4HI8A

Structure of integrin-linked kinase ankyrin repeat domain in complex with pinch1 lim1 domain collected at high energy, wavelength 0.32800
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
170
structure length
169
Chain Sequence
DDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINANEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1 LIM1 domain collected at high energy, wavelength 0.32800
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Integrin-linked protein kinase
total genus 56
structure length 169
sequence length 170
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4hi8A00
4CYMD 3JUEA 2VGEA 4HBDA 2F8YA 3TWSA 4B93B 3JXIA 1NFIE 2ZGGA 5ENSD 3T9KA 2Y1LE 5AAOA 4DX7D 1G3NB 5CECB 1MYOA 2XEHA 4QFVA 4OAUC 2ETCA 1N0QA 3NOCD 3V2XA 4J8YA 4GMRA 2XZDG 2KXPC 4HI8A 3TWQA 3V79K 1BLXB 1WG0A 4DX6D 2DZNA 1K3ZD 2DWZA 3NOGD 5AQBA 4J7WA 2ETAA 3J5PA 4YDWA 5FINA 5EIDA 4HRMB 2J8SD 1YYHA 4K5BA 5CEDB 3W9GA 3UI2A 1MX4A 5EYLA 3AAAC 2V4HC 1S70B 4BSZB 2BKKB 4O1PA 5ENRD 5AQ7A 4DX5D 4O1OA 3JXJA 2F8XK 3TWXA 3UXGA 3DEOA 5ENOD 2Y0BG 4C48B 1BD8A 2MYOA 4ATZD 1TR4A 2BKGA 3SO8A 1MJ0A 5BXOA 4A63B 1SVXA 1BU9A 4UUCA 5AQAA 4ZFHA 1AWCB 2XENA 3DEPA 2FO1E 5KNHD 4F6RD 1DCQA 2JABA 2QYJA 2ZGDA 4HLLA 4O60A 5D66A 4BERA 2DVWA 5ENTD 5BXUA 5KWDA 4HQDA 3W9FA 1D9SA 3HG0D 4K5CA 4K5AB 5JA4D 1MX2A 1AP7A 4NIKA 5KNGA 2L6BA 3Q9UC 2PNNA 1BI8B 4GPMA 4U96D 1QYMA 1N11A 1K1AA 1YCSB 3TWWA 2AJAA 3ZKJA 3ZU7B 3TWRA 5EILA 1MX6A 5HRYA 5EN5D 3IXEA 4RLYA 3T8KA 4TUMA 4HNAD 3UTMA 4OAVB 4BETA 1OY3D 2F37A 3EHQA 3Q9NC 3D9HA 5FIOA 5ITZF 5EYPF 4BESA 1YMPA 1WDYA 2DZOA 3V2OA 4HI9A 3ZUVB 2RFMA 4HRNA 4U8YD 4U95D 1IKND 3B7BA 4N5QA 4BEPA 4CZ2D 1A5EA 5ENPD 2V5QC 5AN8A 2ETBA 3AJIA 2P2CP 3HRAA 1IXVA 2HE0A 4DUIA 1UOHA 4LSZE 4DX2A 4HRLA 4DRXE 5AQ9A 1BI7B 4Z68A 2RFAA 5HKPA 1IHBA 1K1BA 2A5EA 3EU9A 4HB5A 3TWTA 4DX1A 4ZHBA 4YDYA 1DC2A 5JMND 5EIBE 3TWUA 2NYJA 4QQIA 3C5RA 2XEEA 4LG6A 4G8KA 1OT8A 5ENQD 5HS0A 4F1PA 4U8VD 3ZNGA 3V30A 5AARA 5CBNA 5KBAA 5CERB 3B95A 3TWVA 3F6QA 3V31A 2B0OE 3LJNA 3NBNB 1SW6A 1N0RA 2XZTG 3EHRA 3J5QB 2QC9A 5CBOA 3KEAA 4JB8P 4LNUD 2KBXA 5CEAA 4G8LA
chains in the Genus database with same CATH superfamily
4GMJA 3S7FA 4EZKA 1NFIE 1WY6A 1ZBPA 1G3NB 2R2LA 4GYWA 1TJFA 1U3DA 1SZAA 4GPKA 3V79K 4FULA 1JCQA 4GZDA 3UX4A 5EIDA 4HRMB 3RJVA 4I2ZA 1HX8A 1N4PA 3IKOB 4DX5D 4O1OA 3JXJA 5FQ4A 4JHJA 4OYSA 3UKUG 4LNBA 4N3CA 1OWNA 5ANLA 5CRVA 1OCOE 3CVNA 3LCAA 3L13A 3QDNA 5FZQA 1MX2A 4GZ6A 2FF4A 4EZLA 2WXQA 2AJAA 4H7YA 4AIFA 2OVFA 3UT8A 2X6HA 2ONDA 1KT1A 1TYQG 2CHZA 5C2YA 1S64A 5ARGA 3B7BA 4GA2A 2P2CP 1IXVA 4RSYA 3Q15A 3EUVA 3TWUA 4EHMA 5E76A 5EDSA 2QC9A 2EIME 2E2EA 4U04A 5G55A 3ZFWA 1O1SA 3CVWA 4I9EA 3TXMA 1TNOA 3JYSA 4CDRA 3O4ZA 2B6CA 3S7BA 1K3ZD 2DWZA 4PS7A 3ASGA 2IF4A 4DI3A 3T5VA 1OWOA 3ZIMA 2QY7A 3R9AB 3FH7A 2QZAA 5C1DA 4F1SA 4GAAA 2Q7FA 2XS1A 2X6JA 2R02A 5KWDA 4L23A 1D9SA 3ZXSA 4GTSA 3QNKA 2IEJA 2L0IA 1AP7A 2I1KA 1DCEA 4N2QA 5IY5E 3SF4A 2VGYA 2J07A 5ANRA 1OWLA 5H7PA 5M72A 1UW4B 2IFUA 5ITZF 3CVVA 1DVPA 4U8YD 4JD2G 5A6CA 3MCXA 5AN8A 3I5PA 4NQ0A 3L08A 3L22A 4GA1A 2ZISA 3N71A 2GW1A 4GCNA 2P9NG 2Y4TA 5ENQD 3APCA 4G2VA 4GZCA 3V31A 2ZIRA 3SFZA 3CKCA 1SW6A 1JUQA 4AEZC 1H6OA 3RKVA 3UKRG 1Q2ZA 4JL0A 3Q79A 4LNUD 3FP3A 2WXFA 3MYVA 2F8YA 2RKKA 4K0RA 3LYAA 2P9PG 3T9KA 3UPVA 3MA5A 4UWGA 1SA4A 1MYOA 3PZ3A 2ETCA 2XZDG 2KXPC 4HI8A 2LO6A 2IQCA 3UI2A 4Q94A 4UWLA 3PREA 1N95A 4A63B 1IYGA 4K03A 1ELWA 1AWCB 4UI9J 4JC8A 4O60A 2WXLA 2LXMA 4U0UA 4CGWA 4G23A 5CMYA 5BW8C 3FTSA 3FTUA 4CRWA 4E6HA 5HQ8A 4CDMA 1XGWA 4ILIA 2CG2A 5FT9A 5EN5D 4B0ZA 4DJAA 1OY3D 3JQ0A 2Y69E 4HXIA 1YMPA 4AVXA 4HI9A 4NRHB 4PS8A 3MZLB 1FT2A 1H0AA 4I2WA 4U7EB 3ZHEB 5FQ6A 4DI4A 5AQ9A 5AENA 2I9CA 3HXBA 3K9IA 5BV1A 3E37A 2V5FA 4DK5A 3B95A 4BWRA 3LVRE 3Q49B 1N0RA 2XZTG 2Y3AA 3C3OA 3HXFA 3HXCA 3C98A 3ABKE 5LP0A 1NL4A 2WXRA 2LNIA 1E7VA 3SD5A 2LXLA 3CHQA 3Q5MA 3S7JA 4G24A 4G25A 1N54A 2ILRA 3J5PA 2RG8A 3SBSA 2LAIA 3SFXA 3AAAC 4GCOA 2ZXWE 1ELKA 1B89A 1NI1A 4I43A 3ZGQA 1OWPA 2DIWA 3D9IA 3ZYKA 2JABA 3GZ1A 4HQDA 2IONA 4MS6A 1E8ZA 3FTVA 4A3TA 5JJTA 3APFA 3C3RA 4GPMA 2CHXA 5KJLA 1YCSB 5JHBA 4G26A 4FJZA 4L2YA 4RLYA 4OAVB 1OUVA 1GW6A 4UQYA 3RO2A 3ZUVB 1MQSA 2VYIA 4U63A 3B7RL 1UJKA 3CR3A 3BEEA 3HRAA 1O5MA 4M3OA 3UM2A 1LF8A 4HLEA 2VSNA 4CDNA 3L9TA 4L7TA 1TN7A 3ZN3A 4E85A 2WVIA 2VSXE 4U0SA 3NAWA 3BU8A 5FWQA 2FBNA 4LUNU 2XEHA 3I4RB 4YDOA 3HVEA 2XEVA 3NOCD 4GTQA 4JHKA 5AQBA 3EHNA 2CFZA 4ACKA 2UY1A 2WXJA 2XCCA 1EDUA 2PM6A 1H6KA 5ENNA 1RW2A 5T4YA 4FLBA 1TNUA 4URKA 2QYUA 2ZGDA 1OCRE 5D66A 3PNTB 2J08A 3FWVA 1HO8A 3HG0D 3NF1A 4K5AB 4CCAA 3KEZA 4P29A 1DNPA 2EIKE 3HXEA 4FU3A 4GA0A 5AYWD 2WQHA 1H2VC 1HG2A 2WXMA 3CHSA 3NZSA 2HR2A 3T8MA 4R7LA 2AXZA 3VTXA 4U95D 4U0ZA 4APOA 1OXJA 3QAQA 2R03A 3R9MA 1QNFA 3VTYA 3MKQA 4XZ4A 1TN6A 4XEIG 1DC2A 1SA5A 3AS4A 5CCMA 3C5RA 3FU3A 1OT8A 3ZNGA 3B7TA 5AARA 5JJ6A 4I6GA 2AXUA 3D9OA 3AG1E 2KC7A 2KCVA 4C0EA 4YVQC 5B1BE 4J8FA 3U3WA 4KYOB 2YHCA 5EKQD 3VLFA 1N4QA 3RO3A 3KD7A 3SFYA 1FPPA 3CQCB 2OEWA 4B8CB 4J7WA 1P5QA 4G11A 3UT4A 3DSUA 3PUKA 3L17A 5EYLA 3S7DA 3LXUX 4A1SA 3FTXA 1H2UA 3C3QA 2Y0BG 2KCKA 4KZCA 1TNYA 3IHYA 2WXOA 4XI9A 4JA7A 5T8IA 4Q96A 4HLLA 1LTXA 1HZ4A 4BERA 5BXUA 3PH0C 2VTBA 1E96B 5DIZA 2EQXA 4K5CA 3FUKA 5BPPA 5D0QD 3OXLA 2FEZA 4UI9K 2L0TB 3Q9UC 3AU4A 5BUZA 1N11A 3QWWA 1S63A 4BT8A 1NA0A 1MX6A 5HRYA 1N4SA 4BETA 2F37A 1INZA 3FUFA 2VGXA 3HHMA 2JLBA 3ULYA 3LDZA 1KZOA 3QJZA 2H6GA 4FJYA 4YNDA 3TL5A 3IHVA 2X6KA 5G2NA 2HYZA 2AW6A 3DSSA 2XEEA 5CCLA 4U8VD 3MJWA 3ONKA 4JVSA 1RZ4A 2XPZA 3RU0A 4TRQA 2R17C 3AG4E 2KBXA 3DBSA 5CEAA 2OV8A 4CEMA 4B89A 4HBDA 3TWSA 3B13A 3VLDA 3RRUA 4IN3B 2X6FA 1ELRA 4BX8A 2LUHA 2XRYA 1IHGA 4HS2A 2AWIA 3PRZA 1WG0A 4DX6D 2WQ6A 1HG5A 2OVBA 4YDEA 1S70B 4GMLA 4O1PA 1UG3A 5EX3A 5ENOD 3HIZA 5FJYA 4C9BB 3DSVA 2BKGA 5LFAA 5BT1A 2VSYA 3CVUA 4O6FA 1HH8A 4UUCA 2XENA 3FUDA 3ZRHA 4PDXA 2IJGX 4GU5A 5ENTD 4NURA 3CK9A 5AIJA 5JA4D 3RAUA 1K1AA 3KSQA 3CVQA 5EYPF 3E32A 3HXDA 4TUUA 4TXPA 2AXVA 3E34A 3URZA 4BEPA 4N5CA 1IQRA 2ETBA 2RD0A 2J09A 4GZ3A 1BI7B 3ZYMA 3UT7A 4ZHBA 4PH4B 4AJWA 2WXIA 3FEYA 3PEUB 4KXKB 3ZHEA 4WAFA 2H6IA 3R7RA 3AS5A 3EHRA 4JB8P 3CK8A 3TG5A 5D2MC 3E4BA 3B7SA 3Q47B 2XGOA 3JXIA 4GTOA 2ZGGA 4DX7D 2EILE 4FHJA 4HORA 4BX9A 2OCCE 2OOEA 3ENEA 1S0PA 1Y6IA 4A3VA 1YYHA 4K5BA 4WNGA 3UUXA 3FUEA 2XGSA 3DRAA 3Q73A 3Q7FA 3HDXA 2CG3A 5KJNA 1BD8A 4WNFA 3E33A 2L6JA 3ZYQA 3FEXA 4AM9A 3UM3A 1HE8A 4LRZA 3QWPA 2V4LA 3I3NA 3MKQB 3ASFA 2L9BA 2KZTB 3FUHA 3GW4A 3PS6A 1BI8B 5CHEE 2VJ8A 1QQEA 1N9AA 3U9WA 2V8SE 3DXMG 5AJLA 3Q9NC 2GGFA 4FADA 4C0MA 2RFMA 4HRNA 1UN8A 3IV0A 3CGHA 5J90A 2WXNA 1VDYA 4HOUA 5A23A 3FUJA 4WWNA 3U4TA 1H19A 3RRNB 4Z68A 1K1BA 3ASDA 2IY0C 3LPZA 3EHMA 4J8SA 2NXPA 3PVLA 3D9NA 3ISMC 3J5QB 2GRLA 3G2SA 3KEAA 4LEUA 3LY7A 2F0YA 3OXFA 5CRUA 2IO2C 2I2OA 5AAOA 4ANVA 1QBQA 5HI7A 2QFCA 3ONLA 3NOGD 4RG6A 4KT6B 2ETAA 3ZEFA 1MX4A 3QKYA 3HVEB 4MLPA 5ENRD 3SGHA 1V54E 1IQUA 2DYRE 1NA3A 3ZPJA 5JJ7A 1FVHA 2XPIA 5AQAA 1U2VG 4J0UA 5KNHD 4N2SA 3L54A 1E90A 1HU3A 5FTPA 4I9CA 3TJPA 4WNDA 4AOFA 4CT4A 3Q4AB 2C0LA 1NZNA 3EDTB 3AG2E 1PAQA 5KJMA 1TNBA 2LAHA 1JCRA 2OEVA 1A5EA 4N39A 3EU5A 3E30A 4DUIA 5G05C 3D9MA 3TG4A 3G2UA 1KLXA 1YA0A 5HKPA 3PZ4A 4JZYA 4QQIA 1OCZE 3OXGA 2XHEA 4TXQA 2VSOE 4RVBA 1X5BA 4EBAA 2E0IA 2BTDA 4B93B 2P9LG 3ULEG 4Y6WA 2WM9A 1W3BA 4D10C 3SQVA 4GYYA 4UWKA 4ANUA 4CGVA 1EF1C 2DZNA 3RRMB 2KM4A 2KZTA 4TV3A 1K8KG 1HF8A 3UM0A 4A55A 2F8XK 2YNQA 4AXHA 2MYOA 2V0PA 2P9IG 1SVXA 3LY9A 3R7QA 3FDHA 4FC8A 1EYHA 3ASNE 3ZXPA 3MKRA 3TXNA 5KNGA 2PNNA 2IO3C 2GRMA 3LKUA 3UMVA 4GTPA 5FQ7A 1Z6TA 4TUMA 4GTVA 4B8AA 1A17A 1D8DA 2J49A 4WNEA 1IKND 3AG3E 4UI9C 3EJNA 1MZCA 3D9PA 1FCHA 2J4BA 3CVLA 3WG7E 2IOLA 3MGBA 5JMND 4LNGA 2NYJA 1N4RA 2GROB 2KCLA 2B0OE 3PZ1A 3Q7AA 1HFAA 4GTMA 4CT0A 2PQNA 4APFA 4G1TA 2X6IA 3L82A 3ABLE 2VGEA 1X81A 1ZB1A 2P9KG 3PNLB 5ENSD 5LCWC 4BTAA 3U64A 4QFVA 4ILGA 3SBTB 4KVOA 4XKBA 2VQ2A 3V2XA 3GZSA 2PZIA 1N52A 3ABME 4FA6A 3CQGB 4WUYA 3CHOA 4HFGA 2NC9A 2V4HC 2LSVA 4EZJA 4GYOA 3WXXA 1TN8A 2GRQB 3FFLA 3O48A 3ZVVA 1LD7A 4NIKA 1QYMA 3PZ2A 3TWRA 1TEZA 1JPLA 4UWFA 2FO7A 3CHRA 3ESLA 4HOTA 3EHQA 5FZSA 2WB2A 4LERA 4CZ2D 3LEWA 3CKBA 3FU6A 4L2LA 3QC1A 1O1RA 2A5UA 1UOHA 2RFAA 2A5EA 4M7CA 4HB5A 4U8HA 2BF0X 3SI5A 2WXKA 3MV2B 4LG6A 3PUJA 5KBAA 3C72A 3JCKC 5CERB 3ESKA 3NBNB 2I6HA 3U66A 3CV0A 4XKCA 4JEUA 3SHFA 2Y1LE 5CMWA 2IOSA 3ML9A 3ML8A 3L6AA 3Q78A 3RSEG 4YDWA 3ZW3A 5LOZA 4ATZD 4X8QA 3SO8A 1O1TA 4ZFHA 4GTRA 1MHQA 1WM5A 3FH8A 2XGMA 4V3IA 3D9LA 2C0MA 4FLHA 4J6IA 3CSTA 3BG1B 4RG9A 1E8YA 4I1OB 1NP7A 1JCSA 4I6JA 4BESA 4L9PA 2DZOA 3L16A 4N5QA 5LX8A 2V5QC 2J9QA 3DPDA 3DSWA 5JHAA 2KATA 2FI7A 4HVBA 3IBEA 3IEGA 2XQ0A 3DXKG 4OVUA 4EPZA 3FTYA 5BV0A 3FHEA 5HS0A 5CBNA 3GZ2A 4ILHB 4WWPA 3DSTA 1U3CA 3PDNA 3G2WA 2WQ7A 3UINC 3T5XA 3AU5A 5FZRA 3CVYA 2CHWA 4G8LA 1BU9A 1HS6A 5AJDA 3P2BA 5KJKA 2HO1A 3CHPA 4BY6A 3CVPA 5BNWA 4MKTA 5J08A 3EIQC 3QARA 1LD8A 2XPYA 4GMRA 4EBAG 3RIBA 1N94A 2MRIA 2NSZA 2UWJG 5A7DB 1SZ9A 4Q69A 2YHEA 3LJ3A 2J4DA 3UIOC 2HM8A 4GTTA 2BUGA 3DEPA 3D9KA 1BPOA 2WPVA 1DCQA 4I1AA 4F6RD 4I1MA 2DVWA 4XIFA 3W9FA 3DPYA 4BT9A 3TWWA 1HXIA 5G05J 1WAO1 2DBAA 4DLQA 5T3RA 3UTMA 4HNAD 1Y8MA 1PY1A 1KT0A 2VGXB 3KAEA 1WDYA 3BG0B 5G04C 1JWFA 3AJIA 4JHRA 1L5JA 3FTZA 4JEHA 3DWLG 4DX2A 3KSLA 3ULQA 4I17A 4OVVA 3TWTA 4XX5A 2GRPB 1E7UA 3I4GA 3KS2A 3APDA 4ATGA 3PE4A 4F1PA 3Q75A 2A4ZA 4A1GA 3LJNA 3CIAA 1H6PA 4ACLA 2AVPA 3JUIA 2ZU6B 4TXRA 2YQ8A 4IRUA 3FY4A 3NZUA 4LCTA 3QK0A 2MOWA 2R59A 3SY2A 5FINA 1E8XA 3W9GA 4EQFA 4B94A 2EIJE 5AQ7A 3UQ3A 3DEOA 4FHKA 4ABNA 4C48B 4I6EA 2R5SA 1MJ0A 4GB9A 1SQMA 3CK7A 4FP7A 1KZPA 2JEKA 5KCMA 4U96D 3ZYLA 3IXEA 3T8KA 2VTBB 5B3SE 2WXHA 3D9HA 1PC2A 1XNFA 3V2OA 2EINE 4Y6CA 4HOSA 1ZU2A 5ENPD 4MBGA 4GZ5A 2HE0A 3SNXA 4DLOA 3LVQE 3P1UA 3LY8A 4PS3A 3EU9A 4DX1A 3TGOA 3MEKA 3FULA 3VLEA 2WMOA 4G8KA 2PL2A 3V30A 4HOQA 3G2TA 3AS8A 3MV3B 1OWMA 5CBOA 4BTBA 4PUCA 3UIPC 2Y4UA 2DYSE 1OCCE 5DBKA 3BQOA 4F53A 3FU5A 4AV7A 4AP2A 1JWGA 3D3MA 4KZ0A 1N0QA 4F7AA 1UJJA 4UQXA 3QOUA 3EIJA 3TWQA 1BLXB 3FUMA 2GRRB 4L1BA 3CLJA 3OTNA 3JQ1A 4BSZB 4W9RA 2BKKB 5ARFA 2P9UG 3TWXA 3NB2A 3UXGA 3PZDA 4JXTA 4WWOA 1E8WA 1TR4A 5BXOA 1H2TC 1FT1A 3CHMA 4KMOA 2BEDA 3TAXA 3GYZA 1D8EA 3FUNA 4ANWA 3ZKJA 3D9JA 4XE0A 3ZU7B 4ANXA 2PQRA 2M63A 3UM1A 2DCPA 2IU1A 5EX0A 3CSFA 3CVXA 3FUIA 4AY5A 2PM7A 3BUAA 4JA9A 3OAWA 4LSZE 4HRLA 2X38A 4F3VA 3ASOE 4AY6A 2P58C 4JPSA 1UN9A 3FTWA 1KPSB 2LSUA 1Z5SC 2C2LA 3G2VA 3B7UX 2UY1B 2WXGA 2CFUA 1FVFA 4YVOA 1Z3XA 3FH5A 5FQ8A 4CYMD 3JUEA 5E75A 4EECA 4N3BA 3QB2A 5CECB 3ASHA 4OAUC 4MRUA 4UQZA 2XS8A 4J8YA 2FULA 3PE3A 2R05A 4J8EA 2J8SD 5CEDB 2H6HA 4BSXA 4BFRA 4NACA 5LCWJ 4UWHA 5D0OD 4XI0A 4N3AA 3NQPA 2FO1E 2QYJA 3RK6A 2MHKA 3LS8A 5G04J 3DSXA 4H7XA 4DPRA 1TNZA 2H6FA 2L6BA 2YINA 3S2AA 1QZ2A 4KVMA 5EILA 2X3MA 4U07A 4ME2A 3SZ7A 2XCBA 4IYPA 4J8DA 3FU0A 5FIOA 3CEQA 1TJCA 2I1JA 5B1AE 4RQIA 4DRXE 1IHBA 1Z3YA 1V55E 2WXPA 3HYMB 4YDYA 5EIBE 4KBQA 3PEVB 3X2QE 2P9SG 4IULA 3TWVA 3F6QA 3MX3A 2XRZA 1EPUA 3QWVA 4JW1A 2WMNA 2GRNB
chains in the Genus database with same CATH topology
4CYMD 3JUEA 2VGEA 4HBDA 2F8YA 3TWSA 4B93B 3JXIA 1NFIE 2ZGGA 5ENSD 3T9KA 2Y1LE 5AAOA 4DX7D 1G3NB 5CECB 1MYOA 2XEHA 4QFVA 4OAUC 2ETCA 1N0QA 3NOCD 3V2XA 4J8YA 4GMRA 2XZDG 2KXPC 4HI8A 3TWQA 3V79K 1BLXB 1WG0A 4DX6D 2DZNA 1K3ZD 2DWZA 3NOGD 5AQBA 4J7WA 2ETAA 3J5PA 4YDWA 5FINA 5EIDA 4HRMB 2J8SD 1YYHA 4K5BA 5CEDB 3W9GA 3UI2A 1MX4A 5EYLA 3AAAC 2V4HC 1S70B 4BSZB 2BKKB 4O1PA 5ENRD 5AQ7A 4DX5D 4O1OA 3JXJA 2F8XK 3TWXA 3UXGA 3DEOA 5ENOD 2Y0BG 4C48B 1BD8A 2MYOA 4ATZD 1TR4A 2BKGA 3SO8A 1MJ0A 5BXOA 4A63B 1SVXA 1BU9A 4UUCA 5AQAA 4ZFHA 1AWCB 2XENA 3DEPA 2FO1E 5KNHD 4F6RD 1DCQA 2JABA 2QYJA 2ZGDA 4HLLA 4O60A 5D66A 4BERA 2DVWA 5ENTD 5BXUA 5KWDA 4HQDA 3W9FA 1D9SA 3HG0D 4K5CA 4K5AB 5JA4D 1MX2A 1AP7A 4NIKA 5KNGA 2L6BA 3Q9UC 2PNNA 1BI8B 4GPMA 4U96D 1QYMA 1N11A 1K1AA 1YCSB 3TWWA 2AJAA 3ZKJA 3ZU7B 3TWRA 5EILA 1MX6A 5HRYA 5EN5D 3IXEA 4RLYA 3T8KA 4TUMA 4HNAD 3UTMA 4OAVB 4BETA 1OY3D 2F37A 3EHQA 3Q9NC 3D9HA 5FIOA 5ITZF 5EYPF 4BESA 1YMPA 1WDYA 2DZOA 3V2OA 4HI9A 3ZUVB 2RFMA 4HRNA 4U8YD 4U95D 1IKND 3B7BA 4N5QA 4BEPA 4CZ2D 1A5EA 5ENPD 2V5QC 5AN8A 2ETBA 3AJIA 2P2CP 3HRAA 1IXVA 2HE0A 4DUIA 1UOHA 4LSZE 4DX2A 4HRLA 4DRXE 5AQ9A 1BI7B 4Z68A 2RFAA 5HKPA 1IHBA 1K1BA 2A5EA 3EU9A 4HB5A 3TWTA 4DX1A 4ZHBA 4YDYA 1DC2A 5JMND 5EIBE 3TWUA 2NYJA 4QQIA 3C5RA 2XEEA 4LG6A 4G8KA 1OT8A 5ENQD 5HS0A 4F1PA 4U8VD 3ZNGA 3V30A 5AARA 5CBNA 5KBAA 5CERB 3B95A 3TWVA 3F6QA 3V31A 2B0OE 3LJNA 3NBNB 1SW6A 1N0RA 2XZTG 3EHRA 3J5QB 2QC9A 5CBOA 3KEAA 4JB8P 4LNUD 2KBXA 5CEAA 4G8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYM D;  3JUE A;  2VGE A;  4HBD A;  2F8Y A;  3TWS A;  4B93 B;  3JXI A;  1NFI E;  2ZGG A;  5ENS D;  3T9K A;  2Y1L E;  5AAO A;  4DX7 D;  1G3N B;  5CEC B;  1MYO A;  2XEH A;  4QFV A;  4OAU C;  2ETC A;  1N0Q A;  3NOC D;  3V2X A;  4J8Y A;  4GMR A;  2XZD G;  2KXP C;  4HI8 A;  3TWQ A;  3V79 K;  1BLX B;  1WG0 A;  4DX6 D;  2DZN A;  1K3Z D;  2DWZ A;  3NOG D;  5AQB A;  4J7W A;  2ETA A;  3J5P A;  4YDW A;  5FIN A;  5EID A;  4HRM B;  2J8S D;  1YYH A;  4K5B A;  5CED B;  3W9G A;  3UI2 A;  1MX4 A;  5EYL A;  3AAA C;  2V4H C;  1S70 B;  4BSZ B;  2BKK B;  4O1P A;  5ENR D;  5AQ7 A;  4DX5 D;  4O1O A;  3JXJ A;  2F8X K;  3TWX A;  3UXG A;  3DEO A;  5ENO D;  2Y0B G;  4C48 B;  1BD8 A;  2MYO A;  4ATZ D;  1TR4 A;  2BKG A;  3SO8 A;  1MJ0 A;  5BXO A;  4A63 B;  1SVX A;  1BU9 A;  4UUC A;  5AQA A;  4ZFH A;  1AWC B;  2XEN A;  3DEP A;  2FO1 E;  5KNH D;  4F6R D;  1DCQ A;  2JAB A;  2QYJ A;  2ZGD A;  4HLL A;  4O60 A;  5D66 A;  4BER A;  2DVW A;  5ENT D;  5BXU A;  5KWD A;  4HQD A;  3W9F A;  1D9S A;  3HG0 D;  4K5C A;  4K5A B;  5JA4 D;  1MX2 A;  1AP7 A;  4NIK A;  5KNG A;  2L6B A;  3Q9U C;  2PNN A;  1BI8 B;  4GPM A;  4U96 D;  1QYM A;  1N11 A;  1K1A A;  1YCS B;  3TWW A;  2AJA A;  3ZKJ A;  3ZU7 B;  3TWR A;  5EIL A;  1MX6 A;  5HRY A;  5EN5 D;  3IXE A;  4RLY A;  3T8K A;  4TUM A;  4HNA D;  3UTM A;  4OAV B;  4BET A;  1OY3 D;  2F37 A;  3EHQ A;  3Q9N C;  3D9H A;  5FIO A;  5ITZ F;  5EYP F;  4BES A;  1YMP A;  1WDY A;  2DZO A;  3V2O A;  4HI9 A;  3ZUV B;  2RFM A;  4HRN A;  4U8Y D;  4U95 D;  1IKN D;  3B7B A;  4N5Q A;  4BEP A;  4CZ2 D;  1A5E A;  5ENP D;  2V5Q C;  5AN8 A;  2ETB A;  3AJI A;  2P2C P;  3HRA A;  1IXV A;  2HE0 A;  4DUI A;  1UOH A;  4LSZ E;  4DX2 A;  4HRL A;  4DRX E;  5AQ9 A;  1BI7 B;  4Z68 A;  2RFA A;  5HKP A;  1IHB A;  1K1B A;  2A5E A;  3EU9 A;  4HB5 A;  3TWT A;  4DX1 A;  4ZHB A;  4YDY A;  1DC2 A;  5JMN D;  5EIB E;  3TWU A;  2NYJ A;  4QQI A;  3C5R A;  2XEE A;  4LG6 A;  4G8K A;  1OT8 A;  5ENQ D;  5HS0 A;  4F1P A;  4U8V D;  3ZNG A;  3V30 A;  5AAR A;  5CBN A;  5KBA A;  5CER B;  3B95 A;  3TWV A;  3F6Q A;  3V31 A;  2B0O E;  3LJN A;  3NBN B;  1SW6 A;  1N0R A;  2XZT G;  3EHR A;  3J5Q B;  2QC9 A;  5CBO A;  3KEA A;  4JB8 P;  4LNU D;  2KBX A;  5CEA A;  4G8L A; 
#chains in the Genus database with same CATH topology
 4GMJ A;  3S7F A;  4EZK A;  1NFI E;  1WY6 A;  1ZBP A;  1G3N B;  2R2L A;  4GYW A;  1TJF A;  1U3D A;  1SZA A;  4GPK A;  3V79 K;  4FUL A;  1JCQ A;  4GZD A;  3UX4 A;  5EID A;  4HRM B;  3RJV A;  4I2Z A;  1HX8 A;  1N4P A;  3IKO B;  4DX5 D;  4O1O A;  3JXJ A;  5FQ4 A;  4JHJ A;  4OYS A;  3UKU G;  4LNB A;  4N3C A;  1OWN A;  5ANL A;  5CRV A;  1OCO E;  3CVN A;  3LCA A;  3L13 A;  3QDN A;  5FZQ A;  1MX2 A;  4GZ6 A;  2FF4 A;  4EZL A;  2WXQ A;  2AJA A;  4H7Y A;  4AIF A;  2OVF A;  3UT8 A;  2X6H A;  2OND A;  1KT1 A;  1TYQ G;  2CHZ A;  5C2Y A;  1S64 A;  5ARG A;  3B7B A;  4GA2 A;  2P2C P;  1IXV A;  4RSY A;  3Q15 A;  3EUV A;  3TWU A;  4EHM A;  5E76 A;  5EDS A;  2QC9 A;  2EIM E;  2E2E A;  4U04 A;  5G55 A;  3ZFW A;  1O1S A;  3CVW A;  4I9E A;  3TXM A;  1TNO A;  3JYS A;  4CDR A;  3O4Z A;  2B6C A;  3S7B A;  1K3Z D;  2DWZ A;  4PS7 A;  3ASG A;  2IF4 A;  4DI3 A;  3T5V A;  1OWO A;  3ZIM A;  2QY7 A;  3R9A B;  3FH7 A;  2QZA A;  5C1D A;  4F1S A;  4GAA A;  2Q7F A;  2XS1 A;  2X6J A;  2R02 A;  5KWD A;  4L23 A;  1D9S A;  3ZXS A;  4GTS A;  3QNK A;  2IEJ A;  2L0I A;  1AP7 A;  2I1K A;  1DCE A;  4N2Q A;  5IY5 E;  3SF4 A;  2VGY A;  2J07 A;  5ANR A;  1OWL A;  5H7P A;  5M72 A;  1UW4 B;  2IFU A;  5ITZ F;  3CVV A;  1DVP A;  4U8Y D;  4JD2 G;  5A6C A;  3MCX A;  5AN8 A;  3I5P A;  4NQ0 A;  3L08 A;  3L22 A;  4GA1 A;  2ZIS A;  3N71 A;  2GW1 A;  4GCN A;  2P9N G;  2Y4T A;  5ENQ D;  3APC A;  4G2V A;  4GZC A;  3V31 A;  2ZIR A;  3SFZ A;  3CKC A;  1SW6 A;  1JUQ A;  4AEZ C;  1H6O A;  3RKV A;  3UKR G;  1Q2Z A;  4JL0 A;  3Q79 A;  4LNU D;  3FP3 A;  2WXF A;  3MYV A;  2F8Y A;  2RKK A;  4K0R A;  3LYA A;  2P9P G;  3T9K A;  3UPV A;  3MA5 A;  4UWG A;  1SA4 A;  1MYO A;  3PZ3 A;  2ETC A;  2XZD G;  2KXP C;  4HI8 A;  2LO6 A;  2IQC A;  3UI2 A;  4Q94 A;  4UWL A;  3PRE A;  1N95 A;  4A63 B;  1IYG A;  4K03 A;  1ELW A;  1AWC B;  4UI9 J;  4JC8 A;  4O60 A;  2WXL A;  2LXM A;  4U0U A;  4CGW A;  4G23 A;  5CMY A;  5BW8 C;  3FTS A;  3FTU A;  4CRW A;  4E6H A;  5HQ8 A;  4CDM A;  1XGW A;  4ILI A;  2CG2 A;  5FT9 A;  5EN5 D;  4B0Z A;  4DJA A;  1OY3 D;  3JQ0 A;  2Y69 E;  4HXI A;  1YMP A;  4AVX A;  4HI9 A;  4NRH B;  4PS8 A;  3MZL B;  1FT2 A;  1H0A A;  4I2W A;  4U7E B;  3ZHE B;  5FQ6 A;  4DI4 A;  5AQ9 A;  5AEN A;  2I9C A;  3HXB A;  3K9I A;  5BV1 A;  3E37 A;  2V5F A;  4DK5 A;  3B95 A;  4BWR A;  3LVR E;  3Q49 B;  1N0R A;  2XZT G;  2Y3A A;  3C3O A;  3HXF A;  3HXC A;  3C98 A;  3ABK E;  5LP0 A;  1NL4 A;  2WXR A;  2LNI A;  1E7V A;  3SD5 A;  2LXL A;  3CHQ A;  3Q5M A;  3S7J A;  4G24 A;  4G25 A;  1N54 A;  2ILR A;  3J5P A;  2RG8 A;  3SBS A;  2LAI A;  3SFX A;  3AAA C;  4GCO A;  2ZXW E;  1ELK A;  1B89 A;  1NI1 A;  4I43 A;  3ZGQ A;  1OWP A;  2DIW A;  3D9I A;  3ZYK A;  2JAB A;  3GZ1 A;  4HQD A;  2ION A;  4MS6 A;  1E8Z A;  3FTV A;  4A3T A;  5JJT A;  3APF A;  3C3R A;  4GPM A;  2CHX A;  5KJL A;  1YCS B;  5JHB A;  4G26 A;  4FJZ A;  4L2Y A;  4RLY A;  4OAV B;  1OUV A;  1GW6 A;  4UQY A;  3RO2 A;  3ZUV B;  1MQS A;  2VYI A;  4U63 A;  3B7R L;  1UJK A;  3CR3 A;  3BEE A;  3HRA A;  1O5M A;  4M3O A;  3UM2 A;  1LF8 A;  4HLE A;  2VSN A;  4CDN A;  3L9T A;  4L7T A;  1TN7 A;  3ZN3 A;  4E85 A;  2WVI A;  2VSX E;  4U0S A;  3NAW A;  3BU8 A;  5FWQ A;  2FBN A;  4LUN U;  2XEH A;  3I4R B;  4YDO A;  3HVE A;  2XEV A;  3NOC D;  4GTQ A;  4JHK A;  5AQB A;  3EHN A;  2CFZ A;  4ACK A;  2UY1 A;  2WXJ A;  2XCC A;  1EDU A;  2PM6 A;  1H6K A;  5ENN A;  1RW2 A;  5T4Y A;  4FLB A;  1TNU A;  4URK A;  2QYU A;  2ZGD A;  1OCR E;  5D66 A;  3PNT B;  2J08 A;  3FWV A;  1HO8 A;  3HG0 D;  3NF1 A;  4K5A B;  4CCA A;  3KEZ A;  4P29 A;  1DNP A;  2EIK E;  3HXE A;  4FU3 A;  4GA0 A;  5AYW D;  2WQH A;  1H2V C;  1HG2 A;  2WXM A;  3CHS A;  3NZS A;  2HR2 A;  3T8M A;  4R7L A;  2AXZ A;  3VTX A;  4U95 D;  4U0Z A;  4APO A;  1OXJ A;  3QAQ A;  2R03 A;  3R9M A;  1QNF A;  3VTY A;  3MKQ A;  4XZ4 A;  1TN6 A;  4XEI G;  1DC2 A;  1SA5 A;  3AS4 A;  5CCM A;  3C5R A;  3FU3 A;  1OT8 A;  3ZNG A;  3B7T A;  5AAR A;  5JJ6 A;  4I6G A;  2AXU A;  3D9O A;  3AG1 E;  2KC7 A;  2KCV A;  4C0E A;  4YVQ C;  5B1B E;  4J8F A;  3U3W A;  4KYO B;  2YHC A;  5EKQ D;  3VLF A;  1N4Q A;  3RO3 A;  3KD7 A;  3SFY A;  1FPP A;  3CQC B;  2OEW A;  4B8C B;  4J7W A;  1P5Q A;  4G11 A;  3UT4 A;  3DSU A;  3PUK A;  3L17 A;  5EYL A;  3S7D A;  3LXU X;  4A1S A;  3FTX A;  1H2U A;  3C3Q A;  2Y0B G;  2KCK A;  4KZC A;  1TNY A;  3IHY A;  2WXO A;  4XI9 A;  4JA7 A;  5T8I A;  4Q96 A;  4HLL A;  1LTX A;  1HZ4 A;  4BER A;  5BXU A;  3PH0 C;  2VTB A;  1E96 B;  5DIZ A;  2EQX A;  4K5C A;  3FUK A;  5BPP A;  5D0Q D;  3OXL A;  2FEZ A;  4UI9 K;  2L0T B;  3Q9U C;  3AU4 A;  5BUZ A;  1N11 A;  3QWW A;  1S63 A;  4BT8 A;  1NA0 A;  1MX6 A;  5HRY A;  1N4S A;  4BET A;  2F37 A;  1INZ A;  3FUF A;  2VGX A;  3HHM A;  2JLB A;  3ULY A;  3LDZ A;  1KZO A;  3QJZ A;  2H6G A;  4FJY A;  4YND A;  3TL5 A;  3IHV A;  2X6K A;  5G2N A;  2HYZ A;  2AW6 A;  3DSS A;  2XEE A;  5CCL A;  4U8V D;  3MJW A;  3ONK A;  4JVS A;  1RZ4 A;  2XPZ A;  3RU0 A;  4TRQ A;  2R17 C;  3AG4 E;  2KBX A;  3DBS A;  5CEA A;  2OV8 A;  4CEM A;  4B89 A;  4HBD A;  3TWS A;  3B13 A;  3VLD A;  3RRU A;  4IN3 B;  2X6F A;  1ELR A;  4BX8 A;  2LUH A;  2XRY A;  1IHG A;  4HS2 A;  2AWI A;  3PRZ A;  1WG0 A;  4DX6 D;  2WQ6 A;  1HG5 A;  2OVB A;  4YDE A;  1S70 B;  4GML A;  4O1P A;  1UG3 A;  5EX3 A;  5ENO D;  3HIZ A;  5FJY A;  4C9B B;  3DSV A;  2BKG A;  5LFA A;  5BT1 A;  2VSY A;  3CVU A;  4O6F A;  1HH8 A;  4UUC A;  2XEN A;  3FUD A;  3ZRH A;  4PDX A;  2IJG X;  4GU5 A;  5ENT D;  4NUR A;  3CK9 A;  5AIJ A;  5JA4 D;  3RAU A;  1K1A A;  3KSQ A;  3CVQ A;  5EYP F;  3E32 A;  3HXD A;  4TUU A;  4TXP A;  2AXV A;  3E34 A;  3URZ A;  4BEP A;  4N5C A;  1IQR A;  2ETB A;  2RD0 A;  2J09 A;  4GZ3 A;  1BI7 B;  3ZYM A;  3UT7 A;  4ZHB A;  4PH4 B;  4AJW A;  2WXI A;  3FEY A;  3PEU B;  4KXK B;  3ZHE A;  4WAF A;  2H6I A;  3R7R A;  3AS5 A;  3EHR A;  4JB8 P;  3CK8 A;  3TG5 A;  5D2M C;  3E4B A;  3B7S A;  3Q47 B;  2XGO A;  3JXI A;  4GTO A;  2ZGG A;  4DX7 D;  2EIL E;  4FHJ A;  4HOR A;  4BX9 A;  2OCC E;  2OOE A;  3ENE A;  1S0P A;  1Y6I A;  4A3V A;  1YYH A;  4K5B A;  4WNG A;  3UUX A;  3FUE A;  2XGS A;  3DRA A;  3Q73 A;  3Q7F A;  3HDX A;  2CG3 A;  5KJN A;  1BD8 A;  4WNF A;  3E33 A;  2L6J A;  3ZYQ A;  3FEX A;  4AM9 A;  3UM3 A;  1HE8 A;  4LRZ A;  3QWP A;  2V4L A;  3I3N A;  3MKQ B;  3ASF A;  2L9B A;  2KZT B;  3FUH A;  3GW4 A;  3PS6 A;  1BI8 B;  5CHE E;  2VJ8 A;  1QQE A;  1N9A A;  3U9W A;  2V8S E;  3DXM G;  5AJL A;  3Q9N C;  2GGF A;  4FAD A;  4C0M A;  2RFM A;  4HRN A;  1UN8 A;  3IV0 A;  3CGH A;  5J90 A;  2WXN A;  1VDY A;  4HOU A;  5A23 A;  3FUJ A;  4WWN A;  3U4T A;  1H19 A;  3RRN B;  4Z68 A;  1K1B A;  3ASD A;  2IY0 C;  3LPZ A;  3EHM A;  4J8S A;  2NXP A;  3PVL A;  3D9N A;  3ISM C;  3J5Q B;  2GRL A;  3G2S A;  3KEA A;  4LEU A;  3LY7 A;  2F0Y A;  3OXF A;  5CRU A;  2IO2 C;  2I2O A;  5AAO A;  4ANV A;  1QBQ A;  5HI7 A;  2QFC A;  3ONL A;  3NOG D;  4RG6 A;  4KT6 B;  2ETA A;  3ZEF A;  1MX4 A;  3QKY A;  3HVE B;  4MLP A;  5ENR D;  3SGH A;  1V54 E;  1IQU A;  2DYR E;  1NA3 A;  3ZPJ A;  5JJ7 A;  1FVH A;  2XPI A;  5AQA A;  1U2V G;  4J0U A;  5KNH D;  4N2S A;  3L54 A;  1E90 A;  1HU3 A;  5FTP A;  4I9C A;  3TJP A;  4WND A;  4AOF A;  4CT4 A;  3Q4A B;  2C0L A;  1NZN A;  3EDT B;  3AG2 E;  1PAQ A;  5KJM A;  1TNB A;  2LAH A;  1JCR A;  2OEV A;  1A5E A;  4N39 A;  3EU5 A;  3E30 A;  4DUI A;  5G05 C;  3D9M A;  3TG4 A;  3G2U A;  1KLX A;  1YA0 A;  5HKP A;  3PZ4 A;  4JZY A;  4QQI A;  1OCZ E;  3OXG A;  2XHE A;  4TXQ A;  2VSO E;  4RVB A;  1X5B A;  4EBA A;  2E0I A;  2BTD A;  4B93 B;  2P9L G;  3ULE G;  4Y6W A;  2WM9 A;  1W3B A;  4D10 C;  3SQV A;  4GYY A;  4UWK A;  4ANU A;  4CGV A;  1EF1 C;  2DZN A;  3RRM B;  2KM4 A;  2KZT A;  4TV3 A;  1K8K G;  1HF8 A;  3UM0 A;  4A55 A;  2F8X K;  2YNQ A;  4AXH A;  2MYO A;  2V0P A;  2P9I G;  1SVX A;  3LY9 A;  3R7Q A;  3FDH A;  4FC8 A;  1EYH A;  3ASN E;  3ZXP A;  3MKR A;  3TXN A;  5KNG A;  2PNN A;  2IO3 C;  2GRM A;  3LKU A;  3UMV A;  4GTP A;  5FQ7 A;  1Z6T A;  4TUM A;  4GTV A;  4B8A A;  1A17 A;  1D8D A;  2J49 A;  4WNE A;  1IKN D;  3AG3 E;  4UI9 C;  3EJN A;  1MZC A;  3D9P A;  1FCH A;  2J4B A;  3CVL A;  3WG7 E;  2IOL A;  3MGB A;  5JMN D;  4LNG A;  2NYJ A;  1N4R A;  2GRO B;  2KCL A;  2B0O E;  3PZ1 A;  3Q7A A;  1HFA A;  4GTM A;  4CT0 A;  2PQN A;  4APF A;  4G1T A;  2X6I A;  3L82 A;  3ABL E;  2VGE A;  1X81 A;  1ZB1 A;  2P9K G;  3PNL B;  5ENS D;  5LCW C;  4BTA A;  3U64 A;  4QFV A;  4ILG A;  3SBT B;  4KVO A;  4XKB A;  2VQ2 A;  3V2X A;  3GZS A;  2PZI A;  1N52 A;  3ABM E;  4FA6 A;  3CQG B;  4WUY A;  3CHO A;  4HFG A;  2NC9 A;  2V4H C;  2LSV A;  4EZJ A;  4GYO A;  3WXX A;  1TN8 A;  2GRQ B;  3FFL A;  3O48 A;  3ZVV A;  1LD7 A;  4NIK A;  1QYM A;  3PZ2 A;  3TWR A;  1TEZ A;  1JPL A;  4UWF A;  2FO7 A;  3CHR A;  3ESL A;  4HOT A;  3EHQ A;  5FZS A;  2WB2 A;  4LER A;  4CZ2 D;  3LEW A;  3CKB A;  3FU6 A;  4L2L A;  3QC1 A;  1O1R A;  2A5U A;  1UOH A;  2RFA A;  2A5E A;  4M7C A;  4HB5 A;  4U8H A;  2BF0 X;  3SI5 A;  2WXK A;  3MV2 B;  4LG6 A;  3PUJ A;  5KBA A;  3C72 A;  3JCK C;  5CER B;  3ESK A;  3NBN B;  2I6H A;  3U66 A;  3CV0 A;  4XKC A;  4JEU A;  3SHF A;  2Y1L E;  5CMW A;  2IOS A;  3ML9 A;  3ML8 A;  3L6A A;  3Q78 A;  3RSE G;  4YDW A;  3ZW3 A;  5LOZ A;  4ATZ D;  4X8Q A;  3SO8 A;  1O1T A;  4ZFH A;  4GTR A;  1MHQ A;  1WM5 A;  3FH8 A;  2XGM A;  4V3I A;  3D9L A;  2C0M A;  4FLH A;  4J6I A;  3CST A;  3BG1 B;  4RG9 A;  1E8Y A;  4I1O B;  1NP7 A;  1JCS A;  4I6J A;  4BES A;  4L9P A;  2DZO A;  3L16 A;  4N5Q A;  5LX8 A;  2V5Q C;  2J9Q A;  3DPD A;  3DSW A;  5JHA A;  2KAT A;  2FI7 A;  4HVB A;  3IBE A;  3IEG A;  2XQ0 A;  3DXK G;  4OVU A;  4EPZ A;  3FTY A;  5BV0 A;  3FHE A;  5HS0 A;  5CBN A;  3GZ2 A;  4ILH B;  4WWP A;  3DST A;  1U3C A;  3PDN A;  3G2W A;  2WQ7 A;  3UIN C;  3T5X A;  3AU5 A;  5FZR A;  3CVY A;  2CHW A;  4G8L A;  1BU9 A;  1HS6 A;  5AJD A;  3P2B A;  5KJK A;  2HO1 A;  3CHP A;  4BY6 A;  3CVP A;  5BNW A;  4MKT A;  5J08 A;  3EIQ C;  3QAR A;  1LD8 A;  2XPY A;  4GMR A;  4EBA G;  3RIB A;  1N94 A;  2MRI A;  2NSZ A;  2UWJ G;  5A7D B;  1SZ9 A;  4Q69 A;  2YHE A;  3LJ3 A;  2J4D A;  3UIO C;  2HM8 A;  4GTT A;  2BUG A;  3DEP A;  3D9K A;  1BPO A;  2WPV A;  1DCQ A;  4I1A A;  4F6R D;  4I1M A;  2DVW A;  4XIF A;  3W9F A;  3DPY A;  4BT9 A;  3TWW A;  1HXI A;  5G05 J;  1WAO 1;  2DBA A;  4DLQ A;  5T3R A;  3UTM A;  4HNA D;  1Y8M A;  1PY1 A;  1KT0 A;  2VGX B;  3KAE A;  1WDY A;  3BG0 B;  5G04 C;  1JWF A;  3AJI A;  4JHR A;  1L5J A;  3FTZ A;  4JEH A;  3DWL G;  4DX2 A;  3KSL A;  3ULQ A;  4I17 A;  4OVV A;  3TWT A;  4XX5 A;  2GRP B;  1E7U A;  3I4G A;  3KS2 A;  3APD A;  4ATG A;  3PE4 A;  4F1P A;  3Q75 A;  2A4Z A;  4A1G A;  3LJN A;  3CIA A;  1H6P A;  4ACL A;  2AVP A;  3JUI A;  2ZU6 B;  4TXR A;  2YQ8 A;  4IRU A;  3FY4 A;  3NZU A;  4LCT A;  3QK0 A;  2MOW A;  2R59 A;  3SY2 A;  5FIN A;  1E8X A;  3W9G A;  4EQF A;  4B94 A;  2EIJ E;  5AQ7 A;  3UQ3 A;  3DEO A;  4FHK A;  4ABN A;  4C48 B;  4I6E A;  2R5S A;  1MJ0 A;  4GB9 A;  1SQM A;  3CK7 A;  4FP7 A;  1KZP A;  2JEK A;  5KCM A;  4U96 D;  3ZYL A;  3IXE A;  3T8K A;  2VTB B;  5B3S E;  2WXH A;  3D9H A;  1PC2 A;  1XNF A;  3V2O A;  2EIN E;  4Y6C A;  4HOS A;  1ZU2 A;  5ENP D;  4MBG A;  4GZ5 A;  2HE0 A;  3SNX A;  4DLO A;  3LVQ E;  3P1U A;  3LY8 A;  4PS3 A;  3EU9 A;  4DX1 A;  3TGO A;  3MEK A;  3FUL A;  3VLE A;  2WMO A;  4G8K A;  2PL2 A;  3V30 A;  4HOQ A;  3G2T A;  3AS8 A;  3MV3 B;  1OWM A;  5CBO A;  4BTB A;  4PUC A;  3UIP C;  2Y4U A;  2DYS E;  1OCC E;  5DBK A;  3BQO A;  4F53 A;  3FU5 A;  4AV7 A;  4AP2 A;  1JWG A;  3D3M A;  4KZ0 A;  1N0Q A;  4F7A A;  1UJJ A;  4UQX A;  3QOU A;  3EIJ A;  3TWQ A;  1BLX B;  3FUM A;  2GRR B;  4L1B A;  3CLJ A;  3OTN A;  3JQ1 A;  4BSZ B;  4W9R A;  2BKK B;  5ARF A;  2P9U G;  3TWX A;  3NB2 A;  3UXG A;  3PZD A;  4JXT A;  4WWO A;  1E8W A;  1TR4 A;  5BXO A;  1H2T C;  1FT1 A;  3CHM A;  4KMO A;  2BED A;  3TAX A;  3GYZ A;  1D8E A;  3FUN A;  4ANW A;  3ZKJ A;  3D9J A;  4XE0 A;  3ZU7 B;  4ANX A;  2PQR A;  2M63 A;  3UM1 A;  2DCP A;  2IU1 A;  5EX0 A;  3CSF A;  3CVX A;  3FUI A;  4AY5 A;  2PM7 A;  3BUA A;  4JA9 A;  3OAW A;  4LSZ E;  4HRL A;  2X38 A;  4F3V A;  3ASO E;  4AY6 A;  2P58 C;  4JPS A;  1UN9 A;  3FTW A;  1KPS B;  2LSU A;  1Z5S C;  2C2L A;  3G2V A;  3B7U X;  2UY1 B;  2WXG A;  2CFU A;  1FVF A;  4YVO A;  1Z3X A;  3FH5 A;  5FQ8 A;  4CYM D;  3JUE A;  5E75 A;  4EEC A;  4N3B A;  3QB2 A;  5CEC B;  3ASH A;  4OAU C;  4MRU A;  4UQZ A;  2XS8 A;  4J8Y A;  2FUL A;  3PE3 A;  2R05 A;  4J8E A;  2J8S D;  5CED B;  2H6H A;  4BSX A;  4BFR A;  4NAC A;  5LCW J;  4UWH A;  5D0O D;  4XI0 A;  4N3A A;  3NQP A;  2FO1 E;  2QYJ A;  3RK6 A;  2MHK A;  3LS8 A;  5G04 J;  3DSX A;  4H7X A;  4DPR A;  1TNZ A;  2H6F A;  2L6B A;  2YIN A;  3S2A A;  1QZ2 A;  4KVM A;  5EIL A;  2X3M A;  4U07 A;  4ME2 A;  3SZ7 A;  2XCB A;  4IYP A;  4J8D A;  3FU0 A;  5FIO A;  3CEQ A;  1TJC A;  2I1J A;  5B1A E;  4RQI A;  4DRX E;  1IHB A;  1Z3Y A;  1V55 E;  2WXP A;  3HYM B;  4YDY A;  5EIB E;  4KBQ A;  3PEV B;  3X2Q E;  2P9S G;  4IUL A;  3TWV A;  3F6Q A;  3MX3 A;  2XRZ A;  1EPU A;  3QWV A;  4JW1 A;  2WMN A;  2GRN B; 
#chains in the Genus database with same CATH homology
 4CYM D;  3JUE A;  2VGE A;  4HBD A;  2F8Y A;  3TWS A;  4B93 B;  3JXI A;  1NFI E;  2ZGG A;  5ENS D;  3T9K A;  2Y1L E;  5AAO A;  4DX7 D;  1G3N B;  5CEC B;  1MYO A;  2XEH A;  4QFV A;  4OAU C;  2ETC A;  1N0Q A;  3NOC D;  3V2X A;  4J8Y A;  4GMR A;  2XZD G;  2KXP C;  4HI8 A;  3TWQ A;  3V79 K;  1BLX B;  1WG0 A;  4DX6 D;  2DZN A;  1K3Z D;  2DWZ A;  3NOG D;  5AQB A;  4J7W A;  2ETA A;  3J5P A;  4YDW A;  5FIN A;  5EID A;  4HRM B;  2J8S D;  1YYH A;  4K5B A;  5CED B;  3W9G A;  3UI2 A;  1MX4 A;  5EYL A;  3AAA C;  2V4H C;  1S70 B;  4BSZ B;  2BKK B;  4O1P A;  5ENR D;  5AQ7 A;  4DX5 D;  4O1O A;  3JXJ A;  2F8X K;  3TWX A;  3UXG A;  3DEO A;  5ENO D;  2Y0B G;  4C48 B;  1BD8 A;  2MYO A;  4ATZ D;  1TR4 A;  2BKG A;  3SO8 A;  1MJ0 A;  5BXO A;  4A63 B;  1SVX A;  1BU9 A;  4UUC A;  5AQA A;  4ZFH A;  1AWC B;  2XEN A;  3DEP A;  2FO1 E;  5KNH D;  4F6R D;  1DCQ A;  2JAB A;  2QYJ A;  2ZGD A;  4HLL A;  4O60 A;  5D66 A;  4BER A;  2DVW A;  5ENT D;  5BXU A;  5KWD A;  4HQD A;  3W9F A;  1D9S A;  3HG0 D;  4K5C A;  4K5A B;  5JA4 D;  1MX2 A;  1AP7 A;  4NIK A;  5KNG A;  2L6B A;  3Q9U C;  2PNN A;  1BI8 B;  4GPM A;  4U96 D;  1QYM A;  1N11 A;  1K1A A;  1YCS B;  3TWW A;  2AJA A;  3ZKJ A;  3ZU7 B;  3TWR A;  5EIL A;  1MX6 A;  5HRY A;  5EN5 D;  3IXE A;  4RLY A;  3T8K A;  4TUM A;  4HNA D;  3UTM A;  4OAV B;  4BET A;  1OY3 D;  2F37 A;  3EHQ A;  3Q9N C;  3D9H A;  5FIO A;  5ITZ F;  5EYP F;  4BES A;  1YMP A;  1WDY A;  2DZO A;  3V2O A;  4HI9 A;  3ZUV B;  2RFM A;  4HRN A;  4U8Y D;  4U95 D;  1IKN D;  3B7B A;  4N5Q A;  4BEP A;  4CZ2 D;  1A5E A;  5ENP D;  2V5Q C;  5AN8 A;  2ETB A;  3AJI A;  2P2C P;  3HRA A;  1IXV A;  2HE0 A;  4DUI A;  1UOH A;  4LSZ E;  4DX2 A;  4HRL A;  4DRX E;  5AQ9 A;  1BI7 B;  4Z68 A;  2RFA A;  5HKP A;  1IHB A;  1K1B A;  2A5E A;  3EU9 A;  4HB5 A;  3TWT A;  4DX1 A;  4ZHB A;  4YDY A;  1DC2 A;  5JMN D;  5EIB E;  3TWU A;  2NYJ A;  4QQI A;  3C5R A;  2XEE A;  4LG6 A;  4G8K A;  1OT8 A;  5ENQ D;  5HS0 A;  4F1P A;  4U8V D;  3ZNG A;  3V30 A;  5AAR A;  5CBN A;  5KBA A;  5CER B;  3B95 A;  3TWV A;  3F6Q A;  3V31 A;  2B0O E;  3LJN A;  3NBN B;  1SW6 A;  1N0R A;  2XZT G;  3EHR A;  3J5Q B;  2QC9 A;  5CBO A;  3KEA A;  4JB8 P;  4LNU D;  2KBX A;  5CEA A;  4G8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...