1KPSB

Structural basis for e2-mediated sumo conjugation revealed by a complex between ubiquitin conjugating enzyme ubc9 and rangap1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
TDLSTFLSFPSPEKLLRLGPKVSVLIVQQTDTSDPEKVVSAFLKVASVFRDDASVKTAVLDAIDALMKKAFSCSSFNSNTFLTRLLIHMGLLKSEDKIKAIPSLHGPLMVLNHVVRQDYFPKALAPLLLAFVTKPNGALETCSFARHNLLQTLYNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SUMO-1 conjugating enzyme
publication title Structural basis for E2-mediated SUMO conjugation revealed by a complex between ubiquitin-conjugating enzyme Ubc9 and RanGAP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/protein transport
total genus 48
structure length 156
sequence length 156
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 1kpsB00
3UIOC 3UINC 2GRRB 2IO3C 1KPSB 3UIPC 2IO2C 2GRNB 1Z5SC 2GROB 2GRQB 5D2MC 2IY0C 2GRPB
chains in the Genus database with same CATH superfamily
1OCRE 2XZTG 4YNDA 4GMRA 3D9MA 4ANUA 2X6HA 2HO1A 2XGSA 1TEZA 3SBSA 3SY2A 4HOQA 2F8XK 5FWQA 2CHXA 1UJJA 2WXJA 5EX0A 3FU6A 4BEPA 1S63A 2WXQA 4WNGA 3TG5A 3HDXA 4WUYA 4E85A 4CZ2D 2CFZA 2Y4UA 3AS5A 2EINE 1FT1A 4WWPA 4APFA 5G04C 3SO8A 3ONKA 3VLEA 2XGMA 4B94A 3DEOA 3AS4A 3FUEA 4XE0A 4AY6A 5M72A 4LG6A 3JUEA 4PS8A 5CRUA 3ZHEA 3UUXA 3ZXSA 4R7LA 4OVVA 3D9LA 5BT1A 4JA7A 1OCOE 5KBAA 4BWRA 2WXHA 5BPPA 4XZ4A 1QYMA 4WWOA 3CHQA 3APFA 2UY1A 3NOGD 1O5MA 3S2AA 2EIME 4L1BA 3QAQA 3GYZA 4TV3A 5JJ7A 5KNHD 4JHJA 1JPLA 3HXFA 3FTYA 2X6FA 4K5AB 5AARA 4KVMA 3B7BA 4LCTA 3MKQA 1JUQA 4OAVB 3UM2A 1EPUA 3L08A 3CHOA 4U0UA 4DX7D 4ANWA 3CVPA 1MX2A 3CVLA 1TNZA 2DYRE 2F37A 4DX1A 3R9MA 2HYZA 3ASDA 1E8ZA 3EHMA 3KEAA 4ILGA 3R7RA 4YDOA 2VGXA 5FZQA 3R7QA 3RKVA 1BD8A 4HFGA 3CVUA 2IQCA 4I1AA 2LXLA 3X2QE 3TJPA 3KS2A 1L5JA 3TWSA 5KJNA 1LF8A 4HQDA 5LFAA 2RFMA 4UWFA 4ABNA 4XEIG 4Q96A 3G2TA 4J8SA 5T8IA 3V30A 1Z3YA 2XPIA 2ETAA 4DLOA 3ZGQA 4C0EA 3FU5A 4GTQA 1Z3XA 2EIKE 4O60A 3PNLB 5FJYA 4JHKA 3HIZA 4C0MA 2EILE 3ZRHA 4L7TA 2IOSA 3CQGB 3U66A 4A3TA 3NBNB 3IBEA 4HNAD 4HVBA 4ATZD 3HXBA 3TXNA 4AIFA 1KLXA 2BKKB 4LNBA 1HE8A 3MV3B 1DNPA 3LXUX 4PUCA 3CV0A 1Q2ZA 3TG4A 4RG6A 4GCOA 1QBQA 2X6JA 2WMNA 4BX8A 1N0QA 4A1SA 4IYPA 1JCSA 3UM3A 1SZ9A 4CYMD 5JHAA 5FQ6A 2DYSE 4FC8A 2P58C 5AQ7A 3QC1A 2AXUA 3PDNA 4U07A 4RVBA 4HLLA 2IY0C 3B7SA 3NB2A 3JXJA 3QWWA 4GYOA 4AP2A 3LVRE 5CCMA 5HS0A 3MYVA 3FP3A 2H6FA 4UWGA 3HYMB 3TWXA 4GCNA 4JD2G 4JC8A 1N11A 4XKCA 4I2WA 4B93B 3U3WA 2V4LA 4FJYA 2XPZA 4JB8P 4JZYA 5D2MC 3C5RA 1NI1A 3QB2A 4CGVA 3EHNA 5KNGA 4CT0A 4WWNA 2PQNA 4A1GA 3L6AA 3AG1E 3CSTA 2XRYA 4MBGA 3BEEA 1PY1A 1IHGA 3C3OA 5A6CA 4ZFHA 4QQIA 3ESLA 2FO1E 3GW4A 2ZGDA 5AJLA 1N9AA 5LOZA 2HR2A 3CLJA 1NZNA 3PZ3A 4QFVA 4UQZA 3I4GA 3E34A 3FTUA 3VTYA 1FPPA 3Q5MA 5ARFA 5G05J 4TXQA 2P2CP 3UIPC 1JWGA 4N5QA 4KXKB 2P9KG 2YHCA 1Z5SC 3GZ1A 4PDXA 2ZISA 1DC2A 3ASGA 1IQUA 1ZBPA 1BPOA 4N2QA 1SW6A 2QFCA 2VGYA 4WNDA 4FHJA 2DIWA 4TXRA 1KZOA 3AG2E 4GU5A 3MGBA 5J90A 3U4TA 2R02A 4F7AA 4JEUA 3JQ0A 1HFAA 3CKCA 4GTRA 1OWMA 1FVHA 3ZEFA 2WXGA 3D9NA 3RU0A 4KZCA 5T4YA 3FDHA 4D10C 2PNNA 2WXNA 1HO8A 3W9GA 3TAXA 4UWLA 4Z68A 5JJ6A 3VLDA 1HF8A 1YYHA 4DX5D 2XEVA 4K5CA 3DXKG 4DPRA 3C72A 4YVQC 4TXPA 1JWFA 3FY4A 3FH8A 4GTTA 2VQ2A 3MEKA 2LSVA 2WVIA 3L17A 2XS1A 3CK9A 1FCHA 3FU0A 1WM5A 5IY5E 3AS8A 2JEKA 3Q4AB 4RQIA 3RK6A 4FLBA 3G2VA 3ASFA 4J0UA 4EZKA 4A3VA 3D9JA 3UT4A 2P9NG 3ZYMA 1MQSA 3HVEB 3Q7FA 2XCBA 3JQ1A 5FQ4A 4BTAA 1O1RA 4RSYA 4F53A 4NRHB 2V5QC 2P9SG 5KJMA 2CHWA 4FHKA 1YMPA 5FINA 5CHEE 5JMND 3DSSA 2QY7A 3UM1A 4I2ZA 4HI9A 4HOUA 3LJ3A 3AU5A 4FJZA 1N4RA 4ACKA 3FTXA 1RZ4A 4MKTA 2KCLA 2I1JA 1EDUA 3P1UA 4I9EA 1NA3A 1ZU2A 2VJ8A 3BG0B 3PE3A 5FQ8A 5KWDA 1WG0A 4FA6A 2VGEA 5DBKA 4G24A 3ZYKA 1N4SA 2KZTA 3PS6A 1OCZE 4XKBA 1TJCA 5CMYA 4PS7A 4U96D 4HXIA 3BU8A 1H6OA 1N4QA 3SFYA 4GZDA 4LUNU 3RSEG 3FEXA 2GRPB 2X3MA 5CERB 3LDZA 1Z6TA 4GYWA 4A55A 5ARGA 3TWQA 3O48A 3L54A 4DX6D 4GTPA 2VTBB 2Y4TA 4GPMA 2ETCA 4B8AA 2VSYA 4CGWA 2IEJA 3LY8A 1EF1C 4BT8A 1LD8A 1JCQA 4LRZA 3NZSA 4J7WA 2OVFA 3AJIA 1E8WA 2NSZA 3ABKE 3J5PA 1NL4A 4NACA 4ANVA 5E76A 3MZLB 4DX2A 5LX8A 3MCXA 2JLBA 5JJTA 3DBSA 3AG4E 1OWLA 2AXVA 3G2WA 4U0SA 4K0RA 2J4DA 2DZOA 1H2UA 1W3BA 4G25A 4AM9A 3FUJA 2JABA 1N0RA 2HE0A 3J5QB 5EIBE 1N94A 2WM9A 2QYUA 4UWHA 2OEWA 3DXMG 3SFZA 4M3OA 4F1PA 1H19A 2J4BA 3E4BA 4IN3B 2FEZA 1U2VG 2DWZA 4GA0A 4HRMB 3S7FA 3MX3A 3PZDA 1UN9A 4L23A 3BG1B 3URZA 4KMOA 4JVSA 3Q75A 4DI4A 2WQ7A 2XPYA 3CGHA 3LEWA 3SZ7A 4JXTA 4NIKA 4AY5A 3SI5A 2ZGGA 3MJWA 4DK5A 3G2SA 4UI9J 2L0IA 4EBAG 4XX5A 5E75A 2LXMA 4HBDA 2CG2A 3ZFWA 3N71A 2AJAA 2Y0BG 4GB9A 5CBOA 4F6RD 5AJDA 2P9LG 3QOUA 2IJGX 3CVQA 1HG5A 2PL2A 4UI9C 4I6EA 3PRZA 4LNUD 2PM6A 3ASNE 3E30A 2BF0X 2H6GA 3CHRA 4LNGA 3L22A 4ANXA 5AQ9A 5KCMA 4J8DA 3B13A 5EYPF 3PUKA 4DJAA 4G8LA 2F8YA 1UJKA 3ZUVB 3UM0A 2J07A 3CR3A 1K1BA 2GROB 2J49A 4BSXA 2WXRA 3NQPA 3IKOB 4GMJA 2AVPA 4UUCA 1HG2A 4FU3A 3DSUA 4GZCA 4U04A 2MYOA 1ZB1A 3OAWA 2X6IA 2FI7A 4ATGA 4CCAA 1H0AA 4ME2A 5CBNA 1UOHA 1MX6A 4F1SA 4WNEA 4A63B 1MHQA 4IRUA 2V4HC 4P29A 2R03A 4B8CB 3CEQA 1SA5A 4AVXA 2A4ZA 2KATA 4CRWA 2OOEA 3JYSA 5FQ7A 2LO6A 2XENA 2F0YA 1MX4A 4CDRA 3MA5A 3FEYA 2XQ0A 2DVWA 3CK8A 1AWCB 3TWTA 2WB2A 1JCRA 2P9IG 3SNXA 1FVFA 4XI0A 1ELWA 3OXGA 3ZPJA 3I5PA 3PZ4A 2MHKA 3OXFA 4DI3A 1WY6A 3VTXA 1D9SA 3KAEA 4U8VD 2FBNA 4I1MA 1OWPA 1GW6A 1HS6A 2LAHA 1YA0A 2J08A 4AEZC 1LTXA 1E7VA 3S7BA 1S64A 1KPSB 1IQRA 3CHMA 2WXOA 4N3BA 1EYHA 3RO3A 3D3MA 4EBAA 3B7UX 2QC9A 3T9KA 5FIOA 5B1AE 2J09A 2ZU6B 4HRNA 1SQMA 4OAUC 4PH4B 1KT0A 1X5BA 3FH7A 4PS3A 3CVXA 3KEZA 1TNBA 2ILRA 3IV0A 4M7CA 5JHBA 3FTVA 2B6CA 4L2LA 4J8FA 3LS8A 1SZAA 4KBQA 2XCCA 4ZHBA 3MV2B 2LAIA 3FHEA 3PZ1A 4EPZA 4GA1A 2KCKA 3DSTA 1UW4B 4XI9A 3TWWA 3PVLA 3ULQA 1P5QA 5G05C 4FLHA 4WAFA 3E32A 3TWUA 4GZ3A 4YDWA 1Y6IA 2BKGA 2GRRB 4JW1A 3EJNA 3I3NA 4C48B 3QWPA 1N54A 3AG3E 4HOSA 2NXPA 3E37A 2XGOA 3IXEA 1Y8MA 2V8SE 2C2LA 3Q78A 3RRUA 5BV1A 2VYIA 5ENPD 3EIQC 3CVVA 3LCAA 1BI8B 1S0PA 2BTDA 2AW6A 4KVOA 3L16A 1H2TC 4CEMA 4H7XA 3FH5A 2CG3A 5D0QD 2Y1LE 1E8YA 4JA9A 2WQHA 2AWIA 5EKQD 1ELKA 2EQXA 4I1OB 1DCEA 4MS6A 2DBAA 2I1KA 2XEEA 3HXCA 1PAQA 3DEPA 2GRMA 3AU4A 1K8KG 1HU3A 3UT8A 2V0PA 4E6HA 4N2SA 4U0ZA 4KZ0A 1QZ2A 3L9TA 3ASHA 2E0IA 3D9PA 1E96B 3G2UA 3DSXA 3F6QA 5ITZF 3TGOA 4TUMA 4OVUA 2AXZA 3V79K 4N3CA 3IHYA 4ILHB 1SVXA 2YINA 3PE4A 1KT1A 2XZDG 3ISMC 3RJVA 5AN8A 4G26A 5ANRA 5H7PA 1VDYA 2BEDA 3DSVA 2M63A 3ENEA 2UY1B 1H6KA 3BQOA 4HLEA 2DCPA 5FZSA 2C0MA 3OXLA 2QZAA 4J8EA 4JPSA 5FZRA 3S7JA 3UI2A 1S70B 1WDYA 2H6HA 3CVNA 3QNKA 1D8DA 5A7DB 3GZ2A 5B3SE 1B89A 3D9KA 2NYJA 1OT8A 3PUJA 1N52A 4YDYA 5BUZA 2FO7A 1XNFA 2L9BA 4EZJA 4AXHA 3C3QA 1HX8A 3ZKJA 3Q79A 1NFIE 2ZXWE 4GZ6A 1BU9A 3SHFA 3V2XA 4O1OA 4HOTA 2L6BA 5HRYA 2IO3C 3T8KA 3TL5A 1A17A 2RD0A 4NURA 3SF4A 4MRUA 5CMWA 5J08A 3EDTB 4L2YA 3ML9A 3TXMA 2VGXB 5G04J 4BERA 5BXOA 4G8KA 2WXPA 1TN8A 4J8YA 3CK7A 4LERA 3KD7A 4U8HA 4EHMA 4ILIA 4O6FA 2WXKA 1ELRA 3FUNA 4BT9A 3T5VA 2XEHA 4BY6A 4LEUA 1IXVA 2ZIRA 1H2VC 4JHRA 4J6IA 4GYYA 2VSOE 2GRNB 3D9OA 3ONLA 3UKUG 5G2NA 2HM8A 4YVOA 3V2OA 1E90A 5D66A 1OWOA 3ULYA 3CQCB 4HRLA 5D0OD 4BX9A 2KBXA 4AOFA 4TRQA 2J9QA 3Q15A 5BNWA 3HVEA 4H7YA 1IYGA 3UMVA 5EYLA 4GTMA 4C9BB 2R59A 4FADA 2IONA 2KCVA 1TNOA 4Y6CA 2GW1A 3CVYA 3FFLA 4L9PA 3ZXPA 1OY3D 2R2LA 5EN5D 5C1DA 1FT2A 2B0OE 1X81A 1TR4A 2GRLA 3VLFA 2X6KA 3UIOC 3CSFA 1TNYA 3C3RA 3KSLA 5ENQD 4K5BA 4AJWA 2RKKA 4YDEA 4O1PA 1U3DA 4N3AA 2IFUA 3PREA 2OEVA 2IO2C 5AENA 1TJFA 3LJNA 4EZLA 1SA4A 3Q47B 4JEHA 2CFUA 2RG8A 1QNFA 3FTSA 2PQRA 4B0ZA 2MRIA 2RFAA 2KC7A 2C0LA 5BW8C 3U9WA 4ACLA 5KJKA 4OYSA 4TUUA 3LYAA 2A5UA 3ULEG 1AP7A 5A23A 3ZYLA 2GRQB 4I6GA 2I6HA 2I9CA 3CIAA 4BFRA 3I4RB 3QKYA 1RW2A 2KM4A 2XS8A 3HXEA 5LP0A 5ENNA 3UQ3A 4G11A 2VSXE 1A5EA 4BTBA 5BXUA 4I9CA 4G2VA 2IOLA 5ANLA 2VTBA 1DCQA 3GZSA 5AIJA 3UINC 2PM7A 2YQ8A 2P9PG 4RLYA 5HKPA 4KYOB 1HH8A 3UPVA 1OCCE 3DRAA 5G55A 4UI9K 2VSNA 5ENSD 1E7UA 3ZU7B 2ETBA 5LCWJ 2YNQA 2R05A 3LVQE 3RRMB 5JA4D 1UN8A 3FWVA 5FTPA 3UXGA 3WG7E 2Y3AA 3NAWA 4CT4A 3TWRA 1TYQG 3ZNGA 3EU5A 4NQ0A 2WXFA 4APOA 4GAAA 3CKBA 3P2BA 5T3RA 3JCKC 5CECB 5EDSA 5LCWC 1H6PA 3UX4A 1XGWA 3B7TA 4HI8A 1BLXB 3DPDA 3LPZA 3QDNA 3IEGA 4IULA 4JL0A 5ENRD 2QYJA 4X8QA 3HG0D 2Y69E 3APDA 5HI7A 1INZA 4U8YD 2WXMA 2I2OA 3LY9A 4N5CA 2X38A 3BUAA 3FUKA 3EU9A 3EUVA 4F3VA 5FT9A 3Q9UC 4U7EB 3UTMA 3E33A 2L6JA 1UG3A 2J8SD 3UKRG 3ASOE 1K3ZD 4GZ5A 3R9AB 4DRXE 5B1BE 3HHMA 1V55E 3JXIA 3HXDA 2PZIA 3L82A 2FULA 3NF1A 3C98A 2WMOA 3RO2A 3QWVA 2EIJE 4LSZE 5DIZA 3S7DA 3DSWA 3FUHA 4G1TA 4WNFA 4EQFA 3K9IA 4XIFA 1TN7A 3DPYA 3FUDA 5EX3A 4GA2A 3CVWA 1NP7A 2DZNA 3ZIMA 3NZUA 3EHQA 4U63A 3WXXA 1O1SA 2FF4A 2OVBA 4Q94A 2KXPC 1PC2A 4GPKA 1DVPA 3SBTB 3FULA 1V54E 3PNTB 3JUIA 4AV7A 2L0TB 3B95A 2E2EA 1KZPA 5AAOA 3SQVA 3D9IA 3IHVA 4Q69A 2XRZA 1IHBA 5HQ8A 3ML8A 1NA0A 3T8MA 3RIBA 3APCA 1OWNA 1HZ4A 5ENOD 1HXIA 2IF4A 3FUMA 1D8EA 4V3IA 4MLPA 1MYOA 1N4PA 3SD5A 3T5XA 4G23A 1YCSB 5CCLA 1LD7A 4BSZB 5EILA 3QK0A 3CHPA 2NC9A 1TNUA 5CEAA 3Q7AA 4HS2A 3UT7A 3FUFA 4HB5A 5BV0A 4B89A 3B7RL 3D9HA 5AQBA 3EHRA 3ZN3A 3CHSA 3PZ2A 2XHEA 2LUHA 3KSQA 1N95A 2MOWA 1MZCA 2IU1A 3LY7A 4Y6WA 3FTWA 5ENTD 3FUIA 4DUIA 4DLQA 3MKRA 2CHZA 4CDNA 3SFXA 4BESA 2H6IA 3PEVB 3O4ZA 2A5EA 3QJZA 3SGHA 3RRNB 1MJ0A 4I17A 4FULA 2KZTB 5KJLA 3ZVVA 1U3CA 4GTSA 4RG9A 4UQYA 3FU3A 2YHEA 2P9UG 4UWKA 1E8XA 3HRAA 4BETA 2GGFA 2WXIA 4KT6B 4FP7A 3ZHEB 1O1TA 3ESKA 3ZYQA 3U64A 4K03A 5AYWD 1G3NB 4UQXA 3Q73A 4I43A 4GTOA 3OTNA 4W9RA 2R17C 3ABME 5EIDA 4N39A 3LKUA 4GTVA 2LSUA 4GMLA 1IKND 1WAO1 4CDMA 2WQ6A 3TWVA 4EECA 2OCCE 2R5SA 1OXJA 2BUGA 3L13A 5CRVA 2WPVA 3FTZA 3W9FA 5C2YA 3AAAC 1TN6A 3RAUA 4U95D 1BI7B 2Q7FA 2ONDA 4HORA 3Q49B 3ABLE 1QQEA 3Q9NC 3NOCD 3MKQB 2V5FA 2WXLA 2OV8A 3DWLG 2UWJG 3EIJA 3QARA 4URKA 4I6JA 3PH0C 2LNIA 3PEUB 5CEDB 1OUVA 1K1AA 3V31A 3ZW3A 5AQAA
chains in the Genus database with same CATH topology
3UIOC 3UINC 2GRRB 2IO3C 1KPSB 3UIPC 2IO2C 2GRNB 1Z5SC 2GROB 2GRQB 5D2MC 2IY0C 2GRPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIO C;  3UIN C;  2GRR B;  2IO3 C;  1KPS B;  3UIP C;  2IO2 C;  2GRN B;  1Z5S C;  2GRO B;  2GRQ B;  5D2M C;  2IY0 C;  2GRP B; 
#chains in the Genus database with same CATH topology
 1OCR E;  2XZT G;  4YND A;  4GMR A;  3D9M A;  4ANU A;  2X6H A;  2HO1 A;  2XGS A;  1TEZ A;  3SBS A;  3SY2 A;  4HOQ A;  2F8X K;  5FWQ A;  2CHX A;  1UJJ A;  2WXJ A;  5EX0 A;  3FU6 A;  4BEP A;  1S63 A;  2WXQ A;  4WNG A;  3TG5 A;  3HDX A;  4WUY A;  4E85 A;  4CZ2 D;  2CFZ A;  2Y4U A;  3AS5 A;  2EIN E;  1FT1 A;  4WWP A;  4APF A;  5G04 C;  3SO8 A;  3ONK A;  3VLE A;  2XGM A;  4B94 A;  3DEO A;  3AS4 A;  3FUE A;  4XE0 A;  4AY6 A;  5M72 A;  4LG6 A;  3JUE A;  4PS8 A;  5CRU A;  3ZHE A;  3UUX A;  3ZXS A;  4R7L A;  4OVV A;  3D9L A;  5BT1 A;  4JA7 A;  1OCO E;  5KBA A;  4BWR A;  2WXH A;  5BPP A;  4XZ4 A;  1QYM A;  4WWO A;  3CHQ A;  3APF A;  2UY1 A;  3NOG D;  1O5M A;  3S2A A;  2EIM E;  4L1B A;  3QAQ A;  3GYZ A;  4TV3 A;  5JJ7 A;  5KNH D;  4JHJ A;  1JPL A;  3HXF A;  3FTY A;  2X6F A;  4K5A B;  5AAR A;  4KVM A;  3B7B A;  4LCT A;  3MKQ A;  1JUQ A;  4OAV B;  3UM2 A;  1EPU A;  3L08 A;  3CHO A;  4U0U A;  4DX7 D;  4ANW A;  3CVP A;  1MX2 A;  3CVL A;  1TNZ A;  2DYR E;  2F37 A;  4DX1 A;  3R9M A;  2HYZ A;  3ASD A;  1E8Z A;  3EHM A;  3KEA A;  4ILG A;  3R7R A;  4YDO A;  2VGX A;  5FZQ A;  3R7Q A;  3RKV A;  1BD8 A;  4HFG A;  3CVU A;  2IQC A;  4I1A A;  2LXL A;  3X2Q E;  3TJP A;  3KS2 A;  1L5J A;  3TWS A;  5KJN A;  1LF8 A;  4HQD A;  5LFA A;  2RFM A;  4UWF A;  4ABN A;  4XEI G;  4Q96 A;  3G2T A;  4J8S A;  5T8I A;  3V30 A;  1Z3Y A;  2XPI A;  2ETA A;  4DLO A;  3ZGQ A;  4C0E A;  3FU5 A;  4GTQ A;  1Z3X A;  2EIK E;  4O60 A;  3PNL B;  5FJY A;  4JHK A;  3HIZ A;  4C0M A;  2EIL E;  3ZRH A;  4L7T A;  2IOS A;  3CQG B;  3U66 A;  4A3T A;  3NBN B;  3IBE A;  4HNA D;  4HVB A;  4ATZ D;  3HXB A;  3TXN A;  4AIF A;  1KLX A;  2BKK B;  4LNB A;  1HE8 A;  3MV3 B;  1DNP A;  3LXU X;  4PUC A;  3CV0 A;  1Q2Z A;  3TG4 A;  4RG6 A;  4GCO A;  1QBQ A;  2X6J A;  2WMN A;  4BX8 A;  1N0Q A;  4A1S A;  4IYP A;  1JCS A;  3UM3 A;  1SZ9 A;  4CYM D;  5JHA A;  5FQ6 A;  2DYS E;  4FC8 A;  2P58 C;  5AQ7 A;  3QC1 A;  2AXU A;  3PDN A;  4U07 A;  4RVB A;  4HLL A;  2IY0 C;  3B7S A;  3NB2 A;  3JXJ A;  3QWW A;  4GYO A;  4AP2 A;  3LVR E;  5CCM A;  5HS0 A;  3MYV A;  3FP3 A;  2H6F A;  4UWG A;  3HYM B;  3TWX A;  4GCN A;  4JD2 G;  4JC8 A;  1N11 A;  4XKC A;  4I2W A;  4B93 B;  3U3W A;  2V4L A;  4FJY A;  2XPZ A;  4JB8 P;  4JZY A;  5D2M C;  3C5R A;  1NI1 A;  3QB2 A;  4CGV A;  3EHN A;  5KNG A;  4CT0 A;  4WWN A;  2PQN A;  4A1G A;  3L6A A;  3AG1 E;  3CST A;  2XRY A;  4MBG A;  3BEE A;  1PY1 A;  1IHG A;  3C3O A;  5A6C A;  4ZFH A;  4QQI A;  3ESL A;  2FO1 E;  3GW4 A;  2ZGD A;  5AJL A;  1N9A A;  5LOZ A;  2HR2 A;  3CLJ A;  1NZN A;  3PZ3 A;  4QFV A;  4UQZ A;  3I4G A;  3E34 A;  3FTU A;  3VTY A;  1FPP A;  3Q5M A;  5ARF A;  5G05 J;  4TXQ A;  2P2C P;  3UIP C;  1JWG A;  4N5Q A;  4KXK B;  2P9K G;  2YHC A;  1Z5S C;  3GZ1 A;  4PDX A;  2ZIS A;  1DC2 A;  3ASG A;  1IQU A;  1ZBP A;  1BPO A;  4N2Q A;  1SW6 A;  2QFC A;  2VGY A;  4WND A;  4FHJ A;  2DIW A;  4TXR A;  1KZO A;  3AG2 E;  4GU5 A;  3MGB A;  5J90 A;  3U4T A;  2R02 A;  4F7A A;  4JEU A;  3JQ0 A;  1HFA A;  3CKC A;  4GTR A;  1OWM A;  1FVH A;  3ZEF A;  2WXG A;  3D9N A;  3RU0 A;  4KZC A;  5T4Y A;  3FDH A;  4D10 C;  2PNN A;  2WXN A;  1HO8 A;  3W9G A;  3TAX A;  4UWL A;  4Z68 A;  5JJ6 A;  3VLD A;  1HF8 A;  1YYH A;  4DX5 D;  2XEV A;  4K5C A;  3DXK G;  4DPR A;  3C72 A;  4YVQ C;  4TXP A;  1JWF A;  3FY4 A;  3FH8 A;  4GTT A;  2VQ2 A;  3MEK A;  2LSV A;  2WVI A;  3L17 A;  2XS1 A;  3CK9 A;  1FCH A;  3FU0 A;  1WM5 A;  5IY5 E;  3AS8 A;  2JEK A;  3Q4A B;  4RQI A;  3RK6 A;  4FLB A;  3G2V A;  3ASF A;  4J0U A;  4EZK A;  4A3V A;  3D9J A;  3UT4 A;  2P9N G;  3ZYM A;  1MQS A;  3HVE B;  3Q7F A;  2XCB A;  3JQ1 A;  5FQ4 A;  4BTA A;  1O1R A;  4RSY A;  4F53 A;  4NRH B;  2V5Q C;  2P9S G;  5KJM A;  2CHW A;  4FHK A;  1YMP A;  5FIN A;  5CHE E;  5JMN D;  3DSS A;  2QY7 A;  3UM1 A;  4I2Z A;  4HI9 A;  4HOU A;  3LJ3 A;  3AU5 A;  4FJZ A;  1N4R A;  4ACK A;  3FTX A;  1RZ4 A;  4MKT A;  2KCL A;  2I1J A;  1EDU A;  3P1U A;  4I9E A;  1NA3 A;  1ZU2 A;  2VJ8 A;  3BG0 B;  3PE3 A;  5FQ8 A;  5KWD A;  1WG0 A;  4FA6 A;  2VGE A;  5DBK A;  4G24 A;  3ZYK A;  1N4S A;  2KZT A;  3PS6 A;  1OCZ E;  4XKB A;  1TJC A;  5CMY A;  4PS7 A;  4U96 D;  4HXI A;  3BU8 A;  1H6O A;  1N4Q A;  3SFY A;  4GZD A;  4LUN U;  3RSE G;  3FEX A;  2GRP B;  2X3M A;  5CER B;  3LDZ A;  1Z6T A;  4GYW A;  4A55 A;  5ARG A;  3TWQ A;  3O48 A;  3L54 A;  4DX6 D;  4GTP A;  2VTB B;  2Y4T A;  4GPM A;  2ETC A;  4B8A A;  2VSY A;  4CGW A;  2IEJ A;  3LY8 A;  1EF1 C;  4BT8 A;  1LD8 A;  1JCQ A;  4LRZ A;  3NZS A;  4J7W A;  2OVF A;  3AJI A;  1E8W A;  2NSZ A;  3ABK E;  3J5P A;  1NL4 A;  4NAC A;  4ANV A;  5E76 A;  3MZL B;  4DX2 A;  5LX8 A;  3MCX A;  2JLB A;  5JJT A;  3DBS A;  3AG4 E;  1OWL A;  2AXV A;  3G2W A;  4U0S A;  4K0R A;  2J4D A;  2DZO A;  1H2U A;  1W3B A;  4G25 A;  4AM9 A;  3FUJ A;  2JAB A;  1N0R A;  2HE0 A;  3J5Q B;  5EIB E;  1N94 A;  2WM9 A;  2QYU A;  4UWH A;  2OEW A;  3DXM G;  3SFZ A;  4M3O A;  4F1P A;  1H19 A;  2J4B A;  3E4B A;  4IN3 B;  2FEZ A;  1U2V G;  2DWZ A;  4GA0 A;  4HRM B;  3S7F A;  3MX3 A;  3PZD A;  1UN9 A;  4L23 A;  3BG1 B;  3URZ A;  4KMO A;  4JVS A;  3Q75 A;  4DI4 A;  2WQ7 A;  2XPY A;  3CGH A;  3LEW A;  3SZ7 A;  4JXT A;  4NIK A;  4AY5 A;  3SI5 A;  2ZGG A;  3MJW A;  4DK5 A;  3G2S A;  4UI9 J;  2L0I A;  4EBA G;  4XX5 A;  5E75 A;  2LXM A;  4HBD A;  2CG2 A;  3ZFW A;  3N71 A;  2AJA A;  2Y0B G;  4GB9 A;  5CBO A;  4F6R D;  5AJD A;  2P9L G;  3QOU A;  2IJG X;  3CVQ A;  1HG5 A;  2PL2 A;  4UI9 C;  4I6E A;  3PRZ A;  4LNU D;  2PM6 A;  3ASN E;  3E30 A;  2BF0 X;  2H6G A;  3CHR A;  4LNG A;  3L22 A;  4ANX A;  5AQ9 A;  5KCM A;  4J8D A;  3B13 A;  5EYP F;  3PUK A;  4DJA A;  4G8L A;  2F8Y A;  1UJK A;  3ZUV B;  3UM0 A;  2J07 A;  3CR3 A;  1K1B A;  2GRO B;  2J49 A;  4BSX A;  2WXR A;  3NQP A;  3IKO B;  4GMJ A;  2AVP A;  4UUC A;  1HG2 A;  4FU3 A;  3DSU A;  4GZC A;  4U04 A;  2MYO A;  1ZB1 A;  3OAW A;  2X6I A;  2FI7 A;  4ATG A;  4CCA A;  1H0A A;  4ME2 A;  5CBN A;  1UOH A;  1MX6 A;  4F1S A;  4WNE A;  4A63 B;  1MHQ A;  4IRU A;  2V4H C;  4P29 A;  2R03 A;  4B8C B;  3CEQ A;  1SA5 A;  4AVX A;  2A4Z A;  2KAT A;  4CRW A;  2OOE A;  3JYS A;  5FQ7 A;  2LO6 A;  2XEN A;  2F0Y A;  1MX4 A;  4CDR A;  3MA5 A;  3FEY A;  2XQ0 A;  2DVW A;  3CK8 A;  1AWC B;  3TWT A;  2WB2 A;  1JCR A;  2P9I G;  3SNX A;  1FVF A;  4XI0 A;  1ELW A;  3OXG A;  3ZPJ A;  3I5P A;  3PZ4 A;  2MHK A;  3OXF A;  4DI3 A;  1WY6 A;  3VTX A;  1D9S A;  3KAE A;  4U8V D;  2FBN A;  4I1M A;  1OWP A;  1GW6 A;  1HS6 A;  2LAH A;  1YA0 A;  2J08 A;  4AEZ C;  1LTX A;  1E7V A;  3S7B A;  1S64 A;  1KPS B;  1IQR A;  3CHM A;  2WXO A;  4N3B A;  1EYH A;  3RO3 A;  3D3M A;  4EBA A;  3B7U X;  2QC9 A;  3T9K A;  5FIO A;  5B1A E;  2J09 A;  2ZU6 B;  4HRN A;  1SQM A;  4OAU C;  4PH4 B;  1KT0 A;  1X5B A;  3FH7 A;  4PS3 A;  3CVX A;  3KEZ A;  1TNB A;  2ILR A;  3IV0 A;  4M7C A;  5JHB A;  3FTV A;  2B6C A;  4L2L A;  4J8F A;  3LS8 A;  1SZA A;  4KBQ A;  2XCC A;  4ZHB A;  3MV2 B;  2LAI A;  3FHE A;  3PZ1 A;  4EPZ A;  4GA1 A;  2KCK A;  3DST A;  1UW4 B;  4XI9 A;  3TWW A;  3PVL A;  3ULQ A;  1P5Q A;  5G05 C;  4FLH A;  4WAF A;  3E32 A;  3TWU A;  4GZ3 A;  4YDW A;  1Y6I A;  2BKG A;  2GRR B;  4JW1 A;  3EJN A;  3I3N A;  4C48 B;  3QWP A;  1N54 A;  3AG3 E;  4HOS A;  2NXP A;  3E37 A;  2XGO A;  3IXE A;  1Y8M A;  2V8S E;  2C2L A;  3Q78 A;  3RRU A;  5BV1 A;  2VYI A;  5ENP D;  3EIQ C;  3CVV A;  3LCA A;  1BI8 B;  1S0P A;  2BTD A;  2AW6 A;  4KVO A;  3L16 A;  1H2T C;  4CEM A;  4H7X A;  3FH5 A;  2CG3 A;  5D0Q D;  2Y1L E;  1E8Y A;  4JA9 A;  2WQH A;  2AWI A;  5EKQ D;  1ELK A;  2EQX A;  4I1O B;  1DCE A;  4MS6 A;  2DBA A;  2I1K A;  2XEE A;  3HXC A;  1PAQ A;  3DEP A;  2GRM A;  3AU4 A;  1K8K G;  1HU3 A;  3UT8 A;  2V0P A;  4E6H A;  4N2S A;  4U0Z A;  4KZ0 A;  1QZ2 A;  3L9T A;  3ASH A;  2E0I A;  3D9P A;  1E96 B;  3G2U A;  3DSX A;  3F6Q A;  5ITZ F;  3TGO A;  4TUM A;  4OVU A;  2AXZ A;  3V79 K;  4N3C A;  3IHY A;  4ILH B;  1SVX A;  2YIN A;  3PE4 A;  1KT1 A;  2XZD G;  3ISM C;  3RJV A;  5AN8 A;  4G26 A;  5ANR A;  5H7P A;  1VDY A;  2BED A;  3DSV A;  2M63 A;  3ENE A;  2UY1 B;  1H6K A;  3BQO A;  4HLE A;  2DCP A;  5FZS A;  2C0M A;  3OXL A;  2QZA A;  4J8E A;  4JPS A;  5FZR A;  3S7J A;  3UI2 A;  1S70 B;  1WDY A;  2H6H A;  3CVN A;  3QNK A;  1D8D A;  5A7D B;  3GZ2 A;  5B3S E;  1B89 A;  3D9K A;  2NYJ A;  1OT8 A;  3PUJ A;  1N52 A;  4YDY A;  5BUZ A;  2FO7 A;  1XNF A;  2L9B A;  4EZJ A;  4AXH A;  3C3Q A;  1HX8 A;  3ZKJ A;  3Q79 A;  1NFI E;  2ZXW E;  4GZ6 A;  1BU9 A;  3SHF A;  3V2X A;  4O1O A;  4HOT A;  2L6B A;  5HRY A;  2IO3 C;  3T8K A;  3TL5 A;  1A17 A;  2RD0 A;  4NUR A;  3SF4 A;  4MRU A;  5CMW A;  5J08 A;  3EDT B;  4L2Y A;  3ML9 A;  3TXM A;  2VGX B;  5G04 J;  4BER A;  5BXO A;  4G8K A;  2WXP A;  1TN8 A;  4J8Y A;  3CK7 A;  4LER A;  3KD7 A;  4U8H A;  4EHM A;  4ILI A;  4O6F A;  2WXK A;  1ELR A;  3FUN A;  4BT9 A;  3T5V A;  2XEH A;  4BY6 A;  4LEU A;  1IXV A;  2ZIR A;  1H2V C;  4JHR A;  4J6I A;  4GYY A;  2VSO E;  2GRN B;  3D9O A;  3ONL A;  3UKU G;  5G2N A;  2HM8 A;  4YVO A;  3V2O A;  1E90 A;  5D66 A;  1OWO A;  3ULY A;  3CQC B;  4HRL A;  5D0O D;  4BX9 A;  2KBX A;  4AOF A;  4TRQ A;  2J9Q A;  3Q15 A;  5BNW A;  3HVE A;  4H7Y A;  1IYG A;  3UMV A;  5EYL A;  4GTM A;  4C9B B;  2R59 A;  4FAD A;  2ION A;  2KCV A;  1TNO A;  4Y6C A;  2GW1 A;  3CVY A;  3FFL A;  4L9P A;  3ZXP A;  1OY3 D;  2R2L A;  5EN5 D;  5C1D A;  1FT2 A;  2B0O E;  1X81 A;  1TR4 A;  2GRL A;  3VLF A;  2X6K A;  3UIO C;  3CSF A;  1TNY A;  3C3R A;  3KSL A;  5ENQ D;  4K5B A;  4AJW A;  2RKK A;  4YDE A;  4O1P A;  1U3D A;  4N3A A;  2IFU A;  3PRE A;  2OEV A;  2IO2 C;  5AEN A;  1TJF A;  3LJN A;  4EZL A;  1SA4 A;  3Q47 B;  4JEH A;  2CFU A;  2RG8 A;  1QNF A;  3FTS A;  2PQR A;  4B0Z A;  2MRI A;  2RFA A;  2KC7 A;  2C0L A;  5BW8 C;  3U9W A;  4ACL A;  5KJK A;  4OYS A;  4TUU A;  3LYA A;  2A5U A;  3ULE G;  1AP7 A;  5A23 A;  3ZYL A;  2GRQ B;  4I6G A;  2I6H A;  2I9C A;  3CIA A;  4BFR A;  3I4R B;  3QKY A;  1RW2 A;  2KM4 A;  2XS8 A;  3HXE A;  5LP0 A;  5ENN A;  3UQ3 A;  4G11 A;  2VSX E;  1A5E A;  4BTB A;  5BXU A;  4I9C A;  4G2V A;  2IOL A;  5ANL A;  2VTB A;  1DCQ A;  3GZS A;  5AIJ A;  3UIN C;  2PM7 A;  2YQ8 A;  2P9P G;  4RLY A;  5HKP A;  4KYO B;  1HH8 A;  3UPV A;  1OCC E;  3DRA A;  5G55 A;  4UI9 K;  2VSN A;  5ENS D;  1E7U A;  3ZU7 B;  2ETB A;  5LCW J;  2YNQ A;  2R05 A;  3LVQ E;  3RRM B;  5JA4 D;  1UN8 A;  3FWV A;  5FTP A;  3UXG A;  3WG7 E;  2Y3A A;  3NAW A;  4CT4 A;  3TWR A;  1TYQ G;  3ZNG A;  3EU5 A;  4NQ0 A;  2WXF A;  4APO A;  4GAA A;  3CKB A;  3P2B A;  5T3R A;  3JCK C;  5CEC B;  5EDS A;  5LCW C;  1H6P A;  3UX4 A;  1XGW A;  3B7T A;  4HI8 A;  1BLX B;  3DPD A;  3LPZ A;  3QDN A;  3IEG A;  4IUL A;  4JL0 A;  5ENR D;  2QYJ A;  4X8Q A;  3HG0 D;  2Y69 E;  3APD A;  5HI7 A;  1INZ A;  4U8Y D;  2WXM A;  2I2O A;  3LY9 A;  4N5C A;  2X38 A;  3BUA A;  3FUK A;  3EU9 A;  3EUV A;  4F3V A;  5FT9 A;  3Q9U C;  4U7E B;  3UTM A;  3E33 A;  2L6J A;  1UG3 A;  2J8S D;  3UKR G;  3ASO E;  1K3Z D;  4GZ5 A;  3R9A B;  4DRX E;  5B1B E;  3HHM A;  1V55 E;  3JXI A;  3HXD A;  2PZI A;  3L82 A;  2FUL A;  3NF1 A;  3C98 A;  2WMO A;  3RO2 A;  3QWV A;  2EIJ E;  4LSZ E;  5DIZ A;  3S7D A;  3DSW A;  3FUH A;  4G1T A;  4WNF A;  4EQF A;  3K9I A;  4XIF A;  1TN7 A;  3DPY A;  3FUD A;  5EX3 A;  4GA2 A;  3CVW A;  1NP7 A;  2DZN A;  3ZIM A;  3NZU A;  3EHQ A;  4U63 A;  3WXX A;  1O1S A;  2FF4 A;  2OVB A;  4Q94 A;  2KXP C;  1PC2 A;  4GPK A;  1DVP A;  3SBT B;  3FUL A;  1V54 E;  3PNT B;  3JUI A;  4AV7 A;  2L0T B;  3B95 A;  2E2E A;  1KZP A;  5AAO A;  3SQV A;  3D9I A;  3IHV A;  4Q69 A;  2XRZ A;  1IHB A;  5HQ8 A;  3ML8 A;  1NA0 A;  3T8M A;  3RIB A;  3APC A;  1OWN A;  1HZ4 A;  5ENO D;  1HXI A;  2IF4 A;  3FUM A;  1D8E A;  4V3I A;  4MLP A;  1MYO A;  1N4P A;  3SD5 A;  3T5X A;  4G23 A;  1YCS B;  5CCL A;  1LD7 A;  4BSZ B;  5EIL A;  3QK0 A;  3CHP A;  2NC9 A;  1TNU A;  5CEA A;  3Q7A A;  4HS2 A;  3UT7 A;  3FUF A;  4HB5 A;  5BV0 A;  4B89 A;  3B7R L;  3D9H A;  5AQB A;  3EHR A;  3ZN3 A;  3CHS A;  3PZ2 A;  2XHE A;  2LUH A;  3KSQ A;  1N95 A;  2MOW A;  1MZC A;  2IU1 A;  3LY7 A;  4Y6W A;  3FTW A;  5ENT D;  3FUI A;  4DUI A;  4DLQ A;  3MKR A;  2CHZ A;  4CDN A;  3SFX A;  4BES A;  2H6I A;  3PEV B;  3O4Z A;  2A5E A;  3QJZ A;  3SGH A;  3RRN B;  1MJ0 A;  4I17 A;  4FUL A;  2KZT B;  5KJL A;  3ZVV A;  1U3C A;  4GTS A;  4RG9 A;  4UQY A;  3FU3 A;  2YHE A;  2P9U G;  4UWK A;  1E8X A;  3HRA A;  4BET A;  2GGF A;  2WXI A;  4KT6 B;  4FP7 A;  3ZHE B;  1O1T A;  3ESK A;  3ZYQ A;  3U64 A;  4K03 A;  5AYW D;  1G3N B;  4UQX A;  3Q73 A;  4I43 A;  4GTO A;  3OTN A;  4W9R A;  2R17 C;  3ABM E;  5EID A;  4N39 A;  3LKU A;  4GTV A;  2LSU A;  4GML A;  1IKN D;  1WAO 1;  4CDM A;  2WQ6 A;  3TWV A;  4EEC A;  2OCC E;  2R5S A;  1OXJ A;  2BUG A;  3L13 A;  5CRV A;  2WPV A;  3FTZ A;  3W9F A;  5C2Y A;  3AAA C;  1TN6 A;  3RAU A;  4U95 D;  1BI7 B;  2Q7F A;  2OND A;  4HOR A;  3Q49 B;  3ABL E;  1QQE A;  3Q9N C;  3NOC D;  3MKQ B;  2V5F A;  2WXL A;  2OV8 A;  3DWL G;  2UWJ G;  3EIJ A;  3QAR A;  4URK A;  4I6J A;  3PH0 C;  2LNI A;  3PEU B;  5CED B;  1OUV A;  1K1A A;  3V31 A;  3ZW3 A;  5AQA A; 
#chains in the Genus database with same CATH homology
 3UIO C;  3UIN C;  2GRR B;  2IO3 C;  1KPS B;  3UIP C;  2IO2 C;  2GRN B;  1Z5S C;  2GRO B;  2GRQ B;  5D2M C;  2IY0 C;  2GRP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...