2IFUA

Crystal structure of a gamma-snap from danio rerio
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
275
structure length
275
Chain Sequence
AAQKISEAHEHIAKAEKYLKTSFMKWKPDYDSAASEYAKAAVAFKNAKQLEQAKDAYLQEAEAHANNRSLFHAAKAFEQAGMMLKDLQRMPEAVQYIEKASVMYVENGTPDTAAMALDRAGKLMEPLDLSKAVHLYQQAAAVFENEERLRQAAELIGKASRLLVRQQKFDEAAASLQKEKSMYKEMENYPTCYKKCIAQVLVQLHRADYVAAQKCVRESYSIPGFSGSEDCAALEDLLQAYDEQDEEQLLRVCRSPLVTYMDNDYAKLAISLKVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gamma-snap
publication title Structure and dynamics of gamma-SNAP: insight into flexibility of proteins from the SNAP family.
pubmed doi rcsb
source organism Danio rerio
molecule tags Endocytosis/exocytosis
total genus 112
structure length 275
sequence length 275
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14938 SNAP Soluble NSF attachment protein, SNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ifuA00
3CVLA 3S7BA 4WNEA 5DBKA 5A6CA 3CK7A 5AYWD 3U4TA 3PE4A 5FZSA 5EX3A 5ARFA 4G23A 3TG5A 3LY8A 5JJ6A 4AM9A 4I9EA 4XIFA 4UQYA 3SF4A 3LPZA 5G04C 5FT9A 4RG6A 3OXLA 4B94A 2FI7A 4WNDA 1OUVA 2AVPA 4N3CA 1ZU2A 4IN3B 4LEUA 3VTYA 1ELWA 2XGMA 3FWVA 3IEGA 4XI0A 4UQZA 2LSVA 4I9CA 4CGWA 1Y8MA 3Q47B 2C0LA 3LY9A 4KXKB 4UI9C 4AY6A 2XGSA 1HXIA 4YVQC 3S7JA 2V5FA 1NA0A 3RO3A 3TGOA 3GZ1A 4YVOA 4GZ6A 1IYGA 5HI7A 2JLBA 3UPVA 4BT8A 1B89A 3GW4A 4G26A 4GYWA 5M72A 5FTPA 3OXFA 2C0MA 3UQ3A 2HYZA 4BT9A 4N39A 4GCOA 3Q4AB 4BTAA 4I2WA 5A7DB 5D0OD 4F3VA 1ZBPA 5LCWJ 1PC2A 4XI9A 5BT1A 3Q15A 5EKQD 3ZGQA 3MV2B 2XEVA 5BW8C 2YQ8A 4U0ZA 3S7DA 4WNGA 1NZNA 5KJKA 5CHEE 4G1TA 1WAO1 4I1AA 2IFUA 2KC7A 2KATA 4BTBA 4Y6WA 1A17A 2XCBA 4HOSA 3CVPA 3S7FA 4JA9A 1YA0A 3N71A 2UY1A 2FO7A 3QWVA 2L6JA 5D0QD 3CKCA 1FCHA 2VGYA 4YNDA 4CGVA 4N3AA 2FEZA 2KCLA 2UY1B 3ZHEA 2GW1A 2NC9A 4JA7A 3ASFA 1HH8A 4Y6CA 3BEEA 2FF4A 4GA0A 4GPKA 4O6FA 3ZHEB 4J0UA 3LYAA 4RG9A 4U0UA 3GYZA 4U07A 4BWRA 4J8EA 3CVNA 3LCAA 2HR2A 2WQHA 3ASGA 2XCCA 3Q5MA 3QKYA 3CEQA 3AS4A 2XPIA 3JYSA 2HO1A 3URZA 4HOTA 3TG4A 4AIFA 5G04J 4W9RA 4ABNA 2PQRA 3ASHA 2UWJG 5G05C 2E2EA 4KYOB 2FBNA 2LNIA 1KT0A 5ARGA 2VSNA 4U0SA 3PE3A 4NQ0A 4GCNA 2VGXA 2J9QA 4G25A 1TJCA 2OOEA 4HORA 3QWWA 1KLXA 3FFLA 3R9AB 3ZFWA 3QOUA 4GZ3A 2VGXB 2KCVA 3CK9A 4N2QA 3OXGA 4GA1A 4WNFA 4UI9J 4UI9K 2VSYA 1W3BA 1E96B 2WPVA 2Y4UA 5C1DA 5HQ8A 4NRHB 2I6HA 2C2LA 4GA2A 3Q49B 5CCMA 3ESKA 3LY7A 1QZ2A 3KAEA 1KT1A 4I2ZA 3MA5A 3SZ7A 5KJMA 3NF1A 3EDTB 1WM5A 2ONDA 3AS5A 5JJTA 4G24A 4H7YA 3AS8A 3E4BA 3O48A 2VQ2A 3RU0A 3QDNA 4J8FA 3K9IA 1XNFA 3ASDA 3CV0A 2DBAA 2XGOA 2Q7FA 3ZPJA 2QFCA 3RO2A 4APOA 5KJNA 3ZN3A 3KS2A 1NA3A 3CVQA 5FJYA 3RJVA 4UQXA 4CDRA 3FP3A 4GYOA 4KBQA 4H7XA 4J8DA 3MEKA 3RKVA 3QWPA 3U3WA 3ULQA 2KCKA 1HZ4A 3PDNA 2R5SA 4A1SA 4JL0A 4N5CA 2VYIA 5LCWC 3WXXA 4N3BA 4U04A 5BNWA 2P58C 1ELRA 4HOQA 5FZQA 3KD7A 2PQNA 4N2SA 4I17A 3UUXA 5DIZA 3LKUA 4GZ5A 3VTXA 3GZ2A 3HYMB 5JJ7A 1QQEA 4GYYA 2BUGA 3MV3B 3MKRA 2IF4A 5KJLA 3TAXA 3CKBA 4EQFA 4AY5A 4WUYA 4HOUA 2PZIA 4JHRA 3CK8A 4ME2A 4G2VA 1P5QA 5G05J 2Y4TA 3RIBA 2PL2A 1IHGA 2YHCA 2LSUA 5EX0A 5FZRA 2MHKA 5CCLA
chains in the Genus database with same CATH superfamily
4JC8A 4F1PA 4HFGA 1BI7B 3CK7A 3KSLA 4K5BA 5ARFA 5EIBE 4FJZA 4BERA 3LY8A 2ZGDA 5G55A 4AM9A 4Q94A 5FT9A 4RG6A 4B94A 3ZXPA 2WMOA 4V3IA 1E7UA 5J90A 4LG6A 4MLPA 2A5EA 3TWTA 4LEUA 4EZLA 4BX9A 3QJZA 4U95D 4OAVB 5IY5E 3FWVA 3IEGA 1H19A 4HRLA 4Q96A 2WXIA 1Y8MA 5ENOD 5ENTD 2AXUA 2JABA 1TNUA 2XPZA 1U2VG 3MKQA 2V4LA 4AY6A 5BUZA 2OEVA 2XGSA 2OCCE 3S7JA 3HHMA 2V5FA 3FTYA 1NA0A 2CFUA 3TGOA 3GZ1A 3G2UA 4XX5A 1IYGA 5HI7A 4A55A 4U63A 2L0TB 3V30A 3D9NA 3TWWA 2ILRA 4WAFA 5BPPA 4GYWA 2WXKA 5FTPA 3MJWA 1O1RA 2F0YA 1BPOA 2IO2C 4BTAA 2WXFA 4EECA 3EU5A 4I2WA 1AP7A 2H6FA 5CEDB 3JUEA 5D0OD 2GRPB 4LNUD 1HE8A 5LCWJ 3UT8A 2CFZA 2A5UA 3BUAA 5BT1A 3AAAC 2J4DA 3MV2B 2E0IA 1HX8A 3R7QA 3PEVB 1LTXA 4WNGA 5A23A 5CHEE 4GTMA 2LAHA 2KC7A 2RD0A 4TXQA 3TWQA 1YYHA 2Y0BG 5EN5D 3KEZA 1A17A 2L0IA 3CVPA 3S7FA 1HU3A 3N71A 2FO7A 3MGBA 3HXFA 3HVEA 3TL5A 2P9LG 2KCLA 3LXUX 3D9MA 5FQ8A 3BEEA 3I4GA 4GPKA 3ABKE 3ZHEB 3Q79A 3LYAA 4FULA 4ANUA 4B8AA 2WXNA 1K1AA 2JEKA 2VJ8A 3I3NA 2DWZA 3SNXA 2WVIA 3AS4A 1SQMA 4DX2A 5LFAA 3Q9UC 1Z3YA 2CG2A 4GZCA 2XENA 4FLHA 3O4ZA 4K5AB 5G05C 3LS8A 2E2EA 2FBNA 5FQ4A 2LNIA 2R05A 2B0OE 3FH5A 5C2YA 4YDEA 3D9IA 4GTTA 2F8XK 1DVPA 1MX2A 3PEUB 2VGXA 4G25A 4YDYA 5FIOA 4HORA 4CZ2D 1KLXA 3EUVA 4XE0A 4D10C 1ELKA 2J07A 2KZTA 4UWKA 1SVXA 1X5BA 3ZRHA 1JWGA 2OV8A 2I1KA 3AU4A 3DSTA 3PS6A 1E96B 4C9BB 3L22A 3S2AA 4DLQA 2C2LA 4GA2A 5CCMA 4RLYA 3LY7A 1DC2A 3KAEA 3MA5A 3NF1A 5LOZA 2ONDA 4F1SA 2GGFA 4G24A 4J8SA 1IHBA 3FTZA 4LNBA 3E4BA 2V8SE 1VDYA 4CT4A 3RU0A 3T5VA 4BEPA 2DBAA 3HXDA 2LO6A 2Q7FA 2ZISA 3TWSA 4HBDA 1N52A 3SQVA 4JHKA 3RO2A 3TWXA 4B8CB 5KJNA 3ZEFA 3KS2A 2R17C 3DSSA 3LDZA 1E8YA 3ULYA 2XHEA 4CDRA 4HRMB 3FU0A 3APFA 4GYOA 4KBQA 3T8KA 3R7RA 3RKVA 3QWPA 4X8QA 4L9PA 4NIKA 3ULEG 3LJ3A 3CHRA 1HZ4A 1IQUA 2R5SA 3BQOA 2NSZA 4IRUA 4UWHA 3E33A 3WXXA 3ONLA 5ANLA 4TXPA 1UJJA 4XZ4A 3KD7A 3GZSA 3ASNE 4PS7A 3DSUA 3LKUA 3CVYA 1NL4A 1OWPA 3VTXA 4FADA 4J6IA 3CLJA 4U8VD 3SD5A 3L17A 1BU9A 5AAOA 1OWNA 3ZYQA 5BXOA 3DRAA 2IF4A 2WQ7A 1SA4A 4MS6A 4EQFA 1RW2A 3CKBA 4ANVA 4I6EA 5CRVA 3D9JA 4JPSA 4ANXA 1AWCB 3LJNA 4G2VA 2P9PG 2PL2A 4C48B 1N4PA 3FEXA 3FDHA 4GAAA 5BV0A 3G2TA 2Y69E 3S7BA 2WXLA 5A6CA 3CVXA 2H6GA 2XZDG 5FZSA 2AW6A 5EX3A 1Y6IA 1HF8A 4AVXA 3LVQE 1Z6TA 4MKTA 4I9EA 4UQYA 4B0ZA 3LPZA 5G04C 4GTQA 2F8YA 3FY4A 5AQ9A 3UXGA 3W9GA 3L13A 1IKND 4DK5A 2GRNB 4I43A 4GMRA 3P1UA 5AQ7A 1N54A 3FUHA 2I2OA 1TJFA 2XS1A 2XPYA 5JMND 3I5PA 3ZNGA 3TWUA 1HS6A 3DEPA 2MOWA 4DPRA 3DXMG 4UQZA 4JEUA 3WG7E 4I9CA 3ZKJA 2LUHA 3L9TA 4YVQC 4L23A 4N5QA 5ENQD 4Z68A 5EILA 2H6IA 3EHRA 3MKQB 3UMVA 2IY0C 3R9MA 3EIJA 3SY2A 3FULA 2JLBA 3UPVA 2KBXA 4HI9A 3BG1B 3GW4A 4WWNA 4WWPA 1TYQG 3RRNB 3G2WA 4O1PA 3ABME 1H6PA 2I1JA 3VLDA 3FHEA 3FUJA 4GCOA 4BFRA 3EHMA 3J5QB 3ONKA 3FH7A 4KMOA 2YQ8A 4O1OA 2EIJE 4U0ZA 3PZ2A 4JZYA 1NZNA 5KJKA 2OEWA 4G1TA 4I1AA 3BU8A 3Q7AA 3T5XA 2IFUA 4I6JA 2X6JA 2LXLA 4BTBA 4HS2A 4XKBA 3QK0A 4JA9A 3D9OA 2XZTG 2VSXE 3JCKC 2L6JA 3PZ1A 1N0RA 5HRYA 2IO3C 3UIOC 4JB8P 1H0AA 2CHWA 4CDNA 3SO8A 3ABLE 3PNTB 2NC9A 2V0PA 2J49A 2ZXWE 4RVBA 5T3RA 4Y6CA 3HVEB 2DYRE 3RRUA 4B89A 4CEMA 3D9PA 3AG2E 4J0UA 3KEAA 1WG0A 3FU6A 4FHJA 3NZSA 2HR2A 2WQHA 3ASGA 2XCCA 4TV3A 3CEQA 3P2BA 2X6FA 2XPIA 3E30A 4HRNA 4FP7A 2QYJA 5KCMA 2PQRA 4L7TA 4HXIA 1EF1C 1KT0A 4U0SA 1D8EA 2WXJA 4I1MA 4RQIA 4OYSA 1RZ4A 3IV0A 1S64A 4GCNA 1BI8B 3G2SA 4PDXA 5ENRD 3UTMA 2WXOA 3CVVA 3IXEA 1DCQA 3G2VA 1H2TC 4JW1A 2R2LA 4E6HA 3R9AB 2VGXB 5KBAA 3MZLB 4GA1A 4ATGA 2EIME 4UI9K 2IQCA 4GU5A 2KZTB 1W3BA 2P9NG 5LP0A 4NRHB 3FTUA 3AG1E 3ZYKA 1WM5A 4H7YA 4DX6D 1SZ9A 1Q2ZA 4TUUA 3CVUA 2BKGA 3ZUVB 4U8YD 4M3OA 3QDNA 2MRIA 5ENNA 2YHEA 1XNFA 3ASOE 3D3MA 2H6HA 2XGOA 4U8HA 5LX8A 2J8SD 3UKRG 1U3DA 3L6AA 4APOA 2OVFA 3CVQA 1U3CA 4UQXA 2WXGA 1G3NB 4H7XA 5CECB 4J8DA 4I6GA 4EHMA 2AXVA 3RRMB 1K1BA 3JUIA 3APDA 3PDNA 4KZ0A 1JWFA 3B95A 3ENEA 1EYHA 2VYIA 4FLBA 4OVVA 1KZPA 4LCTA 3C3OA 4F53A 2A4ZA 1Z3XA 2P9IG 1E8XA 4N2SA 2GRQB 3AG4E 3L08A 2VTBA 5EYPF 1OY3D 3PH0C 5JJ7A 2R02A 3UX4A 3D9HA 2R59A 2WM9A 2HE0A 3UM2A 5KJLA 5FINA 3DPYA 5EYLA 4WUYA 3ML8A 4URKA 4AJWA 2EINE 1YMPA 2PZIA 4JHRA 3NZUA 4ME2A 4ATZD 2ETAA 3PVLA 1P5QA 5G05J 3SBTB 1HG5A 2DCPA 2YHCA 3JQ0A 4OVUA 3E37A 3PZ4A 3QNKA 1MX4A 1N94A 1N95A 4LERA 5FZRA 4BY6A 3CVLA 5E75A 4DX1A 4NURA 1TNZA 5DBKA 2XS8A 5AN8A 5AYWD 3PE4A 4EPZA 1OXJA 5CMYA 3RK6A 3FTSA 3KSQA 3TG5A 2GRLA 3HXEA 1SA5A 4XIFA 3SF4A 2WXMA 3OXLA 2GRMA 2FI7A 5AARA 4WNDA 4JD2G 2QZAA 4N3CA 2ZIRA 3X2QE 4GTVA 4ILIA 3ML9A 4K0RA 1ZU2A 3VTYA 1ELWA 2XGMA 3UIPC 3T8MA 1SZAA 1LF8A 3PRZA 4EZKA 3TWRA 4JXTA 1OCOE 4KVOA 3DPDA 1O1TA 4KXKB 3QARA 3TWVA 4UI9C 1TNBA 3U66A 3C72A 4CRWA 1HXIA 3FTXA 3OAWA 4TRQA 5BXUA 3RO3A 4GMLA 4KT6B 2WXPA 4YVOA 4EBAG 1O5MA 4CCAA 3FU5A 5EIDA 4BT8A 4HI8A 5ENSD 4LUNU 4G26A 2PM6A 5M72A 3OXFA 5HKPA 4TXRA 3C3RA 3ZYMA 2C0MA 2FULA 1INZA 4BT9A 1KPSB 3Q4AB 2IEJA 4FU3A 1X81A 3UT7A 1ZBPA 1DCEA 2EQXA 3DSXA 1PC2A 1N0QA 4XI9A 3B7BA 3Q15A 4O60A 3U9WA 1MYOA 1OCZE 1OWMA 2P9UG 2IOLA 3S7DA 1UW4B 3SFXA 4BSXA 3SBSA 4XKCA 1V55E 1WAO1 2QYUA 2XEEA 1K8KG 4C0MA 2XCBA 4HOSA 5KNHD 4A3VA 1YA0A 2UY1A 3IBEA 1IQRA 3I4RB 4KZCA 5AIJA 3CKCA 3LEWA 1UN9A 2VGYA 3DEOA 4CGVA 4N3AA 3V2OA 1SW6A 1FT2A 2GW1A 2CG3A 3CHPA 1D9SA 1HH8A 4NACA 3UI2A 2FF4A 3L54A 4GA0A 4ZFHA 1OWOA 3ZIMA 4UWLA 3NAWA 2X6HA 3CGHA 3GYZA 4FJYA 5ENPD 4U07A 3JQ1A 4C0EA 4BWRA 3TXMA 1GW6A 3CVNA 4GB9A 3LCAA 4G8LA 3QKYA 3QAQA 2XRYA 1XGWA 4UWGA 1MX6A 1H6OA 4L1BA 1NP7A 4XEIG 3URZA 4K03A 4HOTA 3TG4A 3RAUA 5G04J 3FUIA 2KM4A 3PNLB 1OCRE 3FUKA 4ABNA 3ASHA 2L9BA 4B93B 4KYOB 2P9SG 2DYSE 5CBNA 4JVSA 4PS8A 3PE3A 4A3TA 5B1BE 3C98A 4NQ0A 4PS3A 2AWIA 1MJ0A 1H2VC 4DI4A 2OOEA 2X6IA 3SFYA 3QWWA 4P29A 3FFLA 3ZFWA 3QOUA 5CERB 3SFZA 3CK9A 4HVBA 4Q69A 5FQ6A 2J09A 3PZDA 3OXGA 2VSYA 3FTVA 3SHFA 2Y4UA 5HQ8A 4I1OB 2Y1LE 4GZDA 1N4QA 1TN7A 3Q49B 4F7AA 2DZOA 3PUKA 1QZ2A 1JCSA 4I2ZA 3SZ7A 4A63B 1A5EA 1Z5SC 4PUCA 4F6RD 3HXBA 5HS0A 3UT4A 3AS8A 3UM3A 4AEZC 1E8WA 4GPMA 2VQ2A 1D8DA 3DSWA 2YNQA 1EDUA 3HRAA 3Q78A 3ASDA 3CV0A 4HLLA 1MQSA 3ZPJA 5CEAA 2QFCA 3PUJA 3W9FA 4AXHA 1UG3A 4DI3A 4WWOA 2BF0X 4AP2A 1BLXB 1NFIE 2IONA 1HG2A 5FJYA 3RJVA 3FP3A 4BESA 4KVMA 3MEKA 1JCRA 3JXJA 2IU1A 2I9CA 5KWDA 1OCCE 4A1SA 4J8YA 4JL0A 5JHBA 5LCWC 4N3BA 1WY6A 2P58C 3AG3E 3EHQA 3UM1A 1UJKA 3V79K 1ELRA 5FZQA 3ZVVA 1KZOA 2PQNA 1TN6A 3DWLG 5G2NA 3E32A 4YDWA 3GZ2A 3HYMB 4R7LA 2LXMA 1FVHA 1QQEA 3APCA 4GYYA 2DVWA 3CIAA 2VTBB 2BUGA 3MV3B 3V31A 3MKRA 4DRXE 4ACLA 3TAXA 4AY5A 4L2YA 4G8KA 4YDOA 3VLFA 4HOUA 3EHNA 3ISMC 3C5RA 3SGHA 4ANWA 4FHKA 3DXKG 3HXCA 3ZW3A 4EZJA 4OAUC 5FWQA 1MZCA 5CMWA 5B3SE 2YINA 5EX0A 3FU3A 1H2UA 1S0PA 2ETBA 3ZXSA 2XEHA 4WNEA 1E90A 3PZ3A 3U4TA 4LNGA 2X3MA 1E8ZA 2FO1E 4G23A 4UWFA 1N4RA 5JJ6A 5JA4D 3IHYA 1JCQA 4DX5D 3CR3A 2EIKE 3FH8A 1OUVA 4CDMA 2PNNA 2AVPA 1WDYA 4IULA 4GTOA 1O1SA 4CYMD 3MYVA 5KNGA 1S63A 4ILHB 2NXPA 5CBOA 4IN3B 4J7WA 3CQCB 2OVBA 2CHXA 4XI0A 2WXRA 3LVRE 4IYPA 3ZU7B 2LSVA 3EJNA 5JHAA 4BETA 2J4BA 2RFMA 4CGWA 3Q47B 4M7CA 2C0LA 4HNAD 3LY9A 4BSZB 2WQ6A 4DJAA 1TNOA 1TR4A 5D2MC 2QY7A 1JPLA 1OT8A 4TUMA 2HM8A 3OTNA 2J08A 5CRUA 1UN8A 3UKUG 2ZGGA 4GZ6A 4GTRA 4AV7A 4L2LA 3FUNA 3NOGD 3NQPA 3PREA 1V54E 1B89A 3U64A 3ZYLA 4GTSA 4U7EB 1YCSB 1FPPA 2X38A 4CT0A 2WB2A 1K3ZD 3UQ3A 2HYZA 4N39A 5AJLA 2P2CP 3D9KA 5A7DB 4DLOA 4F3VA 4MBGA 2ETCA 3L82A 5EKQD 3VLEA 5ITZF 3ZGQA 2B6CA 3B7SA 3EU9A 2XEVA 5BW8C 3FUMA 4E85A 4UUCA 2PM7A 2F37A 2DIWA 5EDSA 1LD7A 4JEHA 2VGEA 3NBNB 4A1GA 4JHJA 2KATA 1NI1A 4HB5A 3FUFA 4Y6WA 1JUQA 3HDXA 2RG8A 2QC9A 3QWVA 3CQGB 4DUIA 5D0QD 1FCHA 4YNDA 3NB2A 3J5PA 2L6BA 3CHSA 3CSFA 2FEZA 2UY1B 3ZHEA 4JA7A 3ASFA 1N4SA 4O6FA 1TEZA 3T9KA 1FVFA 1PAQA 4RG9A 2LAIA 4U0UA 1E7VA 4J8EA 2AXZA 3ESLA 5ANRA 3L16A 3B7UX 1L5JA 3Q5MA 5H7PA 4ZHBA 2MYOA 5E76A 5T8IA 2IJGX 3DSVA 3JYSA 2HO1A 2XQ0A 1TNYA 4DX7D 4GMJA 4AIFA 1HO8A 4W9RA 5D66A 2UWJG 1N11A 1S70B 1ZB1A 5ARGA 5AQAA 1N9AA 3CSTA 3CHMA 2VSNA 3FUDA 3FTWA 4ILGA 1QBQA 3IKOB 2Y3AA 3CHQA 4U96D 2J9QA 1TJCA 2GROB 2NYJA 4K5CA 3B7TA 3RSEG 4APFA 4GZ3A 1QNFA 3Q75A 2KCVA 2RFAA 3D9LA 4N2QA 4WNFA 4UI9J 2X6KA 2WPVA 5C1DA 3FEYA 5AJDA 2I6HA 4EBAA 3Q7FA 3ESKA 1HFAA 3B7RL 1KT1A 5KJMA 2V4HC 3EDTB 3B13A 3AS5A 5JJTA 1OWLA 3AJIA 4LRZA 2KXPC 4AOFA 4ACKA 3Q73A 3CHOA 3O48A 3MX3A 4J8FA 3K9IA 3FUEA 5AENA 1QYMA 2XRZA 3JXIA 3TXNA 2GRRB 3UINC 4LSZE 5FQ7A 3V2XA 3ZN3A 3Q9NC 1NA3A 5J08A 4QQIA 1FT1A 2WXHA 3TJPA 1PY1A 3U3WA 5BV1A 3ULQA 2KCKA 3QC1A 1H6KA 2AJAA 4BX8A 3C3QA 3HIZA 3SI5A 2V5QC 4N5CA 1EPUA 3UM0A 2BTDA 1LD8A 4U04A 5BNWA 3EIQC 1IXVA 4HOQA 4FC8A 4RSYA 2IOSA 2BEDA 3AU5A 4PH4B 3MCXA 4I17A 3UUXA 3BG0B 5DIZA 2VSOE 4GZ5A 5B1AE 2RKKA 4G11A 2WXQA 1BD8A 3CVWA 4GTPA 3F6QA 2WMNA 2EILE 3NOCD 4FA6A 4MRUA 1MHQA 3DBSA 4QFVA 5AQBA 2BKKB 5T4YA 3IHVA 2R03A 3E34A 4HQDA 2M63A 3CK8A 1UOHA 2DZNA 3QB2A 2Y4TA 3RIBA 1DNPA 1IHGA 3HG0D 4HLEA 2LSUA 1TN8A 2P9KG 2CHZA 2ZU6B 2MHKA 5CCLA
chains in the Genus database with same CATH topology
3CVLA 4JC8A 5E75A 3ZXSA 3S7BA 4HFGA 2WXLA 4NURA 4WNEA 1E90A 5DBKA 5A6CA 3CVXA 3CK7A 5AYWD 3U4TA 3PE4A 4EPZA 5FZSA 2AW6A 2X3MA 5CMYA 1E8ZA 5EX3A 3RK6A 1Y6IA 3FTSA 4G23A 5ARFA 1HF8A 3TG5A 4FJZA 4UWFA 2GRLA 3LY8A 5G55A 5JJ6A 4AM9A 4AVXA 3IHYA 3LVQE 4Q94A 1Z6TA 4MKTA 4I9EA 4XIFA 4UQYA 4B0ZA 3SF4A 2WXMA 3CR3A 3LPZA 5G04C 5FT9A 4RG6A 3OXLA 2GRMA 4B94A 2FI7A 2WMOA 3FY4A 4V3IA 1E7UA 3FH8A 3L13A 5J90A 4WNDA 1OUVA 4CDMA 4DK5A 2AVPA 4I43A 4MLPA 3P1UA 4IULA 4N3CA 1N54A 3FUHA 2I2OA 1TJFA 4ILIA 3ML9A 3MYVA 2XPYA 4ILHB 4K0RA 2NXPA 1ZU2A 3I5PA 4IN3B 4LEUA 3VTYA 1ELWA 4EZLA 2XGMA 4BX9A 3QJZA 3T8MA 3CQCB 2OVBA 3FWVA 3IEGA 1SZAA 2CHXA 4XI0A 1HS6A 1H19A 1LF8A 2MOWA 2WXRA 3LVRE 4IYPA 4DPRA 4Q96A 4UQZA 4JEUA 2LSVA 3EJNA 3PRZA 4JXTA 4EZKA 5JHAA 2J4BA 2WXIA 4I9CA 4CGWA 1Y8MA 3Q47B 4KVOA 2C0LA 3DPDA 2AXUA 2XPZA 3LY9A 2WQ6A 4KXKB 3QARA 3MKQA 3U66A 2V4LA 4UI9C 4AY6A 4DJAA 5BUZA 2XGSA 4CRWA 1HXIA 3FTXA 3OAWA 4YVQC 4TRQA 4L23A 3S7JA 3HHMA 2V5FA 3FTYA 1NA0A 2QY7A 1JPLA 2CFUA 3RO3A 2HM8A 3MKQB 3TGOA 3UMVA 3OTNA 2J08A 3GZ1A 3EIJA 4GMLA 4KT6B 2WXPA 4YVOA 3G2UA 4EBAG 1UN8A 4CCAA 4XX5A 3FULA 4GZ6A 1IYGA 4AV7A 5HI7A 4L2LA 3FU5A 3FUNA 2JLBA 4A55A 4U63A 2L0TB 3UPVA 3NQPA 4BT8A 3D9NA 2ILRA 3BG1B 3PREA 1B89A 3GW4A 3U64A 3ZYLA 4WWNA 4WWPA 4WAFA 4LUNU 5BPPA 4G26A 4GYWA 2PM6A 2WXKA 3G2WA 5FTPA 3RRNB 5M72A 2X38A 3MJWA 3OXFA 4CT0A 3ZYMA 2WB2A 2I1JA 3VLDA 2C0MA 2FULA 3UQ3A 1INZA 2HYZA 3FHEA 4BT9A 1BPOA 3FUJA 4GCOA 3Q4AB 2WXFA 4N39A 5AJLA 4I2WA 4BTAA 3D9KA 4FU3A 3EHMA 4BFRA 4EECA 3UT7A 5A7DB 4DLOA 5D0OD 4F3VA 3ONKA 1ZBPA 1HE8A 2EQXA 3UT8A 2CFZA 1PC2A 2A5UA 4XI9A 5LCWJ 5BT1A 3Q15A 5EKQD 3U9WA 2J4DA 3VLEA 3ZGQA 3FH7A 3B7SA 4KMOA 3MV2B 2XEVA 1OWMA 5BW8C 2E0IA 1HX8A 3FUMA 2YQ8A 4E85A 2IOLA 2PM7A 3R7QA 3PEVB 4U0ZA 3S7DA 1UW4B 4WNGA 4JZYA 4BSXA 3SBSA 5A23A 1NZNA 2DIWA 4XKCA 5CHEE 5KJKA 5EDSA 4G1TA 4JEHA 1WAO1 4I1AA 4I6JA 2IFUA 2LAHA 3T5XA 2KC7A 2RD0A 4A1GA 4JHJA 2KATA 2X6JA 4BTBA 3FUFA 4HS2A 4C0MA 3KEZA 4Y6WA 1A17A 2L0IA 2XCBA 4XKBA 3QK0A 3CVPA 4HOSA 1JUQA 4JA9A 3S7FA 4A3VA 3HDXA 1HU3A 3D9OA 1YA0A 3N71A 2UY1A 2RG8A 2FO7A 3IBEA 2VSXE 1IQRA 3I4RB 3QWVA 4KZCA 3JCKC 3CQGB 2L6JA 3MGBA 5D0QD 3CKCA 5AIJA 1FCHA 3LEWA 1UN9A 2VGYA 4YNDA 3HVEA 1H0AA 2CHWA 3TL5A 4CDNA 4CGVA 4N3AA 3CHSA 3CSFA 2FEZA 2KCLA 2UY1B 3LXUX 3PNTB 3ZHEA 2GW1A 2NC9A 2V0PA 3D9MA 2J49A 4JA7A 3ASFA 2CG3A 3CHPA 4RVBA 5T3RA 1HH8A 5FQ8A 4Y6CA 4NACA 3HVEB 3BEEA 3I4GA 2FF4A 3L54A 4GA0A 3RRUA 4GPKA 4O6FA 1TEZA 1OWOA 3ZIMA 4B89A 3ZHEB 4CEMA 4UWLA 1FVFA 2X6HA 3D9PA 4J0UA 1PAQA 3CGHA 2LAIA 3LYAA 4FULA 4RG9A 4U0UA 3GYZA 4FJYA 1E7VA 4ANUA 4U07A 3JQ1A 4B8AA 2WXNA 4C0EA 4BWRA 4J8EA 3TXMA 3FU6A 1GW6A 2AXZA 3CVNA 3LCAA 4FHJA 3NZSA 4GB9A 3ESLA 5ANRA 2JEKA 3L16A 2VJ8A 2HR2A 2WQHA 3B7UX 1L5JA 3ASGA 2XCCA 3I3NA 3Q5MA 3SNXA 3QKYA 2WVIA 4TV3A 3CEQA 3P2BA 3QAQA 5E76A 3AS4A 2X6FA 2XRYA 5T8IA 1XGWA 2IJGX 2XPIA 4UWGA 3JYSA 4L1BA 2HO1A 2XQ0A 1SQMA 1NP7A 3URZA 4K03A 4FP7A 5LFAA 4HOTA 3TG4A 5KCMA 4GMJA 1Z3YA 2CG2A 4AIFA 1HO8A 5G04J 3FUIA 4W9RA 2KM4A 4GZCA 3PNLB 4FLHA 3FUKA 4ABNA 3O4ZA 2PQRA 4L7TA 3ASHA 2UWJG 4HXIA 5G05C 2L9BA 1EF1C 3LS8A 2E2EA 4KYOB 2FBNA 5FQ4A 2LNIA 1KT0A 3FH5A 5ARGA 3CSTA 5C2YA 3CHMA 2VSNA 4U0SA 3FUDA 4JVSA 3FTWA 4ILGA 3D9IA 2WXJA 4PS8A 3PE3A 4I1MA 3IKOB 4A3TA 3C98A 4NQ0A 4OYSA 1DVPA 3IV0A 3PEUB 4PS3A 4GCNA 2AWIA 2VGXA 3G2SA 2Y3AA 4PDXA 3CHQA 2J9QA 4G25A 2WXOA 1TJCA 1H2VC 4DI4A 2OOEA 3CVVA 4HORA 2X6IA 3G2VA 1H2TC 3QWWA 4P29A 1KLXA 3B7TA 4XE0A 3FFLA 4JW1A 1ELKA 4D10C 4E6HA 3R9AB 2J07A 2KZTA 3ZFWA 3QOUA 4GZ3A 4UWKA 2VGXB 4APFA 1X5BA 1QNFA 3SFZA 3ZRHA 2KCVA 1JWGA 3CK9A 4HVBA 4Q69A 2OV8A 2I1KA 3AU4A 3D9LA 3MZLB 2J09A 3PZDA 5FQ6A 3OXGA 4N2QA 4GA1A 4WNFA 4UI9J 4ATGA 4UI9K 2X6KA 2IQCA 4GU5A 2VSYA 3FTVA 3PS6A 2KZTB 3SHFA 1W3BA 1E96B 2WPVA 2Y4UA 4C9BB 5C1DA 3L22A 5HQ8A 4I1OB 5LP0A 4GZDA 3FEYA 4NRHB 3S2AA 5AJDA 4DLQA 2I6HA 2C2LA 3FTUA 4GA2A 3Q49B 4EBAA 4F7AA 5CCMA 3PUKA 3ESKA 3LY7A 1HFAA 1QZ2A 3B7RL 3KAEA 1KT1A 4I2ZA 3MA5A 3SZ7A 5KJMA 3NF1A 3EDTB 3B13A 3ZYKA 1WM5A 5LOZA 2ONDA 3AS5A 4F1SA 5JJTA 2GGFA 1OWLA 4PUCA 4G24A 4H7YA 4J8SA 3UT4A 4LRZA 3AS8A 3FTZA 1SZ9A 4AOFA 4AEZC 4TUUA 3CVUA 3E4BA 1E8WA 4ACKA 2V8SE 3CHOA 3O48A 2VQ2A 1VDYA 4CT4A 3RU0A 2YNQA 3MX3A 4M3OA 1EDUA 3QDNA 4J8FA 3K9IA 3FUEA 2MRIA 5AENA 5ENNA 3T5VA 2YHEA 1XNFA 2XRZA 3TXNA 3D3MA 3ASDA 3CV0A 2DBAA 2XGOA 1MQSA 2LO6A 2Q7FA 4U8HA 5LX8A 3ZPJA 1N52A 2QFCA 3PUJA 4JHKA 5FQ7A 1U3DA 3L6AA 3RO2A 4APOA 4B8CB 5KJNA 4AXHA 2OVFA 1UG3A 3ZEFA 3ZN3A 4DI3A 3KS2A 4WWOA 2BF0X 1NA3A 3CVQA 4AP2A 2R17C 3LDZA 1E8YA 2IONA 2XHEA 1HG2A 5FJYA 3RJVA 5J08A 1U3CA 4UQXA 4CDRA 2WXGA 3FU0A 3APFA 3FP3A 4GYOA 4KBQA 4KVMA 2WXHA 4H7XA 3R7RA 4J8DA 3TJPA 3MEKA 3RKVA 1PY1A 3QWPA 4I6GA 5BV1A 3ULQA 3U3WA 2AXVA 2KCKA 3QC1A 1H6KA 4BX8A 3LJ3A 3CHRA 3RRMB 3HIZA 1HZ4A 3JUIA 3APDA 2IU1A 1IQUA 2I9CA 2R5SA 3PDNA 3SI5A 4KZ0A 1JWFA 2NSZA 4A1SA 3ENEA 4JL0A 1EYHA 4IRUA 4N5CA 1EPUA 2VYIA 4FLBA 4UWHA 4OVVA 5JHBA 5LCWC 2BTDA 3WXXA 4N3BA 4U04A 5BNWA 3ONLA 4LCTA 1WY6A 2P58C 4F53A 5ANLA 3EIQC 1UJKA 1UJJA 2A4ZA 1Z3XA 1ELRA 4HOQA 4FC8A 5FZQA 4RSYA 1E8XA 3KD7A 4XZ4A 2IOSA 3GZSA 3ZVVA 2PQNA 3AU5A 4N2SA 4PH4B 3MCXA 4I17A 3UUXA 4PS7A 3BG0B 5DIZA 2VSOE 3LKUA 5G2NA 3L08A 4GZ5A 2VTBA 3CVYA 4G11A 1OWPA 3VTXA 4FADA 2WXQA 3GZ2A 3PH0C 4J6IA 3CVWA 3HYMB 5JJ7A 2WMNA 3CLJA 3UX4A 4R7LA 2R59A 3SD5A 3L17A 1FVHA 1QQEA 3APCA 4GYYA 3CIAA 2VTBB 1OWNA 2BUGA 2WM9A 3MV3B 3ZYQA 3MKRA 4FA6A 4MRUA 2IF4A 2WQ7A 1MHQA 4ACLA 5KJLA 4MS6A 3TAXA 3CKBA 4ANVA 4EQFA 4AY5A 3DBSA 4I6EA 4L2YA 4QFVA 4WUYA 3VLFA 3D9JA 4JPSA 3ML8A 4ANXA 4HOUA 4URKA 4AJWA 5T4YA 3EHNA 2PZIA 3IHVA 4JHRA 2M63A 3NZUA 3CK8A 4ME2A 3SGHA 4ANWA 4FHKA 4G2VA 3PVLA 1P5QA 3QB2A 3ZW3A 4EZJA 5G05J 2Y4TA 3RIBA 3SBTB 1HG5A 2DCPA 2PL2A 1DNPA 5FWQA 1IHGA 2YHCA 3JQ0A 4HLEA 4OVUA 3QNKA 3FEXA 2LSUA 3FDHA 4GAAA 5CMWA 2CHZA 2YINA 2ZU6B 4LERA 3FU3A 5EX0A 5BV0A 5FZRA 1H2UA 2MHKA 4BY6A 3G2TA 5CCLA 1S0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CVL A;  3S7B A;  4WNE A;  5DBK A;  5A6C A;  3CK7 A;  5AYW D;  3U4T A;  3PE4 A;  5FZS A;  5EX3 A;  5ARF A;  4G23 A;  3TG5 A;  3LY8 A;  5JJ6 A;  4AM9 A;  4I9E A;  4XIF A;  4UQY A;  3SF4 A;  3LPZ A;  5G04 C;  5FT9 A;  4RG6 A;  3OXL A;  4B94 A;  2FI7 A;  4WND A;  1OUV A;  2AVP A;  4N3C A;  1ZU2 A;  4IN3 B;  4LEU A;  3VTY A;  1ELW A;  2XGM A;  3FWV A;  3IEG A;  4XI0 A;  4UQZ A;  2LSV A;  4I9C A;  4CGW A;  1Y8M A;  3Q47 B;  2C0L A;  3LY9 A;  4KXK B;  4UI9 C;  4AY6 A;  2XGS A;  1HXI A;  4YVQ C;  3S7J A;  2V5F A;  1NA0 A;  3RO3 A;  3TGO A;  3GZ1 A;  4YVO A;  4GZ6 A;  1IYG A;  5HI7 A;  2JLB A;  3UPV A;  4BT8 A;  1B89 A;  3GW4 A;  4G26 A;  4GYW A;  5M72 A;  5FTP A;  3OXF A;  2C0M A;  3UQ3 A;  2HYZ A;  4BT9 A;  4N39 A;  4GCO A;  3Q4A B;  4BTA A;  4I2W A;  5A7D B;  5D0O D;  4F3V A;  1ZBP A;  5LCW J;  1PC2 A;  4XI9 A;  5BT1 A;  3Q15 A;  5EKQ D;  3ZGQ A;  3MV2 B;  2XEV A;  5BW8 C;  2YQ8 A;  4U0Z A;  3S7D A;  4WNG A;  1NZN A;  5KJK A;  5CHE E;  4G1T A;  1WAO 1;  4I1A A;  2IFU A;  2KC7 A;  2KAT A;  4BTB A;  4Y6W A;  1A17 A;  2XCB A;  4HOS A;  3CVP A;  3S7F A;  4JA9 A;  1YA0 A;  3N71 A;  2UY1 A;  2FO7 A;  3QWV A;  2L6J A;  5D0Q D;  3CKC A;  1FCH A;  2VGY A;  4YND A;  4CGV A;  4N3A A;  2FEZ A;  2KCL A;  2UY1 B;  3ZHE A;  2GW1 A;  2NC9 A;  4JA7 A;  3ASF A;  1HH8 A;  4Y6C A;  3BEE A;  2FF4 A;  4GA0 A;  4GPK A;  4O6F A;  3ZHE B;  4J0U A;  3LYA A;  4RG9 A;  4U0U A;  3GYZ A;  4U07 A;  4BWR A;  4J8E A;  3CVN A;  3LCA A;  2HR2 A;  2WQH A;  3ASG A;  2XCC A;  3Q5M A;  3QKY A;  3CEQ A;  3AS4 A;  2XPI A;  3JYS A;  2HO1 A;  3URZ A;  4HOT A;  3TG4 A;  4AIF A;  5G04 J;  4W9R A;  4ABN A;  2PQR A;  3ASH A;  2UWJ G;  5G05 C;  2E2E A;  4KYO B;  2FBN A;  2LNI A;  1KT0 A;  5ARG A;  2VSN A;  4U0S A;  3PE3 A;  4NQ0 A;  4GCN A;  2VGX A;  2J9Q A;  4G25 A;  1TJC A;  2OOE A;  4HOR A;  3QWW A;  1KLX A;  3FFL A;  3R9A B;  3ZFW A;  3QOU A;  4GZ3 A;  2VGX B;  2KCV A;  3CK9 A;  4N2Q A;  3OXG A;  4GA1 A;  4WNF A;  4UI9 J;  4UI9 K;  2VSY A;  1W3B A;  1E96 B;  2WPV A;  2Y4U A;  5C1D A;  5HQ8 A;  4NRH B;  2I6H A;  2C2L A;  4GA2 A;  3Q49 B;  5CCM A;  3ESK A;  3LY7 A;  1QZ2 A;  3KAE A;  1KT1 A;  4I2Z A;  3MA5 A;  3SZ7 A;  5KJM A;  3NF1 A;  3EDT B;  1WM5 A;  2OND A;  3AS5 A;  5JJT A;  4G24 A;  4H7Y A;  3AS8 A;  3E4B A;  3O48 A;  2VQ2 A;  3RU0 A;  3QDN A;  4J8F A;  3K9I A;  1XNF A;  3ASD A;  3CV0 A;  2DBA A;  2XGO A;  2Q7F A;  3ZPJ A;  2QFC A;  3RO2 A;  4APO A;  5KJN A;  3ZN3 A;  3KS2 A;  1NA3 A;  3CVQ A;  5FJY A;  3RJV A;  4UQX A;  4CDR A;  3FP3 A;  4GYO A;  4KBQ A;  4H7X A;  4J8D A;  3MEK A;  3RKV A;  3QWP A;  3U3W A;  3ULQ A;  2KCK A;  1HZ4 A;  3PDN A;  2R5S A;  4A1S A;  4JL0 A;  4N5C A;  2VYI A;  5LCW C;  3WXX A;  4N3B A;  4U04 A;  5BNW A;  2P58 C;  1ELR A;  4HOQ A;  5FZQ A;  3KD7 A;  2PQN A;  4N2S A;  4I17 A;  3UUX A;  5DIZ A;  3LKU A;  4GZ5 A;  3VTX A;  3GZ2 A;  3HYM B;  5JJ7 A;  1QQE A;  4GYY A;  2BUG A;  3MV3 B;  3MKR A;  2IF4 A;  5KJL A;  3TAX A;  3CKB A;  4EQF A;  4AY5 A;  4WUY A;  4HOU A;  2PZI A;  4JHR A;  3CK8 A;  4ME2 A;  4G2V A;  1P5Q A;  5G05 J;  2Y4T A;  3RIB A;  2PL2 A;  1IHG A;  2YHC A;  2LSU A;  5EX0 A;  5FZR A;  2MHK A;  5CCL A; 
#chains in the Genus database with same CATH topology
 4JC8 A;  4F1P A;  4HFG A;  1BI7 B;  3CK7 A;  3KSL A;  4K5B A;  5ARF A;  5EIB E;  4FJZ A;  4BER A;  3LY8 A;  2ZGD A;  5G55 A;  4AM9 A;  4Q94 A;  5FT9 A;  4RG6 A;  4B94 A;  3ZXP A;  2WMO A;  4V3I A;  1E7U A;  5J90 A;  4LG6 A;  4MLP A;  2A5E A;  3TWT A;  4LEU A;  4EZL A;  4BX9 A;  3QJZ A;  4U95 D;  4OAV B;  5IY5 E;  3FWV A;  3IEG A;  1H19 A;  4HRL A;  4Q96 A;  2WXI A;  1Y8M A;  5ENO D;  5ENT D;  2AXU A;  2JAB A;  1TNU A;  2XPZ A;  1U2V G;  3MKQ A;  2V4L A;  4AY6 A;  5BUZ A;  2OEV A;  2XGS A;  2OCC E;  3S7J A;  3HHM A;  2V5F A;  3FTY A;  1NA0 A;  2CFU A;  3TGO A;  3GZ1 A;  3G2U A;  4XX5 A;  1IYG A;  5HI7 A;  4A55 A;  4U63 A;  2L0T B;  3V30 A;  3D9N A;  3TWW A;  2ILR A;  4WAF A;  5BPP A;  4GYW A;  2WXK A;  5FTP A;  3MJW A;  1O1R A;  2F0Y A;  1BPO A;  2IO2 C;  4BTA A;  2WXF A;  4EEC A;  3EU5 A;  4I2W A;  1AP7 A;  2H6F A;  5CED B;  3JUE A;  5D0O D;  2GRP B;  4LNU D;  1HE8 A;  5LCW J;  3UT8 A;  2CFZ A;  2A5U A;  3BUA A;  5BT1 A;  3AAA C;  2J4D A;  3MV2 B;  2E0I A;  1HX8 A;  3R7Q A;  3PEV B;  1LTX A;  4WNG A;  5A23 A;  5CHE E;  4GTM A;  2LAH A;  2KC7 A;  2RD0 A;  4TXQ A;  3TWQ A;  1YYH A;  2Y0B G;  5EN5 D;  3KEZ A;  1A17 A;  2L0I A;  3CVP A;  3S7F A;  1HU3 A;  3N71 A;  2FO7 A;  3MGB A;  3HXF A;  3HVE A;  3TL5 A;  2P9L G;  2KCL A;  3LXU X;  3D9M A;  5FQ8 A;  3BEE A;  3I4G A;  4GPK A;  3ABK E;  3ZHE B;  3Q79 A;  3LYA A;  4FUL A;  4ANU A;  4B8A A;  2WXN A;  1K1A A;  2JEK A;  2VJ8 A;  3I3N A;  2DWZ A;  3SNX A;  2WVI A;  3AS4 A;  1SQM A;  4DX2 A;  5LFA A;  3Q9U C;  1Z3Y A;  2CG2 A;  4GZC A;  2XEN A;  4FLH A;  3O4Z A;  4K5A B;  5G05 C;  3LS8 A;  2E2E A;  2FBN A;  5FQ4 A;  2LNI A;  2R05 A;  2B0O E;  3FH5 A;  5C2Y A;  4YDE A;  3D9I A;  4GTT A;  2F8X K;  1DVP A;  1MX2 A;  3PEU B;  2VGX A;  4G25 A;  4YDY A;  5FIO A;  4HOR A;  4CZ2 D;  1KLX A;  3EUV A;  4XE0 A;  4D10 C;  1ELK A;  2J07 A;  2KZT A;  4UWK A;  1SVX A;  1X5B A;  3ZRH A;  1JWG A;  2OV8 A;  2I1K A;  3AU4 A;  3DST A;  3PS6 A;  1E96 B;  4C9B B;  3L22 A;  3S2A A;  4DLQ A;  2C2L A;  4GA2 A;  5CCM A;  4RLY A;  3LY7 A;  1DC2 A;  3KAE A;  3MA5 A;  3NF1 A;  5LOZ A;  2OND A;  4F1S A;  2GGF A;  4G24 A;  4J8S A;  1IHB A;  3FTZ A;  4LNB A;  3E4B A;  2V8S E;  1VDY A;  4CT4 A;  3RU0 A;  3T5V A;  4BEP A;  2DBA A;  3HXD A;  2LO6 A;  2Q7F A;  2ZIS A;  3TWS A;  4HBD A;  1N52 A;  3SQV A;  4JHK A;  3RO2 A;  3TWX A;  4B8C B;  5KJN A;  3ZEF A;  3KS2 A;  2R17 C;  3DSS A;  3LDZ A;  1E8Y A;  3ULY A;  2XHE A;  4CDR A;  4HRM B;  3FU0 A;  3APF A;  4GYO A;  4KBQ A;  3T8K A;  3R7R A;  3RKV A;  3QWP A;  4X8Q A;  4L9P A;  4NIK A;  3ULE G;  3LJ3 A;  3CHR A;  1HZ4 A;  1IQU A;  2R5S A;  3BQO A;  2NSZ A;  4IRU A;  4UWH A;  3E33 A;  3WXX A;  3ONL A;  5ANL A;  4TXP A;  1UJJ A;  4XZ4 A;  3KD7 A;  3GZS A;  3ASN E;  4PS7 A;  3DSU A;  3LKU A;  3CVY A;  1NL4 A;  1OWP A;  3VTX A;  4FAD A;  4J6I A;  3CLJ A;  4U8V D;  3SD5 A;  3L17 A;  1BU9 A;  5AAO A;  1OWN A;  3ZYQ A;  5BXO A;  3DRA A;  2IF4 A;  2WQ7 A;  1SA4 A;  4MS6 A;  4EQF A;  1RW2 A;  3CKB A;  4ANV A;  4I6E A;  5CRV A;  3D9J A;  4JPS A;  4ANX A;  1AWC B;  3LJN A;  4G2V A;  2P9P G;  2PL2 A;  4C48 B;  1N4P A;  3FEX A;  3FDH A;  4GAA A;  5BV0 A;  3G2T A;  2Y69 E;  3S7B A;  2WXL A;  5A6C A;  3CVX A;  2H6G A;  2XZD G;  5FZS A;  2AW6 A;  5EX3 A;  1Y6I A;  1HF8 A;  4AVX A;  3LVQ E;  1Z6T A;  4MKT A;  4I9E A;  4UQY A;  4B0Z A;  3LPZ A;  5G04 C;  4GTQ A;  2F8Y A;  3FY4 A;  5AQ9 A;  3UXG A;  3W9G A;  3L13 A;  1IKN D;  4DK5 A;  2GRN B;  4I43 A;  4GMR A;  3P1U A;  5AQ7 A;  1N54 A;  3FUH A;  2I2O A;  1TJF A;  2XS1 A;  2XPY A;  5JMN D;  3I5P A;  3ZNG A;  3TWU A;  1HS6 A;  3DEP A;  2MOW A;  4DPR A;  3DXM G;  4UQZ A;  4JEU A;  3WG7 E;  4I9C A;  3ZKJ A;  2LUH A;  3L9T A;  4YVQ C;  4L23 A;  4N5Q A;  5ENQ D;  4Z68 A;  5EIL A;  2H6I A;  3EHR A;  3MKQ B;  3UMV A;  2IY0 C;  3R9M A;  3EIJ A;  3SY2 A;  3FUL A;  2JLB A;  3UPV A;  2KBX A;  4HI9 A;  3BG1 B;  3GW4 A;  4WWN A;  4WWP A;  1TYQ G;  3RRN B;  3G2W A;  4O1P A;  3ABM E;  1H6P A;  2I1J A;  3VLD A;  3FHE A;  3FUJ A;  4GCO A;  4BFR A;  3EHM A;  3J5Q B;  3ONK A;  3FH7 A;  4KMO A;  2YQ8 A;  4O1O A;  2EIJ E;  4U0Z A;  3PZ2 A;  4JZY A;  1NZN A;  5KJK A;  2OEW A;  4G1T A;  4I1A A;  3BU8 A;  3Q7A A;  3T5X A;  2IFU A;  4I6J A;  2X6J A;  2LXL A;  4BTB A;  4HS2 A;  4XKB A;  3QK0 A;  4JA9 A;  3D9O A;  2XZT G;  2VSX E;  3JCK C;  2L6J A;  3PZ1 A;  1N0R A;  5HRY A;  2IO3 C;  3UIO C;  4JB8 P;  1H0A A;  2CHW A;  4CDN A;  3SO8 A;  3ABL E;  3PNT B;  2NC9 A;  2V0P A;  2J49 A;  2ZXW E;  4RVB A;  5T3R A;  4Y6C A;  3HVE B;  2DYR E;  3RRU A;  4B89 A;  4CEM A;  3D9P A;  3AG2 E;  4J0U A;  3KEA A;  1WG0 A;  3FU6 A;  4FHJ A;  3NZS A;  2HR2 A;  2WQH A;  3ASG A;  2XCC A;  4TV3 A;  3CEQ A;  3P2B A;  2X6F A;  2XPI A;  3E30 A;  4HRN A;  4FP7 A;  2QYJ A;  5KCM A;  2PQR A;  4L7T A;  4HXI A;  1EF1 C;  1KT0 A;  4U0S A;  1D8E A;  2WXJ A;  4I1M A;  4RQI A;  4OYS A;  1RZ4 A;  3IV0 A;  1S64 A;  4GCN A;  1BI8 B;  3G2S A;  4PDX A;  5ENR D;  3UTM A;  2WXO A;  3CVV A;  3IXE A;  1DCQ A;  3G2V A;  1H2T C;  4JW1 A;  2R2L A;  4E6H A;  3R9A B;  2VGX B;  5KBA A;  3MZL B;  4GA1 A;  4ATG A;  2EIM E;  4UI9 K;  2IQC A;  4GU5 A;  2KZT B;  1W3B A;  2P9N G;  5LP0 A;  4NRH B;  3FTU A;  3AG1 E;  3ZYK A;  1WM5 A;  4H7Y A;  4DX6 D;  1SZ9 A;  1Q2Z A;  4TUU A;  3CVU A;  2BKG A;  3ZUV B;  4U8Y D;  4M3O A;  3QDN A;  2MRI A;  5ENN A;  2YHE A;  1XNF A;  3ASO E;  3D3M A;  2H6H A;  2XGO A;  4U8H A;  5LX8 A;  2J8S D;  3UKR G;  1U3D A;  3L6A A;  4APO A;  2OVF A;  3CVQ A;  1U3C A;  4UQX A;  2WXG A;  1G3N B;  4H7X A;  5CEC B;  4J8D A;  4I6G A;  4EHM A;  2AXV A;  3RRM B;  1K1B A;  3JUI A;  3APD A;  3PDN A;  4KZ0 A;  1JWF A;  3B95 A;  3ENE A;  1EYH A;  2VYI A;  4FLB A;  4OVV A;  1KZP A;  4LCT A;  3C3O A;  4F53 A;  2A4Z A;  1Z3X A;  2P9I G;  1E8X A;  4N2S A;  2GRQ B;  3AG4 E;  3L08 A;  2VTB A;  5EYP F;  1OY3 D;  3PH0 C;  5JJ7 A;  2R02 A;  3UX4 A;  3D9H A;  2R59 A;  2WM9 A;  2HE0 A;  3UM2 A;  5KJL A;  5FIN A;  3DPY A;  5EYL A;  4WUY A;  3ML8 A;  4URK A;  4AJW A;  2EIN E;  1YMP A;  2PZI A;  4JHR A;  3NZU A;  4ME2 A;  4ATZ D;  2ETA A;  3PVL A;  1P5Q A;  5G05 J;  3SBT B;  1HG5 A;  2DCP A;  2YHC A;  3JQ0 A;  4OVU A;  3E37 A;  3PZ4 A;  3QNK A;  1MX4 A;  1N94 A;  1N95 A;  4LER A;  5FZR A;  4BY6 A;  3CVL A;  5E75 A;  4DX1 A;  4NUR A;  1TNZ A;  5DBK A;  2XS8 A;  5AN8 A;  5AYW D;  3PE4 A;  4EPZ A;  1OXJ A;  5CMY A;  3RK6 A;  3FTS A;  3KSQ A;  3TG5 A;  2GRL A;  3HXE A;  1SA5 A;  4XIF A;  3SF4 A;  2WXM A;  3OXL A;  2GRM A;  2FI7 A;  5AAR A;  4WND A;  4JD2 G;  2QZA A;  4N3C A;  2ZIR A;  3X2Q E;  4GTV A;  4ILI A;  3ML9 A;  4K0R A;  1ZU2 A;  3VTY A;  1ELW A;  2XGM A;  3UIP C;  3T8M A;  1SZA A;  1LF8 A;  3PRZ A;  4EZK A;  3TWR A;  4JXT A;  1OCO E;  4KVO A;  3DPD A;  1O1T A;  4KXK B;  3QAR A;  3TWV A;  4UI9 C;  1TNB A;  3U66 A;  3C72 A;  4CRW A;  1HXI A;  3FTX A;  3OAW A;  4TRQ A;  5BXU A;  3RO3 A;  4GML A;  4KT6 B;  2WXP A;  4YVO A;  4EBA G;  1O5M A;  4CCA A;  3FU5 A;  5EID A;  4BT8 A;  4HI8 A;  5ENS D;  4LUN U;  4G26 A;  2PM6 A;  5M72 A;  3OXF A;  5HKP A;  4TXR A;  3C3R A;  3ZYM A;  2C0M A;  2FUL A;  1INZ A;  4BT9 A;  1KPS B;  3Q4A B;  2IEJ A;  4FU3 A;  1X81 A;  3UT7 A;  1ZBP A;  1DCE A;  2EQX A;  3DSX A;  1PC2 A;  1N0Q A;  4XI9 A;  3B7B A;  3Q15 A;  4O60 A;  3U9W A;  1MYO A;  1OCZ E;  1OWM A;  2P9U G;  2IOL A;  3S7D A;  1UW4 B;  3SFX A;  4BSX A;  3SBS A;  4XKC A;  1V55 E;  1WAO 1;  2QYU A;  2XEE A;  1K8K G;  4C0M A;  2XCB A;  4HOS A;  5KNH D;  4A3V A;  1YA0 A;  2UY1 A;  3IBE A;  1IQR A;  3I4R B;  4KZC A;  5AIJ A;  3CKC A;  3LEW A;  1UN9 A;  2VGY A;  3DEO A;  4CGV A;  4N3A A;  3V2O A;  1SW6 A;  1FT2 A;  2GW1 A;  2CG3 A;  3CHP A;  1D9S A;  1HH8 A;  4NAC A;  3UI2 A;  2FF4 A;  3L54 A;  4GA0 A;  4ZFH A;  1OWO A;  3ZIM A;  4UWL A;  3NAW A;  2X6H A;  3CGH A;  3GYZ A;  4FJY A;  5ENP D;  4U07 A;  3JQ1 A;  4C0E A;  4BWR A;  3TXM A;  1GW6 A;  3CVN A;  4GB9 A;  3LCA A;  4G8L A;  3QKY A;  3QAQ A;  2XRY A;  1XGW A;  4UWG A;  1MX6 A;  1H6O A;  4L1B A;  1NP7 A;  4XEI G;  3URZ A;  4K03 A;  4HOT A;  3TG4 A;  3RAU A;  5G04 J;  3FUI A;  2KM4 A;  3PNL B;  1OCR E;  3FUK A;  4ABN A;  3ASH A;  2L9B A;  4B93 B;  4KYO B;  2P9S G;  2DYS E;  5CBN A;  4JVS A;  4PS8 A;  3PE3 A;  4A3T A;  5B1B E;  3C98 A;  4NQ0 A;  4PS3 A;  2AWI A;  1MJ0 A;  1H2V C;  4DI4 A;  2OOE A;  2X6I A;  3SFY A;  3QWW A;  4P29 A;  3FFL A;  3ZFW A;  3QOU A;  5CER B;  3SFZ A;  3CK9 A;  4HVB A;  4Q69 A;  5FQ6 A;  2J09 A;  3PZD A;  3OXG A;  2VSY A;  3FTV A;  3SHF A;  2Y4U A;  5HQ8 A;  4I1O B;  2Y1L E;  4GZD A;  1N4Q A;  1TN7 A;  3Q49 B;  4F7A A;  2DZO A;  3PUK A;  1QZ2 A;  1JCS A;  4I2Z A;  3SZ7 A;  4A63 B;  1A5E A;  1Z5S C;  4PUC A;  4F6R D;  3HXB A;  5HS0 A;  3UT4 A;  3AS8 A;  3UM3 A;  4AEZ C;  1E8W A;  4GPM A;  2VQ2 A;  1D8D A;  3DSW A;  2YNQ A;  1EDU A;  3HRA A;  3Q78 A;  3ASD A;  3CV0 A;  4HLL A;  1MQS A;  3ZPJ A;  5CEA A;  2QFC A;  3PUJ A;  3W9F A;  4AXH A;  1UG3 A;  4DI3 A;  4WWO A;  2BF0 X;  4AP2 A;  1BLX B;  1NFI E;  2ION A;  1HG2 A;  5FJY A;  3RJV A;  3FP3 A;  4BES A;  4KVM A;  3MEK A;  1JCR A;  3JXJ A;  2IU1 A;  2I9C A;  5KWD A;  1OCC E;  4A1S A;  4J8Y A;  4JL0 A;  5JHB A;  5LCW C;  4N3B A;  1WY6 A;  2P58 C;  3AG3 E;  3EHQ A;  3UM1 A;  1UJK A;  3V79 K;  1ELR A;  5FZQ A;  3ZVV A;  1KZO A;  2PQN A;  1TN6 A;  3DWL G;  5G2N A;  3E32 A;  4YDW A;  3GZ2 A;  3HYM B;  4R7L A;  2LXM A;  1FVH A;  1QQE A;  3APC A;  4GYY A;  2DVW A;  3CIA A;  2VTB B;  2BUG A;  3MV3 B;  3V31 A;  3MKR A;  4DRX E;  4ACL A;  3TAX A;  4AY5 A;  4L2Y A;  4G8K A;  4YDO A;  3VLF A;  4HOU A;  3EHN A;  3ISM C;  3C5R A;  3SGH A;  4ANW A;  4FHK A;  3DXK G;  3HXC A;  3ZW3 A;  4EZJ A;  4OAU C;  5FWQ A;  1MZC A;  5CMW A;  5B3S E;  2YIN A;  5EX0 A;  3FU3 A;  1H2U A;  1S0P A;  2ETB A;  3ZXS A;  2XEH A;  4WNE A;  1E90 A;  3PZ3 A;  3U4T A;  4LNG A;  2X3M A;  1E8Z A;  2FO1 E;  4G23 A;  4UWF A;  1N4R A;  5JJ6 A;  5JA4 D;  3IHY A;  1JCQ A;  4DX5 D;  3CR3 A;  2EIK E;  3FH8 A;  1OUV A;  4CDM A;  2PNN A;  2AVP A;  1WDY A;  4IUL A;  4GTO A;  1O1S A;  4CYM D;  3MYV A;  5KNG A;  1S63 A;  4ILH B;  2NXP A;  5CBO A;  4IN3 B;  4J7W A;  3CQC B;  2OVB A;  2CHX A;  4XI0 A;  2WXR A;  3LVR E;  4IYP A;  3ZU7 B;  2LSV A;  3EJN A;  5JHA A;  4BET A;  2J4B A;  2RFM A;  4CGW A;  3Q47 B;  4M7C A;  2C0L A;  4HNA D;  3LY9 A;  4BSZ B;  2WQ6 A;  4DJA A;  1TNO A;  1TR4 A;  5D2M C;  2QY7 A;  1JPL A;  1OT8 A;  4TUM A;  2HM8 A;  3OTN A;  2J08 A;  5CRU A;  1UN8 A;  3UKU G;  2ZGG A;  4GZ6 A;  4GTR A;  4AV7 A;  4L2L A;  3FUN A;  3NOG D;  3NQP A;  3PRE A;  1V54 E;  1B89 A;  3U64 A;  3ZYL A;  4GTS A;  4U7E B;  1YCS B;  1FPP A;  2X38 A;  4CT0 A;  2WB2 A;  1K3Z D;  3UQ3 A;  2HYZ A;  4N39 A;  5AJL A;  2P2C P;  3D9K A;  5A7D B;  4DLO A;  4F3V A;  4MBG A;  2ETC A;  3L82 A;  5EKQ D;  3VLE A;  5ITZ F;  3ZGQ A;  2B6C A;  3B7S A;  3EU9 A;  2XEV A;  5BW8 C;  3FUM A;  4E85 A;  4UUC A;  2PM7 A;  2F37 A;  2DIW A;  5EDS A;  1LD7 A;  4JEH A;  2VGE A;  3NBN B;  4A1G A;  4JHJ A;  2KAT A;  1NI1 A;  4HB5 A;  3FUF A;  4Y6W A;  1JUQ A;  3HDX A;  2RG8 A;  2QC9 A;  3QWV A;  3CQG B;  4DUI A;  5D0Q D;  1FCH A;  4YND A;  3NB2 A;  3J5P A;  2L6B A;  3CHS A;  3CSF A;  2FEZ A;  2UY1 B;  3ZHE A;  4JA7 A;  3ASF A;  1N4S A;  4O6F A;  1TEZ A;  3T9K A;  1FVF A;  1PAQ A;  4RG9 A;  2LAI A;  4U0U A;  1E7V A;  4J8E A;  2AXZ A;  3ESL A;  5ANR A;  3L16 A;  3B7U X;  1L5J A;  3Q5M A;  5H7P A;  4ZHB A;  2MYO A;  5E76 A;  5T8I A;  2IJG X;  3DSV A;  3JYS A;  2HO1 A;  2XQ0 A;  1TNY A;  4DX7 D;  4GMJ A;  4AIF A;  1HO8 A;  4W9R A;  5D66 A;  2UWJ G;  1N11 A;  1S70 B;  1ZB1 A;  5ARG A;  5AQA A;  1N9A A;  3CST A;  3CHM A;  2VSN A;  3FUD A;  3FTW A;  4ILG A;  1QBQ A;  3IKO B;  2Y3A A;  3CHQ A;  4U96 D;  2J9Q A;  1TJC A;  2GRO B;  2NYJ A;  4K5C A;  3B7T A;  3RSE G;  4APF A;  4GZ3 A;  1QNF A;  3Q75 A;  2KCV A;  2RFA A;  3D9L A;  4N2Q A;  4WNF A;  4UI9 J;  2X6K A;  2WPV A;  5C1D A;  3FEY A;  5AJD A;  2I6H A;  4EBA A;  3Q7F A;  3ESK A;  1HFA A;  3B7R L;  1KT1 A;  5KJM A;  2V4H C;  3EDT B;  3B13 A;  3AS5 A;  5JJT A;  1OWL A;  3AJI A;  4LRZ A;  2KXP C;  4AOF A;  4ACK A;  3Q73 A;  3CHO A;  3O48 A;  3MX3 A;  4J8F A;  3K9I A;  3FUE A;  5AEN A;  1QYM A;  2XRZ A;  3JXI A;  3TXN A;  2GRR B;  3UIN C;  4LSZ E;  5FQ7 A;  3V2X A;  3ZN3 A;  3Q9N C;  1NA3 A;  5J08 A;  4QQI A;  1FT1 A;  2WXH A;  3TJP A;  1PY1 A;  3U3W A;  5BV1 A;  3ULQ A;  2KCK A;  3QC1 A;  1H6K A;  2AJA A;  4BX8 A;  3C3Q A;  3HIZ A;  3SI5 A;  2V5Q C;  4N5C A;  1EPU A;  3UM0 A;  2BTD A;  1LD8 A;  4U04 A;  5BNW A;  3EIQ C;  1IXV A;  4HOQ A;  4FC8 A;  4RSY A;  2IOS A;  2BED A;  3AU5 A;  4PH4 B;  3MCX A;  4I17 A;  3UUX A;  3BG0 B;  5DIZ A;  2VSO E;  4GZ5 A;  5B1A E;  2RKK A;  4G11 A;  2WXQ A;  1BD8 A;  3CVW A;  4GTP A;  3F6Q A;  2WMN A;  2EIL E;  3NOC D;  4FA6 A;  4MRU A;  1MHQ A;  3DBS A;  4QFV A;  5AQB A;  2BKK B;  5T4Y A;  3IHV A;  2R03 A;  3E34 A;  4HQD A;  2M63 A;  3CK8 A;  1UOH A;  2DZN A;  3QB2 A;  2Y4T A;  3RIB A;  1DNP A;  1IHG A;  3HG0 D;  4HLE A;  2LSU A;  1TN8 A;  2P9K G;  2CHZ A;  2ZU6 B;  2MHK A;  5CCL A; 
#chains in the Genus database with same CATH homology
 3CVL A;  4JC8 A;  5E75 A;  3ZXS A;  3S7B A;  4HFG A;  2WXL A;  4NUR A;  4WNE A;  1E90 A;  5DBK A;  5A6C A;  3CVX A;  3CK7 A;  5AYW D;  3U4T A;  3PE4 A;  4EPZ A;  5FZS A;  2AW6 A;  2X3M A;  5CMY A;  1E8Z A;  5EX3 A;  3RK6 A;  1Y6I A;  3FTS A;  4G23 A;  5ARF A;  1HF8 A;  3TG5 A;  4FJZ A;  4UWF A;  2GRL A;  3LY8 A;  5G55 A;  5JJ6 A;  4AM9 A;  4AVX A;  3IHY A;  3LVQ E;  4Q94 A;  1Z6T A;  4MKT A;  4I9E A;  4XIF A;  4UQY A;  4B0Z A;  3SF4 A;  2WXM A;  3CR3 A;  3LPZ A;  5G04 C;  5FT9 A;  4RG6 A;  3OXL A;  2GRM A;  4B94 A;  2FI7 A;  2WMO A;  3FY4 A;  4V3I A;  1E7U A;  3FH8 A;  3L13 A;  5J90 A;  4WND A;  1OUV A;  4CDM A;  4DK5 A;  2AVP A;  4I43 A;  4MLP A;  3P1U A;  4IUL A;  4N3C A;  1N54 A;  3FUH A;  2I2O A;  1TJF A;  4ILI A;  3ML9 A;  3MYV A;  2XPY A;  4ILH B;  4K0R A;  2NXP A;  1ZU2 A;  3I5P A;  4IN3 B;  4LEU A;  3VTY A;  1ELW A;  4EZL A;  2XGM A;  4BX9 A;  3QJZ A;  3T8M A;  3CQC B;  2OVB A;  3FWV A;  3IEG A;  1SZA A;  2CHX A;  4XI0 A;  1HS6 A;  1H19 A;  1LF8 A;  2MOW A;  2WXR A;  3LVR E;  4IYP A;  4DPR A;  4Q96 A;  4UQZ A;  4JEU A;  2LSV A;  3EJN A;  3PRZ A;  4JXT A;  4EZK A;  5JHA A;  2J4B A;  2WXI A;  4I9C A;  4CGW A;  1Y8M A;  3Q47 B;  4KVO A;  2C0L A;  3DPD A;  2AXU A;  2XPZ A;  3LY9 A;  2WQ6 A;  4KXK B;  3QAR A;  3MKQ A;  3U66 A;  2V4L A;  4UI9 C;  4AY6 A;  4DJA A;  5BUZ A;  2XGS A;  4CRW A;  1HXI A;  3FTX A;  3OAW A;  4YVQ C;  4TRQ A;  4L23 A;  3S7J A;  3HHM A;  2V5F A;  3FTY A;  1NA0 A;  2QY7 A;  1JPL A;  2CFU A;  3RO3 A;  2HM8 A;  3MKQ B;  3TGO A;  3UMV A;  3OTN A;  2J08 A;  3GZ1 A;  3EIJ A;  4GML A;  4KT6 B;  2WXP A;  4YVO A;  3G2U A;  4EBA G;  1UN8 A;  4CCA A;  4XX5 A;  3FUL A;  4GZ6 A;  1IYG A;  4AV7 A;  5HI7 A;  4L2L A;  3FU5 A;  3FUN A;  2JLB A;  4A55 A;  4U63 A;  2L0T B;  3UPV A;  3NQP A;  4BT8 A;  3D9N A;  2ILR A;  3BG1 B;  3PRE A;  1B89 A;  3GW4 A;  3U64 A;  3ZYL A;  4WWN A;  4WWP A;  4WAF A;  4LUN U;  5BPP A;  4G26 A;  4GYW A;  2PM6 A;  2WXK A;  3G2W A;  5FTP A;  3RRN B;  5M72 A;  2X38 A;  3MJW A;  3OXF A;  4CT0 A;  3ZYM A;  2WB2 A;  2I1J A;  3VLD A;  2C0M A;  2FUL A;  3UQ3 A;  1INZ A;  2HYZ A;  3FHE A;  4BT9 A;  1BPO A;  3FUJ A;  4GCO A;  3Q4A B;  2WXF A;  4N39 A;  5AJL A;  4I2W A;  4BTA A;  3D9K A;  4FU3 A;  3EHM A;  4BFR A;  4EEC A;  3UT7 A;  5A7D B;  4DLO A;  5D0O D;  4F3V A;  3ONK A;  1ZBP A;  1HE8 A;  2EQX A;  3UT8 A;  2CFZ A;  1PC2 A;  2A5U A;  4XI9 A;  5LCW J;  5BT1 A;  3Q15 A;  5EKQ D;  3U9W A;  2J4D A;  3VLE A;  3ZGQ A;  3FH7 A;  3B7S A;  4KMO A;  3MV2 B;  2XEV A;  1OWM A;  5BW8 C;  2E0I A;  1HX8 A;  3FUM A;  2YQ8 A;  4E85 A;  2IOL A;  2PM7 A;  3R7Q A;  3PEV B;  4U0Z A;  3S7D A;  1UW4 B;  4WNG A;  4JZY A;  4BSX A;  3SBS A;  5A23 A;  1NZN A;  2DIW A;  4XKC A;  5CHE E;  5KJK A;  5EDS A;  4G1T A;  4JEH A;  1WAO 1;  4I1A A;  4I6J A;  2IFU A;  2LAH A;  3T5X A;  2KC7 A;  2RD0 A;  4A1G A;  4JHJ A;  2KAT A;  2X6J A;  4BTB A;  3FUF A;  4HS2 A;  4C0M A;  3KEZ A;  4Y6W A;  1A17 A;  2L0I A;  2XCB A;  4XKB A;  3QK0 A;  3CVP A;  4HOS A;  1JUQ A;  4JA9 A;  3S7F A;  4A3V A;  3HDX A;  1HU3 A;  3D9O A;  1YA0 A;  3N71 A;  2UY1 A;  2RG8 A;  2FO7 A;  3IBE A;  2VSX E;  1IQR A;  3I4R B;  3QWV A;  4KZC A;  3JCK C;  3CQG B;  2L6J A;  3MGB A;  5D0Q D;  3CKC A;  5AIJ A;  1FCH A;  3LEW A;  1UN9 A;  2VGY A;  4YND A;  3HVE A;  1H0A A;  2CHW A;  3TL5 A;  4CDN A;  4CGV A;  4N3A A;  3CHS A;  3CSF A;  2FEZ A;  2KCL A;  2UY1 B;  3LXU X;  3PNT B;  3ZHE A;  2GW1 A;  2NC9 A;  2V0P A;  3D9M A;  2J49 A;  4JA7 A;  3ASF A;  2CG3 A;  3CHP A;  4RVB A;  5T3R A;  1HH8 A;  5FQ8 A;  4Y6C A;  4NAC A;  3HVE B;  3BEE A;  3I4G A;  2FF4 A;  3L54 A;  4GA0 A;  3RRU A;  4GPK A;  4O6F A;  1TEZ A;  1OWO A;  3ZIM A;  4B89 A;  3ZHE B;  4CEM A;  4UWL A;  1FVF A;  2X6H A;  3D9P A;  4J0U A;  1PAQ A;  3CGH A;  2LAI A;  3LYA A;  4FUL A;  4RG9 A;  4U0U A;  3GYZ A;  4FJY A;  1E7V A;  4ANU A;  4U07 A;  3JQ1 A;  4B8A A;  2WXN A;  4C0E A;  4BWR A;  4J8E A;  3TXM A;  3FU6 A;  1GW6 A;  2AXZ A;  3CVN A;  3LCA A;  4FHJ A;  3NZS A;  4GB9 A;  3ESL A;  5ANR A;  2JEK A;  3L16 A;  2VJ8 A;  2HR2 A;  2WQH A;  3B7U X;  1L5J A;  3ASG A;  2XCC A;  3I3N A;  3Q5M A;  3SNX A;  3QKY A;  2WVI A;  4TV3 A;  3CEQ A;  3P2B A;  3QAQ A;  5E76 A;  3AS4 A;  2X6F A;  2XRY A;  5T8I A;  1XGW A;  2IJG X;  2XPI A;  4UWG A;  3JYS A;  4L1B A;  2HO1 A;  2XQ0 A;  1SQM A;  1NP7 A;  3URZ A;  4K03 A;  4FP7 A;  5LFA A;  4HOT A;  3TG4 A;  5KCM A;  4GMJ A;  1Z3Y A;  2CG2 A;  4AIF A;  1HO8 A;  5G04 J;  3FUI A;  4W9R A;  2KM4 A;  4GZC A;  3PNL B;  4FLH A;  3FUK A;  4ABN A;  3O4Z A;  2PQR A;  4L7T A;  3ASH A;  2UWJ G;  4HXI A;  5G05 C;  2L9B A;  1EF1 C;  3LS8 A;  2E2E A;  4KYO B;  2FBN A;  5FQ4 A;  2LNI A;  1KT0 A;  3FH5 A;  5ARG A;  3CST A;  5C2Y A;  3CHM A;  2VSN A;  4U0S A;  3FUD A;  4JVS A;  3FTW A;  4ILG A;  3D9I A;  2WXJ A;  4PS8 A;  3PE3 A;  4I1M A;  3IKO B;  4A3T A;  3C98 A;  4NQ0 A;  4OYS A;  1DVP A;  3IV0 A;  3PEU B;  4PS3 A;  4GCN A;  2AWI A;  2VGX A;  3G2S A;  2Y3A A;  4PDX A;  3CHQ A;  2J9Q A;  4G25 A;  2WXO A;  1TJC A;  1H2V C;  4DI4 A;  2OOE A;  3CVV A;  4HOR A;  2X6I A;  3G2V A;  1H2T C;  3QWW A;  4P29 A;  1KLX A;  3B7T A;  4XE0 A;  3FFL A;  4JW1 A;  1ELK A;  4D10 C;  4E6H A;  3R9A B;  2J07 A;  2KZT A;  3ZFW A;  3QOU A;  4GZ3 A;  4UWK A;  2VGX B;  4APF A;  1X5B A;  1QNF A;  3SFZ A;  3ZRH A;  2KCV A;  1JWG A;  3CK9 A;  4HVB A;  4Q69 A;  2OV8 A;  2I1K A;  3AU4 A;  3D9L A;  3MZL B;  2J09 A;  3PZD A;  5FQ6 A;  3OXG A;  4N2Q A;  4GA1 A;  4WNF A;  4UI9 J;  4ATG A;  4UI9 K;  2X6K A;  2IQC A;  4GU5 A;  2VSY A;  3FTV A;  3PS6 A;  2KZT B;  3SHF A;  1W3B A;  1E96 B;  2WPV A;  2Y4U A;  4C9B B;  5C1D A;  3L22 A;  5HQ8 A;  4I1O B;  5LP0 A;  4GZD A;  3FEY A;  4NRH B;  3S2A A;  5AJD A;  4DLQ A;  2I6H A;  2C2L A;  3FTU A;  4GA2 A;  3Q49 B;  4EBA A;  4F7A A;  5CCM A;  3PUK A;  3ESK A;  3LY7 A;  1HFA A;  1QZ2 A;  3B7R L;  3KAE A;  1KT1 A;  4I2Z A;  3MA5 A;  3SZ7 A;  5KJM A;  3NF1 A;  3EDT B;  3B13 A;  3ZYK A;  1WM5 A;  5LOZ A;  2OND A;  3AS5 A;  4F1S A;  5JJT A;  2GGF A;  1OWL A;  4PUC A;  4G24 A;  4H7Y A;  4J8S A;  3UT4 A;  4LRZ A;  3AS8 A;  3FTZ A;  1SZ9 A;  4AOF A;  4AEZ C;  4TUU A;  3CVU A;  3E4B A;  1E8W A;  4ACK A;  2V8S E;  3CHO A;  3O48 A;  2VQ2 A;  1VDY A;  4CT4 A;  3RU0 A;  2YNQ A;  3MX3 A;  4M3O A;  1EDU A;  3QDN A;  4J8F A;  3K9I A;  3FUE A;  2MRI A;  5AEN A;  5ENN A;  3T5V A;  2YHE A;  1XNF A;  2XRZ A;  3TXN A;  3D3M A;  3ASD A;  3CV0 A;  2DBA A;  2XGO A;  1MQS A;  2LO6 A;  2Q7F A;  4U8H A;  5LX8 A;  3ZPJ A;  1N52 A;  2QFC A;  3PUJ A;  4JHK A;  5FQ7 A;  1U3D A;  3L6A A;  3RO2 A;  4APO A;  4B8C B;  5KJN A;  4AXH A;  2OVF A;  1UG3 A;  3ZEF A;  3ZN3 A;  4DI3 A;  3KS2 A;  4WWO A;  2BF0 X;  1NA3 A;  3CVQ A;  4AP2 A;  2R17 C;  3LDZ A;  1E8Y A;  2ION A;  2XHE A;  1HG2 A;  5FJY A;  3RJV A;  5J08 A;  1U3C A;  4UQX A;  4CDR A;  2WXG A;  3FU0 A;  3APF A;  3FP3 A;  4GYO A;  4KBQ A;  4KVM A;  2WXH A;  4H7X A;  3R7R A;  4J8D A;  3TJP A;  3MEK A;  3RKV A;  1PY1 A;  3QWP A;  4I6G A;  5BV1 A;  3ULQ A;  3U3W A;  2AXV A;  2KCK A;  3QC1 A;  1H6K A;  4BX8 A;  3LJ3 A;  3CHR A;  3RRM B;  3HIZ A;  1HZ4 A;  3JUI A;  3APD A;  2IU1 A;  1IQU A;  2I9C A;  2R5S A;  3PDN A;  3SI5 A;  4KZ0 A;  1JWF A;  2NSZ A;  4A1S A;  3ENE A;  4JL0 A;  1EYH A;  4IRU A;  4N5C A;  1EPU A;  2VYI A;  4FLB A;  4UWH A;  4OVV A;  5JHB A;  5LCW C;  2BTD A;  3WXX A;  4N3B A;  4U04 A;  5BNW A;  3ONL A;  4LCT A;  1WY6 A;  2P58 C;  4F53 A;  5ANL A;  3EIQ C;  1UJK A;  1UJJ A;  2A4Z A;  1Z3X A;  1ELR A;  4HOQ A;  4FC8 A;  5FZQ A;  4RSY A;  1E8X A;  3KD7 A;  4XZ4 A;  2IOS A;  3GZS A;  3ZVV A;  2PQN A;  3AU5 A;  4N2S A;  4PH4 B;  3MCX A;  4I17 A;  3UUX A;  4PS7 A;  3BG0 B;  5DIZ A;  2VSO E;  3LKU A;  5G2N A;  3L08 A;  4GZ5 A;  2VTB A;  3CVY A;  4G11 A;  1OWP A;  3VTX A;  4FAD A;  2WXQ A;  3GZ2 A;  3PH0 C;  4J6I A;  3CVW A;  3HYM B;  5JJ7 A;  2WMN A;  3CLJ A;  3UX4 A;  4R7L A;  2R59 A;  3SD5 A;  3L17 A;  1FVH A;  1QQE A;  3APC A;  4GYY A;  3CIA A;  2VTB B;  1OWN A;  2BUG A;  2WM9 A;  3MV3 B;  3ZYQ A;  3MKR A;  4FA6 A;  4MRU A;  2IF4 A;  2WQ7 A;  1MHQ A;  4ACL A;  5KJL A;  4MS6 A;  3TAX A;  3CKB A;  4ANV A;  4EQF A;  4AY5 A;  3DBS A;  4I6E A;  4L2Y A;  4QFV A;  4WUY A;  3VLF A;  3D9J A;  4JPS A;  3ML8 A;  4ANX A;  4HOU A;  4URK A;  4AJW A;  5T4Y A;  3EHN A;  2PZI A;  3IHV A;  4JHR A;  2M63 A;  3NZU A;  3CK8 A;  4ME2 A;  3SGH A;  4ANW A;  4FHK A;  4G2V A;  3PVL A;  1P5Q A;  3QB2 A;  3ZW3 A;  4EZJ A;  5G05 J;  2Y4T A;  3RIB A;  3SBT B;  1HG5 A;  2DCP A;  2PL2 A;  1DNP A;  5FWQ A;  1IHG A;  2YHC A;  3JQ0 A;  4HLE A;  4OVU A;  3QNK A;  3FEX A;  2LSU A;  3FDH A;  4GAA A;  5CMW A;  2CHZ A;  2YIN A;  2ZU6 B;  4LER A;  3FU3 A;  5EX0 A;  5BV0 A;  5FZR A;  1H2U A;  2MHK A;  4BY6 A;  3G2T A;  5CCL A;  1S0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...