1KPSB

Structural basis for e2-mediated sumo conjugation revealed by a complex between ubiquitin conjugating enzyme ubc9 and rangap1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
TDLSTFLSFPSPEKLLRLGPKVSVLIVQQTDTSDPEKVVSAFLKVASVFRDDASVKTAVLDAIDALMKKAFSCSSFNSNTFLTRLLIHMGLLKSEDKIKAIPSLHGPLMVLNHVVRQDYFPKALAPLLLAFVTKPNGALETCSFARHNLLQTLYNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/protein transport
molecule keywords Ubiquitin-like protein SUMO-1 conjugating enzyme
publication title Structural basis for E2-mediated SUMO conjugation revealed by a complex between ubiquitin-conjugating enzyme Ubc9 and RanGAP1.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 156
sequence length 156
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 1kpsB00
2IY0C 2GRNB 2GROB 2GRQB 3UIPC 3UINC 2IO3C 2GRPB 1Z5SC 1KPSB 2GRRB 3UIOC 5D2MC 2IO2C
chains in the Genus database with same CATH superfamily
2CG3A 5BW8C 3AG3E 4K0RA 3D9OA 3ZVVA 4MRUA 4BSXA 5KJLA 1GW6A 3CVNA 4PS8A 2WXRA 2UWJG 3SFYA 2X38A 3ZRHA 4DUIA 3C3QA 1X81A 4BX8A 2BUGA 5JHBA 3I3NA 2I1KA 2E0IA 3SFZA 2X6HA 3UMVA 1JWFA 5CCMA 2X6IA 4RQIA 2A5UA 4LG6A 4GB9A 5BXOA 4DRXE 4PS3A 2WB2A 5HI7A 3V2OA 1G3NB 1WAO1 4M7CA 2BTDA 1A5EA 4GA2A 4CEMA 3ML9A 2JABA 3NAWA 4WWPA 3RO2A 1K3ZD 4TXRA 3MJWA 3Q7FA 4AIFA 3DXMG 4U96D 5ANRA 4I6EA 4LCTA 4UQYA 5BV0A 3FP3A 2H6GA 1TNUA 4OYSA 2UY1B 5BV1A 2B6CA 4F3VA 1RW2A 1ELWA 1MX6A 2RFAA 3ZUVB 5CERB 3NF1A 1IYGA 2MOWA 2I6HA 2R2LA 4Q96A 3UTMA 2RD0A 2I2OA 4KVOA 3B7RL 3MGBA 3GW4A 2L6JA 4G25A 5JJTA 3AG1E 5FZQA 4R7LA 1EDUA 5ENOD 4G26A 4MBGA 2IJGX 2KC7A 5AAOA 5HKPA 3TG4A 4QQIA 3CHPA 3CKCA 2AXUA 1BPOA 2CHZA 4HQDA 3S7BA 2HR2A 5CECB 3APFA 1N4RA 4CCAA 2L6BA 3N71A 2VQ2A 3FU6A 3GZ1A 4J8YA 4G1TA 3D9HA 5DBKA 4NQ0A 2P2CP 2QZAA 4DLQA 3LVRE 1HXIA 3UINC 3I4RB 2FO1E 3TWTA 3RU0A 4CDRA 1SQMA 4JXTA 4XKCA 4D10C 2LAHA 3TGOA 2H6HA 2J49A 3RK6A 4JD2G 3ZYMA 4N39A 1TNBA 2R59A 4K5CA 1H19A 4XI0A 1YYHA 3IHYA 1ZU2A 1WDYA 4FU3A 4WNGA 5B3SE 4IULA 3AU5A 3PUJA 4RG9A 3E30A 3EHNA 2Y69E 3Q79A 3TWVA 1HF8A 2FULA 3BEEA 1QNFA 2EQXA 3LKUA 3PZDA 3T8MA 5EN5D 3JXJA 2MRIA 3V30A 1O5MA 3O4ZA 2VYIA 3BQOA 3U66A 4EQFA 3R7RA 4YDYA 3TXMA 4ACLA 4UWFA 2Y3AA 2RFMA 1E96B 3B95A 2ETAA 3Q78A 1HX8A 1D8EA 3FY4A 3ESLA 3S7FA 4J0UA 3W9FA 1FVFA 5AQ9A 3FEXA 2OEWA 2Y1LE 3EU5A 4APFA 4HLLA 3P1UA 3PNTB 5KNHD 4J7WA 5JJ7A 1OCOE 4FLBA 3SQVA 5ITZF 2VJ8A 5LCWJ 3CQGB 3G2TA 4U7EB 2X6FA 3P2BA 3UT8A 5D66A 2P9SG 2XPZA 1N0QA 3CHSA 2XEEA 3T8KA 2LAIA 2NXPA 5JMND 1YCSB 3TWQA 4G23A 1H2TC 2WQ7A 4UI9J 3TWUA 4N2QA 3R7QA 5G55A 2IF4A 1ELKA 3Q49B 2XZTG 3C72A 3ISMC 4FA6A 2YHEA 2CFUA 1TR4A 4GYYA 2IQCA 5AYWD 2YINA 3EUVA 5CMWA 3MCXA 2DZNA 3EHMA 3SD5A 1WM5A 1LTXA 1H0AA 1S0PA 3ASOE 4H7YA 3UX4A 5EX0A 3DWLG 1RZ4A 4K03A 5ANLA 1N95A 1ZB1A 4GZCA 1MX4A 2F8YA 3T5XA 2DVWA 5EIBE 4L23A 3EHQA 5JJ6A 3UM2A 4UI9K 1DNPA 4G24A 3DXKG 3AU4A 2NC9A 4U8YD 1S64A 3K9IA 2KCVA 3PZ4A 3FUNA 3VTYA 2GRPB 2ZGGA 4FHJA 4HBDA 5E76A 2XQ0A 4A1SA 4A1GA 5AARA 4OAUC 3CIAA 1IHGA 3QNKA 3TWSA 2X6KA 3FTSA 3PRZA 3IHVA 1DC2A 4A3TA 3CVWA 1YA0A 1TJFA 4Z68A 2L0IA 4ACKA 4ZHBA 1BI7B 3BG1B 3TWRA 1QBQA 1YMPA 2FEZA 4DLOA 2KBXA 4GCOA 1DVPA 2DBAA 4LNGA 4N2SA 4TV3A 2IU1A 4H7XA 1E8XA 3CQCB 4C48B 2CHXA 2XS8A 4K5AB 1V54E 2IEJA 2V5FA 2CG2A 4GA1A 2J9QA 2XEHA 4TXQA 3CHOA 3MKQA 5G2NA 1MHQA 2KM4A 2WMNA 3KEZA 1UJJA 3DRAA 3PNLB 4LUNU 2Y4UA 3APDA 2R02A 3T5VA 3QKYA 3FFLA 1O1TA 1TN6A 2UY1A 3PE4A 4BESA 3HXEA 4CZ2D 3URZA 3KS2A 4PS7A 5AJDA 5FIOA 3PDNA 5KJKA 2ZISA 3EU9A 4IRUA 4GTQA 1NA0A 4EECA 3U9WA 2ZGDA 4AV7A 4GPMA 1E8ZA 3D9IA 4JEHA 3NZUA 2WXFA 2GROB 2NSZA 3QOUA 4FULA 1BD8A 5G05J 4OAVB 3CVLA 3PZ3A 3CHMA 1EF1C 3ZNGA 2QC9A 3JCKC 4G2VA 1NI1A 4ME2A 4C9BB 3ABLE 4AM9A 4N5QA 4KBQA 3JYSA 3D9PA 4TUMA 1N4SA 3GZSA 5KJNA 1U3CA 5H7PA 4B93B 2MYOA 2EIKE 3RO3A 3FUMA 4HXIA 2F0YA 4YDWA 1P5QA 1UN8A 3D9JA 4B94A 4E6HA 4GTPA 5FINA 3CLJA 4I43A 3KD7A 3Q5MA 2P9LG 3FUHA 4GMRA 4ANXA 3UKUG 5HS0A 1KZPA 3FUKA 2GW1A 3TXNA 4ATGA 3AS8A 4BT8A 4ANWA 2YHCA 3DPDA 1SW6A 4FJZA 1QQEA 4HI8A 4ZFHA 3FUJA 5ARFA 3C3RA 3CHRA 3ZKJA 3J5PA 3IV0A 4GTRA 5CHEE 4X8QA 3S7DA 4N5CA 5KNGA 3TL5A 3E37A 4DX7D 5A7DB 1IHBA 2WXIA 4UWLA 4HRLA 2LSVA 4O60A 5AIJA 2WQHA 4O1PA 5BXUA 4TXPA 3AG2E 3PE3A 1N0RA 3HVEB 4Y6WA 2P58C 4XX5A 5DIZA 4L2YA 4GMJA 2Q7FA 1N4PA 1SZ9A 5LCWC 3MKRA 3MX3A 4LNBA 3B13A 4EHMA 4GTOA 4XI9A 1PY1A 3E4BA 2ZU6B 3U4TA 2H6FA 1H2UA 4NRHB 5D0OD 1U2VG 2PZIA 3PREA 4U63A 2KZTA 3F6QA 1V55E 2AWIA 3FTZA 4UI9C 1K1BA 3GYZA 2KATA 1E8WA 3ENEA 2GGFA 3I5PA 3QB2A 3EIQC 4JHKA 4AEZC 4OVUA 1H6KA 2FBNA 2QY7A 3RAUA 3W9GA 2OVFA 1Y6IA 2VGEA 4DX6D 3V31A 5FQ8A 2IONA 3IXEA 3CVUA 4U0UA 4O1OA 1E8YA 3G2WA 1TEZA 1HFAA 4XKBA 1QZ2A 4YNDA 3PVLA 4I9CA 3DSUA 4LEUA 4YDOA 1TYQG 3Q9NC 2J8SD 4AXHA 3EDTB 3ZFWA 5BPPA 4MS6A 3ZHEB 3CSTA 4UWGA 3U3WA 5AENA 1IQUA 2KCKA 1D9SA 3DBSA 3CV0A 3D9LA 4CT4A 3FUEA 1S63A 4V3IA 3MV2B 4YVOA 1N9AA 2IOLA 3UIPC 5T3RA 1OWMA 1FVHA 3TJPA 4RLYA 2GRRB 4EZKA 4OVVA 5E75A 3DSSA 4AVXA 4ABNA 1OCCE 4K5BA 4KVMA 3HXDA 4UUCA 2RG8A 3WG7E 4DK5A 1O1SA 5EYLA 4NACA 4LRZA 4HNAD 2VSYA 4HOTA 5CCLA 2OOEA 4XZ4A 3CVXA 2X3MA 2PM7A 3OAWA 2Y4TA 5IY5E 4PUCA 4WNDA 4BEPA 3L54A 2WM9A 3NOCD 2VSNA 2XRZA 4I17A 1VDYA 4UWKA 2YQ8A 2V0PA 1TNYA 2AXVA 3R9AB 4FC8A 4CGWA 1SVXA 3UM3A 3BG0B 5CEAA 3E33A 1S70B 3UM1A 1OUVA 3L6AA 4GZ3A 4LNUD 1DCEA 4GYOA 3HXCA 1IQRA 3ASNE 2P9KG 1Q2ZA 5C2YA 3ASFA 2CHWA 2WXNA 4J8SA 2J4BA 1IKND 4HVBA 4GZ5A 3KSLA 4KMOA 1H2VC 3CVPA 3JXIA 4U95D 3FWVA 2P9UG 5EILA 4KT6B 3IKOB 4BX9A 4NURA 5G05C 2H6IA 4HI9A 4JA7A 4UQXA 3ABKE 5KBAA 3V2XA 2VTBB 4LSZE 4N3BA 2WXHA 3LEWA 2QYUA 3LY9A 3SBSA 1X5BA 4MLPA 4B8AA 4Y6CA 4BFRA 5ENQD 3AG4E 2J08A 3FUFA 3RKVA 5FT9A 1TN8A 2PNNA 3X2QE 4BSZB 3FH7A 5FTPA 4GTSA 2XEVA 4I9EA 4W9RA 3FH8A 1AWCB 2L9BA 2P9NG 4WAFA 4M3OA 3RJVA 2V4LA 1OWLA 2BKKB 2AW6A 3TWXA 3UT4A 4KXKB 2VGXA 4I1OB 2LSUA 2ZXWE 3UUXA 2GRQB 4G8LA 2FI7A 2VSOE 3NBNB 1TNOA 3DPYA 4JVSA 4ANUA 5ENTD 2WXKA 5J08A 3TAXA 1JCRA 4BTAA 2L0TB 3B7TA 1A17A 1JCQA 3KAEA 2AJAA 5M72A 2XGOA 2OVBA 1Z3XA 2C0MA 5A23A 1MZCA 5CBNA 3I4GA 2DZOA 4I6JA 5EKQD 3SFXA 2B0OE 3FUIA 4HORA 4JB8P 5CBOA 4IN3B 4ILIA 3GZ2A 4BY6A 3L08A 2VSXE 3UQ3A 1ELRA 3FU0A 2FO7A 4PH4B 4L1BA 3QWWA 2JEKA 4I2WA 3PEVB 2BKGA 2IOSA 5B1BE 3QARA 5ENNA 4U04A 1FPPA 5EIDA 5AJLA 5KJMA 4KZ0A 3CVYA 3QK0A 3CK7A 4L7TA 3ULQA 5CEDB 4B0ZA 4J8DA 2X6JA 3T9KA 4EZJA 1NL4A 2BF0X 1OCZE 1XGWA 3L9TA 4TUUA 3HIZA 4GYWA 4GAAA 1OWNA 2E2EA 4DI3A 3ASHA 5JA4D 4HOQA 3UXGA 5ENSD 3ASGA 3FTYA 3HRAA 3Q47B 3QJZA 3S7JA 5FZSA 4BERA 1SA5A 5D2MC 3FU5A 3HXBA 1K8KG 1JUQA 3ESKA 3KSQA 3OXFA 2IY0C 4FJYA 1TNZA 3NQPA 3MYVA 4RSYA 3JQ1A 2XPYA 3JUIA 4A63B 4CRWA 4U07A 1XNFA 4N3CA 2WXPA 4GCNA 3EJNA 5CMYA 1N4QA 2KXPC 2LXMA 1DCQA 4WUYA 4QFVA 3PS6A 3SZ7A 4PDXA 3ZHEA 1HU3A 1Z6TA 2WXOA 4A55A 3OTNA 4U8HA 2YNQA 1H6PA 4XE0A 4XEIG 3FTUA 5BNWA 5AQBA 4DX5D 1L5JA 3PH0C 1H6OA 2F8XK 3UPVA 4FADA 4I1AA 4AP2A 5AQ7A 3NB2A 3Q75A 3QWPA 1PC2A 5EYPF 3B7BA 4NIKA 3QAQA 4BETA 2R03A 3L16A 3B7UX 2XGSA 3PZ2A 3FDHA 3B7SA 3NOGD 3L82A 3C98A 4P29A 3L17A 1KLXA 4L2LA 3LY7A 3ULEG 3KEAA 4RVBA 3ZYLA 1SZAA 4AY5A 1MJ0A 5FQ6A 2J4DA 2OV8A 5T8IA 3JQ0A 3L22A 3MV3B 5ENRD 3C5RA 3ASDA 1OT8A 5CRVA 3ZXSA 3VLDA 2LO6A 2XCCA 3MKQB 3D9MA 3E32A 3Q9UC 5FQ7A 4Q94A 3ZXPA 3S2AA 3OXGA 3EHRA 3D9KA 3LYAA 4HB5A 3ZYQA 1KT1A 1JPLA 2WXJA 1Z5SC 3MEKA 4AY6A 3CR3A 3LDZA 2DWZA 1EYHA 1ZBPA 4JA9A 3SGHA 4DJAA 3J5QB 1JCSA 1KPSB 4B89A 1E90A 4GTTA 3MZLB 2HM8A 3FU3A 1FT2A 4F1PA 4YDEA 2EIME 5LX8A 4CGVA 2M63A 1OY3D 2R05A 2GRMA 1OWOA 1LD8A 3BU8A 4DX2A 5G04J 3DSWA 4CDNA 3V79K 3FTXA 2WXQA 4WWOA 2LNIA 3SNXA 4EBAG 4JL0A 4IYPA 3QDNA 1NZNA 4AJWA 3CEQA 5BUZA 2VTBA 3HXFA 4GTVA 1HZ4A 3RRMB 4CYMD 3Q4AB 2PM6A 2A4ZA 4UWHA 4GZDA 2XS1A 2J07A 4I1MA 2ONDA 3HG0D 1U3DA 4XIFA 5A6CA 2EILE 4E85A 1FT1A 1HE8A 2J09A 1Z3YA 4GMLA 2PL2A 3QWVA 3ONKA 4I2ZA 5ENPD 4ATZD 3RIBA 5FJYA 3DSTA 3QC1A 3MA5A 1W3BA 3ONLA 2ILRA 3RSEG 3O48A 4KZCA 4HOSA 2OCCE 2R17C 4U0ZA 1SA4A 1EPUA 4YVQC 3WXXA 3D3MA 4RG6A 5AQAA 2FF4A 1N54A 3FTWA 3LCAA 4WWNA 4A3VA 4DX1A 4DPRA 1NP7A 4U8VD 1BLXB 4C0EA 4JHRA 4GTMA 3ZEFA 3IEGA 3G2UA 4AOFA 1MX2A 2HE0A 2BEDA 4G8KA 3Q7AA 4URKA 1HS6A 5FZRA 2C0LA 4TRQA 2ETCA 1B89A 4EBAA 1BI8B 3FEYA 3SO8A 3UKRG 1N52A 4HFGA 4BTBA 3ZPJA 4HOUA 1MYOA 3HHMA 4JHJA 5LFAA 4J8FA 2ETBA 3HYMB 3E34A 4GPKA 2PQNA 3CGHA 3SBTB 1E7VA 4L9PA 1WY6A 2MHKA 3LJ3A 1HG5A 4ILHB 4FP7A 1LF8A 2DYRE 3JUEA 1UJKA 2AXZA 1UOHA 2HYZA 4N3AA 3SI5A 4WNEA 2WXGA 1JWGA 2QFCA 1WG0A 2KZTB 4C0MA 4F1SA 4FHKA 2JLBA 1N94A 2RKKA 4ILGA 3U64A 1TJCA 1LD7A 3APCA 3ZYKA 2A5EA 1BU9A 4O6FA 3AAAC 2EINE 4G11A 3LS8A 4DI4A 2P9IG 1IXVA 4JPSA 3CK9A 2V4HC 1HO8A 2I1JA 2XPIA 3G2VA 2C2LA 5LOZA 5LP0A 3R9MA 4WNFA 4I6GA 1PAQA 3UT7A 1OWPA 2IO3C 3ZIMA 4HLEA 3C3OA 2V5QC 5D0QD 1NA3A 3D9NA 3DEPA 3Q73A 1D8DA 3VLEA 3AS5A 3CHQA 3ML8A 1O1RA 2Y0BG 2VGYA 3NZSA 3SF4A 3G2SA 3UI2A 3PEUB 4GZ6A 4F6RD 2XCBA 3LVQE 4CDMA 5CRUA 5J90A 2QYJA 4J6IA 4FLHA 3LXUX 2NYJA 4F53A 1QYMA 4EPZA 1HG2A 2DCPA 4J8EA 3VLFA 3TG5A 1Y8MA 3CSFA 4JW1A 2WPVA 1INZA 3CKBA 4HRNA 5KWDA 2WXLA 3ZU7B 2XRYA 2OEVA 4JC8A 3UIOC 1KT0A 5FQ4A 3VTXA 1MQSA 5B1AE 5FWQA 1OXJA 3AJIA 3BUAA 5JHAA 4CT0A 1TN7A 2V8SE 1OCRE 4B8CB 2EIJE 2XZDG 4F7AA 4KYOB 3CK8A 2LUHA 3PUKA 3ABME 5BT1A 2LXLA 3FULA 3UM0A 2XHEA 3TWWA 2DIWA 3HVEA 5AN8A 2F37A 4HRMB 3ZW3A 3FTVA 3FH5A 3ZGQA 3LPZA 1AP7A 2GRNB 4APOA 3ZN3A 2AVPA 3ULYA 5T4YA 1N11A 2CFZA 2WVIA 2I9CA 4MKTA 5HQ8A 2P9PG 3LY8A 1KZOA 3CVVA 1NFIE 1UW4B 2WQ6A 3IBEA 2WXMA 3EIJA 3Q15A 1E7UA 1FCHA 5KCMA 1HH8A 5EDSA 5G04C 3DEOA 4JEUA 1UG3A 2KCLA 2XGMA 4JZYA 4GU5A 4ANVA 4EZLA 3CVQA 5EX3A 5HRYA 2R5SA 3RRNB 4U0SA 4BT9A 2DYSE 1K1AA 2XENA 4UQZA 2WMOA 3SY2A 4LERA 3PZ1A 3FHEA 5C1DA 2GRLA 1UN9A 4GA0A 3AS4A 3DSVA 3L13A 4BWRA 5ARGA 2PQRA 2HO1A 3FUDA 2IO2C 3DSXA 4HS2A 2ZIRA 3SHFA 3OXLA 2VGXB 3HDXA 3RRUA 4Q69A 2IFUA 3LJNA
chains in the Genus database with same CATH topology
2IY0C 2GRNB 2GROB 2GRQB 3UIPC 3UINC 2IO3C 2GRPB 1Z5SC 1KPSB 2GRRB 3UIOC 5D2MC 2IO2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IY0 C;  2GRN B;  2GRO B;  2GRQ B;  3UIP C;  3UIN C;  2IO3 C;  2GRP B;  1Z5S C;  1KPS B;  2GRR B;  3UIO C;  5D2M C;  2IO2 C; 
#chains in the Genus database with same CATH topology
 2CG3 A;  5BW8 C;  3AG3 E;  4K0R A;  3D9O A;  3ZVV A;  4MRU A;  4BSX A;  5KJL A;  1GW6 A;  3CVN A;  4PS8 A;  2WXR A;  2UWJ G;  3SFY A;  2X38 A;  3ZRH A;  4DUI A;  3C3Q A;  1X81 A;  4BX8 A;  2BUG A;  5JHB A;  3I3N A;  2I1K A;  2E0I A;  3SFZ A;  2X6H A;  3UMV A;  1JWF A;  5CCM A;  2X6I A;  4RQI A;  2A5U A;  4LG6 A;  4GB9 A;  5BXO A;  4DRX E;  4PS3 A;  2WB2 A;  5HI7 A;  3V2O A;  1G3N B;  1WAO 1;  4M7C A;  2BTD A;  1A5E A;  4GA2 A;  4CEM A;  3ML9 A;  2JAB A;  3NAW A;  4WWP A;  3RO2 A;  1K3Z D;  4TXR A;  3MJW A;  3Q7F A;  4AIF A;  3DXM G;  4U96 D;  5ANR A;  4I6E A;  4LCT A;  4UQY A;  5BV0 A;  3FP3 A;  2H6G A;  1TNU A;  4OYS A;  2UY1 B;  5BV1 A;  2B6C A;  4F3V A;  1RW2 A;  1ELW A;  1MX6 A;  2RFA A;  3ZUV B;  5CER B;  3NF1 A;  1IYG A;  2MOW A;  2I6H A;  2R2L A;  4Q96 A;  3UTM A;  2RD0 A;  2I2O A;  4KVO A;  3B7R L;  3MGB A;  3GW4 A;  2L6J A;  4G25 A;  5JJT A;  3AG1 E;  5FZQ A;  4R7L A;  1EDU A;  5ENO D;  4G26 A;  4MBG A;  2IJG X;  2KC7 A;  5AAO A;  5HKP A;  3TG4 A;  4QQI A;  3CHP A;  3CKC A;  2AXU A;  1BPO A;  2CHZ A;  4HQD A;  3S7B A;  2HR2 A;  5CEC B;  3APF A;  1N4R A;  4CCA A;  2L6B A;  3N71 A;  2VQ2 A;  3FU6 A;  3GZ1 A;  4J8Y A;  4G1T A;  3D9H A;  5DBK A;  4NQ0 A;  2P2C P;  2QZA A;  4DLQ A;  3LVR E;  1HXI A;  3UIN C;  3I4R B;  2FO1 E;  3TWT A;  3RU0 A;  4CDR A;  1SQM A;  4JXT A;  4XKC A;  4D10 C;  2LAH A;  3TGO A;  2H6H A;  2J49 A;  3RK6 A;  4JD2 G;  3ZYM A;  4N39 A;  1TNB A;  2R59 A;  4K5C A;  1H19 A;  4XI0 A;  1YYH A;  3IHY A;  1ZU2 A;  1WDY A;  4FU3 A;  4WNG A;  5B3S E;  4IUL A;  3AU5 A;  3PUJ A;  4RG9 A;  3E30 A;  3EHN A;  2Y69 E;  3Q79 A;  3TWV A;  1HF8 A;  2FUL A;  3BEE A;  1QNF A;  2EQX A;  3LKU A;  3PZD A;  3T8M A;  5EN5 D;  3JXJ A;  2MRI A;  3V30 A;  1O5M A;  3O4Z A;  2VYI A;  3BQO A;  3U66 A;  4EQF A;  3R7R A;  4YDY A;  3TXM A;  4ACL A;  4UWF A;  2Y3A A;  2RFM A;  1E96 B;  3B95 A;  2ETA A;  3Q78 A;  1HX8 A;  1D8E A;  3FY4 A;  3ESL A;  3S7F A;  4J0U A;  3W9F A;  1FVF A;  5AQ9 A;  3FEX A;  2OEW A;  2Y1L E;  3EU5 A;  4APF A;  4HLL A;  3P1U A;  3PNT B;  5KNH D;  4J7W A;  5JJ7 A;  1OCO E;  4FLB A;  3SQV A;  5ITZ F;  2VJ8 A;  5LCW J;  3CQG B;  3G2T A;  4U7E B;  2X6F A;  3P2B A;  3UT8 A;  5D66 A;  2P9S G;  2XPZ A;  1N0Q A;  3CHS A;  2XEE A;  3T8K A;  2LAI A;  2NXP A;  5JMN D;  1YCS B;  3TWQ A;  4G23 A;  1H2T C;  2WQ7 A;  4UI9 J;  3TWU A;  4N2Q A;  3R7Q A;  5G55 A;  2IF4 A;  1ELK A;  3Q49 B;  2XZT G;  3C72 A;  3ISM C;  4FA6 A;  2YHE A;  2CFU A;  1TR4 A;  4GYY A;  2IQC A;  5AYW D;  2YIN A;  3EUV A;  5CMW A;  3MCX A;  2DZN A;  3EHM A;  3SD5 A;  1WM5 A;  1LTX A;  1H0A A;  1S0P A;  3ASO E;  4H7Y A;  3UX4 A;  5EX0 A;  3DWL G;  1RZ4 A;  4K03 A;  5ANL A;  1N95 A;  1ZB1 A;  4GZC A;  1MX4 A;  2F8Y A;  3T5X A;  2DVW A;  5EIB E;  4L23 A;  3EHQ A;  5JJ6 A;  3UM2 A;  4UI9 K;  1DNP A;  4G24 A;  3DXK G;  3AU4 A;  2NC9 A;  4U8Y D;  1S64 A;  3K9I A;  2KCV A;  3PZ4 A;  3FUN A;  3VTY A;  2GRP B;  2ZGG A;  4FHJ A;  4HBD A;  5E76 A;  2XQ0 A;  4A1S A;  4A1G A;  5AAR A;  4OAU C;  3CIA A;  1IHG A;  3QNK A;  3TWS A;  2X6K A;  3FTS A;  3PRZ A;  3IHV A;  1DC2 A;  4A3T A;  3CVW A;  1YA0 A;  1TJF A;  4Z68 A;  2L0I A;  4ACK A;  4ZHB A;  1BI7 B;  3BG1 B;  3TWR A;  1QBQ A;  1YMP A;  2FEZ A;  4DLO A;  2KBX A;  4GCO A;  1DVP A;  2DBA A;  4LNG A;  4N2S A;  4TV3 A;  2IU1 A;  4H7X A;  1E8X A;  3CQC B;  4C48 B;  2CHX A;  2XS8 A;  4K5A B;  1V54 E;  2IEJ A;  2V5F A;  2CG2 A;  4GA1 A;  2J9Q A;  2XEH A;  4TXQ A;  3CHO A;  3MKQ A;  5G2N A;  1MHQ A;  2KM4 A;  2WMN A;  3KEZ A;  1UJJ A;  3DRA A;  3PNL B;  4LUN U;  2Y4U A;  3APD A;  2R02 A;  3T5V A;  3QKY A;  3FFL A;  1O1T A;  1TN6 A;  2UY1 A;  3PE4 A;  4BES A;  3HXE A;  4CZ2 D;  3URZ A;  3KS2 A;  4PS7 A;  5AJD A;  5FIO A;  3PDN A;  5KJK A;  2ZIS A;  3EU9 A;  4IRU A;  4GTQ A;  1NA0 A;  4EEC A;  3U9W A;  2ZGD A;  4AV7 A;  4GPM A;  1E8Z A;  3D9I A;  4JEH A;  3NZU A;  2WXF A;  2GRO B;  2NSZ A;  3QOU A;  4FUL A;  1BD8 A;  5G05 J;  4OAV B;  3CVL A;  3PZ3 A;  3CHM A;  1EF1 C;  3ZNG A;  2QC9 A;  3JCK C;  4G2V A;  1NI1 A;  4ME2 A;  4C9B B;  3ABL E;  4AM9 A;  4N5Q A;  4KBQ A;  3JYS A;  3D9P A;  4TUM A;  1N4S A;  3GZS A;  5KJN A;  1U3C A;  5H7P A;  4B93 B;  2MYO A;  2EIK E;  3RO3 A;  3FUM A;  4HXI A;  2F0Y A;  4YDW A;  1P5Q A;  1UN8 A;  3D9J A;  4B94 A;  4E6H A;  4GTP A;  5FIN A;  3CLJ A;  4I43 A;  3KD7 A;  3Q5M A;  2P9L G;  3FUH A;  4GMR A;  4ANX A;  3UKU G;  5HS0 A;  1KZP A;  3FUK A;  2GW1 A;  3TXN A;  4ATG A;  3AS8 A;  4BT8 A;  4ANW A;  2YHC A;  3DPD A;  1SW6 A;  4FJZ A;  1QQE A;  4HI8 A;  4ZFH A;  3FUJ A;  5ARF A;  3C3R A;  3CHR A;  3ZKJ A;  3J5P A;  3IV0 A;  4GTR A;  5CHE E;  4X8Q A;  3S7D A;  4N5C A;  5KNG A;  3TL5 A;  3E37 A;  4DX7 D;  5A7D B;  1IHB A;  2WXI A;  4UWL A;  4HRL A;  2LSV A;  4O60 A;  5AIJ A;  2WQH A;  4O1P A;  5BXU A;  4TXP A;  3AG2 E;  3PE3 A;  1N0R A;  3HVE B;  4Y6W A;  2P58 C;  4XX5 A;  5DIZ A;  4L2Y A;  4GMJ A;  2Q7F A;  1N4P A;  1SZ9 A;  5LCW C;  3MKR A;  3MX3 A;  4LNB A;  3B13 A;  4EHM A;  4GTO A;  4XI9 A;  1PY1 A;  3E4B A;  2ZU6 B;  3U4T A;  2H6F A;  1H2U A;  4NRH B;  5D0O D;  1U2V G;  2PZI A;  3PRE A;  4U63 A;  2KZT A;  3F6Q A;  1V55 E;  2AWI A;  3FTZ A;  4UI9 C;  1K1B A;  3GYZ A;  2KAT A;  1E8W A;  3ENE A;  2GGF A;  3I5P A;  3QB2 A;  3EIQ C;  4JHK A;  4AEZ C;  4OVU A;  1H6K A;  2FBN A;  2QY7 A;  3RAU A;  3W9G A;  2OVF A;  1Y6I A;  2VGE A;  4DX6 D;  3V31 A;  5FQ8 A;  2ION A;  3IXE A;  3CVU A;  4U0U A;  4O1O A;  1E8Y A;  3G2W A;  1TEZ A;  1HFA A;  4XKB A;  1QZ2 A;  4YND A;  3PVL A;  4I9C A;  3DSU A;  4LEU A;  4YDO A;  1TYQ G;  3Q9N C;  2J8S D;  4AXH A;  3EDT B;  3ZFW A;  5BPP A;  4MS6 A;  3ZHE B;  3CST A;  4UWG A;  3U3W A;  5AEN A;  1IQU A;  2KCK A;  1D9S A;  3DBS A;  3CV0 A;  3D9L A;  4CT4 A;  3FUE A;  1S63 A;  4V3I A;  3MV2 B;  4YVO A;  1N9A A;  2IOL A;  3UIP C;  5T3R A;  1OWM A;  1FVH A;  3TJP A;  4RLY A;  2GRR B;  4EZK A;  4OVV A;  5E75 A;  3DSS A;  4AVX A;  4ABN A;  1OCC E;  4K5B A;  4KVM A;  3HXD A;  4UUC A;  2RG8 A;  3WG7 E;  4DK5 A;  1O1S A;  5EYL A;  4NAC A;  4LRZ A;  4HNA D;  2VSY A;  4HOT A;  5CCL A;  2OOE A;  4XZ4 A;  3CVX A;  2X3M A;  2PM7 A;  3OAW A;  2Y4T A;  5IY5 E;  4PUC A;  4WND A;  4BEP A;  3L54 A;  2WM9 A;  3NOC D;  2VSN A;  2XRZ A;  4I17 A;  1VDY A;  4UWK A;  2YQ8 A;  2V0P A;  1TNY A;  2AXV A;  3R9A B;  4FC8 A;  4CGW A;  1SVX A;  3UM3 A;  3BG0 B;  5CEA A;  3E33 A;  1S70 B;  3UM1 A;  1OUV A;  3L6A A;  4GZ3 A;  4LNU D;  1DCE A;  4GYO A;  3HXC A;  1IQR A;  3ASN E;  2P9K G;  1Q2Z A;  5C2Y A;  3ASF A;  2CHW A;  2WXN A;  4J8S A;  2J4B A;  1IKN D;  4HVB A;  4GZ5 A;  3KSL A;  4KMO A;  1H2V C;  3CVP A;  3JXI A;  4U95 D;  3FWV A;  2P9U G;  5EIL A;  4KT6 B;  3IKO B;  4BX9 A;  4NUR A;  5G05 C;  2H6I A;  4HI9 A;  4JA7 A;  4UQX A;  3ABK E;  5KBA A;  3V2X A;  2VTB B;  4LSZ E;  4N3B A;  2WXH A;  3LEW A;  2QYU A;  3LY9 A;  3SBS A;  1X5B A;  4MLP A;  4B8A A;  4Y6C A;  4BFR A;  5ENQ D;  3AG4 E;  2J08 A;  3FUF A;  3RKV A;  5FT9 A;  1TN8 A;  2PNN A;  3X2Q E;  4BSZ B;  3FH7 A;  5FTP A;  4GTS A;  2XEV A;  4I9E A;  4W9R A;  3FH8 A;  1AWC B;  2L9B A;  2P9N G;  4WAF A;  4M3O A;  3RJV A;  2V4L A;  1OWL A;  2BKK B;  2AW6 A;  3TWX A;  3UT4 A;  4KXK B;  2VGX A;  4I1O B;  2LSU A;  2ZXW E;  3UUX A;  2GRQ B;  4G8L A;  2FI7 A;  2VSO E;  3NBN B;  1TNO A;  3DPY A;  4JVS A;  4ANU A;  5ENT D;  2WXK A;  5J08 A;  3TAX A;  1JCR A;  4BTA A;  2L0T B;  3B7T A;  1A17 A;  1JCQ A;  3KAE A;  2AJA A;  5M72 A;  2XGO A;  2OVB A;  1Z3X A;  2C0M A;  5A23 A;  1MZC A;  5CBN A;  3I4G A;  2DZO A;  4I6J A;  5EKQ D;  3SFX A;  2B0O E;  3FUI A;  4HOR A;  4JB8 P;  5CBO A;  4IN3 B;  4ILI A;  3GZ2 A;  4BY6 A;  3L08 A;  2VSX E;  3UQ3 A;  1ELR A;  3FU0 A;  2FO7 A;  4PH4 B;  4L1B A;  3QWW A;  2JEK A;  4I2W A;  3PEV B;  2BKG A;  2IOS A;  5B1B E;  3QAR A;  5ENN A;  4U04 A;  1FPP A;  5EID A;  5AJL A;  5KJM A;  4KZ0 A;  3CVY A;  3QK0 A;  3CK7 A;  4L7T A;  3ULQ A;  5CED B;  4B0Z A;  4J8D A;  2X6J A;  3T9K A;  4EZJ A;  1NL4 A;  2BF0 X;  1OCZ E;  1XGW A;  3L9T A;  4TUU A;  3HIZ A;  4GYW A;  4GAA A;  1OWN A;  2E2E A;  4DI3 A;  3ASH A;  5JA4 D;  4HOQ A;  3UXG A;  5ENS D;  3ASG A;  3FTY A;  3HRA A;  3Q47 B;  3QJZ A;  3S7J A;  5FZS A;  4BER A;  1SA5 A;  5D2M C;  3FU5 A;  3HXB A;  1K8K G;  1JUQ A;  3ESK A;  3KSQ A;  3OXF A;  2IY0 C;  4FJY A;  1TNZ A;  3NQP A;  3MYV A;  4RSY A;  3JQ1 A;  2XPY A;  3JUI A;  4A63 B;  4CRW A;  4U07 A;  1XNF A;  4N3C A;  2WXP A;  4GCN A;  3EJN A;  5CMY A;  1N4Q A;  2KXP C;  2LXM A;  1DCQ A;  4WUY A;  4QFV A;  3PS6 A;  3SZ7 A;  4PDX A;  3ZHE A;  1HU3 A;  1Z6T A;  2WXO A;  4A55 A;  3OTN A;  4U8H A;  2YNQ A;  1H6P A;  4XE0 A;  4XEI G;  3FTU A;  5BNW A;  5AQB A;  4DX5 D;  1L5J A;  3PH0 C;  1H6O A;  2F8X K;  3UPV A;  4FAD A;  4I1A A;  4AP2 A;  5AQ7 A;  3NB2 A;  3Q75 A;  3QWP A;  1PC2 A;  5EYP F;  3B7B A;  4NIK A;  3QAQ A;  4BET A;  2R03 A;  3L16 A;  3B7U X;  2XGS A;  3PZ2 A;  3FDH A;  3B7S A;  3NOG D;  3L82 A;  3C98 A;  4P29 A;  3L17 A;  1KLX A;  4L2L A;  3LY7 A;  3ULE G;  3KEA A;  4RVB A;  3ZYL A;  1SZA A;  4AY5 A;  1MJ0 A;  5FQ6 A;  2J4D A;  2OV8 A;  5T8I A;  3JQ0 A;  3L22 A;  3MV3 B;  5ENR D;  3C5R A;  3ASD A;  1OT8 A;  5CRV A;  3ZXS A;  3VLD A;  2LO6 A;  2XCC A;  3MKQ B;  3D9M A;  3E32 A;  3Q9U C;  5FQ7 A;  4Q94 A;  3ZXP A;  3S2A A;  3OXG A;  3EHR A;  3D9K A;  3LYA A;  4HB5 A;  3ZYQ A;  1KT1 A;  1JPL A;  2WXJ A;  1Z5S C;  3MEK A;  4AY6 A;  3CR3 A;  3LDZ A;  2DWZ A;  1EYH A;  1ZBP A;  4JA9 A;  3SGH A;  4DJA A;  3J5Q B;  1JCS A;  1KPS B;  4B89 A;  1E90 A;  4GTT A;  3MZL B;  2HM8 A;  3FU3 A;  1FT2 A;  4F1P A;  4YDE A;  2EIM E;  5LX8 A;  4CGV A;  2M63 A;  1OY3 D;  2R05 A;  2GRM A;  1OWO A;  1LD8 A;  3BU8 A;  4DX2 A;  5G04 J;  3DSW A;  4CDN A;  3V79 K;  3FTX A;  2WXQ A;  4WWO A;  2LNI A;  3SNX A;  4EBA G;  4JL0 A;  4IYP A;  3QDN A;  1NZN A;  4AJW A;  3CEQ A;  5BUZ A;  2VTB A;  3HXF A;  4GTV A;  1HZ4 A;  3RRM B;  4CYM D;  3Q4A B;  2PM6 A;  2A4Z A;  4UWH A;  4GZD A;  2XS1 A;  2J07 A;  4I1M A;  2OND A;  3HG0 D;  1U3D A;  4XIF A;  5A6C A;  2EIL E;  4E85 A;  1FT1 A;  1HE8 A;  2J09 A;  1Z3Y A;  4GML A;  2PL2 A;  3QWV A;  3ONK A;  4I2Z A;  5ENP D;  4ATZ D;  3RIB A;  5FJY A;  3DST A;  3QC1 A;  3MA5 A;  1W3B A;  3ONL A;  2ILR A;  3RSE G;  3O48 A;  4KZC A;  4HOS A;  2OCC E;  2R17 C;  4U0Z A;  1SA4 A;  1EPU A;  4YVQ C;  3WXX A;  3D3M A;  4RG6 A;  5AQA A;  2FF4 A;  1N54 A;  3FTW A;  3LCA A;  4WWN A;  4A3V A;  4DX1 A;  4DPR A;  1NP7 A;  4U8V D;  1BLX B;  4C0E A;  4JHR A;  4GTM A;  3ZEF A;  3IEG A;  3G2U A;  4AOF A;  1MX2 A;  2HE0 A;  2BED A;  4G8K A;  3Q7A A;  4URK A;  1HS6 A;  5FZR A;  2C0L A;  4TRQ A;  2ETC A;  1B89 A;  4EBA A;  1BI8 B;  3FEY A;  3SO8 A;  3UKR G;  1N52 A;  4HFG A;  4BTB A;  3ZPJ A;  4HOU A;  1MYO A;  3HHM A;  4JHJ A;  5LFA A;  4J8F A;  2ETB A;  3HYM B;  3E34 A;  4GPK A;  2PQN A;  3CGH A;  3SBT B;  1E7V A;  4L9P A;  1WY6 A;  2MHK A;  3LJ3 A;  1HG5 A;  4ILH B;  4FP7 A;  1LF8 A;  2DYR E;  3JUE A;  1UJK A;  2AXZ A;  1UOH A;  2HYZ A;  4N3A A;  3SI5 A;  4WNE A;  2WXG A;  1JWG A;  2QFC A;  1WG0 A;  2KZT B;  4C0M A;  4F1S A;  4FHK A;  2JLB A;  1N94 A;  2RKK A;  4ILG A;  3U64 A;  1TJC A;  1LD7 A;  3APC A;  3ZYK A;  2A5E A;  1BU9 A;  4O6F A;  3AAA C;  2EIN E;  4G11 A;  3LS8 A;  4DI4 A;  2P9I G;  1IXV A;  4JPS A;  3CK9 A;  2V4H C;  1HO8 A;  2I1J A;  2XPI A;  3G2V A;  2C2L A;  5LOZ A;  5LP0 A;  3R9M A;  4WNF A;  4I6G A;  1PAQ A;  3UT7 A;  1OWP A;  2IO3 C;  3ZIM A;  4HLE A;  3C3O A;  2V5Q C;  5D0Q D;  1NA3 A;  3D9N A;  3DEP A;  3Q73 A;  1D8D A;  3VLE A;  3AS5 A;  3CHQ A;  3ML8 A;  1O1R A;  2Y0B G;  2VGY A;  3NZS A;  3SF4 A;  3G2S A;  3UI2 A;  3PEU B;  4GZ6 A;  4F6R D;  2XCB A;  3LVQ E;  4CDM A;  5CRU A;  5J90 A;  2QYJ A;  4J6I A;  4FLH A;  3LXU X;  2NYJ A;  4F53 A;  1QYM A;  4EPZ A;  1HG2 A;  2DCP A;  4J8E A;  3VLF A;  3TG5 A;  1Y8M A;  3CSF A;  4JW1 A;  2WPV A;  1INZ A;  3CKB A;  4HRN A;  5KWD A;  2WXL A;  3ZU7 B;  2XRY A;  2OEV A;  4JC8 A;  3UIO C;  1KT0 A;  5FQ4 A;  3VTX A;  1MQS A;  5B1A E;  5FWQ A;  1OXJ A;  3AJI A;  3BUA A;  5JHA A;  4CT0 A;  1TN7 A;  2V8S E;  1OCR E;  4B8C B;  2EIJ E;  2XZD G;  4F7A A;  4KYO B;  3CK8 A;  2LUH A;  3PUK A;  3ABM E;  5BT1 A;  2LXL A;  3FUL A;  3UM0 A;  2XHE A;  3TWW A;  2DIW A;  3HVE A;  5AN8 A;  2F37 A;  4HRM B;  3ZW3 A;  3FTV A;  3FH5 A;  3ZGQ A;  3LPZ A;  1AP7 A;  2GRN B;  4APO A;  3ZN3 A;  2AVP A;  3ULY A;  5T4Y A;  1N11 A;  2CFZ A;  2WVI A;  2I9C A;  4MKT A;  5HQ8 A;  2P9P G;  3LY8 A;  1KZO A;  3CVV A;  1NFI E;  1UW4 B;  2WQ6 A;  3IBE A;  2WXM A;  3EIJ A;  3Q15 A;  1E7U A;  1FCH A;  5KCM A;  1HH8 A;  5EDS A;  5G04 C;  3DEO A;  4JEU A;  1UG3 A;  2KCL A;  2XGM A;  4JZY A;  4GU5 A;  4ANV A;  4EZL A;  3CVQ A;  5EX3 A;  5HRY A;  2R5S A;  3RRN B;  4U0S A;  4BT9 A;  2DYS E;  1K1A A;  2XEN A;  4UQZ A;  2WMO A;  3SY2 A;  4LER A;  3PZ1 A;  3FHE A;  5C1D A;  2GRL A;  1UN9 A;  4GA0 A;  3AS4 A;  3DSV A;  3L13 A;  4BWR A;  5ARG A;  2PQR A;  2HO1 A;  3FUD A;  2IO2 C;  3DSX A;  4HS2 A;  2ZIR A;  3SHF A;  3OXL A;  2VGX B;  3HDX A;  3RRU A;  4Q69 A;  2IFU A;  3LJN A; 
#chains in the Genus database with same CATH homology
 2IY0 C;  2GRN B;  2GRO B;  2GRQ B;  3UIP C;  3UIN C;  2IO3 C;  2GRP B;  1Z5S C;  1KPS B;  2GRR B;  3UIO C;  5D2M C;  2IO2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...