2IFUA

Crystal structure of a gamma-snap from danio rerio
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
275
structure length
275
Chain Sequence
AAQKISEAHEHIAKAEKYLKTSFMKWKPDYDSAASEYAKAAVAFKNAKQLEQAKDAYLQEAEAHANNRSLFHAAKAFEQAGMMLKDLQRMPEAVQYIEKASVMYVENGTPDTAAMALDRAGKLMEPLDLSKAVHLYQQAAAVFENEERLRQAAELIGKASRLLVRQQKFDEAAASLQKEKSMYKEMENYPTCYKKCIAQVLVQLHRADYVAAQKCVRESYSIPGFSGSEDCAALEDLLQAYDEQDEEQLLRVCRSPLVTYMDNDYAKLAISLKVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords gamma-snap
publication title Structure and dynamics of gamma-SNAP: insight into flexibility of proteins from the SNAP family.
pubmed doi rcsb
source organism Danio rerio
total genus 112
structure length 275
sequence length 275
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14938 SNAP Soluble NSF attachment protein, SNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ifuA00
2FI7A 2LSUA 5KJLA 2XCCA 3HYMB 4GA0A 4N3CA 3GZ2A 4YNDA 4GA2A 1QZ2A 4I2WA 3K9IA 2XEVA 4GZ5A 3Q49B 5ARFA 5EKQD 3LY8A 3GZ1A 3S7FA 2PQRA 5FZQA 4GPKA 3NF1A 5FTPA 4XIFA 3SF4A 4WNGA 3Q15A 3OXLA 3Q5MA 3R9AB 5BNWA 5G04J 2J9QA 2WPVA 4O6FA 5CHEE 4JL0A 3LYAA 4HOQA 3FWVA 3TG4A 3Q4AB 4I17A 5G05C 4I2ZA 1NA0A 5KJNA 2PZIA 4JA7A 4UQYA 3ASDA 2BUGA 4RG6A 2LSVA 4UQZA 2VYIA 2HR2A 2HYZA 3LY9A 3QWPA 3LY7A 5FZSA 1HXIA 4UI9C 3VTYA 4GA1A 2KCKA 4BT8A 4I9CA 4AIFA 2KCLA 5D0QD 4JA9A 4Y6WA 4I1AA 3URZA 5A6CA 3UQ3A 2VSYA 4F3VA 1ELRA 5CCLA 4H7XA 3RU0A 4GYWA 3U4TA 4KYOB 3KD7A 3CVLA 1P5QA 4HOUA 3LPZA 4GZ3A 5KJMA 4YVOA 3KAEA 2Y4UA 1TJCA 4N2QA 2FEZA 3FP3A 3GYZA 5LCWC 4NQ0A 5FJYA 3QOUA 4I9EA 2NC9A 2ONDA 5M72A 1E96B 2C2LA 2L6JA 4ABNA 3OXFA 5BT1A 4KBQA 3RO3A 2FO7A 3CK9A 5C1DA 3CK7A 1IHGA 3CK8A 3MKRA 4G1TA 5BW8C 2FBNA 3ASHA 5ARGA 2Y4TA 2WQHA 4N3BA 4U0UA 2P58C 5JJTA 2PL2A 4AY5A 4EQFA 4J8DA 4XI0A 3ULQA 3CVPA 4CGVA 4U04A 4AY6A 4AM9A 4U0ZA 3WXXA 4BTBA 3ZPJA 4HOTA 3PDNA 5HI7A 3RJVA 3RO2A 2KC7A 1KT1A 3MV2B 3U3WA 3TAXA 1NA3A 4G2VA 4N5CA 3EDTB 3PE4A 1PC2A 1KLXA 1WM5A 3TG5A 3ZN3A 3QDNA 2XGSA 5D0OD 1WAO1 2LNIA 4APOA 3CKCA 1QQEA 3CVQA 3QWWA 4GZ6A 4J8FA 1NZNA 3AS8A 2MHKA 5G05J 4RG9A 2XGMA 5FT9A 4WUYA 3E4BA 5DIZA 3CVNA 2XGOA 4CGWA 1YA0A 1B89A 3MV3B 4ME2A 4BT9A 3S7BA 5DBKA 4GCNA 4N2SA 2IFUA 1ZU2A 4XI9A 5G04C 3CKBA 4WNEA 3ZFWA 3GW4A 4HORA 4LEUA 2GW1A 2OOEA 4U0SA 4Y6CA 4J8EA 2VGXB 2UWJG 1OUVA 3SZ7A 4NRHB 5HQ8A 3TGOA 3AS5A 3S7JA 1HH8A 4BTAA 4H7YA 2UY1A 2KATA 4G26A 3S7DA 4CDRA 5CCMA 4UI9K 4N3AA 5LCWJ 2DBAA 3CEQA 4JHRA 4YVQC 2V5FA 2QFCA 3ASFA 3ZHEA 4WNDA 4UQXA 4W9RA 3RIBA 3PE3A 4IN3B 4BWRA 3ZGQA 4A1SA 4KXKB 5JJ6A 1XNFA 2KCVA 3AS4A 4G23A 3MA5A 4HOSA 2E2EA 2PQNA 3CV0A 3UPVA 3BEEA 2HO1A 3UUXA 4B94A 2UY1B 5AYWD 3QWVA 4GYYA 5JJ7A 2VSNA 4G24A 4J0UA 1ZBPA 3Q47B 2R5SA 2C0MA 4U07A 2XPIA 3IEGA 3RKVA 1W3BA 3ZHEB 3VTXA 3N71A 1ELWA 2I6HA 2IF4A 3MEKA 2VQ2A 5A7DB 2VGYA 1A17A 4N39A 3LCAA 4GCOA 4WNFA 1Y8MA 3LKUA 2XCBA 2YQ8A 5KJKA 2VGXA 1KT0A 2Q7FA 3ESKA 2AVPA 3FFLA 1FCHA 2C0LA 4GYOA 4G25A 2FF4A 2YHCA 3KS2A 1HZ4A 1IYGA 5EX3A 5FZRA 4UI9J 3ASGA 3OXGA 3QKYA 3JYSA 2JLBA 5EX0A 3O48A
chains in the Genus database with same CATH superfamily
5HKPA 3SFXA 4DX7D 3ENEA 5J08A 3U64A 3UIPC 4DK5A 4APFA 3HRAA 2LSUA 1O1TA 4JEHA 3HYMB 4GA0A 3DPDA 4JPSA 4Q69A 3UKRG 4L2LA 4A3TA 3APDA 3PEUB 4PDXA 2XZTG 1SZAA 3FTWA 3HXBA 4GTOA 3GZ1A 2EIJE 1TN8A 2PQRA 3C5RA 4XIFA 3ZEFA 4B8AA 1IQRA 1QBQA 1WDYA 4CDMA 4CZ2D 5CHEE 1RZ4A 3NQPA 1U3DA 4JL0A 4HS2A 4DX2A 1FVFA 4FLBA 4UWFA 3T9KA 3C3RA 2KM4A 1JWFA 3ABME 4CDNA 2A5EA 3NZUA 4I6GA 4C9BB 5KJNA 3PZ4A 4URKA 4UQYA 2AXUA 2RFMA 2BUGA 4RG6A 2LSVA 1UN8A 4LNGA 1RW2A 3NB2A 3VTYA 1DNPA 1VDYA 4BT8A 1H6OA 3FU0A 3CVUA 1OWOA 3ZXPA 4CRWA 5BPPA 5CCLA 3Q75A 4GYWA 3JQ0A 3KD7A 3LPZA 1AP7A 5KJMA 4YDWA 5LFAA 4ANVA 2Y4UA 3NAWA 4GU5A 4ANUA 4N2QA 1OCCE 4AJWA 3TWVA 4FJZA 5AAOA 5BUZA 4MLPA 5LCWC 4GZCA 4NQ0A 4ILGA 5FJYA 2CHXA 3TJPA 2XS8A 2XHEA 4BX8A 3DSSA 2NC9A 3HXFA 4HI9A 1E96B 3DSTA 1JCQA 3FH8A 2WQ6A 3FH7A 4KBQA 4LSZE 3B7RL 3V2XA 4C48B 4D10C 2H6FA 3ONKA 4EPZA 4GZDA 3CK8A 5BW8C 3QC1A 1IHBA 3HG0D 2R03A 3EUVA 3SBSA 4U0UA 3W9GA 5CMYA 4JHJA 4AY5A 4EQFA 1H19A 4J8DA 2AJAA 3SQVA 4XI0A 3QARA 2XS1A 3ULEG 3CVPA 4U95D 3RK6A 4AOFA 3BG1B 4DUIA 3E30A 1OWMA 1X5BA 3C98A 3Q7FA 3FU3A 4BTBA 1KZPA 4GB9A 3ZVVA 1SQMA 3PDNA 2X38A 2OEWA 3RRUA 1OWLA 3L54A 4O1OA 4N5CA 3E34A 3PE4A 1N4RA 4N5QA 3G2SA 1PC2A 4ZFHA 1H0AA 1WM5A 3TG5A 3QDNA 1E8YA 2XGSA 1WAO1 2LNIA 2XPYA 2M63A 4APOA 3CGHA 1QQEA 1FT2A 3QWWA 3I5PA 3T8MA 4K5BA 3CHPA 5T3RA 4TXPA 2WMOA 2L0IA 4BX9A 4EBAG 2EQXA 3PNLB 4I1OB 3FUDA 1DCEA 2XGMA 3UM3A 3E4BA 5DIZA 3CVNA 1B89A 4ME2A 3DRAA 4BT9A 2R17C 4GCNA 4N2SA 1OCRE 3GW4A 4ANWA 1MZCA 3BUAA 4K5CA 3D3MA 1Z6TA 2OOEA 2VGXB 2WXHA 4UWLA 2I9CA 2I1JA 3TGOA 3EIQC 3OTNA 3ZNGA 4K0RA 3S2AA 4B89A 4LRZA 4N3AA 5LCWJ 1YYHA 4JHRA 3ASFA 3ZHEA 4WNDA 4W9RA 1BD8A 3BG0B 3KEAA 3F6QA 5JJ6A 2J4DA 4HRMB 1U3CA 4KT6B 3CVVA 2XPZA 3UPVA 4E6HA 5HRYA 2UY1B 2DZNA 3EHQA 5AYWD 5JJ7A 3D9IA 2VSNA 4G24A 5HS0A 4AVXA 1KZOA 2BF0X 4A1GA 2A5UA 1W3BA 3HXCA 3UI2A 5CEDB 5LP0A 1H6KA 2GGFA 2X6HA 1Z3YA 2I6HA 3Q9NC 2VGYA 1HS6A 4P29A 5CMWA 4WNFA 3MYVA 1EF1C 1HFAA 2XCBA 1UJJA 5IY5E 1KT0A 2ZIRA 3DSWA 1EPUA 3ESKA 2Y69E 4NACA 5H7PA 4G11A 4O1PA 1FCHA 2LXLA 3AG4E 3R7QA 2J4BA 4G25A 1PY1A 3AU5A 2P9SG 5FZRA 3PVLA 1TNBA 3J5QB 3FTVA 3DXKG 4GTPA 5EILA 3PREA 5ENRD 4CT4A 3FUMA 1N94A 3KSLA 4AEZC 3DPYA 1MYOA 3D9HA 3D9JA 3T8KA 1H2UA 4N3CA 3IBEA 1ELKA 4MKTA 2V5QC 4GA2A 4HXIA 5AJDA 4I2WA 4GTQA 1V54E 2VSOE 3Q7AA 1UW4B 3R9MA 5EYPF 4FA6A 5C2YA 5ENPD 4X8QA 2LXMA 5ENOD 2XZDG 1FT1A 3QK0A 4WNGA 3CVWA 1DC2A 3SY2A 2WPVA 4O6FA 4JXTA 4OYSA 3LVRE 5ENTD 1N11A 3V30A 1JCRA 3E37A 3VLEA 2KXPC 3SFZA 2CHZA 1TJFA 4KZCA 4Q94A 4NURA 2PZIA 3LXUX 2JABA 2KBXA 3UT4A 3UT8A 1SZ9A 4UQZA 1HU3A 2VYIA 2HR2A 2HYZA 2BTDA 3LY7A 2R2LA 4UI9C 2KCKA 4DJAA 4K03A 2KCLA 4Y6WA 3LJNA 2WMNA 1N0RA 5A6CA 4OVUA 1N52A 5ENNA 5G55A 3EIJA 3RU0A 3OAWA 2WXQA 3U4TA 1K1BA 1MX6A 5FQ8A 5G2NA 3UT7A 4XZ4A 2LO6A 4XKCA 2DCPA 2WXLA 3GYZA 3G2TA 4GMRA 2CG3A 4WWOA 3CR3A 1HG2A 4GTRA 3FDHA 2R05A 3EHRA 3DWLG 3ZIMA 2C2LA 4F1SA 2L6JA 1O1SA 3EJNA 5LOZA 4EBAA 2XEHA 3Q78A 5AQ7A 3E33A 4HI8A 2X6IA 5EYLA 1NFIE 2RD0A 1S64A 3NBNB 3LVQE 5C1DA 3G2VA 2WXMA 3U66A 2FBNA 4I43A 5ARGA 3LEWA 4GTTA 2IO2C 4WAFA 1BI8B 4DPRA 2MYOA 2WXJA 4L7TA 2P58C 2GRMA 2P9KG 3CSFA 5AJLA 3W9FA 3AG1E 4CGVA 4DX5D 3V31A 5FIOA 3ABKE 2CFUA 3WXXA 3ZPJA 2AXZA 3EHMA 4PH4B 3D9KA 4EHMA 3ZW3A 3RJVA 4JHKA 1NP7A 1KT1A 3PEVB 1FPPA 3T5XA 1NA3A 2ETAA 3ASNE 4F7AA 4GMLA 5ANLA 4JB8P 4JW1A 1JPLA 5KNGA 3UM0A 2OVFA 3ZUVB 1Z5SC 4BESA 4GZ6A 4U8YD 5CRVA 2AW6A 1NZNA 3AS8A 4XE0A 2MHKA 3FU6A 4RG9A 4B93B 1DCQA 4ILHB 2WQ7A 1N9AA 2XGOA 1LD7A 1YA0A 4FLHA 3UX4A 2L0TB 3DSXA 3RSEG 4PS7A 3WG7E 5DBKA 4AV7A 3L22A 3D9OA 3I3NA 4WNEA 4XEIG 4FP7A 3ESLA 3CHOA 2YHEA 1NI1A 1SA5A 3L82A 2GW1A 2RG8A 4U0SA 1EDUA 4R7LA 4F53A 4TV3A 3VLFA 3AS5A 1HH8A 4BTAA 2UY1A 3AAAC 4LERA 1OT8A 2H6GA 3S7DA 2ETCA 3FTZA 3Q79A 2QYUA 4UWHA 2WXKA 4UI9K 2DBAA 3CEQA 4YVQC 3L6AA 2H6IA 2QFCA 1X81A 5JHAA 1HX8A 3PNTB 4TUUA 2LAIA 4BWRA 1O5MA 2Y1LE 1YMPA 1IKND 5D66A 4A1SA 3PUJA 4TUMA 2KCVA 4HOSA 4DI3A 3ZYMA 2PQNA 3V79K 3BEEA 2HO1A 3Q73A 3UUXA 1IQUA 3EU9A 3QWVA 3QNKA 4PS8A 3TWUA 4J7WA 4DLQA 2C0MA 3IHVA 3L13A 2XPIA 2ZGGA 3IEGA 4I6JA 3RKVA 4NIKA 4B8CB 2MRIA 2R59A 3O4ZA 3P1UA 5AENA 3N71A 2IF4A 3TWTA 3AU4A 1A17A 3ISMC 4GCOA 2IONA 1Y8MA 4G8LA 4YDEA 4UWGA 1HG5A 4ILIA 2YQ8A 3PZDA 2QC9A 2Q7FA 5JA4D 2AVPA 3FFLA 2V0PA 3P2BA 1E8XA 1H2TC 2JEKA 2R02A 1AWCB 2C0LA 3C3OA 3DEOA 3ULYA 2YHCA 3KS2A 4BY6A 4HBDA 3MKQB 4J8YA 3PZ1A 4DRXE 2PNNA 2FI7A 5ENQD 3CQCB 3C72A 1BPOA 4BERA 5KJLA 2XCCA 4RSYA 1UJKA 5ITZF 4YNDA 3LS8A 4CCAA 1E90A 2X6JA 3K9IA 1V55E 3V2OA 4GZ5A 5EKQD 3LY8A 3S7FA 3AJIA 5FZQA 3NF1A 3FTYA 5FTPA 4EECA 4HQDA 3OXLA 4J8SA 4CYMD 3Q5MA 5EDSA 5B3SE 1N4SA 5BNWA 4L1BA 3LYAA 3FWVA 5FINA 3TG4A 2I2OA 4XKBA 4I17A 4I1MA 5G05C 4U8VD 2AXVA 2X3MA 2OVBA 4FHKA 3EHNA 3KSQA 3CSTA 2X6FA 2J09A 3UKUG 1HXIA 2DZOA 2P9NG 3I4GA 1D9SA 4GA1A 4ZHBA 4ATGA 1GW6A 1TEZA 4AIFA 1UG3A 4JVSA 4K5AB 5D0QD 4JA9A 2XEEA 2IEJA 2OEVA 5LX8A 1O1RA 1UOHA 3UQ3A 1ELRA 3D9LA 3AG2E 1TR4A 4I6EA 3SHFA 3FUJA 4O60A 3HHMA 3CVLA 1P5QA 4HOUA 4YDOA 2YINA 3TWSA 3MGBA 2KZTB 4GAAA 2DYSE 4YVOA 3KAEA 1TJCA 3B7UX 5FQ6A 2DYRE 2FEZA 3SBTB 4Q96A 4B0ZA 1U2VG 4FU3A 4JEUA 4ATZD 3MX3A 1K8KG 2IJGX 4HB5A 1QNFA 3TWWA 2ONDA 3FEXA 3NOGD 1HO8A 4ABNA 3OXFA 5BT1A 3RO3A 2WVIA 2FO7A 3SO8A 1N54A 3FUEA 1MX2A 3MCXA 3CK9A 1N4PA 2CG2A 2IU1A 3CK7A 2AWIA 3X2QE 2P9UG 2ZXWE 3FY4A 2IY0C 5BV0A 3LDZA 3TXMA 4U8HA 4M7CA 3L9TA 2ZU6B 4QFVA 4EZJA 4U7EB 3FHEA 2PL2A 4ACLA 2V4LA 2DIWA 2HM8A 4HLLA 4MS6A 4U04A 3RRMB 3CVYA 3CHRA 4AY6A 3J5PA 4AM9A 2VSXE 2QYJA 4U0ZA 5JMND 2PM7A 1IXVA 4HOTA 3CVXA 5HI7A 3T5VA 2BEDA 1TNUA 5E75A 3TAXA 4BEPA 2RFAA 1KLXA 4AXHA 3ZN3A 2XQ0A 5D0OD 3CHSA 1OWPA 1SVXA 3SFYA 1D8EA 3CKCA 3JXJA 5D2MC 4GTVA 1BI7B 3CVQA 4ANXA 4L2YA 2V4HC 4BSZB 3QB2A 3DBSA 4GTMA 2DWZA 3QJZA 5G05J 1OWNA 3LJ3A 3IKOB 1E7VA 3UINC 3FUNA 3MV3B 2EIKE 2WXFA 5KWDA 4RLYA 1LD8A 1TNOA 2P9PG 3FUIA 3ML9A 2FO1E 1BU9A 2IFUA 5G04C 3CKBA 2IOSA 1PAQA 3ML8A 3ZFWA 3CLJA 4QQIA 3E32A 2ZGDA 2PM6A 4IYPA 3AG3E 3RAUA 2NSZA 4Y6CA 1MJ0A 2XRYA 4TXQA 2VTBB 3S7JA 3TXNA 1UN9A 4H7YA 2KATA 2DVWA 5EIDA 3FTSA 4BETA 3MJWA 5CCMA 2ILRA 1EYHA 4HRNA 1TN7A 2V5FA 3ABLE 3HXDA 2MOWA 4OAVB 3RIBA 3PE3A 4IN3B 4BSXA 1S63A 3IHYA 1YCSB 2RKKA 3AS4A 4LUNU 3CHQA 3VLDA 3KEZA 5B1BE 4HNAD 3ZYQA 2OCCE 1K3ZD 4HLEA 4RQIA 2EIME 5T8IA 1JCSA 4L23A 2XRZA 5KCMA 1INZA 4DX6D 3FULA 5FWQA 1ZBPA 3Q47B 4DLOA 2NXPA 4CT0A 4KVOA 3PZ2A 2IOLA 5CBNA 2WXNA 2BKGA 1WY6A 2HE0A 4J6IA 1WG0A 2WXIA 3MKQA 4EZKA 3TWQA 3FUKA 4GTSA 3MEKA 3LCAA 5JHBA 4TRQA 3L17A 3HXEA 2I1KA 3LKUA 2VGXA 3RRNB 2J07A 3L08A 3APFA 3B13A 4FHJA 2E0IA 1E8ZA 2GROB 2Y3AA 4HVBA 5CRUA 5CBOA 2ETBA 5EX3A 4UI9J 3ASGA 3OXGA 5CEAA 3QKYA 3JYSA 2JLBA 2GRNB 5EX0A 5J90A 2J49A 3DXMG 4AP2A 3HDXA 5EN5D 3NZSA 2LAHA 3GZ2A 4XX5A 2L9BA 5AARA 4FADA 1QZ2A 1N95A 1TN6A 5AIJA 2WXPA 3SI5A 3FH5A 1H6PA 2XEVA 4UWKA 5CERB 2EILE 3Q49B 5ARFA 3ZU7B 5A23A 3HVEB 4GPKA 4TXRA 1DVPA 3SF4A 1Q2ZA 2EINE 3BQOA 3Q15A 1ZB1A 3R9AB 1JWGA 2J9QA 5G04J 4FC8A 4HOQA 3DSVA 1HE8A 3Q4AB 4I2ZA 4DI4A 2Y0BG 1NA0A 2V8SE 3TWRA 3IV0A 1HF8A 1L5JA 2KZTA 4JA7A 3UMVA 3ASDA 3G2UA 3FUHA 3ZXSA 5KBAA 4BFRA 3CHMA 2P9LG 1QYMA 3PZ3A 3LY9A 3QWPA 5FZSA 1H2VC 2GRLA 3D9MA 3ASOE 4I9CA 4F1PA 1XGWA 2WB2A 5E76A 5ENSD 4I1AA 3URZA 3ZYLA 1NL4A 3EU5A 2VSYA 4F3VA 5T4YA 1A5EA 4H7XA 5FQ4A 1LF8A 4KYOB 2F8XK 2WM9A 3APCA 4GZ3A 3HIZA 4JZYA 4L9PA 1BLXB 5KNHD 3FP3A 2F8YA 2OV8A 5B1AE 3Q9UC 3QOUA 1TYQG 1G3NB 4RVBA 4I9EA 3UIOC 3PS6A 3GZSA 5AQAA 5M72A 4HRLA 4JC8A 4DX1A 3PUKA 3UM2A 2CFZA 3UM1A 1OXJA 4KZ0A 4A3VA 3U9WA 1IHGA 2H6HA 3MKRA 4G1TA 2GRRB 2B0OE 2YNQA 5EIBE 3ASHA 5AQBA 3G2WA 3FUFA 3L16A 4G8KA 1E8WA 4OAUC 2Y4TA 2WQHA 3QAQA 5AQ9A 2ZISA 4N3BA 4U96D 2B6CA 5JJTA 1TNYA 3DEPA 3FEYA 3D9PA 4LG6A 1Y6IA 3ULQA 4F6RD 4KVMA 4C0MA 3DSUA 4LNBA 5ANRA 3PRZA 4PUCA 3UTMA 4EZLA 2P9IG 3RO2A 3UXGA 2L6BA 2KC7A 4KMOA 3TL5A 4A55A 3MV2B 3U3WA 4G2VA 3I4RB 3EDTB 3SGHA 4MRUA 3SNXA 1MHQA 4Z68A 3R7RA 2CHWA 3ONLA 4YDYA 2GRPB 2GRQB 1Z3XA 2WXOA 4OVVA 1LTXA 3ZKJA 4J8FA 2J08A 2QY7A 1OCOE 2FULA 1KPSB 3C3QA 4HFGA 5FT9A 4WUYA 2VTBA 1FVHA 4CGWA 2F37A 1N4QA 1JUQA 5AN8A 4E85A 3JXIA 1MX4A 2P2CP 3FU5A 3B95A 3S7BA 3B7BA 1ZU2A 4XI9A 2LUHA 3MZLB 4HORA 4LEUA 4IRUA 5CECB 3TWXA 3CQGB 4V3IA 4J8EA 1OY3D 2UWJG 2WXRA 1OUVA 3SZ7A 4NRHB 4MBGA 5HQ8A 1S0PA 3IXEA 1K1AA 3JUIA 3JCKC 4G26A 2XENA 2NYJA 4CDRA 4GPMA 3D9NA 1S70B 1OCZE 4C0EA 2J8SD 2VGEA 2A4ZA 4FJYA 4UQXA 1N0QA 4A63B 3B7SA 3ZGQA 4KXKB 1XNFA 4G23A 3MA5A 3ZYKA 2E2EA 4LNUD 1TNZA 3CV0A 2QZAA 4B94A 3JQ1A 4GYYA 3ZRHA 4CEMA 1MQSA 4J0UA 4U07A 2R5SA 4LCTA 3BU8A 4IULA 3ZHEB 5BXUA 3VTXA 4JD2G 3CIAA 4FULA 1ELWA 2F0YA 3FTXA 5FQ7A 4UUCA 2VQ2A 4M3OA 5A7DB 2VJ8A 4N39A 4WWNA 3B7TA 2BKKB 3JUEA 2X6KA 3SD5A 2WXGA 5KJKA 1SW6A 2IQCA 4PS3A 4ACKA 2IO3C 1E7UA 4U63A 5BXOA 3PH0C 1SA4A 4GMJA 4GYOA 2FF4A 1D8DA 1HZ4A 1IYGA 4WWPA 5BV1A 3FTUA 3HVEA 3O48A 3NOCD
chains in the Genus database with same CATH topology
5J90A 2J49A 4AP2A 3PREA 2FI7A 4CT4A 3ENEA 5J08A 3CQCB 3FUMA 3U64A 1BPOA 3HDXA 4AEZC 4DK5A 4APFA 2LSUA 3NZSA 5KJLA 2XCCA 4RSYA 3D9JA 4JEHA 2LAHA 1UJKA 3HYMB 1H2UA 4GA0A 4N3CA 3IBEA 3GZ2A 3DPDA 4JPSA 1ELKA 2L9BA 4XX5A 3LS8A 4MKTA 4GA2A 4YNDA 4FADA 1QZ2A 4HXIA 5AIJA 2WXPA 4CCAA 4Q69A 1E90A 5AJDA 4I2WA 4L2LA 2X6JA 3K9IA 3SI5A 2VSOE 3FH5A 4A3TA 3APDA 3PEUB 2XEVA 4GZ5A 4UWKA 1UW4B 3Q49B 4PDXA 5EKQD 5ARFA 1SZAA 3FTWA 3LY8A 4FA6A 3GZ1A 5A23A 5C2YA 3S7FA 2PQRA 3HVEB 5FZQA 4GPKA 3NF1A 3FTYA 5FTPA 1DVPA 4EECA 4XIFA 3SF4A 3QK0A 3ZEFA 4WNGA 4B8AA 3CVWA 1IQRA 3Q15A 3OXLA 4J8SA 3Q5MA 5EDSA 3R9AB 5BNWA 1JWGA 2J9QA 2WPVA 5G04J 4O6FA 4JXTA 4OYSA 4L1BA 4CDMA 4FC8A 3LVRE 5CHEE 3NQPA 1U3DA 4JL0A 4HS2A 1FVFA 3LYAA 4FLBA 4HOQA 3FWVA 4UWFA 1HE8A 2KM4A 1JWFA 2I2OA 3Q4AB 4XKBA 4I17A 3TG4A 3VLEA 4I1MA 5G05C 3SFZA 4I2ZA 4CDNA 4DI4A 2CHZA 1NA0A 4WWNA 1TJFA 2AXVA 2V8SE 3NZUA 4I6GA 4C9BB 4KZCA 5KJNA 4Q94A 3IV0A 4NURA 2X3MA 1HF8A 1L5JA 2PZIA 2KZTA 2OVBA 4FHKA 4JA7A 4UQYA 4URKA 3LXUX 3UMVA 2AXUA 3ASDA 3EHNA 3G2UA 2BUGA 3FUHA 4RG6A 3UT4A 2LSVA 1UN8A 3UT8A 3ZXSA 1SZ9A 4UQZA 1HU3A 4BFRA 3CSTA 2X6FA 2VYIA 3CHMA 2HR2A 2HYZA 2BTDA 3LY9A 3QWPA 2J09A 3LY7A 5FZSA 1HXIA 4UI9C 1H2VC 2GRLA 3I4GA 1DNPA 3VTYA 1VDYA 3D9MA 2KCKA 4GA1A 4BT8A 4I9CA 4ATGA 1XGWA 1GW6A 1TEZA 4DJAA 4AIFA 1UG3A 2KCLA 4K03A 4JVSA 5D0QD 2WB2A 4JA9A 4Y6WA 3FU0A 4I1AA 5E76A 3URZA 3ZYLA 3CVUA 5JHBA 1OWOA 2WMNA 5LX8A 4CRWA 5BPPA 3UQ3A 4OVUA 1N52A 5ENNA 5A6CA 2VSYA 4F3VA 5T4YA 1ELRA 5G55A 3D9LA 5CCLA 3EIJA 4H7XA 5FQ4A 3OAWA 2WXQA 4GYWA 1LF8A 3JQ0A 4I6EA 3RU0A 3SHFA 4KYOB 3FUJA 3KD7A 3U4TA 2WM9A 3HHMA 3CVLA 1P5QA 4HOUA 3LPZA 3APCA 2YINA 4GZ3A 3HIZA 3MGBA 2KZTB 4GAAA 5FQ8A 5G2NA 3UT7A 5KJMA 4JZYA 4YVOA 5LFAA 3KAEA 4XZ4A 4ANVA 2Y4UA 2LO6A 4XKCA 4GU5A 4ANUA 1TJCA 2DCPA 4N2QA 3B7UX 5FQ6A 4AJWA 2FEZA 3SBTB 2WXLA 3FP3A 3GYZA 4FJZA 3G2TA 5BUZA 4Q96A 2CG3A 4MLPA 4GZCA 4NQ0A 4ILGA 4WWOA 4B0ZA 5LCWC 3CR3A 5FJYA 1HG2A 4FU3A 4JEUA 3MX3A 2OV8A 2CHXA 3FDHA 3QOUA 3TJPA 2IJGX 4RVBA 4I9EA 2XHEA 1QNFA 4BX8A 3PS6A 2NC9A 2ONDA 3GZSA 5M72A 3ZIMA 1E96B 2C2LA 4JC8A 4F1SA 2L6JA 3FEXA 3PUKA 3FH8A 2CFZA 1HO8A 3EJNA 3FH7A 2WQ6A 5LOZA 4ABNA 3OXFA 5BT1A 4EBAA 4KBQA 3RO3A 4TRQA 2WVIA 3B7RL 2FO7A 4KZ0A 4D10C 4A3VA 1N54A 2X6IA 3FUEA 2RD0A 3CK9A 3MCXA 3ONKA 2CG2A 3LVQE 5C1DA 4EPZA 3U9WA 2IU1A 3G2VA 2WXMA 3CK7A 1IHGA 4GZDA 2AWIA 3CK8A 3MKRA 4G1TA 5BW8C 2FBNA 3U66A 2YNQA 4I43A 3ASHA 3QC1A 5ARGA 3LEWA 3G2WA 3FY4A 3FUFA 3L16A 4WAFA 1E8WA 4DPRA 5BV0A 3LDZA 3TXMA 4U8HA 2Y4TA 2WQHA 2WXJA 3QAQA 4N3BA 2ZU6B 4QFVA 3SBSA 4U0UA 4L7TA 4EZJA 2P58C 5CMYA 2GRMA 3FHEA 5JJTA 2PL2A 4ACLA 2V4LA 2DIWA 4JHJA 4AY5A 3CSFA 3FEYA 2HM8A 4MS6A 4EQFA 1H19A 4J8DA 3D9PA 5AJLA 4XI0A 3QARA 1Y6IA 3ULQA 3CVPA 4KVMA 4C0MA 4CGVA 3RK6A 4AOFA 4U04A 3RRMB 3BG1B 3CHRA 3CVYA 4AY6A 1OWMA 4AM9A 2VSXE 1X5BA 3C98A 5ANRA 3FU3A 2CFUA 4U0ZA 3WXXA 2PM7A 4BTBA 3PRZA 3ZPJA 4HOTA 4GB9A 3ZVVA 2AXZA 1SQMA 3PDNA 3EHMA 3CVXA 2X38A 4PH4B 3D9KA 4PUCA 5HI7A 3T5VA 4EZLA 3ZW3A 3RRUA 3RJVA 1OWLA 4JHKA 3RO2A 1NP7A 3L54A 2KC7A 1KT1A 4KMOA 3TL5A 3MV2B 3PEVB 4A55A 3U3WA 3T5XA 5E75A 3TAXA 1NA3A 4G2VA 3I4RB 4N5CA 3EDTB 3PE4A 3SGHA 3G2SA 1PC2A 1KLXA 4MRUA 4AXHA 1H0AA 1WM5A 3SNXA 3TG5A 4F7AA 3ZN3A 4GMLA 2XQ0A 1MHQA 5ANLA 3QDNA 1E8YA 2XGSA 3R7RA 5D0OD 3CHSA 1OWPA 1WAO1 2CHWA 4JW1A 2LNIA 1JPLA 2XPYA 2M63A 3ONLA 4APOA 3CGHA 3CKCA 1Z3XA 1QQEA 3CVQA 2OVFA 4ANXA 3QWWA 2WXOA 3I5PA 4OVVA 3T8MA 4L2YA 4GZ6A 3CHPA 4J8FA 2AW6A 5T3RA 1NZNA 2J08A 2WMOA 2QY7A 3AS8A 4XE0A 3QB2A 3DBSA 2L0IA 4BX9A 4EBAG 2EQXA 3PNLB 4I1OB 3QJZA 3FUDA 2MHKA 5G05J 1OWNA 3FU6A 2FULA 3LJ3A 4RG9A 2XGMA 3IKOB 1E7VA 4HFGA 4ILHB 5FT9A 2WQ7A 4WUYA 2VTBA 3E4BA 5DIZA 1FVHA 3CVNA 2XGOA 4CGWA 3FUNA 1JUQA 1YA0A 4FLHA 1B89A 3UX4A 4E85A 3MV3B 2WXFA 2L0TB 4ME2A 3FU5A 4PS7A 4BT9A 3S7BA 5DBKA 2R17C 4GCNA 4AV7A 3FUIA 3ML9A 4N2SA 2IFUA 3L22A 1ZU2A 3D9OA 4XI9A 5G04C 3CKBA 3I3NA 2IOSA 3MZLB 4WNEA 1PAQA 3ML8A 4FP7A 3GW4A 3ZFWA 3CLJA 3ESLA 4ANWA 3CHOA 2YHEA 4HORA 4LEUA 4IRUA 3CQGB 2PM6A 3D3MA 4IYPA 4V3IA 1Z6TA 2GW1A 2OOEA 2RG8A 2NSZA 4U0SA 1EDUA 4Y6CA 4J8EA 2XRYA 4R7LA 2VGXB 2WXHA 2UWJG 2WXRA 1OUVA 4F53A 3SZ7A 4UWLA 4TV3A 4NRHB 2I9CA 3VLFA 2I1JA 1S0PA 5HQ8A 3TGOA 2VTBB 3AS5A 3S7JA 3TXNA 1UN9A 1HH8A 3EIQC 3JUIA 3JCKC 4BTAA 3OTNA 4H7YA 2UY1A 2KATA 4K0RA 4LERA 4G26A 3FTSA 3S7DA 3FTZA 4CDRA 3D9NA 3MJWA 4UWHA 3S2AA 5CCMA 2ILRA 4B89A 2WXKA 4LRZA 4UI9K 1EYHA 4N3AA 5LCWJ 2DBAA 3CEQA 4C0EA 4JHRA 3L6AA 4YVQC 2V5FA 2QFCA 2A4ZA 3ASFA 3ZHEA 5JHAA 4WNDA 4FJYA 1HX8A 2MOWA 3PNTB 4UQXA 4W9RA 4TUUA 2LAIA 3PE3A 4IN3B 3RIBA 4BSXA 4BWRA 3B7SA 3BG0B 3IHYA 3ZGQA 4A1SA 4KXKB 5JJ6A 3PUJA 1XNFA 2KCVA 3AS4A 4G23A 4LUNU 3CHQA 3MA5A 3KEZA 3VLDA 4HOSA 2J4DA 4DI3A 1U3CA 3ZYKA 2E2EA 4KT6B 3ZYMA 3CVVA 2PQNA 3ZYQA 3CV0A 2XPZA 4HLEA 3UPVA 4E6HA 3BEEA 2HO1A 3UUXA 5T8IA 4B94A 1IQUA 4L23A 2XRZA 2UY1B 3JQ1A 5KCMA 5AYWD 1INZA 3QWVA 4GYYA 3D9IA 3QNKA 4PS8A 5JJ7A 3ZRHA 3FULA 2VSNA 4G24A 4DLQA 4CEMA 1MQSA 4AVXA 4J0UA 2BF0X 5FWQA 4A1GA 1ZBPA 3Q47B 2R5SA 2C0MA 4U07A 2NXPA 3IHVA 4LCTA 4DLOA 4CT0A 3L13A 2XPIA 4KVOA 3IEGA 2A5UA 2IOLA 1W3BA 4I6JA 3RKVA 5LP0A 4IULA 3ZHEB 2WXNA 4B8CB 2MRIA 1WY6A 3VTXA 1H6KA 2R59A 3CIAA 3O4ZA 3P1UA 5AENA 3N71A 4FULA 4J6IA 2GGFA 2X6HA 1ELWA 3FTXA 1Z3YA 2WXIA 2I6HA 3MKQA 5FQ7A 4EZKA 3FUKA 2IF4A 3MEKA 2VQ2A 4M3OA 5A7DB 2VGYA 3AU4A 1A17A 1HS6A 2VJ8A 3LCAA 4GCOA 4N39A 4P29A 4WNFA 5CMWA 2IONA 1Y8MA 3L17A 1EF1C 1HFAA 2I1KA 3B7TA 2XCBA 3LKUA 3MYVA 2X6KA 4UWGA 3SD5A 1HG5A 4ILIA 2WXGA 2YQ8A 5KJKA 2VGXA 1UJJA 3PZDA 3RRNB 1KT0A 2Q7FA 1EPUA 2IQCA 2J07A 3ESKA 4PS3A 2AVPA 3FFLA 4ACKA 2V0PA 3L08A 3APFA 1E7UA 3B13A 3P2BA 1E8XA 4FHJA 4NACA 4U63A 1H2TC 2JEKA 4G11A 1FCHA 3PH0C 2E0IA 1E8ZA 2C0LA 4GMJA 4GYOA 3R7QA 2J4BA 4G25A 2FF4A 2Y3AA 4HVBA 2YHCA 1PY1A 3KS2A 1HZ4A 3AU5A 1IYGA 4BY6A 5EX3A 5FZRA 3PVLA 4UI9J 4WWPA 3ASGA 3OXGA 3FTVA 3QKYA 5BV1A 3FTUA 3HVEA 3MKQB 3JYSA 2JLBA 5EX0A 3O48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FI7 A;  2LSU A;  5KJL A;  2XCC A;  3HYM B;  4GA0 A;  4N3C A;  3GZ2 A;  4YND A;  4GA2 A;  1QZ2 A;  4I2W A;  3K9I A;  2XEV A;  4GZ5 A;  3Q49 B;  5ARF A;  5EKQ D;  3LY8 A;  3GZ1 A;  3S7F A;  2PQR A;  5FZQ A;  4GPK A;  3NF1 A;  5FTP A;  4XIF A;  3SF4 A;  4WNG A;  3Q15 A;  3OXL A;  3Q5M A;  3R9A B;  5BNW A;  5G04 J;  2J9Q A;  2WPV A;  4O6F A;  5CHE E;  4JL0 A;  3LYA A;  4HOQ A;  3FWV A;  3TG4 A;  3Q4A B;  4I17 A;  5G05 C;  4I2Z A;  1NA0 A;  5KJN A;  2PZI A;  4JA7 A;  4UQY A;  3ASD A;  2BUG A;  4RG6 A;  2LSV A;  4UQZ A;  2VYI A;  2HR2 A;  2HYZ A;  3LY9 A;  3QWP A;  3LY7 A;  5FZS A;  1HXI A;  4UI9 C;  3VTY A;  4GA1 A;  2KCK A;  4BT8 A;  4I9C A;  4AIF A;  2KCL A;  5D0Q D;  4JA9 A;  4Y6W A;  4I1A A;  3URZ A;  5A6C A;  3UQ3 A;  2VSY A;  4F3V A;  1ELR A;  5CCL A;  4H7X A;  3RU0 A;  4GYW A;  3U4T A;  4KYO B;  3KD7 A;  3CVL A;  1P5Q A;  4HOU A;  3LPZ A;  4GZ3 A;  5KJM A;  4YVO A;  3KAE A;  2Y4U A;  1TJC A;  4N2Q A;  2FEZ A;  3FP3 A;  3GYZ A;  5LCW C;  4NQ0 A;  5FJY A;  3QOU A;  4I9E A;  2NC9 A;  2OND A;  5M72 A;  1E96 B;  2C2L A;  2L6J A;  4ABN A;  3OXF A;  5BT1 A;  4KBQ A;  3RO3 A;  2FO7 A;  3CK9 A;  5C1D A;  3CK7 A;  1IHG A;  3CK8 A;  3MKR A;  4G1T A;  5BW8 C;  2FBN A;  3ASH A;  5ARG A;  2Y4T A;  2WQH A;  4N3B A;  4U0U A;  2P58 C;  5JJT A;  2PL2 A;  4AY5 A;  4EQF A;  4J8D A;  4XI0 A;  3ULQ A;  3CVP A;  4CGV A;  4U04 A;  4AY6 A;  4AM9 A;  4U0Z A;  3WXX A;  4BTB A;  3ZPJ A;  4HOT A;  3PDN A;  5HI7 A;  3RJV A;  3RO2 A;  2KC7 A;  1KT1 A;  3MV2 B;  3U3W A;  3TAX A;  1NA3 A;  4G2V A;  4N5C A;  3EDT B;  3PE4 A;  1PC2 A;  1KLX A;  1WM5 A;  3TG5 A;  3ZN3 A;  3QDN A;  2XGS A;  5D0O D;  1WAO 1;  2LNI A;  4APO A;  3CKC A;  1QQE A;  3CVQ A;  3QWW A;  4GZ6 A;  4J8F A;  1NZN A;  3AS8 A;  2MHK A;  5G05 J;  4RG9 A;  2XGM A;  5FT9 A;  4WUY A;  3E4B A;  5DIZ A;  3CVN A;  2XGO A;  4CGW A;  1YA0 A;  1B89 A;  3MV3 B;  4ME2 A;  4BT9 A;  3S7B A;  5DBK A;  4GCN A;  4N2S A;  2IFU A;  1ZU2 A;  4XI9 A;  5G04 C;  3CKB A;  4WNE A;  3ZFW A;  3GW4 A;  4HOR A;  4LEU A;  2GW1 A;  2OOE A;  4U0S A;  4Y6C A;  4J8E A;  2VGX B;  2UWJ G;  1OUV A;  3SZ7 A;  4NRH B;  5HQ8 A;  3TGO A;  3AS5 A;  3S7J A;  1HH8 A;  4BTA A;  4H7Y A;  2UY1 A;  2KAT A;  4G26 A;  3S7D A;  4CDR A;  5CCM A;  4UI9 K;  4N3A A;  5LCW J;  2DBA A;  3CEQ A;  4JHR A;  4YVQ C;  2V5F A;  2QFC A;  3ASF A;  3ZHE A;  4WND A;  4UQX A;  4W9R A;  3RIB A;  3PE3 A;  4IN3 B;  4BWR A;  3ZGQ A;  4A1S A;  4KXK B;  5JJ6 A;  1XNF A;  2KCV A;  3AS4 A;  4G23 A;  3MA5 A;  4HOS A;  2E2E A;  2PQN A;  3CV0 A;  3UPV A;  3BEE A;  2HO1 A;  3UUX A;  4B94 A;  2UY1 B;  5AYW D;  3QWV A;  4GYY A;  5JJ7 A;  2VSN A;  4G24 A;  4J0U A;  1ZBP A;  3Q47 B;  2R5S A;  2C0M A;  4U07 A;  2XPI A;  3IEG A;  3RKV A;  1W3B A;  3ZHE B;  3VTX A;  3N71 A;  1ELW A;  2I6H A;  2IF4 A;  3MEK A;  2VQ2 A;  5A7D B;  2VGY A;  1A17 A;  4N39 A;  3LCA A;  4GCO A;  4WNF A;  1Y8M A;  3LKU A;  2XCB A;  2YQ8 A;  5KJK A;  2VGX A;  1KT0 A;  2Q7F A;  3ESK A;  2AVP A;  3FFL A;  1FCH A;  2C0L A;  4GYO A;  4G25 A;  2FF4 A;  2YHC A;  3KS2 A;  1HZ4 A;  1IYG A;  5EX3 A;  5FZR A;  4UI9 J;  3ASG A;  3OXG A;  3QKY A;  3JYS A;  2JLB A;  5EX0 A;  3O48 A; 
#chains in the Genus database with same CATH topology
 5HKP A;  3SFX A;  4DX7 D;  3ENE A;  5J08 A;  3U64 A;  3UIP C;  4DK5 A;  4APF A;  3HRA A;  2LSU A;  1O1T A;  4JEH A;  3HYM B;  4GA0 A;  3DPD A;  4JPS A;  4Q69 A;  3UKR G;  4L2L A;  4A3T A;  3APD A;  3PEU B;  4PDX A;  2XZT G;  1SZA A;  3FTW A;  3HXB A;  4GTO A;  3GZ1 A;  2EIJ E;  1TN8 A;  2PQR A;  3C5R A;  4XIF A;  3ZEF A;  4B8A A;  1IQR A;  1QBQ A;  1WDY A;  4CDM A;  4CZ2 D;  5CHE E;  1RZ4 A;  3NQP A;  1U3D A;  4JL0 A;  4HS2 A;  4DX2 A;  1FVF A;  4FLB A;  4UWF A;  3T9K A;  3C3R A;  2KM4 A;  1JWF A;  3ABM E;  4CDN A;  2A5E A;  3NZU A;  4I6G A;  4C9B B;  5KJN A;  3PZ4 A;  4URK A;  4UQY A;  2AXU A;  2RFM A;  2BUG A;  4RG6 A;  2LSV A;  1UN8 A;  4LNG A;  1RW2 A;  3NB2 A;  3VTY A;  1DNP A;  1VDY A;  4BT8 A;  1H6O A;  3FU0 A;  3CVU A;  1OWO A;  3ZXP A;  4CRW A;  5BPP A;  5CCL A;  3Q75 A;  4GYW A;  3JQ0 A;  3KD7 A;  3LPZ A;  1AP7 A;  5KJM A;  4YDW A;  5LFA A;  4ANV A;  2Y4U A;  3NAW A;  4GU5 A;  4ANU A;  4N2Q A;  1OCC E;  4AJW A;  3TWV A;  4FJZ A;  5AAO A;  5BUZ A;  4MLP A;  5LCW C;  4GZC A;  4NQ0 A;  4ILG A;  5FJY A;  2CHX A;  3TJP A;  2XS8 A;  2XHE A;  4BX8 A;  3DSS A;  2NC9 A;  3HXF A;  4HI9 A;  1E96 B;  3DST A;  1JCQ A;  3FH8 A;  2WQ6 A;  3FH7 A;  4KBQ A;  4LSZ E;  3B7R L;  3V2X A;  4C48 B;  4D10 C;  2H6F A;  3ONK A;  4EPZ A;  4GZD A;  3CK8 A;  5BW8 C;  3QC1 A;  1IHB A;  3HG0 D;  2R03 A;  3EUV A;  3SBS A;  4U0U A;  3W9G A;  5CMY A;  4JHJ A;  4AY5 A;  4EQF A;  1H19 A;  4J8D A;  2AJA A;  3SQV A;  4XI0 A;  3QAR A;  2XS1 A;  3ULE G;  3CVP A;  4U95 D;  3RK6 A;  4AOF A;  3BG1 B;  4DUI A;  3E30 A;  1OWM A;  1X5B A;  3C98 A;  3Q7F A;  3FU3 A;  4BTB A;  1KZP A;  4GB9 A;  3ZVV A;  1SQM A;  3PDN A;  2X38 A;  2OEW A;  3RRU A;  1OWL A;  3L54 A;  4O1O A;  4N5C A;  3E34 A;  3PE4 A;  1N4R A;  4N5Q A;  3G2S A;  1PC2 A;  4ZFH A;  1H0A A;  1WM5 A;  3TG5 A;  3QDN A;  1E8Y A;  2XGS A;  1WAO 1;  2LNI A;  2XPY A;  2M63 A;  4APO A;  3CGH A;  1QQE A;  1FT2 A;  3QWW A;  3I5P A;  3T8M A;  4K5B A;  3CHP A;  5T3R A;  4TXP A;  2WMO A;  2L0I A;  4BX9 A;  4EBA G;  2EQX A;  3PNL B;  4I1O B;  3FUD A;  1DCE A;  2XGM A;  3UM3 A;  3E4B A;  5DIZ A;  3CVN A;  1B89 A;  4ME2 A;  3DRA A;  4BT9 A;  2R17 C;  4GCN A;  4N2S A;  1OCR E;  3GW4 A;  4ANW A;  1MZC A;  3BUA A;  4K5C A;  3D3M A;  1Z6T A;  2OOE A;  2VGX B;  2WXH A;  4UWL A;  2I9C A;  2I1J A;  3TGO A;  3EIQ C;  3OTN A;  3ZNG A;  4K0R A;  3S2A A;  4B89 A;  4LRZ A;  4N3A A;  5LCW J;  1YYH A;  4JHR A;  3ASF A;  3ZHE A;  4WND A;  4W9R A;  1BD8 A;  3BG0 B;  3KEA A;  3F6Q A;  5JJ6 A;  2J4D A;  4HRM B;  1U3C A;  4KT6 B;  3CVV A;  2XPZ A;  3UPV A;  4E6H A;  5HRY A;  2UY1 B;  2DZN A;  3EHQ A;  5AYW D;  5JJ7 A;  3D9I A;  2VSN A;  4G24 A;  5HS0 A;  4AVX A;  1KZO A;  2BF0 X;  4A1G A;  2A5U A;  1W3B A;  3HXC A;  3UI2 A;  5CED B;  5LP0 A;  1H6K A;  2GGF A;  2X6H A;  1Z3Y A;  2I6H A;  3Q9N C;  2VGY A;  1HS6 A;  4P29 A;  5CMW A;  4WNF A;  3MYV A;  1EF1 C;  1HFA A;  2XCB A;  1UJJ A;  5IY5 E;  1KT0 A;  2ZIR A;  3DSW A;  1EPU A;  3ESK A;  2Y69 E;  4NAC A;  5H7P A;  4G11 A;  4O1P A;  1FCH A;  2LXL A;  3AG4 E;  3R7Q A;  2J4B A;  4G25 A;  1PY1 A;  3AU5 A;  2P9S G;  5FZR A;  3PVL A;  1TNB A;  3J5Q B;  3FTV A;  3DXK G;  4GTP A;  5EIL A;  3PRE A;  5ENR D;  4CT4 A;  3FUM A;  1N94 A;  3KSL A;  4AEZ C;  3DPY A;  1MYO A;  3D9H A;  3D9J A;  3T8K A;  1H2U A;  4N3C A;  3IBE A;  1ELK A;  4MKT A;  2V5Q C;  4GA2 A;  4HXI A;  5AJD A;  4I2W A;  4GTQ A;  1V54 E;  2VSO E;  3Q7A A;  1UW4 B;  3R9M A;  5EYP F;  4FA6 A;  5C2Y A;  5ENP D;  4X8Q A;  2LXM A;  5ENO D;  2XZD G;  1FT1 A;  3QK0 A;  4WNG A;  3CVW A;  1DC2 A;  3SY2 A;  2WPV A;  4O6F A;  4JXT A;  4OYS A;  3LVR E;  5ENT D;  1N11 A;  3V30 A;  1JCR A;  3E37 A;  3VLE A;  2KXP C;  3SFZ A;  2CHZ A;  1TJF A;  4KZC A;  4Q94 A;  4NUR A;  2PZI A;  3LXU X;  2JAB A;  2KBX A;  3UT4 A;  3UT8 A;  1SZ9 A;  4UQZ A;  1HU3 A;  2VYI A;  2HR2 A;  2HYZ A;  2BTD A;  3LY7 A;  2R2L A;  4UI9 C;  2KCK A;  4DJA A;  4K03 A;  2KCL A;  4Y6W A;  3LJN A;  2WMN A;  1N0R A;  5A6C A;  4OVU A;  1N52 A;  5ENN A;  5G55 A;  3EIJ A;  3RU0 A;  3OAW A;  2WXQ A;  3U4T A;  1K1B A;  1MX6 A;  5FQ8 A;  5G2N A;  3UT7 A;  4XZ4 A;  2LO6 A;  4XKC A;  2DCP A;  2WXL A;  3GYZ A;  3G2T A;  4GMR A;  2CG3 A;  4WWO A;  3CR3 A;  1HG2 A;  4GTR A;  3FDH A;  2R05 A;  3EHR A;  3DWL G;  3ZIM A;  2C2L A;  4F1S A;  2L6J A;  1O1S A;  3EJN A;  5LOZ A;  4EBA A;  2XEH A;  3Q78 A;  5AQ7 A;  3E33 A;  4HI8 A;  2X6I A;  5EYL A;  1NFI E;  2RD0 A;  1S64 A;  3NBN B;  3LVQ E;  5C1D A;  3G2V A;  2WXM A;  3U66 A;  2FBN A;  4I43 A;  5ARG A;  3LEW A;  4GTT A;  2IO2 C;  4WAF A;  1BI8 B;  4DPR A;  2MYO A;  2WXJ A;  4L7T A;  2P58 C;  2GRM A;  2P9K G;  3CSF A;  5AJL A;  3W9F A;  3AG1 E;  4CGV A;  4DX5 D;  3V31 A;  5FIO A;  3ABK E;  2CFU A;  3WXX A;  3ZPJ A;  2AXZ A;  3EHM A;  4PH4 B;  3D9K A;  4EHM A;  3ZW3 A;  3RJV A;  4JHK A;  1NP7 A;  1KT1 A;  3PEV B;  1FPP A;  3T5X A;  1NA3 A;  2ETA A;  3ASN E;  4F7A A;  4GML A;  5ANL A;  4JB8 P;  4JW1 A;  1JPL A;  5KNG A;  3UM0 A;  2OVF A;  3ZUV B;  1Z5S C;  4BES A;  4GZ6 A;  4U8Y D;  5CRV A;  2AW6 A;  1NZN A;  3AS8 A;  4XE0 A;  2MHK A;  3FU6 A;  4RG9 A;  4B93 B;  1DCQ A;  4ILH B;  2WQ7 A;  1N9A A;  2XGO A;  1LD7 A;  1YA0 A;  4FLH A;  3UX4 A;  2L0T B;  3DSX A;  3RSE G;  4PS7 A;  3WG7 E;  5DBK A;  4AV7 A;  3L22 A;  3D9O A;  3I3N A;  4WNE A;  4XEI G;  4FP7 A;  3ESL A;  3CHO A;  2YHE A;  1NI1 A;  1SA5 A;  3L82 A;  2GW1 A;  2RG8 A;  4U0S A;  1EDU A;  4R7L A;  4F53 A;  4TV3 A;  3VLF A;  3AS5 A;  1HH8 A;  4BTA A;  2UY1 A;  3AAA C;  4LER A;  1OT8 A;  2H6G A;  3S7D A;  2ETC A;  3FTZ A;  3Q79 A;  2QYU A;  4UWH A;  2WXK A;  4UI9 K;  2DBA A;  3CEQ A;  4YVQ C;  3L6A A;  2H6I A;  2QFC A;  1X81 A;  5JHA A;  1HX8 A;  3PNT B;  4TUU A;  2LAI A;  4BWR A;  1O5M A;  2Y1L E;  1YMP A;  1IKN D;  5D66 A;  4A1S A;  3PUJ A;  4TUM A;  2KCV A;  4HOS A;  4DI3 A;  3ZYM A;  2PQN A;  3V79 K;  3BEE A;  2HO1 A;  3Q73 A;  3UUX A;  1IQU A;  3EU9 A;  3QWV A;  3QNK A;  4PS8 A;  3TWU A;  4J7W A;  4DLQ A;  2C0M A;  3IHV A;  3L13 A;  2XPI A;  2ZGG A;  3IEG A;  4I6J A;  3RKV A;  4NIK A;  4B8C B;  2MRI A;  2R59 A;  3O4Z A;  3P1U A;  5AEN A;  3N71 A;  2IF4 A;  3TWT A;  3AU4 A;  1A17 A;  3ISM C;  4GCO A;  2ION A;  1Y8M A;  4G8L A;  4YDE A;  4UWG A;  1HG5 A;  4ILI A;  2YQ8 A;  3PZD A;  2QC9 A;  2Q7F A;  5JA4 D;  2AVP A;  3FFL A;  2V0P A;  3P2B A;  1E8X A;  1H2T C;  2JEK A;  2R02 A;  1AWC B;  2C0L A;  3C3O A;  3DEO A;  3ULY A;  2YHC A;  3KS2 A;  4BY6 A;  4HBD A;  3MKQ B;  4J8Y A;  3PZ1 A;  4DRX E;  2PNN A;  2FI7 A;  5ENQ D;  3CQC B;  3C72 A;  1BPO A;  4BER A;  5KJL A;  2XCC A;  4RSY A;  1UJK A;  5ITZ F;  4YND A;  3LS8 A;  4CCA A;  1E90 A;  2X6J A;  3K9I A;  1V55 E;  3V2O A;  4GZ5 A;  5EKQ D;  3LY8 A;  3S7F A;  3AJI A;  5FZQ A;  3NF1 A;  3FTY A;  5FTP A;  4EEC A;  4HQD A;  3OXL A;  4J8S A;  4CYM D;  3Q5M A;  5EDS A;  5B3S E;  1N4S A;  5BNW A;  4L1B A;  3LYA A;  3FWV A;  5FIN A;  3TG4 A;  2I2O A;  4XKB A;  4I17 A;  4I1M A;  5G05 C;  4U8V D;  2AXV A;  2X3M A;  2OVB A;  4FHK A;  3EHN A;  3KSQ A;  3CST A;  2X6F A;  2J09 A;  3UKU G;  1HXI A;  2DZO A;  2P9N G;  3I4G A;  1D9S A;  4GA1 A;  4ZHB A;  4ATG A;  1GW6 A;  1TEZ A;  4AIF A;  1UG3 A;  4JVS A;  4K5A B;  5D0Q D;  4JA9 A;  2XEE A;  2IEJ A;  2OEV A;  5LX8 A;  1O1R A;  1UOH A;  3UQ3 A;  1ELR A;  3D9L A;  3AG2 E;  1TR4 A;  4I6E A;  3SHF A;  3FUJ A;  4O60 A;  3HHM A;  3CVL A;  1P5Q A;  4HOU A;  4YDO A;  2YIN A;  3TWS A;  3MGB A;  2KZT B;  4GAA A;  2DYS E;  4YVO A;  3KAE A;  1TJC A;  3B7U X;  5FQ6 A;  2DYR E;  2FEZ A;  3SBT B;  4Q96 A;  4B0Z A;  1U2V G;  4FU3 A;  4JEU A;  4ATZ D;  3MX3 A;  1K8K G;  2IJG X;  4HB5 A;  1QNF A;  3TWW A;  2OND A;  3FEX A;  3NOG D;  1HO8 A;  4ABN A;  3OXF A;  5BT1 A;  3RO3 A;  2WVI A;  2FO7 A;  3SO8 A;  1N54 A;  3FUE A;  1MX2 A;  3MCX A;  3CK9 A;  1N4P A;  2CG2 A;  2IU1 A;  3CK7 A;  2AWI A;  3X2Q E;  2P9U G;  2ZXW E;  3FY4 A;  2IY0 C;  5BV0 A;  3LDZ A;  3TXM A;  4U8H A;  4M7C A;  3L9T A;  2ZU6 B;  4QFV A;  4EZJ A;  4U7E B;  3FHE A;  2PL2 A;  4ACL A;  2V4L A;  2DIW A;  2HM8 A;  4HLL A;  4MS6 A;  4U04 A;  3RRM B;  3CVY A;  3CHR A;  4AY6 A;  3J5P A;  4AM9 A;  2VSX E;  2QYJ A;  4U0Z A;  5JMN D;  2PM7 A;  1IXV A;  4HOT A;  3CVX A;  5HI7 A;  3T5V A;  2BED A;  1TNU A;  5E75 A;  3TAX A;  4BEP A;  2RFA A;  1KLX A;  4AXH A;  3ZN3 A;  2XQ0 A;  5D0O D;  3CHS A;  1OWP A;  1SVX A;  3SFY A;  1D8E A;  3CKC A;  3JXJ A;  5D2M C;  4GTV A;  1BI7 B;  3CVQ A;  4ANX A;  4L2Y A;  2V4H C;  4BSZ B;  3QB2 A;  3DBS A;  4GTM A;  2DWZ A;  3QJZ A;  5G05 J;  1OWN A;  3LJ3 A;  3IKO B;  1E7V A;  3UIN C;  3FUN A;  3MV3 B;  2EIK E;  2WXF A;  5KWD A;  4RLY A;  1LD8 A;  1TNO A;  2P9P G;  3FUI A;  3ML9 A;  2FO1 E;  1BU9 A;  2IFU A;  5G04 C;  3CKB A;  2IOS A;  1PAQ A;  3ML8 A;  3ZFW A;  3CLJ A;  4QQI A;  3E32 A;  2ZGD A;  2PM6 A;  4IYP A;  3AG3 E;  3RAU A;  2NSZ A;  4Y6C A;  1MJ0 A;  2XRY A;  4TXQ A;  2VTB B;  3S7J A;  3TXN A;  1UN9 A;  4H7Y A;  2KAT A;  2DVW A;  5EID A;  3FTS A;  4BET A;  3MJW A;  5CCM A;  2ILR A;  1EYH A;  4HRN A;  1TN7 A;  2V5F A;  3ABL E;  3HXD A;  2MOW A;  4OAV B;  3RIB A;  3PE3 A;  4IN3 B;  4BSX A;  1S63 A;  3IHY A;  1YCS B;  2RKK A;  3AS4 A;  4LUN U;  3CHQ A;  3VLD A;  3KEZ A;  5B1B E;  4HNA D;  3ZYQ A;  2OCC E;  1K3Z D;  4HLE A;  4RQI A;  2EIM E;  5T8I A;  1JCS A;  4L23 A;  2XRZ A;  5KCM A;  1INZ A;  4DX6 D;  3FUL A;  5FWQ A;  1ZBP A;  3Q47 B;  4DLO A;  2NXP A;  4CT0 A;  4KVO A;  3PZ2 A;  2IOL A;  5CBN A;  2WXN A;  2BKG A;  1WY6 A;  2HE0 A;  4J6I A;  1WG0 A;  2WXI A;  3MKQ A;  4EZK A;  3TWQ A;  3FUK A;  4GTS A;  3MEK A;  3LCA A;  5JHB A;  4TRQ A;  3L17 A;  3HXE A;  2I1K A;  3LKU A;  2VGX A;  3RRN B;  2J07 A;  3L08 A;  3APF A;  3B13 A;  4FHJ A;  2E0I A;  1E8Z A;  2GRO B;  2Y3A A;  4HVB A;  5CRU A;  5CBO A;  2ETB A;  5EX3 A;  4UI9 J;  3ASG A;  3OXG A;  5CEA A;  3QKY A;  3JYS A;  2JLB A;  2GRN B;  5EX0 A;  5J90 A;  2J49 A;  3DXM G;  4AP2 A;  3HDX A;  5EN5 D;  3NZS A;  2LAH A;  3GZ2 A;  4XX5 A;  2L9B A;  5AAR A;  4FAD A;  1QZ2 A;  1N95 A;  1TN6 A;  5AIJ A;  2WXP A;  3SI5 A;  3FH5 A;  1H6P A;  2XEV A;  4UWK A;  5CER B;  2EIL E;  3Q49 B;  5ARF A;  3ZU7 B;  5A23 A;  3HVE B;  4GPK A;  4TXR A;  1DVP A;  3SF4 A;  1Q2Z A;  2EIN E;  3BQO A;  3Q15 A;  1ZB1 A;  3R9A B;  1JWG A;  2J9Q A;  5G04 J;  4FC8 A;  4HOQ A;  3DSV A;  1HE8 A;  3Q4A B;  4I2Z A;  4DI4 A;  2Y0B G;  1NA0 A;  2V8S E;  3TWR A;  3IV0 A;  1HF8 A;  1L5J A;  2KZT A;  4JA7 A;  3UMV A;  3ASD A;  3G2U A;  3FUH A;  3ZXS A;  5KBA A;  4BFR A;  3CHM A;  2P9L G;  1QYM A;  3PZ3 A;  3LY9 A;  3QWP A;  5FZS A;  1H2V C;  2GRL A;  3D9M A;  3ASO E;  4I9C A;  4F1P A;  1XGW A;  2WB2 A;  5E76 A;  5ENS D;  4I1A A;  3URZ A;  3ZYL A;  1NL4 A;  3EU5 A;  2VSY A;  4F3V A;  5T4Y A;  1A5E A;  4H7X A;  5FQ4 A;  1LF8 A;  4KYO B;  2F8X K;  2WM9 A;  3APC A;  4GZ3 A;  3HIZ A;  4JZY A;  4L9P A;  1BLX B;  5KNH D;  3FP3 A;  2F8Y A;  2OV8 A;  5B1A E;  3Q9U C;  3QOU A;  1TYQ G;  1G3N B;  4RVB A;  4I9E A;  3UIO C;  3PS6 A;  3GZS A;  5AQA A;  5M72 A;  4HRL A;  4JC8 A;  4DX1 A;  3PUK A;  3UM2 A;  2CFZ A;  3UM1 A;  1OXJ A;  4KZ0 A;  4A3V A;  3U9W A;  1IHG A;  2H6H A;  3MKR A;  4G1T A;  2GRR B;  2B0O E;  2YNQ A;  5EIB E;  3ASH A;  5AQB A;  3G2W A;  3FUF A;  3L16 A;  4G8K A;  1E8W A;  4OAU C;  2Y4T A;  2WQH A;  3QAQ A;  5AQ9 A;  2ZIS A;  4N3B A;  4U96 D;  2B6C A;  5JJT A;  1TNY A;  3DEP A;  3FEY A;  3D9P A;  4LG6 A;  1Y6I A;  3ULQ A;  4F6R D;  4KVM A;  4C0M A;  3DSU A;  4LNB A;  5ANR A;  3PRZ A;  4PUC A;  3UTM A;  4EZL A;  2P9I G;  3RO2 A;  3UXG A;  2L6B A;  2KC7 A;  4KMO A;  3TL5 A;  4A55 A;  3MV2 B;  3U3W A;  4G2V A;  3I4R B;  3EDT B;  3SGH A;  4MRU A;  3SNX A;  1MHQ A;  4Z68 A;  3R7R A;  2CHW A;  3ONL A;  4YDY A;  2GRP B;  2GRQ B;  1Z3X A;  2WXO A;  4OVV A;  1LTX A;  3ZKJ A;  4J8F A;  2J08 A;  2QY7 A;  1OCO E;  2FUL A;  1KPS B;  3C3Q A;  4HFG A;  5FT9 A;  4WUY A;  2VTB A;  1FVH A;  4CGW A;  2F37 A;  1N4Q A;  1JUQ A;  5AN8 A;  4E85 A;  3JXI A;  1MX4 A;  2P2C P;  3FU5 A;  3B95 A;  3S7B A;  3B7B A;  1ZU2 A;  4XI9 A;  2LUH A;  3MZL B;  4HOR A;  4LEU A;  4IRU A;  5CEC B;  3TWX A;  3CQG B;  4V3I A;  4J8E A;  1OY3 D;  2UWJ G;  2WXR A;  1OUV A;  3SZ7 A;  4NRH B;  4MBG A;  5HQ8 A;  1S0P A;  3IXE A;  1K1A A;  3JUI A;  3JCK C;  4G26 A;  2XEN A;  2NYJ A;  4CDR A;  4GPM A;  3D9N A;  1S70 B;  1OCZ E;  4C0E A;  2J8S D;  2VGE A;  2A4Z A;  4FJY A;  4UQX A;  1N0Q A;  4A63 B;  3B7S A;  3ZGQ A;  4KXK B;  1XNF A;  4G23 A;  3MA5 A;  3ZYK A;  2E2E A;  4LNU D;  1TNZ A;  3CV0 A;  2QZA A;  4B94 A;  3JQ1 A;  4GYY A;  3ZRH A;  4CEM A;  1MQS A;  4J0U A;  4U07 A;  2R5S A;  4LCT A;  3BU8 A;  4IUL A;  3ZHE B;  5BXU A;  3VTX A;  4JD2 G;  3CIA A;  4FUL A;  1ELW A;  2F0Y A;  3FTX A;  5FQ7 A;  4UUC A;  2VQ2 A;  4M3O A;  5A7D B;  2VJ8 A;  4N39 A;  4WWN A;  3B7T A;  2BKK B;  3JUE A;  2X6K A;  3SD5 A;  2WXG A;  5KJK A;  1SW6 A;  2IQC A;  4PS3 A;  4ACK A;  2IO3 C;  1E7U A;  4U63 A;  5BXO A;  3PH0 C;  1SA4 A;  4GMJ A;  4GYO A;  2FF4 A;  1D8D A;  1HZ4 A;  1IYG A;  4WWP A;  5BV1 A;  3FTU A;  3HVE A;  3O48 A;  3NOC D; 
#chains in the Genus database with same CATH homology
 5J90 A;  2J49 A;  4AP2 A;  3PRE A;  2FI7 A;  4CT4 A;  3ENE A;  5J08 A;  3CQC B;  3FUM A;  3U64 A;  1BPO A;  3HDX A;  4AEZ C;  4DK5 A;  4APF A;  2LSU A;  3NZS A;  5KJL A;  2XCC A;  4RSY A;  3D9J A;  4JEH A;  2LAH A;  1UJK A;  3HYM B;  1H2U A;  4GA0 A;  4N3C A;  3IBE A;  3GZ2 A;  3DPD A;  4JPS A;  1ELK A;  2L9B A;  4XX5 A;  3LS8 A;  4MKT A;  4GA2 A;  4YND A;  4FAD A;  1QZ2 A;  4HXI A;  5AIJ A;  2WXP A;  4CCA A;  4Q69 A;  1E90 A;  5AJD A;  4I2W A;  4L2L A;  2X6J A;  3K9I A;  3SI5 A;  2VSO E;  3FH5 A;  4A3T A;  3APD A;  3PEU B;  2XEV A;  4GZ5 A;  4UWK A;  1UW4 B;  3Q49 B;  4PDX A;  5EKQ D;  5ARF A;  1SZA A;  3FTW A;  3LY8 A;  4FA6 A;  3GZ1 A;  5A23 A;  5C2Y A;  3S7F A;  2PQR A;  3HVE B;  5FZQ A;  4GPK A;  3NF1 A;  3FTY A;  5FTP A;  1DVP A;  4EEC A;  4XIF A;  3SF4 A;  3QK0 A;  3ZEF A;  4WNG A;  4B8A A;  3CVW A;  1IQR A;  3Q15 A;  3OXL A;  4J8S A;  3Q5M A;  5EDS A;  3R9A B;  5BNW A;  1JWG A;  2J9Q A;  2WPV A;  5G04 J;  4O6F A;  4JXT A;  4OYS A;  4L1B A;  4CDM A;  4FC8 A;  3LVR E;  5CHE E;  3NQP A;  1U3D A;  4JL0 A;  4HS2 A;  1FVF A;  3LYA A;  4FLB A;  4HOQ A;  3FWV A;  4UWF A;  1HE8 A;  2KM4 A;  1JWF A;  2I2O A;  3Q4A B;  4XKB A;  4I17 A;  3TG4 A;  3VLE A;  4I1M A;  5G05 C;  3SFZ A;  4I2Z A;  4CDN A;  4DI4 A;  2CHZ A;  1NA0 A;  4WWN A;  1TJF A;  2AXV A;  2V8S E;  3NZU A;  4I6G A;  4C9B B;  4KZC A;  5KJN A;  4Q94 A;  3IV0 A;  4NUR A;  2X3M A;  1HF8 A;  1L5J A;  2PZI A;  2KZT A;  2OVB A;  4FHK A;  4JA7 A;  4UQY A;  4URK A;  3LXU X;  3UMV A;  2AXU A;  3ASD A;  3EHN A;  3G2U A;  2BUG A;  3FUH A;  4RG6 A;  3UT4 A;  2LSV A;  1UN8 A;  3UT8 A;  3ZXS A;  1SZ9 A;  4UQZ A;  1HU3 A;  4BFR A;  3CST A;  2X6F A;  2VYI A;  3CHM A;  2HR2 A;  2HYZ A;  2BTD A;  3LY9 A;  3QWP A;  2J09 A;  3LY7 A;  5FZS A;  1HXI A;  4UI9 C;  1H2V C;  2GRL A;  3I4G A;  1DNP A;  3VTY A;  1VDY A;  3D9M A;  2KCK A;  4GA1 A;  4BT8 A;  4I9C A;  4ATG A;  1XGW A;  1GW6 A;  1TEZ A;  4DJA A;  4AIF A;  1UG3 A;  2KCL A;  4K03 A;  4JVS A;  5D0Q D;  2WB2 A;  4JA9 A;  4Y6W A;  3FU0 A;  4I1A A;  5E76 A;  3URZ A;  3ZYL A;  3CVU A;  5JHB A;  1OWO A;  2WMN A;  5LX8 A;  4CRW A;  5BPP A;  3UQ3 A;  4OVU A;  1N52 A;  5ENN A;  5A6C A;  2VSY A;  4F3V A;  5T4Y A;  1ELR A;  5G55 A;  3D9L A;  5CCL A;  3EIJ A;  4H7X A;  5FQ4 A;  3OAW A;  2WXQ A;  4GYW A;  1LF8 A;  3JQ0 A;  4I6E A;  3RU0 A;  3SHF A;  4KYO B;  3FUJ A;  3KD7 A;  3U4T A;  2WM9 A;  3HHM A;  3CVL A;  1P5Q A;  4HOU A;  3LPZ A;  3APC A;  2YIN A;  4GZ3 A;  3HIZ A;  3MGB A;  2KZT B;  4GAA A;  5FQ8 A;  5G2N A;  3UT7 A;  5KJM A;  4JZY A;  4YVO A;  5LFA A;  3KAE A;  4XZ4 A;  4ANV A;  2Y4U A;  2LO6 A;  4XKC A;  4GU5 A;  4ANU A;  1TJC A;  2DCP A;  4N2Q A;  3B7U X;  5FQ6 A;  4AJW A;  2FEZ A;  3SBT B;  2WXL A;  3FP3 A;  3GYZ A;  4FJZ A;  3G2T A;  5BUZ A;  4Q96 A;  2CG3 A;  4MLP A;  4GZC A;  4NQ0 A;  4ILG A;  4WWO A;  4B0Z A;  5LCW C;  3CR3 A;  5FJY A;  1HG2 A;  4FU3 A;  4JEU A;  3MX3 A;  2OV8 A;  2CHX A;  3FDH A;  3QOU A;  3TJP A;  2IJG X;  4RVB A;  4I9E A;  2XHE A;  1QNF A;  4BX8 A;  3PS6 A;  2NC9 A;  2OND A;  3GZS A;  5M72 A;  3ZIM A;  1E96 B;  2C2L A;  4JC8 A;  4F1S A;  2L6J A;  3FEX A;  3PUK A;  3FH8 A;  2CFZ A;  1HO8 A;  3EJN A;  3FH7 A;  2WQ6 A;  5LOZ A;  4ABN A;  3OXF A;  5BT1 A;  4EBA A;  4KBQ A;  3RO3 A;  4TRQ A;  2WVI A;  3B7R L;  2FO7 A;  4KZ0 A;  4D10 C;  4A3V A;  1N54 A;  2X6I A;  3FUE A;  2RD0 A;  3CK9 A;  3MCX A;  3ONK A;  2CG2 A;  3LVQ E;  5C1D A;  4EPZ A;  3U9W A;  2IU1 A;  3G2V A;  2WXM A;  3CK7 A;  1IHG A;  4GZD A;  2AWI A;  3CK8 A;  3MKR A;  4G1T A;  5BW8 C;  2FBN A;  3U66 A;  2YNQ A;  4I43 A;  3ASH A;  3QC1 A;  5ARG A;  3LEW A;  3G2W A;  3FY4 A;  3FUF A;  3L16 A;  4WAF A;  1E8W A;  4DPR A;  5BV0 A;  3LDZ A;  3TXM A;  4U8H A;  2Y4T A;  2WQH A;  2WXJ A;  3QAQ A;  4N3B A;  2ZU6 B;  4QFV A;  3SBS A;  4U0U A;  4L7T A;  4EZJ A;  2P58 C;  5CMY A;  2GRM A;  3FHE A;  5JJT A;  2PL2 A;  4ACL A;  2V4L A;  2DIW A;  4JHJ A;  4AY5 A;  3CSF A;  3FEY A;  2HM8 A;  4MS6 A;  4EQF A;  1H19 A;  4J8D A;  3D9P A;  5AJL A;  4XI0 A;  3QAR A;  1Y6I A;  3ULQ A;  3CVP A;  4KVM A;  4C0M A;  4CGV A;  3RK6 A;  4AOF A;  4U04 A;  3RRM B;  3BG1 B;  3CHR A;  3CVY A;  4AY6 A;  1OWM A;  4AM9 A;  2VSX E;  1X5B A;  3C98 A;  5ANR A;  3FU3 A;  2CFU A;  4U0Z A;  3WXX A;  2PM7 A;  4BTB A;  3PRZ A;  3ZPJ A;  4HOT A;  4GB9 A;  3ZVV A;  2AXZ A;  1SQM A;  3PDN A;  3EHM A;  3CVX A;  2X38 A;  4PH4 B;  3D9K A;  4PUC A;  5HI7 A;  3T5V A;  4EZL A;  3ZW3 A;  3RRU A;  3RJV A;  1OWL A;  4JHK A;  3RO2 A;  1NP7 A;  3L54 A;  2KC7 A;  1KT1 A;  4KMO A;  3TL5 A;  3MV2 B;  3PEV B;  4A55 A;  3U3W A;  3T5X A;  5E75 A;  3TAX A;  1NA3 A;  4G2V A;  3I4R B;  4N5C A;  3EDT B;  3PE4 A;  3SGH A;  3G2S A;  1PC2 A;  1KLX A;  4MRU A;  4AXH A;  1H0A A;  1WM5 A;  3SNX A;  3TG5 A;  4F7A A;  3ZN3 A;  4GML A;  2XQ0 A;  1MHQ A;  5ANL A;  3QDN A;  1E8Y A;  2XGS A;  3R7R A;  5D0O D;  3CHS A;  1OWP A;  1WAO 1;  2CHW A;  4JW1 A;  2LNI A;  1JPL A;  2XPY A;  2M63 A;  3ONL A;  4APO A;  3CGH A;  3CKC A;  1Z3X A;  1QQE A;  3CVQ A;  2OVF A;  4ANX A;  3QWW A;  2WXO A;  3I5P A;  4OVV A;  3T8M A;  4L2Y A;  4GZ6 A;  3CHP A;  4J8F A;  2AW6 A;  5T3R A;  1NZN A;  2J08 A;  2WMO A;  2QY7 A;  3AS8 A;  4XE0 A;  3QB2 A;  3DBS A;  2L0I A;  4BX9 A;  4EBA G;  2EQX A;  3PNL B;  4I1O B;  3QJZ A;  3FUD A;  2MHK A;  5G05 J;  1OWN A;  3FU6 A;  2FUL A;  3LJ3 A;  4RG9 A;  2XGM A;  3IKO B;  1E7V A;  4HFG A;  4ILH B;  5FT9 A;  2WQ7 A;  4WUY A;  2VTB A;  3E4B A;  5DIZ A;  1FVH A;  3CVN A;  2XGO A;  4CGW A;  3FUN A;  1JUQ A;  1YA0 A;  4FLH A;  1B89 A;  3UX4 A;  4E85 A;  3MV3 B;  2WXF A;  2L0T B;  4ME2 A;  3FU5 A;  4PS7 A;  4BT9 A;  3S7B A;  5DBK A;  2R17 C;  4GCN A;  4AV7 A;  3FUI A;  3ML9 A;  4N2S A;  2IFU A;  3L22 A;  1ZU2 A;  3D9O A;  4XI9 A;  5G04 C;  3CKB A;  3I3N A;  2IOS A;  3MZL B;  4WNE A;  1PAQ A;  3ML8 A;  4FP7 A;  3GW4 A;  3ZFW A;  3CLJ A;  3ESL A;  4ANW A;  3CHO A;  2YHE A;  4HOR A;  4LEU A;  4IRU A;  3CQG B;  2PM6 A;  3D3M A;  4IYP A;  4V3I A;  1Z6T A;  2GW1 A;  2OOE A;  2RG8 A;  2NSZ A;  4U0S A;  1EDU A;  4Y6C A;  4J8E A;  2XRY A;  4R7L A;  2VGX B;  2WXH A;  2UWJ G;  2WXR A;  1OUV A;  4F53 A;  3SZ7 A;  4UWL A;  4TV3 A;  4NRH B;  2I9C A;  3VLF A;  2I1J A;  1S0P A;  5HQ8 A;  3TGO A;  2VTB B;  3AS5 A;  3S7J A;  3TXN A;  1UN9 A;  1HH8 A;  3EIQ C;  3JUI A;  3JCK C;  4BTA A;  3OTN A;  4H7Y A;  2UY1 A;  2KAT A;  4K0R A;  4LER A;  4G26 A;  3FTS A;  3S7D A;  3FTZ A;  4CDR A;  3D9N A;  3MJW A;  4UWH A;  3S2A A;  5CCM A;  2ILR A;  4B89 A;  2WXK A;  4LRZ A;  4UI9 K;  1EYH A;  4N3A A;  5LCW J;  2DBA A;  3CEQ A;  4C0E A;  4JHR A;  3L6A A;  4YVQ C;  2V5F A;  2QFC A;  2A4Z A;  3ASF A;  3ZHE A;  5JHA A;  4WND A;  4FJY A;  1HX8 A;  2MOW A;  3PNT B;  4UQX A;  4W9R A;  4TUU A;  2LAI A;  3PE3 A;  4IN3 B;  3RIB A;  4BSX A;  4BWR A;  3B7S A;  3BG0 B;  3IHY A;  3ZGQ A;  4A1S A;  4KXK B;  5JJ6 A;  3PUJ A;  1XNF A;  2KCV A;  3AS4 A;  4G23 A;  4LUN U;  3CHQ A;  3MA5 A;  3KEZ A;  3VLD A;  4HOS A;  2J4D A;  4DI3 A;  1U3C A;  3ZYK A;  2E2E A;  4KT6 B;  3ZYM A;  3CVV A;  2PQN A;  3ZYQ A;  3CV0 A;  2XPZ A;  4HLE A;  3UPV A;  4E6H A;  3BEE A;  2HO1 A;  3UUX A;  5T8I A;  4B94 A;  1IQU A;  4L23 A;  2XRZ A;  2UY1 B;  3JQ1 A;  5KCM A;  5AYW D;  1INZ A;  3QWV A;  4GYY A;  3D9I A;  3QNK A;  4PS8 A;  5JJ7 A;  3ZRH A;  3FUL A;  2VSN A;  4G24 A;  4DLQ A;  4CEM A;  1MQS A;  4AVX A;  4J0U A;  2BF0 X;  5FWQ A;  4A1G A;  1ZBP A;  3Q47 B;  2R5S A;  2C0M A;  4U07 A;  2NXP A;  3IHV A;  4LCT A;  4DLO A;  4CT0 A;  3L13 A;  2XPI A;  4KVO A;  3IEG A;  2A5U A;  2IOL A;  1W3B A;  4I6J A;  3RKV A;  5LP0 A;  4IUL A;  3ZHE B;  2WXN A;  4B8C B;  2MRI A;  1WY6 A;  3VTX A;  1H6K A;  2R59 A;  3CIA A;  3O4Z A;  3P1U A;  5AEN A;  3N71 A;  4FUL A;  4J6I A;  2GGF A;  2X6H A;  1ELW A;  3FTX A;  1Z3Y A;  2WXI A;  2I6H A;  3MKQ A;  5FQ7 A;  4EZK A;  3FUK A;  2IF4 A;  3MEK A;  2VQ2 A;  4M3O A;  5A7D B;  2VGY A;  3AU4 A;  1A17 A;  1HS6 A;  2VJ8 A;  3LCA A;  4GCO A;  4N39 A;  4P29 A;  4WNF A;  5CMW A;  2ION A;  1Y8M A;  3L17 A;  1EF1 C;  1HFA A;  2I1K A;  3B7T A;  2XCB A;  3LKU A;  3MYV A;  2X6K A;  4UWG A;  3SD5 A;  1HG5 A;  4ILI A;  2WXG A;  2YQ8 A;  5KJK A;  2VGX A;  1UJJ A;  3PZD A;  3RRN B;  1KT0 A;  2Q7F A;  1EPU A;  2IQC A;  2J07 A;  3ESK A;  4PS3 A;  2AVP A;  3FFL A;  4ACK A;  2V0P A;  3L08 A;  3APF A;  1E7U A;  3B13 A;  3P2B A;  1E8X A;  4FHJ A;  4NAC A;  4U63 A;  1H2T C;  2JEK A;  4G11 A;  1FCH A;  3PH0 C;  2E0I A;  1E8Z A;  2C0L A;  4GMJ A;  4GYO A;  3R7Q A;  2J4B A;  4G25 A;  2FF4 A;  2Y3A A;  4HVB A;  2YHC A;  1PY1 A;  3KS2 A;  1HZ4 A;  3AU5 A;  1IYG A;  4BY6 A;  5EX3 A;  5FZR A;  3PVL A;  4UI9 J;  4WWP A;  3ASG A;  3OXG A;  3FTV A;  3QKY A;  5BV1 A;  3FTU A;  3HVE A;  3MKQ B;  3JYS A;  2JLB A;  5EX0 A;  3O48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...