3Q7FA

Cryptococcus neoformans protein farnesyltransferase in complex with fpp and ethylenediamine inhibitor 1
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
330
structure length
313
Chain Sequence
b'TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase alpha subunit
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase/transferase inhibitor
total genus 126
structure length 313
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q7fA00
2H6IA 1TN7A 1LD8A 1N4PA 3HXDA 1QBQA 3PZ1A 3EUVA 3SFYA 3HXBA 1TN6A 3DSWA 4GTQA 1N4SA 3HXFA 1JCRA 3KSQA 2IEJA 1N9AA 3Q75A 2H6HA 3DRAA 2ZIRA 2H6FA 3KSLA 3Q78A 4MBGA 1JCSA 4LNBA 1D8DA 4YDEA 3DSUA 4GTOA 1FT1A 1N94A 1O1TA 3Q7FA 1MZCA 4L9PA 1LTXA 1S64A 1LD7A 1O1SA 1TNOA 1TNUA 3E32A 4GTTA 1S63A 3DSVA 1SA5A 4GTRA 1D8EA 1FT2A 4YDOA 1KZPA 3Q79A 3SFXA 2BEDA 3Q7AA 3E37A 1TNYA 4LNGA 1TN8A 3EU5A 4GTPA 1NL4A 3E34A 2ZISA 1FPPA 1TNZA 3DSXA 3PZ3A 3Q73A 4GTMA 1O5MA 4GTSA 1SA4A 1DCEA 3DSSA 3E30A 3HXEA 1N4QA 1O1RA 1KZOA 4GTVA 4EHMA 3HXCA 3PZ4A 1JCQA 1NI1A 3C72A 1TNBA 1N95A 2R2LA 3DPYA 2F0YA 2H6GA 1X81A 1N4RA 3PZ2A 3E33A 3DSTA
chains in the Genus database with same CATH superfamily
3NAWA 2ZGDA 2ZGGA 1N4PA 2R59A 3BG1B 1KLXA 3HHMA 2XCBA 3FUEA 2J4DA 3ZYKA 3G2VA 1SZAA 1VDYA 2DCPA 4W9RA 4JHRA 4GTQA 2WXJA 2AWIA 1L5JA 2J08A 3TAXA 4DX5D 4EQFA 1YYHA 2GROB 5AQ7A 3DRAA 2ZIRA 4BEPA 1H2VC 4BT9A 4PUCA 1YCSB 1HS6A 3QB2A 2A4ZA 2YNQA 1IQUA 2BUGA 1H2UA 4H7YA 3V2XA 3URZA 2LSUA 5ENTD 3EIJA 3W9FA 1UN9A 3KEZA 3LY9A 4GTTA 1TNUA 3P2BA 4N2SA 1SA5A 4XX5A 2YINA 3S7FA 5ANRA 2CHZA 3Q79A 4N39A 4QFVA 3L82A 5AJLA 3QOUA 5HKPA 2A5EA 3EHRA 5AJDA 4G1TA 4CCAA 2XENA 5ARFA 5LCWJ 3FUDA 5CEAA 3Q5MA 1MYOA 4TV3A 5B3SE 2RFAA 2KZTB 3EU9A 3GZSA 2Y69E 3UM1A 3HXCA 2XRZA 2RD0A 3AJIA 3NOCD 4PDXA 4G25A 3DPYA 4IYPA 2HO1A 4EECA 3ENEA 4YDWA 5EYPF 1A17A 3B7BA 3ASNE 2P2CP 4BESA 5CMYA 2P9UG 4AP2A 3S7DA 4WNDA 3HXDA 5HRYA 3EIQC 4HS2A 3I3NA 4QQIA 3SZ7A 3Q9NC 4P29A 3HDXA 3UXGA 5FQ7A 4I1AA 3KSQA 3ZW3A 3J5QB 1LF8A 2ONDA 5FZSA 5KCMA 5A23A 3ABKE 5H7PA 3FU3A 4J8YA 3ZPJA 4EBAG 4BX9A 1D8DA 4J8DA 4BT8A 3DPDA 3L17A 3PE4A 3ZGQA 4DX7D 4A1GA 3W9GA 3UIPC 2YQ8A 4AXHA 2V4LA 2XEVA 5KJLA 4N5CA 1GW6A 1DNPA 2L0TB 3SGHA 3I4GA 5G05J 4K03A 3UQ3A 4E6HA 5KJMA 5JJ6A 4I6JA 3D9OA 3Q49B 2NYJA 4I2WA 2LXLA 2DZNA 3C98A 3B95A 1K1AA 3HXEA 2ETCA 2GRQB 3U66A 4I1MA 3CHPA 2IQCA 1HG2A 1UW4B 2H6GA 1X81A 2C2LA 4O6FA 2R03A 4ANWA 2XS1A 2PM6A 4Q94A 4DX2A 3TGOA 3MGBA 3AU4A 2F8YA 4AY6A 3NQPA 4UI9J 5FWQA 3TL5A 2NC9A 2VSYA 3EHMA 1BD8A 4DX6D 2PQRA 3CVYA 1FVFA 3PZDA 4G8KA 3TG4A 4EPZA 2I1KA 2KCVA 4NACA 4B8AA 2VSOE 3RK6A 4FHKA 1TYQG 2KCKA 3R7QA 1N94A 3ISMC 4HB5A 3AS5A 3CQGB 3U4TA 3HVEB 4DK5A 4GU5A 3HVEA 3FDHA 4B89A 2CHXA 1S63A 4AIFA 4R7LA 3UPVA 2IF4A 1MJ0A 3NB2A 1TN8A 4PS8A 4A3VA 1Q2ZA 4BFRA 4N3AA 4GYWA 3WG7E 2VGXB 4CYMD 1Y6IA 1DC2A 1HXIA 3C3QA 3L54A 3OTNA 3IV0A 4Q96A 4U8HA 4FA6A 5FJYA 2HR2A 3FY4A 3CGHA 1H19A 4YVQC 3C72A 2CHWA 3ONKA 3QARA 3LPZA 3I5PA 3TWQA 1K1BA 4G11A 2H6IA 3FFLA 3PE3A 5CEDB 5B1AE 5BV0A 4E85A 1KT0A 3DSWA 3HXFA 4KVMA 5AAOA 2WXNA 4B94A 4N3CA 2H6HA 4UWFA 3JUEA 5A6CA 4F1SA 3C3RA 2XPZA 4M3OA 5HQ8A 4FHJA 2XGOA 5ENQD 4TXRA 2DYSE 1H6KA 3L08A 4L9PA 3FUJA 2OV8A 2ZU6B 5CCLA 1E90A 3JCKC 4NRHB 3ZIMA 2CFUA 4KMOA 3D9HA 4HLLA 4UQXA 4K5AB 2P9LG 2WXMA 3L22A 3DXKG 2EIJE 4YNDA 5B1BE 4GTPA 5G05C 2FO1E 4CEMA 4RQIA 4JW1A 1PAQA 5KNHD 1B89A 2J09A 1INZA 1FVHA 1TR4A 2KM4A 2Y1LE 3IHYA 2QZAA 4FU3A 4WUYA 4KZ0A 2XCCA 1E7UA 2RKKA 2AXUA 4I2ZA 2R02A 4F1PA 4ILHB 1RZ4A 3RSEG 5A7DB 4ACLA 2WPVA 1Z6TA 3FTZA 3IEGA 4Y6CA 5KNGA 5JA4D 3LJ3A 3ZN3A 1QYMA 3ULYA 4L1BA 5JHBA 2MRIA 3Q15A 2WQ6A 3CVXA 2UY1B 2X6JA 3AS8A 5ANLA 2VSXE 4F53A 1HU3A 3FEYA 2XEEA 2WXIA 3CVNA 4U0UA 5AIJA 3JQ0A 1A5EA 1MHQA 2BTDA 3KS2A 2IOLA 2X6KA 4F3VA 3ML9A 5AN8A 4AV7A 2FO7A 1N4QA 3VTYA 2QYUA 2FI7A 4ILIA 1V54E 3D9KA 3G2SA 2J9QA 5BW8C 4D10C 1G3NB 1OWOA 3GZ2A 2EIME 3CHQA 3E33A 1Z3YA 4OAUC 4FC8A 4KVOA 3O4ZA 1WDYA 3L6AA 4V3IA 4DX1A 3IHVA 3ZYLA 3SD5A 4HI9A 3UTMA 2WB2A 2LUHA 4N5QA 3MKRA 1JCRA 2P9KG 4EZJA 4GYYA 2VJ8A 2KATA 5BT1A 3UT4A 1JCSA 3APFA 1WAO1 1E8ZA 4N2QA 4BSZB 5M72A 5CRVA 3SF4A 3CV0A 2IO3C 1IKND 4U95D 4DI4A 3BEEA 4HOUA 3CHMA 5D0OD 3ZU7B 1AP7A 1MZCA 3TWRA 1OWLA 4XKCA 1S64A 1TJCA 5EKQD 4J8EA 4B0ZA 4G8LA 1E8YA 1ZBPA 4ATZD 1YA0A 2QY7A 1D8EA 3MEKA 4U0ZA 4XE0A 3N71A 1NL4A 3PS6A 1AWCB 5IY5E 1D9SA 4IN3B 1ELKA 4L2YA 3CKBA 4MRUA 3S7JA 4G24A 3MV3B 2LAHA 3WXXA 2BKGA 4PH4B 5CRUA 3OXFA 3DEOA 4JHJA 3TJPA 4JA7A 5AYWD 1JWGA 4AEZC 1V55E 3D9PA 5ENPD 3FH8A 3ONLA 3U9WA 1H2TC 2X6FA 2GRLA 3TWSA 3QNKA 2B0OE 4FADA 2KC7A 2X6IA 4HRMB 1K8KG 1YMPA 2KZTA 2YHEA 3V79K 2JEKA 4FJYA 2WXPA 3ZEFA 4GA1A 1N9AA 3RO2A 4PS3A 3TWTA 4J8SA 4CT0A 3GZ1A 4TXQA 3ABLE 4BWRA 1Z5SC 1OCCE 3NF1A 3JUIA 4F6RD 1IHGA 4MS6A 3CK9A 4XIFA 1QNFA 3Q7FA 5CERB 2J8SD 2R05A 3SFZA 3D9NA 5C1DA 2F37A 3ASOE 2IFUA 2DIWA 2XZTG 2KXPC 2I1JA 3UI2A 3VTXA 4LG6A 1UJJA 3E34A 3QJZA 1H6OA 1JUQA 2LSVA 4RG9A 3RIBA 3ZHEB 3ZHEA 3ZXSA 4ANUA 1K3ZD 4UWGA 1OWNA 2AVPA 3AG3E 4EZLA 5BXUA 2E0IA 1HE8A 4BTBA 4HXIA 1N95A 2MOWA 4Q69A 1BLXB 3L16A 3ESLA 4GMJA 3PREA 5KWDA 4UQZA 2I2OA 4HI8A 4AY5A 2R17C 3Q9UC 4UWKA 1JPLA 5AQ9A 4M7CA 2CFZA 4DJAA 5AQAA 3LDZA 2P9PG 4I6GA 2BF0X 3B7RL 2L6BA 2GRNB 4MKTA 1TEZA 2GW1A 2IEJA 3ZUVB 5FZQA 3ZYQA 3Q75A 3LCAA 3KSLA 5J90A 4OYSA 2CG2A 4U63A 3JXIA 4A63B 2I9CA 2Y0BG 1Y8MA 2WXFA 3JXJA 3TWXA 5D2MC 3ASGA 2VSNA 2FULA 1MX4A 5JJTA 1HH8A 5CMWA 4GTRA 3NZUA 2A5UA 4UWLA 2EQXA 2BEDA 3CHRA 3ASHA 3LVQE 3AAAC 3FULA 5D66A 5G04J 2OCCE 4GZ3A 3G2WA 2P9NG 1SA4A 4JZYA 5CBNA 2WMOA 1KZOA 4H7XA 4HOQA 5LFAA 5EIBE 5CECB 3DXMG 2HE0A 3BUAA 1BI7B 1LD8A 2VGXA 4ANVA 1NP7A 2J49A 4APOA 2EIKE 5LCWC 4AM9A 2E2EA 5AENA 4JC8A 2Y3AA 2AXVA 4TUUA 5T4YA 3ML8A 3TWVA 2GRMA 1UOHA 2DZOA 3JYSA 3PVLA 4UI9K 3R7RA 3MKQB 4PS7A 3MKQA 4LNBA 3UKRG 1XNFA 3VLDA 3PUJA 3SBSA 4DRXE 2EILE 2WVIA 2P9IG 3DWLG 3LJNA 4I1OB 4DI3A 1OUVA 1LTXA 2L6JA 3MYVA 4L2LA 1IQRA 4J8FA 4RVBA 1HFAA 2WQ7A 1KPSB 1N11A 5EX0A 1N54A 1SW6A 5LX8A 4B8CB 5ENNA 4GA0A 4CZ2D 4U96D 3FU6A 4GZDA 1U2VG 2ILRA 1TNZA 3DSXA 4JEHA 5FT9A 4O1PA 2DBAA 2LNIA 3Q73A 4GTMA 3QK0A 4A1SA 2Y4UA 4BETA 3J5PA 3D9MA 4I9CA 2OEWA 3QKYA 3D9LA 2RFMA 3D9JA 5LOZA 1O1RA 4OVUA 4WNGA 3FTYA 1TNBA 4U07A 3RU0A 4JVSA 3D3MA 3PZ2A 5G2NA 4ME2A 5DIZA 4EZKA 4O60A 1WY6A 3CLJA 3SI5A 4CDMA 3Q4AB 5BNWA 2XS8A 4HNAD 3FU5A 4CRWA 3QAQA 3FEXA 2NXPA 4LNUD 3ZRHA 4Z68A 3SNXA 2WM9A 1OCRE 5AQBA 3UX4A 3QWVA 4URKA 1UG3A 5BXOA 2L9BA 1BI8B 3DSUA 1PC2A 2HYZA 1XGWA 1SZ9A 2ZXWE 3UUXA 1TNOA 4UI9C 4KBQA 4A3TA 3DSVA 3U64A 3Q47B 2QFCA 4K5CA 1OT8A 4YDOA 4CT4A 1KZPA 1OY3D 1TNYA 3LY7A 5JJ7A 5EN5D 4CGWA 4WWOA 4JL0A 2UY1A 4GB9A 3DEPA 3R9MA 1IHBA 5G04C 4YDYA 3DSSA 2WXGA 2V8SE 3E30A 4FLHA 5T8IA 2XZDG 4UQYA 2PQNA 2C0MA 1H0AA 2XGSA 1EYHA 3CVUA 3CVWA 4ZHBA 2MYOA 2JABA 5CBOA 4G26A 3FUNA 3D9IA 3PZ1A 1E96B 1H6PA 2AW6A 4GZ5A 2V5QC 4OVVA 1P5QA 3NBNB 2DWZA 1HZ4A 3FUHA 4TRQA 4O1OA 1SVXA 4WWNA 2UWJG 4ILGA 2X38A 2IY0C 3LYAA 2QYJA 3CSTA 1OWPA 1FT1A 3UKUG 4X8QA 3SBTB 2J07A 4MLPA 3LEWA 4ACKA 3LXUX 4I6EA 3ZKJA 4JD2G 2VTBB 4FJZA 2IU1A 3UM0A 2VTBA 2IONA 4DUIA 5BPPA 5HS0A 4XKBA 4WNEA 4BX8A 3PDNA 4LNGA 4JHKA 2GRPB 3BQOA 2PM7A 4NURA 5ITZF 3PZ3A 4TUMA 4GZ6A 4HQDA 4DLQA 2X6HA 1HG5A 4IRUA 3B7UX 2YHCA 3FUIA 5EIDA 2WXQA 3SY2A 5FIOA 5ENOD 3TG5A 1N4RA 4KYOB 2I6HA 2LO6A 5ARGA 2VGEA 4LEUA 2M63A 4ATGA 4FLBA 2VGYA 1MX2A 4RLYA 3NOGD 3AS4A 3MV2B 1QBQA 1QQEA 3K9IA 3FUFA 5BV1A 3LVRE 3UIOC 3CVQA 2B6CA 3ULEG 2PZIA 5EYLA 2CG3A 3PNTB 5LP0A 1FCHA 3EHQA 3ULQA 5DBKA 2C0LA 3CQCB 2EINE 1E7VA 2V5FA 3E4BA 2MHKA 4G23A 2XEHA 3O48A 2AXZA 4ZFHA 1O1TA 5E76A 3G2UA 4Y6WA 3F6QA 3CHSA 3FTXA 2ETBA 3E32A 5J08A 3TWWA 3UT7A 5FQ6A 3AU5A 4G2VA 4U04A 4UWHA 3Q7AA 3E37A 4U7EB 2PL2A 2XPYA 2WXRA 3ZNGA 4RSYA 1ELRA 3CHOA 3TXMA 3V2OA 3EDTB 4LCTA 3I4RB 5G55A 3FTUA 3OXGA 4KT6B 1DCEA 1UN8A 4I43A 1W3BA 2LXMA 1NI1A 1N52A 1NA0A 4HLEA 4JB8P 3RRNB 1QZ2A 3BG0B 5ENSD 5ENRD 3TXNA 2V0PA 4IULA 4C0MA 2JLBA 4NIKA 3HXBA 3T8MA 4HFGA 4J7WA 4CGVA 1N4SA 3EJNA 1TJFA 3OXLA 3B7TA 1DCQA 3S7BA 3RRUA 4HRNA 4MBGA 3RRMB 3FU0A 2WXKA 4AOFA 4KZCA 4U8YD 4JPSA 4LSZE 4HVBA 4AJWA 2DYRE 3PH0C 1EPUA 3GYZA 5E75A 4GCNA 3VLFA 3ZXPA 3OAWA 5CHEE 4F7AA 3MCXA 5KJNA 1OXJA 3LKUA 2Y4TA 4TXPA 3V30A 3QWWA 3SFXA 5EX3A 4CDNA 2GRRB 4WWPA 3ASDA 4GAAA 2ZISA 3V31A 3PRZA 3KAEA 2OVBA 1KT1A 1MQSA 3CVVA 4A55A 3B13A 3FTVA 2VQ2A 5FTPA 1WM5A 1JCQA 5FQ8A 3S2AA 2R2LA 5AARA 3T5VA 3FWVA 1IYGA 3UINC 5FINA 3AG1E 3TWUA 4WNFA 1TN7A 5KBAA 3G2TA 3FP3A 3SFYA 4HORA 4CDRA 4HOTA 4RG6A 1NA3A 5HI7A 1TN6A 1Z3XA 3CSFA 4FP7A 4APFA 5KJKA 1N0QA 3SQVA 5EDSA 3PUKA 1UJKA 3GW4A 4GZCA 4OAVB 2H6FA 3Q78A 3IXEA 3KEAA 1DVPA 2OVFA 2R5SA 3FH5A 3RO3A 4L7TA 3SHFA 3LY8A 1EF1C 4GPKA 3ABME 2F8XK 4K0RA 1S70B 1E8WA 2AJAA 5D0QD 2XQ0A 4J6IA 3T9KA 3PEUB 4I9EA 4WAFA 1RW2A 3X2QE 2ETAA 5BUZA 1FPPA 4XI9A 3QWPA 4XI0A 3RKVA 1JWFA 2IOSA 3IKOB 2OOEA 2WXLA 3UT8A 1ZU2A 1N0RA 4GTVA 4EHMA 4I17A 4HOSA 2FBNA 1S0PA 2F0YA 1U3CA 4K5BA 5C2YA 2Q7FA 3UMVA 3L13A 1BPOA 1PY1A 2L0IA 4ANXA 2VYIA 3AG4E 1OWMA 4AVXA 4NQ0A 4C48B 3C5RA 2GGFA 3AG2E 3MJWA 3HYMB 4XEIG 1OCZE 3FTWA 4J0UA 3MA5A 4YVOA 4JA9A 1ELWA 1X5BA 3RAUA 5T3RA 4DPRA 1E8XA 4GCOA 4FULA 1LD7A 1O1SA 2KCLA 1HF8A 1NZNA 4KXKB 3UM3A 4GA2A 2RG8A 1FT2A 3LS8A 3MZLB 3HIZA 1EDUA 4U0SA 3FH7A 3EU5A 2XGMA 4BY6A 3HG0D 3FHEA 3CIAA 1O5MA 2KBXA 2WMNA 4GYOA 4LERA 5EILA 2OEVA 2V4HC 4C0EA 1WG0A 2P9SG 3KD7A 3APDA 3U3WA 4XZ4A 4BSXA 4HRLA 3C3OA 2XHEA 2BKKB 2DVWA 3ESKA 1NFIE 2NSZA 3QC1A 4ABNA 4L23A 2X3MA 4BTAA 3RJVA 3EUVA 3DBSA 3CVLA 2XRYA 2IO2C 3APCA 3PEVB 4N3BA 3ZVVA 3CK8A 1ZB1A 3B7SA 4EBAA 4HBDA 1MX6A 2LAIA 3R9AB 5FQ4A 3T8KA 3FUMA 3HRAA 3NZSA 4UUCA 4YDEA 3ZYMA 4B93B 4GTOA 3EHNA 4LRZA 4JXTA 4GMRA 4GMLA 3QDNA 2J4BA 2WXHA 4U8VD 1U3DA 1HO8A 3IBEA 4GPMA 3FTSA 3P1UA 4DLOA 1SQMA 2FF4A 5JHAA 5FZRA 3L9TA 3CR3A 3T5XA 2HM8A 4BERA 2IJGX 4C9BB 2PNNA 2FEZA 3MX3A 3VLEA 4GTSA 3CK7A 4JEUA 3FUKA 3UM2A 3PNLB 3CKCA 3BU8A 3CVPA 3PZ4A 2WXOA 1OCOE 3CEQA 1BU9A 5JMND 2XPIA 4LUNU 1HX8A 2P58C 2QC9A 3ZFWA 1IXVA 3JQ1A 5CCMA 3SO8A 3ASFA 2WQHA 3DSTA
chains in the Genus database with same CATH topology
2H6IA 1TN7A 1LD8A 1N4PA 3HXDA 1QBQA 3PZ1A 3EUVA 3SFYA 3HXBA 1TN6A 3DSWA 4GTQA 1N4SA 3HXFA 1JCRA 3KSQA 2IEJA 1N9AA 3Q75A 2H6HA 3DRAA 2ZIRA 2H6FA 3KSLA 3Q78A 4MBGA 1JCSA 4LNBA 1D8DA 4YDEA 3DSUA 4GTOA 1FT1A 1N94A 1O1TA 3Q7FA 1MZCA 4L9PA 1LTXA 1S64A 1LD7A 1O1SA 1TNOA 1TNUA 3E32A 4GTTA 1S63A 3DSVA 1SA5A 4GTRA 1D8EA 1FT2A 4YDOA 1KZPA 3Q79A 3SFXA 2BEDA 3Q7AA 3E37A 1TNYA 4LNGA 1TN8A 3EU5A 4GTPA 1NL4A 3E34A 2ZISA 1FPPA 1TNZA 3DSXA 3PZ3A 3Q73A 4GTMA 1O5MA 4GTSA 1SA4A 1DCEA 3DSSA 3E30A 3HXEA 1N4QA 1O1RA 1KZOA 4GTVA 4EHMA 3HXCA 3PZ4A 1JCQA 1NI1A 3C72A 1TNBA 1N95A 2R2LA 3DPYA 2F0YA 2H6GA 1X81A 1N4RA 3PZ2A 3E33A 3DSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6I A;  1TN7 A;  1LD8 A;  1N4P A;  3HXD A;  1QBQ A;  3PZ1 A;  3EUV A;  3SFY A;  3HXB A;  1TN6 A;  3DSW A;  4GTQ A;  1N4S A;  3HXF A;  1JCR A;  3KSQ A;  2IEJ A;  1N9A A;  3Q75 A;  2H6H A;  3DRA A;  2ZIR A;  2H6F A;  3KSL A;  3Q78 A;  4MBG A;  1JCS A;  4LNB A;  1D8D A;  4YDE A;  3DSU A;  4GTO A;  1FT1 A;  1N94 A;  1O1T A;  3Q7F A;  1MZC A;  4L9P A;  1LTX A;  1S64 A;  1LD7 A;  1O1S A;  1TNO A;  1TNU A;  3E32 A;  4GTT A;  1S63 A;  3DSV A;  1SA5 A;  4GTR A;  1D8E A;  1FT2 A;  4YDO A;  1KZP A;  3Q79 A;  3SFX A;  2BED A;  3Q7A A;  3E37 A;  1TNY A;  4LNG A;  1TN8 A;  3EU5 A;  4GTP A;  1NL4 A;  3E34 A;  2ZIS A;  1FPP A;  1TNZ A;  3DSX A;  3PZ3 A;  3Q73 A;  4GTM A;  1O5M A;  4GTS A;  1SA4 A;  1DCE A;  3DSS A;  3E30 A;  3HXE A;  1N4Q A;  1O1R A;  1KZO A;  4GTV A;  4EHM A;  3HXC A;  3PZ4 A;  1JCQ A;  1NI1 A;  3C72 A;  1TNB A;  1N95 A;  2R2L A;  3DPY A;  2F0Y A;  2H6G A;  1X81 A;  1N4R A;  3PZ2 A;  3E33 A;  3DST A; 
#chains in the Genus database with same CATH topology
 3NAW A;  2ZGD A;  2ZGG A;  1N4P A;  2R59 A;  3BG1 B;  1KLX A;  3HHM A;  2XCB A;  3FUE A;  2J4D A;  3ZYK A;  3G2V A;  1SZA A;  1VDY A;  2DCP A;  4W9R A;  4JHR A;  4GTQ A;  2WXJ A;  2AWI A;  1L5J A;  2J08 A;  3TAX A;  4DX5 D;  4EQF A;  1YYH A;  2GRO B;  5AQ7 A;  3DRA A;  2ZIR A;  4BEP A;  1H2V C;  4BT9 A;  4PUC A;  1YCS B;  1HS6 A;  3QB2 A;  2A4Z A;  2YNQ A;  1IQU A;  2BUG A;  1H2U A;  4H7Y A;  3V2X A;  3URZ A;  2LSU A;  5ENT D;  3EIJ A;  3W9F A;  1UN9 A;  3KEZ A;  3LY9 A;  4GTT A;  1TNU A;  3P2B A;  4N2S A;  1SA5 A;  4XX5 A;  2YIN A;  3S7F A;  5ANR A;  2CHZ A;  3Q79 A;  4N39 A;  4QFV A;  3L82 A;  5AJL A;  3QOU A;  5HKP A;  2A5E A;  3EHR A;  5AJD A;  4G1T A;  4CCA A;  2XEN A;  5ARF A;  5LCW J;  3FUD A;  5CEA A;  3Q5M A;  1MYO A;  4TV3 A;  5B3S E;  2RFA A;  2KZT B;  3EU9 A;  3GZS A;  2Y69 E;  3UM1 A;  3HXC A;  2XRZ A;  2RD0 A;  3AJI A;  3NOC D;  4PDX A;  4G25 A;  3DPY A;  4IYP A;  2HO1 A;  4EEC A;  3ENE A;  4YDW A;  5EYP F;  1A17 A;  3B7B A;  3ASN E;  2P2C P;  4BES A;  5CMY A;  2P9U G;  4AP2 A;  3S7D A;  4WND A;  3HXD A;  5HRY A;  3EIQ C;  4HS2 A;  3I3N A;  4QQI A;  3SZ7 A;  3Q9N C;  4P29 A;  3HDX A;  3UXG A;  5FQ7 A;  4I1A A;  3KSQ A;  3ZW3 A;  3J5Q B;  1LF8 A;  2OND A;  5FZS A;  5KCM A;  5A23 A;  3ABK E;  5H7P A;  3FU3 A;  4J8Y A;  3ZPJ A;  4EBA G;  4BX9 A;  1D8D A;  4J8D A;  4BT8 A;  3DPD A;  3L17 A;  3PE4 A;  3ZGQ A;  4DX7 D;  4A1G A;  3W9G A;  3UIP C;  2YQ8 A;  4AXH A;  2V4L A;  2XEV A;  5KJL A;  4N5C A;  1GW6 A;  1DNP A;  2L0T B;  3SGH A;  3I4G A;  5G05 J;  4K03 A;  3UQ3 A;  4E6H A;  5KJM A;  5JJ6 A;  4I6J A;  3D9O A;  3Q49 B;  2NYJ A;  4I2W A;  2LXL A;  2DZN A;  3C98 A;  3B95 A;  1K1A A;  3HXE A;  2ETC A;  2GRQ B;  3U66 A;  4I1M A;  3CHP A;  2IQC A;  1HG2 A;  1UW4 B;  2H6G A;  1X81 A;  2C2L A;  4O6F A;  2R03 A;  4ANW A;  2XS1 A;  2PM6 A;  4Q94 A;  4DX2 A;  3TGO A;  3MGB A;  3AU4 A;  2F8Y A;  4AY6 A;  3NQP A;  4UI9 J;  5FWQ A;  3TL5 A;  2NC9 A;  2VSY A;  3EHM A;  1BD8 A;  4DX6 D;  2PQR A;  3CVY A;  1FVF A;  3PZD A;  4G8K A;  3TG4 A;  4EPZ A;  2I1K A;  2KCV A;  4NAC A;  4B8A A;  2VSO E;  3RK6 A;  4FHK A;  1TYQ G;  2KCK A;  3R7Q A;  1N94 A;  3ISM C;  4HB5 A;  3AS5 A;  3CQG B;  3U4T A;  3HVE B;  4DK5 A;  4GU5 A;  3HVE A;  3FDH A;  4B89 A;  2CHX A;  1S63 A;  4AIF A;  4R7L A;  3UPV A;  2IF4 A;  1MJ0 A;  3NB2 A;  1TN8 A;  4PS8 A;  4A3V A;  1Q2Z A;  4BFR A;  4N3A A;  4GYW A;  3WG7 E;  2VGX B;  4CYM D;  1Y6I A;  1DC2 A;  1HXI A;  3C3Q A;  3L54 A;  3OTN A;  3IV0 A;  4Q96 A;  4U8H A;  4FA6 A;  5FJY A;  2HR2 A;  3FY4 A;  3CGH A;  1H19 A;  4YVQ C;  3C72 A;  2CHW A;  3ONK A;  3QAR A;  3LPZ A;  3I5P A;  3TWQ A;  1K1B A;  4G11 A;  2H6I A;  3FFL A;  3PE3 A;  5CED B;  5B1A E;  5BV0 A;  4E85 A;  1KT0 A;  3DSW A;  3HXF A;  4KVM A;  5AAO A;  2WXN A;  4B94 A;  4N3C A;  2H6H A;  4UWF A;  3JUE A;  5A6C A;  4F1S A;  3C3R A;  2XPZ A;  4M3O A;  5HQ8 A;  4FHJ A;  2XGO A;  5ENQ D;  4TXR A;  2DYS E;  1H6K A;  3L08 A;  4L9P A;  3FUJ A;  2OV8 A;  2ZU6 B;  5CCL A;  1E90 A;  3JCK C;  4NRH B;  3ZIM A;  2CFU A;  4KMO A;  3D9H A;  4HLL A;  4UQX A;  4K5A B;  2P9L G;  2WXM A;  3L22 A;  3DXK G;  2EIJ E;  4YND A;  5B1B E;  4GTP A;  5G05 C;  2FO1 E;  4CEM A;  4RQI A;  4JW1 A;  1PAQ A;  5KNH D;  1B89 A;  2J09 A;  1INZ A;  1FVH A;  1TR4 A;  2KM4 A;  2Y1L E;  3IHY A;  2QZA A;  4FU3 A;  4WUY A;  4KZ0 A;  2XCC A;  1E7U A;  2RKK A;  2AXU A;  4I2Z A;  2R02 A;  4F1P A;  4ILH B;  1RZ4 A;  3RSE G;  5A7D B;  4ACL A;  2WPV A;  1Z6T A;  3FTZ A;  3IEG A;  4Y6C A;  5KNG A;  5JA4 D;  3LJ3 A;  3ZN3 A;  1QYM A;  3ULY A;  4L1B A;  5JHB A;  2MRI A;  3Q15 A;  2WQ6 A;  3CVX A;  2UY1 B;  2X6J A;  3AS8 A;  5ANL A;  2VSX E;  4F53 A;  1HU3 A;  3FEY A;  2XEE A;  2WXI A;  3CVN A;  4U0U A;  5AIJ A;  3JQ0 A;  1A5E A;  1MHQ A;  2BTD A;  3KS2 A;  2IOL A;  2X6K A;  4F3V A;  3ML9 A;  5AN8 A;  4AV7 A;  2FO7 A;  1N4Q A;  3VTY A;  2QYU A;  2FI7 A;  4ILI A;  1V54 E;  3D9K A;  3G2S A;  2J9Q A;  5BW8 C;  4D10 C;  1G3N B;  1OWO A;  3GZ2 A;  2EIM E;  3CHQ A;  3E33 A;  1Z3Y A;  4OAU C;  4FC8 A;  4KVO A;  3O4Z A;  1WDY A;  3L6A A;  4V3I A;  4DX1 A;  3IHV A;  3ZYL A;  3SD5 A;  4HI9 A;  3UTM A;  2WB2 A;  2LUH A;  4N5Q A;  3MKR A;  1JCR A;  2P9K G;  4EZJ A;  4GYY A;  2VJ8 A;  2KAT A;  5BT1 A;  3UT4 A;  1JCS A;  3APF A;  1WAO 1;  1E8Z A;  4N2Q A;  4BSZ B;  5M72 A;  5CRV A;  3SF4 A;  3CV0 A;  2IO3 C;  1IKN D;  4U95 D;  4DI4 A;  3BEE A;  4HOU A;  3CHM A;  5D0O D;  3ZU7 B;  1AP7 A;  1MZC A;  3TWR A;  1OWL A;  4XKC A;  1S64 A;  1TJC A;  5EKQ D;  4J8E A;  4B0Z A;  4G8L A;  1E8Y A;  1ZBP A;  4ATZ D;  1YA0 A;  2QY7 A;  1D8E A;  3MEK A;  4U0Z A;  4XE0 A;  3N71 A;  1NL4 A;  3PS6 A;  1AWC B;  5IY5 E;  1D9S A;  4IN3 B;  1ELK A;  4L2Y A;  3CKB A;  4MRU A;  3S7J A;  4G24 A;  3MV3 B;  2LAH A;  3WXX A;  2BKG A;  4PH4 B;  5CRU A;  3OXF A;  3DEO A;  4JHJ A;  3TJP A;  4JA7 A;  5AYW D;  1JWG A;  4AEZ C;  1V55 E;  3D9P A;  5ENP D;  3FH8 A;  3ONL A;  3U9W A;  1H2T C;  2X6F A;  2GRL A;  3TWS A;  3QNK A;  2B0O E;  4FAD A;  2KC7 A;  2X6I A;  4HRM B;  1K8K G;  1YMP A;  2KZT A;  2YHE A;  3V79 K;  2JEK A;  4FJY A;  2WXP A;  3ZEF A;  4GA1 A;  1N9A A;  3RO2 A;  4PS3 A;  3TWT A;  4J8S A;  4CT0 A;  3GZ1 A;  4TXQ A;  3ABL E;  4BWR A;  1Z5S C;  1OCC E;  3NF1 A;  3JUI A;  4F6R D;  1IHG A;  4MS6 A;  3CK9 A;  4XIF A;  1QNF A;  3Q7F A;  5CER B;  2J8S D;  2R05 A;  3SFZ A;  3D9N A;  5C1D A;  2F37 A;  3ASO E;  2IFU A;  2DIW A;  2XZT G;  2KXP C;  2I1J A;  3UI2 A;  3VTX A;  4LG6 A;  1UJJ A;  3E34 A;  3QJZ A;  1H6O A;  1JUQ A;  2LSV A;  4RG9 A;  3RIB A;  3ZHE B;  3ZHE A;  3ZXS A;  4ANU A;  1K3Z D;  4UWG A;  1OWN A;  2AVP A;  3AG3 E;  4EZL A;  5BXU A;  2E0I A;  1HE8 A;  4BTB A;  4HXI A;  1N95 A;  2MOW A;  4Q69 A;  1BLX B;  3L16 A;  3ESL A;  4GMJ A;  3PRE A;  5KWD A;  4UQZ A;  2I2O A;  4HI8 A;  4AY5 A;  2R17 C;  3Q9U C;  4UWK A;  1JPL A;  5AQ9 A;  4M7C A;  2CFZ A;  4DJA A;  5AQA A;  3LDZ A;  2P9P G;  4I6G A;  2BF0 X;  3B7R L;  2L6B A;  2GRN B;  4MKT A;  1TEZ A;  2GW1 A;  2IEJ A;  3ZUV B;  5FZQ A;  3ZYQ A;  3Q75 A;  3LCA A;  3KSL A;  5J90 A;  4OYS A;  2CG2 A;  4U63 A;  3JXI A;  4A63 B;  2I9C A;  2Y0B G;  1Y8M A;  2WXF A;  3JXJ A;  3TWX A;  5D2M C;  3ASG A;  2VSN A;  2FUL A;  1MX4 A;  5JJT A;  1HH8 A;  5CMW A;  4GTR A;  3NZU A;  2A5U A;  4UWL A;  2EQX A;  2BED A;  3CHR A;  3ASH A;  3LVQ E;  3AAA C;  3FUL A;  5D66 A;  5G04 J;  2OCC E;  4GZ3 A;  3G2W A;  2P9N G;  1SA4 A;  4JZY A;  5CBN A;  2WMO A;  1KZO A;  4H7X A;  4HOQ A;  5LFA A;  5EIB E;  5CEC B;  3DXM G;  2HE0 A;  3BUA A;  1BI7 B;  1LD8 A;  2VGX A;  4ANV A;  1NP7 A;  2J49 A;  4APO A;  2EIK E;  5LCW C;  4AM9 A;  2E2E A;  5AEN A;  4JC8 A;  2Y3A A;  2AXV A;  4TUU A;  5T4Y A;  3ML8 A;  3TWV A;  2GRM A;  1UOH A;  2DZO A;  3JYS A;  3PVL A;  4UI9 K;  3R7R A;  3MKQ B;  4PS7 A;  3MKQ A;  4LNB A;  3UKR G;  1XNF A;  3VLD A;  3PUJ A;  3SBS A;  4DRX E;  2EIL E;  2WVI A;  2P9I G;  3DWL G;  3LJN A;  4I1O B;  4DI3 A;  1OUV A;  1LTX A;  2L6J A;  3MYV A;  4L2L A;  1IQR A;  4J8F A;  4RVB A;  1HFA A;  2WQ7 A;  1KPS B;  1N11 A;  5EX0 A;  1N54 A;  1SW6 A;  5LX8 A;  4B8C B;  5ENN A;  4GA0 A;  4CZ2 D;  4U96 D;  3FU6 A;  4GZD A;  1U2V G;  2ILR A;  1TNZ A;  3DSX A;  4JEH A;  5FT9 A;  4O1P A;  2DBA A;  2LNI A;  3Q73 A;  4GTM A;  3QK0 A;  4A1S A;  2Y4U A;  4BET A;  3J5P A;  3D9M A;  4I9C A;  2OEW A;  3QKY A;  3D9L A;  2RFM A;  3D9J A;  5LOZ A;  1O1R A;  4OVU A;  4WNG A;  3FTY A;  1TNB A;  4U07 A;  3RU0 A;  4JVS A;  3D3M A;  3PZ2 A;  5G2N A;  4ME2 A;  5DIZ A;  4EZK A;  4O60 A;  1WY6 A;  3CLJ A;  3SI5 A;  4CDM A;  3Q4A B;  5BNW A;  2XS8 A;  4HNA D;  3FU5 A;  4CRW A;  3QAQ A;  3FEX A;  2NXP A;  4LNU D;  3ZRH A;  4Z68 A;  3SNX A;  2WM9 A;  1OCR E;  5AQB A;  3UX4 A;  3QWV A;  4URK A;  1UG3 A;  5BXO A;  2L9B A;  1BI8 B;  3DSU A;  1PC2 A;  2HYZ A;  1XGW A;  1SZ9 A;  2ZXW E;  3UUX A;  1TNO A;  4UI9 C;  4KBQ A;  4A3T A;  3DSV A;  3U64 A;  3Q47 B;  2QFC A;  4K5C A;  1OT8 A;  4YDO A;  4CT4 A;  1KZP A;  1OY3 D;  1TNY A;  3LY7 A;  5JJ7 A;  5EN5 D;  4CGW A;  4WWO A;  4JL0 A;  2UY1 A;  4GB9 A;  3DEP A;  3R9M A;  1IHB A;  5G04 C;  4YDY A;  3DSS A;  2WXG A;  2V8S E;  3E30 A;  4FLH A;  5T8I A;  2XZD G;  4UQY A;  2PQN A;  2C0M A;  1H0A A;  2XGS A;  1EYH A;  3CVU A;  3CVW A;  4ZHB A;  2MYO A;  2JAB A;  5CBO A;  4G26 A;  3FUN A;  3D9I A;  3PZ1 A;  1E96 B;  1H6P A;  2AW6 A;  4GZ5 A;  2V5Q C;  4OVV A;  1P5Q A;  3NBN B;  2DWZ A;  1HZ4 A;  3FUH A;  4TRQ A;  4O1O A;  1SVX A;  4WWN A;  2UWJ G;  4ILG A;  2X38 A;  2IY0 C;  3LYA A;  2QYJ A;  3CST A;  1OWP A;  1FT1 A;  3UKU G;  4X8Q A;  3SBT B;  2J07 A;  4MLP A;  3LEW A;  4ACK A;  3LXU X;  4I6E A;  3ZKJ A;  4JD2 G;  2VTB B;  4FJZ A;  2IU1 A;  3UM0 A;  2VTB A;  2ION A;  4DUI A;  5BPP A;  5HS0 A;  4XKB A;  4WNE A;  4BX8 A;  3PDN A;  4LNG A;  4JHK A;  2GRP B;  3BQO A;  2PM7 A;  4NUR A;  5ITZ F;  3PZ3 A;  4TUM A;  4GZ6 A;  4HQD A;  4DLQ A;  2X6H A;  1HG5 A;  4IRU A;  3B7U X;  2YHC A;  3FUI A;  5EID A;  2WXQ A;  3SY2 A;  5FIO A;  5ENO D;  3TG5 A;  1N4R A;  4KYO B;  2I6H A;  2LO6 A;  5ARG A;  2VGE A;  4LEU A;  2M63 A;  4ATG A;  4FLB A;  2VGY A;  1MX2 A;  4RLY A;  3NOG D;  3AS4 A;  3MV2 B;  1QBQ A;  1QQE A;  3K9I A;  3FUF A;  5BV1 A;  3LVR E;  3UIO C;  3CVQ A;  2B6C A;  3ULE G;  2PZI A;  5EYL A;  2CG3 A;  3PNT B;  5LP0 A;  1FCH A;  3EHQ A;  3ULQ A;  5DBK A;  2C0L A;  3CQC B;  2EIN E;  1E7V A;  2V5F A;  3E4B A;  2MHK A;  4G23 A;  2XEH A;  3O48 A;  2AXZ A;  4ZFH A;  1O1T A;  5E76 A;  3G2U A;  4Y6W A;  3F6Q A;  3CHS A;  3FTX A;  2ETB A;  3E32 A;  5J08 A;  3TWW A;  3UT7 A;  5FQ6 A;  3AU5 A;  4G2V A;  4U04 A;  4UWH A;  3Q7A A;  3E37 A;  4U7E B;  2PL2 A;  2XPY A;  2WXR A;  3ZNG A;  4RSY A;  1ELR A;  3CHO A;  3TXM A;  3V2O A;  3EDT B;  4LCT A;  3I4R B;  5G55 A;  3FTU A;  3OXG A;  4KT6 B;  1DCE A;  1UN8 A;  4I43 A;  1W3B A;  2LXM A;  1NI1 A;  1N52 A;  1NA0 A;  4HLE A;  4JB8 P;  3RRN B;  1QZ2 A;  3BG0 B;  5ENS D;  5ENR D;  3TXN A;  2V0P A;  4IUL A;  4C0M A;  2JLB A;  4NIK A;  3HXB A;  3T8M A;  4HFG A;  4J7W A;  4CGV A;  1N4S A;  3EJN A;  1TJF A;  3OXL A;  3B7T A;  1DCQ A;  3S7B A;  3RRU A;  4HRN A;  4MBG A;  3RRM B;  3FU0 A;  2WXK A;  4AOF A;  4KZC A;  4U8Y D;  4JPS A;  4LSZ E;  4HVB A;  4AJW A;  2DYR E;  3PH0 C;  1EPU A;  3GYZ A;  5E75 A;  4GCN A;  3VLF A;  3ZXP A;  3OAW A;  5CHE E;  4F7A A;  3MCX A;  5KJN A;  1OXJ A;  3LKU A;  2Y4T A;  4TXP A;  3V30 A;  3QWW A;  3SFX A;  5EX3 A;  4CDN A;  2GRR B;  4WWP A;  3ASD A;  4GAA A;  2ZIS A;  3V31 A;  3PRZ A;  3KAE A;  2OVB A;  1KT1 A;  1MQS A;  3CVV A;  4A55 A;  3B13 A;  3FTV A;  2VQ2 A;  5FTP A;  1WM5 A;  1JCQ A;  5FQ8 A;  3S2A A;  2R2L A;  5AAR A;  3T5V A;  3FWV A;  1IYG A;  3UIN C;  5FIN A;  3AG1 E;  3TWU A;  4WNF A;  1TN7 A;  5KBA A;  3G2T A;  3FP3 A;  3SFY A;  4HOR A;  4CDR A;  4HOT A;  4RG6 A;  1NA3 A;  5HI7 A;  1TN6 A;  1Z3X A;  3CSF A;  4FP7 A;  4APF A;  5KJK A;  1N0Q A;  3SQV A;  5EDS A;  3PUK A;  1UJK A;  3GW4 A;  4GZC A;  4OAV B;  2H6F A;  3Q78 A;  3IXE A;  3KEA A;  1DVP A;  2OVF A;  2R5S A;  3FH5 A;  3RO3 A;  4L7T A;  3SHF A;  3LY8 A;  1EF1 C;  4GPK A;  3ABM E;  2F8X K;  4K0R A;  1S70 B;  1E8W A;  2AJA A;  5D0Q D;  2XQ0 A;  4J6I A;  3T9K A;  3PEU B;  4I9E A;  4WAF A;  1RW2 A;  3X2Q E;  2ETA A;  5BUZ A;  1FPP A;  4XI9 A;  3QWP A;  4XI0 A;  3RKV A;  1JWF A;  2IOS A;  3IKO B;  2OOE A;  2WXL A;  3UT8 A;  1ZU2 A;  1N0R A;  4GTV A;  4EHM A;  4I17 A;  4HOS A;  2FBN A;  1S0P A;  2F0Y A;  1U3C A;  4K5B A;  5C2Y A;  2Q7F A;  3UMV A;  3L13 A;  1BPO A;  1PY1 A;  2L0I A;  4ANX A;  2VYI A;  3AG4 E;  1OWM A;  4AVX A;  4NQ0 A;  4C48 B;  3C5R A;  2GGF A;  3AG2 E;  3MJW A;  3HYM B;  4XEI G;  1OCZ E;  3FTW A;  4J0U A;  3MA5 A;  4YVO A;  4JA9 A;  1ELW A;  1X5B A;  3RAU A;  5T3R A;  4DPR A;  1E8X A;  4GCO A;  4FUL A;  1LD7 A;  1O1S A;  2KCL A;  1HF8 A;  1NZN A;  4KXK B;  3UM3 A;  4GA2 A;  2RG8 A;  1FT2 A;  3LS8 A;  3MZL B;  3HIZ A;  1EDU A;  4U0S A;  3FH7 A;  3EU5 A;  2XGM A;  4BY6 A;  3HG0 D;  3FHE A;  3CIA A;  1O5M A;  2KBX A;  2WMN A;  4GYO A;  4LER A;  5EIL A;  2OEV A;  2V4H C;  4C0E A;  1WG0 A;  2P9S G;  3KD7 A;  3APD A;  3U3W A;  4XZ4 A;  4BSX A;  4HRL A;  3C3O A;  2XHE A;  2BKK B;  2DVW A;  3ESK A;  1NFI E;  2NSZ A;  3QC1 A;  4ABN A;  4L23 A;  2X3M A;  4BTA A;  3RJV A;  3EUV A;  3DBS A;  3CVL A;  2XRY A;  2IO2 C;  3APC A;  3PEV B;  4N3B A;  3ZVV A;  3CK8 A;  1ZB1 A;  3B7S A;  4EBA A;  4HBD A;  1MX6 A;  2LAI A;  3R9A B;  5FQ4 A;  3T8K A;  3FUM A;  3HRA A;  3NZS A;  4UUC A;  4YDE A;  3ZYM A;  4B93 B;  4GTO A;  3EHN A;  4LRZ A;  4JXT A;  4GMR A;  4GML A;  3QDN A;  2J4B A;  2WXH A;  4U8V D;  1U3D A;  1HO8 A;  3IBE A;  4GPM A;  3FTS A;  3P1U A;  4DLO A;  1SQM A;  2FF4 A;  5JHA A;  5FZR A;  3L9T A;  3CR3 A;  3T5X A;  2HM8 A;  4BER A;  2IJG X;  4C9B B;  2PNN A;  2FEZ A;  3MX3 A;  3VLE A;  4GTS A;  3CK7 A;  4JEU A;  3FUK A;  3UM2 A;  3PNL B;  3CKC A;  3BU8 A;  3CVP A;  3PZ4 A;  2WXO A;  1OCO E;  3CEQ A;  1BU9 A;  5JMN D;  2XPI A;  4LUN U;  1HX8 A;  2P58 C;  2QC9 A;  3ZFW A;  1IXV A;  3JQ1 A;  5CCM A;  3SO8 A;  3ASF A;  2WQH A;  3DST A; 
#chains in the Genus database with same CATH homology
 2H6I A;  1TN7 A;  1LD8 A;  1N4P A;  3HXD A;  1QBQ A;  3PZ1 A;  3EUV A;  3SFY A;  3HXB A;  1TN6 A;  3DSW A;  4GTQ A;  1N4S A;  3HXF A;  1JCR A;  3KSQ A;  2IEJ A;  1N9A A;  3Q75 A;  2H6H A;  3DRA A;  2ZIR A;  2H6F A;  3KSL A;  3Q78 A;  4MBG A;  1JCS A;  4LNB A;  1D8D A;  4YDE A;  3DSU A;  4GTO A;  1FT1 A;  1N94 A;  1O1T A;  3Q7F A;  1MZC A;  4L9P A;  1LTX A;  1S64 A;  1LD7 A;  1O1S A;  1TNO A;  1TNU A;  3E32 A;  4GTT A;  1S63 A;  3DSV A;  1SA5 A;  4GTR A;  1D8E A;  1FT2 A;  4YDO A;  1KZP A;  3Q79 A;  3SFX A;  2BED A;  3Q7A A;  3E37 A;  1TNY A;  4LNG A;  1TN8 A;  3EU5 A;  4GTP A;  1NL4 A;  3E34 A;  2ZIS A;  1FPP A;  1TNZ A;  3DSX A;  3PZ3 A;  3Q73 A;  4GTM A;  1O5M A;  4GTS A;  1SA4 A;  1DCE A;  3DSS A;  3E30 A;  3HXE A;  1N4Q A;  1O1R A;  1KZO A;  4GTV A;  4EHM A;  3HXC A;  3PZ4 A;  1JCQ A;  1NI1 A;  3C72 A;  1TNB A;  1N95 A;  2R2L A;  3DPY A;  2F0Y A;  2H6G A;  1X81 A;  1N4R A;  3PZ2 A;  3E33 A;  3DST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...