3D9IA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
138
structure length
138
Chain Sequence
EAVKTFNSELYSLMDMKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein 16
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 54
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9iA00
3D9LA 1X5BA 3D9NA 1H0AA 3ZYKA 4FU3A 1EDUA 1XGWA 4NACA 4Q96A 1HF8A 3G2TA 4JXTA 1VDYA 3D9KA 2KM4A 1PY1A 1INZA 1JUQA 5LOZA 2L0TB 2DIWA 4Q94A 1EYHA 3ONLA 3G2WA 3ZYQA 5LP0A 1JWFA 3D9MA 3D9JA 2BF0X 3LDZA 1UJKA 4GZDA 3RRUA 3ONKA 3G2UA 1SZ9A 3D9PA 1ELKA 4HFGA 4AVXA 1JPLA 1SZAA 5J08A 1DVPA 4FLBA 1MHQA 1LF8A 1UJJA 1HG2A 5CMWA 1HG5A 3ZYLA 3D9IA 2MOWA 5CMYA 2QY7A 3D9OA 3G2SA 4GZCA 1HFAA 2DCPA 3ZYMA 3CLJA 2V8SE 1HX8A 1JWGA 2LO6A 2L0IA 3G2VA
chains in the Genus database with same CATH superfamily
3CVNA 2FEZA 4GU5A 3MJWA 1INZA 1LTXA 2RFAA 2DIWA 3FU6A 4N39A 4ANWA 3FTVA 1OY3D 3AS4A 3GZSA 3P1UA 3UMVA 3PNLB 4GTVA 2J09A 3EDTB 1JWGA 4F7AA 3D9OA 3MKQB 4DRXE 4N3CA 4F53A 5EKQD 5LOZA 4CT4A 3FY4A 3TWTA 1SZ9A 3QK0A 4IULA 4M7CA 3LCAA 4JA9A 3ZGQA 4APOA 4BEPA 4UQZA 3ASFA 3D9IA 4L1BA 3VLDA 1VDYA 1D9SA 1JUQA 1Z3YA 1KZPA 4BTBA 1TNUA 3Q5MA 2LXLA 3PZ2A 3PEUB 4J8EA 3ZXPA 1N54A 2WXPA 3QOUA 1JCQA 1FT2A 3SBTB 3C72A 2ZGGA 3DSSA 3CV0A 5AENA 2WXLA 3F6QA 4GCNA 2R05A 1DCEA 5KJNA 4XZ4A 3ZYMA 4BSXA 2GGFA 2WXIA 3ZW3A 4APFA 1EF1C 5AJLA 1EYHA 3CK7A 3D9MA 1XNFA 4JZYA 2LNIA 4I9EA 1N4QA 3CR3A 5JMND 1WM5A 2Q7FA 4G11A 3UM2A 2X3MA 4TRQA 3SO8A 2LSVA 4ACLA 5KJKA 4WNFA 1E7VA 4BX8A 5G04C 3B7SA 2H6FA 2RFMA 3S7JA 1S64A 1LF8A 4AIFA 5JHAA 3OXLA 2VSXE 4YDOA 3VLFA 3GZ2A 4GZCA 5CERB 2VGYA 3UIOC 4EBAA 1HF8A 3G2TA 3LY9A 1HXIA 4Q69A 5FZSA 3RAUA 3DRAA 4BETA 2IJGX 3DEOA 4CDRA 3ZHEB 3CVUA 2X6JA 2X6HA 2Y0BG 5KWDA 3KEZA 3L16A 4ZHBA 3BUAA 4U0SA 2I9CA 2L0IA 4LNBA 4B93B 1H2UA 1PY1A 3Q49B 4EZJA 3MCXA 3KSQA 1H6PA 3JQ1A 3URZA 3PZ1A 1JPLA 2XCBA 3Q4AB 1E8ZA 1NP7A 2IOLA 5CMYA 5EYLA 2DBAA 3E32A 4U0ZA 4GA2A 4D10C 3B13A 1FCHA 4F3VA 4U8YD 1V55E 2L9BA 1YMPA 3ASDA 3VTYA 4MKTA 5FQ8A 4N5QA 3OAWA 2C2LA 4DJAA 4EHMA 5J08A 4AJWA 3FUDA 5HRYA 3SGHA 1Y6IA 1UJJA 3ABKE 5T8IA 1IQRA 4BT9A 3ZUVB 4PS3A 4U8HA 4KZ0A 3QAQA 3UM0A 4BFRA 1KPSB 2CFUA 2PL2A 4JC8A 4KZCA 3I5PA 2B0OE 2DVWA 2P2CP 1WAO1 1N52A 4DX2A 4J8SA 4TV3A 1SZAA 1OWLA 4I6JA 2WMNA 2P9KG 1QQEA 5DIZA 4N5CA 3CLJA 3AG4E 2L6BA 2NC9A 4DI3A 2AXUA 5CEAA 5JA4D 2QYJA 3DEPA 5KJMA 2UY1A 3DPYA 3J5QB 2XPIA 4NQ0A 4OVVA 2XEHA 5CCLA 1QYMA 1TJCA 5BV1A 4XE0A 3FEYA 2XRYA 3D9KA 1FVFA 4FJZA 5B1AE 4FJYA 2KXPC 4Y6CA 4WNDA 1BD8A 2Y69E 3FU3A 1H6KA 3ABLE 3HYMB 3AAAC 4URKA 1UN8A 3CVLA 5KBAA 4GTPA 4F6RD 3E34A 1A5EA 3Q9UC 2ZU6B 3FTWA 4DX1A 1Z6TA 3D9LA 4C0EA 3R9AB 1XGWA 4E6HA 3E37A 5IY5E 1X81A 3ULYA 3IHVA 5M72A 3FU5A 2AWIA 4KBQA 4JVSA 3ASGA 2YHCA 3FFLA 5FIOA 3AG1E 4DUIA 4FHKA 1SA5A 3G2VA 2H6HA 3TL5A 3UIPC 3L08A 3UINC 5CCMA 5CECB 2R03A 1SW6A 5KCMA 1MX2A 4GTRA 4CGVA 3GW4A 3U66A 3FTUA 1RZ4A 1O1RA 2VGEA 1MQSA 2EILE 1IKND 5AQ7A 3TWVA 5A6CA 4WAFA 1HG2A 3CVPA 3APDA 2IONA 3Q15A 5AYWD 2F0YA 4I6GA 3RRUA 1TNYA 1SVXA 5HKPA 1OCZE 2C0MA 3L17A 5ARGA 2EIKE 3DSXA 3EHQA 3QB2A 1N4PA 4ATGA 4GB9A 3LXUX 2ONDA 2AXVA 1Z5SC 3FTZA 3UKUG 2J9QA 3R7RA 2ZXWE 5D2MC 5ITZF 1WY6A 2A5UA 1TYQG 2IU1A 3HG0D 4HLLA 4MLPA 3UT7A 2KCLA 4I1MA 2BF0X 1N0RA 2E2EA 2FO1E 3C3OA 3QWVA 5EYPF 5H7PA 2DYSE 3EHMA 4PDXA 2VTBA 2KZTB 2QY7A 3KEAA 3I3NA 1UOHA 4L23A 3KSLA 4HRNA 3QARA 5ENNA 3D9HA 2GRMA 2VJ8A 4LRZA 3PVLA 2ETCA 3ULEG 3V79K 1ELWA 2WVIA 2ETAA 3RU0A 3WXXA 4Q96A 3T9KA 4A3TA 3ESKA 1QNFA 4HB5A 2EIME 2VSOE 5A7DB 4EZKA 5BXOA 2VYIA 4GYYA 4HNAD 4AOFA 3D3MA 1P5QA 4AY5A 1Y8MA 4PH4B 4UWKA 3MEKA 2BUGA 3FUJA 2L0TB 2BTDA 1YYHA 2ZISA 3ML8A 1B89A 4B0ZA 4HFGA 2X6FA 3S2AA 4HRLA 1LD8A 4CGWA 3SHFA 4GA0A 2P9UG 3ASOE 1O1TA 1H0AA 5ANRA 4WNEA 5CBOA 4P29A 4JD2G 2HR2A 3ZRHA 4FA6A 3IKOB 4I9CA 5G05C 2X6KA 1K3ZD 2EQXA 2R5SA 4DX6D 4GPKA 3TJPA 3LPZA 3ZYQA 1UJKA 2Y4TA 3U4TA 4G1TA 3BU8A 3HVEA 4TUMA 2WXFA 3R9MA 3FUMA 3CSTA 3QDNA 3ESLA 2XHEA 2KCKA 2WQHA 3Q75A 2B6CA 1V54E 2X6IA 1A17A 4WWPA 1E8WA 4NIKA 4IRUA 2V0PA 4XEIG 2P9IG 4YNDA 3L82A 4N2QA 3SI5A 3LJ3A 1DC2A 4AY6A 2WXHA 3FWVA 3UT8A 1S63A 3DXKG 4JHKA 4IYPA 4UWLA 5G2NA 4J7WA 2C0LA 3SY2A 1MHQA 3FP3A 5B1BE 4EECA 5EN5D 1OXJA 3FUEA 3D9NA 3EIJA 2H6IA 4UQXA 3LEWA 4TXPA 2OEVA 3CHSA 5LP0A 3C5RA 4FADA 4MS6A 3ZKJA 1SQMA 2VSYA 1ZU2A 1HG5A 2MOWA 2XS8A 5EDSA 1TEZA 3MZLB 3TXNA 1NI1A 4F1SA 4FLHA 1N11A 3RO3A 2QC9A 4XKCA 3SFZA 4RLYA 4FC8A 2L6JA 2J07A 3CVWA 5ENSD 3AJIA 5JHBA 3TWUA 2DWZA 5CHEE 4AEZC 3Q79A 4AXHA 4ILHB 4HOSA 3ZU7B 4AM9A 3CEQA 3HXEA 1N9AA 1OWPA 4Y6WA 1NA3A 2WXNA 1BU9A 5BW8C 3NB2A 1UG3A 3CHPA 4B8CB 3HXCA 4KT6B 3TG4A 3UQ3A 2XS1A 3EJNA 4OAUC 5AARA 3D9PA 3CQGB 3QNKA 3FHEA 4HOTA 1ZBPA 2KC7A 2WPVA 2LO6A 4TXRA 4C48B 5AAOA 3FH7A 2LSUA 2OEWA 5FWQA 3ZEFA 3ZFWA 2PM7A 3HXDA 1IYGA 2NSZA 4E85A 4PUCA 3B7UX 4DK5A 3SF4A 1DNPA 2GRLA 4HI8A 2PM6A 3MKRA 2IFUA 3NF1A 5G04J 3SFXA 4GTMA 2J4DA 2X38A 3JUIA 2XRZA 2P9NG 2PQRA 3TWWA 4U96D 4G25A 3AG3E 4EBAG 3FUHA 4MBGA 4GTSA 3APFA 2R59A 4HORA 2MHKA 4GMRA 2DZNA 1E8XA 3IHYA 2OVFA 5ENPD 1HS6A 4CEMA 4K0RA 4ABNA 2R2LA 3FUKA 3NBNB 3UI2A 4L9PA 3L9TA 3HXFA 1SA4A 5KNGA 2Y4UA 3DXMG 4AP2A 3UXGA 2V5QC 3CHRA 4L7TA 2A4ZA 4ANXA 3LJNA 5LFAA 4EZLA 4PS7A 4N3AA 4U04A 2JLBA 2LXMA 4AVXA 2NXPA 2WMOA 4HRMB 5ENQD 2IOSA 2FI7A 3DSVA 1IHBA 4RG6A 2FO7A 4JB8P 2LAIA 4JPSA 3T5VA 3JCKC 1L5JA 3LY7A 4I1OB 2KBXA 3E30A 3FTSA 4U8VD 4BTAA 4HI9A 3TXMA 1NA0A 3L22A 4I1AA 4UI9C 3SBSA 3CVVA 3LVRE 1TNZA 3FU0A 1BI8B 3Q7AA 2BKGA 2RG8A 2CHWA 4FP7A 3KS2A 4J8FA 3AU5A 4JW1A 5CRUA 4BESA 1HU3A 2GW1A 3L6AA 4KVMA 4I43A 1H2TC 1NZNA 5JJTA 2XENA 1HE8A 4JEUA 4L2LA 5EX0A 2KZTA 5B3SE 2KATA 3B7RL 2UWJG 4UUCA 3JYSA 2HM8A 2AXZA 5AQBA 3V2OA 5LCWC 5EILA 2UY1B 3CIAA 1JCRA 1D8DA 5C1DA 1U2VG 3PDNA 5ENTD 2VGXB 3CK8A 4B89A 3O48A 4RQIA 5FJYA 4GTQA 1MX4A 3V31A 5T4YA 3QWWA 4B8AA 2ETBA 3FH5A 5FT9A 2V5FA 5EIBE 2KCVA 4GYOA 4ME2A 2OV8A 4O6FA 3ZN3A 3Q7FA 2XZTG 3UT4A 2ILRA 3HRAA 4FU3A 2J8SD 4Z68A 3RRMB 3PH0C 5KJLA 2HYZA 3SD5A 3D9JA 3LYAA 1FT1A 2QFCA 2WXOA 2NYJA 3UTMA 2XCCA 4W9RA 4L2YA 3KD7A 4A63B 4G8KA 4GA1A 2XGMA 3R7QA 3PE3A 1HFAA 2LAHA 2WQ6A 4I2WA 1EDUA 3MGBA 3CQCB 3PZ3A 2PNNA 3JXJA 2CG2A 3Q9NC 4GZDA 2HE0A 4JHJA 5BUZA 4PS8A 4UWGA 1LD7A 4KVOA 2CHXA 2I2OA 3GZ1A 4O1OA 3OTNA 1AP7A 3MV3B 2VSNA 1ZB1A 5AJDA 3UM1A 4J8YA 1X5BA 3S7FA 1OWNA 4NACA 3TWXA 4JL0A 3FTYA 3BG1B 4Q94A 5FQ4A 2GRQB 5JJ6A 1OUVA 1KT1A 2CFZA 4CT0A 2J49A 3EHNA 2IQCA 2VQ2A 3Q47B 4ACKA 5AIJA 2F8YA 1E8YA 4DI4A 3OXGA 3G2SA 3FTXA 1IXVA 3AG2E 4XI9A 2MYOA 4C0MA 1RW2A 5EX3A 3MKQA 3HDXA 4XIFA 5A23A 2V4HC 3GYZA 1N0QA 5AN8A 1N4SA 4RSYA 2YNQA 4LEUA 3B95A 3PE4A 5E76A 3O4ZA 3ZNGA 3FUIA 2WXKA 2XGSA 4YDYA 2QYUA 3TWRA 3JXIA 2OCCE 1MZCA 1N95A 3PUKA 4GAAA 2A5EA 3E33A 5CRVA 3L13A 4WUYA 2VTBB 4BSZB 3UX4A 1AWCB 4DLQA 3SNXA 5FTPA 5D0QD 4K5CA 3S7BA 2IO3C 2H6GA 3I4GA 5FQ6A 3LDZA 3I4RB 4UWHA 5FZQA 3SFYA 3NZUA 2P9PG 2P9SG 4MRUA 4TXQA 4GCOA 1HO8A 2EIJE 3ASHA 3Q78A 2GROB 5D0OD 1IHGA 3DWLG 1OT8A 3LS8A 3TAXA 3TWQA 4CYMD 1TN7A 2MRIA 1WG0A 2IEJA 4GMLA 3T8KA 1HH8A 4R7LA 3ISMC 3KAEA 3ZXSA 1OCCE 4XKBA 3K9IA 1WDYA 4EQFA 1TNBA 3VTXA 4HOQA 4LUNU 1MJ0A 4ATZD 3NOCD 2XPZA 4ILGA 5T3RA 4U0UA 4UWFA 5G05J 1E7UA 1OCRE 5BPPA 1QZ2A 3APCA 2IY0C 4G24A 3RJVA 2IO2C 2KM4A 3L54A 1H6OA 2V4LA 5C2YA 3ZHEA 1TJFA 3WG7E 4KYOB 4GTTA 5CEDB 3CKCA 3U64A 3ULQA 5ANLA 4HQDA 2F37A 5BNWA 1QBQA 3W9GA 4JEHA 3LVQE 3EU5A 1PC2A 1TR4A 3AS5A 4UQYA 3PS6A 3C3RA 2M63A 1KLXA 3HVEB 3CVYA 4X8QA 1MX6A 3ML9A 3PRZA 3W9FA 4RG9A 3T5XA 3BG0B 1H2VC 1Z3XA 2RKKA 3DSTA 4FULA 2J4BA 2DZOA 4YDEA 3QC1A 4A1SA 2DYRE 5HI7A 4WWNA 1TN6A 1BLXB 2F8XK 2JEKA 2ZGDA 3ZYLA 3CGHA 5FZRA 4BERA 4BWRA 1H19A 3PUJA 4K5AB 2WXQA 3IBEA 4GZ6A 3FH8A 1ELRA 3BEEA 1KZOA 2GRPB 4ILIA 3S7DA 1UW4B 4M3OA 4CCAA 3FULA 3UPVA 4GZ5A 1U3DA 4IN3B 1BI7B 4KMOA 3TGOA 3FUNA 3NOGD 1OCOE 1Q2ZA 2Y3AA 5DBKA 2FBNA 2XQ0A 3EUVA 5ARFA 2BKKB 4JA7A 4N3BA 4YVOA 3ZYKA 4LCTA 1EPUA 5AQ9A 1KT0A 1JCSA 1HZ4A 1N4RA 3PEVB 1PAQA 4XI0A 3CHOA 3V30A 4HOUA 3FUFA 2GRNB 4G23A 3J5PA 3U9WA 1DVPA 1IQUA 3DSUA 4HXIA 5BXUA 3U3WA 3ABME 3C3QA 2XEVA 2E0IA 2JABA 1E90A 1ELKA 4WWOA 3QJZA 3IXEA 4B94A 4G26A 4U7EB 1G3NB 1W3BA 4H7YA 2XGOA 5AQAA 2EINE 2QZAA 2R02A 4RVBA 3ZIMA 2AJAA 4HS2A 3CHMA 3B7BA 3MA5A 1U3CA 2R17C 2XEEA 4V3IA 4QFVA 3V2XA 3X2QE 1K8KG 4K5BA 4I17A 4CDNA 3HIZA 4CRWA 3CK9A 3AU4A 2CHZA 4HLEA 1O5MA 3CSFA 1YA0A 5D66A 2VGXA 1MYOA 4I6EA 2YINA 4G8LA 4OVUA 4LNUD 2Y1LE 2P9LG 4N2SA 4C9BB 3VLEA 1K1AA 3ONLA 3RO2A 2I6HA 4BX9A 3EU9A 3UM3A 4I2ZA 4OYSA 4FHJA 4FLBA 1N94A 2J08A 3FEXA 4YDWA 4GTOA 5HS0A 3JUEA 3NQPA 2OOEA 1DCQA 4LERA 2WQ7A 3EIQC 1D8EA 1YCSB 1NFIE 4ZFHA 4A3VA 3CKBA 2BEDA 1HX8A 4AV7A 3PREA 5KNHD 2GRRB 3QKYA 4BY6A 4CZ2D 5HQ8A 3N71A 3CVQA 3TWSA 3IV0A 1K1BA 3QWPA 1S0PA 2WXRA 4GPMA 4DLOA 4OAVB 4UI9J 4DX5D 2WM9A 3TG5A 4UI9K 4LSZE 3P2BA 4J0UA 1GW6A 3IEGA 3HHMA 4H7XA 4KXKB 1TN8A 3RIBA 3DPDA 3E4BA 3ASNE 2DCPA 3PZDA 2FF4A 5FQ7A 3B7TA 4U07A 4BT8A 4O60A 2I1JA 4HBDA 4NURA 3ENEA 3DBSA 4WNGA 3LY8A 2PZIA 4GMJA 3RK6A 5E75A 4ANUA 5LCWJ 2WXJA 3SQVA 4K03A 3SZ7A 1JWFA 3G2UA 3BQOA 1OWMA 3T8MA 3NZSA 2LUHA 3DSWA 4GZ3A 3JQ0A 3MV2B 2YHEA 4CDMA 5CBNA 3MX3A 5BV0A 3CVXA 4U95D 5BT1A 4J6IA 3CHQA 3RKVA 4LNGA 4YVQC 2V8SE 5ENRD 3NAWA 2HO1A 2AW6A 1S70B 3RRNB 4JXTA 4DX7D 4G2VA 4ANVA 4TUUA 1OWOA 3EHRA 2WB2A 4J8DA 3UUXA 3OXFA 2FULA 4NRHB 5LX8A 5J90A 4U63A 3FDHA 2PQNA 3RSEG 1UN9A 1FPPA 1E96B 1BPOA 3PZ4A 4A1GA 2OVBA 4A55A 4DPRA 3G2WA 3C98A 3UKRG 4GYWA 3ZVVA 2XZDG 5EIDA 5CMWA 1NL4A 2YQ8A 2P58C 4F1PA 2CG3A 2IF4A 3MYVA 2ZIRA 4O1PA 1O1SA 1TNOA 3HXBA 4XX5A 2XPYA 4JHRA 3Q73A 5ENOD 5JJ7A 2WXGA 4QQIA 3ONKA 2RD0A 4HVBA 2I1KA 3PNTB 3LKUA 2AVPA 1FVHA 4LG6A 5G55A 4EPZA 5FINA 3AS8A 2WXMA 3ZPJA
chains in the Genus database with same CATH topology
2A5UA 2FO7A 3CVNA 3ZYLA 2FEZA 2LAIA 4GU5A 4JPSA 3T5VA 2IU1A 3JCKC 3MJWA 4MLPA 1INZA 3UT7A 1L5JA 2DIWA 2KCLA 3CGHA 3LY7A 4I1OB 3FU6A 4I1MA 5FZRA 2BF0X 4BWRA 2E2EA 1H19A 4N39A 3PUJA 4ANWA 3FTSA 3QWVA 3FTVA 2WXQA 3AS4A 3IBEA 3GZSA 4GZ6A 4BTAA 3FH8A 3P1UA 3UMVA 1ELRA 3EHMA 4PDXA 2VTBA 2KZTB 3BEEA 2QY7A 3PNLB 3I3NA 3TXMA 4L23A 4ILIA 2J09A 3S7DA 3EDTB 1JWGA 1UW4B 3D9OA 4M3OA 4F7AA 4CCAA 3MKQB 1NA0A 3FULA 4N3CA 3UPVA 3L22A 4F53A 4I1AA 4UI9C 5EKQD 5LOZA 4GZ5A 1U3DA 4IN3B 4CT4A 3FY4A 3SBSA 3CVVA 3QARA 3LVRE 4KMOA 3TGOA 3FUNA 1SZ9A 5ENNA 3FU0A 2GRMA 2VJ8A 3QK0A 2RG8A 2Y3AA 4IULA 2CHWA 3PVLA 4LRZA 5DBKA 2FBNA 3LCAA 2XQ0A 4JA9A 3ZGQA 4APOA 4FP7A 5ARFA 4JA7A 4N3BA 1ELWA 4UQZA 2WVIA 3ASFA 3D9IA 4YVOA 3KS2A 4J8FA 3AU5A 4JW1A 4L1BA 3VLDA 1HU3A 3ZYKA 4LCTA 3RU0A 1EPUA 3WXXA 4Q96A 1KT0A 1VDYA 2GW1A 3L6AA 4KVMA 1HZ4A 3PEVB 4XI0A 1PAQA 1JUQA 3ESKA 4A3TA 3CHOA 1QNFA 4HOUA 4I43A 1Z3YA 2VSOE 5A7DB 3FUFA 1H2TC 4EZKA 2VYIA 1NZNA 5JJTA 4G23A 1HE8A 4GYYA 4BTBA 3U9WA 4JEUA 1DVPA 4AOFA 3Q5MA 4L2LA 3D3MA 5EX0A 1IQUA 1P5QA 2KZTA 3PEUB 4J8EA 4HXIA 4AY5A 2KATA 3B7RL 2UWJG 1N54A 1Y8MA 4PH4B 4UWKA 2WXPA 3U3WA 3MEKA 2BUGA 3JYSA 2HM8A 2AXZA 3FUJA 3QOUA 5LCWC 2XEVA 2L0TB 2BTDA 2UY1B 3CIAA 3SBTB 5C1DA 2E0IA 3PDNA 3ML8A 1B89A 4B0ZA 1E90A 1ELKA 4HFGA 4WWOA 2X6FA 3QJZA 2VGXB 3CK8A 3S2AA 3CV0A 4CGWA 4B94A 4B89A 5AENA 2WXLA 4G26A 3SHFA 4GA0A 1W3BA 4GCNA 3O48A 4H7YA 5KJNA 5FJYA 2XGOA 4XZ4A 3ZYMA 5T4YA 4BSXA 4RVBA 2GGFA 2WXIA 3ZW3A 1H0AA 3QWWA 3ZIMA 4B8AA 3FH5A 4APFA 1EF1C 4HS2A 5AJLA 4WNEA 5ANRA 3CHMA 3MA5A 1EYHA 4P29A 3CK7A 1U3CA 3D9MA 2R17C 5FT9A 1XNFA 2HR2A 4V3IA 4JZYA 2LNIA 4QFVA 2V5FA 4I9EA 3ZRHA 4FA6A 2KCVA 4GYOA 3CR3A 1WM5A 3IKOB 4I17A 4I9CA 4CDNA 5G05C 4ME2A 2OV8A 4O6FA 3ZN3A 2Q7FA 3HIZA 4CRWA 2X6KA 4G11A 2EQXA 2X3MA 4TRQA 3UT4A 2LSVA 3CK9A 2ILRA 2R5SA 4ACLA 4FU3A 4GPKA 5KJKA 3AU4A 3TJPA 2CHZA 4WNFA 3RRMB 4HLEA 3PH0C 1E7VA 5KJLA 3LPZA 3ZYQA 3CSFA 4BX8A 2HYZA 5G04C 3SD5A 3D9JA 1YA0A 3B7SA 1UJKA 2Y4TA 3U4TA 3LYAA 4G1TA 2QFCA 2WXOA 3HVEA 2WXFA 2VGXA 2XCCA 4W9RA 4L2YA 3S7JA 1LF8A 3KD7A 4I6EA 4AIFA 4GA1A 2XGMA 2YINA 5JHAA 3R7QA 3FUMA 3OXLA 2VSXE 3VLFA 3PE3A 4OVUA 3GZ2A 1HFAA 4GZCA 2VGYA 3ZPJA 2LAHA 3CSTA 2WQ6A 3QDNA 3ESLA 2XHEA 2KCKA 2WQHA 4I2WA 4EBAA 1EDUA 4N2SA 1HF8A 3G2TA 3LY9A 1HXIA 3MGBA 3CQCB 4C9BB 4Q69A 5FZSA 3VLEA 3ONLA 2CG2A 3RO2A 2I6HA 2IJGX 4BX9A 4CDRA 4GZDA 3ZHEB 2X6IA 4I2ZA 1A17A 4OYSA 3CVUA 2X6JA 4FHJA 4JHJA 2X6HA 4WWPA 5BUZA 4PS8A 4UWGA 4FLBA 3KEZA 4KVOA 2CHXA 2I2OA 3L16A 1E8WA 3GZ1A 3OTNA 4IRUA 2J08A 3FEXA 3MV3B 2V0PA 4U0SA 2VSNA 5AJDA 2I9CA 2L0IA 4YNDA 4N2QA 3NQPA 1X5BA 3S7FA 1OWNA 3SI5A 4NACA 3LJ3A 4JL0A 2OOEA 3FTYA 1H2UA 1PY1A 3Q49B 4AY6A 3BG1B 4Q94A 4EZJA 3MCXA 4LERA 5FQ4A 2WQ7A 2WXHA 3FWVA 5JJ6A 3UT8A 1OUVA 1KT1A 2CFZA 3EIQC 3JQ1A 4CT0A 2J49A 3EHNA 4JHKA 3URZA 4IYPA 1JPLA 4UWLA 2VQ2A 2XCBA 2IQCA 1E8ZA 2C0LA 1NP7A 1MHQA 3Q47B 3Q4AB 5G2NA 4ACKA 5AIJA 3FP3A 2IOLA 1E8YA 4A3VA 5CMYA 4EECA 4DI4A 3OXGA 3G2SA 3FTXA 2DBAA 4U0ZA 4GA2A 3CKBA 4XI9A 1HX8A 3FUEA 4D10C 3B13A 1FCHA 4C0MA 3D9NA 3EIJA 4F3VA 4AV7A 4UQXA 3LEWA 3MKQA 3PREA 5EX3A 3QKYA 4BY6A 3HDXA 2L9BA 3CHSA 3ASDA 4XIFA 5A23A 5HQ8A 5LP0A 4FADA 3N71A 3VTYA 3CVQA 4MS6A 3IV0A 3GYZA 4MKTA 5FQ8A 1SQMA 3QWPA 3OAWA 2C2LA 4DJAA 5J08A 2VSYA 4AJWA 1S0PA 1ZU2A 2WXRA 3FUDA 3SGHA 4RSYA 1Y6IA 2YNQA 4DLOA 1UJJA 1HG5A 5T8IA 2MOWA 4LEUA 1IQRA 3PE4A 5E76A 4BT9A 5EDSA 3O4ZA 4PS3A 3FUIA 2WXKA 2XGSA 4UI9J 2WM9A 4U8HA 1TEZA 4KZ0A 3QAQA 3TG5A 4BFRA 4UI9K 3PUKA 4GAAA 3MZLB 2CFUA 2PL2A 3P2BA 4JC8A 4KZCA 3TXNA 3I5PA 4J0UA 4F1SA 1GW6A 4FLHA 3IEGA 1WAO1 3HHMA 4H7XA 1N52A 3RO3A 4KXKB 4J8SA 4TV3A 1SZAA 4XKCA 3SFZA 3RIBA 3L13A 4WUYA 3DPDA 4FC8A 2VTBB 1OWLA 3E4BA 4I6JA 2WMNA 2L6JA 3UX4A 1QQEA 2J07A 4DLQA 5DIZA 4N5CA 3SNXA 3CVWA 5FTPA 2DCPA 3CLJA 5D0QD 3PZDA 3S7BA 2NC9A 4DI3A 2FF4A 5JHBA 2AXUA 5FQ7A 5CHEE 3I4GA 3B7TA 4U07A 5FQ6A 5KJMA 4AEZC 3LDZA 2UY1A 4BT8A 4AXHA 4ILHB 3I4RB 4HOSA 2I1JA 2XPIA 4NQ0A 3ENEA 4NURA 4OVVA 4UWHA 3DBSA 3CEQA 4AM9A 5FZQA 3NZUA 1TJCA 3LY8A 4WNGA 5BV1A 5CCLA 2PZIA 4XE0A 4GMJA 3FEYA 4MRUA 1OWPA 2XRYA 4Y6WA 1NA3A 2WXNA 3RK6A 4GCOA 3D9KA 5E75A 4ANUA 5LCWJ 1HO8A 2WXJA 1FVFA 5BW8C 1UG3A 3CHPA 4FJZA 4B8CB 3ASHA 4FJYA 5D0OD 1IHGA 4Y6CA 3LS8A 4K03A 4KT6B 4WNDA 3TG4A 3TAXA 3UQ3A 3SZ7A 1JWFA 3EJNA 3FU3A 1H6KA 3G2UA 1OWMA 3HYMB 2MRIA 3D9PA 4GMLA 3CQGB 3QNKA 4URKA 1UN8A 3CVLA 1HH8A 4R7LA 3FHEA 4HOTA 3KAEA 3T8MA 3ZXSA 3NZSA 1ZBPA 2KC7A 4XKBA 2WPVA 3K9IA 2ZU6B 3FTWA 2LO6A 1Z6TA 4GZ3A 3D9LA 4EQFA 3VTXA 3R9AB 4C0EA 1XGWA 3JQ0A 4HOQA 4E6HA 3MV2B 2YHEA 4LUNU 4CDMA 3FH7A 3IHVA 3MX3A 2LSUA 5FWQA 2XPZA 4ILGA 3ZEFA 2PM7A 3ZFWA 5T3RA 4U0UA 5M72A 3FU5A 1IYGA 4UWFA 2NSZA 5G05J 2AWIA 5BV0A 1E7UA 3CVXA 4KBQA 5BT1A 4JVSA 4E85A 4J6IA 3ASGA 4PUCA 3B7UX 4DK5A 5BPPA 1QZ2A 2YHCA 3FFLA 3SF4A 1DNPA 3CHQA 2GRLA 3APCA 3RKVA 4YVQC 2PM6A 3MKRA 4FHKA 2V8SE 2IFUA 3G2VA 2HO1A 3TL5A 2AW6A 4G24A 3NF1A 3RRNB 5G04J 3RJVA 3L08A 4JXTA 2KM4A 2J4DA 5CCMA 2X38A 3L54A 4G2VA 4ANVA 3JUIA 2XRZA 5KCMA 4TUUA 2PQRA 4CGVA 1OWOA 2V4LA 4G25A 2WB2A 4EBAG 4J8DA 3UUXA 3OXFA 5C2YA 3ZHEA 1TJFA 2FULA 3GW4A 4NRHB 5LX8A 3U66A 3FUHA 4KYOB 5J90A 3FTUA 3APFA 4U63A 3CKCA 3U64A 2R59A 3ULQA 5ANLA 4HORA 3FDHA 2PQNA 1MQSA 1UN9A 5BNWA 1E96B 2MHKA 1BPOA 4A1GA 4JEHA 2OVBA 3LVQE 1E8XA 3IHYA 2OVFA 4A55A 1HS6A 4DPRA 1PC2A 3AS5A 4CEMA 3G2WA 4K0RA 4ABNA 3C98A 4UQYA 3PS6A 2M63A 3FUKA 1KLXA 5A6CA 3HVEB 3CVYA 4GYWA 4WAFA 3ZVVA 3ML9A 1HG2A 3PRZA 3CVPA 5CMWA 3APDA 4RG9A 2IONA 3Q15A 5AYWD 2YQ8A 3T5XA 2Y4UA 2P58C 3BG0B 1H2VC 1Z3XA 4AP2A 4I6GA 3RRUA 2CG3A 2IF4A 3MYVA 4FULA 3CHRA 4L7TA 2A4ZA 2J4BA 4XX5A 2C0MA 3L17A 2XPYA 4ANXA 5ARGA 5LFAA 3QB2A 4JHRA 3QC1A 4EZLA 4PS7A 4N3AA 2WXGA 4U04A 2JLBA 4A1SA 4ATGA 3ONKA 5JJ7A 2RD0A 4HVBA 4GB9A 4AVXA 2I1KA 3PNTB 3LXUX 3LKUA 2NXPA 2AVPA 2WMOA 1FVHA 5HI7A 2ONDA 2AXVA 2IOSA 4WWNA 2FI7A 3FTZA 5G55A 4EPZA 2J9QA 4RG6A 3R7RA 3AS8A 2JEKA 2WXMA 1WY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9L A;  1X5B A;  3D9N A;  1H0A A;  3ZYK A;  4FU3 A;  1EDU A;  1XGW A;  4NAC A;  4Q96 A;  1HF8 A;  3G2T A;  4JXT A;  1VDY A;  3D9K A;  2KM4 A;  1PY1 A;  1INZ A;  1JUQ A;  5LOZ A;  2L0T B;  2DIW A;  4Q94 A;  1EYH A;  3ONL A;  3G2W A;  3ZYQ A;  5LP0 A;  1JWF A;  3D9M A;  3D9J A;  2BF0 X;  3LDZ A;  1UJK A;  4GZD A;  3RRU A;  3ONK A;  3G2U A;  1SZ9 A;  3D9P A;  1ELK A;  4HFG A;  4AVX A;  1JPL A;  1SZA A;  5J08 A;  1DVP A;  4FLB A;  1MHQ A;  1LF8 A;  1UJJ A;  1HG2 A;  5CMW A;  1HG5 A;  3ZYL A;  3D9I A;  2MOW A;  5CMY A;  2QY7 A;  3D9O A;  3G2S A;  4GZC A;  1HFA A;  2DCP A;  3ZYM A;  3CLJ A;  2V8S E;  1HX8 A;  1JWG A;  2LO6 A;  2L0I A;  3G2V A; 
#chains in the Genus database with same CATH topology
 3CVN A;  2FEZ A;  4GU5 A;  3MJW A;  1INZ A;  1LTX A;  2RFA A;  2DIW A;  3FU6 A;  4N39 A;  4ANW A;  3FTV A;  1OY3 D;  3AS4 A;  3GZS A;  3P1U A;  3UMV A;  3PNL B;  4GTV A;  2J09 A;  3EDT B;  1JWG A;  4F7A A;  3D9O A;  3MKQ B;  4DRX E;  4N3C A;  4F53 A;  5EKQ D;  5LOZ A;  4CT4 A;  3FY4 A;  3TWT A;  1SZ9 A;  3QK0 A;  4IUL A;  4M7C A;  3LCA A;  4JA9 A;  3ZGQ A;  4APO A;  4BEP A;  4UQZ A;  3ASF A;  3D9I A;  4L1B A;  3VLD A;  1VDY A;  1D9S A;  1JUQ A;  1Z3Y A;  1KZP A;  4BTB A;  1TNU A;  3Q5M A;  2LXL A;  3PZ2 A;  3PEU B;  4J8E A;  3ZXP A;  1N54 A;  2WXP A;  3QOU A;  1JCQ A;  1FT2 A;  3SBT B;  3C72 A;  2ZGG A;  3DSS A;  3CV0 A;  5AEN A;  2WXL A;  3F6Q A;  4GCN A;  2R05 A;  1DCE A;  5KJN A;  4XZ4 A;  3ZYM A;  4BSX A;  2GGF A;  2WXI A;  3ZW3 A;  4APF A;  1EF1 C;  5AJL A;  1EYH A;  3CK7 A;  3D9M A;  1XNF A;  4JZY A;  2LNI A;  4I9E A;  1N4Q A;  3CR3 A;  5JMN D;  1WM5 A;  2Q7F A;  4G11 A;  3UM2 A;  2X3M A;  4TRQ A;  3SO8 A;  2LSV A;  4ACL A;  5KJK A;  4WNF A;  1E7V A;  4BX8 A;  5G04 C;  3B7S A;  2H6F A;  2RFM A;  3S7J A;  1S64 A;  1LF8 A;  4AIF A;  5JHA A;  3OXL A;  2VSX E;  4YDO A;  3VLF A;  3GZ2 A;  4GZC A;  5CER B;  2VGY A;  3UIO C;  4EBA A;  1HF8 A;  3G2T A;  3LY9 A;  1HXI A;  4Q69 A;  5FZS A;  3RAU A;  3DRA A;  4BET A;  2IJG X;  3DEO A;  4CDR A;  3ZHE B;  3CVU A;  2X6J A;  2X6H A;  2Y0B G;  5KWD A;  3KEZ A;  3L16 A;  4ZHB A;  3BUA A;  4U0S A;  2I9C A;  2L0I A;  4LNB A;  4B93 B;  1H2U A;  1PY1 A;  3Q49 B;  4EZJ A;  3MCX A;  3KSQ A;  1H6P A;  3JQ1 A;  3URZ A;  3PZ1 A;  1JPL A;  2XCB A;  3Q4A B;  1E8Z A;  1NP7 A;  2IOL A;  5CMY A;  5EYL A;  2DBA A;  3E32 A;  4U0Z A;  4GA2 A;  4D10 C;  3B13 A;  1FCH A;  4F3V A;  4U8Y D;  1V55 E;  2L9B A;  1YMP A;  3ASD A;  3VTY A;  4MKT A;  5FQ8 A;  4N5Q A;  3OAW A;  2C2L A;  4DJA A;  4EHM A;  5J08 A;  4AJW A;  3FUD A;  5HRY A;  3SGH A;  1Y6I A;  1UJJ A;  3ABK E;  5T8I A;  1IQR A;  4BT9 A;  3ZUV B;  4PS3 A;  4U8H A;  4KZ0 A;  3QAQ A;  3UM0 A;  4BFR A;  1KPS B;  2CFU A;  2PL2 A;  4JC8 A;  4KZC A;  3I5P A;  2B0O E;  2DVW A;  2P2C P;  1WAO 1;  1N52 A;  4DX2 A;  4J8S A;  4TV3 A;  1SZA A;  1OWL A;  4I6J A;  2WMN A;  2P9K G;  1QQE A;  5DIZ A;  4N5C A;  3CLJ A;  3AG4 E;  2L6B A;  2NC9 A;  4DI3 A;  2AXU A;  5CEA A;  5JA4 D;  2QYJ A;  3DEP A;  5KJM A;  2UY1 A;  3DPY A;  3J5Q B;  2XPI A;  4NQ0 A;  4OVV A;  2XEH A;  5CCL A;  1QYM A;  1TJC A;  5BV1 A;  4XE0 A;  3FEY A;  2XRY A;  3D9K A;  1FVF A;  4FJZ A;  5B1A E;  4FJY A;  2KXP C;  4Y6C A;  4WND A;  1BD8 A;  2Y69 E;  3FU3 A;  1H6K A;  3ABL E;  3HYM B;  3AAA C;  4URK A;  1UN8 A;  3CVL A;  5KBA A;  4GTP A;  4F6R D;  3E34 A;  1A5E A;  3Q9U C;  2ZU6 B;  3FTW A;  4DX1 A;  1Z6T A;  3D9L A;  4C0E A;  3R9A B;  1XGW A;  4E6H A;  3E37 A;  5IY5 E;  1X81 A;  3ULY A;  3IHV A;  5M72 A;  3FU5 A;  2AWI A;  4KBQ A;  4JVS A;  3ASG A;  2YHC A;  3FFL A;  5FIO A;  3AG1 E;  4DUI A;  4FHK A;  1SA5 A;  3G2V A;  2H6H A;  3TL5 A;  3UIP C;  3L08 A;  3UIN C;  5CCM A;  5CEC B;  2R03 A;  1SW6 A;  5KCM A;  1MX2 A;  4GTR A;  4CGV A;  3GW4 A;  3U66 A;  3FTU A;  1RZ4 A;  1O1R A;  2VGE A;  1MQS A;  2EIL E;  1IKN D;  5AQ7 A;  3TWV A;  5A6C A;  4WAF A;  1HG2 A;  3CVP A;  3APD A;  2ION A;  3Q15 A;  5AYW D;  2F0Y A;  4I6G A;  3RRU A;  1TNY A;  1SVX A;  5HKP A;  1OCZ E;  2C0M A;  3L17 A;  5ARG A;  2EIK E;  3DSX A;  3EHQ A;  3QB2 A;  1N4P A;  4ATG A;  4GB9 A;  3LXU X;  2OND A;  2AXV A;  1Z5S C;  3FTZ A;  3UKU G;  2J9Q A;  3R7R A;  2ZXW E;  5D2M C;  5ITZ F;  1WY6 A;  2A5U A;  1TYQ G;  2IU1 A;  3HG0 D;  4HLL A;  4MLP A;  3UT7 A;  2KCL A;  4I1M A;  2BF0 X;  1N0R A;  2E2E A;  2FO1 E;  3C3O A;  3QWV A;  5EYP F;  5H7P A;  2DYS E;  3EHM A;  4PDX A;  2VTB A;  2KZT B;  2QY7 A;  3KEA A;  3I3N A;  1UOH A;  4L23 A;  3KSL A;  4HRN A;  3QAR A;  5ENN A;  3D9H A;  2GRM A;  2VJ8 A;  4LRZ A;  3PVL A;  2ETC A;  3ULE G;  3V79 K;  1ELW A;  2WVI A;  2ETA A;  3RU0 A;  3WXX A;  4Q96 A;  3T9K A;  4A3T A;  3ESK A;  1QNF A;  4HB5 A;  2EIM E;  2VSO E;  5A7D B;  4EZK A;  5BXO A;  2VYI A;  4GYY A;  4HNA D;  4AOF A;  3D3M A;  1P5Q A;  4AY5 A;  1Y8M A;  4PH4 B;  4UWK A;  3MEK A;  2BUG A;  3FUJ A;  2L0T B;  2BTD A;  1YYH A;  2ZIS A;  3ML8 A;  1B89 A;  4B0Z A;  4HFG A;  2X6F A;  3S2A A;  4HRL A;  1LD8 A;  4CGW A;  3SHF A;  4GA0 A;  2P9U G;  3ASO E;  1O1T A;  1H0A A;  5ANR A;  4WNE A;  5CBO A;  4P29 A;  4JD2 G;  2HR2 A;  3ZRH A;  4FA6 A;  3IKO B;  4I9C A;  5G05 C;  2X6K A;  1K3Z D;  2EQX A;  2R5S A;  4DX6 D;  4GPK A;  3TJP A;  3LPZ A;  3ZYQ A;  1UJK A;  2Y4T A;  3U4T A;  4G1T A;  3BU8 A;  3HVE A;  4TUM A;  2WXF A;  3R9M A;  3FUM A;  3CST A;  3QDN A;  3ESL A;  2XHE A;  2KCK A;  2WQH A;  3Q75 A;  2B6C A;  1V54 E;  2X6I A;  1A17 A;  4WWP A;  1E8W A;  4NIK A;  4IRU A;  2V0P A;  4XEI G;  2P9I G;  4YND A;  3L82 A;  4N2Q A;  3SI5 A;  3LJ3 A;  1DC2 A;  4AY6 A;  2WXH A;  3FWV A;  3UT8 A;  1S63 A;  3DXK G;  4JHK A;  4IYP A;  4UWL A;  5G2N A;  4J7W A;  2C0L A;  3SY2 A;  1MHQ A;  3FP3 A;  5B1B E;  4EEC A;  5EN5 D;  1OXJ A;  3FUE A;  3D9N A;  3EIJ A;  2H6I A;  4UQX A;  3LEW A;  4TXP A;  2OEV A;  3CHS A;  5LP0 A;  3C5R A;  4FAD A;  4MS6 A;  3ZKJ A;  1SQM A;  2VSY A;  1ZU2 A;  1HG5 A;  2MOW A;  2XS8 A;  5EDS A;  1TEZ A;  3MZL B;  3TXN A;  1NI1 A;  4F1S A;  4FLH A;  1N11 A;  3RO3 A;  2QC9 A;  4XKC A;  3SFZ A;  4RLY A;  4FC8 A;  2L6J A;  2J07 A;  3CVW A;  5ENS D;  3AJI A;  5JHB A;  3TWU A;  2DWZ A;  5CHE E;  4AEZ C;  3Q79 A;  4AXH A;  4ILH B;  4HOS A;  3ZU7 B;  4AM9 A;  3CEQ A;  3HXE A;  1N9A A;  1OWP A;  4Y6W A;  1NA3 A;  2WXN A;  1BU9 A;  5BW8 C;  3NB2 A;  1UG3 A;  3CHP A;  4B8C B;  3HXC A;  4KT6 B;  3TG4 A;  3UQ3 A;  2XS1 A;  3EJN A;  4OAU C;  5AAR A;  3D9P A;  3CQG B;  3QNK A;  3FHE A;  4HOT A;  1ZBP A;  2KC7 A;  2WPV A;  2LO6 A;  4TXR A;  4C48 B;  5AAO A;  3FH7 A;  2LSU A;  2OEW A;  5FWQ A;  3ZEF A;  3ZFW A;  2PM7 A;  3HXD A;  1IYG A;  2NSZ A;  4E85 A;  4PUC A;  3B7U X;  4DK5 A;  3SF4 A;  1DNP A;  2GRL A;  4HI8 A;  2PM6 A;  3MKR A;  2IFU A;  3NF1 A;  5G04 J;  3SFX A;  4GTM A;  2J4D A;  2X38 A;  3JUI A;  2XRZ A;  2P9N G;  2PQR A;  3TWW A;  4U96 D;  4G25 A;  3AG3 E;  4EBA G;  3FUH A;  4MBG A;  4GTS A;  3APF A;  2R59 A;  4HOR A;  2MHK A;  4GMR A;  2DZN A;  1E8X A;  3IHY A;  2OVF A;  5ENP D;  1HS6 A;  4CEM A;  4K0R A;  4ABN A;  2R2L A;  3FUK A;  3NBN B;  3UI2 A;  4L9P A;  3L9T A;  3HXF A;  1SA4 A;  5KNG A;  2Y4U A;  3DXM G;  4AP2 A;  3UXG A;  2V5Q C;  3CHR A;  4L7T A;  2A4Z A;  4ANX A;  3LJN A;  5LFA A;  4EZL A;  4PS7 A;  4N3A A;  4U04 A;  2JLB A;  2LXM A;  4AVX A;  2NXP A;  2WMO A;  4HRM B;  5ENQ D;  2IOS A;  2FI7 A;  3DSV A;  1IHB A;  4RG6 A;  2FO7 A;  4JB8 P;  2LAI A;  4JPS A;  3T5V A;  3JCK C;  1L5J A;  3LY7 A;  4I1O B;  2KBX A;  3E30 A;  3FTS A;  4U8V D;  4BTA A;  4HI9 A;  3TXM A;  1NA0 A;  3L22 A;  4I1A A;  4UI9 C;  3SBS A;  3CVV A;  3LVR E;  1TNZ A;  3FU0 A;  1BI8 B;  3Q7A A;  2BKG A;  2RG8 A;  2CHW A;  4FP7 A;  3KS2 A;  4J8F A;  3AU5 A;  4JW1 A;  5CRU A;  4BES A;  1HU3 A;  2GW1 A;  3L6A A;  4KVM A;  4I43 A;  1H2T C;  1NZN A;  5JJT A;  2XEN A;  1HE8 A;  4JEU A;  4L2L A;  5EX0 A;  2KZT A;  5B3S E;  2KAT A;  3B7R L;  2UWJ G;  4UUC A;  3JYS A;  2HM8 A;  2AXZ A;  5AQB A;  3V2O A;  5LCW C;  5EIL A;  2UY1 B;  3CIA A;  1JCR A;  1D8D A;  5C1D A;  1U2V G;  3PDN A;  5ENT D;  2VGX B;  3CK8 A;  4B89 A;  3O48 A;  4RQI A;  5FJY A;  4GTQ A;  1MX4 A;  3V31 A;  5T4Y A;  3QWW A;  4B8A A;  2ETB A;  3FH5 A;  5FT9 A;  2V5F A;  5EIB E;  2KCV A;  4GYO A;  4ME2 A;  2OV8 A;  4O6F A;  3ZN3 A;  3Q7F A;  2XZT G;  3UT4 A;  2ILR A;  3HRA A;  4FU3 A;  2J8S D;  4Z68 A;  3RRM B;  3PH0 C;  5KJL A;  2HYZ A;  3SD5 A;  3D9J A;  3LYA A;  1FT1 A;  2QFC A;  2WXO A;  2NYJ A;  3UTM A;  2XCC A;  4W9R A;  4L2Y A;  3KD7 A;  4A63 B;  4G8K A;  4GA1 A;  2XGM A;  3R7Q A;  3PE3 A;  1HFA A;  2LAH A;  2WQ6 A;  4I2W A;  1EDU A;  3MGB A;  3CQC B;  3PZ3 A;  2PNN A;  3JXJ A;  2CG2 A;  3Q9N C;  4GZD A;  2HE0 A;  4JHJ A;  5BUZ A;  4PS8 A;  4UWG A;  1LD7 A;  4KVO A;  2CHX A;  2I2O A;  3GZ1 A;  4O1O A;  3OTN A;  1AP7 A;  3MV3 B;  2VSN A;  1ZB1 A;  5AJD A;  3UM1 A;  4J8Y A;  1X5B A;  3S7F A;  1OWN A;  4NAC A;  3TWX A;  4JL0 A;  3FTY A;  3BG1 B;  4Q94 A;  5FQ4 A;  2GRQ B;  5JJ6 A;  1OUV A;  1KT1 A;  2CFZ A;  4CT0 A;  2J49 A;  3EHN A;  2IQC A;  2VQ2 A;  3Q47 B;  4ACK A;  5AIJ A;  2F8Y A;  1E8Y A;  4DI4 A;  3OXG A;  3G2S A;  3FTX A;  1IXV A;  3AG2 E;  4XI9 A;  2MYO A;  4C0M A;  1RW2 A;  5EX3 A;  3MKQ A;  3HDX A;  4XIF A;  5A23 A;  2V4H C;  3GYZ A;  1N0Q A;  5AN8 A;  1N4S A;  4RSY A;  2YNQ A;  4LEU A;  3B95 A;  3PE4 A;  5E76 A;  3O4Z A;  3ZNG A;  3FUI A;  2WXK A;  2XGS A;  4YDY A;  2QYU A;  3TWR A;  3JXI A;  2OCC E;  1MZC A;  1N95 A;  3PUK A;  4GAA A;  2A5E A;  3E33 A;  5CRV A;  3L13 A;  4WUY A;  2VTB B;  4BSZ B;  3UX4 A;  1AWC B;  4DLQ A;  3SNX A;  5FTP A;  5D0Q D;  4K5C A;  3S7B A;  2IO3 C;  2H6G A;  3I4G A;  5FQ6 A;  3LDZ A;  3I4R B;  4UWH A;  5FZQ A;  3SFY A;  3NZU A;  2P9P G;  2P9S G;  4MRU A;  4TXQ A;  4GCO A;  1HO8 A;  2EIJ E;  3ASH A;  3Q78 A;  2GRO B;  5D0O D;  1IHG A;  3DWL G;  1OT8 A;  3LS8 A;  3TAX A;  3TWQ A;  4CYM D;  1TN7 A;  2MRI A;  1WG0 A;  2IEJ A;  4GML A;  3T8K A;  1HH8 A;  4R7L A;  3ISM C;  3KAE A;  3ZXS A;  1OCC E;  4XKB A;  3K9I A;  1WDY A;  4EQF A;  1TNB A;  3VTX A;  4HOQ A;  4LUN U;  1MJ0 A;  4ATZ D;  3NOC D;  2XPZ A;  4ILG A;  5T3R A;  4U0U A;  4UWF A;  5G05 J;  1E7U A;  1OCR E;  5BPP A;  1QZ2 A;  3APC A;  2IY0 C;  4G24 A;  3RJV A;  2IO2 C;  2KM4 A;  3L54 A;  1H6O A;  2V4L A;  5C2Y A;  3ZHE A;  1TJF A;  3WG7 E;  4KYO B;  4GTT A;  5CED B;  3CKC A;  3U64 A;  3ULQ A;  5ANL A;  4HQD A;  2F37 A;  5BNW A;  1QBQ A;  3W9G A;  4JEH A;  3LVQ E;  3EU5 A;  1PC2 A;  1TR4 A;  3AS5 A;  4UQY A;  3PS6 A;  3C3R A;  2M63 A;  1KLX A;  3HVE B;  3CVY A;  4X8Q A;  1MX6 A;  3ML9 A;  3PRZ A;  3W9F A;  4RG9 A;  3T5X A;  3BG0 B;  1H2V C;  1Z3X A;  2RKK A;  3DST A;  4FUL A;  2J4B A;  2DZO A;  4YDE A;  3QC1 A;  4A1S A;  2DYR E;  5HI7 A;  4WWN A;  1TN6 A;  1BLX B;  2F8X K;  2JEK A;  2ZGD A;  3ZYL A;  3CGH A;  5FZR A;  4BER A;  4BWR A;  1H19 A;  3PUJ A;  4K5A B;  2WXQ A;  3IBE A;  4GZ6 A;  3FH8 A;  1ELR A;  3BEE A;  1KZO A;  2GRP B;  4ILI A;  3S7D A;  1UW4 B;  4M3O A;  4CCA A;  3FUL A;  3UPV A;  4GZ5 A;  1U3D A;  4IN3 B;  1BI7 B;  4KMO A;  3TGO A;  3FUN A;  3NOG D;  1OCO E;  1Q2Z A;  2Y3A A;  5DBK A;  2FBN A;  2XQ0 A;  3EUV A;  5ARF A;  2BKK B;  4JA7 A;  4N3B A;  4YVO A;  3ZYK A;  4LCT A;  1EPU A;  5AQ9 A;  1KT0 A;  1JCS A;  1HZ4 A;  1N4R A;  3PEV B;  1PAQ A;  4XI0 A;  3CHO A;  3V30 A;  4HOU A;  3FUF A;  2GRN B;  4G23 A;  3J5P A;  3U9W A;  1DVP A;  1IQU A;  3DSU A;  4HXI A;  5BXU A;  3U3W A;  3ABM E;  3C3Q A;  2XEV A;  2E0I A;  2JAB A;  1E90 A;  1ELK A;  4WWO A;  3QJZ A;  3IXE A;  4B94 A;  4G26 A;  4U7E B;  1G3N B;  1W3B A;  4H7Y A;  2XGO A;  5AQA A;  2EIN E;  2QZA A;  2R02 A;  4RVB A;  3ZIM A;  2AJA A;  4HS2 A;  3CHM A;  3B7B A;  3MA5 A;  1U3C A;  2R17 C;  2XEE A;  4V3I A;  4QFV A;  3V2X A;  3X2Q E;  1K8K G;  4K5B A;  4I17 A;  4CDN A;  3HIZ A;  4CRW A;  3CK9 A;  3AU4 A;  2CHZ A;  4HLE A;  1O5M A;  3CSF A;  1YA0 A;  5D66 A;  2VGX A;  1MYO A;  4I6E A;  2YIN A;  4G8L A;  4OVU A;  4LNU D;  2Y1L E;  2P9L G;  4N2S A;  4C9B B;  3VLE A;  1K1A A;  3ONL A;  3RO2 A;  2I6H A;  4BX9 A;  3EU9 A;  3UM3 A;  4I2Z A;  4OYS A;  4FHJ A;  4FLB A;  1N94 A;  2J08 A;  3FEX A;  4YDW A;  4GTO A;  5HS0 A;  3JUE A;  3NQP A;  2OOE A;  1DCQ A;  4LER A;  2WQ7 A;  3EIQ C;  1D8E A;  1YCS B;  1NFI E;  4ZFH A;  4A3V A;  3CKB A;  2BED A;  1HX8 A;  4AV7 A;  3PRE A;  5KNH D;  2GRR B;  3QKY A;  4BY6 A;  4CZ2 D;  5HQ8 A;  3N71 A;  3CVQ A;  3TWS A;  3IV0 A;  1K1B A;  3QWP A;  1S0P A;  2WXR A;  4GPM A;  4DLO A;  4OAV B;  4UI9 J;  4DX5 D;  2WM9 A;  3TG5 A;  4UI9 K;  4LSZ E;  3P2B A;  4J0U A;  1GW6 A;  3IEG A;  3HHM A;  4H7X A;  4KXK B;  1TN8 A;  3RIB A;  3DPD A;  3E4B A;  3ASN E;  2DCP A;  3PZD A;  2FF4 A;  5FQ7 A;  3B7T A;  4U07 A;  4BT8 A;  4O60 A;  2I1J A;  4HBD A;  4NUR A;  3ENE A;  3DBS A;  4WNG A;  3LY8 A;  2PZI A;  4GMJ A;  3RK6 A;  5E75 A;  4ANU A;  5LCW J;  2WXJ A;  3SQV A;  4K03 A;  3SZ7 A;  1JWF A;  3G2U A;  3BQO A;  1OWM A;  3T8M A;  3NZS A;  2LUH A;  3DSW A;  4GZ3 A;  3JQ0 A;  3MV2 B;  2YHE A;  4CDM A;  5CBN A;  3MX3 A;  5BV0 A;  3CVX A;  4U95 D;  5BT1 A;  4J6I A;  3CHQ A;  3RKV A;  4LNG A;  4YVQ C;  2V8S E;  5ENR D;  3NAW A;  2HO1 A;  2AW6 A;  1S70 B;  3RRN B;  4JXT A;  4DX7 D;  4G2V A;  4ANV A;  4TUU A;  1OWO A;  3EHR A;  2WB2 A;  4J8D A;  3UUX A;  3OXF A;  2FUL A;  4NRH B;  5LX8 A;  5J90 A;  4U63 A;  3FDH A;  2PQN A;  3RSE G;  1UN9 A;  1FPP A;  1E96 B;  1BPO A;  3PZ4 A;  4A1G A;  2OVB A;  4A55 A;  4DPR A;  3G2W A;  3C98 A;  3UKR G;  4GYW A;  3ZVV A;  2XZD G;  5EID A;  5CMW A;  1NL4 A;  2YQ8 A;  2P58 C;  4F1P A;  2CG3 A;  2IF4 A;  3MYV A;  2ZIR A;  4O1P A;  1O1S A;  1TNO A;  3HXB A;  4XX5 A;  2XPY A;  4JHR A;  3Q73 A;  5ENO D;  5JJ7 A;  2WXG A;  4QQI A;  3ONK A;  2RD0 A;  4HVB A;  2I1K A;  3PNT B;  3LKU A;  2AVP A;  1FVH A;  4LG6 A;  5G55 A;  4EPZ A;  5FIN A;  3AS8 A;  2WXM A;  3ZPJ A; 
#chains in the Genus database with same CATH homology
 2A5U A;  2FO7 A;  3CVN A;  3ZYL A;  2FEZ A;  2LAI A;  4GU5 A;  4JPS A;  3T5V A;  2IU1 A;  3JCK C;  3MJW A;  4MLP A;  1INZ A;  3UT7 A;  1L5J A;  2DIW A;  2KCL A;  3CGH A;  3LY7 A;  4I1O B;  3FU6 A;  4I1M A;  5FZR A;  2BF0 X;  4BWR A;  2E2E A;  1H19 A;  4N39 A;  3PUJ A;  4ANW A;  3FTS A;  3QWV A;  3FTV A;  2WXQ A;  3AS4 A;  3IBE A;  3GZS A;  4GZ6 A;  4BTA A;  3FH8 A;  3P1U A;  3UMV A;  1ELR A;  3EHM A;  4PDX A;  2VTB A;  2KZT B;  3BEE A;  2QY7 A;  3PNL B;  3I3N A;  3TXM A;  4L23 A;  4ILI A;  2J09 A;  3S7D A;  3EDT B;  1JWG A;  1UW4 B;  3D9O A;  4M3O A;  4F7A A;  4CCA A;  3MKQ B;  1NA0 A;  3FUL A;  4N3C A;  3UPV A;  3L22 A;  4F53 A;  4I1A A;  4UI9 C;  5EKQ D;  5LOZ A;  4GZ5 A;  1U3D A;  4IN3 B;  4CT4 A;  3FY4 A;  3SBS A;  3CVV A;  3QAR A;  3LVR E;  4KMO A;  3TGO A;  3FUN A;  1SZ9 A;  5ENN A;  3FU0 A;  2GRM A;  2VJ8 A;  3QK0 A;  2RG8 A;  2Y3A A;  4IUL A;  2CHW A;  3PVL A;  4LRZ A;  5DBK A;  2FBN A;  3LCA A;  2XQ0 A;  4JA9 A;  3ZGQ A;  4APO A;  4FP7 A;  5ARF A;  4JA7 A;  4N3B A;  1ELW A;  4UQZ A;  2WVI A;  3ASF A;  3D9I A;  4YVO A;  3KS2 A;  4J8F A;  3AU5 A;  4JW1 A;  4L1B A;  3VLD A;  1HU3 A;  3ZYK A;  4LCT A;  3RU0 A;  1EPU A;  3WXX A;  4Q96 A;  1KT0 A;  1VDY A;  2GW1 A;  3L6A A;  4KVM A;  1HZ4 A;  3PEV B;  4XI0 A;  1PAQ A;  1JUQ A;  3ESK A;  4A3T A;  3CHO A;  1QNF A;  4HOU A;  4I43 A;  1Z3Y A;  2VSO E;  5A7D B;  3FUF A;  1H2T C;  4EZK A;  2VYI A;  1NZN A;  5JJT A;  4G23 A;  1HE8 A;  4GYY A;  4BTB A;  3U9W A;  4JEU A;  1DVP A;  4AOF A;  3Q5M A;  4L2L A;  3D3M A;  5EX0 A;  1IQU A;  1P5Q A;  2KZT A;  3PEU B;  4J8E A;  4HXI A;  4AY5 A;  2KAT A;  3B7R L;  2UWJ G;  1N54 A;  1Y8M A;  4PH4 B;  4UWK A;  2WXP A;  3U3W A;  3MEK A;  2BUG A;  3JYS A;  2HM8 A;  2AXZ A;  3FUJ A;  3QOU A;  5LCW C;  2XEV A;  2L0T B;  2BTD A;  2UY1 B;  3CIA A;  3SBT B;  5C1D A;  2E0I A;  3PDN A;  3ML8 A;  1B89 A;  4B0Z A;  1E90 A;  1ELK A;  4HFG A;  4WWO A;  2X6F A;  3QJZ A;  2VGX B;  3CK8 A;  3S2A A;  3CV0 A;  4CGW A;  4B94 A;  4B89 A;  5AEN A;  2WXL A;  4G26 A;  3SHF A;  4GA0 A;  1W3B A;  4GCN A;  3O48 A;  4H7Y A;  5KJN A;  5FJY A;  2XGO A;  4XZ4 A;  3ZYM A;  5T4Y A;  4BSX A;  4RVB A;  2GGF A;  2WXI A;  3ZW3 A;  1H0A A;  3QWW A;  3ZIM A;  4B8A A;  3FH5 A;  4APF A;  1EF1 C;  4HS2 A;  5AJL A;  4WNE A;  5ANR A;  3CHM A;  3MA5 A;  1EYH A;  4P29 A;  3CK7 A;  1U3C A;  3D9M A;  2R17 C;  5FT9 A;  1XNF A;  2HR2 A;  4V3I A;  4JZY A;  2LNI A;  4QFV A;  2V5F A;  4I9E A;  3ZRH A;  4FA6 A;  2KCV A;  4GYO A;  3CR3 A;  1WM5 A;  3IKO B;  4I17 A;  4I9C A;  4CDN A;  5G05 C;  4ME2 A;  2OV8 A;  4O6F A;  3ZN3 A;  2Q7F A;  3HIZ A;  4CRW A;  2X6K A;  4G11 A;  2EQX A;  2X3M A;  4TRQ A;  3UT4 A;  2LSV A;  3CK9 A;  2ILR A;  2R5S A;  4ACL A;  4FU3 A;  4GPK A;  5KJK A;  3AU4 A;  3TJP A;  2CHZ A;  4WNF A;  3RRM B;  4HLE A;  3PH0 C;  1E7V A;  5KJL A;  3LPZ A;  3ZYQ A;  3CSF A;  4BX8 A;  2HYZ A;  5G04 C;  3SD5 A;  3D9J A;  1YA0 A;  3B7S A;  1UJK A;  2Y4T A;  3U4T A;  3LYA A;  4G1T A;  2QFC A;  2WXO A;  3HVE A;  2WXF A;  2VGX A;  2XCC A;  4W9R A;  4L2Y A;  3S7J A;  1LF8 A;  3KD7 A;  4I6E A;  4AIF A;  4GA1 A;  2XGM A;  2YIN A;  5JHA A;  3R7Q A;  3FUM A;  3OXL A;  2VSX E;  3VLF A;  3PE3 A;  4OVU A;  3GZ2 A;  1HFA A;  4GZC A;  2VGY A;  3ZPJ A;  2LAH A;  3CST A;  2WQ6 A;  3QDN A;  3ESL A;  2XHE A;  2KCK A;  2WQH A;  4I2W A;  4EBA A;  1EDU A;  4N2S A;  1HF8 A;  3G2T A;  3LY9 A;  1HXI A;  3MGB A;  3CQC B;  4C9B B;  4Q69 A;  5FZS A;  3VLE A;  3ONL A;  2CG2 A;  3RO2 A;  2I6H A;  2IJG X;  4BX9 A;  4CDR A;  4GZD A;  3ZHE B;  2X6I A;  4I2Z A;  1A17 A;  4OYS A;  3CVU A;  2X6J A;  4FHJ A;  4JHJ A;  2X6H A;  4WWP A;  5BUZ A;  4PS8 A;  4UWG A;  4FLB A;  3KEZ A;  4KVO A;  2CHX A;  2I2O A;  3L16 A;  1E8W A;  3GZ1 A;  3OTN A;  4IRU A;  2J08 A;  3FEX A;  3MV3 B;  2V0P A;  4U0S A;  2VSN A;  5AJD A;  2I9C A;  2L0I A;  4YND A;  4N2Q A;  3NQP A;  1X5B A;  3S7F A;  1OWN A;  3SI5 A;  4NAC A;  3LJ3 A;  4JL0 A;  2OOE A;  3FTY A;  1H2U A;  1PY1 A;  3Q49 B;  4AY6 A;  3BG1 B;  4Q94 A;  4EZJ A;  3MCX A;  4LER A;  5FQ4 A;  2WQ7 A;  2WXH A;  3FWV A;  5JJ6 A;  3UT8 A;  1OUV A;  1KT1 A;  2CFZ A;  3EIQ C;  3JQ1 A;  4CT0 A;  2J49 A;  3EHN A;  4JHK A;  3URZ A;  4IYP A;  1JPL A;  4UWL A;  2VQ2 A;  2XCB A;  2IQC A;  1E8Z A;  2C0L A;  1NP7 A;  1MHQ A;  3Q47 B;  3Q4A B;  5G2N A;  4ACK A;  5AIJ A;  3FP3 A;  2IOL A;  1E8Y A;  4A3V A;  5CMY A;  4EEC A;  4DI4 A;  3OXG A;  3G2S A;  3FTX A;  2DBA A;  4U0Z A;  4GA2 A;  3CKB A;  4XI9 A;  1HX8 A;  3FUE A;  4D10 C;  3B13 A;  1FCH A;  4C0M A;  3D9N A;  3EIJ A;  4F3V A;  4AV7 A;  4UQX A;  3LEW A;  3MKQ A;  3PRE A;  5EX3 A;  3QKY A;  4BY6 A;  3HDX A;  2L9B A;  3CHS A;  3ASD A;  4XIF A;  5A23 A;  5HQ8 A;  5LP0 A;  4FAD A;  3N71 A;  3VTY A;  3CVQ A;  4MS6 A;  3IV0 A;  3GYZ A;  4MKT A;  5FQ8 A;  1SQM A;  3QWP A;  3OAW A;  2C2L A;  4DJA A;  5J08 A;  2VSY A;  4AJW A;  1S0P A;  1ZU2 A;  2WXR A;  3FUD A;  3SGH A;  4RSY A;  1Y6I A;  2YNQ A;  4DLO A;  1UJJ A;  1HG5 A;  5T8I A;  2MOW A;  4LEU A;  1IQR A;  3PE4 A;  5E76 A;  4BT9 A;  5EDS A;  3O4Z A;  4PS3 A;  3FUI A;  2WXK A;  2XGS A;  4UI9 J;  2WM9 A;  4U8H A;  1TEZ A;  4KZ0 A;  3QAQ A;  3TG5 A;  4BFR A;  4UI9 K;  3PUK A;  4GAA A;  3MZL B;  2CFU A;  2PL2 A;  3P2B A;  4JC8 A;  4KZC A;  3TXN A;  3I5P A;  4J0U A;  4F1S A;  1GW6 A;  4FLH A;  3IEG A;  1WAO 1;  3HHM A;  4H7X A;  1N52 A;  3RO3 A;  4KXK B;  4J8S A;  4TV3 A;  1SZA A;  4XKC A;  3SFZ A;  3RIB A;  3L13 A;  4WUY A;  3DPD A;  4FC8 A;  2VTB B;  1OWL A;  3E4B A;  4I6J A;  2WMN A;  2L6J A;  3UX4 A;  1QQE A;  2J07 A;  4DLQ A;  5DIZ A;  4N5C A;  3SNX A;  3CVW A;  5FTP A;  2DCP A;  3CLJ A;  5D0Q D;  3PZD A;  3S7B A;  2NC9 A;  4DI3 A;  2FF4 A;  5JHB A;  2AXU A;  5FQ7 A;  5CHE E;  3I4G A;  3B7T A;  4U07 A;  5FQ6 A;  5KJM A;  4AEZ C;  3LDZ A;  2UY1 A;  4BT8 A;  4AXH A;  4ILH B;  3I4R B;  4HOS A;  2I1J A;  2XPI A;  4NQ0 A;  3ENE A;  4NUR A;  4OVV A;  4UWH A;  3DBS A;  3CEQ A;  4AM9 A;  5FZQ A;  3NZU A;  1TJC A;  3LY8 A;  4WNG A;  5BV1 A;  5CCL A;  2PZI A;  4XE0 A;  4GMJ A;  3FEY A;  4MRU A;  1OWP A;  2XRY A;  4Y6W A;  1NA3 A;  2WXN A;  3RK6 A;  4GCO A;  3D9K A;  5E75 A;  4ANU A;  5LCW J;  1HO8 A;  2WXJ A;  1FVF A;  5BW8 C;  1UG3 A;  3CHP A;  4FJZ A;  4B8C B;  3ASH A;  4FJY A;  5D0O D;  1IHG A;  4Y6C A;  3LS8 A;  4K03 A;  4KT6 B;  4WND A;  3TG4 A;  3TAX A;  3UQ3 A;  3SZ7 A;  1JWF A;  3EJN A;  3FU3 A;  1H6K A;  3G2U A;  1OWM A;  3HYM B;  2MRI A;  3D9P A;  4GML A;  3CQG B;  3QNK A;  4URK A;  1UN8 A;  3CVL A;  1HH8 A;  4R7L A;  3FHE A;  4HOT A;  3KAE A;  3T8M A;  3ZXS A;  3NZS A;  1ZBP A;  2KC7 A;  4XKB A;  2WPV A;  3K9I A;  2ZU6 B;  3FTW A;  2LO6 A;  1Z6T A;  4GZ3 A;  3D9L A;  4EQF A;  3VTX A;  3R9A B;  4C0E A;  1XGW A;  3JQ0 A;  4HOQ A;  4E6H A;  3MV2 B;  2YHE A;  4LUN U;  4CDM A;  3FH7 A;  3IHV A;  3MX3 A;  2LSU A;  5FWQ A;  2XPZ A;  4ILG A;  3ZEF A;  2PM7 A;  3ZFW A;  5T3R A;  4U0U A;  5M72 A;  3FU5 A;  1IYG A;  4UWF A;  2NSZ A;  5G05 J;  2AWI A;  5BV0 A;  1E7U A;  3CVX A;  4KBQ A;  5BT1 A;  4JVS A;  4E85 A;  4J6I A;  3ASG A;  4PUC A;  3B7U X;  4DK5 A;  5BPP A;  1QZ2 A;  2YHC A;  3FFL A;  3SF4 A;  1DNP A;  3CHQ A;  2GRL A;  3APC A;  3RKV A;  4YVQ C;  2PM6 A;  3MKR A;  4FHK A;  2V8S E;  2IFU A;  3G2V A;  2HO1 A;  3TL5 A;  2AW6 A;  4G24 A;  3NF1 A;  3RRN B;  5G04 J;  3RJV A;  3L08 A;  4JXT A;  2KM4 A;  2J4D A;  5CCM A;  2X38 A;  3L54 A;  4G2V A;  4ANV A;  3JUI A;  2XRZ A;  5KCM A;  4TUU A;  2PQR A;  4CGV A;  1OWO A;  2V4L A;  4G25 A;  2WB2 A;  4EBA G;  4J8D A;  3UUX A;  3OXF A;  5C2Y A;  3ZHE A;  1TJF A;  2FUL A;  3GW4 A;  4NRH B;  5LX8 A;  3U66 A;  3FUH A;  4KYO B;  5J90 A;  3FTU A;  3APF A;  4U63 A;  3CKC A;  3U64 A;  2R59 A;  3ULQ A;  5ANL A;  4HOR A;  3FDH A;  2PQN A;  1MQS A;  1UN9 A;  5BNW A;  1E96 B;  2MHK A;  1BPO A;  4A1G A;  4JEH A;  2OVB A;  3LVQ E;  1E8X A;  3IHY A;  2OVF A;  4A55 A;  1HS6 A;  4DPR A;  1PC2 A;  3AS5 A;  4CEM A;  3G2W A;  4K0R A;  4ABN A;  3C98 A;  4UQY A;  3PS6 A;  2M63 A;  3FUK A;  1KLX A;  5A6C A;  3HVE B;  3CVY A;  4GYW A;  4WAF A;  3ZVV A;  3ML9 A;  1HG2 A;  3PRZ A;  3CVP A;  5CMW A;  3APD A;  4RG9 A;  2ION A;  3Q15 A;  5AYW D;  2YQ8 A;  3T5X A;  2Y4U A;  2P58 C;  3BG0 B;  1H2V C;  1Z3X A;  4AP2 A;  4I6G A;  3RRU A;  2CG3 A;  2IF4 A;  3MYV A;  4FUL A;  3CHR A;  4L7T A;  2A4Z A;  2J4B A;  4XX5 A;  2C0M A;  3L17 A;  2XPY A;  4ANX A;  5ARG A;  5LFA A;  3QB2 A;  4JHR A;  3QC1 A;  4EZL A;  4PS7 A;  4N3A A;  2WXG A;  4U04 A;  2JLB A;  4A1S A;  4ATG A;  3ONK A;  5JJ7 A;  2RD0 A;  4HVB A;  4GB9 A;  4AVX A;  2I1K A;  3PNT B;  3LXU X;  3LKU A;  2NXP A;  2AVP A;  2WMO A;  1FVH A;  5HI7 A;  2OND A;  2AXV A;  2IOS A;  4WWN A;  2FI7 A;  3FTZ A;  5G55 A;  4EPZ A;  2J9Q A;  4RG6 A;  3R7R A;  3AS8 A;  2JEK A;  2WXM A;  1WY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...