2IFUA

Crystal structure of a gamma-snap from danio rerio
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
275
structure length
275
Chain Sequence
AAQKISEAHEHIAKAEKYLKTSFMKWKPDYDSAASEYAKAAVAFKNAKQLEQAKDAYLQEAEAHANNRSLFHAAKAFEQAGMMLKDLQRMPEAVQYIEKASVMYVENGTPDTAAMALDRAGKLMEPLDLSKAVHLYQQAAAVFENEERLRQAAELIGKASRLLVRQQKFDEAAASLQKEKSMYKEMENYPTCYKKCIAQVLVQLHRADYVAAQKCVRESYSIPGFSGSEDCAALEDLLQAYDEQDEEQLLRVCRSPLVTYMDNDYAKLAISLKVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of gamma-SNAP: insight into flexibility of proteins from the SNAP family.
pubmed doi rcsb
source organism Danio rerio
molecule tags Endocytosis/exocytosis
molecule keywords gamma-snap
total genus 112
structure length 275
sequence length 275
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14938 SNAP Soluble NSF attachment protein, SNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ifuA00
3Q5MA 4GYOA 4A1SA 1NA0A 1YA0A 4EQFA 3RKVA 4B94A 2ONDA 1P5QA 3WXXA 4GZ6A 2R5SA 4GZ3A 3O48A 1NA3A 3HYMB 2XGMA 1PC2A 2VYIA 3CVPA 2VQ2A 3KD7A 1ZU2A 4JL0A 4G26A 4WNGA 5D0QD 2VGYA 2YQ8A 4KYOB 3LKUA 3OXGA 3PDNA 4H7YA 1ELRA 4U07A 4N2QA 3LY9A 4G1TA 4UI9J 3ZHEB 4BTBA 4ABNA 2KATA 4I1AA 4BT8A 4CGWA 4GA1A 5EX0A 5HI7A 1E96B 2Q7FA 4J8DA 4J0UA 3RO2A 3ZN3A 3QDNA 2C0LA 3QKYA 3CK9A 5DIZA 2KCLA 3MA5A 3R9AB 4AY5A 2QFCA 4GZ5A 1ELWA 4LEUA 4UI9C 5BT1A 5JJTA 5ARGA 3CV0A 3QWWA 3TG4A 3RO3A 4GCOA 2BUGA 3LY8A 5FT9A 2XCBA 1HXIA 3Q15A 2KC7A 4GPKA 3Q49B 3CK7A 4G2VA 4N3AA 5D0OD 2DBAA 3ZHEA 4AY6A 3Q4AB 4NQ0A 5ARFA 2C0MA 2FI7A 4CDRA 2VGXA 4N5CA 3AS4A 3JYSA 3CEQA 5KJNA 5KJKA 1ZBPA 2WPVA 3LPZA 3Q47B 4UQYA 5DBKA 1NZNA 4ME2A 4UI9K 4APOA 2C2LA 3CKBA 3FP3A 2LSUA 3S7DA 1W3BA 3FFLA 4IN3B 3ASDA 2MHKA 3IEGA 5LCWC 5KJLA 2FO7A 1Y8MA 3ESKA 3QWVA 3S7BA 3VTXA 5BNWA 2UY1B 4U0SA 3ULQA 3URZA 4JA7A 2LNIA 5FTPA 2V5FA 4GA2A 4GYYA 4HOQA 5G04J 5G05J 2LSVA 3QWPA 5JJ6A 2PZIA 3MV2B 4J8EA 3RU0A 2NC9A 4I2ZA 5C1DA 5LCWJ 4RG9A 2JLBA 1XNFA 4BTAA 2VGXB 4J8FA 3ZGQA 3GW4A 3BEEA 2UY1A 3E4BA 4G25A 3S7FA 4HORA 3ASGA 4XIFA 3FWVA 2OOEA 4G23A 3GYZA 4U0ZA 5G04C 1HZ4A 4GYWA 1KT0A 3TAXA 5KJMA 4N2SA 2IFUA 5BW8C 3CK8A 3CVLA 2UWJG 3CVQA 2E2EA 3GZ2A 3OXLA 3U4TA 4F3VA 1QQEA 3UPVA 3MKRA 4U0UA 4RG6A 2PQRA 2KCVA 2PL2A 4GCNA 4YVOA 1A17A 5AYWD 3CKCA 3UQ3A 3S7JA 4AM9A 1HH8A 4HOUA 2P58C 5CCMA 1TJCA 2AVPA 1WAO1 3CVNA 4N3BA 2Y4TA 4G24A 4WNDA 2PQNA 3RIBA 5HQ8A 4XI0A 3U3WA 4KBQA 5EX3A 2GW1A 3ZFWA 1IYGA 3N71A 5CHEE 3KAEA 2HR2A 4YNDA 2WQHA 2XGOA 3ASFA 3ASHA 5A7DB 2HYZA 4UQZA 4YVQC 3TGOA 4KXKB 3VTYA 5M72A 4I2WA 1KT1A 3QOUA 4N39A 3TG5A 2FEZA 2I6HA 2IF4A 1IHGA 2FBNA 4NRHB 1OUVA 3KS2A 4N3CA 4WNFA 4U04A 3LCAA 3MV3B 2KCKA 3OXFA 5EKQD 5FJYA 4GA0A 5CCLA 3K9IA 4AIFA 4UQXA 3EDTB 3UUXA 3SF4A 2Y4UA 4Y6CA 5FZQA 3LYAA 2VSNA 4Y6WA 4HOTA 4I9CA 3MEKA 1KLXA 4I17A 4BT9A 2J9QA 2L6JA 4O6FA 5FZRA 1WM5A 3ZPJA 4JA9A 4HOSA 5JJ7A 2XPIA 3AS8A 5G05C 4XI9A 2XCCA 2XGSA 3SZ7A 1B89A 2XEVA 3PE3A 2FF4A 4WNEA 5FZSA 3NF1A 3PE4A 2HO1A 1FCHA 3AS5A 3RJVA 4W9RA 4CGVA 2YHCA 3LY7A 4H7XA 4BWRA 4I9EA 4JHRA 5A6CA 3GZ1A 1QZ2A 4WUYA 2VSYA
chains in the Genus database with same CATH superfamily
4GYOA 4B94A 4EZJA 5ENOD 4HLLA 2XGMA 4WNGA 4FLHA 4G26A 4DLQA 3FH7A 4TV3A 3DSVA 4U07A 4B8CB 3FUHA 4BTBA 5EYLA 3UM3A 3PNTB 3EHRA 4U7EB 1E96B 4J0UA 1TNOA 3Q9UC 2IY0C 3RAUA 3CV0A 4GCOA 2BUGA 2P9KG 2GRMA 2R05A 2AXUA 2CHXA 3DSTA 5KJNA 1O1RA 3KSLA 4DLOA 3EJNA 4JHKA 5CMYA 1TN6A 2EIJE 3IEGA 3QWVA 1Y8MA 5G05J 5JJ6A 1SQMA 2JLBA 3FUNA 3BU8A 1HX8A 3APFA 3DEOA 5ENSD 3UPVA 1TYQG 4PDXA 1SZAA 4ATZD 1UJKA 2PQRA 4MKTA 3IBEA 4HNAD 3VLDA 1A5EA 2AVPA 1E7VA 2XZTG 3SNXA 3ZFWA 4DPRA 3S2AA 2J07A 4FADA 2X38A 1MQSA 2V4HC 4XEIG 4UUCA 3W9FA 2J9QA 2L6JA 4XI9A 3PEUB 3SZ7A 3PE3A 3RRMB 1BU9A 4OAVB 3Q73A 4EQFA 2F8YA 4CDNA 4GZ3A 2QYUA 3E32A 4NURA 1S0PA 4FJYA 2YQ8A 4EECA 3V30A 3SD5A 4CGWA 1PY1A 4GMRA 4ANWA 4J8DA 5G55A 3AG2E 3EHMA 5ARGA 5CEDB 3JCKC 1JWGA 2DWZA 4G2VA 4EZKA 2VGXA 2BKKB 3TXNA 1W3BA 3U64A 1FT1A 3I3NA 4GYYA 4WWNA 2KZTB 4I1MA 2WVIA 1IXVA 4FHJA 2L0TB 3TAXA 2GRQB 1N4PA 4CZ2D 1HE8A 4RG6A 3FU3A 2CHZA 3T8KA 2NXPA 3S7JA 5CCMA 3UT4A 3UI2A 4KBQA 1U3CA 3T8MA 1KT1A 1GW6A 4WNFA 2KCKA 4K5AB 4TXQA 2ETBA 5C2YA 2XPIA 3UXGA 3JUEA 4WNEA 1N54A 1SW6A 4Q69A 5BXUA 1HFAA 2AXZA 2WXRA 3LVRE 2OVFA 1NA3A 2CFUA 3PDNA 3LY9A 2C0LA 1YMPA 1OWPA 4IYPA 5HRYA 1HG5A 3CK7A 3O4ZA 2VJ8A 3L16A 2FI7A 3B7RL 3PS6A 2CFZA 3CSFA 1BLXB 1ZBPA 4DX1A 3TJPA 2EIKE 1V54E 4AJWA 2V5FA 4HOQA 3SFXA 3HXEA 2UY1A 2ZGGA 4DX2A 1H6OA 4HORA 1DVPA 4LG6A 4Q96A 1QQEA 3ESLA 4KZ0A 1DCQA 4A1GA 3QARA 1JCQA 4K5CA 2AXVA 4XZ4A 4F6RD 2HR2A 2PM6A 4WWOA 4YDEA 3EUVA 2FEZA 4U04A 3D9LA 4Y6CA 1H0AA 5LX8A 4HI8A 2A5UA 4QQIA 2MRIA 3ZYKA 1SZ9A 2XGSA 3GZSA 4JVSA 2ILRA 3LY7A 3EU5A 4I9EA 4L9PA 3B7SA 4JPSA 2I1JA 2ZU6B 5LOZA 5LCWJ 2EILE 2XZDG 3ZNGA 1ELRA 2WXQA 4F7AA 3CQCB 3ZHEB 2HM8A 4GMLA 3HXDA 4EBAG 3IV0A 3ULYA 1JPLA 1OT8A 1N95A 2XCBA 4JC8A 2GRRB 4IULA 5AQ9A 3CHOA 4EBAA 3CSTA 3LVQE 4A63B 4DX5D 2LSUA 3LXUX 1O5MA 4FULA 1TR4A 2J4DA 3UMVA 4RG9A 3JQ1A 3D9NA 3HVEB 4ANVA 2WXIA 2XPYA 3AAAC 3DBSA 3RK6A 1Z3XA 3TWVA 3J5QB 1A17A 3FTZA 3UQ3A 2EQXA 1TJCA 2R2LA 4HQDA 2X6HA 3TGOA 3MJWA 3ASOE 2P9SG 2CG3A 4NRHB 3QAQA 4B89A 1UOHA 2Y3AA 4Y6WA 2J49A 5T3RA 2MYOA 4L2LA 3V79K 2WQ7A 2XEVA 2FF4A 5FZSA 2VTBA 3PZ4A 3NOCD 1E8ZA 4ACLA 3CVYA 4AEZC 5E75A 2WXPA 3LS8A 4TXPA 4DX7D 1H6PA 4AV7A 4E6HA 3HYMB 4I6GA 1KZPA 2VGYA 4APFA 4FC8A 3QJZA 2H6HA 1ZB1A 2B6CA 3T9KA 1V55E 1UN8A 2XS1A 4UI9C 3IKOB 2EINE 3VLFA 4MLPA 1HF8A 3UKRG 3MKQB 1NP7A 3B95A 3CHQA 4GTVA 5DBKA 3UKUG 2MHKA 1OCZE 2FO7A 4U0SA 2XRYA 2CHWA 4BEPA 5JMND 3TWXA 5AARA 5KJMA 4U95D 2AWIA 2KBXA 4G8LA 1UG3A 4F1PA 2VTBB 2WXJA 2WXOA 3L54A 2WXKA 4WNDA 3W9GA 1LF8A 2DYSE 5D66A 5FJYA 1HS6A 5CCLA 2Y69E 4CYMD 5ENTD 4HFGA 4CDMA 2Y0BG 4LUNU 4TXRA 4WAFA 2PM7A 3RKVA 4BESA 4JB8P 4BWRA 3V2XA 2X6JA 5LFAA 4GTSA 2XQ0A 5BV0A 3QC1A 1TN8A 3I5PA 3QWWA 3C98A 3RO3A 2L9BA 3SQVA 4N3AA 4LCTA 3Q4AB 5AJDA 4N5CA 1WG0A 5CMWA 2I9CA 3ZEFA 4HRLA 1H2VC 4DRXE 3ESKA 3QNKA 3P2BA 2WXLA 1N0QA 5CRVA 4LNUD 3GW4A 2DIWA 4HI9A 3D9KA 5HS0A 2OOEA 4ZHBA 3FU5A 4OVUA 3T5VA 3KSQA 4CEMA 2F8XK 3FU6A 3ASFA 3ASHA 5M72A 3QOUA 5ANLA 2RD0A 3HXFA 1X5BA 3WG7E 4JXTA 1O1SA 3MEKA 1VDYA 5BXOA 5JHAA 4O1PA 3KEZA 4CT4A 2HE0A 3SY2A 4PUCA 3PE4A 2YHCA 1E7UA 4LNGA 5AJLA 2YINA 2VSYA 3CHPA 3U9WA 4FA6A 3O48A 4GTTA 4EHMA 3SGHA 3SBSA 3OXGA 4H7YA 2VGEA 3PH0C 3ZYQA 2NYJA 3EIQC 3CK9A 5DIZA 1H2TC 2KCLA 3MA5A 5FQ8A 4DI3A 3L6AA 1QBQA 1K1AA 3JXJA 3ML9A 2WMOA 3C5RA 4GTQA 3Q9NC 1TEZA 2E0IA 3Q78A 1IQUA 2IEJA 2QYJA 1DNPA 4GMJA 2KZTA 3DWLG 3FFLA 5BNWA 3S7BA 4GA2A 4LRZA 3AJIA 3ABME 4XIFA 2ZXWE 3J5PA 3GYZA 5ENQD 1MYOA 5T4YA 1SVXA 4FHKA 3IHVA 3UM1A 3AG1E 3MX3A 1N0RA 3HVEA 3EIJA 1L5JA 3JXIA 4FLBA 1WAO1 2R02A 3DSXA 5CHEE 3EU9A 1BPOA 2RG8A 4ANXA 5ENNA 4AVXA 3VTYA 3IXEA 5J90A 4HS2A 1EF1C 1N9AA 4HXIA 3UM2A 1D8EA 2Y4UA 1RZ4A 3LYAA 3NQPA 3EHQA 4UWKA 4LNBA 4ILHB 3SFYA 4XKCA 1TJFA 3FH5A 1KPSB 4JHRA 2GRNB 1TNYA 1QZ2A 2YNQA 4U63A 3Q5MA 1P5QA 3ONLA 4W9RA 1PC2A 3LKUA 2V5QC 2RFMA 2KATA 4ANUA 4FP7A 2Q7FA 3HIZA 3D9OA 1H19A 3U66A 3FEYA 2PNNA 5ENRD 3ZYMA 3PUJA 2A4ZA 1KZOA 3ABKE 3PZ1A 3AS4A 3FEXA 3Q47B 3UX4A 5ITZF 2F37A 3ASDA 2V8SE 1U2VG 2VGXB 3BEEA 3HRAA 3S7FA 3ASGA 2CG2A 3SBTB 5BW8C 5FIOA 3CVQA 3OXLA 2GROB 1OWLA 1YCSB 1Z6TA 3G2SA 3CKCA 3BG1B 3BG0B 3NZSA 3ZXSA 1IYGA 3TXMA 4XE0A 3CQGB 1FPPA 3UTMA 1HG2A 2WXFA 2GRLA 4J8YA 4TUUA 1SA4A 3CVVA 3L13A 2KM4A 2ETCA 5CECB 2OVBA 4KVMA 1Q2ZA 3FUDA 3ZPJA 4Q94A 2IU1A 1BI7B 3X2QE 5J08A 4L1BA 4YDWA 2HO1A 3FTYA 1NA0A 2DYRE 4M7CA 2R5SA 4AXHA 2VQ2A 5D0QD 3FUJA 4GZCA 3QDNA 3QKYA 4GTMA 3R9AB 1ELWA 3FTSA 5E76A 2H6GA 1H2UA 3LY8A 1HXIA 5EN5D 3FH8A 1U3DA 2P9NG 3TWUA 3RSEG 4FU3A 4M3OA 5AAOA 5CEAA 2J08A 3D9HA 1WDYA 2P2CP 4KVOA 3CKBA 4GB9A 3S7DA 3UT8A 4R7LA 4D10C 1TN7A 4I43A 5FTPA 5BUZA 3PZ2A 3E33A 4F53A 1ELKA 1IQRA 4BTAA 3B7BA 4GYWA 4JEHA 5BPPA 3KEAA 3U4TA 3VLEA 3CIAA 2J8SD 1PAQA 2R59A 3WXXA 1DC2A 2WB2A 3CLJA 1MHQA 4PS7A 4CT0A 4GA0A 4MRUA 4HOTA 2OV8A 3LEWA 3E34A 4ILIA 2LXLA 2XRZA 4I6JA 5FZRA 5AQBA 4XKBA 3B13A 1OCCE 5JHBA 2QC9A 2DBAA 4BSZB 2VSXE 3KD7A 1JUQA 2P9IG 3ULEG 2OEWA 2WXHA 1K3ZD 3IHYA 3R7QA 4AY5A 3MKQA 1OY3D 5FT9A 3Q15A 4C0MA 3SI5A 5D0OD 3ZHEA 3V31A 5KJKA 5AENA 1NZNA 2C2LA 3JQ0A 3ZRHA 4G8KA 1LD7A 3DSSA 1HU3A 1NFIE 2LSVA 3ZW3A 4I2ZA 3C3OA 3PRZA 5G04C 4ZFHA 5CRUA 3SFZA 4EZLA 3SO8A 3G2UA 5D2MC 4ILGA 4GPMA 4UWFA 4G24A 3TWRA 5HQ8A 4XI0A 1QYMA 4WWPA 4RVBA 4I1OB 3ZYLA 1LD8A 4BT9A 3ZIMA 4O6FA 1INZA 4HBDA 4JD2G 4JHJA 3AS5A 3UINC 3ABLE 3FY4A 3C3QA 4WUYA 1UJJA 1YA0A 2FULA 4BX8A 4BSXA 4YVOA 2GRPB 4O1OA 3FTWA 1RW2A 4N2QA 5AQ7A 2WM9A 2XPZA 3NAWA 4GA1A 5ANRA 4GZDA 3DSUA 2JEKA 1WY6A 3ZXPA 1LTXA 4O60A 1N4SA 4L2YA 3MCXA 5ARFA 4CDRA 3CGHA 4B0ZA 3JYSA 3CEQA 3FULA 3AG3E 3DPDA 4Z68A 3QB2A 4L23A 3E30A 5FQ4A 3LJ3A 3CVUA 2LXMA 3OAWA 3DEPA 1HZ4A 2J4BA 2X6KA 4LSZE 4F3VA 1DCEA 4U0UA 5CBOA 2XEHA 2P58C 2QZAA 4FJZA 2PQNA 1E90A 3HHMA 5EX3A 3CHSA 1N94A 4YDOA 4YNDA 3N71A 1OWMA 4YVQC 4C9BB 2I6HA 3L22A 2DCPA 3KS2A 4N3CA 4MBGA 3FUKA 3HXBA 3B7TA 3K9IA 4XX5A 3FDHA 3SF4A 4DI4A 2L0IA 3ZUVB 4V3IA 2OEVA 3FTXA 3NOGD 4UWGA 3ZVVA 1N52A 4X8QA 3RRUA 4A1SA 2ONDA 4JEUA 4LERA 4ATGA 3F6QA 5AIJA 3D3MA 3LJNA 4J6IA 4I1AA 3JUIA 4OAUC 2QFCA 4JZYA 4LEUA 1K1BA 5CERB 1SA5A 4NQ0A 4C48B 4URKA 4G11A 3LPZA 4F1SA 4UQYA 4APOA 3PEVB 3FP3A 5KJLA 3URZA 2LNIA 4RSYA 3FWVA 3DPYA 3I4GA 3Q7FA 4G23A 1KT0A 4GTOA 4UWHA 4E85A 3AG4E 2AJAA 3GZ2A 2E2EA 4TUMA 1MZCA 3UIPC 2X3MA 1HH8A 3TL5A 3FTUA 3CVNA 4N3BA 1OXJA 3RIBA 2IQCA 5T8IA 3UT7A 4I2WA 2IF4A 1UW4B 1MX2A 3LCAA 3OTNA 3ENEA 5EYPF 1X81A 2LAIA 2BEDA 1JWFA 2IOSA 1S63A 4ACKA 2R03A 4HOSA 3Q75A 3AS8A 2MOWA 2XCCA 1B89A 4GAAA 1AWCB 4H7XA 4MS6A 3P1UA 5FQ6A 1FVHA 2M63A 3MGBA 4G1TA 4UI9J 5B1AE 5EX0A 3DXMG 3ZN3A 3ASNE 1MX6A 1OWNA 4U8YD 4GZ5A 4KZCA 4AOFA 4BY6A 4GPKA 3Q49B 3AU5A 1IKND 2H6FA 4K0RA 4PH4B 5EIDA 3D9PA 2ZISA 1HO8A 3APCA 4ME2A 2KXPC 3TWTA 4QFVA 1NI1A 2F0YA 3CVXA 4JA7A 3RU0A 3CVWA 2NC9A 3L17A 1BD8A 1E8YA 5KNGA 4B93B 3E4BA 4G25A 3PNLB 3PREA 2JABA 5LCWC 3G2WA 4L7TA 2R17C 2WQ6A 3CK8A 2UWJG 3TWWA 4HVBA 3FU0A 2KCVA 2PL2A 2ETAA 3PZDA 3Q79A 3TWQA 5ENPD 2XEEA 3EHNA 5BV1A 2WQHA 2IONA 4UQZA 4KXKB 4N39A 3R9MA 4OVVA 1OUVA 1EDUA 2WMNA 3UUXA 5KWDA 2LUHA 1KLXA 3ML8A 2V0PA 4JA9A 4KT6B 3UM0A 4I6EA 3FUFA 3SHFA 1FCHA 3RJVA 5KCMA 4A55A 2BKGA 1E8WA 2WXMA 3VTXA 2I1KA 4BX9A 4CCAA 4J8SA 5HKPA 3UIOC 2P9UG 4ABNA 5HI7A 3T5XA 2LAHA 4YDYA 5JJTA 2ZIRA 5H7PA 1S70B 3RRNB 5EIBE 3FHEA 2RKKA 4HRMB 2ZGDA 5AQAA 2WXGA 4UWLA 1IHBA 4BFRA 4UI9K 3HG0D 1MJ0A 5CBNA 2AW6A 3AU4A 4PS3A 2H6IA 5LP0A 3I4RB 4N2SA 5G04J 4RLYA 3MV2B 5G2NA 4J8EA 4J8FA 4JW1A 3ULQA 5FINA 3QK0A 3LDZA 2B0OE 3CVLA 4DK5A 4A3TA 1Z3YA 4P29A 1BI8B 1NL4A 5AYWD 2X6IA 4HOUA 4TRQA 4A3VA 3U3WA 3ISMC 1FT2A 2XGOA 2HYZA 1D9SA 3PVLA 1IHGA 3CHMA 3B7UX 5EDSA 1QNFA 3FUIA 2Y1LE 2P9LG 4AIFA 2FO1E 3C72A 1WM5A 5JJ7A 1MX4A 1D8DA 3C3RA 3NF1A 1OCRE 3L08A 5B1BE 2OCCE 5G05C 2XENA 4U96D 4GZ6A 4JL0A 3CVPA 3HDXA 3DXKG 1Y6IA 1ZU2A 1AP7A 3ZU7B 5KNHD 1Z5SC 4NIKA 1TNUA 4BETA 1UN9A 3HXCA 3V2OA 3G2TA 3TG4A 3L82A 4RQIA 4HLEA 2KC7A 3D9MA 4IRUA 1O1TA 2C0MA 3D9IA 2WPVA 1YYHA 2X6FA 4EPZA 1XGWA 4IN3B 4KMOA 3BQOA 4AM9A 3FUMA 3QWPA 1JCRA 5C1DA 2XS8A 3ZGQA 2IJGX 4U0ZA 4GU5A 2IFUA 4GTPA 5A23A 5FWQA 1N11A 3MKRA 4U8VD 2V4LA 3R7RA 2IO3C 2J09A 4U8HA 3CR3A 3G2VA 4C0EA 1TNBA 3KAEA 1EPUA 2WXNA 3CHRA 2IO2C 4BERA 2FBNA 3FUEA 3MYVA 5EKQD 3OXFA 4UQXA 4HRNA 5FZQA 1OWOA 2DZNA 2VSNA 4I9CA 4J7WA 1S64A 4K5BA 3APDA 4OYSA 4CGVA 2YHEA 3E37A 3PZ3A 3PUKA 2VYIA 1E8XA 4GTRA 4KYOB 1TNZA 4DX6D 4BT8A 3NBNB 1OCOE 5JA4D 5KBAA 3RO2A 3FTVA 2P9PG 5AN8A 5BT1A 2DVWA 2VSOE 3ONKA 2L6BA 3ZKJA 1FVFA 4AY6A 5IY5E 2A5EA 4N5QA 3Q7AA 2GGFA 1H6KA 2UY1B 2LO6A 2BTDA 3DRAA 2PZIA 4B8AA 1XNFA 3D9JA 3BUAA 4PS8A 2IOLA 2DZOA 2EIME 4HB5A 2QY7A 4AP2A 5B3SE 1G3NB 4CRWA 1JCSA 4DUIA 4GCNA 4DJAA 3DSWA 2Y4TA 1N4RA 2GW1A 5A7DB 3NZUA 2BF0X 5EILA 3TG5A 2XHEA 3MV3B 3L9TA 1K8KG 4NACA 3NB2A 1EYHA 3EDTB 4I17A 2NSZA 2I2OA 3MZLB 3TWSA 5FQ7A 4K03A 5A6CA 3GZ1A 1N4QA 2RFAA
chains in the Genus database with same CATH topology
4AEZC 4GYOA 5E75A 1NA0A 2WXPA 3LS8A 4B94A 4MS6A 3P1UA 4EZJA 2R5SA 4AV7A 4E6HA 3HYMB 2XGMA 1FVHA 4WNGA 5FQ6A 2VQ2A 5D0QD 4I6GA 4FLHA 4G26A 4AXHA 4DLQA 2VGYA 2M63A 3FH7A 3FUJA 3MGBA 4U07A 4TV3A 4G1TA 4APFA 3FUHA 4FC8A 4B8CB 4UI9J 4BTBA 3QJZA 3PNTB 4GZCA 5EX0A 1E96B 4J0UA 3ZN3A 3QDNA 3QKYA 3R9AB 1UN8A 1OWNA 4UI9C 4GZ5A 1ELWA 4KZCA 3FTSA 3IKOB 4AOFA 1TEZA 4BY6A 3CV0A 4GCOA 2BUGA 5E76A 4MLPA 3VLFA 1H2UA 3LY8A 1HF8A 1HXIA 3FH8A 4GPKA 1U3DA 2GRMA 3Q49B 3MKQB 3AU5A 4FU3A 4M3OA 1NP7A 2AXUA 2CHXA 4K0RA 3D9PA 4PH4B 2J08A 5KJNA 4CDRA 1HO8A 3CHQA 3EJNA 3APCA 4DLOA 5DBKA 4ME2A 4JHKA 3CKBA 4GB9A 4KVOA 5CMYA 3S7DA 3UT8A 4QFVA 2MHKA 3IEGA 2FO7A 1Y8MA 3QWVA 4R7LA 4D10C 3CVXA 4U0SA 4I43A 5BUZA 4JA7A 5FTPA 5G05J 4F53A 5JJ6A 2XRYA 1ELKA 3RU0A 3CVWA 2CHWA 2NC9A 3L17A 1IQRA 1SQMA 2JLBA 4BTAA 3FUNA 1E8YA 3E4BA 4G25A 3PNLB 3PREA 5LCWC 3G2WA 1HX8A 4GYWA 2R17C 4JEHA 3APFA 4L7TA 5BPPA 5KJMA 2AWIA 2WQ6A 3CK8A 1UG3A 2UWJG 3U4TA 3VLEA 4HVBA 2VTBB 3UPVA 2WXJA 1SZAA 2WXOA 3FU0A 4PDXA 1UJKA 2PQRA 2KCVA 2PL2A 2WXKA 3L54A 3CIAA 4MKTA 3IBEA 3PZDA 3VLDA 1PAQA 2R59A 2AVPA 3WXXA 4WNDA 1E7VA 3EHNA 3SNXA 3ZFWA 5BV1A 2WQHA 2IONA 1LF8A 4DPRA 2WB2A 4UQZA 3CLJA 3S2AA 4KXKB 4N39A 2J07A 4OVVA 1OUVA 1EDUA 1MHQA 4PS7A 4FADA 5FJYA 1HS6A 2WMNA 4CT0A 2X38A 1MQSA 4GA0A 5CCLA 3UUXA 4MRUA 4HOTA 2OV8A 3LEWA 1KLXA 4ILIA 2XRZA 2J9QA 2V0PA 2L6JA 3ML8A 4I6JA 5FZRA 4HFGA 4XKBA 4JA9A 3B13A 4KT6B 4CDMA 4I6EA 4XI9A 3PEUB 3SZ7A 3PE3A 3FUFA 4LUNU 3RRMB 3SHFA 1FCHA 3RJVA 5KCMA 4A55A 5JHBA 1E8WA 2WXMA 2DBAA 3VTXA 4EQFA 2I1KA 4WAFA 2PM7A 3RKVA 4BX9A 4CCAA 4CDNA 4GZ3A 4J8SA 4NURA 2VSXE 3KD7A 1S0PA 4BWRA 1JUQA 4FJYA 2YQ8A 4EECA 2X6JA 5LFAA 3SD5A 4ABNA 4CGWA 1PY1A 2WXHA 5HI7A 4ANWA 4J8DA 2XQ0A 3IHYA 5G55A 3R7QA 5BV0A 3T5XA 2LAHA 3QC1A 4AY5A 5JJTA 3I5PA 3EHMA 3MKQA 5ARGA 3QWWA 3C98A 3RO3A 3RRNB 5FT9A 3JCKC 3FHEA 3Q15A 2L9BA 4C0MA 1JWGA 3SI5A 4G2VA 4N3AA 5D0OD 3ZHEA 4LCTA 3Q4AB 4EZKA 5AJDA 2WXGA 4UWLA 2VGXA 4N5CA 5KJKA 4BFRA 5CMWA 5AENA 1NZNA 2I9CA 4UI9K 2C2LA 3JQ0A 3ZEFA 3TXNA 3ZRHA 2AW6A 1W3BA 1H2VC 3U64A 3ESKA 3QNKA 3P2BA 3AU4A 3I3NA 4PS3A 1HU3A 5LP0A 3I4RB 4N2SA 2WXLA 4GYYA 4WWNA 5G04J 2LSVA 3MV2B 2KZTB 4I1MA 2WVIA 4J8EA 4I2ZA 5G2NA 3ZW3A 4J8FA 3GW4A 2DIWA 3PRZA 3D9KA 4JW1A 2OOEA 4FHJA 5G04C 3ULQA 2L0TB 3QK0A 3TAXA 3LDZA 3CVLA 3SFZA 3FU5A 4DK5A 4A3TA 1HE8A 4EZLA 4OVUA 3T5VA 1Z3YA 4P29A 4RG6A 3FU3A 5AYWD 3G2UA 2CHZA 4ILGA 2NXPA 3S7JA 2X6IA 4HOUA 4TRQA 4CEMA 5CCMA 3UT4A 4UWFA 4G24A 5HQ8A 4A3VA 3FU6A 4XI0A 3U3WA 4KBQA 1U3CA 2XGOA 3ASHA 3ASFA 2HYZA 3T8MA 5M72A 3PVLA 1KT1A 4WWPA 3QOUA 1IHGA 3CHMA 5ANLA 3B7UX 5EDSA 1QNFA 1GW6A 2RD0A 4WNFA 3FUIA 2KCKA 4AIFA 4RVBA 4I1OB 3ZYLA 1X5BA 4JXTA 3MEKA 1VDYA 5JHAA 4BT9A 3ZIMA 4O6FA 1WM5A 5C2YA 1INZA 5JJ7A 2XPIA 3KEZA 4CT4A 4JHJA 4WNEA 3NF1A 4PUCA 1N54A 3PE4A 3AS5A 3L08A 2YHCA 1E7UA 4Q69A 3FY4A 5AJLA 4WUYA 2YINA 2VSYA 1HFAA 1UJJA 2AXZA 1YA0A 2FULA 3CHPA 5G05C 4BX8A 4BSXA 2WXRA 3LVRE 3U9WA 4GZ6A 2OVFA 4FA6A 3O48A 1NA3A 4JL0A 3CVPA 3HDXA 4YVOA 1Y6IA 1ZU2A 3FTWA 2CFUA 3SGHA 3SBSA 3OXGA 3PDNA 4H7YA 4N2QA 3LY9A 2WM9A 2XPZA 3PH0C 3ZYQA 1UN9A 4GA1A 5ANRA 4GZDA 2C0LA 3EIQC 2JEKA 3CK9A 5DIZA 1H2TC 2KCLA 3MA5A 3G2TA 1WY6A 5FQ8A 3TG4A 1OWPA 4DI3A 3L6AA 4HLEA 4IYPA 2KC7A 3D9MA 4L2YA 1HG5A 3CK7A 2WMOA 3MCXA 3ML9A 4IRUA 3O4ZA 2VJ8A 3L16A 5ARFA 2C0MA 2E0IA 2FI7A 3B7RL 2CFZA 3CGHA 3PS6A 3D9IA 3CSFA 3JYSA 4B0ZA 3CEQA 1ZBPA 1IQUA 2WPVA 2X6FA 4EPZA 3FULA 1XGWA 3DPDA 1DNPA 4GMJA 2KZTA 3FFLA 4IN3B 3QB2A 3TJPA 4KMOA 5BNWA 4L23A 3S7BA 4AJWA 2V5FA 4GA2A 4HOQA 4LRZA 4AM9A 3FUMA 3QWPA 5C1DA 5FQ4A 3LJ3A 3CVUA 3ZGQA 2IJGX 2UY1A 4HORA 1DVPA 3OAWA 4XIFA 3GYZA 4GU5A 4U0ZA 1HZ4A 4Q96A 2J4BA 2X6KA 5T4YA 2IFUA 4FHKA 5A23A 3IHVA 5FWQA 3MX3A 4F3VA 1QQEA 3ESLA 3HVEA 4KZ0A 3MKRA 4U0UA 2V4LA 3EIJA 1L5JA 3R7RA 4A1GA 3QARA 2P58C 4FLBA 1WAO1 2AXVA 2J09A 2PQNA 4FJZA 1E90A 3HHMA 4U8HA 4XZ4A 3CR3A 5EX3A 3CHSA 3G2VA 4C0EA 3N71A 5CHEE 3KAEA 2HR2A 4YNDA 1OWMA 1BPOA 2PM6A 1EPUA 2RG8A 5ENNA 4ANXA 4YVQC 2WXNA 3CHRA 4AVXA 3VTYA 4WWOA 4C9BB 5J90A 2FEZA 2FBNA 2I6HA 3FUEA 2DCPA 3L22A 3KS2A 4HS2A 1EF1C 3MYVA 4N3CA 4U04A 4HXIA 5EKQD 3OXFA 3FUKA 3B7TA 3K9IA 4XX5A 3D9LA 4UQXA 3FDHA 2Y4UA 1H0AA 4Y6CA 1OWOA 2VSNA 3LYAA 5FZQA 3SF4A 4I9CA 2L0IA 4DI4A 3NQPA 5LX8A 4V3IA 3APDA 4UWKA 2A5UA 4OYSA 2MRIA 3ZYKA 3FTXA 4ILHB 1SZ9A 2XGSA 3GZSA 4JVSA 4UWGA 3ZVVA 4XKCA 1N52A 4CGVA 2ILRA 3LY7A 1TJFA 3FH5A 3RRUA 4I9EA 4JHRA 2YHEA 1QZ2A 2YNQA 4U63A 3Q5MA 3B7SA 4JPSA 4A1SA 2I1JA 2ONDA 4JEUA 2ZU6B 4LERA 1P5QA 3ONLA 4ATGA 3PUKA 4W9RA 1PC2A 2VYIA 1E8XA 5LOZA 5LCWJ 4KYOB 3LKUA 1ELRA 2WXQA 5AIJA 4F7AA 3CQCB 3ZHEB 3D3MA 4J6IA 2HM8A 2KATA 4I1AA 4ANUA 4BT8A 4FP7A 4GMLA 2Q7FA 3JUIA 3RO2A 3HIZA 3FTVA 4EBAG 2QFCA 4JZYA 5BT1A 4LEUA 3D9OA 1H19A 2VSOE 3ONKA 3IV0A 1JPLA 3U66A 2XCBA 3FEYA 4JC8A 1FVFA 4IULA 3ZYMA 4AY6A 3PUJA 2A4ZA 4NQ0A 3CHOA 4URKA 4EBAA 3AS4A 3CSTA 3FEXA 4G11A 3LPZA 3Q47B 3LVQE 4UQYA 4F1SA 3UX4A 3PEVB 4APOA 3FP3A 2LSUA 3ASDA 3LXUX 2GGFA 5KJLA 1H6KA 2V8SE 2UY1B 4FULA 3URZA 2LO6A 2BTDA 2LNIA 2J4DA 2PZIA 3UMVA 4B8AA 4RG9A 1XNFA 2VGXB 3JQ1A 4RSYA 3BEEA 3S7FA 3D9JA 3ASGA 2CG2A 3D9NA 3FWVA 3I4GA 4G23A 4PS8A 3HVEB 1KT0A 2IOLA 4ANVA 3SBTB 2WXIA 2XPYA 4UWHA 5BW8C 4E85A 2QY7A 4AP2A 3DBSA 3CVQA 3GZ2A 2E2EA 3OXLA 4CRWA 3RK6A 1OWLA 1Z3XA 1Z6TA 3G2SA 4GCNA 4DJAA 1A17A 3CKCA 3FTZA 3UQ3A 2X3MA 3BG1B 3BG0B 1HH8A 3TL5A 2EQXA 1TJCA 3FTUA 3CVNA 4N3BA 2Y4TA 3NZSA 3RIBA 3ZXSA 2GW1A 1IYGA 5A7DB 3NZUA 3TXMA 2IQCA 2BF0X 4XE0A 2X6HA 3CQGB 3MJWA 5T8IA 3UT7A 4I2WA 3TGOA 1HG2A 2CG3A 2WXFA 2IF4A 2GRLA 3TG5A 1UW4B 4NRHB 2XHEA 3LCAA 3MV3B 3OTNA 4TUUA 3CVVA 3QAQA 4NACA 4B89A 1EYHA 3EDTB 3L13A 2KM4A 2Y3AA 3ENEA 2LAIA 4Y6WA 1JWFA 2IOSA 2OVBA 4KVMA 2J49A 4I17A 2NSZA 5T3RA 4L2LA 3FUDA 4ACKA 3ZPJA 2I2OA 4HOSA 3MZLB 4Q94A 2WQ7A 2IU1A 3AS8A 5J08A 2MOWA 2XCCA 4L1BA 1B89A 2XEVA 2FF4A 5FZSA 5FQ7A 2HO1A 4GAAA 2VTBA 3FTYA 4H7XA 1E8ZA 4K03A 5A6CA 3GZ1A 4ACLA 3CVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5M A;  4GYO A;  4A1S A;  1NA0 A;  1YA0 A;  4EQF A;  3RKV A;  4B94 A;  2OND A;  1P5Q A;  3WXX A;  4GZ6 A;  2R5S A;  4GZ3 A;  3O48 A;  1NA3 A;  3HYM B;  2XGM A;  1PC2 A;  2VYI A;  3CVP A;  2VQ2 A;  3KD7 A;  1ZU2 A;  4JL0 A;  4G26 A;  4WNG A;  5D0Q D;  2VGY A;  2YQ8 A;  4KYO B;  3LKU A;  3OXG A;  3PDN A;  4H7Y A;  1ELR A;  4U07 A;  4N2Q A;  3LY9 A;  4G1T A;  4UI9 J;  3ZHE B;  4BTB A;  4ABN A;  2KAT A;  4I1A A;  4BT8 A;  4CGW A;  4GA1 A;  5EX0 A;  5HI7 A;  1E96 B;  2Q7F A;  4J8D A;  4J0U A;  3RO2 A;  3ZN3 A;  3QDN A;  2C0L A;  3QKY A;  3CK9 A;  5DIZ A;  2KCL A;  3MA5 A;  3R9A B;  4AY5 A;  2QFC A;  4GZ5 A;  1ELW A;  4LEU A;  4UI9 C;  5BT1 A;  5JJT A;  5ARG A;  3CV0 A;  3QWW A;  3TG4 A;  3RO3 A;  4GCO A;  2BUG A;  3LY8 A;  5FT9 A;  2XCB A;  1HXI A;  3Q15 A;  2KC7 A;  4GPK A;  3Q49 B;  3CK7 A;  4G2V A;  4N3A A;  5D0O D;  2DBA A;  3ZHE A;  4AY6 A;  3Q4A B;  4NQ0 A;  5ARF A;  2C0M A;  2FI7 A;  4CDR A;  2VGX A;  4N5C A;  3AS4 A;  3JYS A;  3CEQ A;  5KJN A;  5KJK A;  1ZBP A;  2WPV A;  3LPZ A;  3Q47 B;  4UQY A;  5DBK A;  1NZN A;  4ME2 A;  4UI9 K;  4APO A;  2C2L A;  3CKB A;  3FP3 A;  2LSU A;  3S7D A;  1W3B A;  3FFL A;  4IN3 B;  3ASD A;  2MHK A;  3IEG A;  5LCW C;  5KJL A;  2FO7 A;  1Y8M A;  3ESK A;  3QWV A;  3S7B A;  3VTX A;  5BNW A;  2UY1 B;  4U0S A;  3ULQ A;  3URZ A;  4JA7 A;  2LNI A;  5FTP A;  2V5F A;  4GA2 A;  4GYY A;  4HOQ A;  5G04 J;  5G05 J;  2LSV A;  3QWP A;  5JJ6 A;  2PZI A;  3MV2 B;  4J8E A;  3RU0 A;  2NC9 A;  4I2Z A;  5C1D A;  5LCW J;  4RG9 A;  2JLB A;  1XNF A;  4BTA A;  2VGX B;  4J8F A;  3ZGQ A;  3GW4 A;  3BEE A;  2UY1 A;  3E4B A;  4G25 A;  3S7F A;  4HOR A;  3ASG A;  4XIF A;  3FWV A;  2OOE A;  4G23 A;  3GYZ A;  4U0Z A;  5G04 C;  1HZ4 A;  4GYW A;  1KT0 A;  3TAX A;  5KJM A;  4N2S A;  2IFU A;  5BW8 C;  3CK8 A;  3CVL A;  2UWJ G;  3CVQ A;  2E2E A;  3GZ2 A;  3OXL A;  3U4T A;  4F3V A;  1QQE A;  3UPV A;  3MKR A;  4U0U A;  4RG6 A;  2PQR A;  2KCV A;  2PL2 A;  4GCN A;  4YVO A;  1A17 A;  5AYW D;  3CKC A;  3UQ3 A;  3S7J A;  4AM9 A;  1HH8 A;  4HOU A;  2P58 C;  5CCM A;  1TJC A;  2AVP A;  1WAO 1;  3CVN A;  4N3B A;  2Y4T A;  4G24 A;  4WND A;  2PQN A;  3RIB A;  5HQ8 A;  4XI0 A;  3U3W A;  4KBQ A;  5EX3 A;  2GW1 A;  3ZFW A;  1IYG A;  3N71 A;  5CHE E;  3KAE A;  2HR2 A;  4YND A;  2WQH A;  2XGO A;  3ASF A;  3ASH A;  5A7D B;  2HYZ A;  4UQZ A;  4YVQ C;  3TGO A;  4KXK B;  3VTY A;  5M72 A;  4I2W A;  1KT1 A;  3QOU A;  4N39 A;  3TG5 A;  2FEZ A;  2I6H A;  2IF4 A;  1IHG A;  2FBN A;  4NRH B;  1OUV A;  3KS2 A;  4N3C A;  4WNF A;  4U04 A;  3LCA A;  3MV3 B;  2KCK A;  3OXF A;  5EKQ D;  5FJY A;  4GA0 A;  5CCL A;  3K9I A;  4AIF A;  4UQX A;  3EDT B;  3UUX A;  3SF4 A;  2Y4U A;  4Y6C A;  5FZQ A;  3LYA A;  2VSN A;  4Y6W A;  4HOT A;  4I9C A;  3MEK A;  1KLX A;  4I17 A;  4BT9 A;  2J9Q A;  2L6J A;  4O6F A;  5FZR A;  1WM5 A;  3ZPJ A;  4JA9 A;  4HOS A;  5JJ7 A;  2XPI A;  3AS8 A;  5G05 C;  4XI9 A;  2XCC A;  2XGS A;  3SZ7 A;  1B89 A;  2XEV A;  3PE3 A;  2FF4 A;  4WNE A;  5FZS A;  3NF1 A;  3PE4 A;  2HO1 A;  1FCH A;  3AS5 A;  3RJV A;  4W9R A;  4CGV A;  2YHC A;  3LY7 A;  4H7X A;  4BWR A;  4I9E A;  4JHR A;  5A6C A;  3GZ1 A;  1QZ2 A;  4WUY A;  2VSY A; 
#chains in the Genus database with same CATH topology
 4GYO A;  4B94 A;  4EZJ A;  5ENO D;  4HLL A;  2XGM A;  4WNG A;  4FLH A;  4G26 A;  4DLQ A;  3FH7 A;  4TV3 A;  3DSV A;  4U07 A;  4B8C B;  3FUH A;  4BTB A;  5EYL A;  3UM3 A;  3PNT B;  3EHR A;  4U7E B;  1E96 B;  4J0U A;  1TNO A;  3Q9U C;  2IY0 C;  3RAU A;  3CV0 A;  4GCO A;  2BUG A;  2P9K G;  2GRM A;  2R05 A;  2AXU A;  2CHX A;  3DST A;  5KJN A;  1O1R A;  3KSL A;  4DLO A;  3EJN A;  4JHK A;  5CMY A;  1TN6 A;  2EIJ E;  3IEG A;  3QWV A;  1Y8M A;  5G05 J;  5JJ6 A;  1SQM A;  2JLB A;  3FUN A;  3BU8 A;  1HX8 A;  3APF A;  3DEO A;  5ENS D;  3UPV A;  1TYQ G;  4PDX A;  1SZA A;  4ATZ D;  1UJK A;  2PQR A;  4MKT A;  3IBE A;  4HNA D;  3VLD A;  1A5E A;  2AVP A;  1E7V A;  2XZT G;  3SNX A;  3ZFW A;  4DPR A;  3S2A A;  2J07 A;  4FAD A;  2X38 A;  1MQS A;  2V4H C;  4XEI G;  4UUC A;  3W9F A;  2J9Q A;  2L6J A;  4XI9 A;  3PEU B;  3SZ7 A;  3PE3 A;  3RRM B;  1BU9 A;  4OAV B;  3Q73 A;  4EQF A;  2F8Y A;  4CDN A;  4GZ3 A;  2QYU A;  3E32 A;  4NUR A;  1S0P A;  4FJY A;  2YQ8 A;  4EEC A;  3V30 A;  3SD5 A;  4CGW A;  1PY1 A;  4GMR A;  4ANW A;  4J8D A;  5G55 A;  3AG2 E;  3EHM A;  5ARG A;  5CED B;  3JCK C;  1JWG A;  2DWZ A;  4G2V A;  4EZK A;  2VGX A;  2BKK B;  3TXN A;  1W3B A;  3U64 A;  1FT1 A;  3I3N A;  4GYY A;  4WWN A;  2KZT B;  4I1M A;  2WVI A;  1IXV A;  4FHJ A;  2L0T B;  3TAX A;  2GRQ B;  1N4P A;  4CZ2 D;  1HE8 A;  4RG6 A;  3FU3 A;  2CHZ A;  3T8K A;  2NXP A;  3S7J A;  5CCM A;  3UT4 A;  3UI2 A;  4KBQ A;  1U3C A;  3T8M A;  1KT1 A;  1GW6 A;  4WNF A;  2KCK A;  4K5A B;  4TXQ A;  2ETB A;  5C2Y A;  2XPI A;  3UXG A;  3JUE A;  4WNE A;  1N54 A;  1SW6 A;  4Q69 A;  5BXU A;  1HFA A;  2AXZ A;  2WXR A;  3LVR E;  2OVF A;  1NA3 A;  2CFU A;  3PDN A;  3LY9 A;  2C0L A;  1YMP A;  1OWP A;  4IYP A;  5HRY A;  1HG5 A;  3CK7 A;  3O4Z A;  2VJ8 A;  3L16 A;  2FI7 A;  3B7R L;  3PS6 A;  2CFZ A;  3CSF A;  1BLX B;  1ZBP A;  4DX1 A;  3TJP A;  2EIK E;  1V54 E;  4AJW A;  2V5F A;  4HOQ A;  3SFX A;  3HXE A;  2UY1 A;  2ZGG A;  4DX2 A;  1H6O A;  4HOR A;  1DVP A;  4LG6 A;  4Q96 A;  1QQE A;  3ESL A;  4KZ0 A;  1DCQ A;  4A1G A;  3QAR A;  1JCQ A;  4K5C A;  2AXV A;  4XZ4 A;  4F6R D;  2HR2 A;  2PM6 A;  4WWO A;  4YDE A;  3EUV A;  2FEZ A;  4U04 A;  3D9L A;  4Y6C A;  1H0A A;  5LX8 A;  4HI8 A;  2A5U A;  4QQI A;  2MRI A;  3ZYK A;  1SZ9 A;  2XGS A;  3GZS A;  4JVS A;  2ILR A;  3LY7 A;  3EU5 A;  4I9E A;  4L9P A;  3B7S A;  4JPS A;  2I1J A;  2ZU6 B;  5LOZ A;  5LCW J;  2EIL E;  2XZD G;  3ZNG A;  1ELR A;  2WXQ A;  4F7A A;  3CQC B;  3ZHE B;  2HM8 A;  4GML A;  3HXD A;  4EBA G;  3IV0 A;  3ULY A;  1JPL A;  1OT8 A;  1N95 A;  2XCB A;  4JC8 A;  2GRR B;  4IUL A;  5AQ9 A;  3CHO A;  4EBA A;  3CST A;  3LVQ E;  4A63 B;  4DX5 D;  2LSU A;  3LXU X;  1O5M A;  4FUL A;  1TR4 A;  2J4D A;  3UMV A;  4RG9 A;  3JQ1 A;  3D9N A;  3HVE B;  4ANV A;  2WXI A;  2XPY A;  3AAA C;  3DBS A;  3RK6 A;  1Z3X A;  3TWV A;  3J5Q B;  1A17 A;  3FTZ A;  3UQ3 A;  2EQX A;  1TJC A;  2R2L A;  4HQD A;  2X6H A;  3TGO A;  3MJW A;  3ASO E;  2P9S G;  2CG3 A;  4NRH B;  3QAQ A;  4B89 A;  1UOH A;  2Y3A A;  4Y6W A;  2J49 A;  5T3R A;  2MYO A;  4L2L A;  3V79 K;  2WQ7 A;  2XEV A;  2FF4 A;  5FZS A;  2VTB A;  3PZ4 A;  3NOC D;  1E8Z A;  4ACL A;  3CVY A;  4AEZ C;  5E75 A;  2WXP A;  3LS8 A;  4TXP A;  4DX7 D;  1H6P A;  4AV7 A;  4E6H A;  3HYM B;  4I6G A;  1KZP A;  2VGY A;  4APF A;  4FC8 A;  3QJZ A;  2H6H A;  1ZB1 A;  2B6C A;  3T9K A;  1V55 E;  1UN8 A;  2XS1 A;  4UI9 C;  3IKO B;  2EIN E;  3VLF A;  4MLP A;  1HF8 A;  3UKR G;  3MKQ B;  1NP7 A;  3B95 A;  3CHQ A;  4GTV A;  5DBK A;  3UKU G;  2MHK A;  1OCZ E;  2FO7 A;  4U0S A;  2XRY A;  2CHW A;  4BEP A;  5JMN D;  3TWX A;  5AAR A;  5KJM A;  4U95 D;  2AWI A;  2KBX A;  4G8L A;  1UG3 A;  4F1P A;  2VTB B;  2WXJ A;  2WXO A;  3L54 A;  2WXK A;  4WND A;  3W9G A;  1LF8 A;  2DYS E;  5D66 A;  5FJY A;  1HS6 A;  5CCL A;  2Y69 E;  4CYM D;  5ENT D;  4HFG A;  4CDM A;  2Y0B G;  4LUN U;  4TXR A;  4WAF A;  2PM7 A;  3RKV A;  4BES A;  4JB8 P;  4BWR A;  3V2X A;  2X6J A;  5LFA A;  4GTS A;  2XQ0 A;  5BV0 A;  3QC1 A;  1TN8 A;  3I5P A;  3QWW A;  3C98 A;  3RO3 A;  2L9B A;  3SQV A;  4N3A A;  4LCT A;  3Q4A B;  5AJD A;  4N5C A;  1WG0 A;  5CMW A;  2I9C A;  3ZEF A;  4HRL A;  1H2V C;  4DRX E;  3ESK A;  3QNK A;  3P2B A;  2WXL A;  1N0Q A;  5CRV A;  4LNU D;  3GW4 A;  2DIW A;  4HI9 A;  3D9K A;  5HS0 A;  2OOE A;  4ZHB A;  3FU5 A;  4OVU A;  3T5V A;  3KSQ A;  4CEM A;  2F8X K;  3FU6 A;  3ASF A;  3ASH A;  5M72 A;  3QOU A;  5ANL A;  2RD0 A;  3HXF A;  1X5B A;  3WG7 E;  4JXT A;  1O1S A;  3MEK A;  1VDY A;  5BXO A;  5JHA A;  4O1P A;  3KEZ A;  4CT4 A;  2HE0 A;  3SY2 A;  4PUC A;  3PE4 A;  2YHC A;  1E7U A;  4LNG A;  5AJL A;  2YIN A;  2VSY A;  3CHP A;  3U9W A;  4FA6 A;  3O48 A;  4GTT A;  4EHM A;  3SGH A;  3SBS A;  3OXG A;  4H7Y A;  2VGE A;  3PH0 C;  3ZYQ A;  2NYJ A;  3EIQ C;  3CK9 A;  5DIZ A;  1H2T C;  2KCL A;  3MA5 A;  5FQ8 A;  4DI3 A;  3L6A A;  1QBQ A;  1K1A A;  3JXJ A;  3ML9 A;  2WMO A;  3C5R A;  4GTQ A;  3Q9N C;  1TEZ A;  2E0I A;  3Q78 A;  1IQU A;  2IEJ A;  2QYJ A;  1DNP A;  4GMJ A;  2KZT A;  3DWL G;  3FFL A;  5BNW A;  3S7B A;  4GA2 A;  4LRZ A;  3AJI A;  3ABM E;  4XIF A;  2ZXW E;  3J5P A;  3GYZ A;  5ENQ D;  1MYO A;  5T4Y A;  1SVX A;  4FHK A;  3IHV A;  3UM1 A;  3AG1 E;  3MX3 A;  1N0R A;  3HVE A;  3EIJ A;  1L5J A;  3JXI A;  4FLB A;  1WAO 1;  2R02 A;  3DSX A;  5CHE E;  3EU9 A;  1BPO A;  2RG8 A;  4ANX A;  5ENN A;  4AVX A;  3VTY A;  3IXE A;  5J90 A;  4HS2 A;  1EF1 C;  1N9A A;  4HXI A;  3UM2 A;  1D8E A;  2Y4U A;  1RZ4 A;  3LYA A;  3NQP A;  3EHQ A;  4UWK A;  4LNB A;  4ILH B;  3SFY A;  4XKC A;  1TJF A;  3FH5 A;  1KPS B;  4JHR A;  2GRN B;  1TNY A;  1QZ2 A;  2YNQ A;  4U63 A;  3Q5M A;  1P5Q A;  3ONL A;  4W9R A;  1PC2 A;  3LKU A;  2V5Q C;  2RFM A;  2KAT A;  4ANU A;  4FP7 A;  2Q7F A;  3HIZ A;  3D9O A;  1H19 A;  3U66 A;  3FEY A;  2PNN A;  5ENR D;  3ZYM A;  3PUJ A;  2A4Z A;  1KZO A;  3ABK E;  3PZ1 A;  3AS4 A;  3FEX A;  3Q47 B;  3UX4 A;  5ITZ F;  2F37 A;  3ASD A;  2V8S E;  1U2V G;  2VGX B;  3BEE A;  3HRA A;  3S7F A;  3ASG A;  2CG2 A;  3SBT B;  5BW8 C;  5FIO A;  3CVQ A;  3OXL A;  2GRO B;  1OWL A;  1YCS B;  1Z6T A;  3G2S A;  3CKC A;  3BG1 B;  3BG0 B;  3NZS A;  3ZXS A;  1IYG A;  3TXM A;  4XE0 A;  3CQG B;  1FPP A;  3UTM A;  1HG2 A;  2WXF A;  2GRL A;  4J8Y A;  4TUU A;  1SA4 A;  3CVV A;  3L13 A;  2KM4 A;  2ETC A;  5CEC B;  2OVB A;  4KVM A;  1Q2Z A;  3FUD A;  3ZPJ A;  4Q94 A;  2IU1 A;  1BI7 B;  3X2Q E;  5J08 A;  4L1B A;  4YDW A;  2HO1 A;  3FTY A;  1NA0 A;  2DYR E;  4M7C A;  2R5S A;  4AXH A;  2VQ2 A;  5D0Q D;  3FUJ A;  4GZC A;  3QDN A;  3QKY A;  4GTM A;  3R9A B;  1ELW A;  3FTS A;  5E76 A;  2H6G A;  1H2U A;  3LY8 A;  1HXI A;  5EN5 D;  3FH8 A;  1U3D A;  2P9N G;  3TWU A;  3RSE G;  4FU3 A;  4M3O A;  5AAO A;  5CEA A;  2J08 A;  3D9H A;  1WDY A;  2P2C P;  4KVO A;  3CKB A;  4GB9 A;  3S7D A;  3UT8 A;  4R7L A;  4D10 C;  1TN7 A;  4I43 A;  5FTP A;  5BUZ A;  3PZ2 A;  3E33 A;  4F53 A;  1ELK A;  1IQR A;  4BTA A;  3B7B A;  4GYW A;  4JEH A;  5BPP A;  3KEA A;  3U4T A;  3VLE A;  3CIA A;  2J8S D;  1PAQ A;  2R59 A;  3WXX A;  1DC2 A;  2WB2 A;  3CLJ A;  1MHQ A;  4PS7 A;  4CT0 A;  4GA0 A;  4MRU A;  4HOT A;  2OV8 A;  3LEW A;  3E34 A;  4ILI A;  2LXL A;  2XRZ A;  4I6J A;  5FZR A;  5AQB A;  4XKB A;  3B13 A;  1OCC E;  5JHB A;  2QC9 A;  2DBA A;  4BSZ B;  2VSX E;  3KD7 A;  1JUQ A;  2P9I G;  3ULE G;  2OEW A;  2WXH A;  1K3Z D;  3IHY A;  3R7Q A;  4AY5 A;  3MKQ A;  1OY3 D;  5FT9 A;  3Q15 A;  4C0M A;  3SI5 A;  5D0O D;  3ZHE A;  3V31 A;  5KJK A;  5AEN A;  1NZN A;  2C2L A;  3JQ0 A;  3ZRH A;  4G8K A;  1LD7 A;  3DSS A;  1HU3 A;  1NFI E;  2LSV A;  3ZW3 A;  4I2Z A;  3C3O A;  3PRZ A;  5G04 C;  4ZFH A;  5CRU A;  3SFZ A;  4EZL A;  3SO8 A;  3G2U A;  5D2M C;  4ILG A;  4GPM A;  4UWF A;  4G24 A;  3TWR A;  5HQ8 A;  4XI0 A;  1QYM A;  4WWP A;  4RVB A;  4I1O B;  3ZYL A;  1LD8 A;  4BT9 A;  3ZIM A;  4O6F A;  1INZ A;  4HBD A;  4JD2 G;  4JHJ A;  3AS5 A;  3UIN C;  3ABL E;  3FY4 A;  3C3Q A;  4WUY A;  1UJJ A;  1YA0 A;  2FUL A;  4BX8 A;  4BSX A;  4YVO A;  2GRP B;  4O1O A;  3FTW A;  1RW2 A;  4N2Q A;  5AQ7 A;  2WM9 A;  2XPZ A;  3NAW A;  4GA1 A;  5ANR A;  4GZD A;  3DSU A;  2JEK A;  1WY6 A;  3ZXP A;  1LTX A;  4O60 A;  1N4S A;  4L2Y A;  3MCX A;  5ARF A;  4CDR A;  3CGH A;  4B0Z A;  3JYS A;  3CEQ A;  3FUL A;  3AG3 E;  3DPD A;  4Z68 A;  3QB2 A;  4L23 A;  3E30 A;  5FQ4 A;  3LJ3 A;  3CVU A;  2LXM A;  3OAW A;  3DEP A;  1HZ4 A;  2J4B A;  2X6K A;  4LSZ E;  4F3V A;  1DCE A;  4U0U A;  5CBO A;  2XEH A;  2P58 C;  2QZA A;  4FJZ A;  2PQN A;  1E90 A;  3HHM A;  5EX3 A;  3CHS A;  1N94 A;  4YDO A;  4YND A;  3N71 A;  1OWM A;  4YVQ C;  4C9B B;  2I6H A;  3L22 A;  2DCP A;  3KS2 A;  4N3C A;  4MBG A;  3FUK A;  3HXB A;  3B7T A;  3K9I A;  4XX5 A;  3FDH A;  3SF4 A;  4DI4 A;  2L0I A;  3ZUV B;  4V3I A;  2OEV A;  3FTX A;  3NOG D;  4UWG A;  3ZVV A;  1N52 A;  4X8Q A;  3RRU A;  4A1S A;  2OND A;  4JEU A;  4LER A;  4ATG A;  3F6Q A;  5AIJ A;  3D3M A;  3LJN A;  4J6I A;  4I1A A;  3JUI A;  4OAU C;  2QFC A;  4JZY A;  4LEU A;  1K1B A;  5CER B;  1SA5 A;  4NQ0 A;  4C48 B;  4URK A;  4G11 A;  3LPZ A;  4F1S A;  4UQY A;  4APO A;  3PEV B;  3FP3 A;  5KJL A;  3URZ A;  2LNI A;  4RSY A;  3FWV A;  3DPY A;  3I4G A;  3Q7F A;  4G23 A;  1KT0 A;  4GTO A;  4UWH A;  4E85 A;  3AG4 E;  2AJA A;  3GZ2 A;  2E2E A;  4TUM A;  1MZC A;  3UIP C;  2X3M A;  1HH8 A;  3TL5 A;  3FTU A;  3CVN A;  4N3B A;  1OXJ A;  3RIB A;  2IQC A;  5T8I A;  3UT7 A;  4I2W A;  2IF4 A;  1UW4 B;  1MX2 A;  3LCA A;  3OTN A;  3ENE A;  5EYP F;  1X81 A;  2LAI A;  2BED A;  1JWF A;  2IOS A;  1S63 A;  4ACK A;  2R03 A;  4HOS A;  3Q75 A;  3AS8 A;  2MOW A;  2XCC A;  1B89 A;  4GAA A;  1AWC B;  4H7X A;  4MS6 A;  3P1U A;  5FQ6 A;  1FVH A;  2M63 A;  3MGB A;  4G1T A;  4UI9 J;  5B1A E;  5EX0 A;  3DXM G;  3ZN3 A;  3ASN E;  1MX6 A;  1OWN A;  4U8Y D;  4GZ5 A;  4KZC A;  4AOF A;  4BY6 A;  4GPK A;  3Q49 B;  3AU5 A;  1IKN D;  2H6F A;  4K0R A;  4PH4 B;  5EID A;  3D9P A;  2ZIS A;  1HO8 A;  3APC A;  4ME2 A;  2KXP C;  3TWT A;  4QFV A;  1NI1 A;  2F0Y A;  3CVX A;  4JA7 A;  3RU0 A;  3CVW A;  2NC9 A;  3L17 A;  1BD8 A;  1E8Y A;  5KNG A;  4B93 B;  3E4B A;  4G25 A;  3PNL B;  3PRE A;  2JAB A;  5LCW C;  3G2W A;  4L7T A;  2R17 C;  2WQ6 A;  3CK8 A;  2UWJ G;  3TWW A;  4HVB A;  3FU0 A;  2KCV A;  2PL2 A;  2ETA A;  3PZD A;  3Q79 A;  3TWQ A;  5ENP D;  2XEE A;  3EHN A;  5BV1 A;  2WQH A;  2ION A;  4UQZ A;  4KXK B;  4N39 A;  3R9M A;  4OVV A;  1OUV A;  1EDU A;  2WMN A;  3UUX A;  5KWD A;  2LUH A;  1KLX A;  3ML8 A;  2V0P A;  4JA9 A;  4KT6 B;  3UM0 A;  4I6E A;  3FUF A;  3SHF A;  1FCH A;  3RJV A;  5KCM A;  4A55 A;  2BKG A;  1E8W A;  2WXM A;  3VTX A;  2I1K A;  4BX9 A;  4CCA A;  4J8S A;  5HKP A;  3UIO C;  2P9U G;  4ABN A;  5HI7 A;  3T5X A;  2LAH A;  4YDY A;  5JJT A;  2ZIR A;  5H7P A;  1S70 B;  3RRN B;  5EIB E;  3FHE A;  2RKK A;  4HRM B;  2ZGD A;  5AQA A;  2WXG A;  4UWL A;  1IHB A;  4BFR A;  4UI9 K;  3HG0 D;  1MJ0 A;  5CBN A;  2AW6 A;  3AU4 A;  4PS3 A;  2H6I A;  5LP0 A;  3I4R B;  4N2S A;  5G04 J;  4RLY A;  3MV2 B;  5G2N A;  4J8E A;  4J8F A;  4JW1 A;  3ULQ A;  5FIN A;  3QK0 A;  3LDZ A;  2B0O E;  3CVL A;  4DK5 A;  4A3T A;  1Z3Y A;  4P29 A;  1BI8 B;  1NL4 A;  5AYW D;  2X6I A;  4HOU A;  4TRQ A;  4A3V A;  3U3W A;  3ISM C;  1FT2 A;  2XGO A;  2HYZ A;  1D9S A;  3PVL A;  1IHG A;  3CHM A;  3B7U X;  5EDS A;  1QNF A;  3FUI A;  2Y1L E;  2P9L G;  4AIF A;  2FO1 E;  3C72 A;  1WM5 A;  5JJ7 A;  1MX4 A;  1D8D A;  3C3R A;  3NF1 A;  1OCR E;  3L08 A;  5B1B E;  2OCC E;  5G05 C;  2XEN A;  4U96 D;  4GZ6 A;  4JL0 A;  3CVP A;  3HDX A;  3DXK G;  1Y6I A;  1ZU2 A;  1AP7 A;  3ZU7 B;  5KNH D;  1Z5S C;  4NIK A;  1TNU A;  4BET A;  1UN9 A;  3HXC A;  3V2O A;  3G2T A;  3TG4 A;  3L82 A;  4RQI A;  4HLE A;  2KC7 A;  3D9M A;  4IRU A;  1O1T A;  2C0M A;  3D9I A;  2WPV A;  1YYH A;  2X6F A;  4EPZ A;  1XGW A;  4IN3 B;  4KMO A;  3BQO A;  4AM9 A;  3FUM A;  3QWP A;  1JCR A;  5C1D A;  2XS8 A;  3ZGQ A;  2IJG X;  4U0Z A;  4GU5 A;  2IFU A;  4GTP A;  5A23 A;  5FWQ A;  1N11 A;  3MKR A;  4U8V D;  2V4L A;  3R7R A;  2IO3 C;  2J09 A;  4U8H A;  3CR3 A;  3G2V A;  4C0E A;  1TNB A;  3KAE A;  1EPU A;  2WXN A;  3CHR A;  2IO2 C;  4BER A;  2FBN A;  3FUE A;  3MYV A;  5EKQ D;  3OXF A;  4UQX A;  4HRN A;  5FZQ A;  1OWO A;  2DZN A;  2VSN A;  4I9C A;  4J7W A;  1S64 A;  4K5B A;  3APD A;  4OYS A;  4CGV A;  2YHE A;  3E37 A;  3PZ3 A;  3PUK A;  2VYI A;  1E8X A;  4GTR A;  4KYO B;  1TNZ A;  4DX6 D;  4BT8 A;  3NBN B;  1OCO E;  5JA4 D;  5KBA A;  3RO2 A;  3FTV A;  2P9P G;  5AN8 A;  5BT1 A;  2DVW A;  2VSO E;  3ONK A;  2L6B A;  3ZKJ A;  1FVF A;  4AY6 A;  5IY5 E;  2A5E A;  4N5Q A;  3Q7A A;  2GGF A;  1H6K A;  2UY1 B;  2LO6 A;  2BTD A;  3DRA A;  2PZI A;  4B8A A;  1XNF A;  3D9J A;  3BUA A;  4PS8 A;  2IOL A;  2DZO A;  2EIM E;  4HB5 A;  2QY7 A;  4AP2 A;  5B3S E;  1G3N B;  4CRW A;  1JCS A;  4DUI A;  4GCN A;  4DJA A;  3DSW A;  2Y4T A;  1N4R A;  2GW1 A;  5A7D B;  3NZU A;  2BF0 X;  5EIL A;  3TG5 A;  2XHE A;  3MV3 B;  3L9T A;  1K8K G;  4NAC A;  3NB2 A;  1EYH A;  3EDT B;  4I17 A;  2NSZ A;  2I2O A;  3MZL B;  3TWS A;  5FQ7 A;  4K03 A;  5A6C A;  3GZ1 A;  1N4Q A;  2RFA A; 
#chains in the Genus database with same CATH homology
 4AEZ C;  4GYO A;  5E75 A;  1NA0 A;  2WXP A;  3LS8 A;  4B94 A;  4MS6 A;  3P1U A;  4EZJ A;  2R5S A;  4AV7 A;  4E6H A;  3HYM B;  2XGM A;  1FVH A;  4WNG A;  5FQ6 A;  2VQ2 A;  5D0Q D;  4I6G A;  4FLH A;  4G26 A;  4AXH A;  4DLQ A;  2VGY A;  2M63 A;  3FH7 A;  3FUJ A;  3MGB A;  4U07 A;  4TV3 A;  4G1T A;  4APF A;  3FUH A;  4FC8 A;  4B8C B;  4UI9 J;  4BTB A;  3QJZ A;  3PNT B;  4GZC A;  5EX0 A;  1E96 B;  4J0U A;  3ZN3 A;  3QDN A;  3QKY A;  3R9A B;  1UN8 A;  1OWN A;  4UI9 C;  4GZ5 A;  1ELW A;  4KZC A;  3FTS A;  3IKO B;  4AOF A;  1TEZ A;  4BY6 A;  3CV0 A;  4GCO A;  2BUG A;  5E76 A;  4MLP A;  3VLF A;  1H2U A;  3LY8 A;  1HF8 A;  1HXI A;  3FH8 A;  4GPK A;  1U3D A;  2GRM A;  3Q49 B;  3MKQ B;  3AU5 A;  4FU3 A;  4M3O A;  1NP7 A;  2AXU A;  2CHX A;  4K0R A;  3D9P A;  4PH4 B;  2J08 A;  5KJN A;  4CDR A;  1HO8 A;  3CHQ A;  3EJN A;  3APC A;  4DLO A;  5DBK A;  4ME2 A;  4JHK A;  3CKB A;  4GB9 A;  4KVO A;  5CMY A;  3S7D A;  3UT8 A;  4QFV A;  2MHK A;  3IEG A;  2FO7 A;  1Y8M A;  3QWV A;  4R7L A;  4D10 C;  3CVX A;  4U0S A;  4I43 A;  5BUZ A;  4JA7 A;  5FTP A;  5G05 J;  4F53 A;  5JJ6 A;  2XRY A;  1ELK A;  3RU0 A;  3CVW A;  2CHW A;  2NC9 A;  3L17 A;  1IQR A;  1SQM A;  2JLB A;  4BTA A;  3FUN A;  1E8Y A;  3E4B A;  4G25 A;  3PNL B;  3PRE A;  5LCW C;  3G2W A;  1HX8 A;  4GYW A;  2R17 C;  4JEH A;  3APF A;  4L7T A;  5BPP A;  5KJM A;  2AWI A;  2WQ6 A;  3CK8 A;  1UG3 A;  2UWJ G;  3U4T A;  3VLE A;  4HVB A;  2VTB B;  3UPV A;  2WXJ A;  1SZA A;  2WXO A;  3FU0 A;  4PDX A;  1UJK A;  2PQR A;  2KCV A;  2PL2 A;  2WXK A;  3L54 A;  3CIA A;  4MKT A;  3IBE A;  3PZD A;  3VLD A;  1PAQ A;  2R59 A;  2AVP A;  3WXX A;  4WND A;  1E7V A;  3EHN A;  3SNX A;  3ZFW A;  5BV1 A;  2WQH A;  2ION A;  1LF8 A;  4DPR A;  2WB2 A;  4UQZ A;  3CLJ A;  3S2A A;  4KXK B;  4N39 A;  2J07 A;  4OVV A;  1OUV A;  1EDU A;  1MHQ A;  4PS7 A;  4FAD A;  5FJY A;  1HS6 A;  2WMN A;  4CT0 A;  2X38 A;  1MQS A;  4GA0 A;  5CCL A;  3UUX A;  4MRU A;  4HOT A;  2OV8 A;  3LEW A;  1KLX A;  4ILI A;  2XRZ A;  2J9Q A;  2V0P A;  2L6J A;  3ML8 A;  4I6J A;  5FZR A;  4HFG A;  4XKB A;  4JA9 A;  3B13 A;  4KT6 B;  4CDM A;  4I6E A;  4XI9 A;  3PEU B;  3SZ7 A;  3PE3 A;  3FUF A;  4LUN U;  3RRM B;  3SHF A;  1FCH A;  3RJV A;  5KCM A;  4A55 A;  5JHB A;  1E8W A;  2WXM A;  2DBA A;  3VTX A;  4EQF A;  2I1K A;  4WAF A;  2PM7 A;  3RKV A;  4BX9 A;  4CCA A;  4CDN A;  4GZ3 A;  4J8S A;  4NUR A;  2VSX E;  3KD7 A;  1S0P A;  4BWR A;  1JUQ A;  4FJY A;  2YQ8 A;  4EEC A;  2X6J A;  5LFA A;  3SD5 A;  4ABN A;  4CGW A;  1PY1 A;  2WXH A;  5HI7 A;  4ANW A;  4J8D A;  2XQ0 A;  3IHY A;  5G55 A;  3R7Q A;  5BV0 A;  3T5X A;  2LAH A;  3QC1 A;  4AY5 A;  5JJT A;  3I5P A;  3EHM A;  3MKQ A;  5ARG A;  3QWW A;  3C98 A;  3RO3 A;  3RRN B;  5FT9 A;  3JCK C;  3FHE A;  3Q15 A;  2L9B A;  4C0M A;  1JWG A;  3SI5 A;  4G2V A;  4N3A A;  5D0O D;  3ZHE A;  4LCT A;  3Q4A B;  4EZK A;  5AJD A;  2WXG A;  4UWL A;  2VGX A;  4N5C A;  5KJK A;  4BFR A;  5CMW A;  5AEN A;  1NZN A;  2I9C A;  4UI9 K;  2C2L A;  3JQ0 A;  3ZEF A;  3TXN A;  3ZRH A;  2AW6 A;  1W3B A;  1H2V C;  3U64 A;  3ESK A;  3QNK A;  3P2B A;  3AU4 A;  3I3N A;  4PS3 A;  1HU3 A;  5LP0 A;  3I4R B;  4N2S A;  2WXL A;  4GYY A;  4WWN A;  5G04 J;  2LSV A;  3MV2 B;  2KZT B;  4I1M A;  2WVI A;  4J8E A;  4I2Z A;  5G2N A;  3ZW3 A;  4J8F A;  3GW4 A;  2DIW A;  3PRZ A;  3D9K A;  4JW1 A;  2OOE A;  4FHJ A;  5G04 C;  3ULQ A;  2L0T B;  3QK0 A;  3TAX A;  3LDZ A;  3CVL A;  3SFZ A;  3FU5 A;  4DK5 A;  4A3T A;  1HE8 A;  4EZL A;  4OVU A;  3T5V A;  1Z3Y A;  4P29 A;  4RG6 A;  3FU3 A;  5AYW D;  3G2U A;  2CHZ A;  4ILG A;  2NXP A;  3S7J A;  2X6I A;  4HOU A;  4TRQ A;  4CEM A;  5CCM A;  3UT4 A;  4UWF A;  4G24 A;  5HQ8 A;  4A3V A;  3FU6 A;  4XI0 A;  3U3W A;  4KBQ A;  1U3C A;  2XGO A;  3ASH A;  3ASF A;  2HYZ A;  3T8M A;  5M72 A;  3PVL A;  1KT1 A;  4WWP A;  3QOU A;  1IHG A;  3CHM A;  5ANL A;  3B7U X;  5EDS A;  1QNF A;  1GW6 A;  2RD0 A;  4WNF A;  3FUI A;  2KCK A;  4AIF A;  4RVB A;  4I1O B;  3ZYL A;  1X5B A;  4JXT A;  3MEK A;  1VDY A;  5JHA A;  4BT9 A;  3ZIM A;  4O6F A;  1WM5 A;  5C2Y A;  1INZ A;  5JJ7 A;  2XPI A;  3KEZ A;  4CT4 A;  4JHJ A;  4WNE A;  3NF1 A;  4PUC A;  1N54 A;  3PE4 A;  3AS5 A;  3L08 A;  2YHC A;  1E7U A;  4Q69 A;  3FY4 A;  5AJL A;  4WUY A;  2YIN A;  2VSY A;  1HFA A;  1UJJ A;  2AXZ A;  1YA0 A;  2FUL A;  3CHP A;  5G05 C;  4BX8 A;  4BSX A;  2WXR A;  3LVR E;  3U9W A;  4GZ6 A;  2OVF A;  4FA6 A;  3O48 A;  1NA3 A;  4JL0 A;  3CVP A;  3HDX A;  4YVO A;  1Y6I A;  1ZU2 A;  3FTW A;  2CFU A;  3SGH A;  3SBS A;  3OXG A;  3PDN A;  4H7Y A;  4N2Q A;  3LY9 A;  2WM9 A;  2XPZ A;  3PH0 C;  3ZYQ A;  1UN9 A;  4GA1 A;  5ANR A;  4GZD A;  2C0L A;  3EIQ C;  2JEK A;  3CK9 A;  5DIZ A;  1H2T C;  2KCL A;  3MA5 A;  3G2T A;  1WY6 A;  5FQ8 A;  3TG4 A;  1OWP A;  4DI3 A;  3L6A A;  4HLE A;  4IYP A;  2KC7 A;  3D9M A;  4L2Y A;  1HG5 A;  3CK7 A;  2WMO A;  3MCX A;  3ML9 A;  4IRU A;  3O4Z A;  2VJ8 A;  3L16 A;  5ARF A;  2C0M A;  2E0I A;  2FI7 A;  3B7R L;  2CFZ A;  3CGH A;  3PS6 A;  3D9I A;  3CSF A;  3JYS A;  4B0Z A;  3CEQ A;  1ZBP A;  1IQU A;  2WPV A;  2X6F A;  4EPZ A;  3FUL A;  1XGW A;  3DPD A;  1DNP A;  4GMJ A;  2KZT A;  3FFL A;  4IN3 B;  3QB2 A;  3TJP A;  4KMO A;  5BNW A;  4L23 A;  3S7B A;  4AJW A;  2V5F A;  4GA2 A;  4HOQ A;  4LRZ A;  4AM9 A;  3FUM A;  3QWP A;  5C1D A;  5FQ4 A;  3LJ3 A;  3CVU A;  3ZGQ A;  2IJG X;  2UY1 A;  4HOR A;  1DVP A;  3OAW A;  4XIF A;  3GYZ A;  4GU5 A;  4U0Z A;  1HZ4 A;  4Q96 A;  2J4B A;  2X6K A;  5T4Y A;  2IFU A;  4FHK A;  5A23 A;  3IHV A;  5FWQ A;  3MX3 A;  4F3V A;  1QQE A;  3ESL A;  3HVE A;  4KZ0 A;  3MKR A;  4U0U A;  2V4L A;  3EIJ A;  1L5J A;  3R7R A;  4A1G A;  3QAR A;  2P58 C;  4FLB A;  1WAO 1;  2AXV A;  2J09 A;  2PQN A;  4FJZ A;  1E90 A;  3HHM A;  4U8H A;  4XZ4 A;  3CR3 A;  5EX3 A;  3CHS A;  3G2V A;  4C0E A;  3N71 A;  5CHE E;  3KAE A;  2HR2 A;  4YND A;  1OWM A;  1BPO A;  2PM6 A;  1EPU A;  2RG8 A;  5ENN A;  4ANX A;  4YVQ C;  2WXN A;  3CHR A;  4AVX A;  3VTY A;  4WWO A;  4C9B B;  5J90 A;  2FEZ A;  2FBN A;  2I6H A;  3FUE A;  2DCP A;  3L22 A;  3KS2 A;  4HS2 A;  1EF1 C;  3MYV A;  4N3C A;  4U04 A;  4HXI A;  5EKQ D;  3OXF A;  3FUK A;  3B7T A;  3K9I A;  4XX5 A;  3D9L A;  4UQX A;  3FDH A;  2Y4U A;  1H0A A;  4Y6C A;  1OWO A;  2VSN A;  3LYA A;  5FZQ A;  3SF4 A;  4I9C A;  2L0I A;  4DI4 A;  3NQP A;  5LX8 A;  4V3I A;  3APD A;  4UWK A;  2A5U A;  4OYS A;  2MRI A;  3ZYK A;  3FTX A;  4ILH B;  1SZ9 A;  2XGS A;  3GZS A;  4JVS A;  4UWG A;  3ZVV A;  4XKC A;  1N52 A;  4CGV A;  2ILR A;  3LY7 A;  1TJF A;  3FH5 A;  3RRU A;  4I9E A;  4JHR A;  2YHE A;  1QZ2 A;  2YNQ A;  4U63 A;  3Q5M A;  3B7S A;  4JPS A;  4A1S A;  2I1J A;  2OND A;  4JEU A;  2ZU6 B;  4LER A;  1P5Q A;  3ONL A;  4ATG A;  3PUK A;  4W9R A;  1PC2 A;  2VYI A;  1E8X A;  5LOZ A;  5LCW J;  4KYO B;  3LKU A;  1ELR A;  2WXQ A;  5AIJ A;  4F7A A;  3CQC B;  3ZHE B;  3D3M A;  4J6I A;  2HM8 A;  2KAT A;  4I1A A;  4ANU A;  4BT8 A;  4FP7 A;  4GML A;  2Q7F A;  3JUI A;  3RO2 A;  3HIZ A;  3FTV A;  4EBA G;  2QFC A;  4JZY A;  5BT1 A;  4LEU A;  3D9O A;  1H19 A;  2VSO E;  3ONK A;  3IV0 A;  1JPL A;  3U66 A;  2XCB A;  3FEY A;  4JC8 A;  1FVF A;  4IUL A;  3ZYM A;  4AY6 A;  3PUJ A;  2A4Z A;  4NQ0 A;  3CHO A;  4URK A;  4EBA A;  3AS4 A;  3CST A;  3FEX A;  4G11 A;  3LPZ A;  3Q47 B;  3LVQ E;  4UQY A;  4F1S A;  3UX4 A;  3PEV B;  4APO A;  3FP3 A;  2LSU A;  3ASD A;  3LXU X;  2GGF A;  5KJL A;  1H6K A;  2V8S E;  2UY1 B;  4FUL A;  3URZ A;  2LO6 A;  2BTD A;  2LNI A;  2J4D A;  2PZI A;  3UMV A;  4B8A A;  4RG9 A;  1XNF A;  2VGX B;  3JQ1 A;  4RSY A;  3BEE A;  3S7F A;  3D9J A;  3ASG A;  2CG2 A;  3D9N A;  3FWV A;  3I4G A;  4G23 A;  4PS8 A;  3HVE B;  1KT0 A;  2IOL A;  4ANV A;  3SBT B;  2WXI A;  2XPY A;  4UWH A;  5BW8 C;  4E85 A;  2QY7 A;  4AP2 A;  3DBS A;  3CVQ A;  3GZ2 A;  2E2E A;  3OXL A;  4CRW A;  3RK6 A;  1OWL A;  1Z3X A;  1Z6T A;  3G2S A;  4GCN A;  4DJA A;  1A17 A;  3CKC A;  3FTZ A;  3UQ3 A;  2X3M A;  3BG1 B;  3BG0 B;  1HH8 A;  3TL5 A;  2EQX A;  1TJC A;  3FTU A;  3CVN A;  4N3B A;  2Y4T A;  3NZS A;  3RIB A;  3ZXS A;  2GW1 A;  1IYG A;  5A7D B;  3NZU A;  3TXM A;  2IQC A;  2BF0 X;  4XE0 A;  2X6H A;  3CQG B;  3MJW A;  5T8I A;  3UT7 A;  4I2W A;  3TGO A;  1HG2 A;  2CG3 A;  2WXF A;  2IF4 A;  2GRL A;  3TG5 A;  1UW4 B;  4NRH B;  2XHE A;  3LCA A;  3MV3 B;  3OTN A;  4TUU A;  3CVV A;  3QAQ A;  4NAC A;  4B89 A;  1EYH A;  3EDT B;  3L13 A;  2KM4 A;  2Y3A A;  3ENE A;  2LAI A;  4Y6W A;  1JWF A;  2IOS A;  2OVB A;  4KVM A;  2J49 A;  4I17 A;  2NSZ A;  5T3R A;  4L2L A;  3FUD A;  4ACK A;  3ZPJ A;  2I2O A;  4HOS A;  3MZL B;  4Q94 A;  2WQ7 A;  2IU1 A;  3AS8 A;  5J08 A;  2MOW A;  2XCC A;  4L1B A;  1B89 A;  2XEV A;  2FF4 A;  5FZS A;  5FQ7 A;  2HO1 A;  4GAA A;  2VTB A;  3FTY A;  4H7X A;  1E8Z A;  4K03 A;  5A6C A;  3GZ1 A;  4ACL A;  3CVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...