3QWV A;  1MZC A;  3OTN A;  4N3A A;  4GTO A;  5EX0 A;  1UN9 A;  4GZ5 A;  2PM7 A;  3FU5 A;  2VTB B;  1V55 E;  5AQB A;  4U63 A;  4DLO A;  1Z5S C;  2AWI A;  1PC2 A;  5KJN A;  2ZGG A;  4LNU D;  3Q4A B;  2KBX A;  5EN5 D;  3SZ7 A;  5BXU A;  5CRU A;  4J8F A;  3ASN E;  1LD8 A;  4YDE A;  1K1A A;  4I1A A;  5FQ6 A;  5B1B E;  5LCW C;  4WUY A;  3D9P A;  4FA6 A;  3PEU B;  3GZS A;  4XE0 A;  4FP7 A;  3SD5 A;  2MRI A;  3VTY A;  2AXV A;  2I1J A;  1GW6 A;  1IYG A;  2VSX E;  3FUM A;  3SGH A;  3NZU A;  3BG0 B;  4WNE A;  4C0E A;  1IHG A;  3RIB A;  4XEI G;  5HRY A;  4QFV A;  3UKR G;  2LUH A;  2BF0 X;  3ML9 A;  2WXQ A;  2Y69 E;  3CKB A;  2XZD G;  1KZO A;  4CZ2 D;  3CK7 A;  1KT1 A;  5EX3 A;  3C98 A;  1EF1 C;  1H6P A;  3E34 A;  2CFZ A;  3L13 A;  3EIJ A;  3V31 A;  1EPU A;  4HB5 A;  2XS1 A;  3MKQ B;  4HOU A;  1E8W A;  4KMO A;  3J5P A;  4F1P A;  4BY6 A;  1X5B A;  2L6B A;  1ZB1 A;  4I9E A;  3WG7 E;  3PS6 A;  2R03 A;  3ULY A;  3KSQ A;  3DST A;  1UW4 B;  3FU6 A;  3V2O A;  3FUD A;  3ABL E;  1WM5 A;  4JHR A;  3VLE A;  4GZC A;  4JB8 P;  3DRA A;  3L9T A;  4V3I A;  2DZN A;  4A1G A;  3D9J A;  4U0U A;  3ZYM A;  4H7Y A;  4APO A;  5EDS A;  4EBA A;  4GTQ A;  1OY3 D;  4F6R D;  2IO2 C;  1D8D A;  4KYO B;  4DX5 D;  3G2W A;  3G2U A;  2HE0 A;  1O1T A;  3HXC A;  2L9B A;  3FUJ A;  2EQX A;  4J8E A;  5AIJ A;  5CBN A;  2R59 A;  3ZU7 B;  4EZJ A;  5LX8 A;  3LVQ E;  5ENR D;  3AU4 A;  2KZT A;  4I17 A;  4BT8 A;  2FUL A;  3PDN A;  3S7J A;  5HI7 A;  5E75 A;  2F8X K;  4LSZ E;  3SI5 A;  1IXV A;  2Y0B G;  4WNG A;  3D3M A;  3SY2 A;  3P1U A;  1YCS B;  1N52 A;  1WAO 1;  1NP7 A;  5FQ7 A;  3U3W A;  2JLB A;  2X38 A;  4BET A;  5LP0 A;  1RW2 A;  2VGE A;  4GML A;  5A23 A;  4UWF A;  2ETC A;  3UT4 A;  3TG4 A;  4NAC A;  3V79 K;  5FIO A;  5G04 J;  1YA0 A;  3Q9U C;  2AW6 A;  5ARF A;  4NQ0 A;  1DVP A;  1YMP A;  4J8S A;  1OWM A;  2CG2 A;  5KJL A;  3SHF A;  4AM9 A; 
#chains in the Genus database with same CATH homology
 3LVR E;  1ELR A;  2C0L A;  1P5Q A;  3L22 A;  3LS8 A;  3FEX A;  4XKB A;  3OXL A;  1JWG A;  2J09 A;  4OVU A;  3UMV A;  3SBT B;  3TGO A;  2P58 C;  3SBS A;  4JHK A;  2VSO E;  4LUN U;  3I3N A;  3B7R L;  2WB2 A;  4AEZ C;  4UQZ A;  3R7Q A;  4N2Q A;  2E0I A;  1E7U A;  3LPZ A;  3RK6 A;  4GPK A;  1U3D A;  3CHS A;  2FF4 A;  4GCO A;  1HG5 A;  4IN3 B;  4B0Z A;  4BX9 A;  4MRU A;  1Y8M A;  3RKV A;  3CHQ A;  3ONK A;  4I1M A;  1MHQ A;  2NXP A;  3UPV A;  3FFL A;  2XPZ A;  3CLJ A;  3CQC B;  4CT0 A;  1ZBP A;  2X6H A;  2Y4U A;  2KCV A;  3MJW A;  3Q5M A;  4I6E A;  2WQ6 A;  3CQG B;  3Q15 A;  3TAX A;  3U9W A;  3BEE A;  5FQ8 A;  5JJ6 A;  5CMW A;  3CKC A;  2WXM A;  4FC8 A;  3UQ3 A;  1MQS A;  2IOL A;  3QJZ A;  5ARG A;  3T8M A;  5BV1 A;  1NZN A;  3ZYL A;  4BX8 A;  3FP3 A;  3RRN B;  2I6H A;  4HFG A;  4AVX A;  3ZPJ A;  3UUX A;  4G26 A;  4N3C A;  3ZW3 A;  2KM4 A;  4FHJ A;  4KXK B;  4U07 A;  3ASD A;  3CV0 A;  4B8A A;  4Q94 A;  3P2B A;  3Q47 B;  3WXX A;  2L0I A;  1HU3 A;  3B7U X;  3FU0 A;  3DPD A;  2XQ0 A;  3TJP A;  2OVF A;  1N54 A;  4GB9 A;  3FTX A;  4FLB A;  4K03 A;  3DBS A;  4GAA A;  3LXU X;  4UWL A;  5FWQ A;  5LCW J;  4AJW A;  5HQ8 A;  4F7A A;  4JA9 A;  3CVV A;  4FLH A;  4G11 A;  1HF8 A;  3ASF A;  3ZGQ A;  3QK0 A;  5FT9 A;  3CVX A;  1HFA A;  5G04 C;  2YHE A;  1UG3 A;  3PE3 A;  5JJT A;  2XGS A;  2IF4 A;  3FH5 A;  2VSN A;  2WXO A;  1HX8 A;  2R17 C;  4CT4 A;  4UI9 K;  4EZL A;  2WXF A;  2Y3A A;  5FJY A;  4Y6W A;  2V0P A;  4F1S A;  3UT7 A;  3FUN A;  3LYA A;  4FUL A;  1VDY A;  3HDX A;  3VTX A;  5FTP A;  2VQ2 A;  3TXM A;  1U3C A;  1EYH A;  2ZU6 B;  4KVM A;  1ZU2 A;  3QAQ A;  2Y4T A;  1B89 A;  4I6J A;  5AJL A;  1A17 A;  2RD0 A;  2LAI A;  5JJ7 A;  2WXH A;  1H6K A;  2VGX A;  4U8H A;  3TL5 A;  4J8D A;  2YNQ A;  3CR3 A;  4ILG A;  3CEQ A;  1HG2 A;  3LCA A;  5D0O D;  1TEZ A;  1FVH A;  5BT1 A;  2PQR A;  4RVB A;  4N3B A;  3AU5 A;  3MKR A;  4AIF A;  1IQR A;  3PEV B;  5JHA A;  4C0M A;  1FVF A;  3CVP A;  3ZHE B;  1OUV A;  3CHR A;  4JEU A;  4JC8 A;  2JEK A;  3VLD A;  5G2N A;  3T5V A;  5CCL A;  4KVO A;  2AXU A;  2DIW A;  2NSZ A;  4KT6 B;  4PH4 B;  2WQH A;  1HXI A;  1PAQ A;  4H7X A;  1LF8 A;  2IOS A;  3FUH A;  4HVB A;  2WMN A;  4JL0 A;  3CVW A;  4XI0 A;  3ESK A;  4BTA A;  2A5U A;  4ILI A;  3CK8 A;  2OND A;  3CVN A;  4JHJ A;  4JW1 A;  4NUR A;  4PS8 A;  3FTV A;  2WXL A;  2YHC A;  3QDN A;  4U0Z A;  3OAW A;  4YND A;  5AYW D;  1NA0 A;  1Z3Y A;  2V8S E;  3APD A;  1H19 A;  4OYS A;  2PQN A;  2LAH A;  3GYZ A;  3PE4 A;  2X3M A;  3QWP A;  4CDM A;  4G25 A;  3EJN A;  4MKT A;  1OWP A;  3QC1 A;  4UWG A;  1JWF A;  3PNT B;  5ANR A;  4DK5 A;  3KD7 A;  4KZ0 A;  2C2L A;  2MHK A;  3U4T A;  3ZYQ A;  4A3V A;  2XHE A;  3IEG A;  3JUI A;  3NZS A;  3JYS A;  4GMJ A;  3TG5 A;  3EHM A;  4A3T A;  1H2T C;  4DJA A;  4EBA G;  5BW8 C;  3S7F A;  5CMY A;  1INZ A;  2XCB A;  3HIZ A;  5AEN A;  4FAD A;  2GGF A;  1XNF A;  2WVI A;  3B7S A;  3MA5 A;  4MS6 A;  4CRW A;  2CHX A;  3CHO A;  1E7V A;  2KC7 A;  1UJJ A;  3I4R B;  5AJD A;  4AY5 A;  2CFU A;  3QOU A;  5E76 A;  3IBE A;  2VTB A;  2ION A;  4BTB A;  3MV3 B;  4N5C A;  4ANV A;  2UWJ G;  2E2E A;  1FCH A;  4GZ3 A;  4AOF A;  2OV8 A;  4AM9 A;  2QFC A;  4KBQ A;  2QY7 A;  3D9I A;  3MCX A;  4WWO A;  1QNF A;  4K0R A;  4Q96 A;  2X6J A;  4L1B A;  3CGH A;  3HHM A;  4CEM A;  2J08 A;  3APC A;  4PDX A;  3D9L A;  4FHK A;  4GA0 A;  4UI9 C;  3G2V A;  1OWL A;  2WXR A;  5FQ4 A;  3FUE A;  2ILR A;  3ASG A;  1QQE A;  4N39 A;  2R5S A;  3QB2 A;  4JXT A;  3S2A A;  3ULQ A;  5J08 A;  1Z3X A;  4JZY A;  4WWP A;  3GW4 A;  2WQ7 A;  2XEV A;  3HYM B;  4AY6 A;  3E4B A;  2BUG A;  2UY1 B;  4CDN A;  4HS2 A;  5KCM A;  3TXN A;  3AS5 A;  4GCN A;  4GZ6 A;  1EDU A;  3ZIM A;  2OOE A;  5G55 A;  4W9R A;  1DNP A;  4HOQ A;  2IJG X;  2LNI A;  3RRM B;  3PUK A;  4GZD A;  3KS2 A;  4N2S A;  2LSU A;  4U0S A;  2CHZ A;  2WXG A;  5JHB A;  5G05 C;  3QKY A;  1Y6I A;  2KCL A;  5ENN A;  4J0U A;  3T5X A;  4L23 A;  1HO8 A;  1HE8 A;  4JEH A;  4URK A;  3SFZ A;  2J49 A;  3QWV A;  3FUI A;  3L6A A;  2FBN A;  5BUZ A;  3IHV A;  3OTN A;  3MYV A;  4I6G A;  1JUQ A;  3HVE A;  3O4Z A;  4N3A A;  5EX0 A;  1UN9 A;  4GZ5 A;  4GYW A;  3LY9 A;  4R7L A;  2WXI A;  2X6I A;  2PM7 A;  3D9K A;  3FU5 A;  2YIN A;  2DCP A;  4PS3 A;  2VTB B;  2GRL A;  3I4G A;  2FI7 A;  2XRY A;  2OVB A;  4U63 A;  4DLO A;  2AWI A;  4L2Y A;  4JA7 A;  3ZHE A;  1PC2 A;  4O6F A;  3I5P A;  5KJN A;  4B8C B;  4B89 A;  4GA2 A;  3NF1 A;  4DLQ A;  3IV0 A;  4PUC A;  2I1K A;  3ZYK A;  1BPO A;  2IFU A;  2KCK A;  4ANX A;  2HO1 A;  4BSX A;  4Q69 A;  3Q4A B;  3CST A;  3ESL A;  3MGB A;  3ZEF A;  3CHM A;  5D0Q D;  2YQ8 A;  2C0M A;  3Q49 B;  3SZ7 A;  4WND A;  5T3R A;  2V5F A;  4J8F A;  4I2W A;  4C9B B;  3KAE A;  3APF A;  3PZD A;  3U66 A;  3CVY A;  5FZS A;  4E85 A;  4I1A A;  5FQ6 A;  3PUJ A;  3K9I A;  3NQP A;  3FY4 A;  4XIF A;  2WPV A;  4DI3 A;  3FH8 A;  4WUY A;  5LCW C;  3D9P A;  2WXN A;  2FEZ A;  3FDH A;  1NA3 A;  4FA6 A;  5KJK A;  3PEU B;  4I9C A;  5M72 A;  5T8I A;  3G2S A;  3IHY A;  3GZS A;  4XE0 A;  5C1D A;  4UI9 J;  4FP7 A;  4Y6C A;  2HYZ A;  5T4Y A;  2XPY A;  3SD5 A;  2MRI A;  4IUL A;  2XGM A;  3LY8 A;  1IQU A;  2A4Z A;  2AXV A;  2I1J A;  2FO7 A;  4HXI A;  3VTY A;  4DI4 A;  3HVE B;  1OWO A;  4UQY A;  4XI9 A;  1GW6 A;  1IYG A;  1HH8 A;  3JCK C;  3PRZ A;  4IYP A;  4I2Z A;  2VSX E;  3FUM A;  5DBK A;  3RRU A;  3SGH A;  3FTU A;  4F3V A;  3BG1 B;  3NZU A;  3BG0 B;  4L2L A;  1JPL A;  4XZ4 A;  4WNE A;  4ANW A;  4C0E A;  1IHG A;  4J6I A;  3RIB A;  3ASH A;  3FUK A;  4A55 A;  4E6H A;  5BNW A;  4QFV A;  4GYO A;  4ME2 A;  2CG3 A;  4ABN A;  3QWW A;  3B7T A;  2BF0 X;  3ML9 A;  4ACK A;  5A7D B;  4I1O B;  2WXQ A;  3L16 A;  3CKB A;  3JQ0 A;  3PVL A;  4NRH B;  1WY6 A;  4LRZ A;  3FUF A;  3CHP A;  3CK7 A;  4RG9 A;  1KT1 A;  2WM9 A;  2LO6 A;  5EX3 A;  3C98 A;  5C2Y A;  1EF1 C;  2PL2 A;  3RO2 A;  1E8Y A;  2VGX B;  2VYI A;  2WXK A;  4GA1 A;  4JPS A;  4EEC A;  2CFZ A;  3L13 A;  4AV7 A;  4UWH A;  5KJM A;  2MOW A;  3EIJ A;  3LDZ A;  2J4B A;  3FTY A;  5J90 A;  1EPU A;  3EIQ C;  4RSY A;  4ILH B;  2J4D A;  3D9N A;  2XRZ A;  4ANU A;  2VGY A;  3MKQ B;  2XCC A;  2NC9 A;  3RJV A;  3QNK A;  1ELW A;  1UN8 A;  5LOZ A;  3GZ2 A;  4HOU A;  1E8W A;  3CIA A;  5BPP A;  3PH0 C;  2HR2 A;  4HOR A;  2LSV A;  3CVL A;  4KMO A;  3ZXS A;  4UQX A;  2I2O A;  2DBA A;  4JVS A;  2AXZ A;  4BY6 A;  1X5B A;  4U04 A;  4IRU A;  3IKO B;  4FJZ A;  4PS7 A;  3EHN A;  4B94 A;  4I9E A;  4KZC A;  2GRM A;  4APF A;  3PS6 A;  3G2T A;  4BFR A;  4ATG A;  3UT8 A;  3U64 A;  2L6J A;  2KZT B;  3UX4 A;  1UW4 B;  2RG8 A;  3D9M A;  1OWN A;  3FU6 A;  3FUD A;  1S0P A;  3ENE A;  4XKC A;  5DIZ A;  3ZFW A;  4YVO A;  1WM5 A;  4JHR A;  5ANL A;  3KEZ A;  1E8Z A;  3VLE A;  2HM8 A;  2WMO A;  3O48 A;  4GZC A;  4HOT A;  3MZL B;  3LKU A;  4V3I A;  4D10 C;  4A1G A;  3D9J A;  4U0U A;  4LCT A;  4H7Y A;  3ZYM A;  4LER A;  3CVQ A;  4APO A;  4GYY A;  3FU3 A;  3RO3 A;  1E96 B;  5EDS A;  4AP2 A;  4WAF A;  4UWK A;  1H0A A;  2X6K A;  3D9O A;  4P29 A;  4OVV A;  2Q7F A;  3GZ1 A;  4EBA A;  1QZ2 A;  2BTD A;  3OXG A;  4EZK A;  3PNL B;  2I9C A;  3CSF A;  3L08 A;  2CHW A;  2L0T B;  3URZ A;  4KYO B;  4CCA A;  4CDR A;  4RG6 A;  4DPR A;  5CCM A;  3G2W A;  1XGW A;  3FH7 A;  3R9A B;  3R7R A;  3EDT B;  3G2U A;  4AXH A;  3FEY A;  4MLP A;  2X6F A;  4WNF A;  2WXJ A;  2L9B A;  1KLX A;  3FUJ A;  2EQX A;  4J8E A;  5AIJ A;  4HLE A;  2XGO A;  3LJ3 A;  1PY1 A;  2VSY A;  4ACL A;  4CGW A;  1SZ9 A;  1W3B A;  2XPI A;  2J9Q A;  2R59 A;  3N71 A;  3AS8 A;  4WWN A;  2VJ8 A;  5G05 J;  2KAT A;  4EZJ A;  5LX8 A;  1H2V C;  3LVQ E;  4F53 A;  5FZQ A;  2GW1 A;  2J07 A;  3AU4 A;  3FHE A;  2KZT A;  3L54 A;  4I17 A;  2FUL A;  3VLF A;  3PDN A;  4A1S A;  4BT8 A;  1E90 A;  3PRE A;  5LFA A;  1SQM A;  3S7J A;  4BWR A;  3S7D A;  5HI7 A;  4CGV A;  5E75 A;  1KT0 A;  3MEK A;  3B13 A;  4TUU A;  2V4L A;  3SI5 A;  2PM6 A;  1HZ4 A;  4WNG A;  3JQ1 A;  3OXF A;  4XX5 A;  3QAR A;  1ELK A;  3D3M A;  4TV3 A;  4GU5 A;  3FWV A;  4G24 A;  4FU3 A;  3P1U A;  5A6C A;  2PZI A;  1N52 A;  1WAO 1;  1NP7 A;  3RU0 A;  1TJF A;  3FTZ A;  3LEW A;  1H2U A;  1L5J A;  5CHE E;  3MKQ A;  3MV2 B;  4LEU A;  3AS4 A;  3L17 A;  1E8X A;  3FUL A;  5FQ7 A;  3U3W A;  3LY7 A;  2JLB A;  2X38 A;  3CVU A;  5LP0 A;  3ZVV A;  1HS6 A;  2IQC A;  3SF4 A;  2M63 A;  5FZR A;  4GML A;  2WXP A;  3SNX A;  5A23 A;  1SZA A;  4UWF A;  4YVQ C;  3FTS A;  4G23 A;  3ZRH A;  3UT4 A;  3TG4 A;  5BV0 A;  4G1T A;  2UY1 A;  3MX3 A;  4NAC A;  4HOS A;  3FTW A;  3ZN3 A;  5G04 J;  1YA0 A;  3ONL A;  4EQF A;  1Z6T A;  2AW6 A;  4TRQ A;  5ARF A;  4NQ0 A;  1DVP A;  5EKQ D;  4J8S A;  4BT9 A;  1OWM A;  4L7T A;  4M3O A;  1TJC A;  3CK9 A;  3ML8 A;  4G2V A;  2CG2 A;  5KJL A;  4EPZ A;  1UJK A;  4FJY A;  4I43 A;  2IU1 A;  3S7B A;  3SHF A;  2AVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...