2IFUA

Crystal structure of a gamma-snap from danio rerio
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
275
structure length
275
Chain Sequence
AAQKISEAHEHIAKAEKYLKTSFMKWKPDYDSAASEYAKAAVAFKNAKQLEQAKDAYLQEAEAHANNRSLFHAAKAFEQAGMMLKDLQRMPEAVQYIEKASVMYVENGTPDTAAMALDRAGKLMEPLDLSKAVHLYQQAAAVFENEERLRQAAELIGKASRLLVRQQKFDEAAASLQKEKSMYKEMENYPTCYKKCIAQVLVQLHRADYVAAQKCVRESYSIPGFSGSEDCAALEDLLQAYDEQDEEQLLRVCRSPLVTYMDNDYAKLAISLKVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of gamma-SNAP: insight into flexibility of proteins from the SNAP family.
pubmed doi rcsb
source organism Danio rerio
molecule tags Endocytosis/exocytosis
molecule keywords gamma-snap
total genus 112
structure length 275
sequence length 275
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14938 SNAP Soluble NSF attachment protein, SNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ifuA00
3S7FA 4I9CA 5FZSA 3Q49B 5AYWD 2DBAA 4XIFA 5A6CA 3CK7A 4U0SA 4CDRA 5G05C 1ZU2A 4BT8A 1NA0A 2KCLA 3CEQA 2KCKA 3CV0A 4A1SA 2Q7FA 4LEUA 3U4TA 2VSYA 3GZ1A 2C2LA 4UI9C 1QQEA 4WNEA 3EDTB 2YHCA 3ESKA 5M72A 3UPVA 1KT1A 4I17A 4N3CA 1B89A 3U3WA 5EX3A 3RKVA 1FCHA 3ULQA 3CVLA 1E96B 1ELRA 5KJNA 1ZBPA 5DBKA 5EKQD 2XEVA 3FFLA 4GCOA 4B94A 2ONDA 3RJVA 3LCAA 3Q4AB 1KT0A 2OOEA 3CK8A 3MV2B 3QWVA 2IFUA 1ELWA 4GCNA 4GYYA 4KYOB 3SF4A 4BWRA 3QOUA 2MHKA 3S7BA 1HH8A 2FI7A 3LPZA 2KC7A 4GZ6A 3OXFA 4GYWA 2VGYA 2HO1A 2UY1A 2XCCA 2C0MA 3IEGA 3OXLA 4N5CA 3VTYA 2HR2A 1A17A 3Q15A 2PQRA 5BW8C 5C1DA 2Y4UA 4W9RA 3QKYA 4EQFA 1OUVA 2I6HA 2V5FA 3RIBA 5CCMA 1WAO1 3TGOA 3O48A 5A7DB 4RG6A 4JA9A 3ZPJA 4I2WA 4AY5A 1P5QA 3ASDA 5HQ8A 3ASGA 4NQ0A 4AIFA 3MKRA 1HZ4A 2NC9A 4G25A 4GYOA 2IF4A 4H7XA 4JHRA 2C0LA 2Y4TA 4WNDA 5CHEE 4YVOA 5G05J 3WXXA 5CCLA 1PC2A 4UI9J 2FO7A 4YVQC 4BT9A 5FT9A 4KXKB 1KLXA 4HOQA 3NF1A 4GZ5A 4KBQA 3ZGQA 4BTAA 3N71A 4N3BA 1NA3A 4Y6WA 3CVQA 3LY9A 3ZHEB 4HOTA 1NZNA 4G2VA 5FZRA 4WNGA 3AS4A 5G04J 2JLBA 3SZ7A 1QZ2A 4U0UA 3CKBA 4ABNA 4WNFA 4ME2A 1TJCA 3TG5A 4HORA 2PZIA 5BNWA 3MEKA 4AY6A 3AS8A 2XPIA 3LY7A 3Q5MA 4UQZA 2VQ2A 2R5SA 5LCWJ 1IYGA 2P58C 4G1TA 5D0QD 4JA7A 4JL0A 5KJMA 3Q47B 4IN3B 4N2SA 2LSVA 3FWVA 4J8FA 2PL2A 1HXIA 2PQNA 1XNFA 2FBNA 2L6JA 4G23A 4I2ZA 5FZQA 2YQ8A 3VTXA 3LKUA 4NRHB 4XI0A 2GW1A 3PE3A 3GYZA 5DIZA 5ARGA 3ZN3A 4J0UA 4BTBA 4H7YA 1W3BA 3BEEA 3KD7A 5FTPA 3RU0A 4APOA 4U04A 4CGVA 1IHGA 3LY8A 2UY1B 2LSUA 3HYMB 2VSNA 3MV3B 4I9EA 2XGOA 4WUYA 4Y6CA 3RO2A 2KCVA 3QWWA 3QWPA 5HI7A 3URZA 3QDNA 2HYZA 3GW4A 2XCBA 2J9QA 1YA0A 4N2QA 2KATA 2XGSA 3KAEA 4UQXA 3JYSA 4F3VA 3E4BA 3ZFWA 3R9AB 5KJLA 2QFCA 3CKCA 4YNDA 5EX0A 4GA1A 4N39A 3CVNA 5JJ7A 4HOUA 5JJTA 3PE4A 4GPKA 4GA0A 4J8DA 3FP3A 4O6FA 2FF4A 4G26A 2UWJG 3ASFA 3KS2A 2E2EA 4GZ3A 3TG4A 4UQYA 3AS5A 2WPVA 2WQHA 2LNIA 4XI9A 1WM5A 2VYIA 5LCWC 2BUGA 2AVPA 4HOSA 3TAXA 3GZ2A 3PDNA 4J8EA 1Y8MA 4G24A 4N3AA 3RO3A 3MA5A 2VGXB 3K9IA 2VGXA 2FEZA 4U07A 4CGWA 5G04C 5KJKA 2XGMA 5D0OD 5ARFA 3LYAA 5JJ6A 3S7JA 4RG9A 3UQ3A 3UUXA 4I1AA 4UI9K 5FJYA 3ASHA 3OXGA 4GA2A 4U0ZA 3CVPA 3CK9A 3ZHEA 3S7DA 5BT1A 4AM9A
chains in the Genus database with same CATH superfamily
5A6CA 4XE0A 1OT8A 2EILE 3EU5A 4WNEA 3ESKA 3TXNA 3FEYA 5LP0A 5AENA 5DBKA 4M7CA 2VSOE 3NB2A 2P2CP 3QOUA 2MHKA 1OCRE 1KZPA 4GTMA 4I43A 3L13A 3R7RA 3E34A 4DX2A 2P9PG 3QB2A 2Y4TA 2AXZA 4HOQA 2IONA 3ZHEB 2F0YA 2X6FA 3UTMA 4TUUA 4FLBA 4A1GA 3CHMA 3ZUVB 2LSVA 3UI2A 3ZN3A 3FU6A 3D9OA 1HFAA 4BSZB 3D9IA 1X5BA 2KXPC 2DYSE 3TG4A 4APOA 3VLEA 4MS6A 2GRNB 3HRAA 3C5RA 3K9IA 4B8CB 1FT2A 4RG9A 4BESA 2H6IA 5E75A 4AP2A 3UM3A 4BY6A 2QC9A 3C3OA 1FPPA 2BKGA 4IYPA 3NOCD 2WB2A 4FA6A 3WG7E 3FTWA 1PY1A 5EILA 2FO1E 4GCOA 2XPYA 3P1UA 2OOEA 3I4RB 3QWVA 2A5UA 2R05A 3PEVB 3IEGA 1BPOA 5FQ4A 5B1BE 3DWLG 1OUVA 3TGOA 3O48A 4JC8A 2XS8A 3UMVA 2GROB 4G8KA 1FVFA 5CHEE 3CVUA 1N4SA 2I9CA 3MX3A 3CSFA 4JB8P 4WNFA 3DSTA 1IHBA 3AS8A 1IYGA 4F7AA 2B0OE 2L0TB 4I6EA 1HXIA 4HS2A 3MJWA 3CHRA 2Y69E 4HNAD 5BPPA 2XGOA 1YMPA 1HG2A 1YA0A 1MYOA 3AG2E 4GTTA 5AAOA 3ZYKA 4J8DA 4G26A 3R7QA 4ILIA 4NIKA 5LCWC 1Z3XA 4LERA 3FHEA 4BEPA 3PZ3A 3ML8A 4JVSA 4V3IA 3B95A 3FTYA 1K8KG 1TNZA 1NL4A 4U0ZA 4O1PA 4OVUA 2J8SD 2GRLA 3UPVA 3U3WA 1B89A 2CFZA 3NAWA 4CYMD 3Q78A 1N54A 3AJIA 4PUCA 2QYUA 4GZ6A 4ACLA 1U2VG 3VTYA 4HQDA 1X81A 1A5EA 4PH4B 4BT9A 3VLDA 3WXXA 2V4HC 3NF1A 1S64A 3KEAA 1UJJA 3SZ7A 3NZUA 4TRQA 1JUQA 3E32A 5ENNA 1O1SA 5H7PA 4JA7A 3MZLB 2PL2A 4FHKA 4LNGA 1OWMA 1OXJA 4J6IA 4J0UA 4O1OA 2X6IA 5LX8A 3HXFA 2J9QA 4PS7A 3QARA 1E7UA 1HG5A 2BKKB 3SNXA 3CVNA 4G11A 1HE8A 2H6FA 3NOGD 4L2LA 2BTDA 3FH7A 4J8EA 4KT6B 4N3AA 3ENEA 3ABKE 2L6BA 1JCSA 1MX6A 3S7DA 4GMLA 4BSXA 3S7FA 5CRUA 2ZIRA 2OVBA 2QY7A 5CMWA 5FQ7A 1H2VC 4D10C 1NA0A 4JPSA 3APFA 4GTVA 5CMYA 1U3CA 3EJNA 1QQEA 3QC1A 3EDTB 3CVLA 5FWQA 1ZBPA 3RAUA 4BWRA 3G2SA 4GCNA 2I1JA 2ZGGA 2FI7A 1MHQA 2XCCA 1OWOA 4E85A 3L82A 3TWWA 2JEKA 2AW6A 3LVRE 2NC9A 2IF4A 2C0LA 5CCLA 4JW1A 4DI4A 5BXUA 3ESLA 4Y6WA 2WXJA 2JABA 4BX9A 4HORA 5BNWA 3CVVA 3AG1E 1UG3A 1QYMA 3ASOE 3FTSA 2R02A 5LCWJ 1H19A 5G55A 5FZQA 4FJYA 4XI0A 3D9MA 4WWPA 5FTPA 3B7UX 2UY1B 5AQ7A 3C3RA 4I1MA 4BX8A 2X6JA 4GPKA 3FP3A 3L54A 4CRWA 5ANRA 1MQSA 2EIME 4A55A 3MA5A 2WQ7A 4DX5D 3DXKG 4EBAA 3BU8A 1DCQA 3UKUG 3FUEA 3ML9A 3CV0A 1TN8A 3IV0A 1N0QA 1KZOA 1ELRA 3B7TA 1DVPA 4R7LA 3S7BA 1HH8A 2X3MA 3ZW3A 3OXLA 4DX6D 2Y4UA 4GZDA 2WXQA 3RIBA 4EECA 4JA9A 3MKRA 5T4YA 4HRLA 4YVQC 4ATGA 1UOHA 3UM2A 2WXLA 4MLPA 4UWLA 4ABNA 1TJCA 3VLFA 4AY6A 1OY3D 2P58C 1EYHA 1LD7A 3DEOA 1JCQA 4HBDA 2PQNA 3C3QA 3CHSA 5CBNA 5KNHD 3PH0C 2M63A 2OVFA 2LSUA 3F6QA 3I4GA 3QDNA 1QNFA 1O5MA 1DCEA 3ZFWA 4HLEA 3CKCA 2YINA 3S2AA 3ASFA 4UQYA 1SA4A 1BU9A 1Y8MA 2FEZA 4U07A 3TJPA 5HRYA 3FUJA 4KVOA 2ILRA 3ABME 2R2LA 3V30A 3PREA 4U0SA 2FULA 2A5EA 3CEQA 4A1SA 2Q7FA 3CQCB 4ILGA 4G8LA 4GZCA 5FQ6A 4DPRA 3RJVA 1ELWA 5EIBE 4A63B 3FU0A 3D9PA 3HHMA 4L2YA 3CIAA 4LCTA 4ZHBA 1H2TC 2RG8A 3ZPJA 4AY5A 4J7WA 3TWTA 3DSSA 4YDOA 4F53A 3SD5A 2XRYA 4H7XA 2PNNA 4OAUC 3UIOC 5CRVA 2P9SG 4HOTA 4Q96A 3JUIA 3LJNA 1H6OA 2IJGX 2H6HA 1UN9A 1BLXB 3IXEA 1N94A 3FTZA 3D9LA 3PE3A 4UWGA 1HO8A 4K5CA 5DIZA 3I5PA 4PS3A 3KD7A 1S63A 2AJAA 1BD8A 5BV0A 3Q79A 5ENPD 1Q2ZA 2P9IG 3IKOB 4UQXA 2OEWA 4IULA 3FUNA 3ULEG 1SQMA 4MBGA 4XZ4A 3AU5A 3E30A 3FU5A 4I6JA 4GTSA 4EZLA 3CHOA 4AJWA 3ULYA 3KEZA 3PUJA 3CVPA 2DBAA 4F1PA 3CK7A 1E8WA 4BT8A 4DUIA 1N95A 3HXDA 3V2OA 2RKKA 4U96D 3RRUA 3RK6A 1WDYA 4KZ0A 5EKQD 3FFLA 3BQOA 1JWFA 1TNOA 3PS6A 1S0PA 2PM7A 4DRXE 2PQRA 2WMOA 3ASDA 4DI3A 3ZU7B 3L17A 5G05J 3JXIA 4YVOA 4BTAA 4E6HA 4JEHA 5JMND 1MX4A 2CG2A 3MEKA 4AVXA 2VQ2A 2R5SA 4GTOA 4Q69A 4GU5A 4NRHB 4CDMA 3QNKA 4BTBA 4H7YA 3BEEA 2DCPA 5FIOA 1BI7B 3RO2A 4ILHB 1AP7A 3J5PA 2XENA 1Z6TA 3E4BA 2ETCA 3R9AB 2P9NG 3JXJA 4GA0A 4O6FA 2FF4A 5B1AE 4MKTA 4I6GA 3T8MA 1V55E 4C9BB 3ZRHA 3GZ2A 5C2YA 5G04C 3LDZA 4Q94A 3E37A 5D0OD 5CEAA 4K5BA 1N0RA 4PDXA 2X6HA 3SBSA 5AYWD 3C72A 3LS8A 3EHQA 2J4BA 5EYPF 3MYVA 3JQ1A 2NSZA 1JCRA 2GGFA 3KSLA 4F1SA 2BF0X 2IOSA 5KJNA 4DX7D 1AWCB 2AXUA 3Q4AB 1MZCA 2WXHA 2VGYA 4UUCA 2HO1A 2C0MA 3UXGA 4WAFA 2DVWA 2DYRE 3QKYA 1UW4B 1WAO1 4AV7A 2LXLA 4KVMA 3T9KA 1IKND 3I3NA 4J8SA 3G2VA 3JCKC 3SHFA 2KBXA 2LXMA 4UWKA 4L1BA 4WNGA 3AS4A 4CEMA 4AOFA 2ETAA 3CVYA 3D9JA 4ACKA 2WXKA 3L22A 5KBAA 3VTXA 5AQAA 1S70B 3BUAA 3UT7A 3FU3A 1PAQA 4A3TA 1SW6A 2J4DA 4C0EA 2QFCA 2UWJG 4XI9A 2LNIA 3EHNA 4HOSA 1YYHA 3UT8A 3CK9A 4YDWA 4C48B 2CHZA 1GW6A 4I9CA 4J8YA 4GMRA 5KNGA 3ZYQA 3L16A 3CLJA 3DXMG 3ZKJA 3APDA 3NZSA 5ENRD 5HKPA 2VJ8A 1OCZE 2ONDA 1DC2A 3LCAA 1ELKA 4HRNA 5AJDA 2P9LG 5T8IA 4QQIA 3EIQC 5BW8C 2J09A 5CBOA 3CQGB 2V5FA 3DPDA 3TXMA 2J49A 1TNYA 2Y1LE 2ZU6B 4UWHA 5CEDB 1L5JA 3RRNB 3HVEB 2GRMA 5FT9A 1DNPA 3UM1A 3D9KA 3LY9A 4G2VA 2XEHA 3EIJA 4U0UA 5ENQD 4B0ZA 3TWRA 4IRUA 3NQPA 1OWNA 2DZOA 1BI8B 2L6JA 3GYZA 4LNBA 3G2WA 2R59A 3EU9A 4U04A 4NACA 2EIKE 4C0MA 4CZ2D 5KJLA 4JEUA 4B89A 2RFAA 2MYOA 1WM5A 3FTXA 4GTQA 3PDNA 2ZISA 3FTUA 2RD0A 3LYAA 1XGWA 2EIJE 2X38A 2R17C 2V5QC 4DK5A 3PUKA 3QJZA 3DEPA 1JPLA 5ENTD 4ANVA 1WY6A 2KCKA 5AARA 4LEUA 3GZ1A 3PEUB 3ULQA 4KMOA 1OCOE 3OAWA 4JHJA 4HI8A 3CSTA 2UY1A 3ZNGA 4N5CA 2HR2A 1A17A 2E0IA 4L23A 4OVVA 1FVHA 4EQFA 4FLHA 1P5QA 3DRAA 1LD8A 2J07A 4B8AA 1EPUA 2QYJA 3SY2A 4JZYA 1SVXA 3FH8A 1NZNA 4P29A 3U66A 1QZ2A 2ZGDA 3CKBA 2QZAA 2PZIA 2XPIA 4G1TA 5KJMA 4JL0A 4FP7A 3ONLA 1O1TA 2OCCE 3P2BA 5B3SE 1H6KA 3IBEA 4I9EA 2X6KA 3FEXA 2KATA 4RQIA 2XGSA 3KAEA 3JYSA 4AEZC 4K03A 4GB9A 3PRZA 3LJ3A 2IU1A 4X8QA 5EN5D 4CCAA 2E2EA 3AS5A 2AVPA 2OEVA 4EPZA 2VGXB 5KJKA 4LG6A 3S7JA 5JJ6A 1H6PA 5E76A 3R9MA 1N4RA 2L0IA 3CVXA 1FT1A 3UKRG 2I2OA 5G05C 4HFGA 4HI9A 5D66A 3ZXSA 3DSUA 4GTPA 4N3CA 5BUZA 5EX3A 2WXMA 2B6CA 2BEDA 4B93B 3UX4A 4TXQA 3CHPA 3PNTB 4LRZA 1H0AA 2GRQB 5BXOA 3DSWA 2LO6A 4G25A 3TWQA 4WNDA 5G2NA 3Q7AA 4KXKB 2WXNA 3PZ4A 2KZTB 4F6RD 2VGEA 3SFYA 4DLOA 4FADA 3LVQE 3D9HA 1TNBA 2VSXE 4CDNA 2LUHA 2YHEA 4J8FA 5EIDA 4QFVA 3LKUA 5ARGA 4CT0A 3ISMC 3LY8A 3EHRA 3LEWA 3CGHA 3JUEA 4EZKA 5JA4D 1LF8A 4XKCA 2WQ6A 3AG3E 2KM4A 2GRPB 4GA1A 3SQVA 4EBAG 4HOUA 4OYSA 5CERB 1WG0A 2I1KA 3HXEA 2WXFA 3MKQB 2BUGA 4GTRA 3SFXA 3ABLE 3G2TA 2VGXA 5ARFA 4GMJA 3T5VA 1OWPA 2IQCA 5BT1A 5FZSA 2LAIA 5ITZF 1ZU2A 3HG0D 3U4TA 1SA5A 1FCHA 1E96B 4XKBA 1K1AA 2IO3C 4OAVB 2AWIA 4KYOB 4LUNU 4N5QA 3OXFA 3C98A 1TJFA 5J08A 5KWDA 2XZTG 4M3OA 2LAHA 4HLLA 2CFUA 2XZDG 4AXHA 1D8EA 4URKA 4LSZE 1PC2A 4UI9J 1KLXA 3CVQA 3Q5MA 3L08A 4FU3A 1N52A 1V54E 1JWGA 2CHWA 5D0QD 2RFMA 3Q47B 4IN3B 1E8YA 3APCA 4FHJA 2FBNA 1IHGA 4XX5A 5A23A 2A4ZA 3D9NA 4U8HA 1LTXA 3B7RL 3FUDA 1TEZA 3FUKA 3ZVVA 3PNLB 1E7VA 2NXPA 4K0RA 3ZYLA 3RSEG 1G3NB 3PE4A 4MRUA 3PZDA 3B7BA 2WPVA 4CT4A 3MGBA 2F8XK 1O1RA 3UQ3A 2XQ0A 3TWUA 3W9GA 1K3ZD 3ZYMA 4XIFA 3AG4E 4CDRA 3X2QE 2WM9A 3DBSA 3FTVA 1E8ZA 3ZXPA 1U3DA 3MV2B 4F3VA 2ETBA 2IOLA 3SF4A 3B13A 5T3RA 4U8YD 4GYWA 1VDYA 4APFA 3HIZA 4ANXA 3Q15A 4W9RA 5CCMA 2F37A 5A7DB 4I2WA 5HQ8A 2J08A 4GYOA 2FO7A 4DJAA 4KZCA 3HVEA 5G04J 2WVIA 2WXPA 1IXVA 3V31A 3TG5A 1TN7A 3EUVA 4UQZA 2XS1A 3FULA 3FWVA 3HXBA 3G2UA 1HF8A 3O4ZA 5D2MC 2WXRA 3Q9UC 3URZA 5HI7A 3JQ0A 3QWPA 2WMNA 3FUIA 3TWVA 5EX0A 4LNUD 3UT4A 4GZ3A 4JXTA 3T8KA 2WQHA 3T5XA 2VYIA 4TUMA 3Q9NC 2WXGA 3U64A 5FJYA 3ASHA 3MCXA 4AM9A 5EYLA 3PVLA 3QAQA 2P9UG 5EDSA 2WXOA 2C2LA 3U9WA 1OWLA 3FDHA 4UI9C 2YHCA 4YDEA 1KT1A 2IEJA 3TL5A 1SZAA 2XPZA 4WWNA 4HB5A 3CK8A 4GYYA 3OTNA 2VTBB 2KC7A 5AIJA 3KSQA 3E33A 4GAAA 4XEIG 3UIPC 4ZFHA 2DZNA 2DIWA 4FULA 1OCCE 1D9SA 2I6HA 1D8DA 1N4QA 3L9TA 1Z3YA 4RVBA 1HZ4A 4U7EB 4KBQA 3ZGQA 1EDUA 2V8SE 2OV8A 5IY5E 1YCSB 3TWXA 1MJ0A 3LY7A 4JHKA 3IHVA 3RRMB 1H2UA 4G23A 2YQ8A 1K1BA 2GW1A 3RU0A 5J90A 2HE0A 3EHMA 3MV3B 4Y6CA 1IQUA 2KCVA 3QWWA 1IQRA 3AU4A 3GW4A 2XCBA 1QBQA 2DWZA 3DSXA 1RZ4A 4N39A 1TNUA 3B7SA 3Q75A 3ZEFA 5KCMA 1EF1C 2R03A 2MRIA 3D3MA 1TN6A 4G24A 2XGMA 1KPSB 4TV3A 2PM6A 4I1AA 4ANUA 3CVWA 2WXIA 4GA2A 4DLQA 1E8XA 4EHMA 3Q49B 4U8VD 2H6GA 2VSYA 4EZJA 1NI1A 3DPYA 5AQ9A 3RKVA 1HX8A 4U95D 4N2QA 4B94A 1UJKA 3AAAC 2IFUA 5ENSD 3QK0A 1ZB1A 1N11A 3HXCA 3LXUX 2MOWA 2YNQA 4FC8A 4U63A 4RG6A 3MKQA 4YDYA 3ASGA 4AIFA 5LOZA 4ATZD 3FY4A 4JHRA 3SBTB 3Q73A 5AJLA 4BERA 4GZ5A 4N3BA 1SZ9A 4K5AB 1N9AA 4ME2A 3ASNE 4N2SA 1UN8A 2HM8A 3CHQA 3L6AA 1XNFA 3FH5A 4BETA 3HYMB 5CECB 2VSNA 4WUYA 4TXRA 2KZTA 4HRMB 2Y3AA 3SI5A 4HVBA 2XRZA 3DSVA 4YNDA 5JHBA 4DX1A 3BG1B 2V4LA 3TAXA 4PS8A 3RO3A 1NFIE 4JD2G 4HXIA 5HS0A 4UWFA 3PZ1A 3ZIMA 3OXGA 5JHAA 1INZA 4BFRA 3V79K 1MX2A 2KCLA 4O60A 3PZ2A 5M72A 4I17A 2EQXA 2CHXA 3W9FA 2XEVA 5C1DA 1KT0A 2IY0C 2VTBA 3LPZA 4ANWA 1RW2A 5ANLA 1HS6A 3SFZA 4RLYA 4NURA 1TR4A 4NQ0A 4TXPA 2Y0BG 4FJZA 1Z5SC 3NBNB 1HU3A 4GPMA 3N71A 1NA3A 5FZRA 5FQ8A 2JLBA 2F8YA 3GZSA 4L7TA 3Q7FA 3SO8A 3V2XA 4Z68A 1E90A 3FUHA 5AN8A 2V0PA 2GRRB 2AXVA 2XEEA 2NYJA 4I2ZA 3UINC 3UM0A 2CG3A 5LFAA 1W3BA 4CGVA 5FINA 3BG0B 4I1OB 3HDXA 4A3VA 1Y6IA 2L9BA 3CR3A 2HYZA 2IO2C 5JJ7A 5ENOD 3J5QB 5JJTA 3KS2A 3TWSA 2XHEA 1TYQG 3SGHA 4L9PA 3IHYA 5AQBA 2ZXWE 2EINE 4CGWA 2P9KG 4RSYA 1N4PA 3UUXA 4UI9K 1NP7A 3ONKA 3FUFA 3ZHEA 5BV1A 4WWOA 3FUMA
chains in the Genus database with same CATH topology
3ZYMA 2CHZA 1GW6A 4I9CA 5A6CA 4XIFA 4XE0A 4CDRA 2WM9A 3DBSA 3FUEA 3ML9A 3FTVA 3ZRHA 3CV0A 3ZYQA 1E8ZA 3L16A 3CLJA 3APDA 4WNEA 1U3DA 3ESKA 3TXNA 3NZSA 3FEYA 5LP0A 3IV0A 5AENA 1ELRA 2VJ8A 3B7TA 5DBKA 1DVPA 2ONDA 2VSOE 3LCAA 3MV2B 4F3VA 2IOLA 4R7LA 1ELKA 3SF4A 3B13A 5T3RA 3QOUA 2MHKA 5AJDA 3S7BA 1HH8A 2X3MA 3ZW3A 4GYWA 5T8IA 1VDYA 3OXLA 4I43A 3HIZA 4APFA 4ANXA 3Q15A 3L13A 3EIQC 5BW8C 2J09A 2Y4UA 4W9RA 4GZDA 2WXQA 3CQGB 2V5FA 3DPDA 3RIBA 3TXMA 5CCMA 5A7DB 2J49A 4JA9A 3R7RA 4I2WA 4EECA 5HQ8A 2ZU6B 4UWHA 2J08A 3MKRA 1L5JA 5T4YA 3RRNB 4GYOA 3QB2A 2Y4TA 3HVEB 2GRMA 2AXZA 2FO7A 4YVQC 4ATGA 4DJAA 5FT9A 4KZCA 4HOQA 2IONA 3HVEA 2WXLA 1DNPA 3ZHEB 3D9KA 3LY9A 4MLPA 4G2VA 5G04J 2WVIA 2WXPA 3EIJA 4U0UA 4UWLA 4ABNA 3TG5A 1TJCA 2X6FA 3VLFA 4AY6A 4TUUA 4FLBA 4B0ZA 4A1GA 3CHMA 4UQZA 4IRUA 2P58C 1EYHA 3FULA 3NQPA 1OWNA 2LSVA 3FWVA 3G2UA 1HF8A 2PQNA 2L6JA 3O4ZA 3CHSA 3GYZA 3ZN3A 3FU6A 3G2WA 2R59A 3PH0C 3D9OA 4U04A 2M63A 1HFAA 2OVFA 2LSUA 2WXRA 4NACA 3URZA 3I4GA 4C0MA 5HI7A 3JQ0A 3QWPA 3QDNA 2WMNA 1QNFA 3FUIA 3ZFWA 4HLEA 3D9IA 5KJLA 3CKCA 4JEUA 5EX0A 4B89A 2YINA 1X5BA 3UT4A 3TG4A 3S2AA 3ASFA 4GZ3A 4JXTA 4APOA 4UQYA 2WQHA 3T5XA 3VLEA 1WM5A 2VYIA 4MS6A 3FTXA 3PDNA 1Y8MA 3K9IA 3FTUA 2FEZA 4U07A 2WXGA 4B8CB 2RD0A 3TJPA 3LYAA 4RG9A 1XGWA 3FUJA 4KVOA 2X38A 3U64A 2R17C 5FJYA 3ASHA 4DK5A 3PUKA 3QJZA 5E75A 1JPLA 2ILRA 3MCXA 4AM9A 4ANVA 3PVLA 3QAQA 4AP2A 3PREA 1WY6A 4U0SA 2FULA 4BY6A 3CEQA 2KCKA 4A1SA 2Q7FA 4LEUA 4IYPA 5EDSA 2WXOA 3GZ1A 2C2LA 3U9WA 1OWLA 3FDHA 3PEUB 4UI9C 3CQCB 2YHCA 4ILGA 1KT1A 4GZCA 5FQ6A 3TL5A 2WB2A 1SZAA 3ULQA 2XPZA 4DPRA 4KMOA 4FA6A 3FTWA 1PY1A 4GCOA 4WWNA 3RJVA 2XPYA 3P1UA 2OOEA 3CK8A 3I4RB 3QWVA 3OAWA 1ELWA 4GYYA 3OTNA 4JHJA 2VTBB 2A5UA 2KC7A 3CSTA 3FU0A 3PEVB 5AIJA 3IEGA 2UY1A 4GAAA 3D9PA 3HHMA 4N5CA 1BPOA 2HR2A 4L2YA 5FQ4A 1A17A 3CIAA 2E0IA 2DIWA 4L23A 4FULA 4LCTA 4OVVA 1FVHA 1H2TC 1OUVA 2I6HA 4EQFA 2RG8A 3TGOA 3O48A 4JC8A 3ZPJA 4AY5A 4FLHA 3UMVA 1P5QA 1Z3YA 3SD5A 2XRYA 4RVBA 1HZ4A 1FVFA 4H7XA 4F53A 2J07A 4B8AA 1EPUA 5CHEE 4JZYA 3CVUA 4KBQA 3ZGQA 1EDUA 4HOTA 2I9CA 2V8SE 3FH8A 1NZNA 4P29A 4Q96A 3U66A 3JUIA 3MX3A 2OV8A 1QZ2A 3CSFA 3CKBA 4WNFA 2PZIA 2IJGX 3AS8A 2XPIA 3LY7A 1IYGA 4G1TA 4JHKA 4F7AA 4JL0A 5KJMA 2L0TB 4I6EA 1UN9A 3IHVA 4FP7A 1HXIA 4HS2A 3ONLA 3RRMB 1H2UA 4G23A 2YQ8A 3FTZA 3MJWA 2GW1A 3D9LA 3PE3A 4UWGA 1HO8A 5DIZA 3CHRA 3I5PA 3P2BA 4PS3A 1H6KA 3KD7A 3RU0A 3IBEA 5J90A 5BPPA 3EHMA 3MV3B 4I9EA 2XGOA 4Y6CA 1IQUA 2KCVA 3QWWA 5BV0A 1IQRA 3AU4A 3GW4A 2X6KA 2XCBA 1HG2A 1YA0A 3FEXA 2KATA 3IKOB 2XGSA 3KAEA 4UQXA 3JYSA 4AEZC 4K03A 4GB9A 4IULA 3PRZA 3FUNA 3LJ3A 4N39A 3B7SA 2IU1A 3ZYKA 4J8DA 3ZEFA 4CCAA 4G26A 2E2EA 1SQMA 4ILIA 5KCMA 3AS5A 1EF1C 3R7QA 5LCWC 1Z3XA 2AVPA 2MRIA 3D3MA 4XZ4A 3AU5A 4G24A 4EPZA 3FU5A 4I6JA 4LERA 2VGXB 3FHEA 5KJKA 3ML8A 2XGMA 3CHOA 4EZLA 4AJWA 3S7JA 4JVSA 5JJ6A 4V3IA 3KEZA 2PM6A 4TV3A 3PUJA 4I1AA 4ANUA 3FTYA 3CVWA 5E76A 2WXIA 2L0IA 4GA2A 4DLQA 4U0ZA 3CVPA 3CVXA 1E8XA 4OVUA 3Q49B 2DBAA 3CK7A 1E8WA 2I2OA 5G05C 4HFGA 4BT8A 2VSYA 4EZJA 3ZXSA 2GRLA 3UPVA 4N3CA 5BUZA 3U3WA 1B89A 2CFZA 3RRUA 5EX3A 3RKVA 1HX8A 3RK6A 4KZ0A 5EKQD 4N2QA 3FFLA 2WXMA 4B94A 1JWFA 1UJKA 3PS6A 1N54A 2IFUA 1S0PA 3UX4A 3CHPA 3QK0A 3PNTB 2PM7A 4LRZA 4PUCA 4GZ6A 4ACLA 1H0AA 3LXUX 3VTYA 2PQRA 2MOWA 2WMOA 2YNQA 4FC8A 4U63A 4RG6A 3MKQA 3ASDA 4DI3A 3ASGA 2LO6A 4PH4B 4AIFA 5LOZA 3FY4A 3L17A 4G25A 4JHRA 4WNDA 4YVOA 5G05J 3SBTB 3VLDA 4BT9A 5G2NA 3WXXA 5AJLA 4KXKB 3NF1A 4GZ5A 4BTAA 2WXNA 4N3BA 4E6HA 4JEHA 1SZ9A 2KZTB 1UJJA 3SZ7A 2CG2A 3NZUA 4ME2A 4TRQA 1JUQA 3MEKA 5ENNA 4AVXA 4DLOA 4FADA 3LVQE 2VQ2A 2R5SA 4JA7A 2VSXE 3MZLB 4CDNA 4N2SA 2YHEA 1UN8A 4J8FA 2PL2A 4FHKA 2HM8A 3CHQA 3L6AA 1XNFA 1OWMA 4Q69A 4GU5A 4J6IA 4QFVA 3LKUA 4NRHB 4CDMA 5ARGA 3QNKA 4J0UA 3FH5A 4BTBA 4CT0A 4H7YA 3BEEA 2DCPA 3LY8A 3LEWA 3HYMB 3CGHA 2VSNA 3RO2A 4WUYA 2X6IA 4ILHB 1LF8A 4XKCA 4EZKA 5LX8A 2KZTA 2WQ6A 2J9QA 4PS7A 2Y3AA 1Z6TA 3QARA 3SI5A 1E7UA 1HG5A 2KM4A 3E4BA 3R9AB 3SNXA 4HVBA 4YNDA 2XRZA 5JHBA 4GA1A 3CVNA 4EBAG 4HOUA 4OYSA 4G11A 2I1KA 4GA0A 4O6FA 3BG1B 2FF4A 1HE8A 2V4LA 2WXFA 3MKQB 4MKTA 4I6GA 3T8MA 2BUGA 4L2LA 3TAXA 4C9BB 3G2TA 3GZ2A 4PS8A 2BTDA 3FH7A 4J8EA 4KT6B 4HXIA 4N3AA 5C2YA 3RO3A 4UWFA 2VGXA 5G04C 3ENEA 3LDZA 4Q94A 5D0OD 5ARFA 3ZIMA 4GMJA 3T5VA 1OWPA 4PDXA 3OXGA 2IQCA 5JHAA 1INZA 3S7DA 5BT1A 2X6HA 4GMLA 3SBSA 4BSXA 3S7FA 5FZSA 5AYWD 2OVBA 2QY7A 5FQ7A 2LAIA 1H2VC 3LS8A 4BFRA 4D10C 5CMWA 1ZU2A 1NA0A 2KCLA 4JPSA 2J4BA 3APFA 3U4TA 3MYVA 3JQ1A 5CMYA 1U3CA 3EJNA 1QQEA 3QC1A 3EDTB 2NSZA 5M72A 4I17A 2EQXA 2GGFA 1FCHA 2CHXA 3CVLA 1E96B 2BF0X 2IOSA 5FWQA 4F1SA 1ZBPA 4XKBA 5KJNA 2XEVA 5C1DA 2AWIA 2AXUA 3Q4AB 1KT0A 4KYOB 4BWRA 3G2SA 4GCNA 4LUNU 2I1JA 2WXHA 2VTBA 2FI7A 3LPZA 1MHQA 3OXFA 2VGYA 3C98A 2HO1A 1TJFA 2XCCA 2C0MA 4ANWA 5ANLA 5J08A 4M3OA 2LAHA 4WAFA 1HS6A 1OWOA 3SFZA 4E85A 3QKYA 1UW4B 1WAO1 2CFUA 4AV7A 4NURA 4KVMA 4AXHA 4NQ0A 2JEKA 4URKA 2AW6A 3LVRE 2NC9A 4FJZA 2IF4A 2C0LA 3I3NA 4J8SA 5CCLA 4JW1A 3G2VA 4DI4A 1PC2A 4UI9J 3JCKC 3SHFA 1HU3A 1KLXA 3ESLA 4UWKA 3N71A 4Y6WA 1NA3A 4L1BA 3CVQA 5FZRA 4WNGA 3AS4A 5FQ8A 2JLBA 4CEMA 2WXJA 4L7TA 3GZSA 4AOFA 4BX9A 4HORA 1E90A 3FUHA 5BNWA 3CVVA 2V0PA 3Q5MA 3D9JA 3L08A 1UG3A 4FU3A 3CVYA 1N52A 3FTSA 2AXVA 5LCWJ 1JWGA 2CHWA 5D0QD 3Q47B 4IN3B 1H19A 1E8YA 3APCA 4FHJA 4ACKA 5G55A 2WXKA 3L22A 2FBNA 4I2ZA 5FZQA 4FJYA 3VTXA 2CG3A 4XI0A 5LFAA 3D9MA 4WWPA 1W3BA 4CGVA 5FTPA 3B7UX 1IHGA 3BG0B 4I1OB 4XX5A 3UT7A 3HDXA 2UY1B 2A4ZA 5A23A 3FU3A 3D9NA 4U8HA 1Y6IA 4A3VA 2L9BA 3B7RL 3FUDA 1TEZA 3CR3A 4I1MA 1PAQA 2HYZA 4A3TA 3FUKA 3ZVVA 4BX8A 2J4DA 3PNLB 1E7VA 2NXPA 2X6JA 4K0RA 3ZYLA 4C0EA 2QFCA 5JJ7A 5JJTA 3PE4A 4GPKA 4MRUA 3FP3A 2UWJG 3KS2A 3L54A 3PZDA 4XI9A 2WPVA 4CRWA 2LNIA 2XHEA 5ANRA 3EHNA 3SGHA 4HOSA 1MQSA 3IHYA 4CT4A 3MGBA 4A55A 3MA5A 4CGWA 4RSYA 2WQ7A 3UQ3A 2XQ0A 3UUXA 4UI9K 1NP7A 4EBAA 3ONKA 3UT8A 3FUFA 3ZHEA 3CK9A 5BV1A 4WWOA 3FUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7F A;  4I9C A;  5FZS A;  3Q49 B;  5AYW D;  2DBA A;  4XIF A;  5A6C A;  3CK7 A;  4U0S A;  4CDR A;  5G05 C;  1ZU2 A;  4BT8 A;  1NA0 A;  2KCL A;  3CEQ A;  2KCK A;  3CV0 A;  4A1S A;  2Q7F A;  4LEU A;  3U4T A;  2VSY A;  3GZ1 A;  2C2L A;  4UI9 C;  1QQE A;  4WNE A;  3EDT B;  2YHC A;  3ESK A;  5M72 A;  3UPV A;  1KT1 A;  4I17 A;  4N3C A;  1B89 A;  3U3W A;  5EX3 A;  3RKV A;  1FCH A;  3ULQ A;  3CVL A;  1E96 B;  1ELR A;  5KJN A;  1ZBP A;  5DBK A;  5EKQ D;  2XEV A;  3FFL A;  4GCO A;  4B94 A;  2OND A;  3RJV A;  3LCA A;  3Q4A B;  1KT0 A;  2OOE A;  3CK8 A;  3MV2 B;  3QWV A;  2IFU A;  1ELW A;  4GCN A;  4GYY A;  4KYO B;  3SF4 A;  4BWR A;  3QOU A;  2MHK A;  3S7B A;  1HH8 A;  2FI7 A;  3LPZ A;  2KC7 A;  4GZ6 A;  3OXF A;  4GYW A;  2VGY A;  2HO1 A;  2UY1 A;  2XCC A;  2C0M A;  3IEG A;  3OXL A;  4N5C A;  3VTY A;  2HR2 A;  1A17 A;  3Q15 A;  2PQR A;  5BW8 C;  5C1D A;  2Y4U A;  4W9R A;  3QKY A;  4EQF A;  1OUV A;  2I6H A;  2V5F A;  3RIB A;  5CCM A;  1WAO 1;  3TGO A;  3O48 A;  5A7D B;  4RG6 A;  4JA9 A;  3ZPJ A;  4I2W A;  4AY5 A;  1P5Q A;  3ASD A;  5HQ8 A;  3ASG A;  4NQ0 A;  4AIF A;  3MKR A;  1HZ4 A;  2NC9 A;  4G25 A;  4GYO A;  2IF4 A;  4H7X A;  4JHR A;  2C0L A;  2Y4T A;  4WND A;  5CHE E;  4YVO A;  5G05 J;  3WXX A;  5CCL A;  1PC2 A;  4UI9 J;  2FO7 A;  4YVQ C;  4BT9 A;  5FT9 A;  4KXK B;  1KLX A;  4HOQ A;  3NF1 A;  4GZ5 A;  4KBQ A;  3ZGQ A;  4BTA A;  3N71 A;  4N3B A;  1NA3 A;  4Y6W A;  3CVQ A;  3LY9 A;  3ZHE B;  4HOT A;  1NZN A;  4G2V A;  5FZR A;  4WNG A;  3AS4 A;  5G04 J;  2JLB A;  3SZ7 A;  1QZ2 A;  4U0U A;  3CKB A;  4ABN A;  4WNF A;  4ME2 A;  1TJC A;  3TG5 A;  4HOR A;  2PZI A;  5BNW A;  3MEK A;  4AY6 A;  3AS8 A;  2XPI A;  3LY7 A;  3Q5M A;  4UQZ A;  2VQ2 A;  2R5S A;  5LCW J;  1IYG A;  2P58 C;  4G1T A;  5D0Q D;  4JA7 A;  4JL0 A;  5KJM A;  3Q47 B;  4IN3 B;  4N2S A;  2LSV A;  3FWV A;  4J8F A;  2PL2 A;  1HXI A;  2PQN A;  1XNF A;  2FBN A;  2L6J A;  4G23 A;  4I2Z A;  5FZQ A;  2YQ8 A;  3VTX A;  3LKU A;  4NRH B;  4XI0 A;  2GW1 A;  3PE3 A;  3GYZ A;  5DIZ A;  5ARG A;  3ZN3 A;  4J0U A;  4BTB A;  4H7Y A;  1W3B A;  3BEE A;  3KD7 A;  5FTP A;  3RU0 A;  4APO A;  4U04 A;  4CGV A;  1IHG A;  3LY8 A;  2UY1 B;  2LSU A;  3HYM B;  2VSN A;  3MV3 B;  4I9E A;  2XGO A;  4WUY A;  4Y6C A;  3RO2 A;  2KCV A;  3QWW A;  3QWP A;  5HI7 A;  3URZ A;  3QDN A;  2HYZ A;  3GW4 A;  2XCB A;  2J9Q A;  1YA0 A;  4N2Q A;  2KAT A;  2XGS A;  3KAE A;  4UQX A;  3JYS A;  4F3V A;  3E4B A;  3ZFW A;  3R9A B;  5KJL A;  2QFC A;  3CKC A;  4YND A;  5EX0 A;  4GA1 A;  4N39 A;  3CVN A;  5JJ7 A;  4HOU A;  5JJT A;  3PE4 A;  4GPK A;  4GA0 A;  4J8D A;  3FP3 A;  4O6F A;  2FF4 A;  4G26 A;  2UWJ G;  3ASF A;  3KS2 A;  2E2E A;  4GZ3 A;  3TG4 A;  4UQY A;  3AS5 A;  2WPV A;  2WQH A;  2LNI A;  4XI9 A;  1WM5 A;  2VYI A;  5LCW C;  2BUG A;  2AVP A;  4HOS A;  3TAX A;  3GZ2 A;  3PDN A;  4J8E A;  1Y8M A;  4G24 A;  4N3A A;  3RO3 A;  3MA5 A;  2VGX B;  3K9I A;  2VGX A;  2FEZ A;  4U07 A;  4CGW A;  5G04 C;  5KJK A;  2XGM A;  5D0O D;  5ARF A;  3LYA A;  5JJ6 A;  3S7J A;  4RG9 A;  3UQ3 A;  3UUX A;  4I1A A;  4UI9 K;  5FJY A;  3ASH A;  3OXG A;  4GA2 A;  4U0Z A;  3CVP A;  3CK9 A;  3ZHE A;  3S7D A;  5BT1 A;  4AM9 A; 
#chains in the Genus database with same CATH topology
 5A6C A;  4XE0 A;  1OT8 A;  2EIL E;  3EU5 A;  4WNE A;  3ESK A;  3TXN A;  3FEY A;  5LP0 A;  5AEN A;  5DBK A;  4M7C A;  2VSO E;  3NB2 A;  2P2C P;  3QOU A;  2MHK A;  1OCR E;  1KZP A;  4GTM A;  4I43 A;  3L13 A;  3R7R A;  3E34 A;  4DX2 A;  2P9P G;  3QB2 A;  2Y4T A;  2AXZ A;  4HOQ A;  2ION A;  3ZHE B;  2F0Y A;  2X6F A;  3UTM A;  4TUU A;  4FLB A;  4A1G A;  3CHM A;  3ZUV B;  2LSV A;  3UI2 A;  3ZN3 A;  3FU6 A;  3D9O A;  1HFA A;  4BSZ B;  3D9I A;  1X5B A;  2KXP C;  2DYS E;  3TG4 A;  4APO A;  3VLE A;  4MS6 A;  2GRN B;  3HRA A;  3C5R A;  3K9I A;  4B8C B;  1FT2 A;  4RG9 A;  4BES A;  2H6I A;  5E75 A;  4AP2 A;  3UM3 A;  4BY6 A;  2QC9 A;  3C3O A;  1FPP A;  2BKG A;  4IYP A;  3NOC D;  2WB2 A;  4FA6 A;  3WG7 E;  3FTW A;  1PY1 A;  5EIL A;  2FO1 E;  4GCO A;  2XPY A;  3P1U A;  2OOE A;  3I4R B;  3QWV A;  2A5U A;  2R05 A;  3PEV B;  3IEG A;  1BPO A;  5FQ4 A;  5B1B E;  3DWL G;  1OUV A;  3TGO A;  3O48 A;  4JC8 A;  2XS8 A;  3UMV A;  2GRO B;  4G8K A;  1FVF A;  5CHE E;  3CVU A;  1N4S A;  2I9C A;  3MX3 A;  3CSF A;  4JB8 P;  4WNF A;  3DST A;  1IHB A;  3AS8 A;  1IYG A;  4F7A A;  2B0O E;  2L0T B;  4I6E A;  1HXI A;  4HS2 A;  3MJW A;  3CHR A;  2Y69 E;  4HNA D;  5BPP A;  2XGO A;  1YMP A;  1HG2 A;  1YA0 A;  1MYO A;  3AG2 E;  4GTT A;  5AAO A;  3ZYK A;  4J8D A;  4G26 A;  3R7Q A;  4ILI A;  4NIK A;  5LCW C;  1Z3X A;  4LER A;  3FHE A;  4BEP A;  3PZ3 A;  3ML8 A;  4JVS A;  4V3I A;  3B95 A;  3FTY A;  1K8K G;  1TNZ A;  1NL4 A;  4U0Z A;  4O1P A;  4OVU A;  2J8S D;  2GRL A;  3UPV A;  3U3W A;  1B89 A;  2CFZ A;  3NAW A;  4CYM D;  3Q78 A;  1N54 A;  3AJI A;  4PUC A;  2QYU A;  4GZ6 A;  4ACL A;  1U2V G;  3VTY A;  4HQD A;  1X81 A;  1A5E A;  4PH4 B;  4BT9 A;  3VLD A;  3WXX A;  2V4H C;  3NF1 A;  1S64 A;  3KEA A;  1UJJ A;  3SZ7 A;  3NZU A;  4TRQ A;  1JUQ A;  3E32 A;  5ENN A;  1O1S A;  5H7P A;  4JA7 A;  3MZL B;  2PL2 A;  4FHK A;  4LNG A;  1OWM A;  1OXJ A;  4J6I A;  4J0U A;  4O1O A;  2X6I A;  5LX8 A;  3HXF A;  2J9Q A;  4PS7 A;  3QAR A;  1E7U A;  1HG5 A;  2BKK B;  3SNX A;  3CVN A;  4G11 A;  1HE8 A;  2H6F A;  3NOG D;  4L2L A;  2BTD A;  3FH7 A;  4J8E A;  4KT6 B;  4N3A A;  3ENE A;  3ABK E;  2L6B A;  1JCS A;  1MX6 A;  3S7D A;  4GML A;  4BSX A;  3S7F A;  5CRU A;  2ZIR A;  2OVB A;  2QY7 A;  5CMW A;  5FQ7 A;  1H2V C;  4D10 C;  1NA0 A;  4JPS A;  3APF A;  4GTV A;  5CMY A;  1U3C A;  3EJN A;  1QQE A;  3QC1 A;  3EDT B;  3CVL A;  5FWQ A;  1ZBP A;  3RAU A;  4BWR A;  3G2S A;  4GCN A;  2I1J A;  2ZGG A;  2FI7 A;  1MHQ A;  2XCC A;  1OWO A;  4E85 A;  3L82 A;  3TWW A;  2JEK A;  2AW6 A;  3LVR E;  2NC9 A;  2IF4 A;  2C0L A;  5CCL A;  4JW1 A;  4DI4 A;  5BXU A;  3ESL A;  4Y6W A;  2WXJ A;  2JAB A;  4BX9 A;  4HOR A;  5BNW A;  3CVV A;  3AG1 E;  1UG3 A;  1QYM A;  3ASO E;  3FTS A;  2R02 A;  5LCW J;  1H19 A;  5G55 A;  5FZQ A;  4FJY A;  4XI0 A;  3D9M A;  4WWP A;  5FTP A;  3B7U X;  2UY1 B;  5AQ7 A;  3C3R A;  4I1M A;  4BX8 A;  2X6J A;  4GPK A;  3FP3 A;  3L54 A;  4CRW A;  5ANR A;  1MQS A;  2EIM E;  4A55 A;  3MA5 A;  2WQ7 A;  4DX5 D;  3DXK G;  4EBA A;  3BU8 A;  1DCQ A;  3UKU G;  3FUE A;  3ML9 A;  3CV0 A;  1TN8 A;  3IV0 A;  1N0Q A;  1KZO A;  1ELR A;  3B7T A;  1DVP A;  4R7L A;  3S7B A;  1HH8 A;  2X3M A;  3ZW3 A;  3OXL A;  4DX6 D;  2Y4U A;  4GZD A;  2WXQ A;  3RIB A;  4EEC A;  4JA9 A;  3MKR A;  5T4Y A;  4HRL A;  4YVQ C;  4ATG A;  1UOH A;  3UM2 A;  2WXL A;  4MLP A;  4UWL A;  4ABN A;  1TJC A;  3VLF A;  4AY6 A;  1OY3 D;  2P58 C;  1EYH A;  1LD7 A;  3DEO A;  1JCQ A;  4HBD A;  2PQN A;  3C3Q A;  3CHS A;  5CBN A;  5KNH D;  3PH0 C;  2M63 A;  2OVF A;  2LSU A;  3F6Q A;  3I4G A;  3QDN A;  1QNF A;  1O5M A;  1DCE A;  3ZFW A;  4HLE A;  3CKC A;  2YIN A;  3S2A A;  3ASF A;  4UQY A;  1SA4 A;  1BU9 A;  1Y8M A;  2FEZ A;  4U07 A;  3TJP A;  5HRY A;  3FUJ A;  4KVO A;  2ILR A;  3ABM E;  2R2L A;  3V30 A;  3PRE A;  4U0S A;  2FUL A;  2A5E A;  3CEQ A;  4A1S A;  2Q7F A;  3CQC B;  4ILG A;  4G8L A;  4GZC A;  5FQ6 A;  4DPR A;  3RJV A;  1ELW A;  5EIB E;  4A63 B;  3FU0 A;  3D9P A;  3HHM A;  4L2Y A;  3CIA A;  4LCT A;  4ZHB A;  1H2T C;  2RG8 A;  3ZPJ A;  4AY5 A;  4J7W A;  3TWT A;  3DSS A;  4YDO A;  4F53 A;  3SD5 A;  2XRY A;  4H7X A;  2PNN A;  4OAU C;  3UIO C;  5CRV A;  2P9S G;  4HOT A;  4Q96 A;  3JUI A;  3LJN A;  1H6O A;  2IJG X;  2H6H A;  1UN9 A;  1BLX B;  3IXE A;  1N94 A;  3FTZ A;  3D9L A;  3PE3 A;  4UWG A;  1HO8 A;  4K5C A;  5DIZ A;  3I5P A;  4PS3 A;  3KD7 A;  1S63 A;  2AJA A;  1BD8 A;  5BV0 A;  3Q79 A;  5ENP D;  1Q2Z A;  2P9I G;  3IKO B;  4UQX A;  2OEW A;  4IUL A;  3FUN A;  3ULE G;  1SQM A;  4MBG A;  4XZ4 A;  3AU5 A;  3E30 A;  3FU5 A;  4I6J A;  4GTS A;  4EZL A;  3CHO A;  4AJW A;  3ULY A;  3KEZ A;  3PUJ A;  3CVP A;  2DBA A;  4F1P A;  3CK7 A;  1E8W A;  4BT8 A;  4DUI A;  1N95 A;  3HXD A;  3V2O A;  2RKK A;  4U96 D;  3RRU A;  3RK6 A;  1WDY A;  4KZ0 A;  5EKQ D;  3FFL A;  3BQO A;  1JWF A;  1TNO A;  3PS6 A;  1S0P A;  2PM7 A;  4DRX E;  2PQR A;  2WMO A;  3ASD A;  4DI3 A;  3ZU7 B;  3L17 A;  5G05 J;  3JXI A;  4YVO A;  4BTA A;  4E6H A;  4JEH A;  5JMN D;  1MX4 A;  2CG2 A;  3MEK A;  4AVX A;  2VQ2 A;  2R5S A;  4GTO A;  4Q69 A;  4GU5 A;  4NRH B;  4CDM A;  3QNK A;  4BTB A;  4H7Y A;  3BEE A;  2DCP A;  5FIO A;  1BI7 B;  3RO2 A;  4ILH B;  1AP7 A;  3J5P A;  2XEN A;  1Z6T A;  3E4B A;  2ETC A;  3R9A B;  2P9N G;  3JXJ A;  4GA0 A;  4O6F A;  2FF4 A;  5B1A E;  4MKT A;  4I6G A;  3T8M A;  1V55 E;  4C9B B;  3ZRH A;  3GZ2 A;  5C2Y A;  5G04 C;  3LDZ A;  4Q94 A;  3E37 A;  5D0O D;  5CEA A;  4K5B A;  1N0R A;  4PDX A;  2X6H A;  3SBS A;  5AYW D;  3C72 A;  3LS8 A;  3EHQ A;  2J4B A;  5EYP F;  3MYV A;  3JQ1 A;  2NSZ A;  1JCR A;  2GGF A;  3KSL A;  4F1S A;  2BF0 X;  2IOS A;  5KJN A;  4DX7 D;  1AWC B;  2AXU A;  3Q4A B;  1MZC A;  2WXH A;  2VGY A;  4UUC A;  2HO1 A;  2C0M A;  3UXG A;  4WAF A;  2DVW A;  2DYR E;  3QKY A;  1UW4 B;  1WAO 1;  4AV7 A;  2LXL A;  4KVM A;  3T9K A;  1IKN D;  3I3N A;  4J8S A;  3G2V A;  3JCK C;  3SHF A;  2KBX A;  2LXM A;  4UWK A;  4L1B A;  4WNG A;  3AS4 A;  4CEM A;  4AOF A;  2ETA A;  3CVY A;  3D9J A;  4ACK A;  2WXK A;  3L22 A;  5KBA A;  3VTX A;  5AQA A;  1S70 B;  3BUA A;  3UT7 A;  3FU3 A;  1PAQ A;  4A3T A;  1SW6 A;  2J4D A;  4C0E A;  2QFC A;  2UWJ G;  4XI9 A;  2LNI A;  3EHN A;  4HOS A;  1YYH A;  3UT8 A;  3CK9 A;  4YDW A;  4C48 B;  2CHZ A;  1GW6 A;  4I9C A;  4J8Y A;  4GMR A;  5KNG A;  3ZYQ A;  3L16 A;  3CLJ A;  3DXM G;  3ZKJ A;  3APD A;  3NZS A;  5ENR D;  5HKP A;  2VJ8 A;  1OCZ E;  2OND A;  1DC2 A;  3LCA A;  1ELK A;  4HRN A;  5AJD A;  2P9L G;  5T8I A;  4QQI A;  3EIQ C;  5BW8 C;  2J09 A;  5CBO A;  3CQG B;  2V5F A;  3DPD A;  3TXM A;  2J49 A;  1TNY A;  2Y1L E;  2ZU6 B;  4UWH A;  5CED B;  1L5J A;  3RRN B;  3HVE B;  2GRM A;  5FT9 A;  1DNP A;  3UM1 A;  3D9K A;  3LY9 A;  4G2V A;  2XEH A;  3EIJ A;  4U0U A;  5ENQ D;  4B0Z A;  3TWR A;  4IRU A;  3NQP A;  1OWN A;  2DZO A;  1BI8 B;  2L6J A;  3GYZ A;  4LNB A;  3G2W A;  2R59 A;  3EU9 A;  4U04 A;  4NAC A;  2EIK E;  4C0M A;  4CZ2 D;  5KJL A;  4JEU A;  4B89 A;  2RFA A;  2MYO A;  1WM5 A;  3FTX A;  4GTQ A;  3PDN A;  2ZIS A;  3FTU A;  2RD0 A;  3LYA A;  1XGW A;  2EIJ E;  2X38 A;  2R17 C;  2V5Q C;  4DK5 A;  3PUK A;  3QJZ A;  3DEP A;  1JPL A;  5ENT D;  4ANV A;  1WY6 A;  2KCK A;  5AAR A;  4LEU A;  3GZ1 A;  3PEU B;  3ULQ A;  4KMO A;  1OCO E;  3OAW A;  4JHJ A;  4HI8 A;  3CST A;  2UY1 A;  3ZNG A;  4N5C A;  2HR2 A;  1A17 A;  2E0I A;  4L23 A;  4OVV A;  1FVH A;  4EQF A;  4FLH A;  1P5Q A;  3DRA A;  1LD8 A;  2J07 A;  4B8A A;  1EPU A;  2QYJ A;  3SY2 A;  4JZY A;  1SVX A;  3FH8 A;  1NZN A;  4P29 A;  3U66 A;  1QZ2 A;  2ZGD A;  3CKB A;  2QZA A;  2PZI A;  2XPI A;  4G1T A;  5KJM A;  4JL0 A;  4FP7 A;  3ONL A;  1O1T A;  2OCC E;  3P2B A;  5B3S E;  1H6K A;  3IBE A;  4I9E A;  2X6K A;  3FEX A;  2KAT A;  4RQI A;  2XGS A;  3KAE A;  3JYS A;  4AEZ C;  4K03 A;  4GB9 A;  3PRZ A;  3LJ3 A;  2IU1 A;  4X8Q A;  5EN5 D;  4CCA A;  2E2E A;  3AS5 A;  2AVP A;  2OEV A;  4EPZ A;  2VGX B;  5KJK A;  4LG6 A;  3S7J A;  5JJ6 A;  1H6P A;  5E76 A;  3R9M A;  1N4R A;  2L0I A;  3CVX A;  1FT1 A;  3UKR G;  2I2O A;  5G05 C;  4HFG A;  4HI9 A;  5D66 A;  3ZXS A;  3DSU A;  4GTP A;  4N3C A;  5BUZ A;  5EX3 A;  2WXM A;  2B6C A;  2BED A;  4B93 B;  3UX4 A;  4TXQ A;  3CHP A;  3PNT B;  4LRZ A;  1H0A A;  2GRQ B;  5BXO A;  3DSW A;  2LO6 A;  4G25 A;  3TWQ A;  4WND A;  5G2N A;  3Q7A A;  4KXK B;  2WXN A;  3PZ4 A;  2KZT B;  4F6R D;  2VGE A;  3SFY A;  4DLO A;  4FAD A;  3LVQ E;  3D9H A;  1TNB A;  2VSX E;  4CDN A;  2LUH A;  2YHE A;  4J8F A;  5EID A;  4QFV A;  3LKU A;  5ARG A;  4CT0 A;  3ISM C;  3LY8 A;  3EHR A;  3LEW A;  3CGH A;  3JUE A;  4EZK A;  5JA4 D;  1LF8 A;  4XKC A;  2WQ6 A;  3AG3 E;  2KM4 A;  2GRP B;  4GA1 A;  3SQV A;  4EBA G;  4HOU A;  4OYS A;  5CER B;  1WG0 A;  2I1K A;  3HXE A;  2WXF A;  3MKQ B;  2BUG A;  4GTR A;  3SFX A;  3ABL E;  3G2T A;  2VGX A;  5ARF A;  4GMJ A;  3T5V A;  1OWP A;  2IQC A;  5BT1 A;  5FZS A;  2LAI A;  5ITZ F;  1ZU2 A;  3HG0 D;  3U4T A;  1SA5 A;  1FCH A;  1E96 B;  4XKB A;  1K1A A;  2IO3 C;  4OAV B;  2AWI A;  4KYO B;  4LUN U;  4N5Q A;  3OXF A;  3C98 A;  1TJF A;  5J08 A;  5KWD A;  2XZT G;  4M3O A;  2LAH A;  4HLL A;  2CFU A;  2XZD G;  4AXH A;  1D8E A;  4URK A;  4LSZ E;  1PC2 A;  4UI9 J;  1KLX A;  3CVQ A;  3Q5M A;  3L08 A;  4FU3 A;  1N52 A;  1V54 E;  1JWG A;  2CHW A;  5D0Q D;  2RFM A;  3Q47 B;  4IN3 B;  1E8Y A;  3APC A;  4FHJ A;  2FBN A;  1IHG A;  4XX5 A;  5A23 A;  2A4Z A;  3D9N A;  4U8H A;  1LTX A;  3B7R L;  3FUD A;  1TEZ A;  3FUK A;  3ZVV A;  3PNL B;  1E7V A;  2NXP A;  4K0R A;  3ZYL A;  3RSE G;  1G3N B;  3PE4 A;  4MRU A;  3PZD A;  3B7B A;  2WPV A;  4CT4 A;  3MGB A;  2F8X K;  1O1R A;  3UQ3 A;  2XQ0 A;  3TWU A;  3W9G A;  1K3Z D;  3ZYM A;  4XIF A;  3AG4 E;  4CDR A;  3X2Q E;  2WM9 A;  3DBS A;  3FTV A;  1E8Z A;  3ZXP A;  1U3D A;  3MV2 B;  4F3V A;  2ETB A;  2IOL A;  3SF4 A;  3B13 A;  5T3R A;  4U8Y D;  4GYW A;  1VDY A;  4APF A;  3HIZ A;  4ANX A;  3Q15 A;  4W9R A;  5CCM A;  2F37 A;  5A7D B;  4I2W A;  5HQ8 A;  2J08 A;  4GYO A;  2FO7 A;  4DJA A;  4KZC A;  3HVE A;  5G04 J;  2WVI A;  2WXP A;  1IXV A;  3V31 A;  3TG5 A;  1TN7 A;  3EUV A;  4UQZ A;  2XS1 A;  3FUL A;  3FWV A;  3HXB A;  3G2U A;  1HF8 A;  3O4Z A;  5D2M C;  2WXR A;  3Q9U C;  3URZ A;  5HI7 A;  3JQ0 A;  3QWP A;  2WMN A;  3FUI A;  3TWV A;  5EX0 A;  4LNU D;  3UT4 A;  4GZ3 A;  4JXT A;  3T8K A;  2WQH A;  3T5X A;  2VYI A;  4TUM A;  3Q9N C;  2WXG A;  3U64 A;  5FJY A;  3ASH A;  3MCX A;  4AM9 A;  5EYL A;  3PVL A;  3QAQ A;  2P9U G;  5EDS A;  2WXO A;  2C2L A;  3U9W A;  1OWL A;  3FDH A;  4UI9 C;  2YHC A;  4YDE A;  1KT1 A;  2IEJ A;  3TL5 A;  1SZA A;  2XPZ A;  4WWN A;  4HB5 A;  3CK8 A;  4GYY A;  3OTN A;  2VTB B;  2KC7 A;  5AIJ A;  3KSQ A;  3E33 A;  4GAA A;  4XEI G;  3UIP C;  4ZFH A;  2DZN A;  2DIW A;  4FUL A;  1OCC E;  1D9S A;  2I6H A;  1D8D A;  1N4Q A;  3L9T A;  1Z3Y A;  4RVB A;  1HZ4 A;  4U7E B;  4KBQ A;  3ZGQ A;  1EDU A;  2V8S E;  2OV8 A;  5IY5 E;  1YCS B;  3TWX A;  1MJ0 A;  3LY7 A;  4JHK A;  3IHV A;  3RRM B;  1H2U A;  4G23 A;  2YQ8 A;  1K1B A;  2GW1 A;  3RU0 A;  5J90 A;  2HE0 A;  3EHM A;  3MV3 B;  4Y6C A;  1IQU A;  2KCV A;  3QWW A;  1IQR A;  3AU4 A;  3GW4 A;  2XCB A;  1QBQ A;  2DWZ A;  3DSX A;  1RZ4 A;  4N39 A;  1TNU A;  3B7S A;  3Q75 A;  3ZEF A;  5KCM A;  1EF1 C;  2R03 A;  2MRI A;  3D3M A;  1TN6 A;  4G24 A;  2XGM A;  1KPS B;  4TV3 A;  2PM6 A;  4I1A A;  4ANU A;  3CVW A;  2WXI A;  4GA2 A;  4DLQ A;  1E8X A;  4EHM A;  3Q49 B;  4U8V D;  2H6G A;  2VSY A;  4EZJ A;  1NI1 A;  3DPY A;  5AQ9 A;  3RKV A;  1HX8 A;  4U95 D;  4N2Q A;  4B94 A;  1UJK A;  3AAA C;  2IFU A;  5ENS D;  3QK0 A;  1ZB1 A;  1N11 A;  3HXC A;  3LXU X;  2MOW A;  2YNQ A;  4FC8 A;  4U63 A;  4RG6 A;  3MKQ A;  4YDY A;  3ASG A;  4AIF A;  5LOZ A;  4ATZ D;  3FY4 A;  4JHR A;  3SBT B;  3Q73 A;  5AJL A;  4BER A;  4GZ5 A;  4N3B A;  1SZ9 A;  4K5A B;  1N9A A;  4ME2 A;  3ASN E;  4N2S A;  1UN8 A;  2HM8 A;  3CHQ A;  3L6A A;  1XNF A;  3FH5 A;  4BET A;  3HYM B;  5CEC B;  2VSN A;  4WUY A;  4TXR A;  2KZT A;  4HRM B;  2Y3A A;  3SI5 A;  4HVB A;  2XRZ A;  3DSV A;  4YND A;  5JHB A;  4DX1 A;  3BG1 B;  2V4L A;  3TAX A;  4PS8 A;  3RO3 A;  1NFI E;  4JD2 G;  4HXI A;  5HS0 A;  4UWF A;  3PZ1 A;  3ZIM A;  3OXG A;  5JHA A;  1INZ A;  4BFR A;  3V79 K;  1MX2 A;  2KCL A;  4O60 A;  3PZ2 A;  5M72 A;  4I17 A;  2EQX A;  2CHX A;  3W9F A;  2XEV A;  5C1D A;  1KT0 A;  2IY0 C;  2VTB A;  3LPZ A;  4ANW A;  1RW2 A;  5ANL A;  1HS6 A;  3SFZ A;  4RLY A;  4NUR A;  1TR4 A;  4NQ0 A;  4TXP A;  2Y0B G;  4FJZ A;  1Z5S C;  3NBN B;  1HU3 A;  4GPM A;  3N71 A;  1NA3 A;  5FZR A;  5FQ8 A;  2JLB A;  2F8Y A;  3GZS A;  4L7T A;  3Q7F A;  3SO8 A;  3V2X A;  4Z68 A;  1E90 A;  3FUH A;  5AN8 A;  2V0P A;  2GRR B;  2AXV A;  2XEE A;  2NYJ A;  4I2Z A;  3UIN C;  3UM0 A;  2CG3 A;  5LFA A;  1W3B A;  4CGV A;  5FIN A;  3BG0 B;  4I1O B;  3HDX A;  4A3V A;  1Y6I A;  2L9B A;  3CR3 A;  2HYZ A;  2IO2 C;  5JJ7 A;  5ENO D;  3J5Q B;  5JJT A;  3KS2 A;  3TWS A;  2XHE A;  1TYQ G;  3SGH A;  4L9P A;  3IHY A;  5AQB A;  2ZXW E;  2EIN E;  4CGW A;  2P9K G;  4RSY A;  1N4P A;  3UUX A;  4UI9 K;  1NP7 A;  3ONK A;  3FUF A;  3ZHE A;  5BV1 A;  4WWO A;  3FUM A; 
#chains in the Genus database with same CATH homology
 3ZYM A;  2CHZ A;  1GW6 A;  4I9C A;  5A6C A;  4XIF A;  4XE0 A;  4CDR A;  2WM9 A;  3DBS A;  3FUE A;  3ML9 A;  3FTV A;  3ZRH A;  3CV0 A;  3ZYQ A;  1E8Z A;  3L16 A;  3CLJ A;  3APD A;  4WNE A;  1U3D A;  3ESK A;  3TXN A;  3NZS A;  3FEY A;  5LP0 A;  3IV0 A;  5AEN A;  1ELR A;  2VJ8 A;  3B7T A;  5DBK A;  1DVP A;  2OND A;  2VSO E;  3LCA A;  3MV2 B;  4F3V A;  2IOL A;  4R7L A;  1ELK A;  3SF4 A;  3B13 A;  5T3R A;  3QOU A;  2MHK A;  5AJD A;  3S7B A;  1HH8 A;  2X3M A;  3ZW3 A;  4GYW A;  5T8I A;  1VDY A;  3OXL A;  4I43 A;  3HIZ A;  4APF A;  4ANX A;  3Q15 A;  3L13 A;  3EIQ C;  5BW8 C;  2J09 A;  2Y4U A;  4W9R A;  4GZD A;  2WXQ A;  3CQG B;  2V5F A;  3DPD A;  3RIB A;  3TXM A;  5CCM A;  5A7D B;  2J49 A;  4JA9 A;  3R7R A;  4I2W A;  4EEC A;  5HQ8 A;  2ZU6 B;  4UWH A;  2J08 A;  3MKR A;  1L5J A;  5T4Y A;  3RRN B;  4GYO A;  3QB2 A;  2Y4T A;  3HVE B;  2GRM A;  2AXZ A;  2FO7 A;  4YVQ C;  4ATG A;  4DJA A;  5FT9 A;  4KZC A;  4HOQ A;  2ION A;  3HVE A;  2WXL A;  1DNP A;  3ZHE B;  3D9K A;  3LY9 A;  4MLP A;  4G2V A;  5G04 J;  2WVI A;  2WXP A;  3EIJ A;  4U0U A;  4UWL A;  4ABN A;  3TG5 A;  1TJC A;  2X6F A;  3VLF A;  4AY6 A;  4TUU A;  4FLB A;  4B0Z A;  4A1G A;  3CHM A;  4UQZ A;  4IRU A;  2P58 C;  1EYH A;  3FUL A;  3NQP A;  1OWN A;  2LSV A;  3FWV A;  3G2U A;  1HF8 A;  2PQN A;  2L6J A;  3O4Z A;  3CHS A;  3GYZ A;  3ZN3 A;  3FU6 A;  3G2W A;  2R59 A;  3PH0 C;  3D9O A;  4U04 A;  2M63 A;  1HFA A;  2OVF A;  2LSU A;  2WXR A;  4NAC A;  3URZ A;  3I4G A;  4C0M A;  5HI7 A;  3JQ0 A;  3QWP A;  3QDN A;  2WMN A;  1QNF A;  3FUI A;  3ZFW A;  4HLE A;  3D9I A;  5KJL A;  3CKC A;  4JEU A;  5EX0 A;  4B89 A;  2YIN A;  1X5B A;  3UT4 A;  3TG4 A;  3S2A A;  3ASF A;  4GZ3 A;  4JXT A;  4APO A;  4UQY A;  2WQH A;  3T5X A;  3VLE A;  1WM5 A;  2VYI A;  4MS6 A;  3FTX A;  3PDN A;  1Y8M A;  3K9I A;  3FTU A;  2FEZ A;  4U07 A;  2WXG A;  4B8C B;  2RD0 A;  3TJP A;  3LYA A;  4RG9 A;  1XGW A;  3FUJ A;  4KVO A;  2X38 A;  3U64 A;  2R17 C;  5FJY A;  3ASH A;  4DK5 A;  3PUK A;  3QJZ A;  5E75 A;  1JPL A;  2ILR A;  3MCX A;  4AM9 A;  4ANV A;  3PVL A;  3QAQ A;  4AP2 A;  3PRE A;  1WY6 A;  4U0S A;  2FUL A;  4BY6 A;  3CEQ A;  2KCK A;  4A1S A;  2Q7F A;  4LEU A;  4IYP A;  5EDS A;  2WXO A;  3GZ1 A;  2C2L A;  3U9W A;  1OWL A;  3FDH A;  3PEU B;  4UI9 C;  3CQC B;  2YHC A;  4ILG A;  1KT1 A;  4GZC A;  5FQ6 A;  3TL5 A;  2WB2 A;  1SZA A;  3ULQ A;  2XPZ A;  4DPR A;  4KMO A;  4FA6 A;  3FTW A;  1PY1 A;  4GCO A;  4WWN A;  3RJV A;  2XPY A;  3P1U A;  2OOE A;  3CK8 A;  3I4R B;  3QWV A;  3OAW A;  1ELW A;  4GYY A;  3OTN A;  4JHJ A;  2VTB B;  2A5U A;  2KC7 A;  3CST A;  3FU0 A;  3PEV B;  5AIJ A;  3IEG A;  2UY1 A;  4GAA A;  3D9P A;  3HHM A;  4N5C A;  1BPO A;  2HR2 A;  4L2Y A;  5FQ4 A;  1A17 A;  3CIA A;  2E0I A;  2DIW A;  4L23 A;  4FUL A;  4LCT A;  4OVV A;  1FVH A;  1H2T C;  1OUV A;  2I6H A;  4EQF A;  2RG8 A;  3TGO A;  3O48 A;  4JC8 A;  3ZPJ A;  4AY5 A;  4FLH A;  3UMV A;  1P5Q A;  1Z3Y A;  3SD5 A;  2XRY A;  4RVB A;  1HZ4 A;  1FVF A;  4H7X A;  4F53 A;  2J07 A;  4B8A A;  1EPU A;  5CHE E;  4JZY A;  3CVU A;  4KBQ A;  3ZGQ A;  1EDU A;  4HOT A;  2I9C A;  2V8S E;  3FH8 A;  1NZN A;  4P29 A;  4Q96 A;  3U66 A;  3JUI A;  3MX3 A;  2OV8 A;  1QZ2 A;  3CSF A;  3CKB A;  4WNF A;  2PZI A;  2IJG X;  3AS8 A;  2XPI A;  3LY7 A;  1IYG A;  4G1T A;  4JHK A;  4F7A A;  4JL0 A;  5KJM A;  2L0T B;  4I6E A;  1UN9 A;  3IHV A;  4FP7 A;  1HXI A;  4HS2 A;  3ONL A;  3RRM B;  1H2U A;  4G23 A;  2YQ8 A;  3FTZ A;  3MJW A;  2GW1 A;  3D9L A;  3PE3 A;  4UWG A;  1HO8 A;  5DIZ A;  3CHR A;  3I5P A;  3P2B A;  4PS3 A;  1H6K A;  3KD7 A;  3RU0 A;  3IBE A;  5J90 A;  5BPP A;  3EHM A;  3MV3 B;  4I9E A;  2XGO A;  4Y6C A;  1IQU A;  2KCV A;  3QWW A;  5BV0 A;  1IQR A;  3AU4 A;  3GW4 A;  2X6K A;  2XCB A;  1HG2 A;  1YA0 A;  3FEX A;  2KAT A;  3IKO B;  2XGS A;  3KAE A;  4UQX A;  3JYS A;  4AEZ C;  4K03 A;  4GB9 A;  4IUL A;  3PRZ A;  3FUN A;  3LJ3 A;  4N39 A;  3B7S A;  2IU1 A;  3ZYK A;  4J8D A;  3ZEF A;  4CCA A;  4G26 A;  2E2E A;  1SQM A;  4ILI A;  5KCM A;  3AS5 A;  1EF1 C;  3R7Q A;  5LCW C;  1Z3X A;  2AVP A;  2MRI A;  3D3M A;  4XZ4 A;  3AU5 A;  4G24 A;  4EPZ A;  3FU5 A;  4I6J A;  4LER A;  2VGX B;  3FHE A;  5KJK A;  3ML8 A;  2XGM A;  3CHO A;  4EZL A;  4AJW A;  3S7J A;  4JVS A;  5JJ6 A;  4V3I A;  3KEZ A;  2PM6 A;  4TV3 A;  3PUJ A;  4I1A A;  4ANU A;  3FTY A;  3CVW A;  5E76 A;  2WXI A;  2L0I A;  4GA2 A;  4DLQ A;  4U0Z A;  3CVP A;  3CVX A;  1E8X A;  4OVU A;  3Q49 B;  2DBA A;  3CK7 A;  1E8W A;  2I2O A;  5G05 C;  4HFG A;  4BT8 A;  2VSY A;  4EZJ A;  3ZXS A;  2GRL A;  3UPV A;  4N3C A;  5BUZ A;  3U3W A;  1B89 A;  2CFZ A;  3RRU A;  5EX3 A;  3RKV A;  1HX8 A;  3RK6 A;  4KZ0 A;  5EKQ D;  4N2Q A;  3FFL A;  2WXM A;  4B94 A;  1JWF A;  1UJK A;  3PS6 A;  1N54 A;  2IFU A;  1S0P A;  3UX4 A;  3CHP A;  3QK0 A;  3PNT B;  2PM7 A;  4LRZ A;  4PUC A;  4GZ6 A;  4ACL A;  1H0A A;  3LXU X;  3VTY A;  2PQR A;  2MOW A;  2WMO A;  2YNQ A;  4FC8 A;  4U63 A;  4RG6 A;  3MKQ A;  3ASD A;  4DI3 A;  3ASG A;  2LO6 A;  4PH4 B;  4AIF A;  5LOZ A;  3FY4 A;  3L17 A;  4G25 A;  4JHR A;  4WND A;  4YVO A;  5G05 J;  3SBT B;  3VLD A;  4BT9 A;  5G2N A;  3WXX A;  5AJL A;  4KXK B;  3NF1 A;  4GZ5 A;  4BTA A;  2WXN A;  4N3B A;  4E6H A;  4JEH A;  1SZ9 A;  2KZT B;  1UJJ A;  3SZ7 A;  2CG2 A;  3NZU A;  4ME2 A;  4TRQ A;  1JUQ A;  3MEK A;  5ENN A;  4AVX A;  4DLO A;  4FAD A;  3LVQ E;  2VQ2 A;  2R5S A;  4JA7 A;  2VSX E;  3MZL B;  4CDN A;  4N2S A;  2YHE A;  1UN8 A;  4J8F A;  2PL2 A;  4FHK A;  2HM8 A;  3CHQ A;  3L6A A;  1XNF A;  1OWM A;  4Q69 A;  4GU5 A;  4J6I A;  4QFV A;  3LKU A;  4NRH B;  4CDM A;  5ARG A;  3QNK A;  4J0U A;  3FH5 A;  4BTB A;  4CT0 A;  4H7Y A;  3BEE A;  2DCP A;  3LY8 A;  3LEW A;  3HYM B;  3CGH A;  2VSN A;  3RO2 A;  4WUY A;  2X6I A;  4ILH B;  1LF8 A;  4XKC A;  4EZK A;  5LX8 A;  2KZT A;  2WQ6 A;  2J9Q A;  4PS7 A;  2Y3A A;  1Z6T A;  3QAR A;  3SI5 A;  1E7U A;  1HG5 A;  2KM4 A;  3E4B A;  3R9A B;  3SNX A;  4HVB A;  4YND A;  2XRZ A;  5JHB A;  4GA1 A;  3CVN A;  4EBA G;  4HOU A;  4OYS A;  4G11 A;  2I1K A;  4GA0 A;  4O6F A;  3BG1 B;  2FF4 A;  1HE8 A;  2V4L A;  2WXF A;  3MKQ B;  4MKT A;  4I6G A;  3T8M A;  2BUG A;  4L2L A;  3TAX A;  4C9B B;  3G2T A;  3GZ2 A;  4PS8 A;  2BTD A;  3FH7 A;  4J8E A;  4KT6 B;  4HXI A;  4N3A A;  5C2Y A;  3RO3 A;  4UWF A;  2VGX A;  5G04 C;  3ENE A;  3LDZ A;  4Q94 A;  5D0O D;  5ARF A;  3ZIM A;  4GMJ A;  3T5V A;  1OWP A;  4PDX A;  3OXG A;  2IQC A;  5JHA A;  1INZ A;  3S7D A;  5BT1 A;  2X6H A;  4GML A;  3SBS A;  4BSX A;  3S7F A;  5FZS A;  5AYW D;  2OVB A;  2QY7 A;  5FQ7 A;  2LAI A;  1H2V C;  3LS8 A;  4BFR A;  4D10 C;  5CMW A;  1ZU2 A;  1NA0 A;  2KCL A;  4JPS A;  2J4B A;  3APF A;  3U4T A;  3MYV A;  3JQ1 A;  5CMY A;  1U3C A;  3EJN A;  1QQE A;  3QC1 A;  3EDT B;  2NSZ A;  5M72 A;  4I17 A;  2EQX A;  2GGF A;  1FCH A;  2CHX A;  3CVL A;  1E96 B;  2BF0 X;  2IOS A;  5FWQ A;  4F1S A;  1ZBP A;  4XKB A;  5KJN A;  2XEV A;  5C1D A;  2AWI A;  2AXU A;  3Q4A B;  1KT0 A;  4KYO B;  4BWR A;  3G2S A;  4GCN A;  4LUN U;  2I1J A;  2WXH A;  2VTB A;  2FI7 A;  3LPZ A;  1MHQ A;  3OXF A;  2VGY A;  3C98 A;  2HO1 A;  1TJF A;  2XCC A;  2C0M A;  4ANW A;  5ANL A;  5J08 A;  4M3O A;  2LAH A;  4WAF A;  1HS6 A;  1OWO A;  3SFZ A;  4E85 A;  3QKY A;  1UW4 B;  1WAO 1;  2CFU A;  4AV7 A;  4NUR A;  4KVM A;  4AXH A;  4NQ0 A;  2JEK A;  4URK A;  2AW6 A;  3LVR E;  2NC9 A;  4FJZ A;  2IF4 A;  2C0L A;  3I3N A;  4J8S A;  5CCL A;  4JW1 A;  3G2V A;  4DI4 A;  1PC2 A;  4UI9 J;  3JCK C;  3SHF A;  1HU3 A;  1KLX A;  3ESL A;  4UWK A;  3N71 A;  4Y6W A;  1NA3 A;  4L1B A;  3CVQ A;  5FZR A;  4WNG A;  3AS4 A;  5FQ8 A;  2JLB A;  4CEM A;  2WXJ A;  4L7T A;  3GZS A;  4AOF A;  4BX9 A;  4HOR A;  1E90 A;  3FUH A;  5BNW A;  3CVV A;  2V0P A;  3Q5M A;  3D9J A;  3L08 A;  1UG3 A;  4FU3 A;  3CVY A;  1N52 A;  3FTS A;  2AXV A;  5LCW J;  1JWG A;  2CHW A;  5D0Q D;  3Q47 B;  4IN3 B;  1H19 A;  1E8Y A;  3APC A;  4FHJ A;  4ACK A;  5G55 A;  2WXK A;  3L22 A;  2FBN A;  4I2Z A;  5FZQ A;  4FJY A;  3VTX A;  2CG3 A;  4XI0 A;  5LFA A;  3D9M A;  4WWP A;  1W3B A;  4CGV A;  5FTP A;  3B7U X;  1IHG A;  3BG0 B;  4I1O B;  4XX5 A;  3UT7 A;  3HDX A;  2UY1 B;  2A4Z A;  5A23 A;  3FU3 A;  3D9N A;  4U8H A;  1Y6I A;  4A3V A;  2L9B A;  3B7R L;  3FUD A;  1TEZ A;  3CR3 A;  4I1M A;  1PAQ A;  2HYZ A;  4A3T A;  3FUK A;  3ZVV A;  4BX8 A;  2J4D A;  3PNL B;  1E7V A;  2NXP A;  2X6J A;  4K0R A;  3ZYL A;  4C0E A;  2QFC A;  5JJ7 A;  5JJT A;  3PE4 A;  4GPK A;  4MRU A;  3FP3 A;  2UWJ G;  3KS2 A;  3L54 A;  3PZD A;  4XI9 A;  2WPV A;  4CRW A;  2LNI A;  2XHE A;  5ANR A;  3EHN A;  3SGH A;  4HOS A;  1MQS A;  3IHY A;  4CT4 A;  3MGB A;  4A55 A;  3MA5 A;  4CGW A;  4RSY A;  2WQ7 A;  3UQ3 A;  2XQ0 A;  3UUX A;  4UI9 K;  1NP7 A;  4EBA A;  3ONK A;  3UT8 A;  3FUF A;  3ZHE A;  3CK9 A;  5BV1 A;  4WWO A;  3FUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...