3D9IA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
138
structure length
138
Chain Sequence
EAVKTFNSELYSLMDMKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA-binding protein 16
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9iA00
4Q94A 3ONLA 3ONKA 3D9MA 1SZAA 2KM4A 4AVXA 1UJKA 3G2TA 3G2SA 3G2WA 4NACA 3D9NA 1JWGA 3D9IA 5CMYA 1INZA 1JWFA 1MHQA 3G2VA 3D9OA 1HF8A 3D9KA 4Q96A 1UJJA 1HFAA 1X5BA 5CMWA 2L0IA 3G2UA 1HG5A 1HG2A 5J08A 1JUQA 2QY7A 2BF0X 1SZ9A 4HFGA 3ZYQA 3CLJA 1ELKA 1EYHA 5LOZA 3RRUA 2DCPA 3ZYLA 4GZCA 3ZYMA 5LP0A 1JPLA 3LDZA 2DIWA 1LF8A 3D9JA 3D9LA 3ZYKA 2L0TB 4FLBA 4JXTA 2LO6A 1EDUA 1XGWA 1PY1A 1VDYA 2V8SE 4FU3A 3D9PA 1DVPA 4GZDA 1H0AA 1HX8A 2MOWA
chains in the Genus database with same CATH superfamily
3QWPA 3ONLA 2AWIA 3DSWA 2X6JA 3FH7A 5FWQA 2WVIA 3CKCA 4ANXA 2I9CA 5J90A 1TJFA 1B89A 4HOSA 4HQDA 5BV1A 4L1BA 3S7JA 2CFUA 3JCKC 5EX3A 1N52A 3WXXA 1FT1A 2EIME 5JA4D 4B89A 4EQFA 3PRZA 3HXDA 2GGFA 3CEQA 3Q78A 3JXIA 1WY6A 4G8LA 4ANUA 4I2WA 2QYJA 4J8YA 3FUMA 3CK9A 3PZ1A 5AJDA 4PS3A 3L9TA 1SZAA 1H2TC 3G2SA 3D9IA 4OYSA 1MQSA 3VTYA 2HE0A 3JUEA 4B0ZA 4HRNA 2AXZA 3CVPA 2LAHA 2XCCA 4WNGA 4IULA 4EBAA 4GYWA 2Y0BG 4O1PA 3Q7AA 5ARGA 3U3WA 2WXQA 4XE0A 3CK7A 4L9PA 2WQ6A 4D10C 5LCWJ 5G2NA 4U0ZA 2PQNA 1E8WA 2J09A 1OXJA 3FU3A 3FUJA 4KXKB 4TRQA 4DLQA 3NOGD 2RKKA 1N4QA 1N54A 4ATZD 3TWRA 3FULA 5KJKA 2IU1A 4K0RA 4BWRA 4DRXE 5AIJA 3L22A 3OXFA 5EX0A 4PS8A 2UWJG 3UM0A 1L5JA 5BUZA 3HVEA 3APCA 4KYOB 3Q79A 1H2VC 5CRUA 4B8CB 5B1AE 3CVUA 2F8XK 4UWKA 4DX5D 2Y69E 1OWNA 4P29A 4EZKA 3FU0A 4GB9A 3EIQC 3PH0C 2PQRA 5KNGA 2L9BA 4WNEA 3SFXA 1OCOE 3OXLA 4GPKA 4DPRA 3ABLE 3LXUX 3GZ1A 1TYQG 4GTPA 2J8SD 4B8AA 3PEUB 3HIZA 3FUNA 2I1JA 2QY7A 4WUYA 4JZYA 5ENPD 3S7FA 5B3SE 3DEPA 5AARA 1DVPA 3ASNE 3IBEA 2ETBA 3P1UA 1MX4A 3ESLA 3DWLG 1H6KA 4DX6D 1BPOA 5CMWA 3QJZA 4DLOA 5AJLA 1K3ZD 4ILHB 3IHYA 3QKYA 4AVXA 2IOLA 4IYPA 3QDNA 3MGBA 3RJVA 1ZBPA 2VJ8A 4K5BA 1UOHA 1P5QA 2L0IA 1FCHA 2JLBA 2X6FA 4HNAD 3EHNA 5CCMA 1HZ4A 4BETA 2FF4A 2YINA 4GYOA 3B7TA 4UI9C 1G3NB 3ZHEA 5LX8A 3LY9A 4JHJA 1YMPA 3CVLA 2VGYA 3FTXA 1OCCE 3FUKA 5D0OD 4JL0A 2LAIA 4HS2A 3CSFA 4A3TA 5DIZA 3V2OA 3BEEA 2V5QC 4FA6A 1V55E 1H2UA 5ENOD 3ASDA 2R17C 1HO8A 4TXPA 3EHQA 1FVFA 4UI9K 4G1TA 5KJNA 2GRPB 4I1OB 3CVYA 3KEAA 5JHAA 4JPSA 3E4BA 4GTTA 4GCNA 3JUIA 2DCPA 2KZTA 4GTOA 5C2YA 2LSVA 3IEGA 1XGWA 3PE4A 4UWGA 4ILIA 4U0UA 4AY6A 3J5PA 5G05C 1X5BA 3PZDA 3ZYMA 2EINE 3ZIMA 2J49A 4GAAA 3SHFA 4WNDA 4HB5A 3FTWA 5FTPA 1N9AA 3WG7E 3ONKA 2WXPA 4BESA 2KM4A 5A23A 4CT0A 3V2XA 3S7BA 3SD5A 3TG4A 4H7YA 1S63A 1K8KG 3EJNA 3RRUA 1PAQA 2DIWA 3SGHA 2IFUA 4A63B 4QFVA 4LG6A 2A5UA 4JB8P 4OAUC 4RQIA 3CQCB 3DSXA 4BT8A 4MRUA 2F8YA 2FULA 3DPYA 3KD7A 4W9RA 5T4YA 2WXFA 1ELKA 5LOZA 3MV2B 4PDXA 4UWHA 2KZTB 4XZ4A 5CBNA 5EYLA 3VLFA 1IYGA 3NZSA 4C0MA 2IONA 4GTVA 2V4HC 4TUMA 4ACLA 4XI0A 4OVVA 3ZYLA 5AENA 4JC8A 1SA4A 3Q9UC 2RFAA 1HE8A 3APFA 3J5QB 5EIDA 2J4BA 3HXEA 2IJGX 3LY8A 4YVQC 3T8KA 4XI9A 5FINA 4HLLA 5M72A 1LD7A 2DZOA 1TNZA 1YCSB 3K9IA 5E75A 3ZYQA 4F3VA 5HQ8A 4J8EA 5AQ9A 1QZ2A 5BNWA 4YDEA 4JEUA 3D9PA 4GMRA 3SF4A 2MOWA 4H7XA 4N3CA 4G2VA 2CHWA 4AV7A 3B7SA 3R9MA 5AYWD 2XGSA 2NSZA 5ENNA 4FC8A 1OCRE 3PDNA 3T5XA 4JVSA 2VQ2A 5KJLA 2P58C 1BU9A 1TR4A 5LFAA 3OTNA 2IO3C 3FEXA 3HG0D 3IV0A 2E0IA 4JA9A 3AG3E 5BXOA 2XRZA 2Y1LE 4F1PA 4N39A 4MKTA 3B95A 2J4DA 1LD8A 4UWLA 2WXMA 3FP3A 5ARFA 5JJTA 4U96D 4GZDA 2UY1A 3DEOA 1O1TA 4UQYA 1XNFA 2GW1A 4IRUA 1JWFA 5CMYA 5D2MC 2KATA 3S7DA 2MRIA 2IF4A 2FEZA 3FTUA 5T3RA 5FIOA 3U64A 4HVBA 1IKND 2GRLA 4CDMA 4TV3A 3EHRA 3RKVA 4N3BA 4RLYA 1K1AA 3SY2A 3QOUA 4GTSA 3I4RB 4YDWA 3CSTA 4EHMA 1HG2A 3UI2A 2WXNA 3TWUA 1OT8A 3NB2A 3FH5A 2ZISA 3L16A 3EDTB 3CHMA 3FTSA 3B7UX 4G11A 3EIJA 2DWZA 4GMJA 3O48A 4X8QA 5A6CA 3TGOA 3RSEG 4YDOA 1QYMA 2VSOE 1OWPA 3RU0A 2LXMA 4K03A 3ZRHA 2XZDG 3ASGA 2IY0C 2FO7A 3UMVA 3IKOB 1TEZA 3MKQB 1JUQA 3ZNGA 3I4GA 4F7AA 4O60A 4N2QA 2VYIA 5CECB 3ZUVB 1QNFA 5KWDA 2XS1A 3APDA 2V8SE 3URZA 4DJAA 3BU8A 3PREA 2CFZA 1Y8MA 3TG5A 1E8XA 5CRVA 1N94A 4MLPA 3TWTA 4N2SA 3G2UA 1O1RA 5A7DB 3SI5A 3ASOE 3V30A 1W3BA 5AAOA 4G8KA 3X2QE 2P9IG 3QARA 3CHSA 4I1AA 1TN6A 1OY3D 3EU5A 3CR3A 3PNTB 4CZ2D 2VSXE 1TN8A 3Q7FA 4CRWA 2CHZA 5BXUA 1WAO1 3AU5A 5G04C 1TNOA 4A1SA 4B93B 2XZTG 5ENQD 3FU6A 3R9AB 4LNBA 2OV8A 2GRRB 1KT1A 3RRMB 4B94A 3DSVA 3L54A 4BT9A 2P9NG 4AM9A 4KZCA 4RG6A 4GTMA 4E85A 3QWVA 2MYOA 2XGMA 4GTRA 3D9HA 3ZEFA 5HKPA 4IN3B 4CCAA 5FZSA 2ONDA 2LUHA 5AQAA 3DSUA 3CHQA 4Y6CA 2X3MA 3FUDA 4WNFA 1DCEA 5EYPF 2J08A 1OCZE 1NA0A 3B13A 4XEIG 1EF1C 3NQPA 2H6HA 3ESKA 4FJYA 3DPDA 3G2VA 2CG3A 3D9KA 4RVBA 3HXBA 4HOUA 4JHRA 4EBAG 1YA0A 3CHRA 5C1DA 1FPPA 3ENEA 3Q4AB 3UXGA 3PZ2A 3L82A 1HX8A 4Q94A 2WM9A 3UT4A 4HOQA 3QC1A 5LCWC 1NFIE 3UM1A 2CHXA 1V54E 4PS7A 1DC2A 3ISMC 3S2AA 1IQUA 2LXLA 2XPZA 2AXUA 4TXQA 5BW8C 5CEAA 5CERB 4KT6B 4DK5A 5FZQA 3NBNB 4TUUA 3HVEB 1E8YA 3DBSA 1UJKA 3DSTA 3AS5A 1MYOA 3ZPJA 4I43A 3UINC 2YHCA 4I6JA 4CGVA 4LNGA 4ZHBA 1SVXA 1MJ0A 1JCSA 4DUIA 4F1SA 3FY4A 3QAQA 5T8IA 1Y6IA 1E8ZA 3V31A 3L17A 4Q69A 2EIKE 2IEJA 3UKRG 3U66A 5G05J 2XPYA 3ZGQA 4I6EA 5HI7A 5KNHD 4QQIA 1QQEA 2VGEA 3UT7A 5ANLA 4UQXA 4NIKA 1AP7A 2PZIA 1OWLA 4RSYA 4UUCA 1D8DA 1Z3YA 3OXGA 2VGXA 3PEVB 2I1KA 2RD0A 3KEZA 4BY6A 4I2ZA 3TWQA 1WDYA 1OWMA 3V79K 2BTDA 3CKBA 5H7PA 2OOEA 3D9LA 3ZYKA 1PC2A 2XEHA 3SNXA 3FTYA 3ML9A 3AAAC 4Z68A 3NAWA 3C3OA 2L6JA 3CK8A 4LRZA 5J08A 5FJYA 4I6GA 1HXIA 4PUCA 1OWOA 3SFYA 2ZGGA 4XKBA 4V3IA 1U3DA 1UG3A 4FU3A 1JCRA 2OEVA 3P2BA 2PM7A 3CIAA 4AOFA 4U8YD 3TXMA 1N0RA 4U63A 2KCVA 4C9BB 3UQ3A 4JA7A 5BPPA 2R02A 3ZHEB 5ENSD 2C0MA 4U8HA 3W9FA 3LVQE 3Q73A 1Z6TA 3AU4A 3HHMA 4HLEA 4JW1A 3QB2A 4YNDA 3TJPA 4CT4A 2WXIA 3UUXA 3VLDA 4U8VD 4APOA 1EDUA 3GW4A 1PY1A 2JEKA 5CEDB 2BKGA 1SW6A 3C72A 1N95A 3D9OA 1QBQA 5FZRA 4U0SA 4U04A 5CHEE 4GA1A 2V0PA 1LF8A 2GROB 2C2LA 4U95D 3TXNA 3AG2E 2VTBA 1UN9A 3CVQA 4TXRA 1E90A 4L7TA 3UIPC 3VLEA 2WXRA 4WWPA 4G25A 4GZCA 4I1MA 1JPLA 1KLXA 3E37A 4A55A 1IHBA 3AG1E 1BD8A 3LPZA 3PE3A 4GU5A 5DBKA 2Y4UA 4WWOA 4KMOA 4BTBA 1DNPA 1TNBA 3FEYA 3L13A 4GZ3A 3BG0B 4F6RD 2R59A 4G23A 1N4RA 4JHKA 3HYMB 3QNKA 4WWNA 4GZ5A 4DX2A 3SQVA 3GZSA 2HYZA 5JJ7A 3PUKA 2ZIRA 4LERA 5FQ8A 4CDNA 3HXFA 1ZB1A 4URKA 3LYAA 3TWWA 3KAEA 3AS4A 2I6HA 1O5MA 4KVOA 5D66A 4BERA 4LUNU 3BQOA 1HS6A 2DBAA 2PL2A 2H6FA 2QZAA 2L6BA 1HU3A 2XS8A 1NZNA 1MHQA 1Z3XA 4O1OA 3PVLA 3FTZA 1UW4B 1K1BA 4BEPA 4BFRA 2ZU6B 5CCLA 1U3CA 3F6QA 3MEKA 3MV3B 3W9GA 2J07A 4WAFA 4GA2A 2KXPC 4ILGA 4CEMA 3KS2A 1SZ9A 3I3NA 3SBSA 4FHJA 1NI1A 2MHKA 3DSSA 3TWSA 4XKCA 4L23A 3JYSA 2P9UG 3ML8A 3R7RA 4KBQA 2OVFA 4KZ0A 3Q47B 2X6HA 2YHEA 2E2EA 2GRMA 4HORA 4N3AA 5FQ4A 3QK0A 5FT9A 2LSUA 4XIFA 4BSXA 4GTQA 3FH8A 1TJCA 5HS0A 4NRHB 4DX1A 3L6AA 1RZ4A 2EQXA 2NYJA 2KCLA 5G04J 3UIOC 5ENTD 3AG4E 3PZ4A 1IQRA 1A5EA 5CBOA 1H0AA 3RRNB 4BX8A 5EKQD 3ZN3A 3QWWA 4BTAA 2UY1B 3EU9A 1INZA 3RO3A 3LY7A 4GZ6A 3AS8A 2WPVA 2R2LA 3B7RL 1EPUA 5JJ6A 4LCTA 4GA0A 3CVXA 4LSZE 3FWVA 1VDYA 3T9KA 3MYVA 3BUAA 3FU5A 1E7UA 2X6IA 4NACA 2WMOA 2HM8A 3MCXA 4MS6A 5EILA 4LEUA 3E33A 2DZNA 3RO2A 4J8FA 1WG0A 5KCMA 3HDXA 2X6KA 4ATGA 1HH8A 2B0OE 1JWGA 1S64A 3MX3A 4L2YA 3IXEA 1EYHA 3SBTB 4LNUD 3LJ3A 3ULEG 3LDZA 4K5AB 3JXJA 4ANVA 2QC9A 1H19A 2R5SA 3NZUA 1GW6A 4JEHA 3NF1A 3RIBA 2WXJA 1N4PA 4C48B 4GPMA 1RW2A 1TNYA 4HI9A 3ZW3A 1HF8A 3LCAA 2Q7FA 2H6GA 2LNIA 4YDYA 5ENRD 2BUGA 1KPSB 5EIBE 1FT2A 4AY5A 3HRAA 1TNUA 4XX5A 1WM5A 2AXVA 4GCOA 2Y4TA 2EILE 1BI8B 2XPIA 1UJJA 3AJIA 4I17A 3JQ0A 3RK6A 4FJZA 4JXTA 5AQBA 4ABNA 2YQ8A 2ETAA 4YVOA 2QYUA 1KZOA 1D9SA 4UI9J 4UWFA 4JD2G 5BV0A 5ANRA 2HO1A 4O6FA 3ASHA 4MBGA 3Q75A 3UT8A 1S70B 3U4TA 2CG2A 3FUIA 3EUVA 1TN7A 3D9MA 5G55A 3DRAA 1S0PA 2R03A 2PNNA 1HG5A 2IQCA 4C0EA 4EPZA 1DCQA 4M3OA 4I9EA 3C5RA 3FUFA 3LVRE 2QFCA 3GZ2A 3KSLA 5ITZF 1FVHA 4J6IA 1KZPA 2ETCA 4FHKA 3DXMG 3Q9NC 3UKUG 3ULYA 2AW6A 3BG1B 2KBXA 5JMND 4E6HA 1IXVA 3PUJA 1MZCA 1Z5SC 2XEVA 4Y6WA 1U2VG 5D0QD 4N5CA 4AP2A 3CHPA 3T5VA 4CDRA 1MX2A 3ZXPA 4BX9A 3Q49B 4FULA 2C0LA 1A17A 3TWXA 3UM3A 2WXLA 3O4ZA 3DXKG 3D3MA 4GMLA 3CHOA 3CVNA 2FBNA 4M7CA 3EHMA 4U07A 3PZ3A 3TL5A 2ILRA 2LO6A 4HRLA 3E32A 3ULQA 3U9WA 3LKUA 2P9KG 3TAXA 3CVVA 4AJWA 4AEZC 3CQGB 5E76A 2KC7A 4OAVB 4NURA 4PH4B 4ZFHA 1JCQA 2F0YA 2XHEA 2AJAA 1NL4A 2BF0X 2WQ7A 3G2TA 3SO8A 1OUVA 4HXIA 3D9NA 4HRMB 3TWVA 1LTXA 3MZLB 2A4ZA 5IY5E 3SZ7A 3C98A 3PNLB 3ABME 2WB2A 4NQ0A 3GYZA 5B1BE 3FDHA 4F53A 4DI3A 4A1GA 1N0QA 2XGOA 2WMNA 3SFZA 4R7LA 1X81A 4G26A 1H6PA 2XQ0A 4HFGA 4ACKA 2EIJE 3B7BA 2VSNA 4K5CA 4BSZB 4J7WA 2IOSA 2WXKA 2JABA 1UN8A 2PM6A 2VGXB 5EN5D 3MA5A 2A5EA 3Q15A 1NP7A 2Y3AA 4J8DA 5AQ7A 3UTMA 2HR2A 3OAWA 5BT1A 4ANWA 2OCCE 1E96B 2KCKA 3ZVVA 3FUHA 4AIFA 2XEEA 5FQ7A 2P9LG 5JHBA 1AWCB 5KJMA 3ABKE 2P2CP 2XRYA 2J9QA 3PS6A 3R7QA 5LP0A 3C3RA 3ASFA 2P9PG 2WXGA 3ZKJA 2VSYA 4CYMD 2XCBA 4ME2A 2P9SG 2X38A 3LEWA 1KT0A 1NA3A 4GYYA 3FFLA 2FI7A 2NXPA 4CGWA 1O1SA 3C3QA 3CV0A 1ZU2A 3FUEA 1Q2ZA 4J0UA 5FQ6A 4KVMA 3L08A 4EZLA 3E34A 3N71A 4AXHA 4RG9A 3LS8A 2L0TB 2BKKB 2R05A 3UPVA 2DVWA 3CVWA 5KBAA 2NC9A 2GRNB 1HFAA 3FHEA 4DI4A 2DYRE 3CLJA 2DYSE 2FO1E 4U7EB 4A3VA 3LJNA 1SQMA 2IO2C 2V4LA 4UQZA 1N4SA 4L2LA 2RFMA 3NOCD 2F37A 2M63A 2OEWA 3ZFWA 1MX6A 2ZXWE 4Q96A 3CGHA 2GRQB 4J8SA 1SA5A 1E7VA 1D8EA 2AVPA 5EDSA 5HRYA 2VTBB 2WQHA 3JQ1A 3KSQA 4HBDA 2V5FA 4FADA 4EZJA 3MKRA 3D9JA 3VTXA 2BEDA 3UX4A 4FP7A 4I9CA 1YYHA 1H6OA 3HXCA 4N5QA 1BLXB 3I5PA 2I2OA 2RG8A 3Q5MA 3UM2A 4HI8A 2WXHA 3IHVA 3ZXSA 5AN8A 2OVBA 4EECA 3T8MA 4OVUA 3MKQA 3G2WA 4HOTA 1ELRA 2XENA 2WXOA 3FTVA 4FLHA 4APFA 2B6CA 1BI7B 4G24A 2H6IA 4DX7D 1ELWA 3RAUA 3ZU7B 3E30A 4FLBA 1N11A 2YNQA 2ZGDA 3MJWA 1IHGA
chains in the Genus database with same CATH topology
3QWPA 3PEVB 3VLFA 3ONLA 1IYGA 4GCOA 2Y4TA 2AWIA 2I1KA 2RD0A 3NZSA 3KEZA 4C0MA 2X6JA 3FH7A 2IONA 5FWQA 2WVIA 4BY6A 4I2ZA 4ACLA 2XPIA 3CKCA 1UJJA 4XI0A 1OWMA 4OVVA 4I17A 4ANXA 2BTDA 3JQ0A 3RK6A 3ZYLA 4FJZA 2I9CA 3CKBA 2OOEA 5AENA 5J90A 3D9LA 4JC8A 3ZYKA 1PC2A 1TJFA 4JXTA 3SNXA 1B89A 4ABNA 2YQ8A 4HOSA 3FTYA 4YVOA 1HE8A 3APFA 3ML9A 5BV1A 4L1BA 2J4BA 2IJGX 3LY8A 4YVQC 4UI9J 2L6JA 4XI9A 4UWFA 3S7JA 2CFUA 3JCKC 3CK8A 5M72A 5BV0A 4LRZA 5ANRA 5J08A 2HO1A 5EX3A 3K9IA 5E75A 3ZYQA 1N52A 4O6FA 3ASHA 4I6GA 5FJYA 1HXIA 4PUCA 3WXXA 4F3VA 5HQ8A 4J8EA 1OWOA 1QZ2A 5BNWA 3UT8A 4XKBA 4B89A 4EQFA 3PRZA 4V3IA 4JEUA 3U4TA 2CG2A 1U3DA 1UG3A 3D9PA 3FUIA 4FU3A 3SF4A 2MOWA 4H7XA 4N3CA 4G2VA 2CHWA 3D9MA 5G55A 3B7SA 4AV7A 5AYWD 2GGFA 3P2BA 2PM7A 3CIAA 2XGSA 2NSZA 3CEQA 5ENNA 4FC8A 1WY6A 4AOFA 1S0PA 3PDNA 3TXMA 3T5XA 4JVSA 4U63A 2VQ2A 5KJLA 2KCVA 2P58C 1HG5A 4C9BB 2IQCA 3UQ3A 4ANUA 4C0EA 4JA7A 4I2WA 5BPPA 4EPZA 4M3OA 5LFAA 3ZHEB 3FUMA 4I9EA 3OTNA 3FUFA 3LVRE 2QFCA 3GZ2A 3CK9A 2C0MA 3FEXA 3IV0A 4JA9A 2E0IA 1FVHA 4J6IA 4U8HA 5AJDA 4PS3A 1SZAA 3LVQE 1H2TC 2XRZA 4FHKA 3G2SA 1Z6TA 4N39A 3AU4A 2AW6A 3BG1B 3HHMA 3D9IA 4OYSA 1MQSA 4HLEA 4JW1A 4MKTA 3VTYA 4B0ZA 3QB2A 2J4DA 2AXZA 4YNDA 3CVPA 4UWLA 2LAHA 4E6HA 3TJPA 2XCCA 3PUJA 4WNGA 4IULA 2XEVA 4CT4A 4Y6WA 2WXMA 4GYWA 4EBAA 2WXIA 5D0QD 4N5CA 3UUXA 4AP2A 3VLDA 3FP3A 4APOA 5ARGA 5ARFA 5JJTA 3U3WA 1EDUA 2WXQA 3CHPA 1PY1A 3GW4A 3T5VA 2JEKA 4CDRA 4GZDA 2UY1A 4XE0A 4UQYA 4BX9A 3Q49B 3CK7A 4FULA 2C0LA 2WQ6A 1A17A 4D10C 5LCWJ 5G2NA 4U0ZA 1XNFA 2WXLA 2PQNA 1E8WA 2GW1A 1JWFA 4IRUA 2J09A 5CMYA 3D9OA 3O4ZA 2KATA 3S7DA 2MRIA 2IF4A 5FZRA 3D3MA 3FU3A 2FEZA 3FTUA 4GMLA 4U0SA 5T3RA 3CHOA 3FUJA 4U04A 4KXKB 5CHEE 4TRQA 3U64A 4HVBA 3CVNA 2FBNA 4DLQA 4GA1A 2V0PA 2GRLA 3EHMA 1LF8A 4U07A 3TL5A 1N54A 2C2LA 4CDMA 3TXNA 2ILRA 2LO6A 4TV3A 2VTBA 3RKVA 3FULA 4N3BA 1UN9A 3ULQA 3U9WA 3LKUA 5KJKA 3CVQA 3QOUA 3TAXA 3CVVA 4AJWA 3I4RB 2IU1A 4AEZC 3CQGB 4K0RA 5E76A 4BWRA 1E90A 2KC7A 5AIJA 3CSTA 4NURA 4PH4B 4L7TA 3VLEA 2WXRA 3L22A 4WWPA 3OXFA 1HG2A 4G25A 5EX0A 2WXNA 4PS8A 2UWJG 4GZCA 4I1MA 1L5JA 5BUZA 1JPLA 1KLXA 2XHEA 3FH5A 3HVEA 3APCA 4KYOB 3L16A 3EDTB 4A55A 1H2VC 3CHMA 4B8CB 3CVUA 3FTSA 2BF0X 4UWKA 3LPZA 1OWNA 3B7UX 4P29A 4EZKA 3PE3A 4GU5A 3FU0A 4G11A 5DBKA 3EIJA 2WQ7A 3G2TA 1OUVA 2Y4UA 3O48A 4GMJA 4GB9A 4KMOA 4WWOA 4BTBA 1DNPA 4HXIA 3D9NA 3FEYA 3L13A 4GZ3A 5A6CA 3TGOA 3BG0B 3EIQC 3PH0C 2PQRA 2L9BA 4WNEA 2VSOE 3MZLB 2R59A 4G23A 2A4ZA 1OWPA 4JHKA 3OXLA 3HYMB 3SZ7A 3QNKA 4GPKA 4DPRA 3C98A 3LXUX 4WWNA 3RU0A 3PNLB 4K03A 2WB2A 4GZ5A 3GZ1A 3ZRHA 4NQ0A 3GYZA 3GZSA 3ASGA 2HYZA 4B8AA 3FDHA 3PEUB 5JJ7A 4F53A 3PUKA 4DI3A 2FO7A 4A1GA 2XGOA 3HIZA 4LERA 5FQ8A 4CDNA 3UMVA 3IKOB 3FUNA 1TEZA 4URKA 3MKQB 2WMNA 3SFZA 2I1JA 3LYAA 1JUQA 2QY7A 3KAEA 2XQ0A 4G26A 4R7LA 4HFGA 4JZYA 3I4GA 4WUYA 4F7AA 4ACKA 4N2QA 3AS4A 2I6HA 2VYIA 4KVOA 4LUNU 1QNFA 3S7FA 2VSNA 3APDA 2V8SE 3URZA 4DJAA 1DVPA 3IBEA 1HS6A 2IOSA 2DBAA 2PL2A 2WXKA 1UN8A 3P1UA 2PM6A 2VGXB 3PREA 2CFZA 1Y8MA 3TG5A 3ESLA 3MA5A 1E8XA 3Q15A 1HU3A 1NP7A 1H6KA 1NZNA 1MHQA 1BPOA 4MLPA 1Z3XA 5CMWA 3QJZA 4N2SA 3G2UA 4DLOA 3PVLA 3FTZA 1UW4B 5AJLA 5A7DB 3SI5A 2Y3AA 1W3BA 4ILHB 3IHYA 4J8DA 2HR2A 3QKYA 4BFRA 3OAWA 4AVXA 2ZU6B 5BT1A 5CCLA 1U3CA 4ANWA 2IOLA 4IYPA 3QDNA 3MEKA 1E96B 3MV3B 2KCKA 3QARA 3CHSA 4I1AA 3ZVVA 3FUHA 4AIFA 3MGBA 3RJVA 3CR3A 2J07A 1ZBPA 3PNTB 4WAFA 5FQ7A 2VSXE 2VJ8A 4CRWA 5JHBA 4GA2A 1P5QA 2L0IA 1FCHA 4ILGA 4CEMA 5KJMA 3KS2A 2XRYA 1SZ9A 2JLBA 3I3NA 2CHZA 2J9QA 2X6FA 1WAO1 3AU5A 3PS6A 5G04C 3R7QA 3SBSA 5LP0A 4A1SA 4FHJA 2MHKA 3ASFA 3EHNA 5CCMA 3FU6A 4XKCA 1HZ4A 2WXGA 3R9AB 4L23A 3JYSA 2FF4A 3ML8A 3R7RA 2VSYA 2YINA 4GYOA 4KBQA 2XCBA 2OVFA 2OV8A 4ME2A 3B7TA 2X38A 3LEWA 4KZ0A 3Q47B 2X6HA 1KT0A 4UI9C 1KT1A 1NA3A 2YHEA 4GYYA 3RRMB 3FFLA 4B94A 2FI7A 2NXPA 4CGWA 3L54A 4BT9A 3CV0A 1ZU2A 2E2EA 2GRMA 4AM9A 3FUEA 4KZCA 4RG6A 3ZHEA 4J0UA 5FQ6A 4KVMA 3L08A 4N3AA 4E85A 4EZLA 5FQ4A 5LX8A 4HORA 3LY9A 3N71A 4JHJA 3CVLA 4AXHA 2VGYA 3FTXA 3QK0A 3LS8A 2L0TB 2XGMA 3FUKA 3QWVA 4RG9A 4JL0A 5D0OD 3UPVA 2LAIA 5FT9A 2LSUA 3ZEFA 4XIFA 4HS2A 4IN3B 4BSXA 3CSFA 4A3TA 5DIZA 4CCAA 3CVWA 3FH8A 5FZSA 2ONDA 1TJCA 3BEEA 4FA6A 2NC9A 3CHQA 1H2UA 4NRHB 3ASDA 1HFAA 4Y6CA 2X3MA 3FHEA 2R17C 4DI4A 3L6AA 3FUDA 4WNFA 3CLJA 2EQXA 1HO8A 2KCLA 5G04J 2J08A 4A3VA 1NA0A 1FVFA 1IQRA 1SQMA 3B13A 4UI9K 4G1TA 5KJNA 1EF1C 2V4LA 4UQZA 3NQPA 1H0AA 3RRNB 4L2LA 4I1OB 4BX8A 5EKQD 3ZN3A 3QWWA 3ESKA 4BTAA 4FJYA 2UY1B 2M63A 3CVYA 3DPDA 5JHAA 3ZFWA 4JPSA 1INZA 3RO3A 3G2VA 2CG3A 3LY7A 3D9KA 4Q96A 4GZ6A 4RVBA 3AS8A 3E4BA 4HOUA 4GCNA 2WPVA 4JHRA 3JUIA 3CGHA 2DCPA 4J8SA 4EBAG 3B7RL 1E7VA 1YA0A 1EPUA 2AVPA 2KZTA 3CHRA 5JJ6A 5C2YA 5C1DA 4LCTA 4GA0A 3CVXA 2LSVA 3IEGA 3FWVA 1XGWA 5EDSA 1VDYA 3PE4A 4UWGA 3ENEA 3Q4AB 3MYVA 1HX8A 4Q94A 3FU5A 2WM9A 3UT4A 2VTBB 4ILIA 1E7UA 3QC1A 4HOQA 4U0UA 5LCWC 4AY6A 2CHXA 2X6IA 4PS7A 4NACA 2WMOA 2HM8A 2WQHA 3MCXA 3JQ1A 5G05C 3S2AA 1IQUA 4MS6A 1X5BA 3PZDA 2V5FA 2XPZA 4LEUA 2AXUA 3ZYMA 5BW8C 4FADA 3RO2A 4EZJA 4J8FA 3ZIMA 3MKRA 2J49A 3D9JA 3VTXA 4GAAA 3SHFA 5KCMA 4KT6B 4WNDA 3HDXA 3UX4A 4FP7A 3FTWA 5FTPA 4DK5A 5FZQA 2X6KA 4TUUA 3HVEB 4I9CA 3ONKA 1E8YA 2WXPA 3DBSA 2KM4A 4ATGA 1HH8A 1UJKA 5A23A 4CT0A 3AS5A 1JWGA 3ZPJA 4I43A 3S7BA 3SD5A 2YHCA 3MX3A 4L2YA 4I6JA 3TG4A 3I5PA 4CGVA 2I2OA 2RG8A 4H7YA 1EYHA 3EJNA 3RRUA 3SBTB 3Q5MA 3LJ3A 1PAQA 3LDZA 2DIWA 3SGHA 2IFUA 2WXHA 4F1SA 4ANVA 3FY4A 3IHVA 4QFVA 3ZXSA 3QAQA 5T8IA 2A5UA 1H19A 2OVBA 2R5SA 4EECA 3T8MA 1Y6IA 3NZUA 4OVUA 1E8ZA 1GW6A 3L17A 3NF1A 4JEHA 3RIBA 3MKQA 4Q69A 2WXJA 3G2WA 3CQCB 4HOTA 1ELRA 2WXOA 4BT8A 4MRUA 3FTVA 3U66A 2FULA 4FLHA 3KD7A 5G05J 2XPYA 3ZW3A 1HF8A 4APFA 3ZGQA 3LCAA 2Q7FA 4I6EA 5HI7A 2LNIA 4W9RA 1QQEA 5T4YA 4G24A 2BUGA 3UT7A 5ANLA 2WXFA 1ELKA 4UQXA 5LOZA 1ELWA 3MV2B 4PDXA 4UWHA 2PZIA 4AY5A 1OWLA 4RSYA 2KZTB 4FLBA 1Z3YA 4XZ4A 2YNQA 4XX5A 1WM5A 2AXVA 3MJWA 3OXGA 1IHGA 2VGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q94 A;  3ONL A;  3ONK A;  3D9M A;  1SZA A;  2KM4 A;  4AVX A;  1UJK A;  3G2T A;  3G2S A;  3G2W A;  4NAC A;  3D9N A;  1JWG A;  3D9I A;  5CMY A;  1INZ A;  1JWF A;  1MHQ A;  3G2V A;  3D9O A;  1HF8 A;  3D9K A;  4Q96 A;  1UJJ A;  1HFA A;  1X5B A;  5CMW A;  2L0I A;  3G2U A;  1HG5 A;  1HG2 A;  5J08 A;  1JUQ A;  2QY7 A;  2BF0 X;  1SZ9 A;  4HFG A;  3ZYQ A;  3CLJ A;  1ELK A;  1EYH A;  5LOZ A;  3RRU A;  2DCP A;  3ZYL A;  4GZC A;  3ZYM A;  5LP0 A;  1JPL A;  3LDZ A;  2DIW A;  1LF8 A;  3D9J A;  3D9L A;  3ZYK A;  2L0T B;  4FLB A;  4JXT A;  2LO6 A;  1EDU A;  1XGW A;  1PY1 A;  1VDY A;  2V8S E;  4FU3 A;  3D9P A;  1DVP A;  4GZD A;  1H0A A;  1HX8 A;  2MOW A; 
#chains in the Genus database with same CATH topology
 3QWP A;  3ONL A;  2AWI A;  3DSW A;  2X6J A;  3FH7 A;  5FWQ A;  2WVI A;  3CKC A;  4ANX A;  2I9C A;  5J90 A;  1TJF A;  1B89 A;  4HOS A;  4HQD A;  5BV1 A;  4L1B A;  3S7J A;  2CFU A;  3JCK C;  5EX3 A;  1N52 A;  3WXX A;  1FT1 A;  2EIM E;  5JA4 D;  4B89 A;  4EQF A;  3PRZ A;  3HXD A;  2GGF A;  3CEQ A;  3Q78 A;  3JXI A;  1WY6 A;  4G8L A;  4ANU A;  4I2W A;  2QYJ A;  4J8Y A;  3FUM A;  3CK9 A;  3PZ1 A;  5AJD A;  4PS3 A;  3L9T A;  1SZA A;  1H2T C;  3G2S A;  3D9I A;  4OYS A;  1MQS A;  3VTY A;  2HE0 A;  3JUE A;  4B0Z A;  4HRN A;  2AXZ A;  3CVP A;  2LAH A;  2XCC A;  4WNG A;  4IUL A;  4EBA A;  4GYW A;  2Y0B G;  4O1P A;  3Q7A A;  5ARG A;  3U3W A;  2WXQ A;  4XE0 A;  3CK7 A;  4L9P A;  2WQ6 A;  4D10 C;  5LCW J;  5G2N A;  4U0Z A;  2PQN A;  1E8W A;  2J09 A;  1OXJ A;  3FU3 A;  3FUJ A;  4KXK B;  4TRQ A;  4DLQ A;  3NOG D;  2RKK A;  1N4Q A;  1N54 A;  4ATZ D;  3TWR A;  3FUL A;  5KJK A;  2IU1 A;  4K0R A;  4BWR A;  4DRX E;  5AIJ A;  3L22 A;  3OXF A;  5EX0 A;  4PS8 A;  2UWJ G;  3UM0 A;  1L5J A;  5BUZ A;  3HVE A;  3APC A;  4KYO B;  3Q79 A;  1H2V C;  5CRU A;  4B8C B;  5B1A E;  3CVU A;  2F8X K;  4UWK A;  4DX5 D;  2Y69 E;  1OWN A;  4P29 A;  4EZK A;  3FU0 A;  4GB9 A;  3EIQ C;  3PH0 C;  2PQR A;  5KNG A;  2L9B A;  4WNE A;  3SFX A;  1OCO E;  3OXL A;  4GPK A;  4DPR A;  3ABL E;  3LXU X;  3GZ1 A;  1TYQ G;  4GTP A;  2J8S D;  4B8A A;  3PEU B;  3HIZ A;  3FUN A;  2I1J A;  2QY7 A;  4WUY A;  4JZY A;  5ENP D;  3S7F A;  5B3S E;  3DEP A;  5AAR A;  1DVP A;  3ASN E;  3IBE A;  2ETB A;  3P1U A;  1MX4 A;  3ESL A;  3DWL G;  1H6K A;  4DX6 D;  1BPO A;  5CMW A;  3QJZ A;  4DLO A;  5AJL A;  1K3Z D;  4ILH B;  3IHY A;  3QKY A;  4AVX A;  2IOL A;  4IYP A;  3QDN A;  3MGB A;  3RJV A;  1ZBP A;  2VJ8 A;  4K5B A;  1UOH A;  1P5Q A;  2L0I A;  1FCH A;  2JLB A;  2X6F A;  4HNA D;  3EHN A;  5CCM A;  1HZ4 A;  4BET A;  2FF4 A;  2YIN A;  4GYO A;  3B7T A;  4UI9 C;  1G3N B;  3ZHE A;  5LX8 A;  3LY9 A;  4JHJ A;  1YMP A;  3CVL A;  2VGY A;  3FTX A;  1OCC E;  3FUK A;  5D0O D;  4JL0 A;  2LAI A;  4HS2 A;  3CSF A;  4A3T A;  5DIZ A;  3V2O A;  3BEE A;  2V5Q C;  4FA6 A;  1V55 E;  1H2U A;  5ENO D;  3ASD A;  2R17 C;  1HO8 A;  4TXP A;  3EHQ A;  1FVF A;  4UI9 K;  4G1T A;  5KJN A;  2GRP B;  4I1O B;  3CVY A;  3KEA A;  5JHA A;  4JPS A;  3E4B A;  4GTT A;  4GCN A;  3JUI A;  2DCP A;  2KZT A;  4GTO A;  5C2Y A;  2LSV A;  3IEG A;  1XGW A;  3PE4 A;  4UWG A;  4ILI A;  4U0U A;  4AY6 A;  3J5P A;  5G05 C;  1X5B A;  3PZD A;  3ZYM A;  2EIN E;  3ZIM A;  2J49 A;  4GAA A;  3SHF A;  4WND A;  4HB5 A;  3FTW A;  5FTP A;  1N9A A;  3WG7 E;  3ONK A;  2WXP A;  4BES A;  2KM4 A;  5A23 A;  4CT0 A;  3V2X A;  3S7B A;  3SD5 A;  3TG4 A;  4H7Y A;  1S63 A;  1K8K G;  3EJN A;  3RRU A;  1PAQ A;  2DIW A;  3SGH A;  2IFU A;  4A63 B;  4QFV A;  4LG6 A;  2A5U A;  4JB8 P;  4OAU C;  4RQI A;  3CQC B;  3DSX A;  4BT8 A;  4MRU A;  2F8Y A;  2FUL A;  3DPY A;  3KD7 A;  4W9R A;  5T4Y A;  2WXF A;  1ELK A;  5LOZ A;  3MV2 B;  4PDX A;  4UWH A;  2KZT B;  4XZ4 A;  5CBN A;  5EYL A;  3VLF A;  1IYG A;  3NZS A;  4C0M A;  2ION A;  4GTV A;  2V4H C;  4TUM A;  4ACL A;  4XI0 A;  4OVV A;  3ZYL A;  5AEN A;  4JC8 A;  1SA4 A;  3Q9U C;  2RFA A;  1HE8 A;  3APF A;  3J5Q B;  5EID A;  2J4B A;  3HXE A;  2IJG X;  3LY8 A;  4YVQ C;  3T8K A;  4XI9 A;  5FIN A;  4HLL A;  5M72 A;  1LD7 A;  2DZO A;  1TNZ A;  1YCS B;  3K9I A;  5E75 A;  3ZYQ A;  4F3V A;  5HQ8 A;  4J8E A;  5AQ9 A;  1QZ2 A;  5BNW A;  4YDE A;  4JEU A;  3D9P A;  4GMR A;  3SF4 A;  2MOW A;  4H7X A;  4N3C A;  4G2V A;  2CHW A;  4AV7 A;  3B7S A;  3R9M A;  5AYW D;  2XGS A;  2NSZ A;  5ENN A;  4FC8 A;  1OCR E;  3PDN A;  3T5X A;  4JVS A;  2VQ2 A;  5KJL A;  2P58 C;  1BU9 A;  1TR4 A;  5LFA A;  3OTN A;  2IO3 C;  3FEX A;  3HG0 D;  3IV0 A;  2E0I A;  4JA9 A;  3AG3 E;  5BXO A;  2XRZ A;  2Y1L E;  4F1P A;  4N39 A;  4MKT A;  3B95 A;  2J4D A;  1LD8 A;  4UWL A;  2WXM A;  3FP3 A;  5ARF A;  5JJT A;  4U96 D;  4GZD A;  2UY1 A;  3DEO A;  1O1T A;  4UQY A;  1XNF A;  2GW1 A;  4IRU A;  1JWF A;  5CMY A;  5D2M C;  2KAT A;  3S7D A;  2MRI A;  2IF4 A;  2FEZ A;  3FTU A;  5T3R A;  5FIO A;  3U64 A;  4HVB A;  1IKN D;  2GRL A;  4CDM A;  4TV3 A;  3EHR A;  3RKV A;  4N3B A;  4RLY A;  1K1A A;  3SY2 A;  3QOU A;  4GTS A;  3I4R B;  4YDW A;  3CST A;  4EHM A;  1HG2 A;  3UI2 A;  2WXN A;  3TWU A;  1OT8 A;  3NB2 A;  3FH5 A;  2ZIS A;  3L16 A;  3EDT B;  3CHM A;  3FTS A;  3B7U X;  4G11 A;  3EIJ A;  2DWZ A;  4GMJ A;  3O48 A;  4X8Q A;  5A6C A;  3TGO A;  3RSE G;  4YDO A;  1QYM A;  2VSO E;  1OWP A;  3RU0 A;  2LXM A;  4K03 A;  3ZRH A;  2XZD G;  3ASG A;  2IY0 C;  2FO7 A;  3UMV A;  3IKO B;  1TEZ A;  3MKQ B;  1JUQ A;  3ZNG A;  3I4G A;  4F7A A;  4O60 A;  4N2Q A;  2VYI A;  5CEC B;  3ZUV B;  1QNF A;  5KWD A;  2XS1 A;  3APD A;  2V8S E;  3URZ A;  4DJA A;  3BU8 A;  3PRE A;  2CFZ A;  1Y8M A;  3TG5 A;  1E8X A;  5CRV A;  1N94 A;  4MLP A;  3TWT A;  4N2S A;  3G2U A;  1O1R A;  5A7D B;  3SI5 A;  3ASO E;  3V30 A;  1W3B A;  5AAO A;  4G8K A;  3X2Q E;  2P9I G;  3QAR A;  3CHS A;  4I1A A;  1TN6 A;  1OY3 D;  3EU5 A;  3CR3 A;  3PNT B;  4CZ2 D;  2VSX E;  1TN8 A;  3Q7F A;  4CRW A;  2CHZ A;  5BXU A;  1WAO 1;  3AU5 A;  5G04 C;  1TNO A;  4A1S A;  4B93 B;  2XZT G;  5ENQ D;  3FU6 A;  3R9A B;  4LNB A;  2OV8 A;  2GRR B;  1KT1 A;  3RRM B;  4B94 A;  3DSV A;  3L54 A;  4BT9 A;  2P9N G;  4AM9 A;  4KZC A;  4RG6 A;  4GTM A;  4E85 A;  3QWV A;  2MYO A;  2XGM A;  4GTR A;  3D9H A;  3ZEF A;  5HKP A;  4IN3 B;  4CCA A;  5FZS A;  2OND A;  2LUH A;  5AQA A;  3DSU A;  3CHQ A;  4Y6C A;  2X3M A;  3FUD A;  4WNF A;  1DCE A;  5EYP F;  2J08 A;  1OCZ E;  1NA0 A;  3B13 A;  4XEI G;  1EF1 C;  3NQP A;  2H6H A;  3ESK A;  4FJY A;  3DPD A;  3G2V A;  2CG3 A;  3D9K A;  4RVB A;  3HXB A;  4HOU A;  4JHR A;  4EBA G;  1YA0 A;  3CHR A;  5C1D A;  1FPP A;  3ENE A;  3Q4A B;  3UXG A;  3PZ2 A;  3L82 A;  1HX8 A;  4Q94 A;  2WM9 A;  3UT4 A;  4HOQ A;  3QC1 A;  5LCW C;  1NFI E;  3UM1 A;  2CHX A;  1V54 E;  4PS7 A;  1DC2 A;  3ISM C;  3S2A A;  1IQU A;  2LXL A;  2XPZ A;  2AXU A;  4TXQ A;  5BW8 C;  5CEA A;  5CER B;  4KT6 B;  4DK5 A;  5FZQ A;  3NBN B;  4TUU A;  3HVE B;  1E8Y A;  3DBS A;  1UJK A;  3DST A;  3AS5 A;  1MYO A;  3ZPJ A;  4I43 A;  3UIN C;  2YHC A;  4I6J A;  4CGV A;  4LNG A;  4ZHB A;  1SVX A;  1MJ0 A;  1JCS A;  4DUI A;  4F1S A;  3FY4 A;  3QAQ A;  5T8I A;  1Y6I A;  1E8Z A;  3V31 A;  3L17 A;  4Q69 A;  2EIK E;  2IEJ A;  3UKR G;  3U66 A;  5G05 J;  2XPY A;  3ZGQ A;  4I6E A;  5HI7 A;  5KNH D;  4QQI A;  1QQE A;  2VGE A;  3UT7 A;  5ANL A;  4UQX A;  4NIK A;  1AP7 A;  2PZI A;  1OWL A;  4RSY A;  4UUC A;  1D8D A;  1Z3Y A;  3OXG A;  2VGX A;  3PEV B;  2I1K A;  2RD0 A;  3KEZ A;  4BY6 A;  4I2Z A;  3TWQ A;  1WDY A;  1OWM A;  3V79 K;  2BTD A;  3CKB A;  5H7P A;  2OOE A;  3D9L A;  3ZYK A;  1PC2 A;  2XEH A;  3SNX A;  3FTY A;  3ML9 A;  3AAA C;  4Z68 A;  3NAW A;  3C3O A;  2L6J A;  3CK8 A;  4LRZ A;  5J08 A;  5FJY A;  4I6G A;  1HXI A;  4PUC A;  1OWO A;  3SFY A;  2ZGG A;  4XKB A;  4V3I A;  1U3D A;  1UG3 A;  4FU3 A;  1JCR A;  2OEV A;  3P2B A;  2PM7 A;  3CIA A;  4AOF A;  4U8Y D;  3TXM A;  1N0R A;  4U63 A;  2KCV A;  4C9B B;  3UQ3 A;  4JA7 A;  5BPP A;  2R02 A;  3ZHE B;  5ENS D;  2C0M A;  4U8H A;  3W9F A;  3LVQ E;  3Q73 A;  1Z6T A;  3AU4 A;  3HHM A;  4HLE A;  4JW1 A;  3QB2 A;  4YND A;  3TJP A;  4CT4 A;  2WXI A;  3UUX A;  3VLD A;  4U8V D;  4APO A;  1EDU A;  3GW4 A;  1PY1 A;  2JEK A;  5CED B;  2BKG A;  1SW6 A;  3C72 A;  1N95 A;  3D9O A;  1QBQ A;  5FZR A;  4U0S A;  4U04 A;  5CHE E;  4GA1 A;  2V0P A;  1LF8 A;  2GRO B;  2C2L A;  4U95 D;  3TXN A;  3AG2 E;  2VTB A;  1UN9 A;  3CVQ A;  4TXR A;  1E90 A;  4L7T A;  3UIP C;  3VLE A;  2WXR A;  4WWP A;  4G25 A;  4GZC A;  4I1M A;  1JPL A;  1KLX A;  3E37 A;  4A55 A;  1IHB A;  3AG1 E;  1BD8 A;  3LPZ A;  3PE3 A;  4GU5 A;  5DBK A;  2Y4U A;  4WWO A;  4KMO A;  4BTB A;  1DNP A;  1TNB A;  3FEY A;  3L13 A;  4GZ3 A;  3BG0 B;  4F6R D;  2R59 A;  4G23 A;  1N4R A;  4JHK A;  3HYM B;  3QNK A;  4WWN A;  4GZ5 A;  4DX2 A;  3SQV A;  3GZS A;  2HYZ A;  5JJ7 A;  3PUK A;  2ZIR A;  4LER A;  5FQ8 A;  4CDN A;  3HXF A;  1ZB1 A;  4URK A;  3LYA A;  3TWW A;  3KAE A;  3AS4 A;  2I6H A;  1O5M A;  4KVO A;  5D66 A;  4BER A;  4LUN U;  3BQO A;  1HS6 A;  2DBA A;  2PL2 A;  2H6F A;  2QZA A;  2L6B A;  1HU3 A;  2XS8 A;  1NZN A;  1MHQ A;  1Z3X A;  4O1O A;  3PVL A;  3FTZ A;  1UW4 B;  1K1B A;  4BEP A;  4BFR A;  2ZU6 B;  5CCL A;  1U3C A;  3F6Q A;  3MEK A;  3MV3 B;  3W9G A;  2J07 A;  4WAF A;  4GA2 A;  2KXP C;  4ILG A;  4CEM A;  3KS2 A;  1SZ9 A;  3I3N A;  3SBS A;  4FHJ A;  1NI1 A;  2MHK A;  3DSS A;  3TWS A;  4XKC A;  4L23 A;  3JYS A;  2P9U G;  3ML8 A;  3R7R A;  4KBQ A;  2OVF A;  4KZ0 A;  3Q47 B;  2X6H A;  2YHE A;  2E2E A;  2GRM A;  4HOR A;  4N3A A;  5FQ4 A;  3QK0 A;  5FT9 A;  2LSU A;  4XIF A;  4BSX A;  4GTQ A;  3FH8 A;  1TJC A;  5HS0 A;  4NRH B;  4DX1 A;  3L6A A;  1RZ4 A;  2EQX A;  2NYJ A;  2KCL A;  5G04 J;  3UIO C;  5ENT D;  3AG4 E;  3PZ4 A;  1IQR A;  1A5E A;  5CBO A;  1H0A A;  3RRN B;  4BX8 A;  5EKQ D;  3ZN3 A;  3QWW A;  4BTA A;  2UY1 B;  3EU9 A;  1INZ A;  3RO3 A;  3LY7 A;  4GZ6 A;  3AS8 A;  2WPV A;  2R2L A;  3B7R L;  1EPU A;  5JJ6 A;  4LCT A;  4GA0 A;  3CVX A;  4LSZ E;  3FWV A;  1VDY A;  3T9K A;  3MYV A;  3BUA A;  3FU5 A;  1E7U A;  2X6I A;  4NAC A;  2WMO A;  2HM8 A;  3MCX A;  4MS6 A;  5EIL A;  4LEU A;  3E33 A;  2DZN A;  3RO2 A;  4J8F A;  1WG0 A;  5KCM A;  3HDX A;  2X6K A;  4ATG A;  1HH8 A;  2B0O E;  1JWG A;  1S64 A;  3MX3 A;  4L2Y A;  3IXE A;  1EYH A;  3SBT B;  4LNU D;  3LJ3 A;  3ULE G;  3LDZ A;  4K5A B;  3JXJ A;  4ANV A;  2QC9 A;  1H19 A;  2R5S A;  3NZU A;  1GW6 A;  4JEH A;  3NF1 A;  3RIB A;  2WXJ A;  1N4P A;  4C48 B;  4GPM A;  1RW2 A;  1TNY A;  4HI9 A;  3ZW3 A;  1HF8 A;  3LCA A;  2Q7F A;  2H6G A;  2LNI A;  4YDY A;  5ENR D;  2BUG A;  1KPS B;  5EIB E;  1FT2 A;  4AY5 A;  3HRA A;  1TNU A;  4XX5 A;  1WM5 A;  2AXV A;  4GCO A;  2Y4T A;  2EIL E;  1BI8 B;  2XPI A;  1UJJ A;  3AJI A;  4I17 A;  3JQ0 A;  3RK6 A;  4FJZ A;  4JXT A;  5AQB A;  4ABN A;  2YQ8 A;  2ETA A;  4YVO A;  2QYU A;  1KZO A;  1D9S A;  4UI9 J;  4UWF A;  4JD2 G;  5BV0 A;  5ANR A;  2HO1 A;  4O6F A;  3ASH A;  4MBG A;  3Q75 A;  3UT8 A;  1S70 B;  3U4T A;  2CG2 A;  3FUI A;  3EUV A;  1TN7 A;  3D9M A;  5G55 A;  3DRA A;  1S0P A;  2R03 A;  2PNN A;  1HG5 A;  2IQC A;  4C0E A;  4EPZ A;  1DCQ A;  4M3O A;  4I9E A;  3C5R A;  3FUF A;  3LVR E;  2QFC A;  3GZ2 A;  3KSL A;  5ITZ F;  1FVH A;  4J6I A;  1KZP A;  2ETC A;  4FHK A;  3DXM G;  3Q9N C;  3UKU G;  3ULY A;  2AW6 A;  3BG1 B;  2KBX A;  5JMN D;  4E6H A;  1IXV A;  3PUJ A;  1MZC A;  1Z5S C;  2XEV A;  4Y6W A;  1U2V G;  5D0Q D;  4N5C A;  4AP2 A;  3CHP A;  3T5V A;  4CDR A;  1MX2 A;  3ZXP A;  4BX9 A;  3Q49 B;  4FUL A;  2C0L A;  1A17 A;  3TWX A;  3UM3 A;  2WXL A;  3O4Z A;  3DXK G;  3D3M A;  4GML A;  3CHO A;  3CVN A;  2FBN A;  4M7C A;  3EHM A;  4U07 A;  3PZ3 A;  3TL5 A;  2ILR A;  2LO6 A;  4HRL A;  3E32 A;  3ULQ A;  3U9W A;  3LKU A;  2P9K G;  3TAX A;  3CVV A;  4AJW A;  4AEZ C;  3CQG B;  5E76 A;  2KC7 A;  4OAV B;  4NUR A;  4PH4 B;  4ZFH A;  1JCQ A;  2F0Y A;  2XHE A;  2AJA A;  1NL4 A;  2BF0 X;  2WQ7 A;  3G2T A;  3SO8 A;  1OUV A;  4HXI A;  3D9N A;  4HRM B;  3TWV A;  1LTX A;  3MZL B;  2A4Z A;  5IY5 E;  3SZ7 A;  3C98 A;  3PNL B;  3ABM E;  2WB2 A;  4NQ0 A;  3GYZ A;  5B1B E;  3FDH A;  4F53 A;  4DI3 A;  4A1G A;  1N0Q A;  2XGO A;  2WMN A;  3SFZ A;  4R7L A;  1X81 A;  4G26 A;  1H6P A;  2XQ0 A;  4HFG A;  4ACK A;  2EIJ E;  3B7B A;  2VSN A;  4K5C A;  4BSZ B;  4J7W A;  2IOS A;  2WXK A;  2JAB A;  1UN8 A;  2PM6 A;  2VGX B;  5EN5 D;  3MA5 A;  2A5E A;  3Q15 A;  1NP7 A;  2Y3A A;  4J8D A;  5AQ7 A;  3UTM A;  2HR2 A;  3OAW A;  5BT1 A;  4ANW A;  2OCC E;  1E96 B;  2KCK A;  3ZVV A;  3FUH A;  4AIF A;  2XEE A;  5FQ7 A;  2P9L G;  5JHB A;  1AWC B;  5KJM A;  3ABK E;  2P2C P;  2XRY A;  2J9Q A;  3PS6 A;  3R7Q A;  5LP0 A;  3C3R A;  3ASF A;  2P9P G;  2WXG A;  3ZKJ A;  2VSY A;  4CYM D;  2XCB A;  4ME2 A;  2P9S G;  2X38 A;  3LEW A;  1KT0 A;  1NA3 A;  4GYY A;  3FFL A;  2FI7 A;  2NXP A;  4CGW A;  1O1S A;  3C3Q A;  3CV0 A;  1ZU2 A;  3FUE A;  1Q2Z A;  4J0U A;  5FQ6 A;  4KVM A;  3L08 A;  4EZL A;  3E34 A;  3N71 A;  4AXH A;  4RG9 A;  3LS8 A;  2L0T B;  2BKK B;  2R05 A;  3UPV A;  2DVW A;  3CVW A;  5KBA A;  2NC9 A;  2GRN B;  1HFA A;  3FHE A;  4DI4 A;  2DYR E;  3CLJ A;  2DYS E;  2FO1 E;  4U7E B;  4A3V A;  3LJN A;  1SQM A;  2IO2 C;  2V4L A;  4UQZ A;  1N4S A;  4L2L A;  2RFM A;  3NOC D;  2F37 A;  2M63 A;  2OEW A;  3ZFW A;  1MX6 A;  2ZXW E;  4Q96 A;  3CGH A;  2GRQ B;  4J8S A;  1SA5 A;  1E7V A;  1D8E A;  2AVP A;  5EDS A;  5HRY A;  2VTB B;  2WQH A;  3JQ1 A;  3KSQ A;  4HBD A;  2V5F A;  4FAD A;  4EZJ A;  3MKR A;  3D9J A;  3VTX A;  2BED A;  3UX4 A;  4FP7 A;  4I9C A;  1YYH A;  1H6O A;  3HXC A;  4N5Q A;  1BLX B;  3I5P A;  2I2O A;  2RG8 A;  3Q5M A;  3UM2 A;  4HI8 A;  2WXH A;  3IHV A;  3ZXS A;  5AN8 A;  2OVB A;  4EEC A;  3T8M A;  4OVU A;  3MKQ A;  3G2W A;  4HOT A;  1ELR A;  2XEN A;  2WXO A;  3FTV A;  4FLH A;  4APF A;  2B6C A;  1BI7 B;  4G24 A;  2H6I A;  4DX7 D;  1ELW A;  3RAU A;  3ZU7 B;  3E30 A;  4FLB A;  1N11 A;  2YNQ A;  2ZGD A;  3MJW A;  1IHG A; 
#chains in the Genus database with same CATH homology
 3QWP A;  3PEV B;  3VLF A;  3ONL A;  1IYG A;  4GCO A;  2Y4T A;  2AWI A;  2I1K A;  2RD0 A;  3NZS A;  3KEZ A;  4C0M A;  2X6J A;  3FH7 A;  2ION A;  5FWQ A;  2WVI A;  4BY6 A;  4I2Z A;  4ACL A;  2XPI A;  3CKC A;  1UJJ A;  4XI0 A;  1OWM A;  4OVV A;  4I17 A;  4ANX A;  2BTD A;  3JQ0 A;  3RK6 A;  3ZYL A;  4FJZ A;  2I9C A;  3CKB A;  2OOE A;  5AEN A;  5J90 A;  3D9L A;  4JC8 A;  3ZYK A;  1PC2 A;  1TJF A;  4JXT A;  3SNX A;  1B89 A;  4ABN A;  2YQ8 A;  4HOS A;  3FTY A;  4YVO A;  1HE8 A;  3APF A;  3ML9 A;  5BV1 A;  4L1B A;  2J4B A;  2IJG X;  3LY8 A;  4YVQ C;  4UI9 J;  2L6J A;  4XI9 A;  4UWF A;  3S7J A;  2CFU A;  3JCK C;  3CK8 A;  5M72 A;  5BV0 A;  4LRZ A;  5ANR A;  5J08 A;  2HO1 A;  5EX3 A;  3K9I A;  5E75 A;  3ZYQ A;  1N52 A;  4O6F A;  3ASH A;  4I6G A;  5FJY A;  1HXI A;  4PUC A;  3WXX A;  4F3V A;  5HQ8 A;  4J8E A;  1OWO A;  1QZ2 A;  5BNW A;  3UT8 A;  4XKB A;  4B89 A;  4EQF A;  3PRZ A;  4V3I A;  4JEU A;  3U4T A;  2CG2 A;  1U3D A;  1UG3 A;  3D9P A;  3FUI A;  4FU3 A;  3SF4 A;  2MOW A;  4H7X A;  4N3C A;  4G2V A;  2CHW A;  3D9M A;  5G55 A;  3B7S A;  4AV7 A;  5AYW D;  2GGF A;  3P2B A;  2PM7 A;  3CIA A;  2XGS A;  2NSZ A;  3CEQ A;  5ENN A;  4FC8 A;  1WY6 A;  4AOF A;  1S0P A;  3PDN A;  3TXM A;  3T5X A;  4JVS A;  4U63 A;  2VQ2 A;  5KJL A;  2KCV A;  2P58 C;  1HG5 A;  4C9B B;  2IQC A;  3UQ3 A;  4ANU A;  4C0E A;  4JA7 A;  4I2W A;  5BPP A;  4EPZ A;  4M3O A;  5LFA A;  3ZHE B;  3FUM A;  4I9E A;  3OTN A;  3FUF A;  3LVR E;  2QFC A;  3GZ2 A;  3CK9 A;  2C0M A;  3FEX A;  3IV0 A;  4JA9 A;  2E0I A;  1FVH A;  4J6I A;  4U8H A;  5AJD A;  4PS3 A;  1SZA A;  3LVQ E;  1H2T C;  2XRZ A;  4FHK A;  3G2S A;  1Z6T A;  4N39 A;  3AU4 A;  2AW6 A;  3BG1 B;  3HHM A;  3D9I A;  4OYS A;  1MQS A;  4HLE A;  4JW1 A;  4MKT A;  3VTY A;  4B0Z A;  3QB2 A;  2J4D A;  2AXZ A;  4YND A;  3CVP A;  4UWL A;  2LAH A;  4E6H A;  3TJP A;  2XCC A;  3PUJ A;  4WNG A;  4IUL A;  2XEV A;  4CT4 A;  4Y6W A;  2WXM A;  4GYW A;  4EBA A;  2WXI A;  5D0Q D;  4N5C A;  3UUX A;  4AP2 A;  3VLD A;  3FP3 A;  4APO A;  5ARG A;  5ARF A;  5JJT A;  3U3W A;  1EDU A;  2WXQ A;  3CHP A;  1PY1 A;  3GW4 A;  3T5V A;  2JEK A;  4CDR A;  4GZD A;  2UY1 A;  4XE0 A;  4UQY A;  4BX9 A;  3Q49 B;  3CK7 A;  4FUL A;  2C0L A;  2WQ6 A;  1A17 A;  4D10 C;  5LCW J;  5G2N A;  4U0Z A;  1XNF A;  2WXL A;  2PQN A;  1E8W A;  2GW1 A;  1JWF A;  4IRU A;  2J09 A;  5CMY A;  3D9O A;  3O4Z A;  2KAT A;  3S7D A;  2MRI A;  2IF4 A;  5FZR A;  3D3M A;  3FU3 A;  2FEZ A;  3FTU A;  4GML A;  4U0S A;  5T3R A;  3CHO A;  3FUJ A;  4U04 A;  4KXK B;  5CHE E;  4TRQ A;  3U64 A;  4HVB A;  3CVN A;  2FBN A;  4DLQ A;  4GA1 A;  2V0P A;  2GRL A;  3EHM A;  1LF8 A;  4U07 A;  3TL5 A;  1N54 A;  2C2L A;  4CDM A;  3TXN A;  2ILR A;  2LO6 A;  4TV3 A;  2VTB A;  3RKV A;  3FUL A;  4N3B A;  1UN9 A;  3ULQ A;  3U9W A;  3LKU A;  5KJK A;  3CVQ A;  3QOU A;  3TAX A;  3CVV A;  4AJW A;  3I4R B;  2IU1 A;  4AEZ C;  3CQG B;  4K0R A;  5E76 A;  4BWR A;  1E90 A;  2KC7 A;  5AIJ A;  3CST A;  4NUR A;  4PH4 B;  4L7T A;  3VLE A;  2WXR A;  3L22 A;  4WWP A;  3OXF A;  1HG2 A;  4G25 A;  5EX0 A;  2WXN A;  4PS8 A;  2UWJ G;  4GZC A;  4I1M A;  1L5J A;  5BUZ A;  1JPL A;  1KLX A;  2XHE A;  3FH5 A;  3HVE A;  3APC A;  4KYO B;  3L16 A;  3EDT B;  4A55 A;  1H2V C;  3CHM A;  4B8C B;  3CVU A;  3FTS A;  2BF0 X;  4UWK A;  3LPZ A;  1OWN A;  3B7U X;  4P29 A;  4EZK A;  3PE3 A;  4GU5 A;  3FU0 A;  4G11 A;  5DBK A;  3EIJ A;  2WQ7 A;  3G2T A;  1OUV A;  2Y4U A;  3O48 A;  4GMJ A;  4GB9 A;  4KMO A;  4WWO A;  4BTB A;  1DNP A;  4HXI A;  3D9N A;  3FEY A;  3L13 A;  4GZ3 A;  5A6C A;  3TGO A;  3BG0 B;  3EIQ C;  3PH0 C;  2PQR A;  2L9B A;  4WNE A;  2VSO E;  3MZL B;  2R59 A;  4G23 A;  2A4Z A;  1OWP A;  4JHK A;  3OXL A;  3HYM B;  3SZ7 A;  3QNK A;  4GPK A;  4DPR A;  3C98 A;  3LXU X;  4WWN A;  3RU0 A;  3PNL B;  4K03 A;  2WB2 A;  4GZ5 A;  3GZ1 A;  3ZRH A;  4NQ0 A;  3GYZ A;  3GZS A;  3ASG A;  2HYZ A;  4B8A A;  3FDH A;  3PEU B;  5JJ7 A;  4F53 A;  3PUK A;  4DI3 A;  2FO7 A;  4A1G A;  2XGO A;  3HIZ A;  4LER A;  5FQ8 A;  4CDN A;  3UMV A;  3IKO B;  3FUN A;  1TEZ A;  4URK A;  3MKQ B;  2WMN A;  3SFZ A;  2I1J A;  3LYA A;  1JUQ A;  2QY7 A;  3KAE A;  2XQ0 A;  4G26 A;  4R7L A;  4HFG A;  4JZY A;  3I4G A;  4WUY A;  4F7A A;  4ACK A;  4N2Q A;  3AS4 A;  2I6H A;  2VYI A;  4KVO A;  4LUN U;  1QNF A;  3S7F A;  2VSN A;  3APD A;  2V8S E;  3URZ A;  4DJA A;  1DVP A;  3IBE A;  1HS6 A;  2IOS A;  2DBA A;  2PL2 A;  2WXK A;  1UN8 A;  3P1U A;  2PM6 A;  2VGX B;  3PRE A;  2CFZ A;  1Y8M A;  3TG5 A;  3ESL A;  3MA5 A;  1E8X A;  3Q15 A;  1HU3 A;  1NP7 A;  1H6K A;  1NZN A;  1MHQ A;  1BPO A;  4MLP A;  1Z3X A;  5CMW A;  3QJZ A;  4N2S A;  3G2U A;  4DLO A;  3PVL A;  3FTZ A;  1UW4 B;  5AJL A;  5A7D B;  3SI5 A;  2Y3A A;  1W3B A;  4ILH B;  3IHY A;  4J8D A;  2HR2 A;  3QKY A;  4BFR A;  3OAW A;  4AVX A;  2ZU6 B;  5BT1 A;  5CCL A;  1U3C A;  4ANW A;  2IOL A;  4IYP A;  3QDN A;  3MEK A;  1E96 B;  3MV3 B;  2KCK A;  3QAR A;  3CHS A;  4I1A A;  3ZVV A;  3FUH A;  4AIF A;  3MGB A;  3RJV A;  3CR3 A;  2J07 A;  1ZBP A;  3PNT B;  4WAF A;  5FQ7 A;  2VSX E;  2VJ8 A;  4CRW A;  5JHB A;  4GA2 A;  1P5Q A;  2L0I A;  1FCH A;  4ILG A;  4CEM A;  5KJM A;  3KS2 A;  2XRY A;  1SZ9 A;  2JLB A;  3I3N A;  2CHZ A;  2J9Q A;  2X6F A;  1WAO 1;  3AU5 A;  3PS6 A;  5G04 C;  3R7Q A;  3SBS A;  5LP0 A;  4A1S A;  4FHJ A;  2MHK A;  3ASF A;  3EHN A;  5CCM A;  3FU6 A;  4XKC A;  1HZ4 A;  2WXG A;  3R9A B;  4L23 A;  3JYS A;  2FF4 A;  3ML8 A;  3R7R A;  2VSY A;  2YIN A;  4GYO A;  4KBQ A;  2XCB A;  2OVF A;  2OV8 A;  4ME2 A;  3B7T A;  2X38 A;  3LEW A;  4KZ0 A;  3Q47 B;  2X6H A;  1KT0 A;  4UI9 C;  1KT1 A;  1NA3 A;  2YHE A;  4GYY A;  3RRM B;  3FFL A;  4B94 A;  2FI7 A;  2NXP A;  4CGW A;  3L54 A;  4BT9 A;  3CV0 A;  1ZU2 A;  2E2E A;  2GRM A;  4AM9 A;  3FUE A;  4KZC A;  4RG6 A;  3ZHE A;  4J0U A;  5FQ6 A;  4KVM A;  3L08 A;  4N3A A;  4E85 A;  4EZL A;  5FQ4 A;  5LX8 A;  4HOR A;  3LY9 A;  3N71 A;  4JHJ A;  3CVL A;  4AXH A;  2VGY A;  3FTX A;  3QK0 A;  3LS8 A;  2L0T B;  2XGM A;  3FUK A;  3QWV A;  4RG9 A;  4JL0 A;  5D0O D;  3UPV A;  2LAI A;  5FT9 A;  2LSU A;  3ZEF A;  4XIF A;  4HS2 A;  4IN3 B;  4BSX A;  3CSF A;  4A3T A;  5DIZ A;  4CCA A;  3CVW A;  3FH8 A;  5FZS A;  2OND A;  1TJC A;  3BEE A;  4FA6 A;  2NC9 A;  3CHQ A;  1H2U A;  4NRH B;  3ASD A;  1HFA A;  4Y6C A;  2X3M A;  3FHE A;  2R17 C;  4DI4 A;  3L6A A;  3FUD A;  4WNF A;  3CLJ A;  2EQX A;  1HO8 A;  2KCL A;  5G04 J;  2J08 A;  4A3V A;  1NA0 A;  1FVF A;  1IQR A;  1SQM A;  3B13 A;  4UI9 K;  4G1T A;  5KJN A;  1EF1 C;  2V4L A;  4UQZ A;  3NQP A;  1H0A A;  3RRN B;  4L2L A;  4I1O B;  4BX8 A;  5EKQ D;  3ZN3 A;  3QWW A;  3ESK A;  4BTA A;  4FJY A;  2UY1 B;  2M63 A;  3CVY A;  3DPD A;  5JHA A;  3ZFW A;  4JPS A;  1INZ A;  3RO3 A;  3G2V A;  2CG3 A;  3LY7 A;  3D9K A;  4Q96 A;  4GZ6 A;  4RVB A;  3AS8 A;  3E4B A;  4HOU A;  4GCN A;  2WPV A;  4JHR A;  3JUI A;  3CGH A;  2DCP A;  4J8S A;  4EBA G;  3B7R L;  1E7V A;  1YA0 A;  1EPU A;  2AVP A;  2KZT A;  3CHR A;  5JJ6 A;  5C2Y A;  5C1D A;  4LCT A;  4GA0 A;  3CVX A;  2LSV A;  3IEG A;  3FWV A;  1XGW A;  5EDS A;  1VDY A;  3PE4 A;  4UWG A;  3ENE A;  3Q4A B;  3MYV A;  1HX8 A;  4Q94 A;  3FU5 A;  2WM9 A;  3UT4 A;  2VTB B;  4ILI A;  1E7U A;  3QC1 A;  4HOQ A;  4U0U A;  5LCW C;  4AY6 A;  2CHX A;  2X6I A;  4PS7 A;  4NAC A;  2WMO A;  2HM8 A;  2WQH A;  3MCX A;  3JQ1 A;  5G05 C;  3S2A A;  1IQU A;  4MS6 A;  1X5B A;  3PZD A;  2V5F A;  2XPZ A;  4LEU A;  2AXU A;  3ZYM A;  5BW8 C;  4FAD A;  3RO2 A;  4EZJ A;  4J8F A;  3ZIM A;  3MKR A;  2J49 A;  3D9J A;  3VTX A;  4GAA A;  3SHF A;  5KCM A;  4KT6 B;  4WND A;  3HDX A;  3UX4 A;  4FP7 A;  3FTW A;  5FTP A;  4DK5 A;  5FZQ A;  2X6K A;  4TUU A;  3HVE B;  4I9C A;  3ONK A;  1E8Y A;  2WXP A;  3DBS A;  2KM4 A;  4ATG A;  1HH8 A;  1UJK A;  5A23 A;  4CT0 A;  3AS5 A;  1JWG A;  3ZPJ A;  4I43 A;  3S7B A;  3SD5 A;  2YHC A;  3MX3 A;  4L2Y A;  4I6J A;  3TG4 A;  3I5P A;  4CGV A;  2I2O A;  2RG8 A;  4H7Y A;  1EYH A;  3EJN A;  3RRU A;  3SBT B;  3Q5M A;  3LJ3 A;  1PAQ A;  3LDZ A;  2DIW A;  3SGH A;  2IFU A;  2WXH A;  4F1S A;  4ANV A;  3FY4 A;  3IHV A;  4QFV A;  3ZXS A;  3QAQ A;  5T8I A;  2A5U A;  1H19 A;  2OVB A;  2R5S A;  4EEC A;  3T8M A;  1Y6I A;  3NZU A;  4OVU A;  1E8Z A;  1GW6 A;  3L17 A;  3NF1 A;  4JEH A;  3RIB A;  3MKQ A;  4Q69 A;  2WXJ A;  3G2W A;  3CQC B;  4HOT A;  1ELR A;  2WXO A;  4BT8 A;  4MRU A;  3FTV A;  3U66 A;  2FUL A;  4FLH A;  3KD7 A;  5G05 J;  2XPY A;  3ZW3 A;  1HF8 A;  4APF A;  3ZGQ A;  3LCA A;  2Q7F A;  4I6E A;  5HI7 A;  2LNI A;  4W9R A;  1QQE A;  5T4Y A;  4G24 A;  2BUG A;  3UT7 A;  5ANL A;  2WXF A;  1ELK A;  4UQX A;  5LOZ A;  1ELW A;  3MV2 B;  4PDX A;  4UWH A;  2PZI A;  4AY5 A;  1OWL A;  4RSY A;  2KZT B;  4FLB A;  1Z3Y A;  4XZ4 A;  2YNQ A;  4XX5 A;  1WM5 A;  2AXV A;  3MJW A;  3OXG A;  1IHG A;  2VGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...