3D9IA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
138
structure length
138
Chain Sequence
EAVKTFNSELYSLMDMKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein 16
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 54
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9iA00
4FU3A 3ZYQA 1UJKA 1JWGA 2V8SE 2DIWA 3G2UA 3ZYMA 4GZDA 4FLBA 1LF8A 3CLJA 1HX8A 3D9IA 1DVPA 1XGWA 2LO6A 3D9MA 3ZYLA 4Q96A 3G2VA 3ONLA 1HF8A 1MHQA 2L0TB 1SZ9A 1HFAA 1UJJA 1HG5A 3D9JA 3D9OA 3D9LA 1ELKA 1H0AA 3D9PA 2QY7A 3D9NA 4NACA 2MOWA 3G2TA 5LP0A 1SZAA 1VDYA 2L0IA 5CMYA 4HFGA 5CMWA 1JWFA 1JPLA 3LDZA 5J08A 2BF0X 1INZA 2KM4A 1HG2A 1X5BA 3G2SA 3G2WA 1JUQA 3ONKA 4JXTA 1EDUA 4Q94A 4AVXA 2DCPA 3D9KA 1PY1A 4GZCA 3RRUA 3ZYKA 5LOZA 1EYHA
chains in the Genus database with same CATH superfamily
5LX8A 3G2UA 2V4HC 4I43A 4UI9J 3SZ7A 3RKVA 2GROB 3X2QE 2BKGA 4U63A 2CHZA 3PZ1A 2I6HA 2ETBA 1IKND 4J8SA 2YHCA 2DVWA 2ONDA 4AXHA 3ZNGA 2WXHA 1OCCE 2EIKE 4L1BA 1KT1A 2CG2A 2F0YA 4Y6WA 3CVXA 5B3SE 5G05C 1X81A 2XPYA 1YCSB 4PS7A 1BU9A 2AWIA 4XEIG 1D9SA 4UWKA 3V30A 5CRVA 2C0LA 5FZSA 4A3VA 3TG5A 3SFYA 1EF1C 3MA5A 2FEZA 5G04J 1MX6A 4N2QA 3D9PA 2J07A 4C0MA 3IKOB 4CDNA 1JCQA 2ILRA 1KZOA 3ASHA 3L9TA 4EQFA 3EHNA 2ZGDA 5LFAA 5ARGA 1PAQA 5BW8C 4A55A 3CV0A 2AXUA 3NBNB 4GTOA 3ASOE 3L17A 4WWPA 3F6QA 3GW4A 4LRZA 4XZ4A 3JXJA 3IEGA 3UM1A 1HH8A 4HS2A 2ZXWE 3ZPJA 3EDTB 3BEEA 5FZRA 2JABA 3LY7A 2X6IA 4TRQA 4DX5D 2NXPA 4JZYA 2KZTA 4G24A 3B7SA 1A17A 4FC8A 1SZ9A 2XZTG 4CDRA 3U64A 3NOCD 3CHPA 4URKA 1N4RA 2P58C 1JWFA 2EQXA 4PH4B 1JPLA 4XI0A 1DNPA 4PS8A 1K8KG 3AS4A 1FT2A 2P9LG 5AYWD 4PUCA 3AG2E 3MKQA 3ZKJA 5AENA 2NC9A 4NIKA 3GZSA 4GMRA 5CMWA 4G23A 4MLPA 3DPYA 4UWLA 3OAWA 3Q73A 3ZU7B 1WY6A 4JB8P 5FZQA 1HF8A 2LSVA 3D9OA 3SGHA 2PZIA 1K1BA 1TNUA 3FULA 3T9KA 3AAAC 3SF4A 4AEZC 3R9MA 2P9PG 2ZGGA 3P1UA 1V55E 3TXMA 1QZ2A 2EINE 1WG0A 3HXDA 4JEUA 4Q96A 4N2SA 3T8KA 1N4QA 2VJ8A 2CHWA 1N4SA 1OCOE 3LXUX 5C1DA 2Y69E 1TR4A 4H7XA 3CVQA 5LCWC 1OY3D 3Q75A 4O6FA 2VSYA 4YDOA 3I4GA 2FO1E 4FLHA 4DUIA 2GRRB 4YNDA 3CIAA 1E90A 5AJLA 1O5MA 4J0UA 3ZXSA 4FU3A 1YMPA 1N95A 4GCNA 4LCTA 2NSZA 1DVPA 3PH0C 3NOGD 2XENA 3DSUA 3SQVA 3CQGB 4J8EA 2NYJA 1HU3A 1TNYA 3T5XA 3U3WA 4L2LA 4Q94A 3AJIA 4ILHB 3U66A 2V8SE 2X6KA 5EX3A 4AY5A 4JHRA 2ZIRA 1NP7A 2KCLA 2YQ8A 2J49A 4Y6CA 5H7PA 1LTXA 2CG3A 2WXGA 3C3QA 3FEYA 3ESLA 3DEOA 2DYRE 4M7CA 2VGYA 5D0QD 1OWLA 2XS1A 4UI9C 4EBAG 3V79K 4JHKA 2V5FA 3DBSA 2GRPB 1MYOA 4ME2A 2HR2A 2MYOA 4GPMA 3KEAA 3Q49B 5EYLA 4OVVA 1HE8A 1BPOA 4N3BA 4L9PA 3LPZA 3UT4A 3CVVA 2IF4A 5B1AE 4MBGA 1INZA 2P9UG 2CFUA 3L22A 5CBOA 4FJYA 1YYHA 2Y0BG 4OAVB 3CSTA 5AAOA 3TWWA 4G8LA 4WNGA 5G04C 1SQMA 4FHJA 4GA2A 3ISMC 5AQAA 4UWFA 1H19A 3ASGA 4AV7A 2QZAA 1BI8B 2XEHA 4UI9K 1H2VC 3PEVB 4CT0A 3DSVA 1IXVA 3HXBA 3ASNE 3ABLE 3APFA 2IONA 1HFAA 3L13A 4HB5A 5M72A 4HBDA 1NI1A 3PNTB 5KJMA 2BF0X 4APOA 5BNWA 2ETAA 2HE0A 2VTBA 5E75A 1EPUA 5A7DB 4LUNU 3ZYQA 3W9GA 5FIOA 4GB9A 3WXXA 5JHAA 4ANUA 2MHKA 3HHMA 2LUHA 3EHRA 3DSWA 4I1OB 3JYSA 1WM5A 2PM7A 3L82A 2VGXA 5BXUA 3CVUA 1NFIE 4B89A 2DZNA 2HM8A 3FTWA 4TUUA 2KC7A 4WAFA 2R59A 4U0ZA 1U3DA 2WXFA 4DK5A 5CBNA 4DX7D 1K3ZD 3MV2B 4GTPA 3LJ3A 2P9SG 3SHFA 1LF8A 4M3OA 5EILA 4GMLA 3D9LA 4NRHB 5FTPA 3CSFA 4CEMA 4XIFA 3E4BA 3QDNA 3U4TA 4F3VA 2QYJA 1EYHA 4GYWA 3IHYA 1DCEA 1DC2A 4TV3A 2IJGX 1ELWA 1K1AA 5KWDA 4B8CB 1O1TA 3G2VA 5EKQD 2XPZA 3MZLB 3HXFA 1V54E 3ZHEB 2XGMA 1H6KA 3EIJA 3TXNA 2YINA 4I6JA 3BG0B 4N39A 4DRXE 3DSSA 1RW2A 3VTXA 4K5CA 4I1AA 1KLXA 3HVEB 1N0QA 3TWUA 2WQHA 4UUCA 4BEPA 5JJTA 3UM0A 4GPKA 4RLYA 3VLDA 2OVFA 3MV3B 2XQ0A 3TJPA 3WG7E 4U96D 4BERA 1TNOA 4RG6A 5D2MC 3HXEA 4JW1A 3J5PA 3L16A 1HG2A 4AY6A 1FVFA 2WXJA 3B13A 1KT0A 3CR3A 2WMOA 1YA0A 4JA7A 2VSNA 5ENTD 4HORA 3BQOA 4EZLA 1UJJA 4ATZD 5LP0A 3PVLA 1D8DA 3MGBA 3EU9A 3GYZA 2KCVA 3S7FA 2KM4A 5HI7A 2R2LA 4KZCA 1OXJA 4BSZB 3PEUB 4JA9A 2XRZA 5ENSD 3E34A 3CVNA 4GMJA 3NZSA 2H6IA 2IQCA 3JQ1A 1QBQA 4RG9A 3LY8A 1JWGA 1TN8A 2KATA 3AG1E 5JJ7A 5CRUA 2FI7A 4GA0A 5BPPA 3O48A 4A3TA 3ULQA 3B7UX 2F8YA 4N5QA 3FEXA 4I2WA 1N52A 2P9IG 2L0IA 1OUVA 3L54A 3VLFA 3IV0A 3N71A 1SVXA 4DX2A 2WQ6A 3C5RA 4U95D 3ENEA 2XGSA 2X38A 2I2OA 4FP7A 3PZ3A 5CEAA 4RVBA 3SY2A 2L6BA 2P9KG 2RFAA 2X6HA 1NA3A 3PUKA 4J6IA 2FF4A 4G8KA 5ENOD 4NQ0A 3RRUA 4GTTA 2PL2A 3ML8A 3DXKG 2RG8A 4IYPA 4GZDA 5CCMA 2FBNA 1E8WA 1WAO1 2AVPA 3TWRA 3ASDA 3E32A 4HI8A 4K0RA 5FQ4A 1E7VA 3CK8A 2Y1LE 2PM6A 3FU0A 4ABNA 2Y3AA 3PDNA 4U0UA 4AJWA 3FP3A 3FH5A 2B0OE 1W3BA 5BV1A 4U04A 4HVBA 2PQRA 5AQ7A 3FUKA 3W9FA 5KJKA 3V2OA 5BT1A 3UT8A 3FUNA 4OAUC 3PS6A 5KBAA 4NURA 4LNGA 4RSYA 3S2AA 2WM9A 4UQXA 2Y4UA 3HDXA 3LS8A 4CGVA 2J4BA 2KCKA 2WQ7A 1SW6A 1N9AA 3SI5A 4K03A 5HRYA 3MKRA 3RRMB 1AWCB 3FDHA 4BESA 3JQ0A 3AG4E 2WXPA 3QB2A 4GYOA 4TXQA 3CVYA 3CK9A 4GZCA 4NACA 1S63A 4GZ3A 2IEJA 1E7UA 2EIME 4KT6B 1OT8A 4G26A 3Q7AA 4KVOA 3FTYA 3TG4A 2VQ2A 2LO6A 2QC9A 3Q4AB 2QY7A 3ZEFA 2LXLA 1GW6A 5HKPA 4G1TA 4PDXA 4XI9A 1U2VG 3CHSA 1B89A 3TAXA 4J8YA 3JUIA 3FU3A 3TGOA 2J4DA 2L0TB 4HLLA 1HG5A 2GW1A 3QOUA 4CYMD 1Y8MA 4X8QA 2F37A 5KCMA 3ASFA 3Q47B 2GRMA 1Q2ZA 2KBXA 4K5BA 5KNHD 4ILIA 5ENNA 2L9BA 4DLQA 3FUEA 1DCQA 3Q7FA 2Y4TA 2GRQB 2XS8A 3AU5A 2IFUA 3DSXA 4HRNA 3L6AA 2HO1A 4HOTA 3ML9A 5B1BE 1E8ZA 1BI7B 2CHXA 4ZHBA 2WXRA 4BTAA 2ZISA 2PQNA 4YVOA 1H2TC 1IQRA 4TXRA 3PE4A 2LAHA 3CVPA 2IOLA 2DBAA 3PZDA 4I2ZA 4AM9A 3Q15A 3RAUA 3NAWA 3HYMB 2MOWA 3QWWA 4N3CA 5ENQD 2LAIA 3AU4A 4LNBA 4HNAD 2WXKA 4JEHA 3RIBA 1KZPA 2XHEA 1BLXB 3ABME 5A6CA 4I6GA 1NL4A 1FVHA 3CLJA 1HX8A 1N0RA 3S7JA 2EILE 5KNGA 2J08A 1IYGA 3ZFWA 2VGEA 1OCRE 3FTZA 3S7BA 2A5EA 4FJZA 4IN3B 1N11A 5KJLA 4JXTA 1LD8A 2PNNA 1QYMA 3I3NA 2BEDA 2AXVA 5CEDB 3QC1A 2F8XK 4J8DA 2R17C 4UWGA 1TEZA 3LY9A 4DJAA 3ZYMA 3U9WA 3EHMA 4J7WA 3AS5A 4HFGA 2CFZA 2P9NG 3UQ3A 3HRAA 1AP7A 4BSXA 3QWPA 2DZOA 1MZCA 5JJ6A 3QWVA 4MKTA 3MJWA 3MEKA 3Q78A 1MX4A 2UY1B 4YDEA 5FWQA 2C0MA 4GCOA 4JC8A 4FADA 4GZ6A 4DX6D 1N54A 3T5VA 4I9CA 4L2YA 1QQEA 3HXCA 4B8AA 4AP2A 4JL0A 4B94A 3V2XA 4JVSA 3G2TA 5CMYA 1S0PA 2E2EA 4ANVA 4DX1A 4YDWA 2FO7A 2ZU6B 4IULA 4BT9A 1Z3XA 3DPDA 3IBEA 4APFA 3SD5A 2BKKB 3LKUA 3AG3E 2E0IA 3TWXA 1TYQG 4CT4A 4ANWA 2RFMA 1OWNA 4JPSA 3FUDA 2V0PA 2DCPA 4ACKA 4XX5A 3ULEG 5EIBE 4LSZE 3CEQA 3ZGQA 4O60A 3BU8A 4CCAA 3FU6A 4KMOA 5ARFA 2Q7FA 4FULA 4C9BB 1ELRA 3ABKE 5E76A 4U07A 3D9KA 1TJCA 2X6FA 3FUJA 4P29A 3J5QB 5DIZA 3D9HA 3GZ2A 2OV8A 4O1PA 4F6RD 4IRUA 1IHBA 3ZYLA 1TJFA 3UI2A 4G11A 5CHEE 5BXOA 2RKKA 3UUXA 5T4YA 3RK6A 3RJVA 4TUMA 3UIOC 4EBAA 3PREA 2H6FA 2B6CA 1N4PA 3ZUVB 1U3CA 5AQBA 2WMNA 4I17A 1IQUA 5AN8A 2VSOE 1E96B 5AJDA 3UKUG 3G2WA 1JUQA 1UW4B 1Z3YA 5EX0A 3SFZA 4WUYA 1OWOA 2IU1A 4U7EB 4HOQA 3ZN3A 2OVBA 2J8SD 5A23A 3KD7A 1ZB1A 4DLOA 4GTVA 4B93B 3KSLA 4AIFA 4GTSA 1G3NB 1H2UA 2AW6A 4ZFHA 1FCHA 3TWSA 5ITZF 3DEPA 4JHJA 3ZIMA 2A4ZA 3AS8A 3FUHA 5AARA 3APDA 3URZA 3ZHEA 3CKCA 1MHQA 2KZTB 1MX2A 3C98A 4L23A 1HS6A 4LERA 5FQ7A 3C72A 1Z5SC 2GRNB 3B95A 5JMND 3DSTA 3L08A 3HVEA 3MX3A 3FUMA 3FY4A 2WVIA 3O4ZA 4MS6A 4HI9A 3MKQB 3PZ4A 3ESKA 1UN9A 3R7QA 1SZAA 4DI3A 2HYZA 3JUEA 4EHMA 3LCAA 4GYYA 4CZ2D 1ZU2A 3JCKC 3ZW3A 3LVRE 4E6HA 3Q9NC 3NZUA 4QFVA 3SO8A 1UN8A 3HG0D 3V31A 2WPVA 2DIWA 3LYAA 4I9EA 5CECB 3ONLA 4BFRA 4QQIA 1NZNA 5FQ8A 4BWRA 4U8YD 1BD8A 1E8YA 4H7YA 1JCRA 5KJNA 4XKBA 4HRLA 4UQYA 4BTBA 3FH8A 4WWNA 4F7AA 4A1GA 1D8EA 4TXPA 4GA1A 4HLEA 3PZ2A 3JXIA 4ATGA 4KYOB 3OTNA 5ENPD 4A1SA 3UTMA 4AVXA 5BUZA 4KBQA 3R9AB 2R05A 3E37A 4BY6A 2H6HA 3C3RA 3CHRA 3S7DA 4FHKA 3R7RA 5IY5E 3SFXA 4D10C 2YHEA 3TWQA 4ANXA 3QKYA 5ENRD 4F1SA 3RRNB 2MRIA 2DWZA 3BG1B 1UJKA 2JEKA 5T8IA 3EU5A 3FUIA 1OWPA 2C2LA 4V3IA 5CERB 3B7TA 3CVLA 2BUGA 5J90A 5EDSA 3EIQC 1FT1A 5G2NA 3SBTB 2AJAA 4I6EA 3LVQE 2KXPC 4B0ZA 2AXZA 3OXGA 3UINC 2BTDA 4UWHA 3RSEG 4DPRA 2M63A 4N3AA 3T8MA 4F1PA 1P5QA 5DBKA 2A5UA 2I9CA 5CCLA 3FTSA 3ONKA 3C3OA 5LOZA 4W9RA 3CKBA 4RQIA 1JCSA 1TNZA 3UKRG 4G25A 2WXQA 5FT9A 5G55A 2XCCA 3QNKA 4G2VA 2WXNA 3TWTA 3TWVA 3RO3A 1OWMA 1TN7A 2RD0A 1KPSB 4CGWA 3OXLA 5AQ9A 4OYSA 2OCCE 4KVMA 4I1MA 5HS0A 3RO2A 1XGWA 3D9MA 3APCA 4EZKA 2DYSE 2WXMA 2VYIA 3ZXPA 3D9JA 3LEWA 4L7TA 3MCXA 1E8XA 1SA5A 3VTYA 3Q5MA 5AIJA 5ANRA 3PE3A 2I1KA 4KZ0A 2IO3C 3KEZA 3ZRHA 4N5CA 4EPZA 4EZJA 2LSUA 2OOEA 3Q79A 3Q9UC 3E30A 4HRMB 1HO8A 5D0OD 3I4RB 5G05J 3EJNA 2GRLA 3SBSA 4R7LA 3RU0A 3FU5A 2WB2A 4F53A 4MRUA 3GZ1A 4C0EA 3DWLG 2WXIA 4LG6A 3CK7A 1UG3A 2XEEA 3TL5A 4E85A 1VDYA 5HQ8A 3G2SA 2IO2C 2JLBA 2VSXE 1S64A 5EIDA 2XEVA 3FUFA 3NQPA 2H6GA 2VTBB 2UWJG 4CDMA 1MQSA 3K9IA 4LEUA 2XCBA 4KXKB 3NF1A 2XZDG 1IHGA 2GGFA 5BV0A 2R5SA 3HIZA 4Q69A 3CGHA 2FULA 3LDZA 1X5BA 3B7BA 3UT7A 1NA0A 3EUVA 4K5AB 4U0SA 3CHMA 2VGXB 3UX4A 1LD7A 4PS3A 3UXGA 4HOSA 3D3MA 1Z6TA 4BX9A 1HZ4A 3FTVA 5C2YA 1H0AA 1QNFA 3UM2A 3I5PA 3PUJA 2QFCA 3QK0A 4ILGA 3CHQA 4GAAA 4Z68A 4YVQC 4HOUA 1O1SA 1A5EA 3MYVA 3QARA 4WNFA 3CVWA 1Y6IA 5FJYA 2YNQA 1HXIA 4DI4A 4U8VD 4BT8A 3ZVVA 4HXIA 5FQ6A 3FTXA 2OEWA 1PY1A 2V5QC 2IY0C 2LXMA 3FTUA 4HQDA 4C48B 4YDYA 4XE0A 4FA6A 3D9NA 4WNDA 3CQCB 4CRWA 3FFLA 2X3MA 3DXMG 4LNUD 1PC2A 3P2BA 4AOFA 1H6OA 4GZ5A 2I1JA 2P2CP 3CHOA 5J08A 4GU5A 4WWOA 4OVUA 5ANLA 1EDUA 1L5JA 4ACLA 2WXOA 2XGOA 3FHEA 3IHVA 3VLEA 1UOHA 5FINA 2ETCA 1O1RA 4U8HA 3NB2A 4UQZA 1TNBA 1TN6A 1H6PA 4GTMA 4XKCA 1S70B 4GTRA 3KSQA 5D66A 1N94A 2J9QA 4GTQA 3LJNA 4O1OA 5LCWJ 1ELKA 2XRYA 2L6JA 3B7RL 3FWVA 3DRAA 3QAQA 1ZBPA 3BUAA 2R03A 2OEVA 3FH7A 3QJZA 2WXLA 4BETA 2V4LA 3UM3A 4FLBA 3D9IA 3E33A 3UMVA 2UY1A 2R02A 5JHBA 4JD2G 3OXFA 4BX8A 3SNXA 2IOSA 1FPPA 3PRZA 3ULYA 3EHQA 2J09A 4A63B 3ZYKA 5T3RA 2LNIA 4EECA 1XNFA 3KS2A 2EIJE 2XPIA 1OCZE 2QYUA 5EN5D 4WNEA 3UIPC 4J8FA 1WDYA 5JA4D 3UPVA 1MJ0A 1SA4A 3IXEA 3PNLB 2X6JA 1RZ4A 3KAEA 5EYPF
chains in the Genus database with same CATH topology
3ZYQA 4BY6A 4GB9A 3WXXA 5LX8A 3G2UA 5JHAA 4ANUA 2MHKA 4I43A 3CHRA 4UI9J 3HHMA 4I1OB 3S7DA 3SZ7A 3RKVA 3JYSA 4FHKA 3R7RA 1WM5A 2PM7A 4ILIA 5ENNA 4D10C 2L9BA 4U63A 2YHEA 4DLQA 3FUEA 2CHZA 2I6HA 4ANXA 3QKYA 2Y4TA 4J8SA 2VGXA 4F1SA 2YHCA 2MRIA 3RRNB 3AU5A 3CVUA 4B89A 2IFUA 2ONDA 3L6AA 4AXHA 3BG1B 2HO1A 4HOTA 1UJKA 2WXHA 2JEKA 3ML9A 2HM8A 3FTWA 5T8IA 4TUUA 2KC7A 4WAFA 2R59A 4L1BA 1E8ZA 1KT1A 2CHXA 2CG2A 2WXRA 3FUIA 4BTAA 4Y6WA 4U0ZA 3CVXA 1U3DA 1OWPA 5G05C 2WXFA 2C2LA 4V3IA 2PQNA 4DK5A 2XPYA 4YVOA 1H2TC 1IQRA 3MV2B 3PE4A 4PS7A 3B7TA 2AWIA 3CVLA 2BUGA 2LAHA 3LJ3A 3CVPA 5J90A 5EDSA 2IOLA 3EIQC 2DBAA 4UWKA 5G2NA 3SBTB 1LF8A 3SHFA 4I6EA 2C0LA 5FZSA 3LVQE 3PZDA 4M3OA 4A3VA 4I2ZA 3TG5A 4B0ZA 2AXZA 4AM9A 3OXGA 1EF1C 3Q15A 4GMLA 2BTDA 3MA5A 2FEZA 5G04J 4UWHA 4N2QA 3D9LA 4NRHB 3HYMB 3D9PA 4DPRA 2J07A 2M63A 5FTPA 2MOWA 3CSFA 4N3AA 4CEMA 4XIFA 3T8MA 3E4BA 3QWWA 1P5QA 4N3CA 5DBKA 3QDNA 2A5UA 2LAIA 2I9CA 5CCLA 3AU4A 4C0MA 3U4TA 3FTSA 3IKOB 3ONKA 4CDNA 4F3VA 2ILRA 3ASHA 4EQFA 3EHNA 2WXKA 4JEHA 5LOZA 1EYHA 4W9RA 4GYWA 2XHEA 3IHYA 3RIBA 5A6CA 4I6GA 3CKBA 3CLJA 1FVHA 4TV3A 5LFAA 1HX8A 1ELWA 2IJGX 4B8CB 3S7JA 5ARGA 2J08A 3G2VA 1IYGA 5EKQD 4G25A 2WXQA 3ZFWA 1PAQA 2XPZA 3FTZA 3MZLB 5FT9A 5BW8C 3S7BA 3ZHEB 2XGMA 5G55A 2XCCA 1H6KA 3EIJA 3QNKA 4FJZA 4G2VA 3TXNA 2YINA 2WXNA 4IN3B 5KJLA 4JXTA 3RO3A 4A55A 1OWMA 3CV0A 3BG0B 2AXUA 2RD0A 4I6JA 3I3NA 4N39A 3OXLA 4CGWA 4OYSA 4KVMA 3VTXA 2AXVA 3L17A 4WWPA 4I1MA 4I1AA 3QC1A 4J8DA 3RO2A 2R17C 3GW4A 4LRZA 1XGWA 3D9MA 1KLXA 3APCA 3IEGA 4UWGA 4XZ4A 4EZKA 3HVEB 1HH8A 3LY9A 2WXMA 1TEZA 4DJAA 2VYIA 3ZYMA 3D9JA 2WQHA 3LEWA 4HS2A 4L7TA 3U9WA 3ZPJA 3EHMA 3MCXA 3AS5A 4HFGA 3EDTB 2CFZA 5JJTA 1E8XA 3VTYA 3BEEA 4GPKA 3Q5MA 5FZRA 3VLDA 3LY7A 5AIJA 3UQ3A 2OVFA 2X6IA 3MV3B 5ANRA 4TRQA 2NXPA 2XQ0A 3PE3A 4BSXA 2I1KA 4JZYA 3TJPA 4KZ0A 3KEZA 3QWPA 2KZTA 4G24A 3ZRHA 4N5CA 5JJ6A 4EPZA 3QWVA 4EZJA 3B7SA 4MKTA 2LSUA 2OOEA 1A17A 4FC8A 1SZ9A 3MJWA 3MEKA 4CDRA 4RG6A 3U64A 2UY1B 1HO8A 5D0OD 5FWQA 3I4RB 5G05J 3EJNA 3CHPA 4URKA 2GRLA 4JW1A 2P58C 1JWFA 2C0MA 2EQXA 3L16A 1JPLA 4PH4B 3SBSA 4R7LA 1HG2A 3RU0A 4GCOA 1FVFA 2WXJA 3B13A 3FU5A 4XI0A 1KT0A 1DNPA 4AY6A 3CR3A 4JC8A 4PS8A 4FADA 2WB2A 2WMOA 3AS4A 4F53A 1YA0A 4GZ6A 4MRUA 3GZ1A 4C0EA 4JA7A 5AYWD 1N54A 2VSNA 4PUCA 3T5VA 2WXIA 4I9CA 3MKQA 3CK7A 4L2YA 1QQEA 4HORA 1UG3A 5AENA 4B8AA 4AP2A 4EZLA 4JL0A 1UJJA 4B94A 3TL5A 2NC9A 4JVSA 3G2TA 4E85A 5LP0A 3PVLA 5CMYA 1VDYA 3MGBA 1S0PA 3GZSA 2E2EA 5CMWA 3GYZA 4ANVA 4G23A 5HQ8A 4MLPA 2KCVA 3S7FA 2KM4A 3G2SA 5HI7A 2FO7A 2ZU6B 4IULA 4BT9A 2JLBA 1Z3XA 2VSXE 3DPDA 4KZCA 3IBEA 3PEUB 4JA9A 4APFA 2XRZA 4UWLA 2XEVA 3FUFA 3NQPA 2VTBB 2UWJG 4CDMA 1MQSA 3K9IA 3SD5A 3OAWA 1WY6A 4LEUA 2XCBA 4KXKB 3LKUA 5FZQA 3NF1A 3CVNA 1HF8A 2E0IA 2LSVA 3D9OA 3SGHA 2PZIA 4ANWA 4CT4A 1IHGA 4GMJA 2GGFA 3FULA 1OWNA 5BV0A 3SF4A 3NZSA 4JPSA 2R5SA 3HIZA 4Q69A 3CGHA 2FULA 3LDZA 3FUDA 2IQCA 1X5BA 4AEZC 3JQ1A 3UT7A 1NA0A 2V0PA 4U0SA 2DCPA 4ACKA 4RG9A 3CHMA 4XX5A 2VGXB 3UX4A 3LY8A 4PS3A 1JWGA 3P1UA 2KATA 3TXMA 3CEQA 5JJ7A 1QZ2A 3ZGQA 2FI7A 3D3MA 1Z6TA 4BX9A 4GA0A 1HZ4A 3FTVA 4HOSA 4JEUA 4Q96A 5BPPA 5C2YA 3FU6A 4KMOA 5ARFA 3O48A 4A3TA 3ULQA 2Q7FA 3B7UX 4CCAA 1H0AA 1QNFA 3FEXA 4FULA 4I2WA 1N52A 2L0IA 3I5PA 4N2SA 3PUJA 1OUVA 4C9BB 2VJ8A 1ELRA 2CHWA 2QFCA 3L54A 3QK0A 4ILGA 3IV0A 3VLFA 3N71A 5E76A 4U07A 2WQ6A 3CHQA 4GAAA 3D9KA 3LXUX 1TJCA 2X6FA 4YVQC 5C1DA 3FUJA 4HOUA 3ENEA 2XGSA 2X38A 2I2OA 4FP7A 4P29A 5DIZA 4H7XA 3MYVA 3QARA 4RVBA 4WNFA 3CVWA 3CVQA 5LCWC 1Y6IA 5FJYA 3GZ2A 2OV8A 2YNQA 4O6FA 2VSYA 4IRUA 1HXIA 3I4GA 3ZYLA 2X6HA 4DI4A 4FLHA 1NA3A 1TJFA 4BT8A 4YNDA 3ZVVA 4G11A 3CIAA 4HXIA 5CHEE 1E90A 3PUKA 4J6IA 5AJLA 5FQ6A 3UUXA 2FF4A 3FTXA 5T4YA 1PY1A 3RK6A 4J0UA 4NQ0A 3ZXSA 3RRUA 4FU3A 2PL2A 3ML8A 4IYPA 2RG8A 4GCNA 4GZDA 4LCTA 3RJVA 2NSZA 3FTUA 3PREA 4EBAA 2FBNA 5CCMA 1DVPA 1E8WA 1WAO1 2AVPA 3ASDA 3PH0C 4XE0A 4FA6A 1U3CA 3CQGB 3D9NA 4K0RA 2WMNA 4I17A 4WNDA 5FQ4A 3CQCB 4J8EA 1IQUA 1E7VA 4CRWA 3CK8A 2VSOE 1E96B 5AJDA 1HU3A 2PM6A 3FU0A 4ABNA 2Y3AA 3PDNA 3G2WA 4U0UA 1JUQA 3FFLA 4L2LA 1UW4B 1Z3YA 2X3MA 4Q94A 5EX0A 4AJWA 3FP3A 3FH5A 1W3BA 5BV1A 1PC2A 3U66A 4ILHB 3P2BA 4U04A 3SFZA 4HVBA 4WUYA 2V8SE 2X6KA 2PQRA 5EX3A 4AOFA 3FUKA 4AY5A 1OWOA 4JHRA 2IU1A 2I1JA 4GZ5A 5KJKA 3CHOA 5J08A 4GU5A 4HOQA 5BT1A 3ZN3A 3UT8A 1NP7A 2KCLA 2OVBA 2YQ8A 2J49A 3FUNA 4WWOA 5A23A 3PS6A 3KD7A 4NURA 4Y6CA 4DLOA 4RSYA 3S2AA 4AIFA 4OVUA 5ANLA 1EDUA 1H2UA 2CG3A 2WM9A 2AW6A 2WXGA 1L5JA 4ACLA 1FCHA 2WXOA 2XGOA 3FHEA 3IHVA 2Y4UA 3HDXA 4UQXA 3VLEA 3FEYA 4JHJA 3T5XA 2A4ZA 3ESLA 3ZIMA 3AS8A 3FUHA 3LS8A 4CGVA 2VGYA 2J4BA 1OWLA 2KCKA 3APDA 4UI9C 5D0QD 2WQ7A 3URZA 3ZHEA 4EBAG 3CKCA 1MHQA 3SI5A 2KZTB 4U8HA 4K03A 3C98A 4JHKA 4L23A 2V5FA 1HS6A 4UQZA 3MKRA 3RRMB 4LERA 3FDHA 5FQ7A 3JQ0A 3DBSA 2WXPA 4XKCA 4ME2A 3QB2A 2J9QA 4GYOA 2HR2A 3L08A 3HVEA 3CVYA 3MX3A 3FUMA 3FY4A 5LCWJ 3Q49B 2WVIA 3O4ZA 4MS6A 1HE8A 4OVVA 3CK9A 1BPOA 3MKQB 4N3BA 4GZCA 4NACA 1ELKA 3ESKA 4GZ3A 2XRYA 3LPZA 1UN9A 2L6JA 3UT4A 3CVVA 2IF4A 3R7QA 1SZAA 3B7RL 4DI3A 2HYZA 3FWVA 3LCAA 4GYYA 3QAQA 1ZBPA 1INZA 1E7UA 1ZU2A 3JCKC 3ZW3A 3LVRE 4E6HA 2CFUA 3L22A 3NZUA 4FJYA 3FH7A 3QJZA 4KT6B 4QFVA 3CSTA 2WXLA 4G26A 1UN8A 4KVOA 2V4LA 2WPVA 2DIWA 3U3WA 3LYAA 4FLBA 3FTYA 3D9IA 4I9EA 3TG4A 4WNGA 2VQ2A 3UMVA 2LO6A 2UY1A 5JHBA 3ONLA 5G04C 4BFRA 1SQMA 3Q4AB 4FHJA 4GA2A 2QY7A 1NZNA 3OXFA 5FQ8A 4UWFA 1H19A 3ASGA 4AV7A 3ZEFA 1GW6A 4BWRA 4G1TA 4PDXA 3SNXA 2IOSA 4BX8A 3PRZA 4XI9A 4UI9K 1E8YA 1H2VC 4H7YA 2J09A 3PEVB 4CT0A 5KJNA 3ZYKA 5T3RA 2LNIA 4EECA 3CHSA 1B89A 4XKBA 1XNFA 4UQYA 4BTBA 3FH8A 4WWNA 3TAXA 3APFA 3JUIA 3FU3A 3KS2A 4F7AA 4A1GA 2IONA 2XPIA 3TGOA 2J4DA 2L0TB 4WNEA 1HFAA 3L13A 1HG5A 2GW1A 4GA1A 4HLEA 4J8FA 5M72A 4ATGA 3QOUA 4KYOB 3PNTB 1Y8MA 3OTNA 5KJMA 3UPVA 2BF0X 5KCMA 3PNLB 4A1SA 4APOA 3ASFA 4AVXA 5BNWA 3Q47B 5BUZA 2X6JA 2GRMA 4KBQA 3R9AB 2VTBA 5E75A 3KAEA 1EPUA 5A7DB 4LUNU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FU3 A;  3ZYQ A;  1UJK A;  1JWG A;  2V8S E;  2DIW A;  3G2U A;  3ZYM A;  4GZD A;  4FLB A;  1LF8 A;  3CLJ A;  1HX8 A;  3D9I A;  1DVP A;  1XGW A;  2LO6 A;  3D9M A;  3ZYL A;  4Q96 A;  3G2V A;  3ONL A;  1HF8 A;  1MHQ A;  2L0T B;  1SZ9 A;  1HFA A;  1UJJ A;  1HG5 A;  3D9J A;  3D9O A;  3D9L A;  1ELK A;  1H0A A;  3D9P A;  2QY7 A;  3D9N A;  4NAC A;  2MOW A;  3G2T A;  5LP0 A;  1SZA A;  1VDY A;  2L0I A;  5CMY A;  4HFG A;  5CMW A;  1JWF A;  1JPL A;  3LDZ A;  5J08 A;  2BF0 X;  1INZ A;  2KM4 A;  1HG2 A;  1X5B A;  3G2S A;  3G2W A;  1JUQ A;  3ONK A;  4JXT A;  1EDU A;  4Q94 A;  4AVX A;  2DCP A;  3D9K A;  1PY1 A;  4GZC A;  3RRU A;  3ZYK A;  5LOZ A;  1EYH A; 
#chains in the Genus database with same CATH topology
 5LX8 A;  3G2U A;  2V4H C;  4I43 A;  4UI9 J;  3SZ7 A;  3RKV A;  2GRO B;  3X2Q E;  2BKG A;  4U63 A;  2CHZ A;  3PZ1 A;  2I6H A;  2ETB A;  1IKN D;  4J8S A;  2YHC A;  2DVW A;  2OND A;  4AXH A;  3ZNG A;  2WXH A;  1OCC E;  2EIK E;  4L1B A;  1KT1 A;  2CG2 A;  2F0Y A;  4Y6W A;  3CVX A;  5B3S E;  5G05 C;  1X81 A;  2XPY A;  1YCS B;  4PS7 A;  1BU9 A;  2AWI A;  4XEI G;  1D9S A;  4UWK A;  3V30 A;  5CRV A;  2C0L A;  5FZS A;  4A3V A;  3TG5 A;  3SFY A;  1EF1 C;  3MA5 A;  2FEZ A;  5G04 J;  1MX6 A;  4N2Q A;  3D9P A;  2J07 A;  4C0M A;  3IKO B;  4CDN A;  1JCQ A;  2ILR A;  1KZO A;  3ASH A;  3L9T A;  4EQF A;  3EHN A;  2ZGD A;  5LFA A;  5ARG A;  1PAQ A;  5BW8 C;  4A55 A;  3CV0 A;  2AXU A;  3NBN B;  4GTO A;  3ASO E;  3L17 A;  4WWP A;  3F6Q A;  3GW4 A;  4LRZ A;  4XZ4 A;  3JXJ A;  3IEG A;  3UM1 A;  1HH8 A;  4HS2 A;  2ZXW E;  3ZPJ A;  3EDT B;  3BEE A;  5FZR A;  2JAB A;  3LY7 A;  2X6I A;  4TRQ A;  4DX5 D;  2NXP A;  4JZY A;  2KZT A;  4G24 A;  3B7S A;  1A17 A;  4FC8 A;  1SZ9 A;  2XZT G;  4CDR A;  3U64 A;  3NOC D;  3CHP A;  4URK A;  1N4R A;  2P58 C;  1JWF A;  2EQX A;  4PH4 B;  1JPL A;  4XI0 A;  1DNP A;  4PS8 A;  1K8K G;  3AS4 A;  1FT2 A;  2P9L G;  5AYW D;  4PUC A;  3AG2 E;  3MKQ A;  3ZKJ A;  5AEN A;  2NC9 A;  4NIK A;  3GZS A;  4GMR A;  5CMW A;  4G23 A;  4MLP A;  3DPY A;  4UWL A;  3OAW A;  3Q73 A;  3ZU7 B;  1WY6 A;  4JB8 P;  5FZQ A;  1HF8 A;  2LSV A;  3D9O A;  3SGH A;  2PZI A;  1K1B A;  1TNU A;  3FUL A;  3T9K A;  3AAA C;  3SF4 A;  4AEZ C;  3R9M A;  2P9P G;  2ZGG A;  3P1U A;  1V55 E;  3TXM A;  1QZ2 A;  2EIN E;  1WG0 A;  3HXD A;  4JEU A;  4Q96 A;  4N2S A;  3T8K A;  1N4Q A;  2VJ8 A;  2CHW A;  1N4S A;  1OCO E;  3LXU X;  5C1D A;  2Y69 E;  1TR4 A;  4H7X A;  3CVQ A;  5LCW C;  1OY3 D;  3Q75 A;  4O6F A;  2VSY A;  4YDO A;  3I4G A;  2FO1 E;  4FLH A;  4DUI A;  2GRR B;  4YND A;  3CIA A;  1E90 A;  5AJL A;  1O5M A;  4J0U A;  3ZXS A;  4FU3 A;  1YMP A;  1N95 A;  4GCN A;  4LCT A;  2NSZ A;  1DVP A;  3PH0 C;  3NOG D;  2XEN A;  3DSU A;  3SQV A;  3CQG B;  4J8E A;  2NYJ A;  1HU3 A;  1TNY A;  3T5X A;  3U3W A;  4L2L A;  4Q94 A;  3AJI A;  4ILH B;  3U66 A;  2V8S E;  2X6K A;  5EX3 A;  4AY5 A;  4JHR A;  2ZIR A;  1NP7 A;  2KCL A;  2YQ8 A;  2J49 A;  4Y6C A;  5H7P A;  1LTX A;  2CG3 A;  2WXG A;  3C3Q A;  3FEY A;  3ESL A;  3DEO A;  2DYR E;  4M7C A;  2VGY A;  5D0Q D;  1OWL A;  2XS1 A;  4UI9 C;  4EBA G;  3V79 K;  4JHK A;  2V5F A;  3DBS A;  2GRP B;  1MYO A;  4ME2 A;  2HR2 A;  2MYO A;  4GPM A;  3KEA A;  3Q49 B;  5EYL A;  4OVV A;  1HE8 A;  1BPO A;  4N3B A;  4L9P A;  3LPZ A;  3UT4 A;  3CVV A;  2IF4 A;  5B1A E;  4MBG A;  1INZ A;  2P9U G;  2CFU A;  3L22 A;  5CBO A;  4FJY A;  1YYH A;  2Y0B G;  4OAV B;  3CST A;  5AAO A;  3TWW A;  4G8L A;  4WNG A;  5G04 C;  1SQM A;  4FHJ A;  4GA2 A;  3ISM C;  5AQA A;  4UWF A;  1H19 A;  3ASG A;  4AV7 A;  2QZA A;  1BI8 B;  2XEH A;  4UI9 K;  1H2V C;  3PEV B;  4CT0 A;  3DSV A;  1IXV A;  3HXB A;  3ASN E;  3ABL E;  3APF A;  2ION A;  1HFA A;  3L13 A;  4HB5 A;  5M72 A;  4HBD A;  1NI1 A;  3PNT B;  5KJM A;  2BF0 X;  4APO A;  5BNW A;  2ETA A;  2HE0 A;  2VTB A;  5E75 A;  1EPU A;  5A7D B;  4LUN U;  3ZYQ A;  3W9G A;  5FIO A;  4GB9 A;  3WXX A;  5JHA A;  4ANU A;  2MHK A;  3HHM A;  2LUH A;  3EHR A;  3DSW A;  4I1O B;  3JYS A;  1WM5 A;  2PM7 A;  3L82 A;  2VGX A;  5BXU A;  3CVU A;  1NFI E;  4B89 A;  2DZN A;  2HM8 A;  3FTW A;  4TUU A;  2KC7 A;  4WAF A;  2R59 A;  4U0Z A;  1U3D A;  2WXF A;  4DK5 A;  5CBN A;  4DX7 D;  1K3Z D;  3MV2 B;  4GTP A;  3LJ3 A;  2P9S G;  3SHF A;  1LF8 A;  4M3O A;  5EIL A;  4GML A;  3D9L A;  4NRH B;  5FTP A;  3CSF A;  4CEM A;  4XIF A;  3E4B A;  3QDN A;  3U4T A;  4F3V A;  2QYJ A;  1EYH A;  4GYW A;  3IHY A;  1DCE A;  1DC2 A;  4TV3 A;  2IJG X;  1ELW A;  1K1A A;  5KWD A;  4B8C B;  1O1T A;  3G2V A;  5EKQ D;  2XPZ A;  3MZL B;  3HXF A;  1V54 E;  3ZHE B;  2XGM A;  1H6K A;  3EIJ A;  3TXN A;  2YIN A;  4I6J A;  3BG0 B;  4N39 A;  4DRX E;  3DSS A;  1RW2 A;  3VTX A;  4K5C A;  4I1A A;  1KLX A;  3HVE B;  1N0Q A;  3TWU A;  2WQH A;  4UUC A;  4BEP A;  5JJT A;  3UM0 A;  4GPK A;  4RLY A;  3VLD A;  2OVF A;  3MV3 B;  2XQ0 A;  3TJP A;  3WG7 E;  4U96 D;  4BER A;  1TNO A;  4RG6 A;  5D2M C;  3HXE A;  4JW1 A;  3J5P A;  3L16 A;  1HG2 A;  4AY6 A;  1FVF A;  2WXJ A;  3B13 A;  1KT0 A;  3CR3 A;  2WMO A;  1YA0 A;  4JA7 A;  2VSN A;  5ENT D;  4HOR A;  3BQO A;  4EZL A;  1UJJ A;  4ATZ D;  5LP0 A;  3PVL A;  1D8D A;  3MGB A;  3EU9 A;  3GYZ A;  2KCV A;  3S7F A;  2KM4 A;  5HI7 A;  2R2L A;  4KZC A;  1OXJ A;  4BSZ B;  3PEU B;  4JA9 A;  2XRZ A;  5ENS D;  3E34 A;  3CVN A;  4GMJ A;  3NZS A;  2H6I A;  2IQC A;  3JQ1 A;  1QBQ A;  4RG9 A;  3LY8 A;  1JWG A;  1TN8 A;  2KAT A;  3AG1 E;  5JJ7 A;  5CRU A;  2FI7 A;  4GA0 A;  5BPP A;  3O48 A;  4A3T A;  3ULQ A;  3B7U X;  2F8Y A;  4N5Q A;  3FEX A;  4I2W A;  1N52 A;  2P9I G;  2L0I A;  1OUV A;  3L54 A;  3VLF A;  3IV0 A;  3N71 A;  1SVX A;  4DX2 A;  2WQ6 A;  3C5R A;  4U95 D;  3ENE A;  2XGS A;  2X38 A;  2I2O A;  4FP7 A;  3PZ3 A;  5CEA A;  4RVB A;  3SY2 A;  2L6B A;  2P9K G;  2RFA A;  2X6H A;  1NA3 A;  3PUK A;  4J6I A;  2FF4 A;  4G8K A;  5ENO D;  4NQ0 A;  3RRU A;  4GTT A;  2PL2 A;  3ML8 A;  3DXK G;  2RG8 A;  4IYP A;  4GZD A;  5CCM A;  2FBN A;  1E8W A;  1WAO 1;  2AVP A;  3TWR A;  3ASD A;  3E32 A;  4HI8 A;  4K0R A;  5FQ4 A;  1E7V A;  3CK8 A;  2Y1L E;  2PM6 A;  3FU0 A;  4ABN A;  2Y3A A;  3PDN A;  4U0U A;  4AJW A;  3FP3 A;  3FH5 A;  2B0O E;  1W3B A;  5BV1 A;  4U04 A;  4HVB A;  2PQR A;  5AQ7 A;  3FUK A;  3W9F A;  5KJK A;  3V2O A;  5BT1 A;  3UT8 A;  3FUN A;  4OAU C;  3PS6 A;  5KBA A;  4NUR A;  4LNG A;  4RSY A;  3S2A A;  2WM9 A;  4UQX A;  2Y4U A;  3HDX A;  3LS8 A;  4CGV A;  2J4B A;  2KCK A;  2WQ7 A;  1SW6 A;  1N9A A;  3SI5 A;  4K03 A;  5HRY A;  3MKR A;  3RRM B;  1AWC B;  3FDH A;  4BES A;  3JQ0 A;  3AG4 E;  2WXP A;  3QB2 A;  4GYO A;  4TXQ A;  3CVY A;  3CK9 A;  4GZC A;  4NAC A;  1S63 A;  4GZ3 A;  2IEJ A;  1E7U A;  2EIM E;  4KT6 B;  1OT8 A;  4G26 A;  3Q7A A;  4KVO A;  3FTY A;  3TG4 A;  2VQ2 A;  2LO6 A;  2QC9 A;  3Q4A B;  2QY7 A;  3ZEF A;  2LXL A;  1GW6 A;  5HKP A;  4G1T A;  4PDX A;  4XI9 A;  1U2V G;  3CHS A;  1B89 A;  3TAX A;  4J8Y A;  3JUI A;  3FU3 A;  3TGO A;  2J4D A;  2L0T B;  4HLL A;  1HG5 A;  2GW1 A;  3QOU A;  4CYM D;  1Y8M A;  4X8Q A;  2F37 A;  5KCM A;  3ASF A;  3Q47 B;  2GRM A;  1Q2Z A;  2KBX A;  4K5B A;  5KNH D;  4ILI A;  5ENN A;  2L9B A;  4DLQ A;  3FUE A;  1DCQ A;  3Q7F A;  2Y4T A;  2GRQ B;  2XS8 A;  3AU5 A;  2IFU A;  3DSX A;  4HRN A;  3L6A A;  2HO1 A;  4HOT A;  3ML9 A;  5B1B E;  1E8Z A;  1BI7 B;  2CHX A;  4ZHB A;  2WXR A;  4BTA A;  2ZIS A;  2PQN A;  4YVO A;  1H2T C;  1IQR A;  4TXR A;  3PE4 A;  2LAH A;  3CVP A;  2IOL A;  2DBA A;  3PZD A;  4I2Z A;  4AM9 A;  3Q15 A;  3RAU A;  3NAW A;  3HYM B;  2MOW A;  3QWW A;  4N3C A;  5ENQ D;  2LAI A;  3AU4 A;  4LNB A;  4HNA D;  2WXK A;  4JEH A;  3RIB A;  1KZP A;  2XHE A;  1BLX B;  3ABM E;  5A6C A;  4I6G A;  1NL4 A;  1FVH A;  3CLJ A;  1HX8 A;  1N0R A;  3S7J A;  2EIL E;  5KNG A;  2J08 A;  1IYG A;  3ZFW A;  2VGE A;  1OCR E;  3FTZ A;  3S7B A;  2A5E A;  4FJZ A;  4IN3 B;  1N11 A;  5KJL A;  4JXT A;  1LD8 A;  2PNN A;  1QYM A;  3I3N A;  2BED A;  2AXV A;  5CED B;  3QC1 A;  2F8X K;  4J8D A;  2R17 C;  4UWG A;  1TEZ A;  3LY9 A;  4DJA A;  3ZYM A;  3U9W A;  3EHM A;  4J7W A;  3AS5 A;  4HFG A;  2CFZ A;  2P9N G;  3UQ3 A;  3HRA A;  1AP7 A;  4BSX A;  3QWP A;  2DZO A;  1MZC A;  5JJ6 A;  3QWV A;  4MKT A;  3MJW A;  3MEK A;  3Q78 A;  1MX4 A;  2UY1 B;  4YDE A;  5FWQ A;  2C0M A;  4GCO A;  4JC8 A;  4FAD A;  4GZ6 A;  4DX6 D;  1N54 A;  3T5V A;  4I9C A;  4L2Y A;  1QQE A;  3HXC A;  4B8A A;  4AP2 A;  4JL0 A;  4B94 A;  3V2X A;  4JVS A;  3G2T A;  5CMY A;  1S0P A;  2E2E A;  4ANV A;  4DX1 A;  4YDW A;  2FO7 A;  2ZU6 B;  4IUL A;  4BT9 A;  1Z3X A;  3DPD A;  3IBE A;  4APF A;  3SD5 A;  2BKK B;  3LKU A;  3AG3 E;  2E0I A;  3TWX A;  1TYQ G;  4CT4 A;  4ANW A;  2RFM A;  1OWN A;  4JPS A;  3FUD A;  2V0P A;  2DCP A;  4ACK A;  4XX5 A;  3ULE G;  5EIB E;  4LSZ E;  3CEQ A;  3ZGQ A;  4O60 A;  3BU8 A;  4CCA A;  3FU6 A;  4KMO A;  5ARF A;  2Q7F A;  4FUL A;  4C9B B;  1ELR A;  3ABK E;  5E76 A;  4U07 A;  3D9K A;  1TJC A;  2X6F A;  3FUJ A;  4P29 A;  3J5Q B;  5DIZ A;  3D9H A;  3GZ2 A;  2OV8 A;  4O1P A;  4F6R D;  4IRU A;  1IHB A;  3ZYL A;  1TJF A;  3UI2 A;  4G11 A;  5CHE E;  5BXO A;  2RKK A;  3UUX A;  5T4Y A;  3RK6 A;  3RJV A;  4TUM A;  3UIO C;  4EBA A;  3PRE A;  2H6F A;  2B6C A;  1N4P A;  3ZUV B;  1U3C A;  5AQB A;  2WMN A;  4I17 A;  1IQU A;  5AN8 A;  2VSO E;  1E96 B;  5AJD A;  3UKU G;  3G2W A;  1JUQ A;  1UW4 B;  1Z3Y A;  5EX0 A;  3SFZ A;  4WUY A;  1OWO A;  2IU1 A;  4U7E B;  4HOQ A;  3ZN3 A;  2OVB A;  2J8S D;  5A23 A;  3KD7 A;  1ZB1 A;  4DLO A;  4GTV A;  4B93 B;  3KSL A;  4AIF A;  4GTS A;  1G3N B;  1H2U A;  2AW6 A;  4ZFH A;  1FCH A;  3TWS A;  5ITZ F;  3DEP A;  4JHJ A;  3ZIM A;  2A4Z A;  3AS8 A;  3FUH A;  5AAR A;  3APD A;  3URZ A;  3ZHE A;  3CKC A;  1MHQ A;  2KZT B;  1MX2 A;  3C98 A;  4L23 A;  1HS6 A;  4LER A;  5FQ7 A;  3C72 A;  1Z5S C;  2GRN B;  3B95 A;  5JMN D;  3DST A;  3L08 A;  3HVE A;  3MX3 A;  3FUM A;  3FY4 A;  2WVI A;  3O4Z A;  4MS6 A;  4HI9 A;  3MKQ B;  3PZ4 A;  3ESK A;  1UN9 A;  3R7Q A;  1SZA A;  4DI3 A;  2HYZ A;  3JUE A;  4EHM A;  3LCA A;  4GYY A;  4CZ2 D;  1ZU2 A;  3JCK C;  3ZW3 A;  3LVR E;  4E6H A;  3Q9N C;  3NZU A;  4QFV A;  3SO8 A;  1UN8 A;  3HG0 D;  3V31 A;  2WPV A;  2DIW A;  3LYA A;  4I9E A;  5CEC B;  3ONL A;  4BFR A;  4QQI A;  1NZN A;  5FQ8 A;  4BWR A;  4U8Y D;  1BD8 A;  1E8Y A;  4H7Y A;  1JCR A;  5KJN A;  4XKB A;  4HRL A;  4UQY A;  4BTB A;  3FH8 A;  4WWN A;  4F7A A;  4A1G A;  1D8E A;  4TXP A;  4GA1 A;  4HLE A;  3PZ2 A;  3JXI A;  4ATG A;  4KYO B;  3OTN A;  5ENP D;  4A1S A;  3UTM A;  4AVX A;  5BUZ A;  4KBQ A;  3R9A B;  2R05 A;  3E37 A;  4BY6 A;  2H6H A;  3C3R A;  3CHR A;  3S7D A;  4FHK A;  3R7R A;  5IY5 E;  3SFX A;  4D10 C;  2YHE A;  3TWQ A;  4ANX A;  3QKY A;  5ENR D;  4F1S A;  3RRN B;  2MRI A;  2DWZ A;  3BG1 B;  1UJK A;  2JEK A;  5T8I A;  3EU5 A;  3FUI A;  1OWP A;  2C2L A;  4V3I A;  5CER B;  3B7T A;  3CVL A;  2BUG A;  5J90 A;  5EDS A;  3EIQ C;  1FT1 A;  5G2N A;  3SBT B;  2AJA A;  4I6E A;  3LVQ E;  2KXP C;  4B0Z A;  2AXZ A;  3OXG A;  3UIN C;  2BTD A;  4UWH A;  3RSE G;  4DPR A;  2M63 A;  4N3A A;  3T8M A;  4F1P A;  1P5Q A;  5DBK A;  2A5U A;  2I9C A;  5CCL A;  3FTS A;  3ONK A;  3C3O A;  5LOZ A;  4W9R A;  3CKB A;  4RQI A;  1JCS A;  1TNZ A;  3UKR G;  4G25 A;  2WXQ A;  5FT9 A;  5G55 A;  2XCC A;  3QNK A;  4G2V A;  2WXN A;  3TWT A;  3TWV A;  3RO3 A;  1OWM A;  1TN7 A;  2RD0 A;  1KPS B;  4CGW A;  3OXL A;  5AQ9 A;  4OYS A;  2OCC E;  4KVM A;  4I1M A;  5HS0 A;  3RO2 A;  1XGW A;  3D9M A;  3APC A;  4EZK A;  2DYS E;  2WXM A;  2VYI A;  3ZXP A;  3D9J A;  3LEW A;  4L7T A;  3MCX A;  1E8X A;  1SA5 A;  3VTY A;  3Q5M A;  5AIJ A;  5ANR A;  3PE3 A;  2I1K A;  4KZ0 A;  2IO3 C;  3KEZ A;  3ZRH A;  4N5C A;  4EPZ A;  4EZJ A;  2LSU A;  2OOE A;  3Q79 A;  3Q9U C;  3E30 A;  4HRM B;  1HO8 A;  5D0O D;  3I4R B;  5G05 J;  3EJN A;  2GRL A;  3SBS A;  4R7L A;  3RU0 A;  3FU5 A;  2WB2 A;  4F53 A;  4MRU A;  3GZ1 A;  4C0E A;  3DWL G;  2WXI A;  4LG6 A;  3CK7 A;  1UG3 A;  2XEE A;  3TL5 A;  4E85 A;  1VDY A;  5HQ8 A;  3G2S A;  2IO2 C;  2JLB A;  2VSX E;  1S64 A;  5EID A;  2XEV A;  3FUF A;  3NQP A;  2H6G A;  2VTB B;  2UWJ G;  4CDM A;  1MQS A;  3K9I A;  4LEU A;  2XCB A;  4KXK B;  3NF1 A;  2XZD G;  1IHG A;  2GGF A;  5BV0 A;  2R5S A;  3HIZ A;  4Q69 A;  3CGH A;  2FUL A;  3LDZ A;  1X5B A;  3B7B A;  3UT7 A;  1NA0 A;  3EUV A;  4K5A B;  4U0S A;  3CHM A;  2VGX B;  3UX4 A;  1LD7 A;  4PS3 A;  3UXG A;  4HOS A;  3D3M A;  1Z6T A;  4BX9 A;  1HZ4 A;  3FTV A;  5C2Y A;  1H0A A;  1QNF A;  3UM2 A;  3I5P A;  3PUJ A;  2QFC A;  3QK0 A;  4ILG A;  3CHQ A;  4GAA A;  4Z68 A;  4YVQ C;  4HOU A;  1O1S A;  1A5E A;  3MYV A;  3QAR A;  4WNF A;  3CVW A;  1Y6I A;  5FJY A;  2YNQ A;  1HXI A;  4DI4 A;  4U8V D;  4BT8 A;  3ZVV A;  4HXI A;  5FQ6 A;  3FTX A;  2OEW A;  1PY1 A;  2V5Q C;  2IY0 C;  2LXM A;  3FTU A;  4HQD A;  4C48 B;  4YDY A;  4XE0 A;  4FA6 A;  3D9N A;  4WND A;  3CQC B;  4CRW A;  3FFL A;  2X3M A;  3DXM G;  4LNU D;  1PC2 A;  3P2B A;  4AOF A;  1H6O A;  4GZ5 A;  2I1J A;  2P2C P;  3CHO A;  5J08 A;  4GU5 A;  4WWO A;  4OVU A;  5ANL A;  1EDU A;  1L5J A;  4ACL A;  2WXO A;  2XGO A;  3FHE A;  3IHV A;  3VLE A;  1UOH A;  5FIN A;  2ETC A;  1O1R A;  4U8H A;  3NB2 A;  4UQZ A;  1TNB A;  1TN6 A;  1H6P A;  4GTM A;  4XKC A;  1S70 B;  4GTR A;  3KSQ A;  5D66 A;  1N94 A;  2J9Q A;  4GTQ A;  3LJN A;  4O1O A;  5LCW J;  1ELK A;  2XRY A;  2L6J A;  3B7R L;  3FWV A;  3DRA A;  3QAQ A;  1ZBP A;  3BUA A;  2R03 A;  2OEV A;  3FH7 A;  3QJZ A;  2WXL A;  4BET A;  2V4L A;  3UM3 A;  4FLB A;  3D9I A;  3E33 A;  3UMV A;  2UY1 A;  2R02 A;  5JHB A;  4JD2 G;  3OXF A;  4BX8 A;  3SNX A;  2IOS A;  1FPP A;  3PRZ A;  3ULY A;  3EHQ A;  2J09 A;  4A63 B;  3ZYK A;  5T3R A;  2LNI A;  4EEC A;  1XNF A;  3KS2 A;  2EIJ E;  2XPI A;  1OCZ E;  2QYU A;  5EN5 D;  4WNE A;  3UIP C;  4J8F A;  1WDY A;  5JA4 D;  3UPV A;  1MJ0 A;  1SA4 A;  3IXE A;  3PNL B;  2X6J A;  1RZ4 A;  3KAE A;  5EYP F; 
#chains in the Genus database with same CATH homology
 3ZYQ A;  4BY6 A;  4GB9 A;  3WXX A;  5LX8 A;  3G2U A;  5JHA A;  4ANU A;  2MHK A;  4I43 A;  3CHR A;  4UI9 J;  3HHM A;  4I1O B;  3S7D A;  3SZ7 A;  3RKV A;  3JYS A;  4FHK A;  3R7R A;  1WM5 A;  2PM7 A;  4ILI A;  5ENN A;  4D10 C;  2L9B A;  4U63 A;  2YHE A;  4DLQ A;  3FUE A;  2CHZ A;  2I6H A;  4ANX A;  3QKY A;  2Y4T A;  4J8S A;  2VGX A;  4F1S A;  2YHC A;  2MRI A;  3RRN B;  3AU5 A;  3CVU A;  4B89 A;  2IFU A;  2OND A;  3L6A A;  4AXH A;  3BG1 B;  2HO1 A;  4HOT A;  1UJK A;  2WXH A;  2JEK A;  3ML9 A;  2HM8 A;  3FTW A;  5T8I A;  4TUU A;  2KC7 A;  4WAF A;  2R59 A;  4L1B A;  1E8Z A;  1KT1 A;  2CHX A;  2CG2 A;  2WXR A;  3FUI A;  4BTA A;  4Y6W A;  4U0Z A;  3CVX A;  1U3D A;  1OWP A;  5G05 C;  2WXF A;  2C2L A;  4V3I A;  2PQN A;  4DK5 A;  2XPY A;  4YVO A;  1H2T C;  1IQR A;  3MV2 B;  3PE4 A;  4PS7 A;  3B7T A;  2AWI A;  3CVL A;  2BUG A;  2LAH A;  3LJ3 A;  3CVP A;  5J90 A;  5EDS A;  2IOL A;  3EIQ C;  2DBA A;  4UWK A;  5G2N A;  3SBT B;  1LF8 A;  3SHF A;  4I6E A;  2C0L A;  5FZS A;  3LVQ E;  3PZD A;  4M3O A;  4A3V A;  4I2Z A;  3TG5 A;  4B0Z A;  2AXZ A;  4AM9 A;  3OXG A;  1EF1 C;  3Q15 A;  4GML A;  2BTD A;  3MA5 A;  2FEZ A;  5G04 J;  4UWH A;  4N2Q A;  3D9L A;  4NRH B;  3HYM B;  3D9P A;  4DPR A;  2J07 A;  2M63 A;  5FTP A;  2MOW A;  3CSF A;  4N3A A;  4CEM A;  4XIF A;  3T8M A;  3E4B A;  3QWW A;  1P5Q A;  4N3C A;  5DBK A;  3QDN A;  2A5U A;  2LAI A;  2I9C A;  5CCL A;  3AU4 A;  4C0M A;  3U4T A;  3FTS A;  3IKO B;  3ONK A;  4CDN A;  4F3V A;  2ILR A;  3ASH A;  4EQF A;  3EHN A;  2WXK A;  4JEH A;  5LOZ A;  1EYH A;  4W9R A;  4GYW A;  2XHE A;  3IHY A;  3RIB A;  5A6C A;  4I6G A;  3CKB A;  3CLJ A;  1FVH A;  4TV3 A;  5LFA A;  1HX8 A;  1ELW A;  2IJG X;  4B8C B;  3S7J A;  5ARG A;  2J08 A;  3G2V A;  1IYG A;  5EKQ D;  4G25 A;  2WXQ A;  3ZFW A;  1PAQ A;  2XPZ A;  3FTZ A;  3MZL B;  5FT9 A;  5BW8 C;  3S7B A;  3ZHE B;  2XGM A;  5G55 A;  2XCC A;  1H6K A;  3EIJ A;  3QNK A;  4FJZ A;  4G2V A;  3TXN A;  2YIN A;  2WXN A;  4IN3 B;  5KJL A;  4JXT A;  3RO3 A;  4A55 A;  1OWM A;  3CV0 A;  3BG0 B;  2AXU A;  2RD0 A;  4I6J A;  3I3N A;  4N39 A;  3OXL A;  4CGW A;  4OYS A;  4KVM A;  3VTX A;  2AXV A;  3L17 A;  4WWP A;  4I1M A;  4I1A A;  3QC1 A;  4J8D A;  3RO2 A;  2R17 C;  3GW4 A;  4LRZ A;  1XGW A;  3D9M A;  1KLX A;  3APC A;  3IEG A;  4UWG A;  4XZ4 A;  4EZK A;  3HVE B;  1HH8 A;  3LY9 A;  2WXM A;  1TEZ A;  4DJA A;  2VYI A;  3ZYM A;  3D9J A;  2WQH A;  3LEW A;  4HS2 A;  4L7T A;  3U9W A;  3ZPJ A;  3EHM A;  3MCX A;  3AS5 A;  4HFG A;  3EDT B;  2CFZ A;  5JJT A;  1E8X A;  3VTY A;  3BEE A;  4GPK A;  3Q5M A;  5FZR A;  3VLD A;  3LY7 A;  5AIJ A;  3UQ3 A;  2OVF A;  2X6I A;  3MV3 B;  5ANR A;  4TRQ A;  2NXP A;  2XQ0 A;  3PE3 A;  4BSX A;  2I1K A;  4JZY A;  3TJP A;  4KZ0 A;  3KEZ A;  3QWP A;  2KZT A;  4G24 A;  3ZRH A;  4N5C A;  5JJ6 A;  4EPZ A;  3QWV A;  4EZJ A;  3B7S A;  4MKT A;  2LSU A;  2OOE A;  1A17 A;  4FC8 A;  1SZ9 A;  3MJW A;  3MEK A;  4CDR A;  4RG6 A;  3U64 A;  2UY1 B;  1HO8 A;  5D0O D;  5FWQ A;  3I4R B;  5G05 J;  3EJN A;  3CHP A;  4URK A;  2GRL A;  4JW1 A;  2P58 C;  1JWF A;  2C0M A;  2EQX A;  3L16 A;  1JPL A;  4PH4 B;  3SBS A;  4R7L A;  1HG2 A;  3RU0 A;  4GCO A;  1FVF A;  2WXJ A;  3B13 A;  3FU5 A;  4XI0 A;  1KT0 A;  1DNP A;  4AY6 A;  3CR3 A;  4JC8 A;  4PS8 A;  4FAD A;  2WB2 A;  2WMO A;  3AS4 A;  4F53 A;  1YA0 A;  4GZ6 A;  4MRU A;  3GZ1 A;  4C0E A;  4JA7 A;  5AYW D;  1N54 A;  2VSN A;  4PUC A;  3T5V A;  2WXI A;  4I9C A;  3MKQ A;  3CK7 A;  4L2Y A;  1QQE A;  4HOR A;  1UG3 A;  5AEN A;  4B8A A;  4AP2 A;  4EZL A;  4JL0 A;  1UJJ A;  4B94 A;  3TL5 A;  2NC9 A;  4JVS A;  3G2T A;  4E85 A;  5LP0 A;  3PVL A;  5CMY A;  1VDY A;  3MGB A;  1S0P A;  3GZS A;  2E2E A;  5CMW A;  3GYZ A;  4ANV A;  4G23 A;  5HQ8 A;  4MLP A;  2KCV A;  3S7F A;  2KM4 A;  3G2S A;  5HI7 A;  2FO7 A;  2ZU6 B;  4IUL A;  4BT9 A;  2JLB A;  1Z3X A;  2VSX E;  3DPD A;  4KZC A;  3IBE A;  3PEU B;  4JA9 A;  4APF A;  2XRZ A;  4UWL A;  2XEV A;  3FUF A;  3NQP A;  2VTB B;  2UWJ G;  4CDM A;  1MQS A;  3K9I A;  3SD5 A;  3OAW A;  1WY6 A;  4LEU A;  2XCB A;  4KXK B;  3LKU A;  5FZQ A;  3NF1 A;  3CVN A;  1HF8 A;  2E0I A;  2LSV A;  3D9O A;  3SGH A;  2PZI A;  4ANW A;  4CT4 A;  1IHG A;  4GMJ A;  2GGF A;  3FUL A;  1OWN A;  5BV0 A;  3SF4 A;  3NZS A;  4JPS A;  2R5S A;  3HIZ A;  4Q69 A;  3CGH A;  2FUL A;  3LDZ A;  3FUD A;  2IQC A;  1X5B A;  4AEZ C;  3JQ1 A;  3UT7 A;  1NA0 A;  2V0P A;  4U0S A;  2DCP A;  4ACK A;  4RG9 A;  3CHM A;  4XX5 A;  2VGX B;  3UX4 A;  3LY8 A;  4PS3 A;  1JWG A;  3P1U A;  2KAT A;  3TXM A;  3CEQ A;  5JJ7 A;  1QZ2 A;  3ZGQ A;  2FI7 A;  3D3M A;  1Z6T A;  4BX9 A;  4GA0 A;  1HZ4 A;  3FTV A;  4HOS A;  4JEU A;  4Q96 A;  5BPP A;  5C2Y A;  3FU6 A;  4KMO A;  5ARF A;  3O48 A;  4A3T A;  3ULQ A;  2Q7F A;  3B7U X;  4CCA A;  1H0A A;  1QNF A;  3FEX A;  4FUL A;  4I2W A;  1N52 A;  2L0I A;  3I5P A;  4N2S A;  3PUJ A;  1OUV A;  4C9B B;  2VJ8 A;  1ELR A;  2CHW A;  2QFC A;  3L54 A;  3QK0 A;  4ILG A;  3IV0 A;  3VLF A;  3N71 A;  5E76 A;  4U07 A;  2WQ6 A;  3CHQ A;  4GAA A;  3D9K A;  3LXU X;  1TJC A;  2X6F A;  4YVQ C;  5C1D A;  3FUJ A;  4HOU A;  3ENE A;  2XGS A;  2X38 A;  2I2O A;  4FP7 A;  4P29 A;  5DIZ A;  4H7X A;  3MYV A;  3QAR A;  4RVB A;  4WNF A;  3CVW A;  3CVQ A;  5LCW C;  1Y6I A;  5FJY A;  3GZ2 A;  2OV8 A;  2YNQ A;  4O6F A;  2VSY A;  4IRU A;  1HXI A;  3I4G A;  3ZYL A;  2X6H A;  4DI4 A;  4FLH A;  1NA3 A;  1TJF A;  4BT8 A;  4YND A;  3ZVV A;  4G11 A;  3CIA A;  4HXI A;  5CHE E;  1E90 A;  3PUK A;  4J6I A;  5AJL A;  5FQ6 A;  3UUX A;  2FF4 A;  3FTX A;  5T4Y A;  1PY1 A;  3RK6 A;  4J0U A;  4NQ0 A;  3ZXS A;  3RRU A;  4FU3 A;  2PL2 A;  3ML8 A;  4IYP A;  2RG8 A;  4GCN A;  4GZD A;  4LCT A;  3RJV A;  2NSZ A;  3FTU A;  3PRE A;  4EBA A;  2FBN A;  5CCM A;  1DVP A;  1E8W A;  1WAO 1;  2AVP A;  3ASD A;  3PH0 C;  4XE0 A;  4FA6 A;  1U3C A;  3CQG B;  3D9N A;  4K0R A;  2WMN A;  4I17 A;  4WND A;  5FQ4 A;  3CQC B;  4J8E A;  1IQU A;  1E7V A;  4CRW A;  3CK8 A;  2VSO E;  1E96 B;  5AJD A;  1HU3 A;  2PM6 A;  3FU0 A;  4ABN A;  2Y3A A;  3PDN A;  3G2W A;  4U0U A;  1JUQ A;  3FFL A;  4L2L A;  1UW4 B;  1Z3Y A;  2X3M A;  4Q94 A;  5EX0 A;  4AJW A;  3FP3 A;  3FH5 A;  1W3B A;  5BV1 A;  1PC2 A;  3U66 A;  4ILH B;  3P2B A;  4U04 A;  3SFZ A;  4HVB A;  4WUY A;  2V8S E;  2X6K A;  2PQR A;  5EX3 A;  4AOF A;  3FUK A;  4AY5 A;  1OWO A;  4JHR A;  2IU1 A;  2I1J A;  4GZ5 A;  5KJK A;  3CHO A;  5J08 A;  4GU5 A;  4HOQ A;  5BT1 A;  3ZN3 A;  3UT8 A;  1NP7 A;  2KCL A;  2OVB A;  2YQ8 A;  2J49 A;  3FUN A;  4WWO A;  5A23 A;  3PS6 A;  3KD7 A;  4NUR A;  4Y6C A;  4DLO A;  4RSY A;  3S2A A;  4AIF A;  4OVU A;  5ANL A;  1EDU A;  1H2U A;  2CG3 A;  2WM9 A;  2AW6 A;  2WXG A;  1L5J A;  4ACL A;  1FCH A;  2WXO A;  2XGO A;  3FHE A;  3IHV A;  2Y4U A;  3HDX A;  4UQX A;  3VLE A;  3FEY A;  4JHJ A;  3T5X A;  2A4Z A;  3ESL A;  3ZIM A;  3AS8 A;  3FUH A;  3LS8 A;  4CGV A;  2VGY A;  2J4B A;  1OWL A;  2KCK A;  3APD A;  4UI9 C;  5D0Q D;  2WQ7 A;  3URZ A;  3ZHE A;  4EBA G;  3CKC A;  1MHQ A;  3SI5 A;  2KZT B;  4U8H A;  4K03 A;  3C98 A;  4JHK A;  4L23 A;  2V5F A;  1HS6 A;  4UQZ A;  3MKR A;  3RRM B;  4LER A;  3FDH A;  5FQ7 A;  3JQ0 A;  3DBS A;  2WXP A;  4XKC A;  4ME2 A;  3QB2 A;  2J9Q A;  4GYO A;  2HR2 A;  3L08 A;  3HVE A;  3CVY A;  3MX3 A;  3FUM A;  3FY4 A;  5LCW J;  3Q49 B;  2WVI A;  3O4Z A;  4MS6 A;  1HE8 A;  4OVV A;  3CK9 A;  1BPO A;  3MKQ B;  4N3B A;  4GZC A;  4NAC A;  1ELK A;  3ESK A;  4GZ3 A;  2XRY A;  3LPZ A;  1UN9 A;  2L6J A;  3UT4 A;  3CVV A;  2IF4 A;  3R7Q A;  1SZA A;  3B7R L;  4DI3 A;  2HYZ A;  3FWV A;  3LCA A;  4GYY A;  3QAQ A;  1ZBP A;  1INZ A;  1E7U A;  1ZU2 A;  3JCK C;  3ZW3 A;  3LVR E;  4E6H A;  2CFU A;  3L22 A;  3NZU A;  4FJY A;  3FH7 A;  3QJZ A;  4KT6 B;  4QFV A;  3CST A;  2WXL A;  4G26 A;  1UN8 A;  4KVO A;  2V4L A;  2WPV A;  2DIW A;  3U3W A;  3LYA A;  4FLB A;  3FTY A;  3D9I A;  4I9E A;  3TG4 A;  4WNG A;  2VQ2 A;  3UMV A;  2LO6 A;  2UY1 A;  5JHB A;  3ONL A;  5G04 C;  4BFR A;  1SQM A;  3Q4A B;  4FHJ A;  4GA2 A;  2QY7 A;  1NZN A;  3OXF A;  5FQ8 A;  4UWF A;  1H19 A;  3ASG A;  4AV7 A;  3ZEF A;  1GW6 A;  4BWR A;  4G1T A;  4PDX A;  3SNX A;  2IOS A;  4BX8 A;  3PRZ A;  4XI9 A;  4UI9 K;  1E8Y A;  1H2V C;  4H7Y A;  2J09 A;  3PEV B;  4CT0 A;  5KJN A;  3ZYK A;  5T3R A;  2LNI A;  4EEC A;  3CHS A;  1B89 A;  4XKB A;  1XNF A;  4UQY A;  4BTB A;  3FH8 A;  4WWN A;  3TAX A;  3APF A;  3JUI A;  3FU3 A;  3KS2 A;  4F7A A;  4A1G A;  2ION A;  2XPI A;  3TGO A;  2J4D A;  2L0T B;  4WNE A;  1HFA A;  3L13 A;  1HG5 A;  2GW1 A;  4GA1 A;  4HLE A;  4J8F A;  5M72 A;  4ATG A;  3QOU A;  4KYO B;  3PNT B;  1Y8M A;  3OTN A;  5KJM A;  3UPV A;  2BF0 X;  5KCM A;  3PNL B;  4A1S A;  4APO A;  3ASF A;  4AVX A;  5BNW A;  3Q47 B;  5BUZ A;  2X6J A;  2GRM A;  4KBQ A;  3R9A B;  2VTB A;  5E75 A;  3KAE A;  1EPU A;  5A7D B;  4LUN U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...