3D9IA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
138
structure length
138
Chain Sequence
EAVKTFNSELYSLMDMKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords RNA-binding protein 16
total genus 54
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9iA00
3ZYQA 4HFGA 3D9JA 4NACA 2MOWA 1LF8A 4FU3A 1HF8A 1DVPA 3D9IA 3ZYKA 3LDZA 2V8SE 3G2SA 4AVXA 1HX8A 1HG2A 1VDYA 1MHQA 3D9LA 1HFAA 3G2WA 3G2VA 1SZAA 1X5BA 1H0AA 2DIWA 3D9KA 2DCPA 3D9NA 2LO6A 3D9PA 1UJKA 3G2UA 4GZCA 1JPLA 1HG5A 4JXTA 4Q96A 4GZDA 3ZYMA 1UJJA 1JUQA 1PY1A 5J08A 3G2TA 5CMYA 3D9MA 3RRUA 3ZYLA 1SZ9A 1EYHA 1XGWA 5LOZA 2L0TB 1INZA 2QY7A 1JWFA 3CLJA 2L0IA 4FLBA 1EDUA 1ELKA 4Q94A 2BF0X 3ONKA 1JWGA 5CMWA 5LP0A 3D9OA 3ONLA 2KM4A
chains in the Genus database with same CATH superfamily
4LERA 3OAWA 3CVUA 5EX3A 4UWHA 2J49A 3PEVB 5FZRA 3TWSA 1HG5A 1K1BA 3GZ2A 5AJDA 4MLPA 2VGYA 4EZJA 2AXVA 4ABNA 4R7LA 4UQXA 4DRXE 5ENTD 1E8WA 3R9AB 3SHFA 4XIFA 4U96D 4HRMB 3FUEA 2BKGA 2IOLA 2ZIRA 1U3DA 5EILA 4C48B 4APOA 2WXGA 4G8LA 4GMLA 3JYSA 1HS6A 3RJVA 3KD7A 2ZU6B 4LUNU 2AJAA 3L13A 1NA3A 3BEEA 4BX9A 3D9HA 1SZAA 2IFUA 4G2VA 3IEGA 5BNWA 1TN8A 3T5XA 3PH0C 2WXOA 3AG3E 3NAWA 4TUMA 4A1GA 3ML8A 1EDUA 2Y4UA 4AXHA 3UM3A 2H6HA 4HRLA 1KT1A 5ENPD 3Q7AA 2RG8A 3PUJA 3NOGD 2LUHA 4KT6B 4N3BA 3D9KA 4FA6A 3UQ3A 3D9NA 4EBAG 5JJ7A 5CMYA 1SA5A 4N3CA 4YDWA 2Y3AA 2P9UG 4F1PA 4L2LA 2XHEA 5CEDB 4CT4A 4GZ3A 2XPZA 3Q5MA 4LNBA 2WXRA 5CBNA 3G2VA 3CHOA 1UN9A 3SO8A 4ATGA 4BT9A 5ENRD 4GTOA 1QQEA 1N4SA 1Z3XA 5LCWC 3BQOA 3RIBA 1FT1A 4TXPA 3SBSA 4J8SA 1OUVA 3OXLA 3APDA 3HRAA 3F6QA 3E37A 5EYLA 1QBQA 1S64A 3SGHA 2WXJA 4RG9A 4I1OB 1OWNA 2DYRE 4OYSA 4GMRA 2UWJG 3SI5A 2XRYA 3CVWA 1S70B 3D9LA 3PREA 2LAHA 2XPIA 1UOHA 3BG1B 3MEKA 3AG4E 4FHJA 3CK7A 5HI7A 2VSYA 3UT8A 3RO2A 5BXOA 1DC2A 3BU8A 4G26A 3LVRE 4HI8A 3KS2A 4K5BA 1H19A 1DCEA 4WWOA 1BI8B 4M3OA 4ANVA 5J90A 3MV3B 4N2SA 3V79K 1LTXA 5JMND 2BTDA 2WQ6A 3MYVA 1TJCA 2QYJA 2E0IA 4BTAA 5KJLA 5A23A 5FTPA 4OAVB 4FULA 2LNIA 3ZRHA 3ZXSA 2M63A 3FTUA 4UWLA 4A3TA 3SBTB 4E85A 2DZNA 3ZYQA 2V4LA 3MV2B 5HS0A 5CCLA 4N2QA 2BKKB 5BXUA 1O5MA 4DX7D 4CDMA 2R05A 4WAFA 3ABLE 4HRNA 3DRAA 2WMOA 4HOTA 2L0IA 2X6FA 4PS8A 2XEVA 2GROB 5CMWA 3HG0D 3LCAA 3AS5A 3CVPA 1LF8A 3RK6A 2FBNA 2GGFA 2V8SE 2XS1A 1HG2A 3FH8A 4GTRA 4XI9A 5KNHD 4A1SA 2ETCA 3LKUA 4UQZA 3FTVA 2GW1A 4GCOA 3FUHA 4V3IA 4O1PA 4LG6A 4BERA 1IQUA 1OCCE 2F37A 3L17A 1KT0A 3B95A 3EU9A 4NIKA 2J08A 4JHRA 4K5CA 2QZAA 4I43A 1N0QA 2I6HA 4QFVA 3ENEA 2UY1B 3HHMA 3ZYLA 4LNUD 3CSTA 2AW6A 2YNQA 3AG2E 1Z5SC 2OEVA 2GRMA 4JD2G 3KAEA 4LRZA 3G2WA 2P9KG 2ZGDA 3ZN3A 4Q96A 2EIJE 4U8YD 2WPVA 3JQ0A 5HKPA 4G11A 4A63B 2V4HC 1N95A 4WNEA 1H2TC 1YA0A 4MBGA 4RVBA 1N11A 3RRMB 2EILE 4GYOA 4DX5D 1FVHA 4DLOA 3B7RL 2CFZA 1NZNA 3WXXA 3W9GA 2C0MA 4HOSA 2CG3A 3U4TA 1FCHA 5AYWD 4ZHBA 1JUQA 2YHCA 4NURA 3RO3A 2J09A 2R02A 3D9OA 5B1BE 2X3MA 3L82A 3ABKE 4K5AB 3TWXA 4JPSA 3D9MA 3AAAC 3C72A 3LJ3A 4HI9A 1IYGA 4WNFA 1DCQA 3UXGA 4YDOA 3E33A 2MRIA 3G2SA 3QK0A 4MS6A 1QNFA 2VGEA 3QWVA 3TWQA 3Q4AB 3FULA 3PZ4A 3EIJA 1OY3D 3EDTB 3UX4A 1SW6A 3CLJA 4YNDA 2XENA 5E75A 4HOQA 3B13A 1UG3A 3D9IA 4C9BB 3AJIA 3ZU7B 2VTBA 2MHKA 1OCZE 1K1AA 2CHWA 3Q49B 3KEZA 4URKA 4GTSA 2PL2A 1WAO1 5G2NA 3D9PA 2BEDA 5T3RA 1H2UA 4AJWA 5ITZF 2IY0C 1P5QA 2KCVA 1INZA 3FTWA 4CCAA 1YCSB 2EIME 1QZ2A 5AIJA 2YINA 4P29A 4NRHB 4U0ZA 4DLQA 2H6IA 1GW6A 3CK9A 2X6JA 3QDNA 3FH5A 2J8SD 5CCMA 3MX3A 5FT9A 1SVXA 3FUKA 1L5JA 3DSVA 2XEEA 1OWMA 2RFAA 3FHEA 2PZIA 3MCXA 4PS7A 2WXKA 3LYAA 4I2WA 2HO1A 4JEUA 2J4DA 3UM0A 2KXPC 3UI2A 3DPYA 2DCPA 4BWRA 4IN3B 3VTXA 1D8EA 4O6FA 3FU6A 4WWNA 3MKRA 3ONLA 4FJYA 1ZBPA 4I6EA 4RLYA 2Q7FA 4TRQA 3FEXA 3HXDA 4I17A 2C0LA 3LVQE 2CG2A 5G05C 2WXPA 5FZQA 2ZISA 4X8QA 3TWVA 3X2QE 3HVEA 2VGXA 4EECA 5FQ6A 2KZTB 4GTMA 4YDYA 2AXZA 3CGHA 4GTTA 3JXIA 1H6PA 2P9LG 4RQIA 3ZPJA 4WUYA 2H6FA 4J8DA 3O4ZA 2OVFA 2GRNB 1O1SA 5E76A 1K3ZD 4F53A 1AP7A 1SZ9A 4ILGA 5CBOA 3V31A 4ZFHA 1FPPA 3CVYA 1S63A 3PDNA 4GZ5A 2I2OA 3LDZA 3DBSA 3B7TA 3T9KA 3PNLB 1H6KA 3FTSA 3R7QA 4G24A 4CEMA 2X6IA 4UI9C 1PAQA 2KZTA 3S7BA 3PNTB 1WG0A 2R5SA 4JW1A 3FU5A 5CECB 5ENOD 4KYOB 1B89A 3CVVA 3KEAA 3MJWA 4B93B 4EQFA 4U0UA 3HXCA 2WXMA 4H7XA 3RRUA 4GTPA 4KMOA 2NSZA 1NA0A 5ENQD 3ASFA 1DVPA 5G04J 2FO7A 1SQMA 4XKCA 3FUFA 2YQ8A 4TV3A 4XX5A 4GTQA 2WXIA 1V55E 1XGWA 3R9MA 3DSUA 3SFZA 2BF0X 3UUXA 3HDXA 3ZHEA 1UW4B 2XGMA 3TL5A 2F8XK 3EJNA 2I9CA 2Y1LE 1BU9A 2V0PA 4U8HA 1ZU2A 4KZ0A 2J4BA 2VTBB 3LY9A 5LFAA 1IHGA 4FP7A 4EHMA 2AVPA 4GYYA 2KBXA 4U7EB 3LEWA 4BSZB 5FQ4A 3CVNA 5AQBA 3UKUG 2L9BA 3L16A 5H7PA 2WQHA 3KSLA 3PS6A 2LSUA 3PE3A 3UMVA 3EUVA 3FUDA 3Q47B 3L22A 4L7TA 3ULYA 2R17C 3TJPA 1HO8A 1YYHA 3G2UA 1OWPA 4J8YA 2HM8A 2CHXA 4U8VD 2P58C 1JWGA 4MKTA 4HS2A 4A55A 3JUIA 2HE0A 4B0ZA 4CYMD 3FEYA 3NOCD 2X38A 3CQCB 4BT8A 5KJNA 2WXQA 3Q78A 2R2LA 3AS8A 2EINE 5BPPA 3FWVA 1NP7A 3CKBA 5JHBA 4HLLA 3ZNGA 2XEHA 3PE4A 5FIOA 4CDNA 4K03A 3OXFA 3TXMA 3TWRA 1A5EA 1E7UA 4XI0A 5G05J 4BY6A 2XZTG 3HXBA 4AV7A 5AQ7A 2KCKA 1FT2A 4HOUA 4OVVA 4F7AA 2Y69E 3J5QB 3IXEA 3R7RA 3HXEA 2P2CP 5T8IA 3EIQC 3MA5A 3SZ7A 1H0AA 4FHKA 4PUCA 5LCWJ 3C3QA 1N94A 4ANWA 5CHEE 3ONKA 2IOSA 3DPDA 3IHYA 2DVWA 3FP3A 5CRVA 4U07A 3RSEG 1A17A 1KPSB 5AN8A 2IJGX 2WQ7A 3U64A 2CHZA 2FO1E 2IU1A 3DSTA 3PZDA 5BV1A 3NF1A 4EZLA 2HR2A 4O60A 1XNFA 5B1AE 2J9QA 2C2LA 2GRLA 1H2VC 3Q15A 3FTXA 4GZDA 2R03A 3E34A 3ZXPA 2LXMA 4DX6D 1Z3YA 1WM5A 3DXMG 2RKKA 4AOFA 3RKVA 1V54E 3QWPA 2ETBA 3ESLA 2R59A 5FZSA 1UJJA 5D0OD 4HORA 3FH7A 5G55A 2DZOA 1JWFA 4JL0A 4RSYA 3QKYA 4BFRA 4YVOA 2BUGA 1E8ZA 4UWFA 1TN7A 4U0SA 2WVIA 3AU4A 4AIFA 2Y4TA 3MKQB 3S7DA 3QNKA 3BUAA 3ZFWA 2PQRA 4GPMA 4AEZC 4LSZE 5AQAA 3CHQA 2NC9A 3ZIMA 2IEJA 3V2OA 1X81A 2ETAA 4KVOA 1E8YA 1IQRA 3B7UX 5D2MC 2X6KA 4WNGA 3VLDA 4H7YA 4KXKB 3TAXA 4N39A 2OV8A 3I3NA 3IV0A 3JXJA 3L9TA 4I1MA 5FINA 2XCBA 3CHPA 3L54A 5KJKA 2UY1A 1H6OA 1W3BA 2DBAA 5EIBE 3JUEA 1Y6IA 3J5PA 5AARA 3SFXA 4HLEA 3NBNB 2XS8A 1FVFA 1N4RA 3T8MA 1K8KG 4WWPA 4GA1A 4O1OA 3UTMA 2WB2A 1E8XA 4Z68A 5A7DB 3FUMA 2VGXB 3DSSA 1LD7A 2VQ2A 3IKOB 4JB8P 3GZ1A 4BTBA 3PRZA 4GMJA 1BPOA 3C98A 3CVLA 3Q79A 3ULEG 4ANUA 2DWZA 1LD8A 1KZPA 4J7WA 3LY8A 4N5QA 5T4YA 1D8DA 4B94A 4I6JA 4GPKA 1HX8A 1OWOA 2ILRA 3HIZA 4AY6A 2ONDA 3ZUVB 3CR3A 4PS3A 2L0TB 1AWCB 1OT8A 2GRQB 4HFGA 1TJFA 3ZYKA 4G8KA 3B7SA 3U9WA 4JC8A 4JXTA 3V2XA 4U04A 3TG5A 4ME2A 3OXGA 4QQIA 5D0QD 4KZCA 4DPRA 3UT7A 4F6RD 3CV0A 2WM9A 1O1RA 1TR4A 3CSFA 4IRUA 3TWWA 1D9SA 4TUUA 2WXFA 4NACA 3E32A 3ASNE 3I4RB 5C2YA 1MYOA 4XZ4A 4DX1A 2EIKE 1PY1A 4PDXA 1EF1C 5A6CA 3FU3A 4UWKA 4JZYA 2EQXA 4ANXA 3SF4A 3UINC 2A5UA 2L6BA 1U2VG 4GCNA 4APFA 4J0UA 1BD8A 1HU3A 3CHRA 4UWGA 3BG0B 3AS4A 1JCRA 1UJKA 1UN8A 3ASGA 3WG7E 3EHMA 3QAQA 4PH4B 4JHJA 4B89A 4WNDA 3QJZA 3MZLB 4GA2A 1S0PA 3CHMA 1U3CA 2GRPB 1WDYA 4L23A 4LEUA 2XGOA 3FUJA 3T8KA 3EHRA 5BT1A 2DYSE 3TXNA 2QYUA 4CZ2D 4LCTA 1HZ4A 3Q75A 2PQNA 2IQCA 1HE8A 1NI1A 4UQYA 4Y6WA 5CERB 3NB2A 5EYPF 4FU3A 1MJ0A 2WXLA 3LXUX 4BX8A 1KZOA 1VDYA 4DI4A 3LPZA 3NZUA 4K0RA 1TNBA 3D3MA 1N0RA 3VLFA 4JHKA 5AQ9A 3SY2A 5LP0A 2KATA 3UIPC 4BETA 1Q2ZA 3EU5A 4C0EA 4N3AA 2DIWA 3QWWA 2XZDG 1MZCA 3CEQA 1WY6A 4HXIA 3PEUB 1NL4A 3GW4A 1N4PA 4M7CA 2VYIA 2ZGGA 5FWQA 4HNAD 3ZKJA 1JPLA 2FI7A 3CIAA 3N71A 3AU5A 3PZ2A 2WMNA 1JCSA 3QC1A 4G23A 4KBQA 2XCCA 5FQ8A 4EZKA 3CKCA 3G2TA 5CEAA 3P1UA 4GAAA 2WXHA 3K9IA 4TXQA 1OXJA 4G25A 5DIZA 4TXRA 4GZCA 2KM4A 2I1JA 3U66A 1OCRE 5ARFA 5ARGA 2PM6A 4N5CA 4XKBA 2LO6A 4B8AA 1MQSA 4OVUA 4MRUA 3IHVA 5B3SE 2Y0BG 3RAUA 1EPUA 2L6JA 3FU0A 1N9AA 2HYZA 1Y8MA 3FDHA 4L1BA 5EKQD 4ATZD 4AVXA 2X6HA 5HRYA 1HFAA 3CHSA 1TN6A 4J8FA 2AXUA 3ASDA 4OAUC 4JA9A 3Q9NC 5LOZA 3IBEA 3L6AA 5C1DA 5CRUA 5KWDA 3QOUA 3ZGQA 2NXPA 3RRNB 4XEIG 1BI7B 2A5EA 2ZXWE 4CT0A 3GYZA 5ENNA 2PM7A 2MYOA 2FF4A 3CQGB 2JABA 3DXKG 4DJAA 2V5QC 3JCKC 4ILHB 5ANLA 1IXVA 3PVLA 1TEZA 2IO2C 3MKQA 3D9JA 4I9CA 1OWLA 3HVEB 3S2AA 4EBAA 1Z6TA 5JHAA 2QC9A 3VLEA 3E4BA 3FUNA 2JLBA 3ML9A 3TWTA 2XPYA 4ILIA 3UIOC 2MOWA 4L9PA 2KCLA 3UT4A 2GRRB 5BUZA 1G3NB 2LAIA 3QARA 5KBAA 2RFMA 1E90A 2IO3C 3FUIA 3UM2A 4EPZA 3ISMC 5EX0A 2CFUA 2XGSA 2P9IG 3DEPA 3LY7A 3UPVA 2VJ8A 4YDEA 3GZSA 3SQVA 4ACLA 3CVQA 3ASHA 3NZSA 4L2YA 1E96B 1PC2A 4UI9K 4U63A 3SFYA 3PZ1A 3EHNA 3UKRG 3CK8A 4ACKA 4DUIA 4IULA 4GTVA 2FULA 3EHQA 2OOEA 2QFCA 5DBKA 5KNGA 3ZVVA 1MX2A 5ENSD 4I6GA 3TGOA 1TNYA 2VSXE 1MX4A 1QYMA 5J08A 4DK5A 2IF4A 3U3WA 5EIDA 4J8EA 2OEWA 4JVSA 4Q94A 5D66A 1ELWA 1BLXB 4IYPA 2E2EA 3FTZA 4F1SA 1O1TA 3ULQA 3E30A 2LSVA 4FLHA 4DI3A 4CRWA 1TNZA 5M72A 3NQPA 1TNUA 3V30A 2AWIA 3TG4A 1ELKA 1IKND 4F3VA 4Y6CA 2WXNA 4GZ6A 2FEZA 3SNXA 4Q69A 3B7BA 3TWUA 1HXIA 5JJ6A 1SA4A 2V5FA 1X5BA 3C5RA 3FTYA 5IY5E 4HBDA 5BV0A 5EN5D 3RU0A 3ZEFA 5AENA 3PZ3A 2B0OE 2IONA 3OTNA 3UM1A 2P9PG 2J07A 1NFIE 1HF8A 4CGVA 3Q7FA 4AM9A 1YMPA 2I1KA 4DX2A 3URZA 2F0YA 4JA7A 5KJMA 2OCCE 4GU5A 3DEOA 4CGWA 2VSNA 3DWLG 2P9SG 2QY7A 4UUCA 5BW8C 3I4GA 1RW2A 3SD5A 2P9NG 4FJZA 3ZW3A 5G04C 3DSXA 4FC8A 3S7FA 3FFLA 2NYJA 4UI9J 3P2BA 3ZYMA 4BSXA 3C3RA 5JA4D 2KC7A 3O48A 2F8YA 1EYHA 5HQ8A 4GYWA 4FLBA 4C0MA 4RG6A 5FQ7A 2LXLA 5AJLA 4YVQC 3Q73A 5KCMA 4D10C 1HH8A 4HVBA 3CVXA 4B8CB 4NQ0A 3ABME 2OVBA 4KVMA 2XRZA 3ZHEB 1N54A 3APCA 4XE0A 4AY5A 1RZ4A 4G1TA 2XQ0A 3MGBA 1OCOE 3AG1E 4A3VA 4I9EA 3ASOE 1JCQA 1MHQA 3Q9UC 5ANRA 1IHBA 2PNNA 3QB2A 3HYMB 5EDSA 5JJTA 4JEHA 4BESA 3FY4A 3HXFA 3I5PA 4AP2A 3ESKA 4CDRA 2B6CA 3S7JA 4I1AA 1ELRA 2JEKA 2YHEA 1MX6A 3LS8A 4HB5A 4GB9A 2A4ZA 5FJYA 3VTYA 1TNOA 4J6IA 3DSWA 3JQ1A 3LJNA 4FADA 3L08A 5AAOA 3C3OA 3T5VA 3W9FA 3KSQA 4U95D 4E6HA 5LX8A 1TYQG 2H6GA 4HQDA 2RD0A 4W9RA 1E7VA 4GA0A 3PUKA 4I2ZA 4BEPA 2VSOE 1DNPA 1N4QA 1N52A 4LNGA 3APFA 1KLXA 1ZB1A
chains in the Genus database with same CATH topology
3U66A 2GRLA 4LERA 3OAWA 5E75A 4HOQA 3B13A 1UG3A 3D9IA 4C9BB 5ARFA 3CVUA 1H2VC 5ARGA 2PM6A 3Q15A 4N5CA 2VTBA 4XKBA 5EX3A 2LO6A 2J49A 3PEVB 1MQSA 4UWHA 5FZRA 4B8AA 2MHKA 3FTXA 1HG5A 3GZ2A 4GZDA 5AJDA 4OVUA 4MRUA 4MLPA 2CHWA 3IHVA 1EPUA 2VGYA 1Z3YA 1WM5A 3Q49B 2L6JA 4EZJA 2AXVA 4ABNA 3FU0A 3KEZA 4R7LA 4UQXA 1E8WA 4URKA 3R9AB 4AOFA 3RKVA 2HYZA 2PL2A 1Y8MA 3FDHA 3QWPA 4L1BA 5EKQD 3SHFA 4XIFA 1WAO1 4AVXA 2X6HA 1HFAA 3CHSA 5G2NA 3ESLA 3FUEA 2R59A 4J8FA 2IOLA 3D9PA 5FZSA 5T3RA 2AXUA 1U3DA 1H2UA 3ASDA 4AJWA 1UJJA 5D0OD 4JA9A 2WXGA 4APOA 4HORA 1P5QA 2KCVA 3FH7A 5G55A 4GMLA 5LOZA 1INZA 3JYSA 3FTWA 4CCAA 1HS6A 1JWFA 4JL0A 4RSYA 3RJVA 3IBEA 1QZ2A 3KD7A 3QKYA 4YVOA 4BFRA 2ZU6B 3L6AA 2BUGA 1E8ZA 5AIJA 2YINA 4UWFA 4P29A 4LUNU 5C1DA 4NRHB 3QOUA 4U0ZA 3ZGQA 3L13A 4DLQA 2NXPA 3RRNB 1GW6A 1NA3A 3BEEA 4BX9A 3CK9A 4U0SA 2X6JA 3QDNA 1SZAA 2WVIA 3AU4A 3FH5A 2IFUA 3MX3A 4G2VA 3GYZA 5ENNA 2Y4TA 5FT9A 3IEGA 4AIFA 5BNWA 5CCMA 3MKQB 2PM7A 3QNKA 3S7DA 3T5XA 2FF4A 3CQGB 3ZFWA 3FUKA 1L5JA 3PH0C 2WXOA 2PQRA 1OWMA 4AEZC 4DJAA 4A1GA 3FHEA 3JCKC 4ILHB 5ANLA 3ML8A 1EDUA 2NC9A 2PZIA 2Y4UA 3CHQA 4AXHA 3ZIMA 1KT1A 3MCXA 3PVLA 2WXKA 4PS7A 1TEZA 3MKQA 3LYAA 3D9JA 4KVOA 1E8YA 4I2WA 2RG8A 4I9CA 2HO1A 1OWLA 4JEUA 3PUJA 2J4DA 3HVEB 1IQRA 3S2AA 3B7UX 4KT6B 4N3BA 2X6KA 3D9KA 4FA6A 3UQ3A 2DCPA 3D9NA 4BWRA 4EBAA 1Z6TA 4EBAG 5JJ7A 4IN3B 5JHAA 3VTXA 4WNGA 3VLDA 4H7YA 4KXKB 5CMYA 4O6FA 3VLEA 3FU6A 3TAXA 3E4BA 4N3CA 4WWNA 3FUNA 3MKRA 2JLBA 4N39A 2OV8A 3I3NA 3ML9A 2Y3AA 3IV0A 2XPYA 4L2LA 2XHEA 3ONLA 4FJYA 1ZBPA 4I6EA 4ILIA 4CT4A 4GZ3A 2MOWA 2Q7FA 4TRQA 4I1MA 2XPZA 2KCLA 2XCBA 3CHPA 3FEXA 3L54A 3Q5MA 3UT4A 5BUZA 5KJKA 2UY1A 2WXRA 1W3BA 2DBAA 3G2VA 4I17A 2C0LA 3LVQE 2CG2A 2LAIA 5G05C 2WXPA 5FZQA 3CHOA 1UN9A 3QARA 4ATGA 4BT9A 1Y6IA 1E90A 1QQEA 3FUIA 1Z3XA 3HVEA 2VGXA 4EPZA 5LCWC 4EECA 5FQ6A 2KZTB 4HLEA 1FVFA 3T8MA 5EX0A 2AXZA 3RIBA 3CGHA 4WWPA 2CFUA 4GA1A 2XGSA 2WB2A 1E8XA 3SBSA 5A7DB 3LY7A 4J8SA 3FUMA 3UPVA 2VGXB 3ZPJA 4WUYA 4J8DA 1OUVA 3O4ZA 2VQ2A 2VJ8A 3IKOB 2OVFA 3APDA 3OXLA 5E76A 3GZ1A 3GZSA 4BTBA 3PRZA 4GZCA 4GMJA 4F53A 4ACLA 3CVQA 3ASHA 1BPOA 3NZSA 3C98A 3SGHA 3CVLA 1SZ9A 4ILGA 4L2YA 4ANUA 2WXJA 1E96B 4I1OB 4RG9A 1OWNA 3CVYA 3PDNA 1PC2A 3LY8A 4GZ5A 4UI9K 4OYSA 4U63A 5T4YA 2UWJG 3SI5A 2I2OA 4B94A 2XRYA 4I6JA 3CVWA 3LDZA 4GPKA 1HX8A 3DBSA 3B7TA 3EHNA 1OWOA 3D9LA 3PREA 3CK8A 4ACKA 3PNLB 1H6KA 2ILRA 3HIZA 2LAHA 2XPIA 3BG1B 3FTSA 3R7QA 3MEKA 4FHJA 4IULA 4AY6A 3CK7A 4G24A 2VSYA 5HI7A 4CEMA 3UT8A 2ONDA 2X6IA 3RO2A 4UI9C 1PAQA 3CR3A 2FULA 4PS3A 2L0TB 2KZTA 2OOEA 2QFCA 3S7BA 3PNTB 4G26A 3LVRE 5DBKA 3KS2A 2R5SA 4JW1A 4HFGA 3FU5A 1H19A 1TJFA 4KYOB 3ZVVA 1B89A 4WWOA 3CVVA 3ZYKA 4M3OA 4ANVA 3MJWA 4I6GA 3TGOA 3B7SA 5J90A 2VSXE 4EQFA 4U0UA 3MV3B 3U9WA 4N2SA 4JC8A 2WXMA 4JXTA 4H7XA 5J08A 4DK5A 3RRUA 2IF4A 4U04A 3U3WA 3TG5A 2BTDA 4J8EA 4ME2A 4KMOA 2WQ6A 2NSZA 4JVSA 3OXGA 4Q94A 3MYVA 1TJCA 1ELWA 4IYPA 2E2EA 2E0IA 4BTAA 3FTZA 1NA0A 4F1SA 3ASFA 5D0QD 3ULQA 4KZCA 4DPRA 3UT7A 5KJLA 5A23A 3CV0A 1DVPA 5G04J 2LSVA 2WM9A 2FO7A 4FLHA 4DI3A 5FTPA 4CRWA 1SQMA 4XKCA 3FUFA 4FULA 2YQ8A 5M72A 4TV3A 4XX5A 3NQPA 3CSFA 2LNIA 4IRUA 3ZRHA 3ZXSA 2AWIA 2WXIA 2M63A 1XGWA 3FTUA 4UWLA 4A3TA 3SBTB 4E85A 3TG4A 1ELKA 3SFZA 2BF0X 3UUXA 4TUUA 3HDXA 3ZHEA 3ZYQA 4F3VA 2V4LA 3MV2B 4Y6CA 2WXNA 2WXFA 1UW4B 2XGMA 4GZ6A 2FEZA 4NACA 3SNXA 3TL5A 5CCLA 4Q69A 4N2QA 3EJNA 1HXIA 2I9CA 5JJ6A 2V5FA 2V0PA 4U8HA 1X5BA 3I4RB 5C2YA 3FTYA 4CDMA 1ZU2A 4KZ0A 2J4BA 4XZ4A 4WAFA 2VTBB 1PY1A 5BV0A 3LY9A 4PDXA 1EF1C 3RU0A 2WMOA 1IHGA 5LFAA 5A6CA 3FU3A 4UWKA 4FP7A 3ZEFA 5AENA 2AVPA 4HOTA 4JZYA 2L0IA 4GYYA 2X6FA 4PS8A 2EQXA 4ANXA 2IONA 3OTNA 2XEVA 5CMWA 3SF4A 3LEWA 2A5UA 5FQ4A 3LCAA 2J07A 3AS5A 3CVPA 1LF8A 1HF8A 3RK6A 2FBNA 2GGFA 4GCNA 4APFA 2V8SE 4CGVA 1HG2A 3CVNA 3FH8A 4XI9A 4J0UA 1HU3A 2L9BA 3CHRA 3L16A 4UWGA 3BG0B 2WQHA 3AS4A 3LKUA 3PS6A 4A1SA 1UN8A 1UJKA 2I1KA 4UQZA 3FTVA 4AM9A 2GW1A 3ASGA 4GCOA 3URZA 4JA7A 3FUHA 4V3IA 5KJMA 2LSUA 3EHMA 3PE3A 3UMVA 3QAQA 4PH4B 4GU5A 1IQUA 4JHJA 2VSNA 4B89A 5BW8C 4CGWA 2QY7A 3FUDA 3Q47B 3I4GA 3L22A 4L7TA 4WNDA 3SD5A 2R17C 3QJZA 3L17A 3MZLB 4GA2A 1S0PA 4FJZA 1KT0A 1U3CA 3CHMA 3TJPA 3ZW3A 5G04C 2J08A 4L23A 4JHRA 4LEUA 4FC8A 1HO8A 2XGOA 3FUJA 4I43A 3S7FA 3G2UA 1OWPA 5BT1A 2KM4A 3FFLA 4UI9J 3P2BA 2I6HA 3TXNA 3ZYMA 2HM8A 4BSXA 4QFVA 3ENEA 2CHXA 2KC7A 2UY1B 3O48A 4LCTA 3HHMA 3ZYLA 1EYHA 5HQ8A 1HZ4A 3CSTA 2AW6A 2P58C 4GYWA 4FLBA 4C0MA 2PQNA 2IQCA 4RG6A 2YNQA 5FQ7A 5AJLA 1JWGA 4MKTA 1HE8A 4HS2A 4A55A 4YVQC 3JUIA 4UQYA 4Y6WA 2GRMA 4B0ZA 4FU3A 3FEYA 2WXLA 5KCMA 3LXUX 4BX8A 2X38A 4D10C 1HH8A 3CQCB 3KAEA 4BT8A 4HVBA 2WXQA 5KJNA 1VDYA 3CVXA 4LRZA 3G2WA 3AS8A 3LPZA 4DI4A 3NZUA 4B8CB 4NQ0A 4K0RA 3ZN3A 5BPPA 3FWVA 1NP7A 2OVBA 3CKBA 5JHBA 4KVMA 4Q96A 2XRZA 3ZHEB 1N54A 3APCA 3D3MA 4XE0A 4AY5A 2WPVA 4G1TA 3JQ0A 4G11A 2XQ0A 3MGBA 3PE4A 4JHKA 3VLFA 4CDNA 5LP0A 4K03A 4A3VA 4WNEA 1H2TC 1YA0A 2KATA 3OXFA 4RVBA 4I9EA 3TXMA 3RRMB 4GYOA 4C0EA 1FVHA 4N3AA 3B7RL 4DLOA 1MHQA 2CFZA 1NZNA 5ANRA 1E7UA 2DIWA 3WXXA 3QB2A 3QWWA 4XI0A 5G05J 4BY6A 2C0MA 3HYMB 5EDSA 4AV7A 5JJTA 4HOSA 2CG3A 5AYWD 1FCHA 3CEQA 4JEHA 1WY6A 1JUQA 2KCKA 3U4TA 2YHCA 4HOUA 3FY4A 4HXIA 4NURA 4OVVA 3PEUB 3RO3A 3I5PA 4AP2A 4F7AA 3ESKA 4CDRA 2J09A 3GW4A 3S7JA 3D9OA 3R7RA 2X3MA 5T8IA 4I1AA 3EIQC 2VYIA 1ELRA 3MA5A 5FWQA 3SZ7A 1H0AA 4FHKA 1JPLA 4PUCA 2JEKA 2YHEA 5LCWJ 3LS8A 4JPSA 3D9MA 2FI7A 3CIAA 3N71A 3LJ3A 3AU5A 4GB9A 2A4ZA 5FJYA 3VTYA 4ANWA 1IYGA 4WNFA 3ONKA 5CHEE 2IOSA 2WMNA 3DPDA 4J6IA 3JQ1A 3IHYA 3FP3A 4U07A 3QC1A 4G23A 4FADA 3L08A 4KBQA 1A17A 2MRIA 2XCCA 3G2SA 3QK0A 5FQ8A 3T5VA 4MS6A 4EZKA 1QNFA 2IJGX 2WQ7A 3U64A 2CHZA 3QWVA 2IU1A 4E6HA 5LX8A 4CT0A 3Q4AB 3FULA 3PZDA 3CKCA 5BV1A 3G2TA 3EIJA 2RD0A 3EDTB 3UX4A 4W9RA 3P1UA 1E7VA 3NF1A 4GA0A 3PUKA 3CLJA 4I2ZA 4GAAA 2HR2A 2VSOE 4YNDA 2WXHA 4EZLA 1XNFA 1DNPA 1N52A 3K9IA 4G25A 3APFA 2J9QA 5DIZA 1KLXA 2C2LA 2I1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYQ A;  4HFG A;  3D9J A;  4NAC A;  2MOW A;  1LF8 A;  4FU3 A;  1HF8 A;  1DVP A;  3D9I A;  3ZYK A;  3LDZ A;  2V8S E;  3G2S A;  4AVX A;  1HX8 A;  1HG2 A;  1VDY A;  1MHQ A;  3D9L A;  1HFA A;  3G2W A;  3G2V A;  1SZA A;  1X5B A;  1H0A A;  2DIW A;  3D9K A;  2DCP A;  3D9N A;  2LO6 A;  3D9P A;  1UJK A;  3G2U A;  4GZC A;  1JPL A;  1HG5 A;  4JXT A;  4Q96 A;  4GZD A;  3ZYM A;  1UJJ A;  1JUQ A;  1PY1 A;  5J08 A;  3G2T A;  5CMY A;  3D9M A;  3RRU A;  3ZYL A;  1SZ9 A;  1EYH A;  1XGW A;  5LOZ A;  2L0T B;  1INZ A;  2QY7 A;  1JWF A;  3CLJ A;  2L0I A;  4FLB A;  1EDU A;  1ELK A;  4Q94 A;  2BF0 X;  3ONK A;  1JWG A;  5CMW A;  5LP0 A;  3D9O A;  3ONL A;  2KM4 A; 
#chains in the Genus database with same CATH topology
 4LER A;  3OAW A;  3CVU A;  5EX3 A;  4UWH A;  2J49 A;  3PEV B;  5FZR A;  3TWS A;  1HG5 A;  1K1B A;  3GZ2 A;  5AJD A;  4MLP A;  2VGY A;  4EZJ A;  2AXV A;  4ABN A;  4R7L A;  4UQX A;  4DRX E;  5ENT D;  1E8W A;  3R9A B;  3SHF A;  4XIF A;  4U96 D;  4HRM B;  3FUE A;  2BKG A;  2IOL A;  2ZIR A;  1U3D A;  5EIL A;  4C48 B;  4APO A;  2WXG A;  4G8L A;  4GML A;  3JYS A;  1HS6 A;  3RJV A;  3KD7 A;  2ZU6 B;  4LUN U;  2AJA A;  3L13 A;  1NA3 A;  3BEE A;  4BX9 A;  3D9H A;  1SZA A;  2IFU A;  4G2V A;  3IEG A;  5BNW A;  1TN8 A;  3T5X A;  3PH0 C;  2WXO A;  3AG3 E;  3NAW A;  4TUM A;  4A1G A;  3ML8 A;  1EDU A;  2Y4U A;  4AXH A;  3UM3 A;  2H6H A;  4HRL A;  1KT1 A;  5ENP D;  3Q7A A;  2RG8 A;  3PUJ A;  3NOG D;  2LUH A;  4KT6 B;  4N3B A;  3D9K A;  4FA6 A;  3UQ3 A;  3D9N A;  4EBA G;  5JJ7 A;  5CMY A;  1SA5 A;  4N3C A;  4YDW A;  2Y3A A;  2P9U G;  4F1P A;  4L2L A;  2XHE A;  5CED B;  4CT4 A;  4GZ3 A;  2XPZ A;  3Q5M A;  4LNB A;  2WXR A;  5CBN A;  3G2V A;  3CHO A;  1UN9 A;  3SO8 A;  4ATG A;  4BT9 A;  5ENR D;  4GTO A;  1QQE A;  1N4S A;  1Z3X A;  5LCW C;  3BQO A;  3RIB A;  1FT1 A;  4TXP A;  3SBS A;  4J8S A;  1OUV A;  3OXL A;  3APD A;  3HRA A;  3F6Q A;  3E37 A;  5EYL A;  1QBQ A;  1S64 A;  3SGH A;  2WXJ A;  4RG9 A;  4I1O B;  1OWN A;  2DYR E;  4OYS A;  4GMR A;  2UWJ G;  3SI5 A;  2XRY A;  3CVW A;  1S70 B;  3D9L A;  3PRE A;  2LAH A;  2XPI A;  1UOH A;  3BG1 B;  3MEK A;  3AG4 E;  4FHJ A;  3CK7 A;  5HI7 A;  2VSY A;  3UT8 A;  3RO2 A;  5BXO A;  1DC2 A;  3BU8 A;  4G26 A;  3LVR E;  4HI8 A;  3KS2 A;  4K5B A;  1H19 A;  1DCE A;  4WWO A;  1BI8 B;  4M3O A;  4ANV A;  5J90 A;  3MV3 B;  4N2S A;  3V79 K;  1LTX A;  5JMN D;  2BTD A;  2WQ6 A;  3MYV A;  1TJC A;  2QYJ A;  2E0I A;  4BTA A;  5KJL A;  5A23 A;  5FTP A;  4OAV B;  4FUL A;  2LNI A;  3ZRH A;  3ZXS A;  2M63 A;  3FTU A;  4UWL A;  4A3T A;  3SBT B;  4E85 A;  2DZN A;  3ZYQ A;  2V4L A;  3MV2 B;  5HS0 A;  5CCL A;  4N2Q A;  2BKK B;  5BXU A;  1O5M A;  4DX7 D;  4CDM A;  2R05 A;  4WAF A;  3ABL E;  4HRN A;  3DRA A;  2WMO A;  4HOT A;  2L0I A;  2X6F A;  4PS8 A;  2XEV A;  2GRO B;  5CMW A;  3HG0 D;  3LCA A;  3AS5 A;  3CVP A;  1LF8 A;  3RK6 A;  2FBN A;  2GGF A;  2V8S E;  2XS1 A;  1HG2 A;  3FH8 A;  4GTR A;  4XI9 A;  5KNH D;  4A1S A;  2ETC A;  3LKU A;  4UQZ A;  3FTV A;  2GW1 A;  4GCO A;  3FUH A;  4V3I A;  4O1P A;  4LG6 A;  4BER A;  1IQU A;  1OCC E;  2F37 A;  3L17 A;  1KT0 A;  3B95 A;  3EU9 A;  4NIK A;  2J08 A;  4JHR A;  4K5C A;  2QZA A;  4I43 A;  1N0Q A;  2I6H A;  4QFV A;  3ENE A;  2UY1 B;  3HHM A;  3ZYL A;  4LNU D;  3CST A;  2AW6 A;  2YNQ A;  3AG2 E;  1Z5S C;  2OEV A;  2GRM A;  4JD2 G;  3KAE A;  4LRZ A;  3G2W A;  2P9K G;  2ZGD A;  3ZN3 A;  4Q96 A;  2EIJ E;  4U8Y D;  2WPV A;  3JQ0 A;  5HKP A;  4G11 A;  4A63 B;  2V4H C;  1N95 A;  4WNE A;  1H2T C;  1YA0 A;  4MBG A;  4RVB A;  1N11 A;  3RRM B;  2EIL E;  4GYO A;  4DX5 D;  1FVH A;  4DLO A;  3B7R L;  2CFZ A;  1NZN A;  3WXX A;  3W9G A;  2C0M A;  4HOS A;  2CG3 A;  3U4T A;  1FCH A;  5AYW D;  4ZHB A;  1JUQ A;  2YHC A;  4NUR A;  3RO3 A;  2J09 A;  2R02 A;  3D9O A;  5B1B E;  2X3M A;  3L82 A;  3ABK E;  4K5A B;  3TWX A;  4JPS A;  3D9M A;  3AAA C;  3C72 A;  3LJ3 A;  4HI9 A;  1IYG A;  4WNF A;  1DCQ A;  3UXG A;  4YDO A;  3E33 A;  2MRI A;  3G2S A;  3QK0 A;  4MS6 A;  1QNF A;  2VGE A;  3QWV A;  3TWQ A;  3Q4A B;  3FUL A;  3PZ4 A;  3EIJ A;  1OY3 D;  3EDT B;  3UX4 A;  1SW6 A;  3CLJ A;  4YND A;  2XEN A;  5E75 A;  4HOQ A;  3B13 A;  1UG3 A;  3D9I A;  4C9B B;  3AJI A;  3ZU7 B;  2VTB A;  2MHK A;  1OCZ E;  1K1A A;  2CHW A;  3Q49 B;  3KEZ A;  4URK A;  4GTS A;  2PL2 A;  1WAO 1;  5G2N A;  3D9P A;  2BED A;  5T3R A;  1H2U A;  4AJW A;  5ITZ F;  2IY0 C;  1P5Q A;  2KCV A;  1INZ A;  3FTW A;  4CCA A;  1YCS B;  2EIM E;  1QZ2 A;  5AIJ A;  2YIN A;  4P29 A;  4NRH B;  4U0Z A;  4DLQ A;  2H6I A;  1GW6 A;  3CK9 A;  2X6J A;  3QDN A;  3FH5 A;  2J8S D;  5CCM A;  3MX3 A;  5FT9 A;  1SVX A;  3FUK A;  1L5J A;  3DSV A;  2XEE A;  1OWM A;  2RFA A;  3FHE A;  2PZI A;  3MCX A;  4PS7 A;  2WXK A;  3LYA A;  4I2W A;  2HO1 A;  4JEU A;  2J4D A;  3UM0 A;  2KXP C;  3UI2 A;  3DPY A;  2DCP A;  4BWR A;  4IN3 B;  3VTX A;  1D8E A;  4O6F A;  3FU6 A;  4WWN A;  3MKR A;  3ONL A;  4FJY A;  1ZBP A;  4I6E A;  4RLY A;  2Q7F A;  4TRQ A;  3FEX A;  3HXD A;  4I17 A;  2C0L A;  3LVQ E;  2CG2 A;  5G05 C;  2WXP A;  5FZQ A;  2ZIS A;  4X8Q A;  3TWV A;  3X2Q E;  3HVE A;  2VGX A;  4EEC A;  5FQ6 A;  2KZT B;  4GTM A;  4YDY A;  2AXZ A;  3CGH A;  4GTT A;  3JXI A;  1H6P A;  2P9L G;  4RQI A;  3ZPJ A;  4WUY A;  2H6F A;  4J8D A;  3O4Z A;  2OVF A;  2GRN B;  1O1S A;  5E76 A;  1K3Z D;  4F53 A;  1AP7 A;  1SZ9 A;  4ILG A;  5CBO A;  3V31 A;  4ZFH A;  1FPP A;  3CVY A;  1S63 A;  3PDN A;  4GZ5 A;  2I2O A;  3LDZ A;  3DBS A;  3B7T A;  3T9K A;  3PNL B;  1H6K A;  3FTS A;  3R7Q A;  4G24 A;  4CEM A;  2X6I A;  4UI9 C;  1PAQ A;  2KZT A;  3S7B A;  3PNT B;  1WG0 A;  2R5S A;  4JW1 A;  3FU5 A;  5CEC B;  5ENO D;  4KYO B;  1B89 A;  3CVV A;  3KEA A;  3MJW A;  4B93 B;  4EQF A;  4U0U A;  3HXC A;  2WXM A;  4H7X A;  3RRU A;  4GTP A;  4KMO A;  2NSZ A;  1NA0 A;  5ENQ D;  3ASF A;  1DVP A;  5G04 J;  2FO7 A;  1SQM A;  4XKC A;  3FUF A;  2YQ8 A;  4TV3 A;  4XX5 A;  4GTQ A;  2WXI A;  1V55 E;  1XGW A;  3R9M A;  3DSU A;  3SFZ A;  2BF0 X;  3UUX A;  3HDX A;  3ZHE A;  1UW4 B;  2XGM A;  3TL5 A;  2F8X K;  3EJN A;  2I9C A;  2Y1L E;  1BU9 A;  2V0P A;  4U8H A;  1ZU2 A;  4KZ0 A;  2J4B A;  2VTB B;  3LY9 A;  5LFA A;  1IHG A;  4FP7 A;  4EHM A;  2AVP A;  4GYY A;  2KBX A;  4U7E B;  3LEW A;  4BSZ B;  5FQ4 A;  3CVN A;  5AQB A;  3UKU G;  2L9B A;  3L16 A;  5H7P A;  2WQH A;  3KSL A;  3PS6 A;  2LSU A;  3PE3 A;  3UMV A;  3EUV A;  3FUD A;  3Q47 B;  3L22 A;  4L7T A;  3ULY A;  2R17 C;  3TJP A;  1HO8 A;  1YYH A;  3G2U A;  1OWP A;  4J8Y A;  2HM8 A;  2CHX A;  4U8V D;  2P58 C;  1JWG A;  4MKT A;  4HS2 A;  4A55 A;  3JUI A;  2HE0 A;  4B0Z A;  4CYM D;  3FEY A;  3NOC D;  2X38 A;  3CQC B;  4BT8 A;  5KJN A;  2WXQ A;  3Q78 A;  2R2L A;  3AS8 A;  2EIN E;  5BPP A;  3FWV A;  1NP7 A;  3CKB A;  5JHB A;  4HLL A;  3ZNG A;  2XEH A;  3PE4 A;  5FIO A;  4CDN A;  4K03 A;  3OXF A;  3TXM A;  3TWR A;  1A5E A;  1E7U A;  4XI0 A;  5G05 J;  4BY6 A;  2XZT G;  3HXB A;  4AV7 A;  5AQ7 A;  2KCK A;  1FT2 A;  4HOU A;  4OVV A;  4F7A A;  2Y69 E;  3J5Q B;  3IXE A;  3R7R A;  3HXE A;  2P2C P;  5T8I A;  3EIQ C;  3MA5 A;  3SZ7 A;  1H0A A;  4FHK A;  4PUC A;  5LCW J;  3C3Q A;  1N94 A;  4ANW A;  5CHE E;  3ONK A;  2IOS A;  3DPD A;  3IHY A;  2DVW A;  3FP3 A;  5CRV A;  4U07 A;  3RSE G;  1A17 A;  1KPS B;  5AN8 A;  2IJG X;  2WQ7 A;  3U64 A;  2CHZ A;  2FO1 E;  2IU1 A;  3DST A;  3PZD A;  5BV1 A;  3NF1 A;  4EZL A;  2HR2 A;  4O60 A;  1XNF A;  5B1A E;  2J9Q A;  2C2L A;  2GRL A;  1H2V C;  3Q15 A;  3FTX A;  4GZD A;  2R03 A;  3E34 A;  3ZXP A;  2LXM A;  4DX6 D;  1Z3Y A;  1WM5 A;  3DXM G;  2RKK A;  4AOF A;  3RKV A;  1V54 E;  3QWP A;  2ETB A;  3ESL A;  2R59 A;  5FZS A;  1UJJ A;  5D0O D;  4HOR A;  3FH7 A;  5G55 A;  2DZO A;  1JWF A;  4JL0 A;  4RSY A;  3QKY A;  4BFR A;  4YVO A;  2BUG A;  1E8Z A;  4UWF A;  1TN7 A;  4U0S A;  2WVI A;  3AU4 A;  4AIF A;  2Y4T A;  3MKQ B;  3S7D A;  3QNK A;  3BUA A;  3ZFW A;  2PQR A;  4GPM A;  4AEZ C;  4LSZ E;  5AQA A;  3CHQ A;  2NC9 A;  3ZIM A;  2IEJ A;  3V2O A;  1X81 A;  2ETA A;  4KVO A;  1E8Y A;  1IQR A;  3B7U X;  5D2M C;  2X6K A;  4WNG A;  3VLD A;  4H7Y A;  4KXK B;  3TAX A;  4N39 A;  2OV8 A;  3I3N A;  3IV0 A;  3JXJ A;  3L9T A;  4I1M A;  5FIN A;  2XCB A;  3CHP A;  3L54 A;  5KJK A;  2UY1 A;  1H6O A;  1W3B A;  2DBA A;  5EIB E;  3JUE A;  1Y6I A;  3J5P A;  5AAR A;  3SFX A;  4HLE A;  3NBN B;  2XS8 A;  1FVF A;  1N4R A;  3T8M A;  1K8K G;  4WWP A;  4GA1 A;  4O1O A;  3UTM A;  2WB2 A;  1E8X A;  4Z68 A;  5A7D B;  3FUM A;  2VGX B;  3DSS A;  1LD7 A;  2VQ2 A;  3IKO B;  4JB8 P;  3GZ1 A;  4BTB A;  3PRZ A;  4GMJ A;  1BPO A;  3C98 A;  3CVL A;  3Q79 A;  3ULE G;  4ANU A;  2DWZ A;  1LD8 A;  1KZP A;  4J7W A;  3LY8 A;  4N5Q A;  5T4Y A;  1D8D A;  4B94 A;  4I6J A;  4GPK A;  1HX8 A;  1OWO A;  2ILR A;  3HIZ A;  4AY6 A;  2OND A;  3ZUV B;  3CR3 A;  4PS3 A;  2L0T B;  1AWC B;  1OT8 A;  2GRQ B;  4HFG A;  1TJF A;  3ZYK A;  4G8K A;  3B7S A;  3U9W A;  4JC8 A;  4JXT A;  3V2X A;  4U04 A;  3TG5 A;  4ME2 A;  3OXG A;  4QQI A;  5D0Q D;  4KZC A;  4DPR A;  3UT7 A;  4F6R D;  3CV0 A;  2WM9 A;  1O1R A;  1TR4 A;  3CSF A;  4IRU A;  3TWW A;  1D9S A;  4TUU A;  2WXF A;  4NAC A;  3E32 A;  3ASN E;  3I4R B;  5C2Y A;  1MYO A;  4XZ4 A;  4DX1 A;  2EIK E;  1PY1 A;  4PDX A;  1EF1 C;  5A6C A;  3FU3 A;  4UWK A;  4JZY A;  2EQX A;  4ANX A;  3SF4 A;  3UIN C;  2A5U A;  2L6B A;  1U2V G;  4GCN A;  4APF A;  4J0U A;  1BD8 A;  1HU3 A;  3CHR A;  4UWG A;  3BG0 B;  3AS4 A;  1JCR A;  1UJK A;  1UN8 A;  3ASG A;  3WG7 E;  3EHM A;  3QAQ A;  4PH4 B;  4JHJ A;  4B89 A;  4WND A;  3QJZ A;  3MZL B;  4GA2 A;  1S0P A;  3CHM A;  1U3C A;  2GRP B;  1WDY A;  4L23 A;  4LEU A;  2XGO A;  3FUJ A;  3T8K A;  3EHR A;  5BT1 A;  2DYS E;  3TXN A;  2QYU A;  4CZ2 D;  4LCT A;  1HZ4 A;  3Q75 A;  2PQN A;  2IQC A;  1HE8 A;  1NI1 A;  4UQY A;  4Y6W A;  5CER B;  3NB2 A;  5EYP F;  4FU3 A;  1MJ0 A;  2WXL A;  3LXU X;  4BX8 A;  1KZO A;  1VDY A;  4DI4 A;  3LPZ A;  3NZU A;  4K0R A;  1TNB A;  3D3M A;  1N0R A;  3VLF A;  4JHK A;  5AQ9 A;  3SY2 A;  5LP0 A;  2KAT A;  3UIP C;  4BET A;  1Q2Z A;  3EU5 A;  4C0E A;  4N3A A;  2DIW A;  3QWW A;  2XZD G;  1MZC A;  3CEQ A;  1WY6 A;  4HXI A;  3PEU B;  1NL4 A;  3GW4 A;  1N4P A;  4M7C A;  2VYI A;  2ZGG A;  5FWQ A;  4HNA D;  3ZKJ A;  1JPL A;  2FI7 A;  3CIA A;  3N71 A;  3AU5 A;  3PZ2 A;  2WMN A;  1JCS A;  3QC1 A;  4G23 A;  4KBQ A;  2XCC A;  5FQ8 A;  4EZK A;  3CKC A;  3G2T A;  5CEA A;  3P1U A;  4GAA A;  2WXH A;  3K9I A;  4TXQ A;  1OXJ A;  4G25 A;  5DIZ A;  4TXR A;  4GZC A;  2KM4 A;  2I1J A;  3U66 A;  1OCR E;  5ARF A;  5ARG A;  2PM6 A;  4N5C A;  4XKB A;  2LO6 A;  4B8A A;  1MQS A;  4OVU A;  4MRU A;  3IHV A;  5B3S E;  2Y0B G;  3RAU A;  1EPU A;  2L6J A;  3FU0 A;  1N9A A;  2HYZ A;  1Y8M A;  3FDH A;  4L1B A;  5EKQ D;  4ATZ D;  4AVX A;  2X6H A;  5HRY A;  1HFA A;  3CHS A;  1TN6 A;  4J8F A;  2AXU A;  3ASD A;  4OAU C;  4JA9 A;  3Q9N C;  5LOZ A;  3IBE A;  3L6A A;  5C1D A;  5CRU A;  5KWD A;  3QOU A;  3ZGQ A;  2NXP A;  3RRN B;  4XEI G;  1BI7 B;  2A5E A;  2ZXW E;  4CT0 A;  3GYZ A;  5ENN A;  2PM7 A;  2MYO A;  2FF4 A;  3CQG B;  2JAB A;  3DXK G;  4DJA A;  2V5Q C;  3JCK C;  4ILH B;  5ANL A;  1IXV A;  3PVL A;  1TEZ A;  2IO2 C;  3MKQ A;  3D9J A;  4I9C A;  1OWL A;  3HVE B;  3S2A A;  4EBA A;  1Z6T A;  5JHA A;  2QC9 A;  3VLE A;  3E4B A;  3FUN A;  2JLB A;  3ML9 A;  3TWT A;  2XPY A;  4ILI A;  3UIO C;  2MOW A;  4L9P A;  2KCL A;  3UT4 A;  2GRR B;  5BUZ A;  1G3N B;  2LAI A;  3QAR A;  5KBA A;  2RFM A;  1E90 A;  2IO3 C;  3FUI A;  3UM2 A;  4EPZ A;  3ISM C;  5EX0 A;  2CFU A;  2XGS A;  2P9I G;  3DEP A;  3LY7 A;  3UPV A;  2VJ8 A;  4YDE A;  3GZS A;  3SQV A;  4ACL A;  3CVQ A;  3ASH A;  3NZS A;  4L2Y A;  1E96 B;  1PC2 A;  4UI9 K;  4U63 A;  3SFY A;  3PZ1 A;  3EHN A;  3UKR G;  3CK8 A;  4ACK A;  4DUI A;  4IUL A;  4GTV A;  2FUL A;  3EHQ A;  2OOE A;  2QFC A;  5DBK A;  5KNG A;  3ZVV A;  1MX2 A;  5ENS D;  4I6G A;  3TGO A;  1TNY A;  2VSX E;  1MX4 A;  1QYM A;  5J08 A;  4DK5 A;  2IF4 A;  3U3W A;  5EID A;  4J8E A;  2OEW A;  4JVS A;  4Q94 A;  5D66 A;  1ELW A;  1BLX B;  4IYP A;  2E2E A;  3FTZ A;  4F1S A;  1O1T A;  3ULQ A;  3E30 A;  2LSV A;  4FLH A;  4DI3 A;  4CRW A;  1TNZ A;  5M72 A;  3NQP A;  1TNU A;  3V30 A;  2AWI A;  3TG4 A;  1ELK A;  1IKN D;  4F3V A;  4Y6C A;  2WXN A;  4GZ6 A;  2FEZ A;  3SNX A;  4Q69 A;  3B7B A;  3TWU A;  1HXI A;  5JJ6 A;  1SA4 A;  2V5F A;  1X5B A;  3C5R A;  3FTY A;  5IY5 E;  4HBD A;  5BV0 A;  5EN5 D;  3RU0 A;  3ZEF A;  5AEN A;  3PZ3 A;  2B0O E;  2ION A;  3OTN A;  3UM1 A;  2P9P G;  2J07 A;  1NFI E;  1HF8 A;  4CGV A;  3Q7F A;  4AM9 A;  1YMP A;  2I1K A;  4DX2 A;  3URZ A;  2F0Y A;  4JA7 A;  5KJM A;  2OCC E;  4GU5 A;  3DEO A;  4CGW A;  2VSN A;  3DWL G;  2P9S G;  2QY7 A;  4UUC A;  5BW8 C;  3I4G A;  1RW2 A;  3SD5 A;  2P9N G;  4FJZ A;  3ZW3 A;  5G04 C;  3DSX A;  4FC8 A;  3S7F A;  3FFL A;  2NYJ A;  4UI9 J;  3P2B A;  3ZYM A;  4BSX A;  3C3R A;  5JA4 D;  2KC7 A;  3O48 A;  2F8Y A;  1EYH A;  5HQ8 A;  4GYW A;  4FLB A;  4C0M A;  4RG6 A;  5FQ7 A;  2LXL A;  5AJL A;  4YVQ C;  3Q73 A;  5KCM A;  4D10 C;  1HH8 A;  4HVB A;  3CVX A;  4B8C B;  4NQ0 A;  3ABM E;  2OVB A;  4KVM A;  2XRZ A;  3ZHE B;  1N54 A;  3APC A;  4XE0 A;  4AY5 A;  1RZ4 A;  4G1T A;  2XQ0 A;  3MGB A;  1OCO E;  3AG1 E;  4A3V A;  4I9E A;  3ASO E;  1JCQ A;  1MHQ A;  3Q9U C;  5ANR A;  1IHB A;  2PNN A;  3QB2 A;  3HYM B;  5EDS A;  5JJT A;  4JEH A;  4BES A;  3FY4 A;  3HXF A;  3I5P A;  4AP2 A;  3ESK A;  4CDR A;  2B6C A;  3S7J A;  4I1A A;  1ELR A;  2JEK A;  2YHE A;  1MX6 A;  3LS8 A;  4HB5 A;  4GB9 A;  2A4Z A;  5FJY A;  3VTY A;  1TNO A;  4J6I A;  3DSW A;  3JQ1 A;  3LJN A;  4FAD A;  3L08 A;  5AAO A;  3C3O A;  3T5V A;  3W9F A;  3KSQ A;  4U95 D;  4E6H A;  5LX8 A;  1TYQ G;  2H6G A;  4HQD A;  2RD0 A;  4W9R A;  1E7V A;  4GA0 A;  3PUK A;  4I2Z A;  4BEP A;  2VSO E;  1DNP A;  1N4Q A;  1N52 A;  4LNG A;  3APF A;  1KLX A;  1ZB1 A; 
#chains in the Genus database with same CATH homology
 3U66 A;  2GRL A;  4LER A;  3OAW A;  5E75 A;  4HOQ A;  3B13 A;  1UG3 A;  3D9I A;  4C9B B;  5ARF A;  3CVU A;  1H2V C;  5ARG A;  2PM6 A;  3Q15 A;  4N5C A;  2VTB A;  4XKB A;  5EX3 A;  2LO6 A;  2J49 A;  3PEV B;  1MQS A;  4UWH A;  5FZR A;  4B8A A;  2MHK A;  3FTX A;  1HG5 A;  3GZ2 A;  4GZD A;  5AJD A;  4OVU A;  4MRU A;  4MLP A;  2CHW A;  3IHV A;  1EPU A;  2VGY A;  1Z3Y A;  1WM5 A;  3Q49 B;  2L6J A;  4EZJ A;  2AXV A;  4ABN A;  3FU0 A;  3KEZ A;  4R7L A;  4UQX A;  1E8W A;  4URK A;  3R9A B;  4AOF A;  3RKV A;  2HYZ A;  2PL2 A;  1Y8M A;  3FDH A;  3QWP A;  4L1B A;  5EKQ D;  3SHF A;  4XIF A;  1WAO 1;  4AVX A;  2X6H A;  1HFA A;  3CHS A;  5G2N A;  3ESL A;  3FUE A;  2R59 A;  4J8F A;  2IOL A;  3D9P A;  5FZS A;  5T3R A;  2AXU A;  1U3D A;  1H2U A;  3ASD A;  4AJW A;  1UJJ A;  5D0O D;  4JA9 A;  2WXG A;  4APO A;  4HOR A;  1P5Q A;  2KCV A;  3FH7 A;  5G55 A;  4GML A;  5LOZ A;  1INZ A;  3JYS A;  3FTW A;  4CCA A;  1HS6 A;  1JWF A;  4JL0 A;  4RSY A;  3RJV A;  3IBE A;  1QZ2 A;  3KD7 A;  3QKY A;  4YVO A;  4BFR A;  2ZU6 B;  3L6A A;  2BUG A;  1E8Z A;  5AIJ A;  2YIN A;  4UWF A;  4P29 A;  4LUN U;  5C1D A;  4NRH B;  3QOU A;  4U0Z A;  3ZGQ A;  3L13 A;  4DLQ A;  2NXP A;  3RRN B;  1GW6 A;  1NA3 A;  3BEE A;  4BX9 A;  3CK9 A;  4U0S A;  2X6J A;  3QDN A;  1SZA A;  2WVI A;  3AU4 A;  3FH5 A;  2IFU A;  3MX3 A;  4G2V A;  3GYZ A;  5ENN A;  2Y4T A;  5FT9 A;  3IEG A;  4AIF A;  5BNW A;  5CCM A;  3MKQ B;  2PM7 A;  3QNK A;  3S7D A;  3T5X A;  2FF4 A;  3CQG B;  3ZFW A;  3FUK A;  1L5J A;  3PH0 C;  2WXO A;  2PQR A;  1OWM A;  4AEZ C;  4DJA A;  4A1G A;  3FHE A;  3JCK C;  4ILH B;  5ANL A;  3ML8 A;  1EDU A;  2NC9 A;  2PZI A;  2Y4U A;  3CHQ A;  4AXH A;  3ZIM A;  1KT1 A;  3MCX A;  3PVL A;  2WXK A;  4PS7 A;  1TEZ A;  3MKQ A;  3LYA A;  3D9J A;  4KVO A;  1E8Y A;  4I2W A;  2RG8 A;  4I9C A;  2HO1 A;  1OWL A;  4JEU A;  3PUJ A;  2J4D A;  3HVE B;  1IQR A;  3S2A A;  3B7U X;  4KT6 B;  4N3B A;  2X6K A;  3D9K A;  4FA6 A;  3UQ3 A;  2DCP A;  3D9N A;  4BWR A;  4EBA A;  1Z6T A;  4EBA G;  5JJ7 A;  4IN3 B;  5JHA A;  3VTX A;  4WNG A;  3VLD A;  4H7Y A;  4KXK B;  5CMY A;  4O6F A;  3VLE A;  3FU6 A;  3TAX A;  3E4B A;  4N3C A;  4WWN A;  3FUN A;  3MKR A;  2JLB A;  4N39 A;  2OV8 A;  3I3N A;  3ML9 A;  2Y3A A;  3IV0 A;  2XPY A;  4L2L A;  2XHE A;  3ONL A;  4FJY A;  1ZBP A;  4I6E A;  4ILI A;  4CT4 A;  4GZ3 A;  2MOW A;  2Q7F A;  4TRQ A;  4I1M A;  2XPZ A;  2KCL A;  2XCB A;  3CHP A;  3FEX A;  3L54 A;  3Q5M A;  3UT4 A;  5BUZ A;  5KJK A;  2UY1 A;  2WXR A;  1W3B A;  2DBA A;  3G2V A;  4I17 A;  2C0L A;  3LVQ E;  2CG2 A;  2LAI A;  5G05 C;  2WXP A;  5FZQ A;  3CHO A;  1UN9 A;  3QAR A;  4ATG A;  4BT9 A;  1Y6I A;  1E90 A;  1QQE A;  3FUI A;  1Z3X A;  3HVE A;  2VGX A;  4EPZ A;  5LCW C;  4EEC A;  5FQ6 A;  2KZT B;  4HLE A;  1FVF A;  3T8M A;  5EX0 A;  2AXZ A;  3RIB A;  3CGH A;  4WWP A;  2CFU A;  4GA1 A;  2XGS A;  2WB2 A;  1E8X A;  3SBS A;  5A7D B;  3LY7 A;  4J8S A;  3FUM A;  3UPV A;  2VGX B;  3ZPJ A;  4WUY A;  4J8D A;  1OUV A;  3O4Z A;  2VQ2 A;  2VJ8 A;  3IKO B;  2OVF A;  3APD A;  3OXL A;  5E76 A;  3GZ1 A;  3GZS A;  4BTB A;  3PRZ A;  4GZC A;  4GMJ A;  4F53 A;  4ACL A;  3CVQ A;  3ASH A;  1BPO A;  3NZS A;  3C98 A;  3SGH A;  3CVL A;  1SZ9 A;  4ILG A;  4L2Y A;  4ANU A;  2WXJ A;  1E96 B;  4I1O B;  4RG9 A;  1OWN A;  3CVY A;  3PDN A;  1PC2 A;  3LY8 A;  4GZ5 A;  4UI9 K;  4OYS A;  4U63 A;  5T4Y A;  2UWJ G;  3SI5 A;  2I2O A;  4B94 A;  2XRY A;  4I6J A;  3CVW A;  3LDZ A;  4GPK A;  1HX8 A;  3DBS A;  3B7T A;  3EHN A;  1OWO A;  3D9L A;  3PRE A;  3CK8 A;  4ACK A;  3PNL B;  1H6K A;  2ILR A;  3HIZ A;  2LAH A;  2XPI A;  3BG1 B;  3FTS A;  3R7Q A;  3MEK A;  4FHJ A;  4IUL A;  4AY6 A;  3CK7 A;  4G24 A;  2VSY A;  5HI7 A;  4CEM A;  3UT8 A;  2OND A;  2X6I A;  3RO2 A;  4UI9 C;  1PAQ A;  3CR3 A;  2FUL A;  4PS3 A;  2L0T B;  2KZT A;  2OOE A;  2QFC A;  3S7B A;  3PNT B;  4G26 A;  3LVR E;  5DBK A;  3KS2 A;  2R5S A;  4JW1 A;  4HFG A;  3FU5 A;  1H19 A;  1TJF A;  4KYO B;  3ZVV A;  1B89 A;  4WWO A;  3CVV A;  3ZYK A;  4M3O A;  4ANV A;  3MJW A;  4I6G A;  3TGO A;  3B7S A;  5J90 A;  2VSX E;  4EQF A;  4U0U A;  3MV3 B;  3U9W A;  4N2S A;  4JC8 A;  2WXM A;  4JXT A;  4H7X A;  5J08 A;  4DK5 A;  3RRU A;  2IF4 A;  4U04 A;  3U3W A;  3TG5 A;  2BTD A;  4J8E A;  4ME2 A;  4KMO A;  2WQ6 A;  2NSZ A;  4JVS A;  3OXG A;  4Q94 A;  3MYV A;  1TJC A;  1ELW A;  4IYP A;  2E2E A;  2E0I A;  4BTA A;  3FTZ A;  1NA0 A;  4F1S A;  3ASF A;  5D0Q D;  3ULQ A;  4KZC A;  4DPR A;  3UT7 A;  5KJL A;  5A23 A;  3CV0 A;  1DVP A;  5G04 J;  2LSV A;  2WM9 A;  2FO7 A;  4FLH A;  4DI3 A;  5FTP A;  4CRW A;  1SQM A;  4XKC A;  3FUF A;  4FUL A;  2YQ8 A;  5M72 A;  4TV3 A;  4XX5 A;  3NQP A;  3CSF A;  2LNI A;  4IRU A;  3ZRH A;  3ZXS A;  2AWI A;  2WXI A;  2M63 A;  1XGW A;  3FTU A;  4UWL A;  4A3T A;  3SBT B;  4E85 A;  3TG4 A;  1ELK A;  3SFZ A;  2BF0 X;  3UUX A;  4TUU A;  3HDX A;  3ZHE A;  3ZYQ A;  4F3V A;  2V4L A;  3MV2 B;  4Y6C A;  2WXN A;  2WXF A;  1UW4 B;  2XGM A;  4GZ6 A;  2FEZ A;  4NAC A;  3SNX A;  3TL5 A;  5CCL A;  4Q69 A;  4N2Q A;  3EJN A;  1HXI A;  2I9C A;  5JJ6 A;  2V5F A;  2V0P A;  4U8H A;  1X5B A;  3I4R B;  5C2Y A;  3FTY A;  4CDM A;  1ZU2 A;  4KZ0 A;  2J4B A;  4XZ4 A;  4WAF A;  2VTB B;  1PY1 A;  5BV0 A;  3LY9 A;  4PDX A;  1EF1 C;  3RU0 A;  2WMO A;  1IHG A;  5LFA A;  5A6C A;  3FU3 A;  4UWK A;  4FP7 A;  3ZEF A;  5AEN A;  2AVP A;  4HOT A;  4JZY A;  2L0I A;  4GYY A;  2X6F A;  4PS8 A;  2EQX A;  4ANX A;  2ION A;  3OTN A;  2XEV A;  5CMW A;  3SF4 A;  3LEW A;  2A5U A;  5FQ4 A;  3LCA A;  2J07 A;  3AS5 A;  3CVP A;  1LF8 A;  1HF8 A;  3RK6 A;  2FBN A;  2GGF A;  4GCN A;  4APF A;  2V8S E;  4CGV A;  1HG2 A;  3CVN A;  3FH8 A;  4XI9 A;  4J0U A;  1HU3 A;  2L9B A;  3CHR A;  3L16 A;  4UWG A;  3BG0 B;  2WQH A;  3AS4 A;  3LKU A;  3PS6 A;  4A1S A;  1UN8 A;  1UJK A;  2I1K A;  4UQZ A;  3FTV A;  4AM9 A;  2GW1 A;  3ASG A;  4GCO A;  3URZ A;  4JA7 A;  3FUH A;  4V3I A;  5KJM A;  2LSU A;  3EHM A;  3PE3 A;  3UMV A;  3QAQ A;  4PH4 B;  4GU5 A;  1IQU A;  4JHJ A;  2VSN A;  4B89 A;  5BW8 C;  4CGW A;  2QY7 A;  3FUD A;  3Q47 B;  3I4G A;  3L22 A;  4L7T A;  4WND A;  3SD5 A;  2R17 C;  3QJZ A;  3L17 A;  3MZL B;  4GA2 A;  1S0P A;  4FJZ A;  1KT0 A;  1U3C A;  3CHM A;  3TJP A;  3ZW3 A;  5G04 C;  2J08 A;  4L23 A;  4JHR A;  4LEU A;  4FC8 A;  1HO8 A;  2XGO A;  3FUJ A;  4I43 A;  3S7F A;  3G2U A;  1OWP A;  5BT1 A;  2KM4 A;  3FFL A;  4UI9 J;  3P2B A;  2I6H A;  3TXN A;  3ZYM A;  2HM8 A;  4BSX A;  4QFV A;  3ENE A;  2CHX A;  2KC7 A;  2UY1 B;  3O48 A;  4LCT A;  3HHM A;  3ZYL A;  1EYH A;  5HQ8 A;  1HZ4 A;  3CST A;  2AW6 A;  2P58 C;  4GYW A;  4FLB A;  4C0M A;  2PQN A;  2IQC A;  4RG6 A;  2YNQ A;  5FQ7 A;  5AJL A;  1JWG A;  4MKT A;  1HE8 A;  4HS2 A;  4A55 A;  4YVQ C;  3JUI A;  4UQY A;  4Y6W A;  2GRM A;  4B0Z A;  4FU3 A;  3FEY A;  2WXL A;  5KCM A;  3LXU X;  4BX8 A;  2X38 A;  4D10 C;  1HH8 A;  3CQC B;  3KAE A;  4BT8 A;  4HVB A;  2WXQ A;  5KJN A;  1VDY A;  3CVX A;  4LRZ A;  3G2W A;  3AS8 A;  3LPZ A;  4DI4 A;  3NZU A;  4B8C B;  4NQ0 A;  4K0R A;  3ZN3 A;  5BPP A;  3FWV A;  1NP7 A;  2OVB A;  3CKB A;  5JHB A;  4KVM A;  4Q96 A;  2XRZ A;  3ZHE B;  1N54 A;  3APC A;  3D3M A;  4XE0 A;  4AY5 A;  2WPV A;  4G1T A;  3JQ0 A;  4G11 A;  2XQ0 A;  3MGB A;  3PE4 A;  4JHK A;  3VLF A;  4CDN A;  5LP0 A;  4K03 A;  4A3V A;  4WNE A;  1H2T C;  1YA0 A;  2KAT A;  3OXF A;  4RVB A;  4I9E A;  3TXM A;  3RRM B;  4GYO A;  4C0E A;  1FVH A;  4N3A A;  3B7R L;  4DLO A;  1MHQ A;  2CFZ A;  1NZN A;  5ANR A;  1E7U A;  2DIW A;  3WXX A;  3QB2 A;  3QWW A;  4XI0 A;  5G05 J;  4BY6 A;  2C0M A;  3HYM B;  5EDS A;  4AV7 A;  5JJT A;  4HOS A;  2CG3 A;  5AYW D;  1FCH A;  3CEQ A;  4JEH A;  1WY6 A;  1JUQ A;  2KCK A;  3U4T A;  2YHC A;  4HOU A;  3FY4 A;  4HXI A;  4NUR A;  4OVV A;  3PEU B;  3RO3 A;  3I5P A;  4AP2 A;  4F7A A;  3ESK A;  4CDR A;  2J09 A;  3GW4 A;  3S7J A;  3D9O A;  3R7R A;  2X3M A;  5T8I A;  4I1A A;  3EIQ C;  2VYI A;  1ELR A;  3MA5 A;  5FWQ A;  3SZ7 A;  1H0A A;  4FHK A;  1JPL A;  4PUC A;  2JEK A;  2YHE A;  5LCW J;  3LS8 A;  4JPS A;  3D9M A;  2FI7 A;  3CIA A;  3N71 A;  3LJ3 A;  3AU5 A;  4GB9 A;  2A4Z A;  5FJY A;  3VTY A;  4ANW A;  1IYG A;  4WNF A;  3ONK A;  5CHE E;  2IOS A;  2WMN A;  3DPD A;  4J6I A;  3JQ1 A;  3IHY A;  3FP3 A;  4U07 A;  3QC1 A;  4G23 A;  4FAD A;  3L08 A;  4KBQ A;  1A17 A;  2MRI A;  2XCC A;  3G2S A;  3QK0 A;  5FQ8 A;  3T5V A;  4MS6 A;  4EZK A;  1QNF A;  2IJG X;  2WQ7 A;  3U64 A;  2CHZ A;  3QWV A;  2IU1 A;  4E6H A;  5LX8 A;  4CT0 A;  3Q4A B;  3FUL A;  3PZD A;  3CKC A;  5BV1 A;  3G2T A;  3EIJ A;  2RD0 A;  3EDT B;  3UX4 A;  4W9R A;  3P1U A;  1E7V A;  3NF1 A;  4GA0 A;  3PUK A;  3CLJ A;  4I2Z A;  4GAA A;  2HR2 A;  2VSO E;  4YND A;  2WXH A;  4EZL A;  1XNF A;  1DNP A;  1N52 A;  3K9I A;  4G25 A;  3APF A;  2J9Q A;  5DIZ A;  1KLX A;  2C2L A;  2I1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...