3Q7FA

Cryptococcus neoformans protein farnesyltransferase in complex with fpp and ethylenediamine inhibitor 1
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
330
structure length
313
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase alpha subunit
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase/transferase inhibitor
total genus 126
structure length 313
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q7fA00
3KSQA 1N4PA 1LTXA 1O1RA 1FT1A 1N95A 1JCSA 2R2LA 1TN8A 1O1SA 1D8EA 1SA5A 3DSVA 1DCEA 4GTMA 3DSUA 1O5MA 3DSSA 1NI1A 4LNGA 3PZ3A 3E33A 3PZ4A 1LD7A 1N4SA 4GTOA 1O1TA 2F0YA 1KZPA 1TN7A 1N94A 4GTQA 1JCQA 3HXEA 4YDEA 1MZCA 1N4RA 3EU5A 3HXDA 1N9AA 3C72A 3E34A 4LNBA 2H6IA 3Q73A 3Q7AA 3SFYA 1QBQA 4GTTA 4YDOA 4GTSA 4GTRA 3HXCA 1X81A 1TNOA 1KZOA 3PZ1A 1FPPA 4GTVA 3DRAA 2H6HA 2H6GA 3Q7FA 1S64A 1FT2A 1SA4A 3HXBA 2H6FA 3DSTA 1JCRA 3E37A 1TNUA 2BEDA 3Q79A 3HXFA 1D8DA 3KSLA 3DSWA 3Q78A 3Q75A 2ZISA 3EUVA 1NL4A 3DPYA 1N4QA 1TN6A 1TNYA 4L9PA 2ZIRA 1S63A 4GTPA 2IEJA 1TNBA 4EHMA 4MBGA 3E32A 3E30A 3SFXA 1LD8A 3PZ2A 3DSXA 1TNZA
chains in the Genus database with same CATH superfamily
3FP3A 4J8EA 3J5QB 3ZNGA 2JLBA 3EJNA 3FHEA 2X6KA 2KCKA 3HVEB 5ENNA 4FJZA 2WXHA 3NOCD 3HHMA 3Q49B 3CHQA 3DEPA 4BSXA 1NI1A 4N2QA 3BEEA 1YA0A 1V54E 3D9HA 3HVEA 1H2UA 1O1TA 2P9SG 2F0YA 3ZN3A 4HORA 3B13A 3PVLA 5FQ4A 2VTBB 4ANXA 5EYPF 1FVHA 5ENSD 1X81A 3TAXA 4J0UA 3K9IA 5FZRA 4WNDA 3JCKC 2ETBA 2P9IG 4BX9A 4J7WA 4JHRA 3TWXA 3HG0D 3HXBA 4QQIA 2XZTG 2WQ7A 4U96D 3HXFA 5C1DA 3V30A 4WNGA 5E75A 2V8SE 1U2VG 1QZ2A 3RAUA 4I6EA 2AXUA 4M3OA 4U04A 3E32A 5FQ6A 3QJZA 4IRUA 3UTMA 3PE3A 2QFCA 1E8ZA 1N4PA 3S7BA 4OAUC 3AG3E 4LCTA 4LSZE 4RVBA 3ZW3A 4URKA 3W9GA 4UI9C 4FP7A 4LUNU 3TG4A 2J08A 1HX8A 2KCLA 4TRQA 2WXMA 4HBDA 2J4BA 3EDTB 5D2MC 3W9FA 2DIWA 1LD7A 3RSEG 2MOWA 2OV8A 4WNFA 3NQPA 3LS8A 3D9LA 3KD7A 2ETAA 3EIQC 4A1GA 4YDEA 3D9JA 3ZFWA 1XNFA 5JMND 1N54A 4GA2A 1OT8A 3APCA 2NSZA 4LNBA 4B93B 4Y6CA 4EBAG 3ZXPA 3IV0A 2R17C 3Q7AA 3UT7A 5B3SE 5H7PA 3VTXA 2L0TB 2HO1A 4GA0A 2YHEA 4AIFA 4G23A 3WG7E 5IY5E 2KM4A 4J8YA 4JL0A 2B6CA 1YYHA 1HS6A 3FUJA 3KEZA 2XENA 2KZTB 5AAOA 5FZSA 4L2LA 2VSOE 5AQ7A 2WXKA 4GA1A 5BW8C 2WPVA 4IN3B 5B1AE 4EZJA 1E7UA 3AG2E 4OVVA 2KZTA 3FWVA 5JJ6A 1HE8A 2R05A 3APDA 3L17A 3RRUA 1WG0A 4NURA 4I2ZA 3TWQA 4RG9A 1Y6IA 1DCQA 3ZU7B 4TUUA 1INZA 3CQGB 1D8EA 1N52A 1UJJA 3OXFA 5CERB 4RLYA 3LVQE 2RG8A 3L13A 2YQ8A 3GW4A 4CGWA 3IBEA 2J8SD 4GTQA 4U0ZA 1MHQA 1KLXA 2P58C 3FU3A 2EILE 5CBNA 3MCXA 4K0RA 3ZKJA 1N0RA 3EU5A 4YDWA 2J49A 4AOFA 2JEKA 4GAAA 3MX3A 2X6FA 3D9IA 3TWVA 2R03A 3PREA 4U07A 2FBNA 3CLJA 3JQ1A 3BQOA 4DI3A 1S64A 2V4LA 2X38A 3QC1A 1SA4A 2WXIA 4YNDA 3PE4A 2KBXA 4UI9J 3Q78A 3ASDA 1S70B 4WNEA 4UUCA 1VDYA 4UWFA 4XZ4A 4DX2A 2LO6A 2GRNB 2IOLA 5ENQD 2XHEA 3NB2A 4A63B 1LD8A 3RU0A 5AARA 3MGBA 2FO7A 5LP0A 1FVFA 2XEHA 3ISMC 2RKKA 4GTMA 3HIZA 2NC9A 3IXEA 3GZ2A 3BU8A 3Q15A 3TJPA 4UWHA 4XI0A 3E33A 1TR4A 3VLEA 3SFZA 3APFA 4GTOA 4CYMD 2EIJE 1N94A 2ONDA 4JHKA 3CVNA 1OCZE 4JD2G 2F8XK 3AG4E 5JJTA 5FWQA 4W9RA 2VSXE 4IULA 5ANLA 4AVXA 4TXPA 4XEIG 4QFVA 2AXVA 1ZBPA 3G2TA 1JUQA 2WMOA 1SW6A 1TNOA 2BKGA 4PS8A 3C98A 2PNNA 3LDZA 3ML9A 3FULA 3Q7FA 5AJLA 1RW2A 2A5EA 4HOTA 3UI2A 2J4DA 4F1PA 2DWZA 3QNKA 1FCHA 5C2YA 3G2SA 4UQZA 4D10C 3FUFA 5G2NA 2ZIRA 3ZUVB 1S63A 4GTPA 1XGWA 3ASNE 4O60A 3AU4A 5ENOD 3DSXA 4KZ0A 3RK6A 5ENPD 5T4YA 5KBAA 1O1RA 1K1AA 5CCMA 5EIDA 4EQFA 1QYMA 3OAWA 2RFAA 4HXIA 4EZLA 5D0QD 4NACA 1L5JA 3LY8A 4B0ZA 4H7XA 1KZPA 4G25A 4F3VA 2NYJA 3ONLA 2I6HA 3UQ3A 2IO3C 5CECB 1LF8A 3FFLA 3QAQA 4FU3A 2AJAA 4MKTA 4MRUA 3BUAA 1Y8MA 1ELKA 4GTTA 2UWJG 3FY4A 3DEOA 4LERA 3PZ1A 2VJ8A 1HU3A 2GRLA 4BY6A 3CVWA 4DRXE 4I43A 4PS7A 5BXOA 3QKYA 3PDNA 1V55E 3TWUA 4OVUA 4APOA 2BTDA 4AV7A 2A4ZA 2WXFA 3JXJA 3UM1A 2WXOA 2VSNA 3AS8A 2PM7A 4HRLA 2VGYA 4CEMA 3UXGA 3KS2A 3L9TA 3DBSA 3NOGD 2Y1LE 4ZHBA 4KBQA 5D0OD 3B7SA 5LX8A 2LAHA 2Y3AA 1H6PA 3QWWA 3ABKE 3PS6A 2QYUA 4FA6A 5CMWA 2FI7A 2X6IA 3D9PA 5M72A 2XEVA 3FU5A 1O1SA 3D3MA 5JHAA 4GPKA 1N0QA 3JXIA 3MA5A 3QB2A 5KNHD 3FH7A 3TWWA 3CK9A 3R9AB 3S7FA 1E8WA 1PC2A 4JZYA 4FJYA 4MLPA 4A3TA 2C0LA 3TG5A 3JUEA 2Q7FA 3OXLA 4CDRA 2PQRA 3ULYA 4BWRA 2ZGDA 4GTSA 3MEKA 4U8VD 3ZYLA 3CVPA 3FTVA 1EPUA 4OAVB 2VGXA 1OWMA 3B7BA 3UM3A 2E0IA 4WWPA 2MYOA 4GTVA 3CKBA 4JW1A 4BX8A 2KATA 2XRZA 5JJ7A 3AS5A 1TNUA 1SQMA 3SD5A 5A7DB 3DSWA 2WXQA 4HI9A 2L9BA 4BTBA 4I17A 1OWPA 1SZAA 3OTNA 2IEJA 3VLDA 4AP2A 3O48A 4HOUA 1KPSB 3FU0A 2J9QA 4FADA 2WM9A 1A17A 1LTXA 3LKUA 4GZCA 3P1UA 3PZDA 1JCSA 4A55A 2FULA 4YVQC 5BXUA 3DSVA 4UWKA 3TXMA 1DC2A 1HO8A 3Q9UC 2XPZA 4DK5A 5KNGA 5EILA 2CG3A 4TXRA 4BTAA 1TEZA 3V79K 1IHGA 2IF4A 1EYHA 1UJKA 1MX4A 4JPSA 2XGOA 4C48B 5FZQA 4GTRA 2IO2C 3GYZA 1JWGA 2WXNA 2I1JA 2OEVA 3U66A 2Y4UA 3EU9A 4B8AA 2VQ2A 1UW4B 4GMLA 2VGEA 2QZAA 3Q79A 3FH5A 2XGMA 1ZB1A 3ZYQA 3IHVA 2M63A 5FTPA 3R7QA 2XRYA 3ABLE 3CGHA 4ME2A 2X3MA 2DZOA 1TNBA 4GZ5A 4G8KA 3SFXA 1A5EA 1AP7A 3CHOA 1OWLA 5ENRD 4ZFHA 4U7EB 1OWNA 1N95A 1SA5A 2IU1A 3MYVA 3RJVA 4CZ2D 1HH8A 3PZ3A 3SI5A 3FUMA 2CFZA 3PZ4A 4LEUA 2V5FA 2QYJA 2LNIA 1OCCE 2OCCE 4NIKA 4U0SA 4GZ3A 4F53A 3RRNB 2OVBA 3FH8A 2JABA 3UMVA 3S2AA 3ABME 3E34A 3B95A 4J8FA 3U4TA 3UIOC 4BFRA 3GZ1A 3QOUA 1D9SA 2P9UG 2GRRB 4GCOA 3CVVA 2H6FA 4AY5A 4CCAA 3I5PA 1K3ZD 4GMRA 4GCNA 1UG3A 3QARA 5HI7A 2DZNA 1N4QA 4YDYA 5BUZA 3FTZA 2XS1A 3ULEG 4ATZD 3LXUX 4GU5A 4HFGA 3L08A 4GMJA 1N11A 2XEEA 2MHKA 2B0OE 2QY7A 1E8XA 4HS2A 5HRYA 5T3RA 4XX5A 2EIKE 3UKRG 4BESA 2ZXWE 4CDMA 2WXPA 3FTYA 4U8HA 3LJ3A 3SF4A 3SNXA 4O1PA 2AXZA 2P9KG 1O5MA 3U64A 2R02A 3L16A 3R9MA 3Q5MA 5FJYA 1ZU2A 2FEZA 4HOSA 5FQ8A 2LXMA 3BG0B 2GRQB 3EHNA 2HE0A 2CHXA 5LCWC 5AN8A 1N9AA 5HQ8A 1HG2A 5G55A 3UM0A 3D9KA 1QBQA 2ZU6B 2XPYA 4YDOA 3UKUG 2I2OA 4CT0A 5AYWD 3FUKA 3CVXA 3P2BA 2NXPA 4JXTA 1YCSB 4K5BA 3L54A 2H6HA 4PUCA 1U3DA 3FU6A 4Y6WA 2PL2A 2YNQA 1JCRA 4APFA 1QQEA 1BPOA 2OOEA 1RZ4A 3ASFA 1UN9A 3C3OA 4F1SA 2LUHA 3NZSA 2LXLA 3EHMA 3BG1B 4EHMA 1E90A 3QWVA 4DX5D 3LYAA 2Y0BG 3QDNA 4DUIA 1TNZA 3TWTA 5G05C 4LRZA 4GB9A 3Q47B 2LAIA 4G11A 4XKCA 5CBOA 1BLXB 2R2LA 4K5CA 3C5RA 1TN8A 2UY1A 1W3BA 4L7TA 3DSUA 1PY1A 2IY0C 3FDHA 2LSUA 3CSTA 3V2OA 3LPZA 3IKOB 4AEZC 4I1OB 4I9EA 3HXEA 3AU5A 3RO2A 3ML8A 1G3NB 3CVQA 2E2EA 1MJ0A 1YMPA 4I2WA 4R7LA 5ANRA 1NA0A 1H2VC 5B1BE 1N4RA 4HOQA 3PRZA 4HLLA 5FIOA 1OCOE 1TJFA 4GZ6A 4A1SA 4F6RD 4C0MA 3CHRA 2R59A 3L6AA 3IHYA 4I6JA 4PDXA 4C0EA 1IQRA 2H6GA 3QWPA 3LVRE 2LSVA 3U9WA 2OVFA 4JB8P 5CEDB 3HYMB 4TV3A 4GPMA 2CG2A 1NL4A 4KXKB 2HR2A 2C2LA 3CIAA 4O1OA 2L0IA 4JC8A 2ILRA 3DXKG 3CVYA 3RRMB 1K8KG 3D9NA 3URZA 2AVPA 4N3CA 2DBAA 4A3VA 3U3WA 1HF8A 4L1BA 3LCAA 4OYSA 5LCWJ 2GRMA 4DI4A 3FUEA 5J08A 4HQDA 2GROB 1BI7B 2XPIA 1K1BA 4E6HA 2J09A 4BEPA 5KCMA 4ILIA 5AQAA 4LNUD 1BD8A 3V2XA 4EPZA 4K03A 4B89A 3TWSA 4TXQA 1TN7A 3WXXA 4L23A 2DYSE 5CHEE 1Z5SC 1MQSA 4ANVA 5KJLA 4AY6A 4DJAA 1PAQA 3G2VA 3C72A 3J5PA 1H6OA 4N3BA 2H6IA 2Y69E 3X2QE 3B7RL 4J8DA 4N5QA 1KZOA 2XS8A 2KCVA 3FUDA 1HG5A 4G8LA 3SZ7A 4DX1A 2VGXB 5G05J 3AAAC 2KXPC 3I4RB 5G04C 5KJMA 3CVUA 2BEDA 4AM9A 4U63A 2X6JA 3KEAA 4RSYA 3ZVVA 2WMNA 1TNYA 2F8YA 4EECA 5LOZA 4DX6D 4U8YD 3ZXSA 4ANUA 2ZGGA 3UM2A 3MZLB 4K5AB 5EYLA 3ASGA 3N71A 3SBTB 5DIZA 4HRMB 4HLEA 3Q4AB 4F7AA 4E85A 2WVIA 3CR3A 3DSSA 4X8QA 3UT4A 4C9BB 4I1AA 3FUNA 4TUMA 5FINA 5EIBE 3O4ZA 4NQ0A 2AWIA 1JPLA 3CVLA 4HNAD 3ULQA 3UT8A 5JHBA 4XKBA 3R7RA 3T9KA 4N39A 4KMOA 2VTBA 1SZ9A 3ESLA 1E96B 5ARGA 2IFUA 4ABNA 4BETA 3HXDA 3ZHEB 1IKND 1S0PA 3SHFA 3PEUB 1E7VA 3SBSA 4FHJA 4H7YA 3ZHEA 2CHWA 3ASHA 5KJKA 3CHMA 3ZYMA 1BI8B 4ACLA 1OCRE 5HKPA 3RKVA 5EKQD 4ANWA 4FLBA 2AW6A 2KC7A 3S7JA 3KSLA 2I9CA 3TGOA 2BUGA 2ZISA 3EUVA 5JA4D 1IHBA 3DPYA 1WM5A 4LG6A 2RD0A 3OXGA 4GYWA 5A6CA 3CK8A 4G1TA 3ZPJA 2L6BA 2GW1A 5AJDA 4MBGA 3E30A 3ESKA 2PM6A 1ELRA 1H6KA 1U3CA 4PH4B 1JWFA 3HRAA 2WB2A 3UIPC 3EHQA 4B94A 1TYQG 4JA9A 3AS4A 3F6QA 3FTXA 1P5QA 4WWOA 2WXLA 2GGFA 3T5VA 1OY3D 2XCBA 1NP7A 5J90A 1UOHA 4P29A 3HDXA 3UPVA 5G04J 3CEQA 3KAEA 1EDUA 3Q9NC 4V3IA 1IYGA 3VLFA 4N5CA 3PNTB 2WXGA 2V4HC 5HS0A 4XIFA 1WDYA 2PZIA 4WAFA 4FC8A 3ZYKA 4UI9K 3DPDA 4JEUA 3ASOE 1KT1A 1UN8A 1H0AA 3DRAA 3JYSA 4KVOA 1FT2A 2HM8A 3T5XA 4G26A 4WWNA 1E8YA 2XGSA 4G2VA 3CV0A 3CHPA 2C0MA 4DPRA 4JHJA 2F37A 2IOSA 4HI8A 5EDSA 5EX0A 3LY9A 4UWLA 3ZIMA 3RIBA 1BU9A 2WXJA 5KJNA 4Q94A 3CHSA 1KT0A 3ONKA 3EIJA 3FUIA 2I1KA 2YHCA 2GRPB 2L6JA 5BPPA 4FHKA 4J8SA 2Y4TA 4CGVA 5E76A 4LNGA 3TWRA 4BERA 1NZNA 1OWOA 4EZKA 1Z3YA 1N4SA 4AJWA 3S7DA 5FQ7A 3CK7A 4JA7A 3SY2A 1JCQA 2WQHA 3TXNA 5A23A 2J07A 3PUKA 5KWDA 1AWCB 3SQVA 2OEWA 4GZDA 4RQIA 5LFAA 4CT4A 2WXRA 2FO1E 3MJWA 4HRNA 2XCCA 3Q73A 5T8IA 1HFAA 3NF1A 4ILGA 5BV1A 5ITZF 2DCPA 3T8MA 3SGHA 3LEWA 3G2WA 4YVOA 3C3QA 2BF0X 3PNLB 1MYOA 2BKKB 4I9CA 3MV2B 4HVBA 4PS3A 4N2SA 4MS6A 1OXJA 2PQNA 1HZ4A 4M7CA 3QK0A 3ZRHA 3Q75A 1NFIE 4NRHB 2X6HA 4L9PA 3RO3A 1H19A 3CKCA 4XE0A 2XZDG 5FT9A 2P2CP 2P9PG 3SO8A 3EHRA 2V5QC 5ENTD 4JEHA 1WAO1 4JVSA 3FEYA 5EX3A 5AIJA 1SVXA 4ILHB 3FTUA 1DVPA 3UX4A 1HXIA 2IJGX 3FTWA 4ATGA 3L22A 1ELWA 3MV3B 4G24A 3FUHA 5BNWA 2UY1B 3UINC 1GW6A 5AENA 3MKQB 3V31A 2R5SA 5CCLA 4KT6B 5CRUA 5DBKA 2P9NG 4EBAA 3ZEFA 5BV0A 2DVWA 3I3NA 5AQ9A 2CFUA 1MZCA 2IONA 3MKQA 3FTSA 3NAWA 3D9MA 1DNPA 3B7UX 3UUXA 3I4GA 4U95D 2EQXA 2ETCA 4O6FA 4BT9A 3L82A 1Z3XA 2DYRE 1B89A 2VYIA 3AG1E 3T8KA 3MKRA 1H2TC 3DSTA 2HYZA 3E37A 3TL5A 4B8CB 4U0UA 1TJCA 4UQXA 3B7TA 3LJNA 4AXHA 1TN6A 2EIME 4CRWA 4N3AA 4UQYA 4DX7D 1NA3A 4ACKA 4CDNA 2EINE 4KVMA 3VTYA 3PZ2A 3KSQA 1FT1A 4DLQA 4FULA 3FEXA 3E4BA 3GZSA 2IQCA 1DCEA 1WY6A 2CHZA 3PEVB 5EN5D 3CQCB 4BT8A 4GYYA 3DWLG 4BSZB 3CSFA 4GYOA 4HB5A 3ENEA 3IEGA 3ZGQA 2V0PA 5ARFA 4I6GA 1Z6TA 4XI9A 1QNFA 1IQUA 2YINA 3PH0C 2QC9A 4UWGA 4J6IA 4KYOB 3JUIA 3LY7A 1IXVA 1Q2ZA 3NZUA 5CEAA 2FF4A 5BT1A 3SFYA 4L2YA 4I1MA 1EF1C 4DLOA 3HXCA 3PUJA 4WUYA 4IYPA 1FPPA 1X5BA 5CRVA 2RFMA 3AJIA 3NBNB 1MX2A 3JQ0A 1MX6A 4Q69A 4Z68A 3D9OA 2XQ0A 2P9LG 1OUVA 1D8DA 2MRIA 4KZCA 4RG6A 2VSYA 2WQ6A 2A5UA 5D66A 4FLHA 3DXMG 5AQBA 3G2UA 3C3RA 5CMYA 4Q96A
chains in the Genus database with same CATH topology
3KSQA 1N4PA 1LTXA 1O1RA 1FT1A 1N95A 1JCSA 2R2LA 1TN8A 1O1SA 1D8EA 1SA5A 3DSVA 1DCEA 4GTMA 3DSUA 1O5MA 3DSSA 1NI1A 4LNGA 3PZ3A 3E33A 3PZ4A 1LD7A 1N4SA 4GTOA 1O1TA 2F0YA 1KZPA 1TN7A 1N94A 4GTQA 1JCQA 3HXEA 4YDEA 1MZCA 1N4RA 3EU5A 3HXDA 1N9AA 3C72A 3E34A 4LNBA 2H6IA 3Q73A 3Q7AA 3SFYA 1QBQA 4GTTA 4YDOA 4GTSA 4GTRA 3HXCA 1X81A 1TNOA 1KZOA 3PZ1A 1FPPA 4GTVA 3DRAA 2H6HA 2H6GA 3Q7FA 1S64A 1FT2A 1SA4A 3HXBA 2H6FA 3DSTA 1JCRA 3E37A 1TNUA 2BEDA 3Q79A 3HXFA 1D8DA 3KSLA 3DSWA 3Q78A 3Q75A 2ZISA 3EUVA 1NL4A 3DPYA 1N4QA 1TN6A 1TNYA 4L9PA 2ZIRA 1S63A 4GTPA 2IEJA 1TNBA 4EHMA 4MBGA 3E32A 3E30A 3SFXA 1LD8A 3PZ2A 3DSXA 1TNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSQ A;  1N4P A;  1LTX A;  1O1R A;  1FT1 A;  1N95 A;  1JCS A;  2R2L A;  1TN8 A;  1O1S A;  1D8E A;  1SA5 A;  3DSV A;  1DCE A;  4GTM A;  3DSU A;  1O5M A;  3DSS A;  1NI1 A;  4LNG A;  3PZ3 A;  3E33 A;  3PZ4 A;  1LD7 A;  1N4S A;  4GTO A;  1O1T A;  2F0Y A;  1KZP A;  1TN7 A;  1N94 A;  4GTQ A;  1JCQ A;  3HXE A;  4YDE A;  1MZC A;  1N4R A;  3EU5 A;  3HXD A;  1N9A A;  3C72 A;  3E34 A;  4LNB A;  2H6I A;  3Q73 A;  3Q7A A;  3SFY A;  1QBQ A;  4GTT A;  4YDO A;  4GTS A;  4GTR A;  3HXC A;  1X81 A;  1TNO A;  1KZO A;  3PZ1 A;  1FPP A;  4GTV A;  3DRA A;  2H6H A;  2H6G A;  3Q7F A;  1S64 A;  1FT2 A;  1SA4 A;  3HXB A;  2H6F A;  3DST A;  1JCR A;  3E37 A;  1TNU A;  2BED A;  3Q79 A;  3HXF A;  1D8D A;  3KSL A;  3DSW A;  3Q78 A;  3Q75 A;  2ZIS A;  3EUV A;  1NL4 A;  3DPY A;  1N4Q A;  1TN6 A;  1TNY A;  4L9P A;  2ZIR A;  1S63 A;  4GTP A;  2IEJ A;  1TNB A;  4EHM A;  4MBG A;  3E32 A;  3E30 A;  3SFX A;  1LD8 A;  3PZ2 A;  3DSX A;  1TNZ A; 
#chains in the Genus database with same CATH topology
 3FP3 A;  4J8E A;  3J5Q B;  3ZNG A;  2JLB A;  3EJN A;  3FHE A;  2X6K A;  2KCK A;  3HVE B;  5ENN A;  4FJZ A;  2WXH A;  3NOC D;  3HHM A;  3Q49 B;  3CHQ A;  3DEP A;  4BSX A;  1NI1 A;  4N2Q A;  3BEE A;  1YA0 A;  1V54 E;  3D9H A;  3HVE A;  1H2U A;  1O1T A;  2P9S G;  2F0Y A;  3ZN3 A;  4HOR A;  3B13 A;  3PVL A;  5FQ4 A;  2VTB B;  4ANX A;  5EYP F;  1FVH A;  5ENS D;  1X81 A;  3TAX A;  4J0U A;  3K9I A;  5FZR A;  4WND A;  3JCK C;  2ETB A;  2P9I G;  4BX9 A;  4J7W A;  4JHR A;  3TWX A;  3HG0 D;  3HXB A;  4QQI A;  2XZT G;  2WQ7 A;  4U96 D;  3HXF A;  5C1D A;  3V30 A;  4WNG A;  5E75 A;  2V8S E;  1U2V G;  1QZ2 A;  3RAU A;  4I6E A;  2AXU A;  4M3O A;  4U04 A;  3E32 A;  5FQ6 A;  3QJZ A;  4IRU A;  3UTM A;  3PE3 A;  2QFC A;  1E8Z A;  1N4P A;  3S7B A;  4OAU C;  3AG3 E;  4LCT A;  4LSZ E;  4RVB A;  3ZW3 A;  4URK A;  3W9G A;  4UI9 C;  4FP7 A;  4LUN U;  3TG4 A;  2J08 A;  1HX8 A;  2KCL A;  4TRQ A;  2WXM A;  4HBD A;  2J4B A;  3EDT B;  5D2M C;  3W9F A;  2DIW A;  1LD7 A;  3RSE G;  2MOW A;  2OV8 A;  4WNF A;  3NQP A;  3LS8 A;  3D9L A;  3KD7 A;  2ETA A;  3EIQ C;  4A1G A;  4YDE A;  3D9J A;  3ZFW A;  1XNF A;  5JMN D;  1N54 A;  4GA2 A;  1OT8 A;  3APC A;  2NSZ A;  4LNB A;  4B93 B;  4Y6C A;  4EBA G;  3ZXP A;  3IV0 A;  2R17 C;  3Q7A A;  3UT7 A;  5B3S E;  5H7P A;  3VTX A;  2L0T B;  2HO1 A;  4GA0 A;  2YHE A;  4AIF A;  4G23 A;  3WG7 E;  5IY5 E;  2KM4 A;  4J8Y A;  4JL0 A;  2B6C A;  1YYH A;  1HS6 A;  3FUJ A;  3KEZ A;  2XEN A;  2KZT B;  5AAO A;  5FZS A;  4L2L A;  2VSO E;  5AQ7 A;  2WXK A;  4GA1 A;  5BW8 C;  2WPV A;  4IN3 B;  5B1A E;  4EZJ A;  1E7U A;  3AG2 E;  4OVV A;  2KZT A;  3FWV A;  5JJ6 A;  1HE8 A;  2R05 A;  3APD A;  3L17 A;  3RRU A;  1WG0 A;  4NUR A;  4I2Z A;  3TWQ A;  4RG9 A;  1Y6I A;  1DCQ A;  3ZU7 B;  4TUU A;  1INZ A;  3CQG B;  1D8E A;  1N52 A;  1UJJ A;  3OXF A;  5CER B;  4RLY A;  3LVQ E;  2RG8 A;  3L13 A;  2YQ8 A;  3GW4 A;  4CGW A;  3IBE A;  2J8S D;  4GTQ A;  4U0Z A;  1MHQ A;  1KLX A;  2P58 C;  3FU3 A;  2EIL E;  5CBN A;  3MCX A;  4K0R A;  3ZKJ A;  1N0R A;  3EU5 A;  4YDW A;  2J49 A;  4AOF A;  2JEK A;  4GAA A;  3MX3 A;  2X6F A;  3D9I A;  3TWV A;  2R03 A;  3PRE A;  4U07 A;  2FBN A;  3CLJ A;  3JQ1 A;  3BQO A;  4DI3 A;  1S64 A;  2V4L A;  2X38 A;  3QC1 A;  1SA4 A;  2WXI A;  4YND A;  3PE4 A;  2KBX A;  4UI9 J;  3Q78 A;  3ASD A;  1S70 B;  4WNE A;  4UUC A;  1VDY A;  4UWF A;  4XZ4 A;  4DX2 A;  2LO6 A;  2GRN B;  2IOL A;  5ENQ D;  2XHE A;  3NB2 A;  4A63 B;  1LD8 A;  3RU0 A;  5AAR A;  3MGB A;  2FO7 A;  5LP0 A;  1FVF A;  2XEH A;  3ISM C;  2RKK A;  4GTM A;  3HIZ A;  2NC9 A;  3IXE A;  3GZ2 A;  3BU8 A;  3Q15 A;  3TJP A;  4UWH A;  4XI0 A;  3E33 A;  1TR4 A;  3VLE A;  3SFZ A;  3APF A;  4GTO A;  4CYM D;  2EIJ E;  1N94 A;  2OND A;  4JHK A;  3CVN A;  1OCZ E;  4JD2 G;  2F8X K;  3AG4 E;  5JJT A;  5FWQ A;  4W9R A;  2VSX E;  4IUL A;  5ANL A;  4AVX A;  4TXP A;  4XEI G;  4QFV A;  2AXV A;  1ZBP A;  3G2T A;  1JUQ A;  2WMO A;  1SW6 A;  1TNO A;  2BKG A;  4PS8 A;  3C98 A;  2PNN A;  3LDZ A;  3ML9 A;  3FUL A;  3Q7F A;  5AJL A;  1RW2 A;  2A5E A;  4HOT A;  3UI2 A;  2J4D A;  4F1P A;  2DWZ A;  3QNK A;  1FCH A;  5C2Y A;  3G2S A;  4UQZ A;  4D10 C;  3FUF A;  5G2N A;  2ZIR A;  3ZUV B;  1S63 A;  4GTP A;  1XGW A;  3ASN E;  4O60 A;  3AU4 A;  5ENO D;  3DSX A;  4KZ0 A;  3RK6 A;  5ENP D;  5T4Y A;  5KBA A;  1O1R A;  1K1A A;  5CCM A;  5EID A;  4EQF A;  1QYM A;  3OAW A;  2RFA A;  4HXI A;  4EZL A;  5D0Q D;  4NAC A;  1L5J A;  3LY8 A;  4B0Z A;  4H7X A;  1KZP A;  4G25 A;  4F3V A;  2NYJ A;  3ONL A;  2I6H A;  3UQ3 A;  2IO3 C;  5CEC B;  1LF8 A;  3FFL A;  3QAQ A;  4FU3 A;  2AJA A;  4MKT A;  4MRU A;  3BUA A;  1Y8M A;  1ELK A;  4GTT A;  2UWJ G;  3FY4 A;  3DEO A;  4LER A;  3PZ1 A;  2VJ8 A;  1HU3 A;  2GRL A;  4BY6 A;  3CVW A;  4DRX E;  4I43 A;  4PS7 A;  5BXO A;  3QKY A;  3PDN A;  1V55 E;  3TWU A;  4OVU A;  4APO A;  2BTD A;  4AV7 A;  2A4Z A;  2WXF A;  3JXJ A;  3UM1 A;  2WXO A;  2VSN A;  3AS8 A;  2PM7 A;  4HRL A;  2VGY A;  4CEM A;  3UXG A;  3KS2 A;  3L9T A;  3DBS A;  3NOG D;  2Y1L E;  4ZHB A;  4KBQ A;  5D0O D;  3B7S A;  5LX8 A;  2LAH A;  2Y3A A;  1H6P A;  3QWW A;  3ABK E;  3PS6 A;  2QYU A;  4FA6 A;  5CMW A;  2FI7 A;  2X6I A;  3D9P A;  5M72 A;  2XEV A;  3FU5 A;  1O1S A;  3D3M A;  5JHA A;  4GPK A;  1N0Q A;  3JXI A;  3MA5 A;  3QB2 A;  5KNH D;  3FH7 A;  3TWW A;  3CK9 A;  3R9A B;  3S7F A;  1E8W A;  1PC2 A;  4JZY A;  4FJY A;  4MLP A;  4A3T A;  2C0L A;  3TG5 A;  3JUE A;  2Q7F A;  3OXL A;  4CDR A;  2PQR A;  3ULY A;  4BWR A;  2ZGD A;  4GTS A;  3MEK A;  4U8V D;  3ZYL A;  3CVP A;  3FTV A;  1EPU A;  4OAV B;  2VGX A;  1OWM A;  3B7B A;  3UM3 A;  2E0I A;  4WWP A;  2MYO A;  4GTV A;  3CKB A;  4JW1 A;  4BX8 A;  2KAT A;  2XRZ A;  5JJ7 A;  3AS5 A;  1TNU A;  1SQM A;  3SD5 A;  5A7D B;  3DSW A;  2WXQ A;  4HI9 A;  2L9B A;  4BTB A;  4I17 A;  1OWP A;  1SZA A;  3OTN A;  2IEJ A;  3VLD A;  4AP2 A;  3O48 A;  4HOU A;  1KPS B;  3FU0 A;  2J9Q A;  4FAD A;  2WM9 A;  1A17 A;  1LTX A;  3LKU A;  4GZC A;  3P1U A;  3PZD A;  1JCS A;  4A55 A;  2FUL A;  4YVQ C;  5BXU A;  3DSV A;  4UWK A;  3TXM A;  1DC2 A;  1HO8 A;  3Q9U C;  2XPZ A;  4DK5 A;  5KNG A;  5EIL A;  2CG3 A;  4TXR A;  4BTA A;  1TEZ A;  3V79 K;  1IHG A;  2IF4 A;  1EYH A;  1UJK A;  1MX4 A;  4JPS A;  2XGO A;  4C48 B;  5FZQ A;  4GTR A;  2IO2 C;  3GYZ A;  1JWG A;  2WXN A;  2I1J A;  2OEV A;  3U66 A;  2Y4U A;  3EU9 A;  4B8A A;  2VQ2 A;  1UW4 B;  4GML A;  2VGE A;  2QZA A;  3Q79 A;  3FH5 A;  2XGM A;  1ZB1 A;  3ZYQ A;  3IHV A;  2M63 A;  5FTP A;  3R7Q A;  2XRY A;  3ABL E;  3CGH A;  4ME2 A;  2X3M A;  2DZO A;  1TNB A;  4GZ5 A;  4G8K A;  3SFX A;  1A5E A;  1AP7 A;  3CHO A;  1OWL A;  5ENR D;  4ZFH A;  4U7E B;  1OWN A;  1N95 A;  1SA5 A;  2IU1 A;  3MYV A;  3RJV A;  4CZ2 D;  1HH8 A;  3PZ3 A;  3SI5 A;  3FUM A;  2CFZ A;  3PZ4 A;  4LEU A;  2V5F A;  2QYJ A;  2LNI A;  1OCC E;  2OCC E;  4NIK A;  4U0S A;  4GZ3 A;  4F53 A;  3RRN B;  2OVB A;  3FH8 A;  2JAB A;  3UMV A;  3S2A A;  3ABM E;  3E34 A;  3B95 A;  4J8F A;  3U4T A;  3UIO C;  4BFR A;  3GZ1 A;  3QOU A;  1D9S A;  2P9U G;  2GRR B;  4GCO A;  3CVV A;  2H6F A;  4AY5 A;  4CCA A;  3I5P A;  1K3Z D;  4GMR A;  4GCN A;  1UG3 A;  3QAR A;  5HI7 A;  2DZN A;  1N4Q A;  4YDY A;  5BUZ A;  3FTZ A;  2XS1 A;  3ULE G;  4ATZ D;  3LXU X;  4GU5 A;  4HFG A;  3L08 A;  4GMJ A;  1N11 A;  2XEE A;  2MHK A;  2B0O E;  2QY7 A;  1E8X A;  4HS2 A;  5HRY A;  5T3R A;  4XX5 A;  2EIK E;  3UKR G;  4BES A;  2ZXW E;  4CDM A;  2WXP A;  3FTY A;  4U8H A;  3LJ3 A;  3SF4 A;  3SNX A;  4O1P A;  2AXZ A;  2P9K G;  1O5M A;  3U64 A;  2R02 A;  3L16 A;  3R9M A;  3Q5M A;  5FJY A;  1ZU2 A;  2FEZ A;  4HOS A;  5FQ8 A;  2LXM A;  3BG0 B;  2GRQ B;  3EHN A;  2HE0 A;  2CHX A;  5LCW C;  5AN8 A;  1N9A A;  5HQ8 A;  1HG2 A;  5G55 A;  3UM0 A;  3D9K A;  1QBQ A;  2ZU6 B;  2XPY A;  4YDO A;  3UKU G;  2I2O A;  4CT0 A;  5AYW D;  3FUK A;  3CVX A;  3P2B A;  2NXP A;  4JXT A;  1YCS B;  4K5B A;  3L54 A;  2H6H A;  4PUC A;  1U3D A;  3FU6 A;  4Y6W A;  2PL2 A;  2YNQ A;  1JCR A;  4APF A;  1QQE A;  1BPO A;  2OOE A;  1RZ4 A;  3ASF A;  1UN9 A;  3C3O A;  4F1S A;  2LUH A;  3NZS A;  2LXL A;  3EHM A;  3BG1 B;  4EHM A;  1E90 A;  3QWV A;  4DX5 D;  3LYA A;  2Y0B G;  3QDN A;  4DUI A;  1TNZ A;  3TWT A;  5G05 C;  4LRZ A;  4GB9 A;  3Q47 B;  2LAI A;  4G11 A;  4XKC A;  5CBO A;  1BLX B;  2R2L A;  4K5C A;  3C5R A;  1TN8 A;  2UY1 A;  1W3B A;  4L7T A;  3DSU A;  1PY1 A;  2IY0 C;  3FDH A;  2LSU A;  3CST A;  3V2O A;  3LPZ A;  3IKO B;  4AEZ C;  4I1O B;  4I9E A;  3HXE A;  3AU5 A;  3RO2 A;  3ML8 A;  1G3N B;  3CVQ A;  2E2E A;  1MJ0 A;  1YMP A;  4I2W A;  4R7L A;  5ANR A;  1NA0 A;  1H2V C;  5B1B E;  1N4R A;  4HOQ A;  3PRZ A;  4HLL A;  5FIO A;  1OCO E;  1TJF A;  4GZ6 A;  4A1S A;  4F6R D;  4C0M A;  3CHR A;  2R59 A;  3L6A A;  3IHY A;  4I6J A;  4PDX A;  4C0E A;  1IQR A;  2H6G A;  3QWP A;  3LVR E;  2LSV A;  3U9W A;  2OVF A;  4JB8 P;  5CED B;  3HYM B;  4TV3 A;  4GPM A;  2CG2 A;  1NL4 A;  4KXK B;  2HR2 A;  2C2L A;  3CIA A;  4O1O A;  2L0I A;  4JC8 A;  2ILR A;  3DXK G;  3CVY A;  3RRM B;  1K8K G;  3D9N A;  3URZ A;  2AVP A;  4N3C A;  2DBA A;  4A3V A;  3U3W A;  1HF8 A;  4L1B A;  3LCA A;  4OYS A;  5LCW J;  2GRM A;  4DI4 A;  3FUE A;  5J08 A;  4HQD A;  2GRO B;  1BI7 B;  2XPI A;  1K1B A;  4E6H A;  2J09 A;  4BEP A;  5KCM A;  4ILI A;  5AQA A;  4LNU D;  1BD8 A;  3V2X A;  4EPZ A;  4K03 A;  4B89 A;  3TWS A;  4TXQ A;  1TN7 A;  3WXX A;  4L23 A;  2DYS E;  5CHE E;  1Z5S C;  1MQS A;  4ANV A;  5KJL A;  4AY6 A;  4DJA A;  1PAQ A;  3G2V A;  3C72 A;  3J5P A;  1H6O A;  4N3B A;  2H6I A;  2Y69 E;  3X2Q E;  3B7R L;  4J8D A;  4N5Q A;  1KZO A;  2XS8 A;  2KCV A;  3FUD A;  1HG5 A;  4G8L A;  3SZ7 A;  4DX1 A;  2VGX B;  5G05 J;  3AAA C;  2KXP C;  3I4R B;  5G04 C;  5KJM A;  3CVU A;  2BED A;  4AM9 A;  4U63 A;  2X6J A;  3KEA A;  4RSY A;  3ZVV A;  2WMN A;  1TNY A;  2F8Y A;  4EEC A;  5LOZ A;  4DX6 D;  4U8Y D;  3ZXS A;  4ANU A;  2ZGG A;  3UM2 A;  3MZL B;  4K5A B;  5EYL A;  3ASG A;  3N71 A;  3SBT B;  5DIZ A;  4HRM B;  4HLE A;  3Q4A B;  4F7A A;  4E85 A;  2WVI A;  3CR3 A;  3DSS A;  4X8Q A;  3UT4 A;  4C9B B;  4I1A A;  3FUN A;  4TUM A;  5FIN A;  5EIB E;  3O4Z A;  4NQ0 A;  2AWI A;  1JPL A;  3CVL A;  4HNA D;  3ULQ A;  3UT8 A;  5JHB A;  4XKB A;  3R7R A;  3T9K A;  4N39 A;  4KMO A;  2VTB A;  1SZ9 A;  3ESL A;  1E96 B;  5ARG A;  2IFU A;  4ABN A;  4BET A;  3HXD A;  3ZHE B;  1IKN D;  1S0P A;  3SHF A;  3PEU B;  1E7V A;  3SBS A;  4FHJ A;  4H7Y A;  3ZHE A;  2CHW A;  3ASH A;  5KJK A;  3CHM A;  3ZYM A;  1BI8 B;  4ACL A;  1OCR E;  5HKP A;  3RKV A;  5EKQ D;  4ANW A;  4FLB A;  2AW6 A;  2KC7 A;  3S7J A;  3KSL A;  2I9C A;  3TGO A;  2BUG A;  2ZIS A;  3EUV A;  5JA4 D;  1IHB A;  3DPY A;  1WM5 A;  4LG6 A;  2RD0 A;  3OXG A;  4GYW A;  5A6C A;  3CK8 A;  4G1T A;  3ZPJ A;  2L6B A;  2GW1 A;  5AJD A;  4MBG A;  3E30 A;  3ESK A;  2PM6 A;  1ELR A;  1H6K A;  1U3C A;  4PH4 B;  1JWF A;  3HRA A;  2WB2 A;  3UIP C;  3EHQ A;  4B94 A;  1TYQ G;  4JA9 A;  3AS4 A;  3F6Q A;  3FTX A;  1P5Q A;  4WWO A;  2WXL A;  2GGF A;  3T5V A;  1OY3 D;  2XCB A;  1NP7 A;  5J90 A;  1UOH A;  4P29 A;  3HDX A;  3UPV A;  5G04 J;  3CEQ A;  3KAE A;  1EDU A;  3Q9N C;  4V3I A;  1IYG A;  3VLF A;  4N5C A;  3PNT B;  2WXG A;  2V4H C;  5HS0 A;  4XIF A;  1WDY A;  2PZI A;  4WAF A;  4FC8 A;  3ZYK A;  4UI9 K;  3DPD A;  4JEU A;  3ASO E;  1KT1 A;  1UN8 A;  1H0A A;  3DRA A;  3JYS A;  4KVO A;  1FT2 A;  2HM8 A;  3T5X A;  4G26 A;  4WWN A;  1E8Y A;  2XGS A;  4G2V A;  3CV0 A;  3CHP A;  2C0M A;  4DPR A;  4JHJ A;  2F37 A;  2IOS A;  4HI8 A;  5EDS A;  5EX0 A;  3LY9 A;  4UWL A;  3ZIM A;  3RIB A;  1BU9 A;  2WXJ A;  5KJN A;  4Q94 A;  3CHS A;  1KT0 A;  3ONK A;  3EIJ A;  3FUI A;  2I1K A;  2YHC A;  2GRP B;  2L6J A;  5BPP A;  4FHK A;  4J8S A;  2Y4T A;  4CGV A;  5E76 A;  4LNG A;  3TWR A;  4BER A;  1NZN A;  1OWO A;  4EZK A;  1Z3Y A;  1N4S A;  4AJW A;  3S7D A;  5FQ7 A;  3CK7 A;  4JA7 A;  3SY2 A;  1JCQ A;  2WQH A;  3TXN A;  5A23 A;  2J07 A;  3PUK A;  5KWD A;  1AWC B;  3SQV A;  2OEW A;  4GZD A;  4RQI A;  5LFA A;  4CT4 A;  2WXR A;  2FO1 E;  3MJW A;  4HRN A;  2XCC A;  3Q73 A;  5T8I A;  1HFA A;  3NF1 A;  4ILG A;  5BV1 A;  5ITZ F;  2DCP A;  3T8M A;  3SGH A;  3LEW A;  3G2W A;  4YVO A;  3C3Q A;  2BF0 X;  3PNL B;  1MYO A;  2BKK B;  4I9C A;  3MV2 B;  4HVB A;  4PS3 A;  4N2S A;  4MS6 A;  1OXJ A;  2PQN A;  1HZ4 A;  4M7C A;  3QK0 A;  3ZRH A;  3Q75 A;  1NFI E;  4NRH B;  2X6H A;  4L9P A;  3RO3 A;  1H19 A;  3CKC A;  4XE0 A;  2XZD G;  5FT9 A;  2P2C P;  2P9P G;  3SO8 A;  3EHR A;  2V5Q C;  5ENT D;  4JEH A;  1WAO 1;  4JVS A;  3FEY A;  5EX3 A;  5AIJ A;  1SVX A;  4ILH B;  3FTU A;  1DVP A;  3UX4 A;  1HXI A;  2IJG X;  3FTW A;  4ATG A;  3L22 A;  1ELW A;  3MV3 B;  4G24 A;  3FUH A;  5BNW A;  2UY1 B;  3UIN C;  1GW6 A;  5AEN A;  3MKQ B;  3V31 A;  2R5S A;  5CCL A;  4KT6 B;  5CRU A;  5DBK A;  2P9N G;  4EBA A;  3ZEF A;  5BV0 A;  2DVW A;  3I3N A;  5AQ9 A;  2CFU A;  1MZC A;  2ION A;  3MKQ A;  3FTS A;  3NAW A;  3D9M A;  1DNP A;  3B7U X;  3UUX A;  3I4G A;  4U95 D;  2EQX A;  2ETC A;  4O6F A;  4BT9 A;  3L82 A;  1Z3X A;  2DYR E;  1B89 A;  2VYI A;  3AG1 E;  3T8K A;  3MKR A;  1H2T C;  3DST A;  2HYZ A;  3E37 A;  3TL5 A;  4B8C B;  4U0U A;  1TJC A;  4UQX A;  3B7T A;  3LJN A;  4AXH A;  1TN6 A;  2EIM E;  4CRW A;  4N3A A;  4UQY A;  4DX7 D;  1NA3 A;  4ACK A;  4CDN A;  2EIN E;  4KVM A;  3VTY A;  3PZ2 A;  3KSQ A;  1FT1 A;  4DLQ A;  4FUL A;  3FEX A;  3E4B A;  3GZS A;  2IQC A;  1DCE A;  1WY6 A;  2CHZ A;  3PEV B;  5EN5 D;  3CQC B;  4BT8 A;  4GYY A;  3DWL G;  4BSZ B;  3CSF A;  4GYO A;  4HB5 A;  3ENE A;  3IEG A;  3ZGQ A;  2V0P A;  5ARF A;  4I6G A;  1Z6T A;  4XI9 A;  1QNF A;  1IQU A;  2YIN A;  3PH0 C;  2QC9 A;  4UWG A;  4J6I A;  4KYO B;  3JUI A;  3LY7 A;  1IXV A;  1Q2Z A;  3NZU A;  5CEA A;  2FF4 A;  5BT1 A;  3SFY A;  4L2Y A;  4I1M A;  1EF1 C;  4DLO A;  3HXC A;  3PUJ A;  4WUY A;  4IYP A;  1FPP A;  1X5B A;  5CRV A;  2RFM A;  3AJI A;  3NBN B;  1MX2 A;  3JQ0 A;  1MX6 A;  4Q69 A;  4Z68 A;  3D9O A;  2XQ0 A;  2P9L G;  1OUV A;  1D8D A;  2MRI A;  4KZC A;  4RG6 A;  2VSY A;  2WQ6 A;  2A5U A;  5D66 A;  4FLH A;  3DXM G;  5AQB A;  3G2U A;  3C3R A;  5CMY A;  4Q96 A; 
#chains in the Genus database with same CATH homology
 3KSQ A;  1N4P A;  1LTX A;  1O1R A;  1FT1 A;  1N95 A;  1JCS A;  2R2L A;  1TN8 A;  1O1S A;  1D8E A;  1SA5 A;  3DSV A;  1DCE A;  4GTM A;  3DSU A;  1O5M A;  3DSS A;  1NI1 A;  4LNG A;  3PZ3 A;  3E33 A;  3PZ4 A;  1LD7 A;  1N4S A;  4GTO A;  1O1T A;  2F0Y A;  1KZP A;  1TN7 A;  1N94 A;  4GTQ A;  1JCQ A;  3HXE A;  4YDE A;  1MZC A;  1N4R A;  3EU5 A;  3HXD A;  1N9A A;  3C72 A;  3E34 A;  4LNB A;  2H6I A;  3Q73 A;  3Q7A A;  3SFY A;  1QBQ A;  4GTT A;  4YDO A;  4GTS A;  4GTR A;  3HXC A;  1X81 A;  1TNO A;  1KZO A;  3PZ1 A;  1FPP A;  4GTV A;  3DRA A;  2H6H A;  2H6G A;  3Q7F A;  1S64 A;  1FT2 A;  1SA4 A;  3HXB A;  2H6F A;  3DST A;  1JCR A;  3E37 A;  1TNU A;  2BED A;  3Q79 A;  3HXF A;  1D8D A;  3KSL A;  3DSW A;  3Q78 A;  3Q75 A;  2ZIS A;  3EUV A;  1NL4 A;  3DPY A;  1N4Q A;  1TN6 A;  1TNY A;  4L9P A;  2ZIR A;  1S63 A;  4GTP A;  2IEJ A;  1TNB A;  4EHM A;  4MBG A;  3E32 A;  3E30 A;  3SFX A;  1LD8 A;  3PZ2 A;  3DSX A;  1TNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...