2IFUA

Crystal structure of a gamma-snap from danio rerio
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
275
structure length
275
Chain Sequence
AAQKISEAHEHIAKAEKYLKTSFMKWKPDYDSAASEYAKAAVAFKNAKQLEQAKDAYLQEAEAHANNRSLFHAAKAFEQAGMMLKDLQRMPEAVQYIEKASVMYVENGTPDTAAMALDRAGKLMEPLDLSKAVHLYQQAAAVFENEERLRQAAELIGKASRLLVRQQKFDEAAASLQKEKSMYKEMENYPTCYKKCIAQVLVQLHRADYVAAQKCVRESYSIPGFSGSEDCAALEDLLQAYDEQDEEQLLRVCRSPLVTYMDNDYAKLAISLKVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gamma-snap
publication title Structure and dynamics of gamma-SNAP: insight into flexibility of proteins from the SNAP family.
pubmed doi rcsb
source organism Danio rerio
molecule tags Endocytosis/exocytosis
total genus 112
structure length 275
sequence length 275
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14938 SNAP Soluble NSF attachment protein, SNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ifuA00
3O48A 4AY5A 2FI7A 4F3VA 3MKRA 2R5SA 3ASDA 4U0ZA 2PL2A 2ONDA 2Y4UA 5KJNA 2PZIA 5AYWD 1IYGA 3CK8A 1HXIA 4GZ6A 2LSUA 4NRHB 3ASHA 4JL0A 1WM5A 3LY8A 4N3AA 5G05J 4B94A 2I6HA 5LCWJ 3CVLA 5KJKA 1PC2A 1ZBPA 5BNWA 3ZFWA 4KXKB 4RG9A 2GW1A 1HZ4A 3OXLA 2Q7FA 4GYYA 2L6JA 4I2ZA 3TGOA 3ASFA 3BEEA 3HYMB 1ELWA 3LPZA 4ABNA 1QQEA 3MEKA 5FZQA 2C0LA 5JJ6A 3U4TA 1QZ2A 2HO1A 4AY6A 5G04C 2PQNA 3LY7A 2IFUA 4UI9K 3NF1A 4GPKA 2VSYA 5KJMA 3UQ3A 1ZU2A 2KCVA 4XI9A 5DIZA 4XI0A 3S7FA 2PQRA 4U04A 4JHRA 4CGVA 1ELRA 2LSVA 4NQ0A 3MV3B 3TAXA 3OXGA 3LYAA 3CK7A 4N39A 4GA2A 4H7XA 3AS4A 4G1TA 4G25A 4J8FA 3S7BA 5A6CA 3Q15A 3S7JA 3KAEA 5FZRA 3Q5MA 4YVQC 2VGXA 4KYOB 3QWPA 4WNDA 4UQXA 5EX0A 1IHGA 3WXXA 5FTPA 4U0SA 3K9IA 1A17A 4WNEA 4GA1A 5D0OD 2XEVA 3ZGQA 3CKBA 4Y6WA 3CK9A 2FEZA 5FT9A 1WAO1 3AS5A 3SF4A 2KC7A 2Y4TA 5M72A 4G24A 4G23A 2NC9A 2XCCA 3PE4A 4GCOA 4HOUA 5CCMA 3R9AB 3MV2B 4GYWA 2E2EA 4GZ3A 4RG6A 4A1SA 3Q47B 4N2QA 3MA5A 4WUYA 3ZPJA 3RKVA 4JA9A 3PDNA 4O6FA 2J9QA 2VGXB 2P58C 4UI9C 4AIFA 1KLXA 3S7DA 2KCKA 3FFLA 3JYSA 1P5QA 3ASGA 3ZN3A 3U3WA 4LEUA 3CVQA 4BT9A 4XIFA 4AM9A 3QKYA 3VTXA 5HQ8A 5BT1A 3LY9A 1E96B 2MHKA 5JJ7A 1NA3A 1NZNA 3RU0A 3URZA 5G05C 4BTAA 2XGMA 2IF4A 4CDRA 2DBAA 3OXFA 5ARFA 4J8DA 3RJVA 4GYOA 5JJTA 3EDTB 2OOEA 5ARGA 3QWVA 3LCAA 4JA7A 1W3BA 4WNGA 1FCHA 4I9CA 3AS8A 4HOSA 3ULQA 3ESKA 4GA0A 2VGYA 2VSNA 4W9RA 3Q4AB 4GZ5A 3UPVA 4IN3B 4J0UA 3KS2A 2VQ2A 3FP3A 4UI9J 2KCLA 5KJLA 3LKUA 2FF4A 4I17A 1NA0A 2V5FA 5G04J 3CKCA 4WNFA 4I1AA 3QDNA 1XNFA 4HOTA 3ZHEB 1TJCA 2LNIA 3GZ2A 4G2VA 2QFCA 2FO7A 2C0MA 4I9EA 5BW8C 4ME2A 4YVOA 4UQYA 3UUXA 4YNDA 3N71A 2KATA 1KT1A 4APOA 3VTYA 3GZ1A 2HR2A 4BTBA 2XGOA 2YQ8A 5CCLA 4J8EA 4BWRA 4BT8A 3SZ7A 1YA0A 3RO2A 4U0UA 2C2LA 3CV0A 4UQZA 5EX3A 1Y8MA 2UY1B 4G26A 5LCWC 2FBNA 3QOUA 1HH8A 4N3CA 4Y6CA 1B89A 2XPIA 4I2WA 4U07A 2AVPA 3ZHEA 2WQHA 3CEQA 3IEGA 3KD7A 3GW4A 4HOQA 2JLBA 2XGSA 2VYIA 2HYZA 4KBQA 3CVPA 2YHCA 3TG5A 4H7YA 4N3BA 4GCNA 4N5CA 5D0QD 3FWVA 5A7DB 4N2SA 4CGWA 3GYZA 3PE3A 3QWWA 3RO3A 5HI7A 4HORA 5C1DA 2WPVA 2UWJG 3CVNA 5FZSA 2XCBA 5DBKA 1KT0A 5CHEE 3RIBA 2UY1A 5EKQD 5FJYA 3TG4A 3E4BA 3Q49B 2BUGA 1OUVA 4EQFA
chains in the Genus database with same CATH superfamily
1EYHA 3IHVA 2J4DA 3RK6A 1H6OA 1N52A 1O1SA 4FJYA 3ASDA 1UJKA 3DXMG 1OXJA 2GRRB 5T3RA 2EQXA 2Y4UA 5AYWD 3CK8A 3L82A 4I6EA 4GZ6A 2AJAA 4L7TA 4NRHB 1WM5A 3LY8A 4N3AA 2VJ8A 4B94A 3CQCB 1H2UA 5CEAA 4UWLA 3ZUVB 3IKOB 1H6KA 1ZBPA 3ZFWA 4L2LA 2EINE 2R59A 1QBQA 3Q78A 4QQIA 2VSOE 3HXFA 3FHEA 2Q7FA 1TNZA 5JHAA 2NYJA 4CDMA 3TWTA 3BEEA 2WXLA 3FUJA 3T9KA 3OAWA 1ELWA 4ABNA 3MEKA 2AXZA 3FUFA 1QZ2A 2HO1A 4LSZE 1BLXB 5G04C 2PQNA 3LY7A 1DNPA 4FHKA 2VSYA 3CLJA 3ZU7B 5BXUA 3UQ3A 2J09A 2RKKA 4XI9A 1Z3YA 5FWQA 3U64A 5CBOA 2WMOA 3MV3B 3B13A 1N95A 3J5PA 3CK7A 3TXMA 4N39A 2X3MA 2OV8A 3NBNB 3G2TA 3DSXA 3S7JA 4HRLA 4O1OA 4BY6A 2HM8A 4DLOA 2LXMA 3Q5MA 1S0PA 1O5MA 4EZJA 2CHZA 3HVEA 4CEMA 4XEIG 3WXXA 4DJAA 5FTPA 3EUVA 4U0SA 3D9IA 4K0RA 2XEVA 3CKBA 1WDYA 2FO1E 3CK9A 3APFA 4XKCA 2DCPA 5JMND 3V2XA 2WVIA 4GB9A 3SF4A 2KC7A 1BI8B 4DX5D 3IV0A 4JB8P 2NC9A 1IXVA 2XHEA 3SQVA 4CZ2D 3L22A 1MX6A 3R9AB 3MV2B 3ZRHA 5FIOA 3HDXA 2I1KA 2JABA 3Q47B 5E75A 2F0YA 4HLLA 2DZOA 2ZGGA 4D10C 4C0MA 2E0IA 4OVVA 3FUEA 4JVSA 2P58C 1TN6A 4UI9C 1KLXA 2BKKB 3S7DA 1K8KG 3BG0B 1P5QA 3ASGA 1JWGA 2KZTA 3SY2A 2BF0X 3VTXA 5HQ8A 3L17A 3LY9A 1E96B 2AXUA 1D8DA 2R05A 4U8YD 1HFAA 1INZA 2M63A 4PUCA 3T8KA 5ENNA 3WG7E 2PM7A 2MYOA 4EZKA 2DIWA 1HF8A 3EIQC 3APCA 4A3TA 2VSXE 5ENTD 4XX5A 4BERA 4HLEA 2ZU6B 3CHPA 3RSEG 2OCCE 4URKA 1HO8A 3C3OA 2GRPB 3P2BA 3EDTB 3C5RA 3P1UA 1E90A 3VLFA 5ARGA 1NL4A 2CHWA 3LCAA 4JA7A 1BPOA 1SVXA 2OVBA 3EU5A 4LG6A 4WNGA 3JXJA 3CVVA 2A4ZA 4AV7A 3PNLB 3Q7FA 1FT2A 3ASOE 3ASNE 3ML9A 1HS6A 1IHBA 4W9RA 1TEZA 1QNFA 2GRNB 2R03A 2XPYA 5JA4D 3DSWA 4UI9J 4KVMA 2KCLA 2P9NG 5ENOD 1MYOA 3LKUA 1FVHA 4C48B 4AP2A 4TUMA 2WXNA 4OYSA 3CKCA 5D66A 4PS3A 2GRQB 2CHXA 3E37A 2YHEA 3HXBA 4G11A 2WXGA 3ZHEB 3MKQB 1TJCA 2LNIA 3APDA 2QFCA 2FO7A 4JEUA 2H6IA 4I9EA 3PUKA 4UQYA 2J07A 2XPZA 4JC8A 3V30A 3DEOA 2WQ7A 2XRYA 1TN7A 1KT1A 2YQ8A 4TV3A 2OEWA 3CVUA 5LOZA 4EHMA 4A63B 4UQZA 4EBAA 1MJ0A 1OWPA 1V55E 4ILHB 3L13A 1IQRA 3PZDA 1MZCA 1N11A 2WXJA 3EU9A 3ZW3A 3IEGA 3KD7A 3L9TA 3GW4A 4HOQA 5BXOA 2R17C 3JCKC 5J08A 4KBQA 2WMNA 4JZYA 5D0QD 4CGWA 1OCOE 4ANWA 3FTZA 2JEKA 1OT8A 3FTXA 2CG3A 1BD8A 4K5BA 3TWSA 4L1BA 2WPVA 5ITZF 4CDNA 5FZSA 3PZ3A 5DBKA 1KT0A 5HRYA 2UY1A 1PY1A 3TG4A 4RQIA 2X6KA 3TWXA 1A5EA 3HIZA 4AY5A 3LVQE 2FI7A 3FH8A 3HXDA 1MX2A 1U3DA 4K5AB 3ZYMA 2V8SE 1DC2A 2R5SA 1FVFA 3ISMC 4YDOA 4U0ZA 4TXRA 4F53A 4BFRA 1HXIA 2AWIA 3DSSA 4GTSA 4KMOA 1E7VA 4FLHA 4GMLA 1KPSB 4B89A 3FTSA 5D2MC 1ZB1A 1S70B 3FEXA 4B8AA 3ONKA 5BNWA 4FULA 3Q9NC 3DWLG 4LNBA 1IQUA 3E30A 2H6FA 1ELKA 3HYMB 1QQEA 1U3CA 2LXLA 2C0LA 3MJWA 4FA6A 5CMWA 4AY6A 1V54E 3FUNA 4FHJA 3Q7AA 5FQ7A 2A5UA 4XI0A 4JHRA 2LSVA 2QYUA 1N4SA 3LYAA 2B0OE 1O1TA 4GA2A 4ANXA 4G1TA 4G25A 3D9HA 3S7BA 2EILE 3HG0D 3AU5A 2XEEA 4RSYA 4KYOB 1G3NB 4J8SA 4UQXA 4AJWA 5ENSD 1IKND 5B1AE 3SD5A 1JUQA 3K9IA 2YNQA 4GA1A 3SFZA 1Z6TA 4Y6WA 4X8QA 3TWRA 3NOCD 1KZOA 1BI7B 3DBSA 1Z5SC 4F6RD 4J7WA 4G24A 4DI3A 2XCCA 3ML8A 3PE4A 3CR3A 5CCMA 2XS8A 2X6JA 4GYWA 5CECB 4A1SA 4GTPA 3FUMA 3UIOC 4WUYA 3NZUA 1JWFA 3QC1A 4MLPA 4GPMA 3TWQA 4O6FA 2J9QA 4Q69A 4GMJA 4IRUA 2KCKA 3FFLA 2P9LG 5IY5E 3D9NA 2OEVA 3JYSA 4BSZB 3U3WA 4LEUA 3CVQA 3QKYA 4FC8A 3UM2A 3UMVA 1TN8A 4HXIA 1DVPA 1D9SA 3RU0A 3TWWA 5G05C 5ENRD 4I1MA 3CHQA 4CT0A 4I6GA 4AVXA 2ETCA 2QC9A 5ARFA 4J8DA 5CBNA 2OVFA 3D9JA 5G2NA 4GYOA 2H6HA 2WXMA 3HRAA 2L0TB 4KZCA 4F7AA 1TJFA 3I3NA 2WQ6A 5B1BE 3DPYA 1W3BA 3MZLB 2Y1LE 3CIAA 4GTRA 4PS7A 4J8YA 4KVOA 3ULQA 3ZVVA 3TXNA 3G2SA 1KZPA 1RW2A 5C2YA 4GA0A 2VGYA 1WY6A 3PEUB 3T5XA 2R2LA 3CSTA 3FP3A 1WG0A 3F6QA 3CGHA 3D9PA 2FF4A 5FQ6A 5CRVA 3KEAA 4XKBA 2P9PG 3FUKA 2V5FA 5G04J 4EPZA 3KEZA 4WNFA 4HI9A 5FINA 4HOTA 3EHRA 5ENPD 1U2VG 3GZ2A 4M7CA 1AWCB 4G2VA 2DYRE 4DK5A 2R02A 4U63A 3BG1B 1N0RA 4HS2A 4ME2A 2V5QC 3DRAA 3ULYA 2L9BA 3LJ3A 4YNDA 4HVBA 1UOHA 4JW1A 2KATA 5AJDA 2WXQA 3C3RA 4J8EA 4OAUC 5LFAA 3PZ4A 1E8ZA 5EN5D 3SO8A 3ESLA 4U0UA 3G2WA 3R7RA 1BU9A 2C2LA 3FTVA 4DI4A 1OY3D 3FDHA 2XZTG 3FTUA 4G26A 4DPRA 3G2VA 3QOUA 2WXKA 4I2WA 4B0ZA 2WQHA 1N4PA 3AG1E 4DLQA 2RG8A 3B7RL 2VYIA 4HBDA 3CVPA 2VTBA 2BKGA 2WXRA 2YHCA 4HNAD 3TG5A 4C9BB 4A1GA 4H7YA 3TWVA 4RLYA 4N3BA 4GCNA 4N5CA 3FWVA 5A7DB 2Y0BG 3ZEFA 1TR4A 1JCSA 3QWWA 3RO3A 3FEYA 5C1DA 5KWDA 3JUIA 2UWJG 3CVNA 2DWZA 2XCBA 2XS1A 4FP7A 5EKQD 5FQ8A 2VGEA 3O48A 3TWUA 3W9FA 2PL2A 5AIJA 5KNGA 3NB2A 1IYGA 2LAHA 2P2CP 3ASHA 4JL0A 2HE0A 3DXKG 2Y3AA 2RFAA 4GAAA 3E33A 3FTYA 3ZIMA 2I6HA 1NP7A 3PUJA 1H2TC 4RG9A 3UT4A 5EYPF 1H19A 4PH4B 1HZ4A 1E7UA 3I4GA 2V4HC 4GYYA 2L6JA 3TGOA 3ASFA 3CVYA 3HVEB 3LPZA 3QK0A 2MRIA 5JJ6A 3U4TA 5LP0A 3B95A 2IFUA 4GPKA 2KCVA 3RAUA 5E76A 1TNUA 1K1AA 3DPDA 3TAXA 2IO3C 4MKTA 4FLBA 3VLEA 3AS4A 5EILA 4ATZD 3EHNA 5A6CA 2B6CA 3Q15A 3KAEA 1NFIE 5T4YA 3CHOA 3QWPA 5EX0A 3CHSA 4FADA 1K3ZD 1EDUA 4YDWA 1FT1A 5D0OD 1X81A 3AJIA 3AAAC 3RRMB 2PM6A 4E85A 4AXHA 3UXGA 5CEDB 2DZNA 2KZTB 4KT6B 5M72A 1UJJA 3L16A 3PVLA 4G23A 4DX6D 4GCOA 3PH0C 4I1OB 3IXEA 2P9KG 3UKRG 5LX8A 4JPSA 3E32A 3FU0A 3U66A 3EHMA 1VDYA 4RG6A 1LTXA 2ZIRA 5H7PA 1SZAA 4A3VA 3QB2A 4L2YA 5ANLA 3ZPJA 2J8SD 2I2OA 3RKVA 3T5VA 3NQPA 1EPUA 2VGXB 4DUIA 4U8HA 3Q75A 4O60A 4IYPA 3SFXA 2WXPA 4NACA 3RRNB 5KNHD 4DX2A 1YCSB 4I6JA 2V0PA 4BT9A 3IHYA 3AU4A 4LNUD 3EIJA 2GRLA 4FJZA 5BT1A 4ACLA 3X2QE 2MHKA 3ZNGA 2LO6A 2L0IA 2IJGX 1NZNA 3URZA 4BTAA 1N9AA 2PNNA 4EECA 3UX4A 1E8XA 2IF4A 1K1BA 5HS0A 4ILGA 4CDRA 1MHQA 1N54A 2DBAA 2LUHA 3OXFA 1H2VC 3R9MA 1O1RA 1UN9A 4TXQA 5KCMA 3SBSA 4GTTA 5JJTA 1H0AA 3UT8A 4GMRA 3QWVA 1OCRE 3UKUG 2AXVA 1OWOA 3QAQA 1HU3A 5ENQD 4GZDA 4I43A 4L23A 3ENEA 3Q79A 3KSLA 3UTMA 3CVWA 3ZKJA 2VSNA 2ETBA 5AN8A 3Q4AB 4GZ5A 4HRNA 5KBAA 3PRZA 1NI1A 4IN3B 4J0UA 2VQ2A 3CSFA 4DRXE 2ILRA 2MOWA 3JQ1A 3BQOA 4EZLA 3B7UX 4I17A 4ANVA 3FY4A 4B93B 3G2UA 5AJLA 3DSVA 3C98A 4IULA 4I1AA 4MRUA 3QDNA 4P29A 4Q94A 3D9MA 5AAOA 4ACKA 4BSXA 2C0MA 4MBGA 3FU3A 4JD2G 3UUXA 4HQDA 3UIPC 3QJZA 4XZ4A 4M3OA 4QFVA 1UG3A 3GZ1A 2HR2A 3MX3A 4BWRA 3U9WA 4LNGA 1YA0A 2EIJE 2WXIA 5AQ9A 2IONA 1H6PA 1OCZE 4MS6A 4WWNA 1XGWA 2WXHA 5EX3A 1Y8MA 2A5EA 3CHRA 2UY1B 4KZ0A 3VLDA 3FUIA 5CERB 1X5BA 5LCWC 4BESA 2FBNA 3V31A 1B89A 3AG3E 3FU6A 4U07A 2AVPA 3ZHEA 3MKQA 3CEQA 3UINC 4A55A 4G8KA 3NAWA 2JLBA 2XGSA 4OVUA 2GGFA 4BX8A 1OWNA 3L6AA 1AP7A 1DCEA 3T8MA 2WM9A 1RZ4A 4UWFA 3LEWA 4OAVB 1L5JA 4BX9A 3D9LA 4U95D 3LVRE 2GRMA 3PE3A 2KBXA 5HI7A 4G8LA 1JCQA 4ZFHA 1YYHA 2I1JA 5CHEE 1QYMA 3B7SA 3D9OA 3Q49B 3TL5A 4Z68A 3L54A 4EQFA 4U96D 4JHKA 3FH5A 4F3VA 3NOGD 4O1PA 3E34A 3MKRA 4TXPA 3C72A 2ONDA 1SZ9A 5KJNA 2PZIA 3HHMA 2LSUA 3C3QA 5G05J 3CVXA 5AENA 2IOLA 1JPLA 2XENA 5LCWJ 3CVLA 5KJKA 1N4RA 2P9UG 3L08A 2XRZA 1PC2A 2V4LA 2YINA 2XQ0A 4KXKB 2GW1A 4NIKA 1TNOA 3OXLA 1SA5A 4I2ZA 2WXOA 3FUDA 1E8YA 4F1PA 5FZQA 2IQCA 4R7LA 5BV1A 4BEPA 4U8VD 3SGHA 4TUUA 3B7TA 4HRMB 2EIKE 1JCRA 4UI9K 3NF1A 4JXTA 3W9GA 3I4RB 2X6FA 5KJMA 2XEHA 4FU3A 3MCXA 1ZU2A 2J08A 5DIZA 3S7FA 2PQRA 4U04A 4CGVA 1ELRA 4NQ0A 3OXGA 1UW4B 2WXFA 2Y69E 1N4QA 4ZHBA 4H7XA 4J8FA 5CMYA 5BV0A 4ATGA 5FZRA 4YVQC 2VGXA 4WNDA 1IHGA 5A23A 3MGBA 1A17A 2DYSE 4WNEA 3ZGQA 5J90A 1N94A 3IBEA 2DVWA 5BUZA 2ZGDA 2FEZA 2J49A 2P9SG 3EJNA 4DX7D 4CT4A 1UN8A 5FT9A 1WAO1 2KXPC 3AG2E 3AS5A 2IOSA 1HG2A 1OWLA 3ONLA 4GTVA 2ETAA 3J5QB 3O4ZA 2Y4TA 2ZISA 2F8YA 4ANUA 4UWHA 2P9IG 4HI8A 2QYJA 5FQ4A 3UT7A 4HOUA 3LS8A 2L6BA 3CHMA 3JQ0A 4AEZC 3UM3A 3QARA 2E2EA 4GZ3A 3RRUA 4N2QA 3MA5A 2QY7A 3NZSA 3CQGB 4YDYA 3UM1A 2X6HA 1S63A 4DX1A 2ZXWE 4JA9A 3PDNA 3FTWA 5CRUA 1LD7A 4AIFA 3S2AA 3ZYKA 4JEHA 1HG5A 3UI2A 3D3MA 4APFA 3ZN3A 5HKPA 3ABKE 4XIFA 3FUHA 4U7EB 4AM9A 4F1SA 2H6GA 5JJ7A 4WWPA 3ZXPA 3OTNA 4GZCA 4WAFA 1NA3A 3SFYA 1FPPA 3UM0A 2XZDG 3D9KA 4WWOA 4NURA 1HX8A 5EDSA 2XGMA 3SI5A 2CFUA 2J4BA 1E8WA 4XE0A 2EIME 3ABLE 1GW6A 3I5PA 3DSTA 5G55A 3RJVA 2BEDA 4LUNU 5JHBA 2OOEA 2IU1A 4EBAG 3PS6A 3PZ2A 1PAQA 4TRQA 3LJNA 1FCHA 4I9CA 1HE8A 3JXIA 3AS8A 3ZYQA 4HOSA 4AOFA 4HFGA 4K5CA 4N5QA 1TNYA 4GTOA 3V79K 4JHJA 3ESKA 1MQSA 3SHFA 3DSUA 3HXCA 4J6IA 3JUEA 5AARA 3UPVA 1SQMA 3KS2A 1OCCE 3PNTB 5EIBE 5KJLA 2LAIA 1MX4A 3PEVB 2BTDA 3KSQA 3ZYLA 1Z3XA 1NA0A 3LXUX 4UWKA 3ABME 2X38A 1S64A 2I9CA 4CCAA 4PS8A 1XNFA 3SNXA 3MYVA 2X6IA 4V3IA 1TNBA 2CG2A 4E6HA 3DEPA 5AQBA 3BU8A 2IO2C 5BW8C 5ANRA 4YVOA 2VTBB 3AG4E 3LDZA 3Q73A 1Q2ZA 4UWGA 5EIDA 3R7QA 3FH7A 3N71A 3PZ1A 4ILIA 4B8CB 3TJPA 3QNKA 4APOA 3VTYA 2XGOA 4BTBA 5CCLA 2RD0A 1EF1C 4L9PA 4RVBA 4BT8A 4GTQA 5B3SE 3SZ7A 4GU5A 3RO2A 1YMPA 3EHQA 3CV0A 4CRWA 5AQAA 3FULA 2F37A 2AW6A 2IEJA 1LF8A 4Y6CA 1HH8A 4N3CA 2NXPA 4LRZA 3V2OA 4GTMA 2XPIA 2NSZA 1N0QA 2FULA 2RFMA 3FU5A 4YDEA 4K03A 4HB5A 1Y6IA 3GZSA 3SBTB 2HYZA 5T8IA 1LD8A 1OWMA 3BUAA 3HXEA 4LCTA 4Q96A 4N2SA 2CFZA 3ULEG 4C0EA 5AQ7A 4CYMD 4LERA 2KM4A 1SW6A 3GYZA 1DCQA 4PDXA 4HORA 4UUCA 2QZAA 1TYQG 1SA4A 3PREA 5BPPA 2GROB 2WB2A 3RIBA 2IY0C 2F8XK 4BETA 3Q9UC 5FJYA 3E4BA 1D8EA 2BUGA 1OUVA 3ZXSA 5EYLA 3B7BA
chains in the Genus database with same CATH topology
1EYHA 3O48A 3IHVA 2J4DA 3HIZA 4AY5A 3LVQE 3RK6A 4JHKA 2FI7A 3FH8A 1N52A 3FH5A 1U3DA 4F3VA 4FJYA 3ZYMA 2V8SE 3MKRA 2R5SA 3ASDA 1FVFA 4U0ZA 2PL2A 1UJKA 2ONDA 4F53A 5AIJA 5T3RA 2EQXA 1SZ9A 2Y4UA 5KJNA 2PZIA 3HHMA 5AYWD 1IYGA 2LAHA 3CK8A 4BFRA 1HXIA 4I6EA 2AWIA 4GZ6A 2LSUA 4KMOA 4L7TA 4NRHB 3ASHA 4JL0A 1E7VA 1WM5A 3LY8A 4FLHA 2Y3AA 4N3AA 5G05J 4GMLA 3CVXA 2VJ8A 5AENA 4B89A 4B94A 4GAAA 3CQCB 3FTSA 3FTYA 3ZIMA 2I6HA 2IOLA 1JPLA 1H2UA 1NP7A 5LCWJ 4UWLA 3CVLA 3PUJA 5KJKA 3IKOB 3FEXA 3L08A 4B8AA 2XRZA 1H6KA 1PC2A 3ONKA 1H2TC 2V4LA 1ZBPA 2YINA 5BNWA 3ZFWA 4L2LA 2XQ0A 4KXKB 2R59A 4RG9A 3UT4A 1H19A 4PH4B 4FULA 2GW1A 1HZ4A 2VSOE 3FHEA 3OXLA 1E7UA 3I4GA 2Q7FA 4GYYA 2L6JA 4I2ZA 3TGOA 1IQUA 3ASFA 5JHAA 3CVYA 4CDMA 3BEEA 2WXLA 3FUJA 3OAWA 3HVEB 2WXOA 1ELKA 3HYMB 1ELWA 3LPZA 3QK0A 1QQEA 4ABNA 3FUDA 2MRIA 1E8YA 1U3CA 3MEKA 5FZQA 2C0LA 2AXZA 2IQCA 4R7LA 5JJ6A 3U4TA 3FUFA 5BV1A 3SGHA 5LP0A 3MJWA 4TUUA 1QZ2A 3B7TA 4FA6A 5CMWA 2HO1A 4AY6A 3FUNA 5G04C 2PQNA 3LY7A 4FHJA 2IFUA 1DNPA 4FHKA 4UI9K 3NF1A 4GPKA 2VSYA 3CLJA 4JXTA 3I4RB 2X6FA 5KJMA 5FQ7A 4FU3A 3UQ3A 3MCXA 1ZU2A 2A5UA 2J09A 2KCVA 2J08A 4XI9A 5DIZA 4XI0A 5E76A 1Z3YA 5FWQA 3S7FA 2PQRA 4U04A 4JHRA 3U64A 1ELRA 4CGVA 2LSVA 4NQ0A 3DPDA 2WMOA 3MV3B 3TAXA 3OXGA 3LYAA 3B13A 1UW4B 2WXFA 3CK7A 3TXMA 4MKTA 4FLBA 4N39A 2X3MA 2OV8A 4GA2A 3AS4A 4H7XA 3VLEA 4ANXA 4G1TA 4G25A 3EHNA 4J8FA 5CMYA 5BV0A 3S7BA 3G2TA 5A6CA 3Q15A 3S7JA 3KAEA 4ATGA 5FZRA 4BY6A 2HM8A 4DLOA 3AU5A 3Q5MA 1S0PA 5T4YA 4YVQC 2VGXA 3CHOA 4RSYA 4KYOB 3QWPA 4WNDA 4J8SA 4UQXA 5EX0A 4AJWA 2CHZA 4EZJA 1IHGA 3CHSA 3HVEA 4CEMA 4FADA 3WXXA 5A23A 3MGBA 4DJAA 5FTPA 3SD5A 1JUQA 4U0SA 1EDUA 3D9IA 3K9IA 4K0RA 1A17A 4WNEA 2YNQA 4GA1A 3SFZA 5D0OD 1Z6TA 2XEVA 3ZGQA 3CKBA 5J90A 3IBEA 4Y6WA 3CK9A 5BUZA 2FEZA 3APFA 2J49A 3EJNA 3RRMB 2PM6A 4XKCA 1UN8A 4CT4A 2DCPA 5FT9A 1WAO1 4E85A 4AXHA 3AS5A 2IOSA 1HG2A 1OWLA 3ONLA 2WVIA 3DBSA 4GB9A 3SF4A 2KC7A 3O4ZA 2KZTB 4KT6B 2Y4TA 5M72A 1UJJA 4G24A 3L16A 3IV0A 4DI3A 3PVLA 4ANUA 4G23A 4UWHA 2NC9A 2XCCA 3ML8A 3PE4A 4GCOA 3CR3A 3PH0C 5FQ4A 4I1OB 3UT7A 4HOUA 2XHEA 3LS8A 3CHMA 3JQ0A 3L22A 4AEZC 5CCMA 5LX8A 4JPSA 3FU0A 3R9AB 3MV2B 2X6JA 3ZRHA 3QARA 3U66A 3EHMA 4GYWA 3HDXA 2E2EA 4GZ3A 1VDYA 4RG6A 4A1SA 2I1KA 3RRUA 3FUMA 3Q47B 4N2QA 5E75A 3MA5A 1SZAA 2QY7A 4A3VA 4WUYA 3QB2A 3NZSA 3CQGB 4L2YA 5ANLA 3ZPJA 2I2OA 2X6HA 3RKVA 4C0MA 2E0IA 4D10C 3T5VA 3NZUA 3NQPA 1JWFA 3QC1A 4MLPA 4JA9A 4OVVA 3PDNA 4O6FA 1EPUA 2J9QA 3FTWA 4Q69A 2VGXB 3FUEA 4U8HA 4JVSA 2P58C 4GMJA 4IRUA 4UI9C 4AIFA 1KLXA 4IYPA 3S2AA 3ZYKA 3S7DA 2WXPA 1HG5A 4JEHA 2KCKA 3BG0B 4NACA 3FFLA 3D3MA 3D9NA 4APFA 3JYSA 1P5QA 3RRNB 3ASGA 3ZN3A 1JWGA 4LEUA 3U3WA 3CVQA 4I6JA 2KZTA 2V0PA 4BT9A 4XIFA 2BF0X 3IHYA 3FUHA 4AM9A 3QKYA 3VTXA 5HQ8A 4F1SA 3L17A 4FC8A 3AU4A 3EIJA 2GRLA 4FJZA 5BT1A 3LY9A 4ACLA 1E96B 3UMVA 2AXUA 2MHKA 5JJ7A 1HFAA 4WWPA 1INZA 3OTNA 2LO6A 2M63A 1DVPA 2L0IA 4GZCA 4HXIA 1NA3A 4PUCA 4WAFA 2IJGX 1NZNA 5ENNA 2PM7A 3D9KA 4WWOA 3RU0A 5G05C 3URZA 4BTAA 4EZKA 2DIWA 4NURA 1HF8A 3EIQC 1HX8A 3APCA 5EDSA 4A3TA 4EECA 3UX4A 2VSXE 2XGMA 4I1MA 1E8XA 2IF4A 3CHQA 4ILGA 3SI5A 4CT0A 2CFUA 4CDRA 4I6GA 1MHQA 2J4BA 4XX5A 1N54A 2DBAA 1E8WA 3OXFA 4AVXA 1H2VC 4XE0A 4HLEA 5ARFA 4J8DA 2OVFA 2ZU6B 3D9JA 5G2NA 1GW6A 3I5PA 3RJVA 4GYOA 5G55A 1UN9A 3CHPA 2WXMA 4URKA 1HO8A 5KCMA 2L0TB 3SBSA 4KZCA 4F7AA 1TJFA 4LUNU 3P2BA 5JJTA 3EDTB 1H0AA 5JHBA 2OOEA 3I3NA 2WQ6A 2IU1A 3P1UA 4EBAG 1E90A 3UT8A 3PS6A 3VLFA 5ARGA 1PAQA 3QWVA 2CHWA 3LCAA 4JA7A 4TRQA 1W3BA 1BPOA 2OVBA 4WNGA 2AXVA 1OWOA 3MZLB 3QAQA 3CVVA 3CIAA 1FCHA 1HU3A 4I9CA 4PS7A 1HE8A 3ZYQA 3AS8A 2A4ZA 4KVOA 4GZDA 3ULQA 4AOFA 3ZVVA 4I43A 4HFGA 4HOSA 4L23A 4AV7A 3ENEA 3TXNA 3G2SA 3PNLB 5C2YA 3CVWA 4JHJA 3ESKA 3ML9A 1MQSA 3SHFA 1HS6A 4GA0A 2VGYA 2VSNA 1WY6A 4J6IA 4W9RA 3Q4AB 1TEZA 4GZ5A 3PEUB 1QNFA 3T5XA 3UPVA 2XPYA 1SQMA 3PRZA 4IN3B 4J0UA 3KS2A 2VQ2A 3CSFA 3CSTA 3PNTB 3FP3A 4UI9J 4KVMA 2KCLA 2ILRA 2MOWA 3CGHA 3JQ1A 5KJLA 2LAIA 3PEVB 2BTDA 3D9PA 3LKUA 2FF4A 5FQ6A 4EZLA 1FVHA 3B7UX 4I17A 3ZYLA 4ANVA 1Z3XA 4XKBA 1NA0A 3FY4A 3LXUX 4AP2A 3FUKA 3G2UA 2WXNA 5AJLA 4UWKA 2V5FA 2X38A 5G04J 4EPZA 3C98A 3KEZA 4OYSA 3CKCA 4WNFA 4IULA 4I1AA 4MRUA 4PS3A 2I9CA 3QDNA 4P29A 4CCAA 4PS8A 4Q94A 1XNFA 2CHXA 2YHEA 4HOTA 4G11A 3SNXA 2WXGA 3D9MA 3ZHEB 3MKQB 3MYVA 1TJCA 2X6IA 2LNIA 3GZ2A 4V3IA 3APDA 2CG2A 4G2VA 4E6HA 4ACKA 4BSXA 2QFCA 4DK5A 2FO7A 4JEUA 4U63A 3BG1B 2C0MA 4I9EA 3PUKA 5BW8C 4HS2A 5ANRA 3FU3A 4ME2A 4YVOA 2VTBB 4UQYA 3UUXA 3LDZA 2L9BA 2J07A 2XPZA 3QJZA 3LJ3A 4XZ4A 4UWGA 4YNDA 4HVBA 4JC8A 3R7QA 4JW1A 2WQ7A 3FH7A 2XRYA 3N71A 2KATA 4M3OA 5AJDA 2WXQA 4QFVA 4ILIA 4B8CB 3TJPA 3QNKA 1KT1A 1UG3A 3VTYA 3GZ1A 2HR2A 2XGOA 2YQ8A 4APOA 2RD0A 3MX3A 4BTBA 1EF1C 4J8EA 5CCLA 4TV3A 5LFAA 4BWRA 3CVUA 3U9WA 4RVBA 5LOZA 1E8ZA 4BT8A 3SZ7A 1YA0A 4GU5A 3ESLA 4U0UA 3RO2A 3G2WA 2WXIA 3R7RA 2C2LA 2IONA 3FTVA 4DI4A 4MS6A 3CV0A 4UQZA 4EBAA 4CRWA 4WWNA 1XGWA 2WXHA 3FULA 3FDHA 1OWPA 5EX3A 1Y8MA 3CHRA 2UY1B 4ILHB 4KZ0A 3VLDA 3FTUA 4G26A 3L13A 1IQRA 3FUIA 1X5BA 2AW6A 4DPRA 5LCWC 3PZDA 3G2VA 1LF8A 2FBNA 3QOUA 1HH8A 4N3CA 4Y6CA 2NXPA 1B89A 2WXKA 4LRZA 2XPIA 2WXJA 2NSZA 3FU6A 2FULA 4I2WA 4U07A 4B0ZA 2AVPA 3ZHEA 3ZW3A 3MKQA 2WQHA 3CEQA 3IEGA 3FU5A 3KD7A 3GW4A 4A55A 4HOQA 2JLBA 2XGSA 4DLQA 2RG8A 2GGFA 2R17C 3B7RL 4K03A 2VYIA 4OVUA 4BX8A 1Y6IA 3GZSA 3JCKC 5J08A 3SBTB 2HYZA 4KBQA 3CVPA 2VTBA 1OWNA 5T8IA 2WMNA 3L6AA 1OWMA 2WXRA 2YHCA 4JZYA 3TG5A 3T8MA 4C9BB 4A1GA 4H7YA 2WM9A 4N3BA 4GCNA 4N5CA 4UWFA 5D0QD 3LEWA 3FWVA 4LCTA 5A7DB 4Q96A 4N2SA 4CGWA 2CFZA 1L5JA 4ANWA 4BX9A 3ZEFA 3FTZA 2JEKA 4C0EA 3D9LA 3FTXA 2CG3A 4LERA 2KM4A 3LVRE 2GRMA 3GYZA 3PE3A 3QWWA 3RO3A 4PDXA 3FEYA 5HI7A 4HORA 5C1DA 4L1BA 2WPVA 2UWJG 3CVNA 3JUIA 3PREA 4CDNA 5BPPA 5FZSA 2WB2A 2XCBA 5DBKA 1KT0A 2I1JA 5CHEE 3RIBA 4FP7A 2UY1A 5EKQD 1PY1A 3B7SA 5FQ8A 5FJYA 3D9OA 3TG4A 3E4BA 3Q49B 3TL5A 2BUGA 1OUVA 3ZXSA 2X6KA 3L54A 4EQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O48 A;  4AY5 A;  2FI7 A;  4F3V A;  3MKR A;  2R5S A;  3ASD A;  4U0Z A;  2PL2 A;  2OND A;  2Y4U A;  5KJN A;  2PZI A;  5AYW D;  1IYG A;  3CK8 A;  1HXI A;  4GZ6 A;  2LSU A;  4NRH B;  3ASH A;  4JL0 A;  1WM5 A;  3LY8 A;  4N3A A;  5G05 J;  4B94 A;  2I6H A;  5LCW J;  3CVL A;  5KJK A;  1PC2 A;  1ZBP A;  5BNW A;  3ZFW A;  4KXK B;  4RG9 A;  2GW1 A;  1HZ4 A;  3OXL A;  2Q7F A;  4GYY A;  2L6J A;  4I2Z A;  3TGO A;  3ASF A;  3BEE A;  3HYM B;  1ELW A;  3LPZ A;  4ABN A;  1QQE A;  3MEK A;  5FZQ A;  2C0L A;  5JJ6 A;  3U4T A;  1QZ2 A;  2HO1 A;  4AY6 A;  5G04 C;  2PQN A;  3LY7 A;  2IFU A;  4UI9 K;  3NF1 A;  4GPK A;  2VSY A;  5KJM A;  3UQ3 A;  1ZU2 A;  2KCV A;  4XI9 A;  5DIZ A;  4XI0 A;  3S7F A;  2PQR A;  4U04 A;  4JHR A;  4CGV A;  1ELR A;  2LSV A;  4NQ0 A;  3MV3 B;  3TAX A;  3OXG A;  3LYA A;  3CK7 A;  4N39 A;  4GA2 A;  4H7X A;  3AS4 A;  4G1T A;  4G25 A;  4J8F A;  3S7B A;  5A6C A;  3Q15 A;  3S7J A;  3KAE A;  5FZR A;  3Q5M A;  4YVQ C;  2VGX A;  4KYO B;  3QWP A;  4WND A;  4UQX A;  5EX0 A;  1IHG A;  3WXX A;  5FTP A;  4U0S A;  3K9I A;  1A17 A;  4WNE A;  4GA1 A;  5D0O D;  2XEV A;  3ZGQ A;  3CKB A;  4Y6W A;  3CK9 A;  2FEZ A;  5FT9 A;  1WAO 1;  3AS5 A;  3SF4 A;  2KC7 A;  2Y4T A;  5M72 A;  4G24 A;  4G23 A;  2NC9 A;  2XCC A;  3PE4 A;  4GCO A;  4HOU A;  5CCM A;  3R9A B;  3MV2 B;  4GYW A;  2E2E A;  4GZ3 A;  4RG6 A;  4A1S A;  3Q47 B;  4N2Q A;  3MA5 A;  4WUY A;  3ZPJ A;  3RKV A;  4JA9 A;  3PDN A;  4O6F A;  2J9Q A;  2VGX B;  2P58 C;  4UI9 C;  4AIF A;  1KLX A;  3S7D A;  2KCK A;  3FFL A;  3JYS A;  1P5Q A;  3ASG A;  3ZN3 A;  3U3W A;  4LEU A;  3CVQ A;  4BT9 A;  4XIF A;  4AM9 A;  3QKY A;  3VTX A;  5HQ8 A;  5BT1 A;  3LY9 A;  1E96 B;  2MHK A;  5JJ7 A;  1NA3 A;  1NZN A;  3RU0 A;  3URZ A;  5G05 C;  4BTA A;  2XGM A;  2IF4 A;  4CDR A;  2DBA A;  3OXF A;  5ARF A;  4J8D A;  3RJV A;  4GYO A;  5JJT A;  3EDT B;  2OOE A;  5ARG A;  3QWV A;  3LCA A;  4JA7 A;  1W3B A;  4WNG A;  1FCH A;  4I9C A;  3AS8 A;  4HOS A;  3ULQ A;  3ESK A;  4GA0 A;  2VGY A;  2VSN A;  4W9R A;  3Q4A B;  4GZ5 A;  3UPV A;  4IN3 B;  4J0U A;  3KS2 A;  2VQ2 A;  3FP3 A;  4UI9 J;  2KCL A;  5KJL A;  3LKU A;  2FF4 A;  4I17 A;  1NA0 A;  2V5F A;  5G04 J;  3CKC A;  4WNF A;  4I1A A;  3QDN A;  1XNF A;  4HOT A;  3ZHE B;  1TJC A;  2LNI A;  3GZ2 A;  4G2V A;  2QFC A;  2FO7 A;  2C0M A;  4I9E A;  5BW8 C;  4ME2 A;  4YVO A;  4UQY A;  3UUX A;  4YND A;  3N71 A;  2KAT A;  1KT1 A;  4APO A;  3VTY A;  3GZ1 A;  2HR2 A;  4BTB A;  2XGO A;  2YQ8 A;  5CCL A;  4J8E A;  4BWR A;  4BT8 A;  3SZ7 A;  1YA0 A;  3RO2 A;  4U0U A;  2C2L A;  3CV0 A;  4UQZ A;  5EX3 A;  1Y8M A;  2UY1 B;  4G26 A;  5LCW C;  2FBN A;  3QOU A;  1HH8 A;  4N3C A;  4Y6C A;  1B89 A;  2XPI A;  4I2W A;  4U07 A;  2AVP A;  3ZHE A;  2WQH A;  3CEQ A;  3IEG A;  3KD7 A;  3GW4 A;  4HOQ A;  2JLB A;  2XGS A;  2VYI A;  2HYZ A;  4KBQ A;  3CVP A;  2YHC A;  3TG5 A;  4H7Y A;  4N3B A;  4GCN A;  4N5C A;  5D0Q D;  3FWV A;  5A7D B;  4N2S A;  4CGW A;  3GYZ A;  3PE3 A;  3QWW A;  3RO3 A;  5HI7 A;  4HOR A;  5C1D A;  2WPV A;  2UWJ G;  3CVN A;  5FZS A;  2XCB A;  5DBK A;  1KT0 A;  5CHE E;  3RIB A;  2UY1 A;  5EKQ D;  5FJY A;  3TG4 A;  3E4B A;  3Q49 B;  2BUG A;  1OUV A;  4EQF A; 
#chains in the Genus database with same CATH topology
 1EYH A;  3IHV A;  2J4D A;  3RK6 A;  1H6O A;  1N52 A;  1O1S A;  4FJY A;  3ASD A;  1UJK A;  3DXM G;  1OXJ A;  2GRR B;  5T3R A;  2EQX A;  2Y4U A;  5AYW D;  3CK8 A;  3L82 A;  4I6E A;  4GZ6 A;  2AJA A;  4L7T A;  4NRH B;  1WM5 A;  3LY8 A;  4N3A A;  2VJ8 A;  4B94 A;  3CQC B;  1H2U A;  5CEA A;  4UWL A;  3ZUV B;  3IKO B;  1H6K A;  1ZBP A;  3ZFW A;  4L2L A;  2EIN E;  2R59 A;  1QBQ A;  3Q78 A;  4QQI A;  2VSO E;  3HXF A;  3FHE A;  2Q7F A;  1TNZ A;  5JHA A;  2NYJ A;  4CDM A;  3TWT A;  3BEE A;  2WXL A;  3FUJ A;  3T9K A;  3OAW A;  1ELW A;  4ABN A;  3MEK A;  2AXZ A;  3FUF A;  1QZ2 A;  2HO1 A;  4LSZ E;  1BLX B;  5G04 C;  2PQN A;  3LY7 A;  1DNP A;  4FHK A;  2VSY A;  3CLJ A;  3ZU7 B;  5BXU A;  3UQ3 A;  2J09 A;  2RKK A;  4XI9 A;  1Z3Y A;  5FWQ A;  3U64 A;  5CBO A;  2WMO A;  3MV3 B;  3B13 A;  1N95 A;  3J5P A;  3CK7 A;  3TXM A;  4N39 A;  2X3M A;  2OV8 A;  3NBN B;  3G2T A;  3DSX A;  3S7J A;  4HRL A;  4O1O A;  4BY6 A;  2HM8 A;  4DLO A;  2LXM A;  3Q5M A;  1S0P A;  1O5M A;  4EZJ A;  2CHZ A;  3HVE A;  4CEM A;  4XEI G;  3WXX A;  4DJA A;  5FTP A;  3EUV A;  4U0S A;  3D9I A;  4K0R A;  2XEV A;  3CKB A;  1WDY A;  2FO1 E;  3CK9 A;  3APF A;  4XKC A;  2DCP A;  5JMN D;  3V2X A;  2WVI A;  4GB9 A;  3SF4 A;  2KC7 A;  1BI8 B;  4DX5 D;  3IV0 A;  4JB8 P;  2NC9 A;  1IXV A;  2XHE A;  3SQV A;  4CZ2 D;  3L22 A;  1MX6 A;  3R9A B;  3MV2 B;  3ZRH A;  5FIO A;  3HDX A;  2I1K A;  2JAB A;  3Q47 B;  5E75 A;  2F0Y A;  4HLL A;  2DZO A;  2ZGG A;  4D10 C;  4C0M A;  2E0I A;  4OVV A;  3FUE A;  4JVS A;  2P58 C;  1TN6 A;  4UI9 C;  1KLX A;  2BKK B;  3S7D A;  1K8K G;  3BG0 B;  1P5Q A;  3ASG A;  1JWG A;  2KZT A;  3SY2 A;  2BF0 X;  3VTX A;  5HQ8 A;  3L17 A;  3LY9 A;  1E96 B;  2AXU A;  1D8D A;  2R05 A;  4U8Y D;  1HFA A;  1INZ A;  2M63 A;  4PUC A;  3T8K A;  5ENN A;  3WG7 E;  2PM7 A;  2MYO A;  4EZK A;  2DIW A;  1HF8 A;  3EIQ C;  3APC A;  4A3T A;  2VSX E;  5ENT D;  4XX5 A;  4BER A;  4HLE A;  2ZU6 B;  3CHP A;  3RSE G;  2OCC E;  4URK A;  1HO8 A;  3C3O A;  2GRP B;  3P2B A;  3EDT B;  3C5R A;  3P1U A;  1E90 A;  3VLF A;  5ARG A;  1NL4 A;  2CHW A;  3LCA A;  4JA7 A;  1BPO A;  1SVX A;  2OVB A;  3EU5 A;  4LG6 A;  4WNG A;  3JXJ A;  3CVV A;  2A4Z A;  4AV7 A;  3PNL B;  3Q7F A;  1FT2 A;  3ASO E;  3ASN E;  3ML9 A;  1HS6 A;  1IHB A;  4W9R A;  1TEZ A;  1QNF A;  2GRN B;  2R03 A;  2XPY A;  5JA4 D;  3DSW A;  4UI9 J;  4KVM A;  2KCL A;  2P9N G;  5ENO D;  1MYO A;  3LKU A;  1FVH A;  4C48 B;  4AP2 A;  4TUM A;  2WXN A;  4OYS A;  3CKC A;  5D66 A;  4PS3 A;  2GRQ B;  2CHX A;  3E37 A;  2YHE A;  3HXB A;  4G11 A;  2WXG A;  3ZHE B;  3MKQ B;  1TJC A;  2LNI A;  3APD A;  2QFC A;  2FO7 A;  4JEU A;  2H6I A;  4I9E A;  3PUK A;  4UQY A;  2J07 A;  2XPZ A;  4JC8 A;  3V30 A;  3DEO A;  2WQ7 A;  2XRY A;  1TN7 A;  1KT1 A;  2YQ8 A;  4TV3 A;  2OEW A;  3CVU A;  5LOZ A;  4EHM A;  4A63 B;  4UQZ A;  4EBA A;  1MJ0 A;  1OWP A;  1V55 E;  4ILH B;  3L13 A;  1IQR A;  3PZD A;  1MZC A;  1N11 A;  2WXJ A;  3EU9 A;  3ZW3 A;  3IEG A;  3KD7 A;  3L9T A;  3GW4 A;  4HOQ A;  5BXO A;  2R17 C;  3JCK C;  5J08 A;  4KBQ A;  2WMN A;  4JZY A;  5D0Q D;  4CGW A;  1OCO E;  4ANW A;  3FTZ A;  2JEK A;  1OT8 A;  3FTX A;  2CG3 A;  1BD8 A;  4K5B A;  3TWS A;  4L1B A;  2WPV A;  5ITZ F;  4CDN A;  5FZS A;  3PZ3 A;  5DBK A;  1KT0 A;  5HRY A;  2UY1 A;  1PY1 A;  3TG4 A;  4RQI A;  2X6K A;  3TWX A;  1A5E A;  3HIZ A;  4AY5 A;  3LVQ E;  2FI7 A;  3FH8 A;  3HXD A;  1MX2 A;  1U3D A;  4K5A B;  3ZYM A;  2V8S E;  1DC2 A;  2R5S A;  1FVF A;  3ISM C;  4YDO A;  4U0Z A;  4TXR A;  4F53 A;  4BFR A;  1HXI A;  2AWI A;  3DSS A;  4GTS A;  4KMO A;  1E7V A;  4FLH A;  4GML A;  1KPS B;  4B89 A;  3FTS A;  5D2M C;  1ZB1 A;  1S70 B;  3FEX A;  4B8A A;  3ONK A;  5BNW A;  4FUL A;  3Q9N C;  3DWL G;  4LNB A;  1IQU A;  3E30 A;  2H6F A;  1ELK A;  3HYM B;  1QQE A;  1U3C A;  2LXL A;  2C0L A;  3MJW A;  4FA6 A;  5CMW A;  4AY6 A;  1V54 E;  3FUN A;  4FHJ A;  3Q7A A;  5FQ7 A;  2A5U A;  4XI0 A;  4JHR A;  2LSV A;  2QYU A;  1N4S A;  3LYA A;  2B0O E;  1O1T A;  4GA2 A;  4ANX A;  4G1T A;  4G25 A;  3D9H A;  3S7B A;  2EIL E;  3HG0 D;  3AU5 A;  2XEE A;  4RSY A;  4KYO B;  1G3N B;  4J8S A;  4UQX A;  4AJW A;  5ENS D;  1IKN D;  5B1A E;  3SD5 A;  1JUQ A;  3K9I A;  2YNQ A;  4GA1 A;  3SFZ A;  1Z6T A;  4Y6W A;  4X8Q A;  3TWR A;  3NOC D;  1KZO A;  1BI7 B;  3DBS A;  1Z5S C;  4F6R D;  4J7W A;  4G24 A;  4DI3 A;  2XCC A;  3ML8 A;  3PE4 A;  3CR3 A;  5CCM A;  2XS8 A;  2X6J A;  4GYW A;  5CEC B;  4A1S A;  4GTP A;  3FUM A;  3UIO C;  4WUY A;  3NZU A;  1JWF A;  3QC1 A;  4MLP A;  4GPM A;  3TWQ A;  4O6F A;  2J9Q A;  4Q69 A;  4GMJ A;  4IRU A;  2KCK A;  3FFL A;  2P9L G;  5IY5 E;  3D9N A;  2OEV A;  3JYS A;  4BSZ B;  3U3W A;  4LEU A;  3CVQ A;  3QKY A;  4FC8 A;  3UM2 A;  3UMV A;  1TN8 A;  4HXI A;  1DVP A;  1D9S A;  3RU0 A;  3TWW A;  5G05 C;  5ENR D;  4I1M A;  3CHQ A;  4CT0 A;  4I6G A;  4AVX A;  2ETC A;  2QC9 A;  5ARF A;  4J8D A;  5CBN A;  2OVF A;  3D9J A;  5G2N A;  4GYO A;  2H6H A;  2WXM A;  3HRA A;  2L0T B;  4KZC A;  4F7A A;  1TJF A;  3I3N A;  2WQ6 A;  5B1B E;  3DPY A;  1W3B A;  3MZL B;  2Y1L E;  3CIA A;  4GTR A;  4PS7 A;  4J8Y A;  4KVO A;  3ULQ A;  3ZVV A;  3TXN A;  3G2S A;  1KZP A;  1RW2 A;  5C2Y A;  4GA0 A;  2VGY A;  1WY6 A;  3PEU B;  3T5X A;  2R2L A;  3CST A;  3FP3 A;  1WG0 A;  3F6Q A;  3CGH A;  3D9P A;  2FF4 A;  5FQ6 A;  5CRV A;  3KEA A;  4XKB A;  2P9P G;  3FUK A;  2V5F A;  5G04 J;  4EPZ A;  3KEZ A;  4WNF A;  4HI9 A;  5FIN A;  4HOT A;  3EHR A;  5ENP D;  1U2V G;  3GZ2 A;  4M7C A;  1AWC B;  4G2V A;  2DYR E;  4DK5 A;  2R02 A;  4U63 A;  3BG1 B;  1N0R A;  4HS2 A;  4ME2 A;  2V5Q C;  3DRA A;  3ULY A;  2L9B A;  3LJ3 A;  4YND A;  4HVB A;  1UOH A;  4JW1 A;  2KAT A;  5AJD A;  2WXQ A;  3C3R A;  4J8E A;  4OAU C;  5LFA A;  3PZ4 A;  1E8Z A;  5EN5 D;  3SO8 A;  3ESL A;  4U0U A;  3G2W A;  3R7R A;  1BU9 A;  2C2L A;  3FTV A;  4DI4 A;  1OY3 D;  3FDH A;  2XZT G;  3FTU A;  4G26 A;  4DPR A;  3G2V A;  3QOU A;  2WXK A;  4I2W A;  4B0Z A;  2WQH A;  1N4P A;  3AG1 E;  4DLQ A;  2RG8 A;  3B7R L;  2VYI A;  4HBD A;  3CVP A;  2VTB A;  2BKG A;  2WXR A;  2YHC A;  4HNA D;  3TG5 A;  4C9B B;  4A1G A;  4H7Y A;  3TWV A;  4RLY A;  4N3B A;  4GCN A;  4N5C A;  3FWV A;  5A7D B;  2Y0B G;  3ZEF A;  1TR4 A;  1JCS A;  3QWW A;  3RO3 A;  3FEY A;  5C1D A;  5KWD A;  3JUI A;  2UWJ G;  3CVN A;  2DWZ A;  2XCB A;  2XS1 A;  4FP7 A;  5EKQ D;  5FQ8 A;  2VGE A;  3O48 A;  3TWU A;  3W9F A;  2PL2 A;  5AIJ A;  5KNG A;  3NB2 A;  1IYG A;  2LAH A;  2P2C P;  3ASH A;  4JL0 A;  2HE0 A;  3DXK G;  2Y3A A;  2RFA A;  4GAA A;  3E33 A;  3FTY A;  3ZIM A;  2I6H A;  1NP7 A;  3PUJ A;  1H2T C;  4RG9 A;  3UT4 A;  5EYP F;  1H19 A;  4PH4 B;  1HZ4 A;  1E7U A;  3I4G A;  2V4H C;  4GYY A;  2L6J A;  3TGO A;  3ASF A;  3CVY A;  3HVE B;  3LPZ A;  3QK0 A;  2MRI A;  5JJ6 A;  3U4T A;  5LP0 A;  3B95 A;  2IFU A;  4GPK A;  2KCV A;  3RAU A;  5E76 A;  1TNU A;  1K1A A;  3DPD A;  3TAX A;  2IO3 C;  4MKT A;  4FLB A;  3VLE A;  3AS4 A;  5EIL A;  4ATZ D;  3EHN A;  5A6C A;  2B6C A;  3Q15 A;  3KAE A;  1NFI E;  5T4Y A;  3CHO A;  3QWP A;  5EX0 A;  3CHS A;  4FAD A;  1K3Z D;  1EDU A;  4YDW A;  1FT1 A;  5D0O D;  1X81 A;  3AJI A;  3AAA C;  3RRM B;  2PM6 A;  4E85 A;  4AXH A;  3UXG A;  5CED B;  2DZN A;  2KZT B;  4KT6 B;  5M72 A;  1UJJ A;  3L16 A;  3PVL A;  4G23 A;  4DX6 D;  4GCO A;  3PH0 C;  4I1O B;  3IXE A;  2P9K G;  3UKR G;  5LX8 A;  4JPS A;  3E32 A;  3FU0 A;  3U66 A;  3EHM A;  1VDY A;  4RG6 A;  1LTX A;  2ZIR A;  5H7P A;  1SZA A;  4A3V A;  3QB2 A;  4L2Y A;  5ANL A;  3ZPJ A;  2J8S D;  2I2O A;  3RKV A;  3T5V A;  3NQP A;  1EPU A;  2VGX B;  4DUI A;  4U8H A;  3Q75 A;  4O60 A;  4IYP A;  3SFX A;  2WXP A;  4NAC A;  3RRN B;  5KNH D;  4DX2 A;  1YCS B;  4I6J A;  2V0P A;  4BT9 A;  3IHY A;  3AU4 A;  4LNU D;  3EIJ A;  2GRL A;  4FJZ A;  5BT1 A;  4ACL A;  3X2Q E;  2MHK A;  3ZNG A;  2LO6 A;  2L0I A;  2IJG X;  1NZN A;  3URZ A;  4BTA A;  1N9A A;  2PNN A;  4EEC A;  3UX4 A;  1E8X A;  2IF4 A;  1K1B A;  5HS0 A;  4ILG A;  4CDR A;  1MHQ A;  1N54 A;  2DBA A;  2LUH A;  3OXF A;  1H2V C;  3R9M A;  1O1R A;  1UN9 A;  4TXQ A;  5KCM A;  3SBS A;  4GTT A;  5JJT A;  1H0A A;  3UT8 A;  4GMR A;  3QWV A;  1OCR E;  3UKU G;  2AXV A;  1OWO A;  3QAQ A;  1HU3 A;  5ENQ D;  4GZD A;  4I43 A;  4L23 A;  3ENE A;  3Q79 A;  3KSL A;  3UTM A;  3CVW A;  3ZKJ A;  2VSN A;  2ETB A;  5AN8 A;  3Q4A B;  4GZ5 A;  4HRN A;  5KBA A;  3PRZ A;  1NI1 A;  4IN3 B;  4J0U A;  2VQ2 A;  3CSF A;  4DRX E;  2ILR A;  2MOW A;  3JQ1 A;  3BQO A;  4EZL A;  3B7U X;  4I17 A;  4ANV A;  3FY4 A;  4B93 B;  3G2U A;  5AJL A;  3DSV A;  3C98 A;  4IUL A;  4I1A A;  4MRU A;  3QDN A;  4P29 A;  4Q94 A;  3D9M A;  5AAO A;  4ACK A;  4BSX A;  2C0M A;  4MBG A;  3FU3 A;  4JD2 G;  3UUX A;  4HQD A;  3UIP C;  3QJZ A;  4XZ4 A;  4M3O A;  4QFV A;  1UG3 A;  3GZ1 A;  2HR2 A;  3MX3 A;  4BWR A;  3U9W A;  4LNG A;  1YA0 A;  2EIJ E;  2WXI A;  5AQ9 A;  2ION A;  1H6P A;  1OCZ E;  4MS6 A;  4WWN A;  1XGW A;  2WXH A;  5EX3 A;  1Y8M A;  2A5E A;  3CHR A;  2UY1 B;  4KZ0 A;  3VLD A;  3FUI A;  5CER B;  1X5B A;  5LCW C;  4BES A;  2FBN A;  3V31 A;  1B89 A;  3AG3 E;  3FU6 A;  4U07 A;  2AVP A;  3ZHE A;  3MKQ A;  3CEQ A;  3UIN C;  4A55 A;  4G8K A;  3NAW A;  2JLB A;  2XGS A;  4OVU A;  2GGF A;  4BX8 A;  1OWN A;  3L6A A;  1AP7 A;  1DCE A;  3T8M A;  2WM9 A;  1RZ4 A;  4UWF A;  3LEW A;  4OAV B;  1L5J A;  4BX9 A;  3D9L A;  4U95 D;  3LVR E;  2GRM A;  3PE3 A;  2KBX A;  5HI7 A;  4G8L A;  1JCQ A;  4ZFH A;  1YYH A;  2I1J A;  5CHE E;  1QYM A;  3B7S A;  3D9O A;  3Q49 B;  3TL5 A;  4Z68 A;  3L54 A;  4EQF A;  4U96 D;  4JHK A;  3FH5 A;  4F3V A;  3NOG D;  4O1P A;  3E34 A;  3MKR A;  4TXP A;  3C72 A;  2OND A;  1SZ9 A;  5KJN A;  2PZI A;  3HHM A;  2LSU A;  3C3Q A;  5G05 J;  3CVX A;  5AEN A;  2IOL A;  1JPL A;  2XEN A;  5LCW J;  3CVL A;  5KJK A;  1N4R A;  2P9U G;  3L08 A;  2XRZ A;  1PC2 A;  2V4L A;  2YIN A;  2XQ0 A;  4KXK B;  2GW1 A;  4NIK A;  1TNO A;  3OXL A;  1SA5 A;  4I2Z A;  2WXO A;  3FUD A;  1E8Y A;  4F1P A;  5FZQ A;  2IQC A;  4R7L A;  5BV1 A;  4BEP A;  4U8V D;  3SGH A;  4TUU A;  3B7T A;  4HRM B;  2EIK E;  1JCR A;  4UI9 K;  3NF1 A;  4JXT A;  3W9G A;  3I4R B;  2X6F A;  5KJM A;  2XEH A;  4FU3 A;  3MCX A;  1ZU2 A;  2J08 A;  5DIZ A;  3S7F A;  2PQR A;  4U04 A;  4CGV A;  1ELR A;  4NQ0 A;  3OXG A;  1UW4 B;  2WXF A;  2Y69 E;  1N4Q A;  4ZHB A;  4H7X A;  4J8F A;  5CMY A;  5BV0 A;  4ATG A;  5FZR A;  4YVQ C;  2VGX A;  4WND A;  1IHG A;  5A23 A;  3MGB A;  1A17 A;  2DYS E;  4WNE A;  3ZGQ A;  5J90 A;  1N94 A;  3IBE A;  2DVW A;  5BUZ A;  2ZGD A;  2FEZ A;  2J49 A;  2P9S G;  3EJN A;  4DX7 D;  4CT4 A;  1UN8 A;  5FT9 A;  1WAO 1;  2KXP C;  3AG2 E;  3AS5 A;  2IOS A;  1HG2 A;  1OWL A;  3ONL A;  4GTV A;  2ETA A;  3J5Q B;  3O4Z A;  2Y4T A;  2ZIS A;  2F8Y A;  4ANU A;  4UWH A;  2P9I G;  4HI8 A;  2QYJ A;  5FQ4 A;  3UT7 A;  4HOU A;  3LS8 A;  2L6B A;  3CHM A;  3JQ0 A;  4AEZ C;  3UM3 A;  3QAR A;  2E2E A;  4GZ3 A;  3RRU A;  4N2Q A;  3MA5 A;  2QY7 A;  3NZS A;  3CQG B;  4YDY A;  3UM1 A;  2X6H A;  1S63 A;  4DX1 A;  2ZXW E;  4JA9 A;  3PDN A;  3FTW A;  5CRU A;  1LD7 A;  4AIF A;  3S2A A;  3ZYK A;  4JEH A;  1HG5 A;  3UI2 A;  3D3M A;  4APF A;  3ZN3 A;  5HKP A;  3ABK E;  4XIF A;  3FUH A;  4U7E B;  4AM9 A;  4F1S A;  2H6G A;  5JJ7 A;  4WWP A;  3ZXP A;  3OTN A;  4GZC A;  4WAF A;  1NA3 A;  3SFY A;  1FPP A;  3UM0 A;  2XZD G;  3D9K A;  4WWO A;  4NUR A;  1HX8 A;  5EDS A;  2XGM A;  3SI5 A;  2CFU A;  2J4B A;  1E8W A;  4XE0 A;  2EIM E;  3ABL E;  1GW6 A;  3I5P A;  3DST A;  5G55 A;  3RJV A;  2BED A;  4LUN U;  5JHB A;  2OOE A;  2IU1 A;  4EBA G;  3PS6 A;  3PZ2 A;  1PAQ A;  4TRQ A;  3LJN A;  1FCH A;  4I9C A;  1HE8 A;  3JXI A;  3AS8 A;  3ZYQ A;  4HOS A;  4AOF A;  4HFG A;  4K5C A;  4N5Q A;  1TNY A;  4GTO A;  3V79 K;  4JHJ A;  3ESK A;  1MQS A;  3SHF A;  3DSU A;  3HXC A;  4J6I A;  3JUE A;  5AAR A;  3UPV A;  1SQM A;  3KS2 A;  1OCC E;  3PNT B;  5EIB E;  5KJL A;  2LAI A;  1MX4 A;  3PEV B;  2BTD A;  3KSQ A;  3ZYL A;  1Z3X A;  1NA0 A;  3LXU X;  4UWK A;  3ABM E;  2X38 A;  1S64 A;  2I9C A;  4CCA A;  4PS8 A;  1XNF A;  3SNX A;  3MYV A;  2X6I A;  4V3I A;  1TNB A;  2CG2 A;  4E6H A;  3DEP A;  5AQB A;  3BU8 A;  2IO2 C;  5BW8 C;  5ANR A;  4YVO A;  2VTB B;  3AG4 E;  3LDZ A;  3Q73 A;  1Q2Z A;  4UWG A;  5EID A;  3R7Q A;  3FH7 A;  3N71 A;  3PZ1 A;  4ILI A;  4B8C B;  3TJP A;  3QNK A;  4APO A;  3VTY A;  2XGO A;  4BTB A;  5CCL A;  2RD0 A;  1EF1 C;  4L9P A;  4RVB A;  4BT8 A;  4GTQ A;  5B3S E;  3SZ7 A;  4GU5 A;  3RO2 A;  1YMP A;  3EHQ A;  3CV0 A;  4CRW A;  5AQA A;  3FUL A;  2F37 A;  2AW6 A;  2IEJ A;  1LF8 A;  4Y6C A;  1HH8 A;  4N3C A;  2NXP A;  4LRZ A;  3V2O A;  4GTM A;  2XPI A;  2NSZ A;  1N0Q A;  2FUL A;  2RFM A;  3FU5 A;  4YDE A;  4K03 A;  4HB5 A;  1Y6I A;  3GZS A;  3SBT B;  2HYZ A;  5T8I A;  1LD8 A;  1OWM A;  3BUA A;  3HXE A;  4LCT A;  4Q96 A;  4N2S A;  2CFZ A;  3ULE G;  4C0E A;  5AQ7 A;  4CYM D;  4LER A;  2KM4 A;  1SW6 A;  3GYZ A;  1DCQ A;  4PDX A;  4HOR A;  4UUC A;  2QZA A;  1TYQ G;  1SA4 A;  3PRE A;  5BPP A;  2GRO B;  2WB2 A;  3RIB A;  2IY0 C;  2F8X K;  4BET A;  3Q9U C;  5FJY A;  3E4B A;  1D8E A;  2BUG A;  1OUV A;  3ZXS A;  5EYL A;  3B7B A; 
#chains in the Genus database with same CATH homology
 1EYH A;  3O48 A;  3IHV A;  2J4D A;  3HIZ A;  4AY5 A;  3LVQ E;  3RK6 A;  4JHK A;  2FI7 A;  3FH8 A;  1N52 A;  3FH5 A;  1U3D A;  4F3V A;  4FJY A;  3ZYM A;  2V8S E;  3MKR A;  2R5S A;  3ASD A;  1FVF A;  4U0Z A;  2PL2 A;  1UJK A;  2OND A;  4F53 A;  5AIJ A;  5T3R A;  2EQX A;  1SZ9 A;  2Y4U A;  5KJN A;  2PZI A;  3HHM A;  5AYW D;  1IYG A;  2LAH A;  3CK8 A;  4BFR A;  1HXI A;  4I6E A;  2AWI A;  4GZ6 A;  2LSU A;  4KMO A;  4L7T A;  4NRH B;  3ASH A;  4JL0 A;  1E7V A;  1WM5 A;  3LY8 A;  4FLH A;  2Y3A A;  4N3A A;  5G05 J;  4GML A;  3CVX A;  2VJ8 A;  5AEN A;  4B89 A;  4B94 A;  4GAA A;  3CQC B;  3FTS A;  3FTY A;  3ZIM A;  2I6H A;  2IOL A;  1JPL A;  1H2U A;  1NP7 A;  5LCW J;  4UWL A;  3CVL A;  3PUJ A;  5KJK A;  3IKO B;  3FEX A;  3L08 A;  4B8A A;  2XRZ A;  1H6K A;  1PC2 A;  3ONK A;  1H2T C;  2V4L A;  1ZBP A;  2YIN A;  5BNW A;  3ZFW A;  4L2L A;  2XQ0 A;  4KXK B;  2R59 A;  4RG9 A;  3UT4 A;  1H19 A;  4PH4 B;  4FUL A;  2GW1 A;  1HZ4 A;  2VSO E;  3FHE A;  3OXL A;  1E7U A;  3I4G A;  2Q7F A;  4GYY A;  2L6J A;  4I2Z A;  3TGO A;  1IQU A;  3ASF A;  5JHA A;  3CVY A;  4CDM A;  3BEE A;  2WXL A;  3FUJ A;  3OAW A;  3HVE B;  2WXO A;  1ELK A;  3HYM B;  1ELW A;  3LPZ A;  3QK0 A;  1QQE A;  4ABN A;  3FUD A;  2MRI A;  1E8Y A;  1U3C A;  3MEK A;  5FZQ A;  2C0L A;  2AXZ A;  2IQC A;  4R7L A;  5JJ6 A;  3U4T A;  3FUF A;  5BV1 A;  3SGH A;  5LP0 A;  3MJW A;  4TUU A;  1QZ2 A;  3B7T A;  4FA6 A;  5CMW A;  2HO1 A;  4AY6 A;  3FUN A;  5G04 C;  2PQN A;  3LY7 A;  4FHJ A;  2IFU A;  1DNP A;  4FHK A;  4UI9 K;  3NF1 A;  4GPK A;  2VSY A;  3CLJ A;  4JXT A;  3I4R B;  2X6F A;  5KJM A;  5FQ7 A;  4FU3 A;  3UQ3 A;  3MCX A;  1ZU2 A;  2A5U A;  2J09 A;  2KCV A;  2J08 A;  4XI9 A;  5DIZ A;  4XI0 A;  5E76 A;  1Z3Y A;  5FWQ A;  3S7F A;  2PQR A;  4U04 A;  4JHR A;  3U64 A;  1ELR A;  4CGV A;  2LSV A;  4NQ0 A;  3DPD A;  2WMO A;  3MV3 B;  3TAX A;  3OXG A;  3LYA A;  3B13 A;  1UW4 B;  2WXF A;  3CK7 A;  3TXM A;  4MKT A;  4FLB A;  4N39 A;  2X3M A;  2OV8 A;  4GA2 A;  3AS4 A;  4H7X A;  3VLE A;  4ANX A;  4G1T A;  4G25 A;  3EHN A;  4J8F A;  5CMY A;  5BV0 A;  3S7B A;  3G2T A;  5A6C A;  3Q15 A;  3S7J A;  3KAE A;  4ATG A;  5FZR A;  4BY6 A;  2HM8 A;  4DLO A;  3AU5 A;  3Q5M A;  1S0P A;  5T4Y A;  4YVQ C;  2VGX A;  3CHO A;  4RSY A;  4KYO B;  3QWP A;  4WND A;  4J8S A;  4UQX A;  5EX0 A;  4AJW A;  2CHZ A;  4EZJ A;  1IHG A;  3CHS A;  3HVE A;  4CEM A;  4FAD A;  3WXX A;  5A23 A;  3MGB A;  4DJA A;  5FTP A;  3SD5 A;  1JUQ A;  4U0S A;  1EDU A;  3D9I A;  3K9I A;  4K0R A;  1A17 A;  4WNE A;  2YNQ A;  4GA1 A;  3SFZ A;  5D0O D;  1Z6T A;  2XEV A;  3ZGQ A;  3CKB A;  5J90 A;  3IBE A;  4Y6W A;  3CK9 A;  5BUZ A;  2FEZ A;  3APF A;  2J49 A;  3EJN A;  3RRM B;  2PM6 A;  4XKC A;  1UN8 A;  4CT4 A;  2DCP A;  5FT9 A;  1WAO 1;  4E85 A;  4AXH A;  3AS5 A;  2IOS A;  1HG2 A;  1OWL A;  3ONL A;  2WVI A;  3DBS A;  4GB9 A;  3SF4 A;  2KC7 A;  3O4Z A;  2KZT B;  4KT6 B;  2Y4T A;  5M72 A;  1UJJ A;  4G24 A;  3L16 A;  3IV0 A;  4DI3 A;  3PVL A;  4ANU A;  4G23 A;  4UWH A;  2NC9 A;  2XCC A;  3ML8 A;  3PE4 A;  4GCO A;  3CR3 A;  3PH0 C;  5FQ4 A;  4I1O B;  3UT7 A;  4HOU A;  2XHE A;  3LS8 A;  3CHM A;  3JQ0 A;  3L22 A;  4AEZ C;  5CCM A;  5LX8 A;  4JPS A;  3FU0 A;  3R9A B;  3MV2 B;  2X6J A;  3ZRH A;  3QAR A;  3U66 A;  3EHM A;  4GYW A;  3HDX A;  2E2E A;  4GZ3 A;  1VDY A;  4RG6 A;  4A1S A;  2I1K A;  3RRU A;  3FUM A;  3Q47 B;  4N2Q A;  5E75 A;  3MA5 A;  1SZA A;  2QY7 A;  4A3V A;  4WUY A;  3QB2 A;  3NZS A;  3CQG B;  4L2Y A;  5ANL A;  3ZPJ A;  2I2O A;  2X6H A;  3RKV A;  4C0M A;  2E0I A;  4D10 C;  3T5V A;  3NZU A;  3NQP A;  1JWF A;  3QC1 A;  4MLP A;  4JA9 A;  4OVV A;  3PDN A;  4O6F A;  1EPU A;  2J9Q A;  3FTW A;  4Q69 A;  2VGX B;  3FUE A;  4U8H A;  4JVS A;  2P58 C;  4GMJ A;  4IRU A;  4UI9 C;  4AIF A;  1KLX A;  4IYP A;  3S2A A;  3ZYK A;  3S7D A;  2WXP A;  1HG5 A;  4JEH A;  2KCK A;  3BG0 B;  4NAC A;  3FFL A;  3D3M A;  3D9N A;  4APF A;  3JYS A;  1P5Q A;  3RRN B;  3ASG A;  3ZN3 A;  1JWG A;  4LEU A;  3U3W A;  3CVQ A;  4I6J A;  2KZT A;  2V0P A;  4BT9 A;  4XIF A;  2BF0 X;  3IHY A;  3FUH A;  4AM9 A;  3QKY A;  3VTX A;  5HQ8 A;  4F1S A;  3L17 A;  4FC8 A;  3AU4 A;  3EIJ A;  2GRL A;  4FJZ A;  5BT1 A;  3LY9 A;  4ACL A;  1E96 B;  3UMV A;  2AXU A;  2MHK A;  5JJ7 A;  1HFA A;  4WWP A;  1INZ A;  3OTN A;  2LO6 A;  2M63 A;  1DVP A;  2L0I A;  4GZC A;  4HXI A;  1NA3 A;  4PUC A;  4WAF A;  2IJG X;  1NZN A;  5ENN A;  2PM7 A;  3D9K A;  4WWO A;  3RU0 A;  5G05 C;  3URZ A;  4BTA A;  4EZK A;  2DIW A;  4NUR A;  1HF8 A;  3EIQ C;  1HX8 A;  3APC A;  5EDS A;  4A3T A;  4EEC A;  3UX4 A;  2VSX E;  2XGM A;  4I1M A;  1E8X A;  2IF4 A;  3CHQ A;  4ILG A;  3SI5 A;  4CT0 A;  2CFU A;  4CDR A;  4I6G A;  1MHQ A;  2J4B A;  4XX5 A;  1N54 A;  2DBA A;  1E8W A;  3OXF A;  4AVX A;  1H2V C;  4XE0 A;  4HLE A;  5ARF A;  4J8D A;  2OVF A;  2ZU6 B;  3D9J A;  5G2N A;  1GW6 A;  3I5P A;  3RJV A;  4GYO A;  5G55 A;  1UN9 A;  3CHP A;  2WXM A;  4URK A;  1HO8 A;  5KCM A;  2L0T B;  3SBS A;  4KZC A;  4F7A A;  1TJF A;  4LUN U;  3P2B A;  5JJT A;  3EDT B;  1H0A A;  5JHB A;  2OOE A;  3I3N A;  2WQ6 A;  2IU1 A;  3P1U A;  4EBA G;  1E90 A;  3UT8 A;  3PS6 A;  3VLF A;  5ARG A;  1PAQ A;  3QWV A;  2CHW A;  3LCA A;  4JA7 A;  4TRQ A;  1W3B A;  1BPO A;  2OVB A;  4WNG A;  2AXV A;  1OWO A;  3MZL B;  3QAQ A;  3CVV A;  3CIA A;  1FCH A;  1HU3 A;  4I9C A;  4PS7 A;  1HE8 A;  3ZYQ A;  3AS8 A;  2A4Z A;  4KVO A;  4GZD A;  3ULQ A;  4AOF A;  3ZVV A;  4I43 A;  4HFG A;  4HOS A;  4L23 A;  4AV7 A;  3ENE A;  3TXN A;  3G2S A;  3PNL B;  5C2Y A;  3CVW A;  4JHJ A;  3ESK A;  3ML9 A;  1MQS A;  3SHF A;  1HS6 A;  4GA0 A;  2VGY A;  2VSN A;  1WY6 A;  4J6I A;  4W9R A;  3Q4A B;  1TEZ A;  4GZ5 A;  3PEU B;  1QNF A;  3T5X A;  3UPV A;  2XPY A;  1SQM A;  3PRZ A;  4IN3 B;  4J0U A;  3KS2 A;  2VQ2 A;  3CSF A;  3CST A;  3PNT B;  3FP3 A;  4UI9 J;  4KVM A;  2KCL A;  2ILR A;  2MOW A;  3CGH A;  3JQ1 A;  5KJL A;  2LAI A;  3PEV B;  2BTD A;  3D9P A;  3LKU A;  2FF4 A;  5FQ6 A;  4EZL A;  1FVH A;  3B7U X;  4I17 A;  3ZYL A;  4ANV A;  1Z3X A;  4XKB A;  1NA0 A;  3FY4 A;  3LXU X;  4AP2 A;  3FUK A;  3G2U A;  2WXN A;  5AJL A;  4UWK A;  2V5F A;  2X38 A;  5G04 J;  4EPZ A;  3C98 A;  3KEZ A;  4OYS A;  3CKC A;  4WNF A;  4IUL A;  4I1A A;  4MRU A;  4PS3 A;  2I9C A;  3QDN A;  4P29 A;  4CCA A;  4PS8 A;  4Q94 A;  1XNF A;  2CHX A;  2YHE A;  4HOT A;  4G11 A;  3SNX A;  2WXG A;  3D9M A;  3ZHE B;  3MKQ B;  3MYV A;  1TJC A;  2X6I A;  2LNI A;  3GZ2 A;  4V3I A;  3APD A;  2CG2 A;  4G2V A;  4E6H A;  4ACK A;  4BSX A;  2QFC A;  4DK5 A;  2FO7 A;  4JEU A;  4U63 A;  3BG1 B;  2C0M A;  4I9E A;  3PUK A;  5BW8 C;  4HS2 A;  5ANR A;  3FU3 A;  4ME2 A;  4YVO A;  2VTB B;  4UQY A;  3UUX A;  3LDZ A;  2L9B A;  2J07 A;  2XPZ A;  3QJZ A;  3LJ3 A;  4XZ4 A;  4UWG A;  4YND A;  4HVB A;  4JC8 A;  3R7Q A;  4JW1 A;  2WQ7 A;  3FH7 A;  2XRY A;  3N71 A;  2KAT A;  4M3O A;  5AJD A;  2WXQ A;  4QFV A;  4ILI A;  4B8C B;  3TJP A;  3QNK A;  1KT1 A;  1UG3 A;  3VTY A;  3GZ1 A;  2HR2 A;  2XGO A;  2YQ8 A;  4APO A;  2RD0 A;  3MX3 A;  4BTB A;  1EF1 C;  4J8E A;  5CCL A;  4TV3 A;  5LFA A;  4BWR A;  3CVU A;  3U9W A;  4RVB A;  5LOZ A;  1E8Z A;  4BT8 A;  3SZ7 A;  1YA0 A;  4GU5 A;  3ESL A;  4U0U A;  3RO2 A;  3G2W A;  2WXI A;  3R7R A;  2C2L A;  2ION A;  3FTV A;  4DI4 A;  4MS6 A;  3CV0 A;  4UQZ A;  4EBA A;  4CRW A;  4WWN A;  1XGW A;  2WXH A;  3FUL A;  3FDH A;  1OWP A;  5EX3 A;  1Y8M A;  3CHR A;  2UY1 B;  4ILH B;  4KZ0 A;  3VLD A;  3FTU A;  4G26 A;  3L13 A;  1IQR A;  3FUI A;  1X5B A;  2AW6 A;  4DPR A;  5LCW C;  3PZD A;  3G2V A;  1LF8 A;  2FBN A;  3QOU A;  1HH8 A;  4N3C A;  4Y6C A;  2NXP A;  1B89 A;  2WXK A;  4LRZ A;  2XPI A;  2WXJ A;  2NSZ A;  3FU6 A;  2FUL A;  4I2W A;  4U07 A;  4B0Z A;  2AVP A;  3ZHE A;  3ZW3 A;  3MKQ A;  2WQH A;  3CEQ A;  3IEG A;  3FU5 A;  3KD7 A;  3GW4 A;  4A55 A;  4HOQ A;  2JLB A;  2XGS A;  4DLQ A;  2RG8 A;  2GGF A;  2R17 C;  3B7R L;  4K03 A;  2VYI A;  4OVU A;  4BX8 A;  1Y6I A;  3GZS A;  3JCK C;  5J08 A;  3SBT B;  2HYZ A;  4KBQ A;  3CVP A;  2VTB A;  1OWN A;  5T8I A;  2WMN A;  3L6A A;  1OWM A;  2WXR A;  2YHC A;  4JZY A;  3TG5 A;  3T8M A;  4C9B B;  4A1G A;  4H7Y A;  2WM9 A;  4N3B A;  4GCN A;  4N5C A;  4UWF A;  5D0Q D;  3LEW A;  3FWV A;  4LCT A;  5A7D B;  4Q96 A;  4N2S A;  4CGW A;  2CFZ A;  1L5J A;  4ANW A;  4BX9 A;  3ZEF A;  3FTZ A;  2JEK A;  4C0E A;  3D9L A;  3FTX A;  2CG3 A;  4LER A;  2KM4 A;  3LVR E;  2GRM A;  3GYZ A;  3PE3 A;  3QWW A;  3RO3 A;  4PDX A;  3FEY A;  5HI7 A;  4HOR A;  5C1D A;  4L1B A;  2WPV A;  2UWJ G;  3CVN A;  3JUI A;  3PRE A;  4CDN A;  5BPP A;  5FZS A;  2WB2 A;  2XCB A;  5DBK A;  1KT0 A;  2I1J A;  5CHE E;  3RIB A;  4FP7 A;  2UY1 A;  5EKQ D;  1PY1 A;  3B7S A;  5FQ8 A;  5FJY A;  3D9O A;  3TG4 A;  3E4B A;  3Q49 B;  3TL5 A;  2BUG A;  1OUV A;  3ZXS A;  2X6K A;  3L54 A;  4EQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...