4HI8A

Structure of integrin-linked kinase ankyrin repeat domain in complex with pinch1 lim1 domain collected at high energy, wavelength 0.32800
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
170
structure length
169
Chain Sequence
DDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINANEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1 LIM1 domain collected at high energy, wavelength 0.32800
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Integrin-linked protein kinase
total genus 56
structure length 169
sequence length 170
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4hi8A00
4LNUD 5AQAA 3UI2A 5HKPA 1S70B 4U96D 4DX6D 1NFIE 1AP7A 4ZHBA 3UTMA 4HI9A 3V79K 2JABA 5AQBA 4BSZB 1A5EA 3C5RA 1BI7B 1BD8A 4HLLA 5FIOA 4DX5D 4DX2A 4HBDA 3EHRA 4BERA 4DUIA 5ENOD 4YDYA 3ZKJA 1DC2A 3B7BA 4RLYA 2MYOA 3JXIA 4HRNA 3TWWA 3NOCD 1DCQA 1SW6A 2RFAA 4G8LA 4HRMB 2J8SD 2ETAA 4LG6A 5ENRD 3V2XA 4UUCA 5EYPF 1BI8B 4QQIA 4K5BA 2V4HC 5EN5D 4ATZD 5EIDA 1WDYA 2L6BA 2XENA 4G8KA 4DX7D 5AAOA 5ENQD 1OY3D 4U8YD 1WG0A 5EILA 3TWTA 1QYMA 2F37A 2DWZA 2KBXA 1N0QA 2QC9A 5ENTD 2RFMA 3F6QA 4GMRA 5CBOA 2VGEA 3DEOA 2DVWA 2HE0A 4O1OA 3J5PA 4U95D 3DEPA 5BXUA 5ENPD 4GPMA 2AJAA 2XEHA 2BKGA 2XEEA 1BU9A 2Y1LE 4N5QA 2ZGDA 4O60A 5EIBE 4O1PA 1N11A 2V5QC 5ITZF 3SO8A 3D9HA 3Q9NC 5HRYA 1IKND 2A5EA 2P2CP 3EU9A 5HS0A 4F6RD 5KNGA 4NIKA 3T9KA 4QFVA 3AJIA 1D9SA 4LSZE 3LJNA 2Y0BG 2QYJA 1MX2A 4HI8A 4YDWA 5ENSD 2KXPC 4JB8P 5CERB 1YYHA 3W9GA 4B93B 3T8KA 2F8XK 3JXJA 5CBNA 4C48B 4HQDA 2DZNA 3NOGD 4HRLA 3J5QB 5AQ9A 5AARA 3TWUA 5FINA 2XZTG 3KEAA 3HRAA 3W9FA 3IXEA 4TUMA 3TWSA 4CZ2D 2PNNA 5KNHD 3V30A 2ETCA 3JUEA 2BKKB 5KBAA 4DX1A 1YCSB 5CECB 3V2OA 1MJ0A 3AAAC 3TWXA 3ZNGA 3NBNB 5AQ7A 1UOHA 4BEPA 5CEAA 1YMPA 3Q9UC 1MX4A 1N0RA 1SVXA 1MX6A 5CEDB 1IXVA 3HG0D 5AN8A 4F1PA 4ZFHA 2ETBA 2NYJA 2DZOA 3EHQA 3ZUVB 1TR4A 3TWVA 4K5CA 3V31A 2FO1E 1IHBA 4DRXE 4BETA 1K1AA 5D66A 4J7WA 3ZU7B 5KWDA 2B0OE 1BLXB 5JA4D 2F8YA 4OAUC 1K1BA 4HNAD 4K5AB 5BXOA 5EYLA 1AWCB 1G3NB 2XZDG 1OT8A 4J8YA 4HB5A 1K3ZD 2ZGGA 5JMND 3TWRA 4CYMD 3UXGA 4Z68A 1MYOA 4U8VD 4OAVB 4A63B 3B95A 3TWQA 4BESA
chains in the Genus database with same CATH superfamily
3SFZA 3EHNA 1E7VA 1O1TA 1JCQA 3CKBA 3UMVA 3HXFA 2VSXE 3RIBA 2XPIA 3ASDA 5KJMA 4HBDA 1VDYA 3U4TA 3ZKJA 4TUUA 1ZBPA 3ML9A 2AXVA 3FTVA 2RFAA 3RU0A 4J0UA 3DSTA 4XX5A 2VGXB 3PZ1A 1WM5A 4FULA 5BV0A 4NRHB 4GMRA 3S7JA 3MKRA 4G24A 3CVXA 4GPMA 2AJAA 2XEEA 3APDA 1W3BA 1NA0A 4AP2A 1IYGA 2FI7A 1D9SA 3DBSA 3DSSA 4G26A 4J6IA 3LEWA 3E34A 4J8EA 4B94A 4C48B 3FTSA 4HQDA 1HH8A 3QB2A 4GZCA 3ZYMA 3UKUG 3Q73A 4BFRA 5AIJA 4ME2A 4GMJA 3U3WA 2UY1A 5EDSA 3CVQA 3UM2A 4PS8A 1SA5A 3L82A 4YDEA 4UI9K 2V8SE 3HXCA 5D66A 4BWRA 4I2ZA 3TGOA 3FUHA 3BUAA 3Q79A 2ZIRA 4I9EA 3C3OA 2B6CA 3MKQB 2BF0X 3ZHEB 3IHYA 4DK5A 2LAIA 4ZHBA 4ANXA 1XNFA 4HI9A 4EZKA 2JABA 3IEGA 1TJFA 1MQSA 3WXXA 4W9RA 3B13A 3FH7A 5ENOD 2VSOE 1DCEA 2XPYA 4I9CA 4DPRA 3ZXSA 2GROB 4J8SA 4U63A 4AY6A 2KZTA 3ZGQA 4N3AA 3CHSA 4N5QA 1Q2ZA 2R02A 4GTRA 5D2MC 4PDXA 5JHBA 4HS2A 2YNQA 3FTWA 1NI1A 3UIOC 2Y0BG 2QYJA 3DXMG 3LS8A 5D0QD 2EQXA 2X38A 2P9LG 2ZISA 5AJDA 1H6KA 4EECA 3HRAA 4FLHA 3G2UA 4K03A 3V30A 5CECB 3HYMB 1OWLA 3AAAC 3ASNE 1UOHA 2KZTB 1MX4A 4CCAA 5H7PA 3APCA 2WPVA 5JJTA 3R7RA 3RRNB 3CHQA 5CCMA 2QY7A 1K1BA 4XEIG 1UN8A 1O1SA 2V5FA 3B95A 2XS8A 4IULA 1BPOA 4XI9A 3D9NA 5BW8C 4CRWA 2WQ6A 5FZRA 3DWLG 4YDOA 4LRZA 1N4RA 3UPVA 4I43A 1SQMA 2BUGA 3CGHA 4NQ0A 3NOCD 3ULQA 3CIAA 4UUCA 1IQUA 2ILRA 5EKQD 2L6BA 3LPZA 3TJPA 1OY3D 2C2LA 5EILA 4GTVA 2KBXA 4IYPA 5M72A 1L5JA 2Y69E 1RZ4A 4G25A 2GW1A 4LNGA 3CKCA 1Y8MA 3T5VA 1UJKA 3ZXPA 4HI8A 4YDWA 5CERB 1JCRA 1N54A 3D9KA 3FH5A 3BG0B 3CR3A 2WXQA 4WUYA 3NF1A 2XGMA 3HDXA 3TG5A 3LY8A 1UJJA 4WWPA 2BTDA 2XGOA 3JQ1A 4AM9A 3Q5MA 2WMNA 1Z3YA 1E8XA 4LUNU 3MJWA 2LSVA 3CQGB 5IY5E 3I4RB 3OXFA 5G04J 4HNAD 5BXOA 1AWCB 2I6HA 1G3NB 2CG3A 4JHKA 4L2YA 1OCRE 3LJ3A 3L22A 3ZW3A 2IO2C 1YA0A 4CDRA 1PAQA 3BQOA 4GZ3A 3ABME 1TNUA 1DVPA 5LP0A 4DUIA 3SBTB 5LOZA 1D8EA 2XGSA 4LG6A 5J08A 1N52A 2UWJG 2V0PA 4QQIA 3CVWA 4MS6A 4CEMA 4AVXA 2WVIA 3UIPC 3FUNA 4ILHB 4HOUA 2Y1LE 2ZGDA 1JUQA 4GYWA 1TYQG 3PZ4A 2YQ8A 2IEJA 2P2CP 3EU9A 3JCKC 2IONA 3QDNA 3PE3A 3UT7A 3UM3A 1X81A 3CHRA 3E30A 1OCCE 4FHJA 1N4SA 4A1GA 1EYHA 1E8WA 3RK6A 2VYIA 1K8KG 1MJ0A 2LNIA 1HZ4A 5FT9A 1H0AA 4F7AA 4UI9C 3Q7FA 3HHMA 1LF8A 2J07A 2H6IA 3DXKG 4J7WA 2DIWA 4UI9J 3ENEA 4H7YA 4GCOA 4L7TA 3BEEA 4KMOA 4WWNA 3SF4A 3FUEA 3Q15A 3T5XA 3HXEA 3AG1E 3AS4A 4KVMA 2AXUA 3FTZA 1TN6A 2MOWA 3TAXA 4UQYA 3PZDA 4BSZB 4GTQA 5DBKA 3FTUA 4RQIA 4YDYA 5FZSA 3QJZA 1HG5A 3E37A 4KZ0A 4ANVA 3SY2A 4UWKA 1FT2A 2H6FA 5J90A 2QZAA 3CHOA 2P58C 2QC9A 4RSYA 2WB2A 2HE0A 4GPKA 3DEPA 3CV0A 4JHJA 4LNBA 2BKGA 2HR2A 3Q75A 1ZU2A 5HRYA 4A3VA 4OYSA 3QC1A 4N2QA 5ENSD 2KATA 1YYHA 4M7CA 3NOGD 4HRLA 3J5QB 3TWUA 1HXIA 1EF1C 4TUMA 4EPZA 4GTMA 4LERA 3TG4A 2WXGA 2X6KA 3JUEA 4H7XA 5BUZA 2Q7FA 1OWOA 4UQZA 3CHPA 5ENNA 1UG3A 3PZ3A 4MBGA 4XI0A 1IHGA 3D9PA 2I1KA 5CEDB 5FZQA 1IXVA 2JLBA 4JEHA 3ML8A 4EQFA 5HQ8A 3ZHEA 3ASFA 5JA4D 2WXMA 4A55A 3AG4E 2P9SG 2ZGGA 3TWQA 3B7UX 3Q7AA 4I6GA 4CDNA 3CVNA 2R59A 3OXGA 3AG3E 3CK7A 4APFA 2AXZA 1ELWA 4U8HA 3T8MA 4GAAA 3PDNA 3JXIA 3TWWA 2FULA 3FULA 3QKYA 1H2TC 3PVLA 2H6GA 4FADA 1OCZE 3CLJA 3QWWA 1IQRA 4J8FA 2X6HA 3O4ZA 3IBEA 2P9PG 3F6QA 1LD8A 2MHKA 1BU9A 3AG2E 3SO8A 3Q9NC 4KBQA 4RVBA 2WXOA 4NURA 4CGWA 3MX3A 4RG6A 4XKCA 3LYAA 4JXTA 3RKVA 1FT1A 3FUMA 4A3TA 3DSVA 5KJKA 3ONLA 3EIJA 3EDTB 5FINA 5CHEE 4AXHA 4B89A 3UT4A 2OVFA 2KCLA 2CFUA 4UWHA 5KBAA 1E8YA 3G2WA 3LXUX 5CEAA 1SZ9A 2R03A 4F1PA 3HXDA 3NZSA 3EHQA 2RG8A 3NB2A 4I1OB 4K5CA 3B7TA 2WQ7A 4J8DA 4BETA 4UQXA 3RRMB 3B7SA 4J8YA 4EZLA 5JHAA 3R7QA 4A63B 2E0IA 3PH0C 5DIZA 3GW4A 3PUKA 2Y3AA 4IN3B 1AP7A 2XQ0A 1A5EA 4HORA 4EHMA 2A4ZA 2EIJE 2I9CA 5KJNA 3EHRA 4DI4A 3CHMA 1FVFA 4HRNA 4APOA 2WXLA 5E75A 3V2XA 1OWPA 2V4HC 5EIDA 2ZU6B 5AAOA 2L0IA 3CVUA 3Q78A 4U0UA 4TRQA 3FEXA 3FHEA 5EIBE 4EBAG 5ITZF 2R17C 4N3BA 3T9KA 3CVPA 2CHWA 3AU5A 1MX2A 3IHVA 3L08A 3S7DA 4GTSA 3FUJA 5AQ9A 2DYRE 5G55A 3QAQA 3IXEA 3GYZA 3FU5A 3SNXA 4E6HA 4ILIA 2XPZA 5HI7A 5FJYA 2ETBA 4ANWA 3MV2B 3MV3B 3ZN3A 3NZUA 3LVRE 1MHQA 4R7LA 1TNYA 1BLXB 2KC7A 2CFZA 5LCWJ 3PZ2A 5A6CA 1S63A 3SD5A 4C0EA 4GB9A 4L9PA 3UI2A 4JZYA 2CHZA 4BX9A 3UTMA 2P9NG 4YVOA 4DX5D 1HO8A 5FIOA 1V54E 4TXRA 4ANUA 4GTOA 2VGYA 5EX0A 4YVQC 2MYOA 3L16A 3CK8A 2GRPB 2EILE 1U3DA 3ABLE 2J8SD 4AEZC 2UY1B 3LKUA 2QYUA 3SI5A 4X8QA 1OWNA 1INZA 3D9LA 4KT6B 4U04A 1N0QA 5ENTD 3RO2A 4U95D 4KYOB 1HS6A 2XEHA 1WY6A 2R05A 3KEZA 4O1PA 1IKND 1KT1A 1S64A 4F6RD 3CSTA 2NC9A 4LEUA 2LXMA 3ZYKA 4MLPA 3TXMA 3JXJA 5AARA 3L17A 3KEAA 5CMYA 2RD0A 4CZ2D 2ETCA 2IOSA 3DSWA 3FP3A 4L1BA 1YMPA 4FU3A 1MX6A 2AW6A 4BT8A 1QZ2A 3VLDA 3PNTB 3RAUA 1MZCA 4G11A 3SQVA 1TR4A 4DLOA 3ESLA 2BEDA 5BNWA 4K5AB 2HM8A 2IY0C 4A1SA 3MKQA 3KSQA 4CYMD 1MYOA 4N2SA 3C72A 3MZLB 3ASGA 5FQ4A 1S0PA 1OXJA 3FUDA 2L9BA 1NA3A 5ARFA 3ASOE 1Z6TA 4DX7D 1WG0A 4BT9A 4O1OA 5ARGA 2P9UG 4DJAA 4O60A 1GW6A 2GRQB 3QK0A 5A7DB 5FQ7A 4KZCA 1KLXA 4ABNA 1JPLA 2J09A 1JWGA 1ELKA 5G2NA 3U64A 4B93B 4O6FA 3KS2A 2LAHA 4M3OA 3HIZA 5BPPA 4AY5A 3KD7A 1HX8A 2VGXA 4I6JA 1YCSB 4BSXA 3ZNGA 3NBNB 4HOTA 5AQ7A 4BEPA 4GU5A 4TXPA 2ONDA 3PUJA 4HXIA 4G1TA 1V55E 3QWPA 4Y6CA 4CT4A 2WXJA 3C3RA 2B0OE 3ULEG 1E90A 3I5PA 3FDHA 5FQ6A 1N94A 3FU0A 4JPSA 3WG7E 3EHMA 4DX6D 3EIQC 5AYWD 2GRLA 3UKRG 2R5SA 3EUVA 3C5RA 2V4LA 4RLYA 3NQPA 1P5QA 2ETAA 3LY9A 3LCAA 1BI8B 5C2YA 1WDYA 4WNFA 4G8KA 1HE8A 2X6JA 1OWMA 3HVEB 2VGEA 3SFXA 2XRZA 2OV8A 3OXLA 4WNGA 2I1JA 4Q94A 2H6HA 2WM9A 2KM4A 1KZPA 4XIFA 2WXPA 2ZXWE 4F1SA 4MKTA 1Z3XA 1D8DA 2E2EA 2VTBB 3PNLB 3QARA 1H2UA 2F8XK 5FQ8A 4UWGA 5KCMA 5FTPA 4JEUA 1A17A 2BKKB 3B7RL 3FUIA 2KCVA 3TWXA 3MA5A 5AJLA 3D9MA 4GTTA 4GA2A 5T4YA 4GMLA 4I17A 3O48A 5JJ7A 4UWLA 2FO1E 1IHBA 3ZFWA 4CT0A 4KXKB 4ACLA 4WWOA 3L9TA 4B8AA 5AQAA 3UQ3A 1LTXA 3VLFA 3IKOB 3EJNA 4FJZA 2FEZA 3FTXA 2J4BA 3I3NA 1BI7B 4I1AA 3B7BA 4BY6A 1SW6A 3SHFA 2DYSE 5ENRD 3Q49B 3I4GA 2XENA 1TNZA 1U2VG 3QNKA 1OCOE 2DWZA 2RFMA 2J4DA 1H6PA 1NL4A 4GZ5A 3D9HA 2XHEA 2XEVA 4YNDA 3AS5A 1LD7A 4NIKA 4U0ZA 4XKBA 2IQCA 3RRUA 4HOSA 2NSZA 5E76A 4FLBA 2GRMA 3PREA 2YHCA 3W9GA 5LX8A 4BTAA 4KVOA 5CBNA 4L2LA 4E85A 3GZ1A 3ISMC 1N9AA 2WQHA 5KNHD 1N4QA 1WAO1 3RSEG 2WXFA 3SZ7A 5BV1A 3SFYA 3ULYA 4N5CA 3ZRHA 3ZUVB 3ONKA 5G04C 3TWVA 3UM1A 5KWDA 2XRYA 3PEUB 3R9MA 2X6FA 4TXQA 2WXRA 5BT1A 1SA4A 5JMND 3NAWA 1TNOA 4U8VD 4OAVB 1QNFA 1H2VC 3LY7A 4FC8A 2EIKE 4HLLA 3BG1B 5C1DA 2AVPA 4HRMB 1HG2A 3DPDA 4HLEA 1NZNA 3TWTA 1QYMA 4PS7A 4GZ6A 3ZYQA 3D9JA 2DVWA 2HO1A 4K0RA 1ELRA 3UX4A 2VJ8A 1X5BA 2P9IG 3G2VA 4AV7A 3Q4AB 3AJIA 3LJNA 1PY1A 3FUKA 4JB8P 2M63A 3T8KA 4G2VA 3PEVB 3QOUA 4GA1A 3HVEA 4Q96A 3W9FA 3VTXA 3TWSA 4DX1A 5B1AE 4DLQA 4F53A 3C3QA 3CK9A 3TXNA 3U9WA 4U0SA 4JD2G 4OAUC 4FHKA 1DNPA 3U66A 3FH8A 3LVQE 5CBOA 3GZSA 2PZIA 5HKPA 2WXIA 1EPUA 4JA7A 4U96D 2FO7A 3S7BA 2IOLA 5CRVA 3D3MA 5LFAA 4ACKA 1RW2A 4OVUA 4BERA 2YHEA 3C98A 4BTBA 3VLEA 4JHRA 3JYSA 4G8LA 1HU3A 1TN7A 3TL5A 4I2WA 5ENQD 4I1MA 3UT8A 2OEWA 2VQ2A 5A23A 5B3SE 2CHXA 5KJLA 4MRUA 4URKA 4TV3A 3PRZA 3K9IA 4WNDA 4EZJA 1UN9A 1H19A 5KNGA 4PH4B 3MCXA 4HOQA 1Z5SC 4LSZE 3ZIMA 5FWQA 2KXPC 3E33A 3CVVA 1O5MA 1N95A 4C0MA 2DZNA 3MYVA 3P2BA 1FCHA 1TJCA 4HFGA 4NACA 2HYZA 2J49A 2YINA 2IF4A 2IU1A 4L23A 2XCCA 2R2LA 3AU4A 2OCCE 3FFLA 3CSFA 1KZOA 5AN8A 4U07A 2NYJA 2LO6A 2OEVA 4GTPA 3V31A 1PC2A 2C0LA 3Q47B 2EIME 2F8YA 3ABKE 4ILGA 5EYLA 2LXLA 2XS1A 2F0YA 2C0MA 2EINE 2QFCA 4HB5A 3TWRA 1FPPA 3UXGA 3RO3A 3ZVVA 4BESA 5ANRA 1S70B 4IRUA 5CCLA 4PUCA 3V79K 5AQBA 4Q69A 4DX2A 3AS8A 2CG2A 1KT0A 3FTYA 1QQEA 3EU5A 4V3IA 1Y6IA 4B0ZA 3FU6A 3OAWA 2A5UA 1N4PA 3IV0A 4EBAA 4FJYA 1SZAA 3ESKA 3DRAA 2GGFA 3APFA 4GCNA 2I2OA 1UW4B 4QFVA 3OTNA 4JA9A 4U7EB 2PL2A 1O1RA 5CRUA 5T8IA 4XZ4A 4P29A 3E4BA 2XZTG 1TN8A 1H6OA 4FP7A 2Y4UA 4D10C 3P1UA 3JUIA 1N0RA 1HFAA 3CVLA 3FUFA 1FVHA 4Y6WA 1SVXA 5AENA 4AJWA 5B1BE 3UINC 4DRXE 4I6EA 4GA0A 2LSUA 1K3ZD 3CQCB 2P9KG 3PE4A 3L13A 4HVBA 4LNUD 5EX3A 2GRRB 3D9IA 1NFIE 3PS6A 3ZEFA 1BD8A 4N3CA 1DC2A 2RKKA 1DCQA 2GRNB 4AIFA 1TNBA 4UWFA 5LCWC 4ATZD 2IJGX 2WXKA 2MRIA 3JQ0A 3DEOA 5BXUA 3HXBA 3GZ2A 5G05C 5CMWA 2V5QC 2KCKA 2PM7A 3E32A 3N71A 2VTBA 1HF8A 3S7FA 4JL0A 2J08A 2FF4A 3UM0A 2JEKA 3VTYA 4G23A 3URZA 3DSXA 1ZB1A 2VSNA 2IFUA 2FBNA 4GYYA 1XGWA 2PNNA 2PQNA 5ANLA 2VSYA 3V2OA 1TEZA 1NP7A 2WXNA 3CEQA 2IO3C 1KPSB 3DSUA 1E7UA 3G2SA 3FEYA 3FY4A 5JJ6A 5G05J 1K1AA 3ZU7B 4ATGA 1QBQA 4JC8A 3BU8A 4B8CB 3S2AA 4Z68A 3D9OA 3RJVA 5D0OD 2AWIA 3SGHA 1B89A 3CVYA 4GZDA 5T3RA 3ZYLA 4DI3A 1EDUA 4WNEA 2OOEA 4WAFA 4AOFA 3UUXA 3FU3A 4BX8A 3L6AA 2XCBA 2J9QA 5EYPF 4K5BA 1U3CA 5EN5D 4XE0A 4CDMA 4U8YD 2F37A 1JCSA 3J5PA 5ENPD 2PM6A 1N11A 2A5EA 2X3MA 5HS0A 3SBSA 3MEKA 4FA6A 3ZPJA 3L54A 3X2QE 3KSLA 4JW1A 4F3VA 2Y4TA 3DPYA 3G2TA 3FWVA 2LUHA 3R9AB 2X6IA 4PS3A 2L0TB 4CGVA 3Q9UC 4GYOA 4N39A 3HG0D 1E96B 2L6JA 3ASHA 4LCTA 4ZFHA 1E8ZA 2DZOA 3MGBA 4OVVA 2NXPA 4JVSA 1OUVA 4C9BB 3KAEA 2DCPA 2XZDG 4RG9A 1OT8A 2WXHA 2OVBA 2WMOA 2DBAA 1JWFA 3QWVA 2PQRA 3LDZA
chains in the Genus database with same CATH topology
4LNUD 5AQAA 3UI2A 5HKPA 1S70B 4U96D 4DX6D 1NFIE 1AP7A 4ZHBA 3UTMA 4HI9A 3V79K 2JABA 5AQBA 4BSZB 1A5EA 3C5RA 1BI7B 1BD8A 4HLLA 5FIOA 4DX5D 4DX2A 4HBDA 3EHRA 4BERA 4DUIA 5ENOD 4YDYA 3ZKJA 1DC2A 3B7BA 4RLYA 2MYOA 3JXIA 4HRNA 3TWWA 3NOCD 1DCQA 1SW6A 2RFAA 4G8LA 4HRMB 2J8SD 2ETAA 4LG6A 5ENRD 3V2XA 4UUCA 5EYPF 1BI8B 4QQIA 4K5BA 2V4HC 5EN5D 4ATZD 5EIDA 1WDYA 2L6BA 2XENA 4G8KA 4DX7D 5AAOA 5ENQD 1OY3D 4U8YD 1WG0A 5EILA 3TWTA 1QYMA 2F37A 2DWZA 2KBXA 1N0QA 2QC9A 5ENTD 2RFMA 3F6QA 4GMRA 5CBOA 2VGEA 3DEOA 2DVWA 2HE0A 4O1OA 3J5PA 4U95D 3DEPA 5BXUA 5ENPD 4GPMA 2AJAA 2XEHA 2BKGA 2XEEA 1BU9A 2Y1LE 4N5QA 2ZGDA 4O60A 5EIBE 4O1PA 1N11A 2V5QC 5ITZF 3SO8A 3D9HA 3Q9NC 5HRYA 1IKND 2A5EA 2P2CP 3EU9A 5HS0A 4F6RD 5KNGA 4NIKA 3T9KA 4QFVA 3AJIA 1D9SA 4LSZE 3LJNA 2Y0BG 2QYJA 1MX2A 4HI8A 4YDWA 5ENSD 2KXPC 4JB8P 5CERB 1YYHA 3W9GA 4B93B 3T8KA 2F8XK 3JXJA 5CBNA 4C48B 4HQDA 2DZNA 3NOGD 4HRLA 3J5QB 5AQ9A 5AARA 3TWUA 5FINA 2XZTG 3KEAA 3HRAA 3W9FA 3IXEA 4TUMA 3TWSA 4CZ2D 2PNNA 5KNHD 3V30A 2ETCA 3JUEA 2BKKB 5KBAA 4DX1A 1YCSB 5CECB 3V2OA 1MJ0A 3AAAC 3TWXA 3ZNGA 3NBNB 5AQ7A 1UOHA 4BEPA 5CEAA 1YMPA 3Q9UC 1MX4A 1N0RA 1SVXA 1MX6A 5CEDB 1IXVA 3HG0D 5AN8A 4F1PA 4ZFHA 2ETBA 2NYJA 2DZOA 3EHQA 3ZUVB 1TR4A 3TWVA 4K5CA 3V31A 2FO1E 1IHBA 4DRXE 4BETA 1K1AA 5D66A 4J7WA 3ZU7B 5KWDA 2B0OE 1BLXB 5JA4D 2F8YA 4OAUC 1K1BA 4HNAD 4K5AB 5BXOA 5EYLA 1AWCB 1G3NB 2XZDG 1OT8A 4J8YA 4HB5A 1K3ZD 2ZGGA 5JMND 3TWRA 4CYMD 3UXGA 4Z68A 1MYOA 4U8VD 4OAVB 4A63B 3B95A 3TWQA 4BESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LNU D;  5AQA A;  3UI2 A;  5HKP A;  1S70 B;  4U96 D;  4DX6 D;  1NFI E;  1AP7 A;  4ZHB A;  3UTM A;  4HI9 A;  3V79 K;  2JAB A;  5AQB A;  4BSZ B;  1A5E A;  3C5R A;  1BI7 B;  1BD8 A;  4HLL A;  5FIO A;  4DX5 D;  4DX2 A;  4HBD A;  3EHR A;  4BER A;  4DUI A;  5ENO D;  4YDY A;  3ZKJ A;  1DC2 A;  3B7B A;  4RLY A;  2MYO A;  3JXI A;  4HRN A;  3TWW A;  3NOC D;  1DCQ A;  1SW6 A;  2RFA A;  4G8L A;  4HRM B;  2J8S D;  2ETA A;  4LG6 A;  5ENR D;  3V2X A;  4UUC A;  5EYP F;  1BI8 B;  4QQI A;  4K5B A;  2V4H C;  5EN5 D;  4ATZ D;  5EID A;  1WDY A;  2L6B A;  2XEN A;  4G8K A;  4DX7 D;  5AAO A;  5ENQ D;  1OY3 D;  4U8Y D;  1WG0 A;  5EIL A;  3TWT A;  1QYM A;  2F37 A;  2DWZ A;  2KBX A;  1N0Q A;  2QC9 A;  5ENT D;  2RFM A;  3F6Q A;  4GMR A;  5CBO A;  2VGE A;  3DEO A;  2DVW A;  2HE0 A;  4O1O A;  3J5P A;  4U95 D;  3DEP A;  5BXU A;  5ENP D;  4GPM A;  2AJA A;  2XEH A;  2BKG A;  2XEE A;  1BU9 A;  2Y1L E;  4N5Q A;  2ZGD A;  4O60 A;  5EIB E;  4O1P A;  1N11 A;  2V5Q C;  5ITZ F;  3SO8 A;  3D9H A;  3Q9N C;  5HRY A;  1IKN D;  2A5E A;  2P2C P;  3EU9 A;  5HS0 A;  4F6R D;  5KNG A;  4NIK A;  3T9K A;  4QFV A;  3AJI A;  1D9S A;  4LSZ E;  3LJN A;  2Y0B G;  2QYJ A;  1MX2 A;  4HI8 A;  4YDW A;  5ENS D;  2KXP C;  4JB8 P;  5CER B;  1YYH A;  3W9G A;  4B93 B;  3T8K A;  2F8X K;  3JXJ A;  5CBN A;  4C48 B;  4HQD A;  2DZN A;  3NOG D;  4HRL A;  3J5Q B;  5AQ9 A;  5AAR A;  3TWU A;  5FIN A;  2XZT G;  3KEA A;  3HRA A;  3W9F A;  3IXE A;  4TUM A;  3TWS A;  4CZ2 D;  2PNN A;  5KNH D;  3V30 A;  2ETC A;  3JUE A;  2BKK B;  5KBA A;  4DX1 A;  1YCS B;  5CEC B;  3V2O A;  1MJ0 A;  3AAA C;  3TWX A;  3ZNG A;  3NBN B;  5AQ7 A;  1UOH A;  4BEP A;  5CEA A;  1YMP A;  3Q9U C;  1MX4 A;  1N0R A;  1SVX A;  1MX6 A;  5CED B;  1IXV A;  3HG0 D;  5AN8 A;  4F1P A;  4ZFH A;  2ETB A;  2NYJ A;  2DZO A;  3EHQ A;  3ZUV B;  1TR4 A;  3TWV A;  4K5C A;  3V31 A;  2FO1 E;  1IHB A;  4DRX E;  4BET A;  1K1A A;  5D66 A;  4J7W A;  3ZU7 B;  5KWD A;  2B0O E;  1BLX B;  5JA4 D;  2F8Y A;  4OAU C;  1K1B A;  4HNA D;  4K5A B;  5BXO A;  5EYL A;  1AWC B;  1G3N B;  2XZD G;  1OT8 A;  4J8Y A;  4HB5 A;  1K3Z D;  2ZGG A;  5JMN D;  3TWR A;  4CYM D;  3UXG A;  4Z68 A;  1MYO A;  4U8V D;  4OAV B;  4A63 B;  3B95 A;  3TWQ A;  4BES A; 
#chains in the Genus database with same CATH topology
 3SFZ A;  3EHN A;  1E7V A;  1O1T A;  1JCQ A;  3CKB A;  3UMV A;  3HXF A;  2VSX E;  3RIB A;  2XPI A;  3ASD A;  5KJM A;  4HBD A;  1VDY A;  3U4T A;  3ZKJ A;  4TUU A;  1ZBP A;  3ML9 A;  2AXV A;  3FTV A;  2RFA A;  3RU0 A;  4J0U A;  3DST A;  4XX5 A;  2VGX B;  3PZ1 A;  1WM5 A;  4FUL A;  5BV0 A;  4NRH B;  4GMR A;  3S7J A;  3MKR A;  4G24 A;  3CVX A;  4GPM A;  2AJA A;  2XEE A;  3APD A;  1W3B A;  1NA0 A;  4AP2 A;  1IYG A;  2FI7 A;  1D9S A;  3DBS A;  3DSS A;  4G26 A;  4J6I A;  3LEW A;  3E34 A;  4J8E A;  4B94 A;  4C48 B;  3FTS A;  4HQD A;  1HH8 A;  3QB2 A;  4GZC A;  3ZYM A;  3UKU G;  3Q73 A;  4BFR A;  5AIJ A;  4ME2 A;  4GMJ A;  3U3W A;  2UY1 A;  5EDS A;  3CVQ A;  3UM2 A;  4PS8 A;  1SA5 A;  3L82 A;  4YDE A;  4UI9 K;  2V8S E;  3HXC A;  5D66 A;  4BWR A;  4I2Z A;  3TGO A;  3FUH A;  3BUA A;  3Q79 A;  2ZIR A;  4I9E A;  3C3O A;  2B6C A;  3MKQ B;  2BF0 X;  3ZHE B;  3IHY A;  4DK5 A;  2LAI A;  4ZHB A;  4ANX A;  1XNF A;  4HI9 A;  4EZK A;  2JAB A;  3IEG A;  1TJF A;  1MQS A;  3WXX A;  4W9R A;  3B13 A;  3FH7 A;  5ENO D;  2VSO E;  1DCE A;  2XPY A;  4I9C A;  4DPR A;  3ZXS A;  2GRO B;  4J8S A;  4U63 A;  4AY6 A;  2KZT A;  3ZGQ A;  4N3A A;  3CHS A;  4N5Q A;  1Q2Z A;  2R02 A;  4GTR A;  5D2M C;  4PDX A;  5JHB A;  4HS2 A;  2YNQ A;  3FTW A;  1NI1 A;  3UIO C;  2Y0B G;  2QYJ A;  3DXM G;  3LS8 A;  5D0Q D;  2EQX A;  2X38 A;  2P9L G;  2ZIS A;  5AJD A;  1H6K A;  4EEC A;  3HRA A;  4FLH A;  3G2U A;  4K03 A;  3V30 A;  5CEC B;  3HYM B;  1OWL A;  3AAA C;  3ASN E;  1UOH A;  2KZT B;  1MX4 A;  4CCA A;  5H7P A;  3APC A;  2WPV A;  5JJT A;  3R7R A;  3RRN B;  3CHQ A;  5CCM A;  2QY7 A;  1K1B A;  4XEI G;  1UN8 A;  1O1S A;  2V5F A;  3B95 A;  2XS8 A;  4IUL A;  1BPO A;  4XI9 A;  3D9N A;  5BW8 C;  4CRW A;  2WQ6 A;  5FZR A;  3DWL G;  4YDO A;  4LRZ A;  1N4R A;  3UPV A;  4I43 A;  1SQM A;  2BUG A;  3CGH A;  4NQ0 A;  3NOC D;  3ULQ A;  3CIA A;  4UUC A;  1IQU A;  2ILR A;  5EKQ D;  2L6B A;  3LPZ A;  3TJP A;  1OY3 D;  2C2L A;  5EIL A;  4GTV A;  2KBX A;  4IYP A;  5M72 A;  1L5J A;  2Y69 E;  1RZ4 A;  4G25 A;  2GW1 A;  4LNG A;  3CKC A;  1Y8M A;  3T5V A;  1UJK A;  3ZXP A;  4HI8 A;  4YDW A;  5CER B;  1JCR A;  1N54 A;  3D9K A;  3FH5 A;  3BG0 B;  3CR3 A;  2WXQ A;  4WUY A;  3NF1 A;  2XGM A;  3HDX A;  3TG5 A;  3LY8 A;  1UJJ A;  4WWP A;  2BTD A;  2XGO A;  3JQ1 A;  4AM9 A;  3Q5M A;  2WMN A;  1Z3Y A;  1E8X A;  4LUN U;  3MJW A;  2LSV A;  3CQG B;  5IY5 E;  3I4R B;  3OXF A;  5G04 J;  4HNA D;  5BXO A;  1AWC B;  2I6H A;  1G3N B;  2CG3 A;  4JHK A;  4L2Y A;  1OCR E;  3LJ3 A;  3L22 A;  3ZW3 A;  2IO2 C;  1YA0 A;  4CDR A;  1PAQ A;  3BQO A;  4GZ3 A;  3ABM E;  1TNU A;  1DVP A;  5LP0 A;  4DUI A;  3SBT B;  5LOZ A;  1D8E A;  2XGS A;  4LG6 A;  5J08 A;  1N52 A;  2UWJ G;  2V0P A;  4QQI A;  3CVW A;  4MS6 A;  4CEM A;  4AVX A;  2WVI A;  3UIP C;  3FUN A;  4ILH B;  4HOU A;  2Y1L E;  2ZGD A;  1JUQ A;  4GYW A;  1TYQ G;  3PZ4 A;  2YQ8 A;  2IEJ A;  2P2C P;  3EU9 A;  3JCK C;  2ION A;  3QDN A;  3PE3 A;  3UT7 A;  3UM3 A;  1X81 A;  3CHR A;  3E30 A;  1OCC E;  4FHJ A;  1N4S A;  4A1G A;  1EYH A;  1E8W A;  3RK6 A;  2VYI A;  1K8K G;  1MJ0 A;  2LNI A;  1HZ4 A;  5FT9 A;  1H0A A;  4F7A A;  4UI9 C;  3Q7F A;  3HHM A;  1LF8 A;  2J07 A;  2H6I A;  3DXK G;  4J7W A;  2DIW A;  4UI9 J;  3ENE A;  4H7Y A;  4GCO A;  4L7T A;  3BEE A;  4KMO A;  4WWN A;  3SF4 A;  3FUE A;  3Q15 A;  3T5X A;  3HXE A;  3AG1 E;  3AS4 A;  4KVM A;  2AXU A;  3FTZ A;  1TN6 A;  2MOW A;  3TAX A;  4UQY A;  3PZD A;  4BSZ B;  4GTQ A;  5DBK A;  3FTU A;  4RQI A;  4YDY A;  5FZS A;  3QJZ A;  1HG5 A;  3E37 A;  4KZ0 A;  4ANV A;  3SY2 A;  4UWK A;  1FT2 A;  2H6F A;  5J90 A;  2QZA A;  3CHO A;  2P58 C;  2QC9 A;  4RSY A;  2WB2 A;  2HE0 A;  4GPK A;  3DEP A;  3CV0 A;  4JHJ A;  4LNB A;  2BKG A;  2HR2 A;  3Q75 A;  1ZU2 A;  5HRY A;  4A3V A;  4OYS A;  3QC1 A;  4N2Q A;  5ENS D;  2KAT A;  1YYH A;  4M7C A;  3NOG D;  4HRL A;  3J5Q B;  3TWU A;  1HXI A;  1EF1 C;  4TUM A;  4EPZ A;  4GTM A;  4LER A;  3TG4 A;  2WXG A;  2X6K A;  3JUE A;  4H7X A;  5BUZ A;  2Q7F A;  1OWO A;  4UQZ A;  3CHP A;  5ENN A;  1UG3 A;  3PZ3 A;  4MBG A;  4XI0 A;  1IHG A;  3D9P A;  2I1K A;  5CED B;  5FZQ A;  1IXV A;  2JLB A;  4JEH A;  3ML8 A;  4EQF A;  5HQ8 A;  3ZHE A;  3ASF A;  5JA4 D;  2WXM A;  4A55 A;  3AG4 E;  2P9S G;  2ZGG A;  3TWQ A;  3B7U X;  3Q7A A;  4I6G A;  4CDN A;  3CVN A;  2R59 A;  3OXG A;  3AG3 E;  3CK7 A;  4APF A;  2AXZ A;  1ELW A;  4U8H A;  3T8M A;  4GAA A;  3PDN A;  3JXI A;  3TWW A;  2FUL A;  3FUL A;  3QKY A;  1H2T C;  3PVL A;  2H6G A;  4FAD A;  1OCZ E;  3CLJ A;  3QWW A;  1IQR A;  4J8F A;  2X6H A;  3O4Z A;  3IBE A;  2P9P G;  3F6Q A;  1LD8 A;  2MHK A;  1BU9 A;  3AG2 E;  3SO8 A;  3Q9N C;  4KBQ A;  4RVB A;  2WXO A;  4NUR A;  4CGW A;  3MX3 A;  4RG6 A;  4XKC A;  3LYA A;  4JXT A;  3RKV A;  1FT1 A;  3FUM A;  4A3T A;  3DSV A;  5KJK A;  3ONL A;  3EIJ A;  3EDT B;  5FIN A;  5CHE E;  4AXH A;  4B89 A;  3UT4 A;  2OVF A;  2KCL A;  2CFU A;  4UWH A;  5KBA A;  1E8Y A;  3G2W A;  3LXU X;  5CEA A;  1SZ9 A;  2R03 A;  4F1P A;  3HXD A;  3NZS A;  3EHQ A;  2RG8 A;  3NB2 A;  4I1O B;  4K5C A;  3B7T A;  2WQ7 A;  4J8D A;  4BET A;  4UQX A;  3RRM B;  3B7S A;  4J8Y A;  4EZL A;  5JHA A;  3R7Q A;  4A63 B;  2E0I A;  3PH0 C;  5DIZ A;  3GW4 A;  3PUK A;  2Y3A A;  4IN3 B;  1AP7 A;  2XQ0 A;  1A5E A;  4HOR A;  4EHM A;  2A4Z A;  2EIJ E;  2I9C A;  5KJN A;  3EHR A;  4DI4 A;  3CHM A;  1FVF A;  4HRN A;  4APO A;  2WXL A;  5E75 A;  3V2X A;  1OWP A;  2V4H C;  5EID A;  2ZU6 B;  5AAO A;  2L0I A;  3CVU A;  3Q78 A;  4U0U A;  4TRQ A;  3FEX A;  3FHE A;  5EIB E;  4EBA G;  5ITZ F;  2R17 C;  4N3B A;  3T9K A;  3CVP A;  2CHW A;  3AU5 A;  1MX2 A;  3IHV A;  3L08 A;  3S7D A;  4GTS A;  3FUJ A;  5AQ9 A;  2DYR E;  5G55 A;  3QAQ A;  3IXE A;  3GYZ A;  3FU5 A;  3SNX A;  4E6H A;  4ILI A;  2XPZ A;  5HI7 A;  5FJY A;  2ETB A;  4ANW A;  3MV2 B;  3MV3 B;  3ZN3 A;  3NZU A;  3LVR E;  1MHQ A;  4R7L A;  1TNY A;  1BLX B;  2KC7 A;  2CFZ A;  5LCW J;  3PZ2 A;  5A6C A;  1S63 A;  3SD5 A;  4C0E A;  4GB9 A;  4L9P A;  3UI2 A;  4JZY A;  2CHZ A;  4BX9 A;  3UTM A;  2P9N G;  4YVO A;  4DX5 D;  1HO8 A;  5FIO A;  1V54 E;  4TXR A;  4ANU A;  4GTO A;  2VGY A;  5EX0 A;  4YVQ C;  2MYO A;  3L16 A;  3CK8 A;  2GRP B;  2EIL E;  1U3D A;  3ABL E;  2J8S D;  4AEZ C;  2UY1 B;  3LKU A;  2QYU A;  3SI5 A;  4X8Q A;  1OWN A;  1INZ A;  3D9L A;  4KT6 B;  4U04 A;  1N0Q A;  5ENT D;  3RO2 A;  4U95 D;  4KYO B;  1HS6 A;  2XEH A;  1WY6 A;  2R05 A;  3KEZ A;  4O1P A;  1IKN D;  1KT1 A;  1S64 A;  4F6R D;  3CST A;  2NC9 A;  4LEU A;  2LXM A;  3ZYK A;  4MLP A;  3TXM A;  3JXJ A;  5AAR A;  3L17 A;  3KEA A;  5CMY A;  2RD0 A;  4CZ2 D;  2ETC A;  2IOS A;  3DSW A;  3FP3 A;  4L1B A;  1YMP A;  4FU3 A;  1MX6 A;  2AW6 A;  4BT8 A;  1QZ2 A;  3VLD A;  3PNT B;  3RAU A;  1MZC A;  4G11 A;  3SQV A;  1TR4 A;  4DLO A;  3ESL A;  2BED A;  5BNW A;  4K5A B;  2HM8 A;  2IY0 C;  4A1S A;  3MKQ A;  3KSQ A;  4CYM D;  1MYO A;  4N2S A;  3C72 A;  3MZL B;  3ASG A;  5FQ4 A;  1S0P A;  1OXJ A;  3FUD A;  2L9B A;  1NA3 A;  5ARF A;  3ASO E;  1Z6T A;  4DX7 D;  1WG0 A;  4BT9 A;  4O1O A;  5ARG A;  2P9U G;  4DJA A;  4O60 A;  1GW6 A;  2GRQ B;  3QK0 A;  5A7D B;  5FQ7 A;  4KZC A;  1KLX A;  4ABN A;  1JPL A;  2J09 A;  1JWG A;  1ELK A;  5G2N A;  3U64 A;  4B93 B;  4O6F A;  3KS2 A;  2LAH A;  4M3O A;  3HIZ A;  5BPP A;  4AY5 A;  3KD7 A;  1HX8 A;  2VGX A;  4I6J A;  1YCS B;  4BSX A;  3ZNG A;  3NBN B;  4HOT A;  5AQ7 A;  4BEP A;  4GU5 A;  4TXP A;  2OND A;  3PUJ A;  4HXI A;  4G1T A;  1V55 E;  3QWP A;  4Y6C A;  4CT4 A;  2WXJ A;  3C3R A;  2B0O E;  3ULE G;  1E90 A;  3I5P A;  3FDH A;  5FQ6 A;  1N94 A;  3FU0 A;  4JPS A;  3WG7 E;  3EHM A;  4DX6 D;  3EIQ C;  5AYW D;  2GRL A;  3UKR G;  2R5S A;  3EUV A;  3C5R A;  2V4L A;  4RLY A;  3NQP A;  1P5Q A;  2ETA A;  3LY9 A;  3LCA A;  1BI8 B;  5C2Y A;  1WDY A;  4WNF A;  4G8K A;  1HE8 A;  2X6J A;  1OWM A;  3HVE B;  2VGE A;  3SFX A;  2XRZ A;  2OV8 A;  3OXL A;  4WNG A;  2I1J A;  4Q94 A;  2H6H A;  2WM9 A;  2KM4 A;  1KZP A;  4XIF A;  2WXP A;  2ZXW E;  4F1S A;  4MKT A;  1Z3X A;  1D8D A;  2E2E A;  2VTB B;  3PNL B;  3QAR A;  1H2U A;  2F8X K;  5FQ8 A;  4UWG A;  5KCM A;  5FTP A;  4JEU A;  1A17 A;  2BKK B;  3B7R L;  3FUI A;  2KCV A;  3TWX A;  3MA5 A;  5AJL A;  3D9M A;  4GTT A;  4GA2 A;  5T4Y A;  4GML A;  4I17 A;  3O48 A;  5JJ7 A;  4UWL A;  2FO1 E;  1IHB A;  3ZFW A;  4CT0 A;  4KXK B;  4ACL A;  4WWO A;  3L9T A;  4B8A A;  5AQA A;  3UQ3 A;  1LTX A;  3VLF A;  3IKO B;  3EJN A;  4FJZ A;  2FEZ A;  3FTX A;  2J4B A;  3I3N A;  1BI7 B;  4I1A A;  3B7B A;  4BY6 A;  1SW6 A;  3SHF A;  2DYS E;  5ENR D;  3Q49 B;  3I4G A;  2XEN A;  1TNZ A;  1U2V G;  3QNK A;  1OCO E;  2DWZ A;  2RFM A;  2J4D A;  1H6P A;  1NL4 A;  4GZ5 A;  3D9H A;  2XHE A;  2XEV A;  4YND A;  3AS5 A;  1LD7 A;  4NIK A;  4U0Z A;  4XKB A;  2IQC A;  3RRU A;  4HOS A;  2NSZ A;  5E76 A;  4FLB A;  2GRM A;  3PRE A;  2YHC A;  3W9G A;  5LX8 A;  4BTA A;  4KVO A;  5CBN A;  4L2L A;  4E85 A;  3GZ1 A;  3ISM C;  1N9A A;  2WQH A;  5KNH D;  1N4Q A;  1WAO 1;  3RSE G;  2WXF A;  3SZ7 A;  5BV1 A;  3SFY A;  3ULY A;  4N5C A;  3ZRH A;  3ZUV B;  3ONK A;  5G04 C;  3TWV A;  3UM1 A;  5KWD A;  2XRY A;  3PEU B;  3R9M A;  2X6F A;  4TXQ A;  2WXR A;  5BT1 A;  1SA4 A;  5JMN D;  3NAW A;  1TNO A;  4U8V D;  4OAV B;  1QNF A;  1H2V C;  3LY7 A;  4FC8 A;  2EIK E;  4HLL A;  3BG1 B;  5C1D A;  2AVP A;  4HRM B;  1HG2 A;  3DPD A;  4HLE A;  1NZN A;  3TWT A;  1QYM A;  4PS7 A;  4GZ6 A;  3ZYQ A;  3D9J A;  2DVW A;  2HO1 A;  4K0R A;  1ELR A;  3UX4 A;  2VJ8 A;  1X5B A;  2P9I G;  3G2V A;  4AV7 A;  3Q4A B;  3AJI A;  3LJN A;  1PY1 A;  3FUK A;  4JB8 P;  2M63 A;  3T8K A;  4G2V A;  3PEV B;  3QOU A;  4GA1 A;  3HVE A;  4Q96 A;  3W9F A;  3VTX A;  3TWS A;  4DX1 A;  5B1A E;  4DLQ A;  4F53 A;  3C3Q A;  3CK9 A;  3TXN A;  3U9W A;  4U0S A;  4JD2 G;  4OAU C;  4FHK A;  1DNP A;  3U66 A;  3FH8 A;  3LVQ E;  5CBO A;  3GZS A;  2PZI A;  5HKP A;  2WXI A;  1EPU A;  4JA7 A;  4U96 D;  2FO7 A;  3S7B A;  2IOL A;  5CRV A;  3D3M A;  5LFA A;  4ACK A;  1RW2 A;  4OVU A;  4BER A;  2YHE A;  3C98 A;  4BTB A;  3VLE A;  4JHR A;  3JYS A;  4G8L A;  1HU3 A;  1TN7 A;  3TL5 A;  4I2W A;  5ENQ D;  4I1M A;  3UT8 A;  2OEW A;  2VQ2 A;  5A23 A;  5B3S E;  2CHX A;  5KJL A;  4MRU A;  4URK A;  4TV3 A;  3PRZ A;  3K9I A;  4WND A;  4EZJ A;  1UN9 A;  1H19 A;  5KNG A;  4PH4 B;  3MCX A;  4HOQ A;  1Z5S C;  4LSZ E;  3ZIM A;  5FWQ A;  2KXP C;  3E33 A;  3CVV A;  1O5M A;  1N95 A;  4C0M A;  2DZN A;  3MYV A;  3P2B A;  1FCH A;  1TJC A;  4HFG A;  4NAC A;  2HYZ A;  2J49 A;  2YIN A;  2IF4 A;  2IU1 A;  4L23 A;  2XCC A;  2R2L A;  3AU4 A;  2OCC E;  3FFL A;  3CSF A;  1KZO A;  5AN8 A;  4U07 A;  2NYJ A;  2LO6 A;  2OEV A;  4GTP A;  3V31 A;  1PC2 A;  2C0L A;  3Q47 B;  2EIM E;  2F8Y A;  3ABK E;  4ILG A;  5EYL A;  2LXL A;  2XS1 A;  2F0Y A;  2C0M A;  2EIN E;  2QFC A;  4HB5 A;  3TWR A;  1FPP A;  3UXG A;  3RO3 A;  3ZVV A;  4BES A;  5ANR A;  1S70 B;  4IRU A;  5CCL A;  4PUC A;  3V79 K;  5AQB A;  4Q69 A;  4DX2 A;  3AS8 A;  2CG2 A;  1KT0 A;  3FTY A;  1QQE A;  3EU5 A;  4V3I A;  1Y6I A;  4B0Z A;  3FU6 A;  3OAW A;  2A5U A;  1N4P A;  3IV0 A;  4EBA A;  4FJY A;  1SZA A;  3ESK A;  3DRA A;  2GGF A;  3APF A;  4GCN A;  2I2O A;  1UW4 B;  4QFV A;  3OTN A;  4JA9 A;  4U7E B;  2PL2 A;  1O1R A;  5CRU A;  5T8I A;  4XZ4 A;  4P29 A;  3E4B A;  2XZT G;  1TN8 A;  1H6O A;  4FP7 A;  2Y4U A;  4D10 C;  3P1U A;  3JUI A;  1N0R A;  1HFA A;  3CVL A;  3FUF A;  1FVH A;  4Y6W A;  1SVX A;  5AEN A;  4AJW A;  5B1B E;  3UIN C;  4DRX E;  4I6E A;  4GA0 A;  2LSU A;  1K3Z D;  3CQC B;  2P9K G;  3PE4 A;  3L13 A;  4HVB A;  4LNU D;  5EX3 A;  2GRR B;  3D9I A;  1NFI E;  3PS6 A;  3ZEF A;  1BD8 A;  4N3C A;  1DC2 A;  2RKK A;  1DCQ A;  2GRN B;  4AIF A;  1TNB A;  4UWF A;  5LCW C;  4ATZ D;  2IJG X;  2WXK A;  2MRI A;  3JQ0 A;  3DEO A;  5BXU A;  3HXB A;  3GZ2 A;  5G05 C;  5CMW A;  2V5Q C;  2KCK A;  2PM7 A;  3E32 A;  3N71 A;  2VTB A;  1HF8 A;  3S7F A;  4JL0 A;  2J08 A;  2FF4 A;  3UM0 A;  2JEK A;  3VTY A;  4G23 A;  3URZ A;  3DSX A;  1ZB1 A;  2VSN A;  2IFU A;  2FBN A;  4GYY A;  1XGW A;  2PNN A;  2PQN A;  5ANL A;  2VSY A;  3V2O A;  1TEZ A;  1NP7 A;  2WXN A;  3CEQ A;  2IO3 C;  1KPS B;  3DSU A;  1E7U A;  3G2S A;  3FEY A;  3FY4 A;  5JJ6 A;  5G05 J;  1K1A A;  3ZU7 B;  4ATG A;  1QBQ A;  4JC8 A;  3BU8 A;  4B8C B;  3S2A A;  4Z68 A;  3D9O A;  3RJV A;  5D0O D;  2AWI A;  3SGH A;  1B89 A;  3CVY A;  4GZD A;  5T3R A;  3ZYL A;  4DI3 A;  1EDU A;  4WNE A;  2OOE A;  4WAF A;  4AOF A;  3UUX A;  3FU3 A;  4BX8 A;  3L6A A;  2XCB A;  2J9Q A;  5EYP F;  4K5B A;  1U3C A;  5EN5 D;  4XE0 A;  4CDM A;  4U8Y D;  2F37 A;  1JCS A;  3J5P A;  5ENP D;  2PM6 A;  1N11 A;  2A5E A;  2X3M A;  5HS0 A;  3SBS A;  3MEK A;  4FA6 A;  3ZPJ A;  3L54 A;  3X2Q E;  3KSL A;  4JW1 A;  4F3V A;  2Y4T A;  3DPY A;  3G2T A;  3FWV A;  2LUH A;  3R9A B;  2X6I A;  4PS3 A;  2L0T B;  4CGV A;  3Q9U C;  4GYO A;  4N39 A;  3HG0 D;  1E96 B;  2L6J A;  3ASH A;  4LCT A;  4ZFH A;  1E8Z A;  2DZO A;  3MGB A;  4OVV A;  2NXP A;  4JVS A;  1OUV A;  4C9B B;  3KAE A;  2DCP A;  2XZD G;  4RG9 A;  1OT8 A;  2WXH A;  2OVB A;  2WMO A;  2DBA A;  1JWF A;  3QWV A;  2PQR A;  3LDZ A; 
#chains in the Genus database with same CATH homology
 4LNU D;  5AQA A;  3UI2 A;  5HKP A;  1S70 B;  4U96 D;  4DX6 D;  1NFI E;  1AP7 A;  4ZHB A;  3UTM A;  4HI9 A;  3V79 K;  2JAB A;  5AQB A;  4BSZ B;  1A5E A;  3C5R A;  1BI7 B;  1BD8 A;  4HLL A;  5FIO A;  4DX5 D;  4DX2 A;  4HBD A;  3EHR A;  4BER A;  4DUI A;  5ENO D;  4YDY A;  3ZKJ A;  1DC2 A;  3B7B A;  4RLY A;  2MYO A;  3JXI A;  4HRN A;  3TWW A;  3NOC D;  1DCQ A;  1SW6 A;  2RFA A;  4G8L A;  4HRM B;  2J8S D;  2ETA A;  4LG6 A;  5ENR D;  3V2X A;  4UUC A;  5EYP F;  1BI8 B;  4QQI A;  4K5B A;  2V4H C;  5EN5 D;  4ATZ D;  5EID A;  1WDY A;  2L6B A;  2XEN A;  4G8K A;  4DX7 D;  5AAO A;  5ENQ D;  1OY3 D;  4U8Y D;  1WG0 A;  5EIL A;  3TWT A;  1QYM A;  2F37 A;  2DWZ A;  2KBX A;  1N0Q A;  2QC9 A;  5ENT D;  2RFM A;  3F6Q A;  4GMR A;  5CBO A;  2VGE A;  3DEO A;  2DVW A;  2HE0 A;  4O1O A;  3J5P A;  4U95 D;  3DEP A;  5BXU A;  5ENP D;  4GPM A;  2AJA A;  2XEH A;  2BKG A;  2XEE A;  1BU9 A;  2Y1L E;  4N5Q A;  2ZGD A;  4O60 A;  5EIB E;  4O1P A;  1N11 A;  2V5Q C;  5ITZ F;  3SO8 A;  3D9H A;  3Q9N C;  5HRY A;  1IKN D;  2A5E A;  2P2C P;  3EU9 A;  5HS0 A;  4F6R D;  5KNG A;  4NIK A;  3T9K A;  4QFV A;  3AJI A;  1D9S A;  4LSZ E;  3LJN A;  2Y0B G;  2QYJ A;  1MX2 A;  4HI8 A;  4YDW A;  5ENS D;  2KXP C;  4JB8 P;  5CER B;  1YYH A;  3W9G A;  4B93 B;  3T8K A;  2F8X K;  3JXJ A;  5CBN A;  4C48 B;  4HQD A;  2DZN A;  3NOG D;  4HRL A;  3J5Q B;  5AQ9 A;  5AAR A;  3TWU A;  5FIN A;  2XZT G;  3KEA A;  3HRA A;  3W9F A;  3IXE A;  4TUM A;  3TWS A;  4CZ2 D;  2PNN A;  5KNH D;  3V30 A;  2ETC A;  3JUE A;  2BKK B;  5KBA A;  4DX1 A;  1YCS B;  5CEC B;  3V2O A;  1MJ0 A;  3AAA C;  3TWX A;  3ZNG A;  3NBN B;  5AQ7 A;  1UOH A;  4BEP A;  5CEA A;  1YMP A;  3Q9U C;  1MX4 A;  1N0R A;  1SVX A;  1MX6 A;  5CED B;  1IXV A;  3HG0 D;  5AN8 A;  4F1P A;  4ZFH A;  2ETB A;  2NYJ A;  2DZO A;  3EHQ A;  3ZUV B;  1TR4 A;  3TWV A;  4K5C A;  3V31 A;  2FO1 E;  1IHB A;  4DRX E;  4BET A;  1K1A A;  5D66 A;  4J7W A;  3ZU7 B;  5KWD A;  2B0O E;  1BLX B;  5JA4 D;  2F8Y A;  4OAU C;  1K1B A;  4HNA D;  4K5A B;  5BXO A;  5EYL A;  1AWC B;  1G3N B;  2XZD G;  1OT8 A;  4J8Y A;  4HB5 A;  1K3Z D;  2ZGG A;  5JMN D;  3TWR A;  4CYM D;  3UXG A;  4Z68 A;  1MYO A;  4U8V D;  4OAV B;  4A63 B;  3B95 A;  3TWQ A;  4BES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...