3Q7FA

Cryptococcus neoformans protein farnesyltransferase in complex with fpp and ethylenediamine inhibitor 1
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
330
structure length
313
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Farnesyltransferase alpha subunit
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
total genus 126
structure length 313
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q7fA00
3KSLA 4YDOA 3DSUA 1D8EA 3DSVA 3KSQA 1MZCA 2ZIRA 1O1TA 1KZOA 3SFXA 1TNUA 2H6GA 3C72A 3DSSA 3E37A 1N94A 1NI1A 2IEJA 3PZ1A 3PZ2A 2R2LA 2H6IA 1KZPA 2ZISA 4GTQA 2H6HA 1O5MA 3DSXA 1QBQA 1TNOA 3E30A 1TN6A 4L9PA 1TN8A 1N4SA 1O1SA 4YDEA 2F0YA 1DCEA 3E32A 3DRAA 1N9AA 1NL4A 3PZ4A 4GTTA 4GTRA 2BEDA 3Q75A 4GTPA 1TN7A 1TNBA 1TNYA 1FT1A 3HXCA 3Q73A 1JCSA 1SA4A 3SFYA 3Q79A 3EUVA 3HXFA 1JCQA 3Q78A 1FPPA 3E33A 1TNZA 3PZ3A 3DPYA 3E34A 3EU5A 1JCRA 3DSTA 1X81A 1LD8A 1SA5A 3HXEA 2H6FA 4EHMA 3HXDA 4GTVA 1S63A 1N95A 1D8DA 1N4QA 4GTSA 1LTXA 4GTMA 1N4RA 4MBGA 1FT2A 4LNBA 3Q7AA 1S64A 3HXBA 3Q7FA 4LNGA 1N4PA 1O1RA 4GTOA 1LD7A 3DSWA
chains in the Genus database with same CATH superfamily
3FU0A 4XI0A 2KATA 5JJ6A 1ELRA 4AP2A 4J7WA 1Z5SC 3C72A 5D0OD 3I4GA 3LCAA 1KPSB 4L2LA 1QYMA 3FU5A 5LOZA 4BESA 3FUDA 2IONA 3LJ3A 3W9GA 3SF4A 2X6KA 4GYYA 2CG2A 5LCWJ 2XZDG 4GMLA 1X5BA 1FVHA 4I17A 4TXPA 3CVXA 3NAWA 1TJCA 2CFZA 3OXLA 5E76A 2MHKA 2WXMA 4K5AB 4NURA 4P29A 2BTDA 2P9UG 4GYWA 1Z3XA 3HXCA 3SFYA 2P9KG 3PS6A 3RSEG 4HOSA 5ENOD 3IKOB 3CVYA 3ABME 2M63A 2MYOA 4O1OA 1OUVA 4G1TA 2XCCA 5AENA 1UJKA 3ZFWA 2X38A 3QDNA 4RG6A 1TYQG 5CERB 4H7XA 2ZGDA 1TR4A 4UI9K 3L08A 4GTOA 2OOEA 3SQVA 1G3NB 2FO7A 4YDOA 3DSUA 4PH4B 1AWCB 4AY5A 5ENPD 3ZIMA 3OXGA 5BT1A 1HZ4A 2R2LA 5LFAA 2V4LA 3CVNA 3ASOE 4UI9J 5ENSD 3CK8A 2B0OE 3CQGB 4U0UA 1UN9A 5BXUA 2ZGGA 2ETCA 2IF4A 3QC1A 5G04J 2F8YA 2FEZA 3BUAA 1EYHA 2AXVA 4U8YD 1Y8MA 1E8ZA 3PRZA 3ZW3A 2WXHA 3FUJA 3AS5A 3SNXA 3ZN3A 1B89A 4M3OA 3BG0B 3T5VA 3OXFA 5FINA 4HOTA 4FHJA 3TWVA 3RAUA 3FTSA 3E33A 5AJLA 3NZUA 5KJLA 3EIJA 3Q47B 4J0UA 4N5CA 3UINC 1SW6A 2WXPA 1X81A 5EILA 5EYPF 3ESKA 2V5FA 3LVQE 2JLBA 2ZU6B 2VTBB 1N4RA 2GRQB 4GZ5A 3EHQA 4Q69A 4CDMA 2QYJA 4HNAD 4JW1A 2WQHA 2V8SE 4ABNA 1HX8A 3U66A 3AJIA 3C3RA 3FH7A 4CCAA 3AG4E 2OVFA 1OXJA 2GRNB 1NI1A 3WG7E 4L1BA 4I9EA 4OVUA 1H2TC 2AWIA 2VQ2A 3MKQA 3FY4A 4A3TA 3ASFA 1H6OA 3E30A 4RG9A 2C2LA 3PUKA 4WNDA 5CMYA 1O1SA 5KJMA 3APFA 4HFGA 4BFRA 4N2QA 1DCEA 3R7QA 2VJ8A 3CHSA 3UXGA 2L9BA 3JQ0A 3Q9UC 3RK6A 4BT9A 2GGFA 4YNDA 3TWXA 2E2EA 3C5RA 2VGYA 5EKQD 3U4TA 1SA4A 4EECA 3DEPA 3EUVA 4UUCA 1RZ4A 5FT9A 4PUCA 3FH5A 5KJKA 4I1AA 4WWPA 1PC2A 4NQ0A 2GW1A 3DBSA 3HXEA 2XHEA 3ESLA 1FCHA 1N95A 3FUMA 5CECB 4QQIA 2C0MA 3EIQC 3QNKA 4LNGA 4LEUA 2KZTB 4JB8P 3B7UX 3SO8A 3L13A 4UQZA 4N3BA 4WWNA 5EDSA 4AVXA 1H6PA 5EX3A 4U04A 5FQ6A 4F7AA 4H7YA 2C0LA 3FULA 5B3SE 2R02A 3CLJA 5T3RA 1A5EA 2J8SD 5AIJA 4CYMD 3PZ2A 5A6CA 5T8IA 1E96B 4ME2A 3Q4AB 1HFAA 1JUQA 3FUNA 5FZSA 1Z6TA 3R9MA 2J4DA 3T5XA 4YDEA 2F0YA 2J07A 3HVEB 2I1JA 2XEHA 3AU4A 3MV2B 2A4ZA 1E7VA 4GTRA 2KCVA 3CKBA 3Q73A 5J90A 3QJZA 3PEUB 3Q79A 3HXFA 1JCQA 2I6HA 1S70B 3PZDA 5KWDA 4HORA 4FP7A 1MJ0A 5LCWC 3B7SA 4CZ2D 2YINA 3K9IA 1Y6IA 4KVOA 3UUXA 4YDWA 2XRZA 2AJAA 1D9SA 2LNIA 2CHWA 3HDXA 3APCA 4U7EB 3E4BA 3I4RB 4FU3A 4WNEA 5H7PA 5FWQA 2KM4A 4JA7A 4RQIA 5KBAA 2IU1A 3Q15A 3PNLB 3LJNA 3BU8A 3CGHA 4GA1A 5A7DB 3D9PA 4HRLA 2DIWA 3VLDA 2V5QC 3VTXA 1IKND 4N5QA 4CDNA 4ILIA 4NRHB 2ONDA 3VTYA 4BWRA 1U2VG 4U8VD 1OCZE 3I3NA 1DVPA 1E8YA 4DLQA 1KT0A 4UWGA 2I2OA 3EHRA 3ONKA 4ILHB 2FULA 3G2WA 2NC9A 4G8LA 3D9LA 1OY3D 1IYGA 2Y4UA 3RKVA 1EPUA 1JCSA 3GZSA 4ZFHA 3NB2A 5C2YA 2MRIA 1UJJA 4NACA 5M72A 2EQXA 4FLHA 2KCLA 2QYUA 3G2TA 4FJZA 3PVLA 1GW6A 4URKA 4KZCA 2QFCA 5G04C 4FA6A 1K1BA 3TAXA 3DWLG 3HXDA 3ZXPA 1S63A 4LRZA 3Q7AA 1DC2A 2J08A 1VDYA 4GPMA 1SQMA 4MLPA 5JHBA 1KZOA 2LXMA 4BX9A 3E37A 3UMVA 1WM5A 4ATGA 1ELKA 4GA2A 4YVOA 4K03A 2ZISA 5B1BE 3D9IA 3ZKJA 4DRXE 4JHRA 2R5SA 3B7RL 3LY7A 3PNTB 5J08A 2X6HA 1OCOE 2RG8A 1N4SA 4NIKA 4Y6WA 5EIDA 2IFUA 2DBAA 3FTWA 3DEOA 3SI5A 2EIME 2PNNA 4BX8A 5CRVA 3PH0C 4GCOA 1TN7A 1TNBA 5AYWD 1E8WA 5FIOA 2GRRB 4O1PA 2FBNA 3LY9A 4LUNU 5E75A 4AOFA 4UQXA 2WPVA 4MRUA 3IXEA 2BF0X 1H2VC 1P5QA 2P58C 3E34A 3ZHEA 3URZA 2L6JA 4FADA 4JC8A 2WXLA 1SA5A 4XE0A 1UOHA 2VGEA 4GTVA 4DX2A 1N4QA 2Y0BG 5FQ4A 4FHKA 3CKCA 3LYAA 2OEWA 4GA0A 3FH8A 3LEWA 1QQEA 2DWZA 2FI7A 4C0MA 2NSZA 3KSLA 1YYHA 4C9BB 5JJ7A 5D0QD 4XIFA 2WB2A 2LO6A 3ZYMA 5AJDA 2PM6A 3CHOA 3QAQA 3ZRHA 2Y3AA 4A1GA 4XZ4A 3G2VA 4E85A 4N3AA 2QC9A 2AXZA 5LP0A 3EU9A 4ANXA 4WUYA 1HU3A 3UKUG 3V2OA 3OAWA 1TN6A 3P1UA 3JCKC 4UWKA 4HRNA 4KYOB 2R59A 2Q7FA 1MYOA 2LSVA 4APFA 3EJNA 2WXIA 4AV7A 2FF4A 3CIAA 3UI2A 3KD7A 2WXNA 3S7JA 2ETBA 2YNQA 1W3BA 3C3OA 1NFIE 4HXIA 4UQYA 2XGMA 1INZA 1PAQA 4OAUC 4I6GA 3SY2A 3L16A 2I1KA 4G26A 3MKQB 2X6JA 3DSTA 3GYZA 1XGWA 3WXXA 2H6FA 1UN8A 4BY6A 1HE8A 4GTMA 3BEEA 4EZLA 3ZXSA 2IOSA 2A5UA 4JVSA 4DK5A 2F37A 3DSVA 4BTBA 3P2BA 4JA9A 3DSSA 4L23A 1SVXA 4U0SA 4EZJA 3F6QA 3TXNA 3PZ1A 3SGHA 1IQUA 2GRMA 4G8KA 3D9JA 2VYIA 2OEVA 3TWQA 3S2AA 2XQ0A 1QBQA 3ZVVA 3CQCB 1TN8A 1NA3A 3JXIA 4B8CB 5FZQA 2QZAA 4ACKA 4DI4A 3CK7A 3ZYKA 2ZXWE 3FTXA 1N0RA 3ZGQA 4B8AA 4CRWA 3QK0A 2WXJA 1N52A 4DPRA 4JHKA 2IQCA 3FDHA 2KXPC 3CVLA 1E7UA 1K3ZD 2DZOA 5BV0A 3QARA 4G25A 5ARGA 4U0ZA 3HHMA 1MHQA 1LD8A 1H0AA 3B7BA 4IRUA 3EHMA 1HH8A 3CHMA 2KC7A 3D3MA 4HVBA 3GW4A 3IV0A 3C98A 5KJNA 3ENEA 4X8QA 2HR2A 4ACLA 2WXKA 4RLYA 5D2MC 1PY1A 2GROB 4HBDA 3ML9A 1KT1A 1E90A 2XPZA 1HF8A 2WXRA 2DCPA 2H6GA 4MKTA 3KEZA 4K0RA 2WQ6A 4M7CA 4PS3A 1KZPA 2Y4TA 1OCCE 5JMND 5JHAA 3CVPA 4JZYA 1E8XA 3D9HA 1HO8A 2IO3C 3ZNGA 4K5BA 5ANRA 2PQRA 4TXQA 3MA5A 3CHRA 3NF1A 4EQFA 5FQ8A 3IEGA 3ABLE 3UIOC 3SFZA 5G05J 4FC8A 4BSXA 4ATZD 4G23A 5AQ9A 3QWWA 5DIZA 4LCTA 3FWVA 3T9KA 4A1SA 3B7TA 4HI9A 1JWFA 4FULA 3MV3B 5BPPA 4N3CA 4GZDA 4AEZC 3QWPA 2P9SG 5ITZF 4U63A 4U96D 3PDNA 3O48A 3RRNB 3I5PA 4ZHBA 5CBNA 3S7BA 3PREA 4EHMA 1ZB1A 2AVPA 3G2UA 3VLEA 2PM7A 4AIFA 3IHVA 3ULYA 3RRMB 4YVQC 2X6FA 4HOUA 5G2NA 4DUIA 4DLOA 4KXKB 2NYJA 1DNPA 1FVFA 1D8EA 3MZLB 3UTMA 5IY5E 3QWVA 4J6IA 3QB2A 1BI7B 2AW6A 5CCLA 3L82A 4L2YA 4APOA 2IEJA 5CBOA 3TWRA 4XI9A 1ZU2A 3ASGA 2P9LG 4R7LA 1QNFA 4F1SA 2I9CA 4B94A 1TNOA 3AU5A 2XEVA 4I6EA 1H2UA 5AQ7A 3GZ1A 1TEZA 4EBAG 3UX4A 1WG0A 3UIPC 4E6HA 4G2VA 1SZ9A 2IY0C 3LDZA 3N71A 3UM2A 2HE0A 5ENTD 4UWLA 3Q75A 3PE3A 3QOUA 1MX6A 1HG5A 5BW8C 4LSZE 4F3VA 4CDRA 1IHBA 4KZ0A 1NZNA 3DPYA 3FFLA 4OVVA 3U9WA 3ONLA 3B13A 1BPOA 4A63B 2CG3A 3MCXA 3DXKG 2A5EA 4JL0A 2CHXA 3JYSA 2ETAA 4LNBA 4FLBA 3U3WA 4V3IA 2XGSA 3VLFA 3ZU7B 1N54A 1OWMA 2BKGA 2YHCA 4Y6CA 4K5CA 3J5PA 2RKKA 1EDUA 2XPIA 3LPZA 2AXUA 3CHPA 3UM0A 2HM8A 2J09A 2ZIRA 3ASDA 4ILGA 4KMOA 4RVBA 3KEAA 5ENQD 1N94A 2H6IA 3KS2A 1WAO1 4A3VA 4Z68A 4DJAA 3ZHEB 2WM9A 2VGXA 1L5JA 5CEAA 3FTYA 5EYLA 3JUIA 1OWOA 2XEEA 3APDA 2LXLA 4WNGA 4PS8A 1BLXB 2CHZA 3JXJA 3EHNA 4TRQA 3EDTB 2OV8A 2LUHA 3E32A 2E0IA 1N9AA 4JEHA 4J8FA 1JWGA 2R05A 3CK9A 1N11A 3CVQA 2HYZA 5CRUA 2XGOA 3AG2E 1FT1A 1V54E 4B89A 4BEPA 4GU5A 4GB9A 3MEKA 1OWNA 1TNZA 1MX4A 2XCBA 2L0TB 4ANUA 3TG5A 4U8HA 5FQ7A 3CHQA 4XEIG 3LKUA 4J8SA 3FEYA 5B1AE 3L54A 2BKKB 3TWTA 1DCQA 4Q96A 5KCMA 1OWLA 1MZCA 2R17C 2KBXA 4GYOA 4XKCA 3AG3E 3SFXA 5BV1A 1IXVA 4F1PA 4HB5A 3SZ7A 2VSXE 1KLXA 3DXMG 2P2CP 3ZPJA 3Q9NC 2XS8A 2UWJG 2PQNA 3PEVB 1AP7A 3UKRG 5CEDB 1UG3A 5FJYA 3FUFA 1V55E 1WY6A 2CFUA 2Y69E 2LSUA 2EIJE 2P9PG 4G11A 3ABKE 4DX7D 1SZAA 4I9CA 3CSFA 1H19A 5D66A 1YCSB 2PZIA 5BUZA 3AS4A 4GAAA 2V0PA 3LXUX 2J9QA 4C48B 3LS8A 3UT4A 2LAHA 5EIBE 4HOQA 5HI7A 4HRMB 1N0QA 5JA4D 2DYSE 4XKBA 1NA0A 3NQPA 3ISMC 4UWHA 2XENA 5G05C 4O6FA 5AQBA 3CVUA 4I2ZA 4CEMA 4RSYA 4GTSA 4PS7A 1LTXA 2WXQA 5AAOA 5CCMA 4MBGA 2XRYA 4D10C 4U95D 3RRUA 2XS1A 5KNGA 3ASHA 3NOGD 5HS0A 1IQRA 4GZ3A 3L9TA 3TGOA 3J5QB 5FZRA 3TWUA 1QZ2A 3FUKA 1BD8A 2J4BA 3KSQA 1BI8B 4YDYA 1TNUA 4GCNA 3NOCD 4AY6A 3NZSA 3L22A 3FUHA 2XPYA 2QY7A 4GTQA 3TWSA 5ANLA 3SBSA 1IHGA 2X3MA 4GZCA 3CSTA 4L9PA 2IO2C 3KAEA 3G2SA 2J49A 3DRAA 3CVVA 3RJVA 4TUMA 3U64A 4C0EA 4J8DA 2X6IA 4N39A 2BEDA 3SD5A 4GTPA 4LERA 4ANWA 4PDXA 4WNFA 1YMPA 3FUEA 3FTZA 1MX2A 5HKPA 1K8KG 3HIZA 3ZYQA 4GZ6A 5KNHD 3HYMB 3ZUVB 3D9NA 3FU3A 2MOWA 1OWPA 4U07A 2LAIA 2ILRA 2YHEA 3CR3A 2EILE 3MKRA 3Q5MA 3T8MA 3ZYLA 1WDYA 2VSYA 4HQDA 4AM9A 1S0PA 3X2QE 1HXIA 3RIBA 3ULEG 3UM1A 2WQ7A 4BETA 5CHEE 2L6BA 4JHJA 4I43A 2RFAA 4I1OB 2PL2A 3W9FA 4BSZB 5ARFA 3FTVA 3UM3A 5FTPA 1XNFA 2H6HA 4JXTA 3D9MA 3R7RA 3UT8A 1O5MA 1UW4B 3DSXA 3FTUA 4HLLA 5CMWA 5HQ8A 4I6JA 4F6RD 1Z3YA 2VTBA 1EF1C 4IYPA 2YQ8A 1OCRE 4CT0A 4CGWA 1NL4A 3HG0D 4F53A 3DPDA 4QFVA 3TJPA 3FHEA 2DYRE 5G55A 4WAFA 4OAVB 3FU6A 4TUUA 2GRPB 2IJGX 4KT6B 2WXFA 3TG4A 3MGBA 4LG6A 4J8EA 3EU5A 3QKYA 4JPSA 3RO3A 4W9RA 5EN5D 4DI3A 4L7TA 4AJWA 3D9KA 1LF8A 3ML8A 2GRLA 4GPKA 1JPLA 4BT8A 1S64A 3HXBA 1RW2A 2FO1E 1N4PA 4G24A 1A17A 4GMRA 4HI8A 3DSWA 3JQ1A 2JEKA 4JEUA 4BTAA 1HS6A 3FP3A 3V2XA 3ULQA 4XX5A 5ENRD 3R9AB 1NP7A 3RU0A 3MJWA 3CV0A 2WXGA 3S7FA 4AXHA 5C1DA 2WXOA 4EZKA 3LY8A 2IOLA 5JJTA 1TJFA 3PE4A 4TXRA 4HLEA 2EINE 4EPZA 2OVBA 1BU9A 5AQAA 4BERA 3FEXA 3GZ2A 3ZEFA 4ANVA 3AAAC 4JD2G 2KZTA 2HO1A 2WVIA 3CVWA 2R03A 2VSNA 1TNYA 1U3DA 3ASNE 2NXPA 3D9OA 3O4ZA 1OT8A 3IBEA 3SHFA 3C3QA 3Q78A 5AARA 1FPPA 4KBQA 2RD0A 3BG1B 4IN3B 3BQOA 3AG1E 3RO2A 1JCRA 2V4HC 4B0ZA 2VGXB 1MQSA 3L6AA 2UY1B 3S7DA 3MX3A 3MYVA 1K1AA 4MS6A 3UT7A 4DX1A 4I1MA 5T4YA 3HVEA 3B95A 4I2WA 1H6KA 3OTNA 5DBKA 3PUJA 5LX8A 5BNWA 1ELWA 4N2SA 1O1TA 3T8KA 2KCKA 2L0IA 4LNUD 5BXOA 2EIKE 2XZTG 3NBNB 3FUIA 5AN8A 2P9NG 4FJYA 2RFMA 4IULA 5HRYA 4UI9C 4A55A 4CGVA 3TWWA 2Y1LE 2JABA 3UPVA 4TV3A 1HG2A 2VSOE 3IHYA 3LVRE 3V31A 5A23A 3TXMA 4J8YA 3V79K 4EBAA 3TL5A 4HS2A 3UQ3A 3JUEA 4GTTA 4O60A 4UWFA 2B6CA 3CEQA 2BUGA 2DZNA 2WMNA 3SBTB 3L17A 3Q49B 2UY1A 2F8XK 1Q2ZA 4WWOA 2WMOA 5ENNA 4CT4A 4OYSA 2OCCE 4DX6D 3PZ3A 3HRAA 1YA0A 2DVWA 4GMJA 1D8DA 5EX0A 3V30A 1FT2A 1U3CA 4DX5D 1ZBPA 4Q94A 3Q7FA 4KVMA 3AS8A 2P9IG 1O1RA 1LD7A 4B93B 3PZ4A
chains in the Genus database with same CATH topology
3KSLA 4YDOA 3DSUA 1D8EA 3DSVA 3KSQA 1MZCA 2ZIRA 1O1TA 1KZOA 3SFXA 1TNUA 2H6GA 3C72A 3DSSA 3E37A 1N94A 1NI1A 2IEJA 3PZ1A 3PZ2A 2R2LA 2H6IA 1KZPA 2ZISA 4GTQA 2H6HA 1O5MA 3DSXA 1QBQA 1TNOA 3E30A 1TN6A 4L9PA 1TN8A 1N4SA 1O1SA 4YDEA 2F0YA 1DCEA 3E32A 3DRAA 1N9AA 1NL4A 3PZ4A 4GTTA 4GTRA 2BEDA 3Q75A 4GTPA 1TN7A 1TNBA 1TNYA 1FT1A 3HXCA 3Q73A 1JCSA 1SA4A 3SFYA 3Q79A 3EUVA 3HXFA 1JCQA 3Q78A 1FPPA 3E33A 1TNZA 3PZ3A 3DPYA 3E34A 3EU5A 1JCRA 3DSTA 1X81A 1LD8A 1SA5A 3HXEA 2H6FA 4EHMA 3HXDA 4GTVA 1S63A 1N95A 1D8DA 1N4QA 4GTSA 1LTXA 4GTMA 1N4RA 4MBGA 1FT2A 4LNBA 3Q7AA 1S64A 3HXBA 3Q7FA 4LNGA 1N4PA 1O1RA 4GTOA 1LD7A 3DSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSL A;  4YDO A;  3DSU A;  1D8E A;  3DSV A;  3KSQ A;  1MZC A;  2ZIR A;  1O1T A;  1KZO A;  3SFX A;  1TNU A;  2H6G A;  3C72 A;  3DSS A;  3E37 A;  1N94 A;  1NI1 A;  2IEJ A;  3PZ1 A;  3PZ2 A;  2R2L A;  2H6I A;  1KZP A;  2ZIS A;  4GTQ A;  2H6H A;  1O5M A;  3DSX A;  1QBQ A;  1TNO A;  3E30 A;  1TN6 A;  4L9P A;  1TN8 A;  1N4S A;  1O1S A;  4YDE A;  2F0Y A;  1DCE A;  3E32 A;  3DRA A;  1N9A A;  1NL4 A;  3PZ4 A;  4GTT A;  4GTR A;  2BED A;  3Q75 A;  4GTP A;  1TN7 A;  1TNB A;  1TNY A;  1FT1 A;  3HXC A;  3Q73 A;  1JCS A;  1SA4 A;  3SFY A;  3Q79 A;  3EUV A;  3HXF A;  1JCQ A;  3Q78 A;  1FPP A;  3E33 A;  1TNZ A;  3PZ3 A;  3DPY A;  3E34 A;  3EU5 A;  1JCR A;  3DST A;  1X81 A;  1LD8 A;  1SA5 A;  3HXE A;  2H6F A;  4EHM A;  3HXD A;  4GTV A;  1S63 A;  1N95 A;  1D8D A;  1N4Q A;  4GTS A;  1LTX A;  4GTM A;  1N4R A;  4MBG A;  1FT2 A;  4LNB A;  3Q7A A;  1S64 A;  3HXB A;  3Q7F A;  4LNG A;  1N4P A;  1O1R A;  4GTO A;  1LD7 A;  3DSW A; 
#chains in the Genus database with same CATH topology
 3FU0 A;  4XI0 A;  2KAT A;  5JJ6 A;  1ELR A;  4AP2 A;  4J7W A;  1Z5S C;  3C72 A;  5D0O D;  3I4G A;  3LCA A;  1KPS B;  4L2L A;  1QYM A;  3FU5 A;  5LOZ A;  4BES A;  3FUD A;  2ION A;  3LJ3 A;  3W9G A;  3SF4 A;  2X6K A;  4GYY A;  2CG2 A;  5LCW J;  2XZD G;  4GML A;  1X5B A;  1FVH A;  4I17 A;  4TXP A;  3CVX A;  3NAW A;  1TJC A;  2CFZ A;  3OXL A;  5E76 A;  2MHK A;  2WXM A;  4K5A B;  4NUR A;  4P29 A;  2BTD A;  2P9U G;  4GYW A;  1Z3X A;  3HXC A;  3SFY A;  2P9K G;  3PS6 A;  3RSE G;  4HOS A;  5ENO D;  3IKO B;  3CVY A;  3ABM E;  2M63 A;  2MYO A;  4O1O A;  1OUV A;  4G1T A;  2XCC A;  5AEN A;  1UJK A;  3ZFW A;  2X38 A;  3QDN A;  4RG6 A;  1TYQ G;  5CER B;  4H7X A;  2ZGD A;  1TR4 A;  4UI9 K;  3L08 A;  4GTO A;  2OOE A;  3SQV A;  1G3N B;  2FO7 A;  4YDO A;  3DSU A;  4PH4 B;  1AWC B;  4AY5 A;  5ENP D;  3ZIM A;  3OXG A;  5BT1 A;  1HZ4 A;  2R2L A;  5LFA A;  2V4L A;  3CVN A;  3ASO E;  4UI9 J;  5ENS D;  3CK8 A;  2B0O E;  3CQG B;  4U0U A;  1UN9 A;  5BXU A;  2ZGG A;  2ETC A;  2IF4 A;  3QC1 A;  5G04 J;  2F8Y A;  2FEZ A;  3BUA A;  1EYH A;  2AXV A;  4U8Y D;  1Y8M A;  1E8Z A;  3PRZ A;  3ZW3 A;  2WXH A;  3FUJ A;  3AS5 A;  3SNX A;  3ZN3 A;  1B89 A;  4M3O A;  3BG0 B;  3T5V A;  3OXF A;  5FIN A;  4HOT A;  4FHJ A;  3TWV A;  3RAU A;  3FTS A;  3E33 A;  5AJL A;  3NZU A;  5KJL A;  3EIJ A;  3Q47 B;  4J0U A;  4N5C A;  3UIN C;  1SW6 A;  2WXP A;  1X81 A;  5EIL A;  5EYP F;  3ESK A;  2V5F A;  3LVQ E;  2JLB A;  2ZU6 B;  2VTB B;  1N4R A;  2GRQ B;  4GZ5 A;  3EHQ A;  4Q69 A;  4CDM A;  2QYJ A;  4HNA D;  4JW1 A;  2WQH A;  2V8S E;  4ABN A;  1HX8 A;  3U66 A;  3AJI A;  3C3R A;  3FH7 A;  4CCA A;  3AG4 E;  2OVF A;  1OXJ A;  2GRN B;  1NI1 A;  3WG7 E;  4L1B A;  4I9E A;  4OVU A;  1H2T C;  2AWI A;  2VQ2 A;  3MKQ A;  3FY4 A;  4A3T A;  3ASF A;  1H6O A;  3E30 A;  4RG9 A;  2C2L A;  3PUK A;  4WND A;  5CMY A;  1O1S A;  5KJM A;  3APF A;  4HFG A;  4BFR A;  4N2Q A;  1DCE A;  3R7Q A;  2VJ8 A;  3CHS A;  3UXG A;  2L9B A;  3JQ0 A;  3Q9U C;  3RK6 A;  4BT9 A;  2GGF A;  4YND A;  3TWX A;  2E2E A;  3C5R A;  2VGY A;  5EKQ D;  3U4T A;  1SA4 A;  4EEC A;  3DEP A;  3EUV A;  4UUC A;  1RZ4 A;  5FT9 A;  4PUC A;  3FH5 A;  5KJK A;  4I1A A;  4WWP A;  1PC2 A;  4NQ0 A;  2GW1 A;  3DBS A;  3HXE A;  2XHE A;  3ESL A;  1FCH A;  1N95 A;  3FUM A;  5CEC B;  4QQI A;  2C0M A;  3EIQ C;  3QNK A;  4LNG A;  4LEU A;  2KZT B;  4JB8 P;  3B7U X;  3SO8 A;  3L13 A;  4UQZ A;  4N3B A;  4WWN A;  5EDS A;  4AVX A;  1H6P A;  5EX3 A;  4U04 A;  5FQ6 A;  4F7A A;  4H7Y A;  2C0L A;  3FUL A;  5B3S E;  2R02 A;  3CLJ A;  5T3R A;  1A5E A;  2J8S D;  5AIJ A;  4CYM D;  3PZ2 A;  5A6C A;  5T8I A;  1E96 B;  4ME2 A;  3Q4A B;  1HFA A;  1JUQ A;  3FUN A;  5FZS A;  1Z6T A;  3R9M A;  2J4D A;  3T5X A;  4YDE A;  2F0Y A;  2J07 A;  3HVE B;  2I1J A;  2XEH A;  3AU4 A;  3MV2 B;  2A4Z A;  1E7V A;  4GTR A;  2KCV A;  3CKB A;  3Q73 A;  5J90 A;  3QJZ A;  3PEU B;  3Q79 A;  3HXF A;  1JCQ A;  2I6H A;  1S70 B;  3PZD A;  5KWD A;  4HOR A;  4FP7 A;  1MJ0 A;  5LCW C;  3B7S A;  4CZ2 D;  2YIN A;  3K9I A;  1Y6I A;  4KVO A;  3UUX A;  4YDW A;  2XRZ A;  2AJA A;  1D9S A;  2LNI A;  2CHW A;  3HDX A;  3APC A;  4U7E B;  3E4B A;  3I4R B;  4FU3 A;  4WNE A;  5H7P A;  5FWQ A;  2KM4 A;  4JA7 A;  4RQI A;  5KBA A;  2IU1 A;  3Q15 A;  3PNL B;  3LJN A;  3BU8 A;  3CGH A;  4GA1 A;  5A7D B;  3D9P A;  4HRL A;  2DIW A;  3VLD A;  2V5Q C;  3VTX A;  1IKN D;  4N5Q A;  4CDN A;  4ILI A;  4NRH B;  2OND A;  3VTY A;  4BWR A;  1U2V G;  4U8V D;  1OCZ E;  3I3N A;  1DVP A;  1E8Y A;  4DLQ A;  1KT0 A;  4UWG A;  2I2O A;  3EHR A;  3ONK A;  4ILH B;  2FUL A;  3G2W A;  2NC9 A;  4G8L A;  3D9L A;  1OY3 D;  1IYG A;  2Y4U A;  3RKV A;  1EPU A;  1JCS A;  3GZS A;  4ZFH A;  3NB2 A;  5C2Y A;  2MRI A;  1UJJ A;  4NAC A;  5M72 A;  2EQX A;  4FLH A;  2KCL A;  2QYU A;  3G2T A;  4FJZ A;  3PVL A;  1GW6 A;  4URK A;  4KZC A;  2QFC A;  5G04 C;  4FA6 A;  1K1B A;  3TAX A;  3DWL G;  3HXD A;  3ZXP A;  1S63 A;  4LRZ A;  3Q7A A;  1DC2 A;  2J08 A;  1VDY A;  4GPM A;  1SQM A;  4MLP A;  5JHB A;  1KZO A;  2LXM A;  4BX9 A;  3E37 A;  3UMV A;  1WM5 A;  4ATG A;  1ELK A;  4GA2 A;  4YVO A;  4K03 A;  2ZIS A;  5B1B E;  3D9I A;  3ZKJ A;  4DRX E;  4JHR A;  2R5S A;  3B7R L;  3LY7 A;  3PNT B;  5J08 A;  2X6H A;  1OCO E;  2RG8 A;  1N4S A;  4NIK A;  4Y6W A;  5EID A;  2IFU A;  2DBA A;  3FTW A;  3DEO A;  3SI5 A;  2EIM E;  2PNN A;  4BX8 A;  5CRV A;  3PH0 C;  4GCO A;  1TN7 A;  1TNB A;  5AYW D;  1E8W A;  5FIO A;  2GRR B;  4O1P A;  2FBN A;  3LY9 A;  4LUN U;  5E75 A;  4AOF A;  4UQX A;  2WPV A;  4MRU A;  3IXE A;  2BF0 X;  1H2V C;  1P5Q A;  2P58 C;  3E34 A;  3ZHE A;  3URZ A;  2L6J A;  4FAD A;  4JC8 A;  2WXL A;  1SA5 A;  4XE0 A;  1UOH A;  2VGE A;  4GTV A;  4DX2 A;  1N4Q A;  2Y0B G;  5FQ4 A;  4FHK A;  3CKC A;  3LYA A;  2OEW A;  4GA0 A;  3FH8 A;  3LEW A;  1QQE A;  2DWZ A;  2FI7 A;  4C0M A;  2NSZ A;  3KSL A;  1YYH A;  4C9B B;  5JJ7 A;  5D0Q D;  4XIF A;  2WB2 A;  2LO6 A;  3ZYM A;  5AJD A;  2PM6 A;  3CHO A;  3QAQ A;  3ZRH A;  2Y3A A;  4A1G A;  4XZ4 A;  3G2V A;  4E85 A;  4N3A A;  2QC9 A;  2AXZ A;  5LP0 A;  3EU9 A;  4ANX A;  4WUY A;  1HU3 A;  3UKU G;  3V2O A;  3OAW A;  1TN6 A;  3P1U A;  3JCK C;  4UWK A;  4HRN A;  4KYO B;  2R59 A;  2Q7F A;  1MYO A;  2LSV A;  4APF A;  3EJN A;  2WXI A;  4AV7 A;  2FF4 A;  3CIA A;  3UI2 A;  3KD7 A;  2WXN A;  3S7J A;  2ETB A;  2YNQ A;  1W3B A;  3C3O A;  1NFI E;  4HXI A;  4UQY A;  2XGM A;  1INZ A;  1PAQ A;  4OAU C;  4I6G A;  3SY2 A;  3L16 A;  2I1K A;  4G26 A;  3MKQ B;  2X6J A;  3DST A;  3GYZ A;  1XGW A;  3WXX A;  2H6F A;  1UN8 A;  4BY6 A;  1HE8 A;  4GTM A;  3BEE A;  4EZL A;  3ZXS A;  2IOS A;  2A5U A;  4JVS A;  4DK5 A;  2F37 A;  3DSV A;  4BTB A;  3P2B A;  4JA9 A;  3DSS A;  4L23 A;  1SVX A;  4U0S A;  4EZJ A;  3F6Q A;  3TXN A;  3PZ1 A;  3SGH A;  1IQU A;  2GRM A;  4G8K A;  3D9J A;  2VYI A;  2OEV A;  3TWQ A;  3S2A A;  2XQ0 A;  1QBQ A;  3ZVV A;  3CQC B;  1TN8 A;  1NA3 A;  3JXI A;  4B8C B;  5FZQ A;  2QZA A;  4ACK A;  4DI4 A;  3CK7 A;  3ZYK A;  2ZXW E;  3FTX A;  1N0R A;  3ZGQ A;  4B8A A;  4CRW A;  3QK0 A;  2WXJ A;  1N52 A;  4DPR A;  4JHK A;  2IQC A;  3FDH A;  2KXP C;  3CVL A;  1E7U A;  1K3Z D;  2DZO A;  5BV0 A;  3QAR A;  4G25 A;  5ARG A;  4U0Z A;  3HHM A;  1MHQ A;  1LD8 A;  1H0A A;  3B7B A;  4IRU A;  3EHM A;  1HH8 A;  3CHM A;  2KC7 A;  3D3M A;  4HVB A;  3GW4 A;  3IV0 A;  3C98 A;  5KJN A;  3ENE A;  4X8Q A;  2HR2 A;  4ACL A;  2WXK A;  4RLY A;  5D2M C;  1PY1 A;  2GRO B;  4HBD A;  3ML9 A;  1KT1 A;  1E90 A;  2XPZ A;  1HF8 A;  2WXR A;  2DCP A;  2H6G A;  4MKT A;  3KEZ A;  4K0R A;  2WQ6 A;  4M7C A;  4PS3 A;  1KZP A;  2Y4T A;  1OCC E;  5JMN D;  5JHA A;  3CVP A;  4JZY A;  1E8X A;  3D9H A;  1HO8 A;  2IO3 C;  3ZNG A;  4K5B A;  5ANR A;  2PQR A;  4TXQ A;  3MA5 A;  3CHR A;  3NF1 A;  4EQF A;  5FQ8 A;  3IEG A;  3ABL E;  3UIO C;  3SFZ A;  5G05 J;  4FC8 A;  4BSX A;  4ATZ D;  4G23 A;  5AQ9 A;  3QWW A;  5DIZ A;  4LCT A;  3FWV A;  3T9K A;  4A1S A;  3B7T A;  4HI9 A;  1JWF A;  4FUL A;  3MV3 B;  5BPP A;  4N3C A;  4GZD A;  4AEZ C;  3QWP A;  2P9S G;  5ITZ F;  4U63 A;  4U96 D;  3PDN A;  3O48 A;  3RRN B;  3I5P A;  4ZHB A;  5CBN A;  3S7B A;  3PRE A;  4EHM A;  1ZB1 A;  2AVP A;  3G2U A;  3VLE A;  2PM7 A;  4AIF A;  3IHV A;  3ULY A;  3RRM B;  4YVQ C;  2X6F A;  4HOU A;  5G2N A;  4DUI A;  4DLO A;  4KXK B;  2NYJ A;  1DNP A;  1FVF A;  1D8E A;  3MZL B;  3UTM A;  5IY5 E;  3QWV A;  4J6I A;  3QB2 A;  1BI7 B;  2AW6 A;  5CCL A;  3L82 A;  4L2Y A;  4APO A;  2IEJ A;  5CBO A;  3TWR A;  4XI9 A;  1ZU2 A;  3ASG A;  2P9L G;  4R7L A;  1QNF A;  4F1S A;  2I9C A;  4B94 A;  1TNO A;  3AU5 A;  2XEV A;  4I6E A;  1H2U A;  5AQ7 A;  3GZ1 A;  1TEZ A;  4EBA G;  3UX4 A;  1WG0 A;  3UIP C;  4E6H A;  4G2V A;  1SZ9 A;  2IY0 C;  3LDZ A;  3N71 A;  3UM2 A;  2HE0 A;  5ENT D;  4UWL A;  3Q75 A;  3PE3 A;  3QOU A;  1MX6 A;  1HG5 A;  5BW8 C;  4LSZ E;  4F3V A;  4CDR A;  1IHB A;  4KZ0 A;  1NZN A;  3DPY A;  3FFL A;  4OVV A;  3U9W A;  3ONL A;  3B13 A;  1BPO A;  4A63 B;  2CG3 A;  3MCX A;  3DXK G;  2A5E A;  4JL0 A;  2CHX A;  3JYS A;  2ETA A;  4LNB A;  4FLB A;  3U3W A;  4V3I A;  2XGS A;  3VLF A;  3ZU7 B;  1N54 A;  1OWM A;  2BKG A;  2YHC A;  4Y6C A;  4K5C A;  3J5P A;  2RKK A;  1EDU A;  2XPI A;  3LPZ A;  2AXU A;  3CHP A;  3UM0 A;  2HM8 A;  2J09 A;  2ZIR A;  3ASD A;  4ILG A;  4KMO A;  4RVB A;  3KEA A;  5ENQ D;  1N94 A;  2H6I A;  3KS2 A;  1WAO 1;  4A3V A;  4Z68 A;  4DJA A;  3ZHE B;  2WM9 A;  2VGX A;  1L5J A;  5CEA A;  3FTY A;  5EYL A;  3JUI A;  1OWO A;  2XEE A;  3APD A;  2LXL A;  4WNG A;  4PS8 A;  1BLX B;  2CHZ A;  3JXJ A;  3EHN A;  4TRQ A;  3EDT B;  2OV8 A;  2LUH A;  3E32 A;  2E0I A;  1N9A A;  4JEH A;  4J8F A;  1JWG A;  2R05 A;  3CK9 A;  1N11 A;  3CVQ A;  2HYZ A;  5CRU A;  2XGO A;  3AG2 E;  1FT1 A;  1V54 E;  4B89 A;  4BEP A;  4GU5 A;  4GB9 A;  3MEK A;  1OWN A;  1TNZ A;  1MX4 A;  2XCB A;  2L0T B;  4ANU A;  3TG5 A;  4U8H A;  5FQ7 A;  3CHQ A;  4XEI G;  3LKU A;  4J8S A;  3FEY A;  5B1A E;  3L54 A;  2BKK B;  3TWT A;  1DCQ A;  4Q96 A;  5KCM A;  1OWL A;  1MZC A;  2R17 C;  2KBX A;  4GYO A;  4XKC A;  3AG3 E;  3SFX A;  5BV1 A;  1IXV A;  4F1P A;  4HB5 A;  3SZ7 A;  2VSX E;  1KLX A;  3DXM G;  2P2C P;  3ZPJ A;  3Q9N C;  2XS8 A;  2UWJ G;  2PQN A;  3PEV B;  1AP7 A;  3UKR G;  5CED B;  1UG3 A;  5FJY A;  3FUF A;  1V55 E;  1WY6 A;  2CFU A;  2Y69 E;  2LSU A;  2EIJ E;  2P9P G;  4G11 A;  3ABK E;  4DX7 D;  1SZA A;  4I9C A;  3CSF A;  1H19 A;  5D66 A;  1YCS B;  2PZI A;  5BUZ A;  3AS4 A;  4GAA A;  2V0P A;  3LXU X;  2J9Q A;  4C48 B;  3LS8 A;  3UT4 A;  2LAH A;  5EIB E;  4HOQ A;  5HI7 A;  4HRM B;  1N0Q A;  5JA4 D;  2DYS E;  4XKB A;  1NA0 A;  3NQP A;  3ISM C;  4UWH A;  2XEN A;  5G05 C;  4O6F A;  5AQB A;  3CVU A;  4I2Z A;  4CEM A;  4RSY A;  4GTS A;  4PS7 A;  1LTX A;  2WXQ A;  5AAO A;  5CCM A;  4MBG A;  2XRY A;  4D10 C;  4U95 D;  3RRU A;  2XS1 A;  5KNG A;  3ASH A;  3NOG D;  5HS0 A;  1IQR A;  4GZ3 A;  3L9T A;  3TGO A;  3J5Q B;  5FZR A;  3TWU A;  1QZ2 A;  3FUK A;  1BD8 A;  2J4B A;  3KSQ A;  1BI8 B;  4YDY A;  1TNU A;  4GCN A;  3NOC D;  4AY6 A;  3NZS A;  3L22 A;  3FUH A;  2XPY A;  2QY7 A;  4GTQ A;  3TWS A;  5ANL A;  3SBS A;  1IHG A;  2X3M A;  4GZC A;  3CST A;  4L9P A;  2IO2 C;  3KAE A;  3G2S A;  2J49 A;  3DRA A;  3CVV A;  3RJV A;  4TUM A;  3U64 A;  4C0E A;  4J8D A;  2X6I A;  4N39 A;  2BED A;  3SD5 A;  4GTP A;  4LER A;  4ANW A;  4PDX A;  4WNF A;  1YMP A;  3FUE A;  3FTZ A;  1MX2 A;  5HKP A;  1K8K G;  3HIZ A;  3ZYQ A;  4GZ6 A;  5KNH D;  3HYM B;  3ZUV B;  3D9N A;  3FU3 A;  2MOW A;  1OWP A;  4U07 A;  2LAI A;  2ILR A;  2YHE A;  3CR3 A;  2EIL E;  3MKR A;  3Q5M A;  3T8M A;  3ZYL A;  1WDY A;  2VSY A;  4HQD A;  4AM9 A;  1S0P A;  3X2Q E;  1HXI A;  3RIB A;  3ULE G;  3UM1 A;  2WQ7 A;  4BET A;  5CHE E;  2L6B A;  4JHJ A;  4I43 A;  2RFA A;  4I1O B;  2PL2 A;  3W9F A;  4BSZ B;  5ARF A;  3FTV A;  3UM3 A;  5FTP A;  1XNF A;  2H6H A;  4JXT A;  3D9M A;  3R7R A;  3UT8 A;  1O5M A;  1UW4 B;  3DSX A;  3FTU A;  4HLL A;  5CMW A;  5HQ8 A;  4I6J A;  4F6R D;  1Z3Y A;  2VTB A;  1EF1 C;  4IYP A;  2YQ8 A;  1OCR E;  4CT0 A;  4CGW A;  1NL4 A;  3HG0 D;  4F53 A;  3DPD A;  4QFV A;  3TJP A;  3FHE A;  2DYR E;  5G55 A;  4WAF A;  4OAV B;  3FU6 A;  4TUU A;  2GRP B;  2IJG X;  4KT6 B;  2WXF A;  3TG4 A;  3MGB A;  4LG6 A;  4J8E A;  3EU5 A;  3QKY A;  4JPS A;  3RO3 A;  4W9R A;  5EN5 D;  4DI3 A;  4L7T A;  4AJW A;  3D9K A;  1LF8 A;  3ML8 A;  2GRL A;  4GPK A;  1JPL A;  4BT8 A;  1S64 A;  3HXB A;  1RW2 A;  2FO1 E;  1N4P A;  4G24 A;  1A17 A;  4GMR A;  4HI8 A;  3DSW A;  3JQ1 A;  2JEK A;  4JEU A;  4BTA A;  1HS6 A;  3FP3 A;  3V2X A;  3ULQ A;  4XX5 A;  5ENR D;  3R9A B;  1NP7 A;  3RU0 A;  3MJW A;  3CV0 A;  2WXG A;  3S7F A;  4AXH A;  5C1D A;  2WXO A;  4EZK A;  3LY8 A;  2IOL A;  5JJT A;  1TJF A;  3PE4 A;  4TXR A;  4HLE A;  2EIN E;  4EPZ A;  2OVB A;  1BU9 A;  5AQA A;  4BER A;  3FEX A;  3GZ2 A;  3ZEF A;  4ANV A;  3AAA C;  4JD2 G;  2KZT A;  2HO1 A;  2WVI A;  3CVW A;  2R03 A;  2VSN A;  1TNY A;  1U3D A;  3ASN E;  2NXP A;  3D9O A;  3O4Z A;  1OT8 A;  3IBE A;  3SHF A;  3C3Q A;  3Q78 A;  5AAR A;  1FPP A;  4KBQ A;  2RD0 A;  3BG1 B;  4IN3 B;  3BQO A;  3AG1 E;  3RO2 A;  1JCR A;  2V4H C;  4B0Z A;  2VGX B;  1MQS A;  3L6A A;  2UY1 B;  3S7D A;  3MX3 A;  3MYV A;  1K1A A;  4MS6 A;  3UT7 A;  4DX1 A;  4I1M A;  5T4Y A;  3HVE A;  3B95 A;  4I2W A;  1H6K A;  3OTN A;  5DBK A;  3PUJ A;  5LX8 A;  5BNW A;  1ELW A;  4N2S A;  1O1T A;  3T8K A;  2KCK A;  2L0I A;  4LNU D;  5BXO A;  2EIK E;  2XZT G;  3NBN B;  3FUI A;  5AN8 A;  2P9N G;  4FJY A;  2RFM A;  4IUL A;  5HRY A;  4UI9 C;  4A55 A;  4CGV A;  3TWW A;  2Y1L E;  2JAB A;  3UPV A;  4TV3 A;  1HG2 A;  2VSO E;  3IHY A;  3LVR E;  3V31 A;  5A23 A;  3TXM A;  4J8Y A;  3V79 K;  4EBA A;  3TL5 A;  4HS2 A;  3UQ3 A;  3JUE A;  4GTT A;  4O60 A;  4UWF A;  2B6C A;  3CEQ A;  2BUG A;  2DZN A;  2WMN A;  3SBT B;  3L17 A;  3Q49 B;  2UY1 A;  2F8X K;  1Q2Z A;  4WWO A;  2WMO A;  5ENN A;  4CT4 A;  4OYS A;  2OCC E;  4DX6 D;  3PZ3 A;  3HRA A;  1YA0 A;  2DVW A;  4GMJ A;  1D8D A;  5EX0 A;  3V30 A;  1FT2 A;  1U3C A;  4DX5 D;  1ZBP A;  4Q94 A;  3Q7F A;  4KVM A;  3AS8 A;  2P9I G;  1O1R A;  1LD7 A;  4B93 B;  3PZ4 A; 
#chains in the Genus database with same CATH homology
 3KSL A;  4YDO A;  3DSU A;  1D8E A;  3DSV A;  3KSQ A;  1MZC A;  2ZIR A;  1O1T A;  1KZO A;  3SFX A;  1TNU A;  2H6G A;  3C72 A;  3DSS A;  3E37 A;  1N94 A;  1NI1 A;  2IEJ A;  3PZ1 A;  3PZ2 A;  2R2L A;  2H6I A;  1KZP A;  2ZIS A;  4GTQ A;  2H6H A;  1O5M A;  3DSX A;  1QBQ A;  1TNO A;  3E30 A;  1TN6 A;  4L9P A;  1TN8 A;  1N4S A;  1O1S A;  4YDE A;  2F0Y A;  1DCE A;  3E32 A;  3DRA A;  1N9A A;  1NL4 A;  3PZ4 A;  4GTT A;  4GTR A;  2BED A;  3Q75 A;  4GTP A;  1TN7 A;  1TNB A;  1TNY A;  1FT1 A;  3HXC A;  3Q73 A;  1JCS A;  1SA4 A;  3SFY A;  3Q79 A;  3EUV A;  3HXF A;  1JCQ A;  3Q78 A;  1FPP A;  3E33 A;  1TNZ A;  3PZ3 A;  3DPY A;  3E34 A;  3EU5 A;  1JCR A;  3DST A;  1X81 A;  1LD8 A;  1SA5 A;  3HXE A;  2H6F A;  4EHM A;  3HXD A;  4GTV A;  1S63 A;  1N95 A;  1D8D A;  1N4Q A;  4GTS A;  1LTX A;  4GTM A;  1N4R A;  4MBG A;  1FT2 A;  4LNB A;  3Q7A A;  1S64 A;  3HXB A;  3Q7F A;  4LNG A;  1N4P A;  1O1R A;  4GTO A;  1LD7 A;  3DSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...