1KPSB

Structural basis for e2-mediated sumo conjugation revealed by a complex between ubiquitin conjugating enzyme ubc9 and rangap1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
b'TDLSTFLSFPSPEKLLRLGPKVSVLIVQQTDTSDPEKVVSAFLKVASVFRDDASVKTAVLDAIDALMKKAFSCSSFNSNTFLTRLLIHMGLLKSEDKIKAIPSLHGPLMVLNHVVRQDYFPKALAPLLLAFVTKPNGALETCSFARHNLLQTLYNI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SUMO-1 conjugating enzyme
publication title Structural basis for E2-mediated SUMO conjugation revealed by a complex between ubiquitin-conjugating enzyme Ubc9 and RanGAP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/protein transport
total genus 48
structure length 156
sequence length 156
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 1kpsB00
2IO2C 3UIOC 1KPSB 2GRQB 3UIPC 2GRRB 1Z5SC 2GROB 2GRPB 3UINC 5D2MC 2IY0C 2GRNB 2IO3C
chains in the Genus database with same CATH superfamily
1H2TC 5FQ6A 3RKVA 1D8DA 3TXNA 1HFAA 1BPOA 4EZLA 1WM5A 5AQ7A 1QYMA 4FU3A 4ILHB 5BUZA 1XGWA 3LPZA 2FI7A 4LCTA 4FJYA 3TWTA 3CK9A 2FBNA 2CG2A 4N39A 3CLJA 2VQ2A 4I9EA 4XIFA 4GYYA 2IOSA 1RZ4A 4GMJA 1S64A 4RVBA 3SI5A 4DX1A 1TN8A 3EDTB 4LERA 2OEVA 1UJKA 1OCCE 2J09A 2FO1E 3BUAA 3X2QE 3NZSA 2XCBA 3C3OA 3APCA 4A3VA 3L82A 1EDUA 2IF4A 3B7TA 3IKOB 1JCQA 1H2VC 3SFXA 3PNTB 2WQ6A 2DCPA 3D9JA 4W9RA 2NYJA 3W9FA 3NOCD 4YVQC 4E6HA 5EN5D 3UPVA 3L6AA 1SVXA 4X8QA 3FP3A 2DWZA 3ASHA 1EF1C 1LD7A 2IY0C 4NRHB 4UI9K 2GROB 4J8DA 1ELWA 5T3RA 3G2WA 3GZSA 3QARA 3ONLA 5KNHD 3LJNA 3UKUG 5CCMA 1UW4B 4G24A 2RD0A 5ENOD 1UN8A 2LXMA 1X81A 2OVFA 3FY4A 3UQ3A 3D9NA 1PY1A 1YMPA 3Q7FA 1N95A 2QYJA 3E32A 4J8EA 4AOFA 4PH4B 1U2VG 2XEHA 3SZ7A 2VSYA 4GCOA 2KCLA 4UWLA 1WAO1 3PZ2A 3K9IA 2LO6A 3N71A 3ZHEB 2R17C 4O60A 4Q96A 4EHMA 3I3NA 3QWVA 2XS8A 1P5QA 1N94A 4HQDA 5E75A 3PUKA 5CBNA 1OCOE 2LSUA 3DEPA 3PZ1A 3QJZA 1NA0A 4BT8A 2XRZA 5ENTD 3PDNA 2X6FA 2CG3A 4K03A 2KATA 4FULA 4GPKA 4DI3A 4C9BB 5H7PA 4DRXE 4JHJA 3ML8A 2WXOA 1OWMA 2P9UG 3CV0A 2EIKE 4BSXA 3SFZA 3B7SA 2I1JA 4CGWA 4CYMD 3KAEA 2B0OE 4XX5A 4TV3A 2X6JA 4A55A 1IXVA 4HNAD 4N5QA 4A3TA 2KM4A 3ESLA 3L22A 2WXGA 3APDA 3CVWA 2ETAA 3T9KA 4HVBA 2KZTA 4KVMA 2R2LA 2V0PA 3Q15A 5D2MC 4JPSA 3RK6A 2F8YA 3PREA 5KNGA 3VLDA 4I1AA 2VGXB 4CZ2D 1Z3YA 4LRZA 3FTYA 4GZ5A 3CVPA 4G23A 5LOZA 1OUVA 3D9IA 1N4PA 2WXQA 4HBDA 1DCEA 3AG3E 4DK5A 4UI9J 4GA1A 3OXGA 1O1TA 4GAAA 3TL5A 1E7UA 5LFAA 4U96D 2L6BA 3CVQA 3UT8A 1MJ0A 2EILE 3AG2E 4Q69A 1TJFA 4BSZB 2IQCA 2QY7A 4MKTA 5JA4D 1G3NB 1XNFA 3FUFA 1JCSA 1FT1A 4PS7A 4JHKA 2PQRA 5KCMA 2KBXA 3CHPA 4TXPA 1N4QA 3GZ1A 3TWVA 3FTXA 2ZIRA 3L17A 3UINC 1OCZE 3V2XA 3CVXA 3LJ3A 4L2YA 3B7RL 4C0EA 2AJAA 1U3CA 4XKCA 4BWRA 4PS3A 5AENA 2FF4A 4LNBA 1V54E 2RFMA 1TNUA 2H6GA 4J6IA 3DEOA 2XCCA 4G25A 4WWNA 3ZNGA 3FU6A 2WMOA 3D9PA 4FHJA 3ZYKA 4JHRA 1Z6TA 2HR2A 3FUNA 2LSVA 4AM9A 4M7CA 1MX2A 2JABA 3TWWA 1ZB1A 3E33A 3QB2A 3E37A 3EHQA 2P9LG 4LNUD 3ZYQA 2CHWA 2DZNA 3FTVA 5CMWA 4GTPA 2OV8A 3U64A 5AAOA 3Q75A 5BXOA 2GW1A 3TWXA 4FLBA 4GTRA 3E4BA 4HRNA 4AIFA 3IV0A 5EIBE 3R7RA 2YHCA 4OAVB 2PM7A 4JW1A 2AXUA 4H7YA 1OWNA 4HRLA 1NP7A 3IHVA 2XZTG 2V5QC 1NL4A 3MJWA 2UY1B 4GTMA 5BNWA 1N52A 3ZXPA 4B0ZA 4J8SA 2RG8A 3EUVA 3CVYA 3TWQA 4E85A 3GZ2A 5G04C 3UTMA 2C0MA 4RSYA 3TWUA 4RG9A 4YVOA 1BI7B 2QYUA 4N2SA 3QOUA 3SNXA 5KJLA 3DSTA 3MKQB 4JA9A 5B3SE 4GZCA 1MZCA 4GU5A 4O1PA 1BI8B 5CEAA 4IRUA 2C0LA 3ZEFA 5BV1A 1UOHA 5J90A 1E90A 3VTXA 3ESKA 3U66A 2XRYA 2FO7A 2Q7FA 5C2YA 3S7JA 1KZOA 1IKND 1SA4A 2Y0BG 3ASGA 3Q49B 4WNGA 3QNKA 4UQXA 5KWDA 2E2EA 2KCKA 2XS1A 3UUXA 3LVRE 3CQCB 3TG5A 3ZPJA 1WDYA 2QC9A 2GRPB 2X6IA 2EIME 4EPZA 5JHAA 5FZSA 5FT9A 5LCWJ 4WWPA 3CSTA 3VLFA 4OAUC 1ELKA 5G05J 4EBAA 5AIJA 2H6FA 3HYMB 3D9LA 3PZDA 5AJDA 1SQMA 3T8KA 4DUIA 2H6HA 4FC8A 3JQ0A 4Y6WA 3HG0D 3PNLB 5KJMA 2L0IA 3RRUA 5AN8A 4TRQA 2AWIA 3FULA 3NQPA 4BFRA 2F8XK 4RLYA 3HIZA 4HXIA 4I17A 5B1BE 4OYSA 3F6QA 5CMYA 3PRZA 2VGEA 2A5EA 4WUYA 4JVSA 3Q7AA 3ASNE 3MA5A 4EQFA 2GRNB 2DYRE 2IO2C 5AJLA 4U07A 3U9WA 1TR4A 2ETCA 4GTSA 3UM2A 2PNNA 4KMOA 2WXIA 4PDXA 4ATGA 1H6KA 3RO2A 3EIQC 3Q9UC 5ENPD 3ZFWA 3V30A 3FTSA 5ENSD 4KT6B 5AYWD 3QWWA 3HVEA 3FTWA 1N0QA 3AS8A 4YDYA 2FEZA 2R02A 3ZHEA 1TJCA 4BX9A 3ASOE 1TNZA 4DLOA 3KSLA 5FZRA 1H6OA 2GRMA 2XPYA 2BKGA 4GMLA 3TJPA 4UUCA 1OY3D 1AP7A 3L54A 4BTAA 5JJ6A 2BF0X 4BETA 3G2TA 1Y8MA 4Q94A 4JB8P 1B89A 3HXDA 2WXMA 2VSOE 4EECA 4JL0A 3NB2A 5FQ4A 3IHYA 2X38A 3DSXA 4EZKA 3SFYA 1HO8A 1MQSA 2WB2A 3CVNA 3RRMB 1Z5SC 4H7XA 1DVPA 2HO1A 3QDNA 2WXRA 3UIOC 2M63A 5HQ8A 4JEHA 1E96B 2P58C 3OAWA 3UT7A 4K5AB 4N3BA 4L2LA 3LCAA 1INZA 5D66A 3JQ1A 3UMVA 2Y3AA 4LEUA 4FJZA 1X5BA 2YQ8A 3CKBA 1TEZA 2EINE 5G2NA 4I2WA 3C98A 5KJKA 1E8XA 4MS6A 3GW4A 1E8ZA 1WG0A 2VGXA 2YINA 3ML9A 4JA7A 4R7LA 2XPIA 4HB5A 4U04A 3VTYA 2P9PG 1JUQA 4U7EB 4CDRA 1FPPA 3QAQA 3AU4A 3CVUA 2KC7A 2I6HA 5ENNA 1FVFA 4I6JA 2RKKA 2FULA 3IBEA 4MRUA 1KT0A 4TUMA 3CHMA 3ZYLA 4G11A 4XEIG 4BERA 4BT9A 3SQVA 5DIZA 1LD8A 4LNGA 3AS5A 5AQBA 1BD8A 4CT0A 4ZFHA 3CVVA 3P2BA 3TWRA 4HOUA 3FH5A 1K8KG 3HXBA 4XE0A 4FLHA 4RQIA 3D9MA 3CEQA 4JC8A 4DX6D 2J9QA 1N54A 2OEWA 2DZOA 1E7VA 2I9CA 4WAFA 2VTBA 2H6IA 4GYOA 3FUEA 2CHXA 3EJNA 1Z3XA 3B7UX 3GYZA 4J8FA 4U95D 4YDOA 4ME2A 1IHGA 2IU1A 4CEMA 3TGOA 3S7DA 4GB9A 3DXKG 3FU3A 3JUEA 3Q73A 4GZ6A 1KT1A 3R9AB 3APFA 2XEEA 5ENRD 4URKA 3BQOA 3DSWA 4GMRA 3C3RA 1K1BA 2LXLA 3SGHA 4WNFA 3HXCA 3ISMC 4DX2A 4ATZD 2EIJE 1MX6A 2IJGX 2J8SD 2WXKA 3LY7A 3I4RB 2R03A 4F1PA 3KD7A 4DJAA 3E34A 4GPMA 1IHBA 1TNYA 3FUIA 2UY1A 2QFCA 4DPRA 1K1AA 3RRNB 3MEKA 3FUHA 2LUHA 4KBQA 2WXPA 1O5MA 4Z68A 2ZGGA 4B89A 4V3IA 2V8SE 4C48B 1N4SA 4HLLA 3CHQA 3AG1E 3ZXSA 4APFA 3MYVA 3CK7A 4BEPA 2F37A 3DPYA 2R59A 3Q79A 3PS6A 4HOSA 3MKQA 4I43A 4CT4A 2YHEA 3RSEG 1D9SA 4GTOA 4K0RA 4LUNU 4UWFA 2E0IA 5HRYA 4FHKA 1OT8A 1A17A 4QFVA 4DI4A 1FCHA 3C5RA 4AV7A 5G55A 3D9KA 4GYWA 4GA2A 4L23A 4CCAA 3BU8A 3RAUA 4L1BA 5ARFA 1VDYA 3B13A 4J0UA 1OWLA 3MCXA 2J49A 3FU5A 2RFAA 3L16A 1MX4A 4U8VD 1MYOA 3PZ3A 3L08A 4PUCA 4U63A 5G04J 3G2VA 4JXTA 3ABME 3O4ZA 1JWFA 3CIAA 3PEUB 4HOQA 4KZ0A 3FWVA 3TXMA 2VSNA 3ZW3A 3ASFA 3P1UA 4G8KA 3OTNA 2DYSE 2NSZA 2Y4TA 2VGYA 2XPZA 3DBSA 3U4TA 3NAWA 4AP2A 3CQGB 5BPPA 5EYPF 3FFLA 3ULEG 1E8WA 1HG5A 4B93B 2LAHA 3BG1B 2MHKA 3FEXA 4J7WA 4P29A 3TWSA 4U0UA 4NURA 3TG4A 3DSUA 3URZA 3B95A 2V4HC 3FHEA 2JEKA 2LAIA 5CHEE 5HKPA 1IYGA 1HZ4A 2J4BA 2XGMA 3DWLG 4FP7A 4A1GA 1OWPA 2J07A 2R05A 2VYIA 4I2ZA 4I1OB 2B6CA 3LY9A 4YNDA 4G26A 5AQAA 3IEGA 5AARA 3FEYA 4NIKA 4EBAG 1TNOA 3MV2B 3OXLA 2KXPC 4TXRA 4D10C 4I1MA 4KVOA 4GTVA 4HRMB 1KZPA 3EU9A 4XKBA 5FJYA 4B8CB 3T5VA 4GTTA 1ELRA 5BT1A 2AXVA 4TUUA 1NZNA 2R5SA 2XHEA 3VLEA 4U8YD 1H2UA 1NFIE 5EILA 3MGBA 5ANLA 4ACLA 3FU0A 4O1OA 4ILGA 2WXHA 3L13A 3SF4A 4GA0A 3W9GA 3RO3A 2EQXA 5A23A 2GRRB 1H0AA 4U0ZA 1K3ZD 4GCNA 1JWGA 4AEZC 1HU3A 2CFZA 3G2UA 4XZ4A 3U3WA 1HE8A 3JXJA 3EHMA 4JEUA 2L6JA 3HXEA 3FDHA 2L9BA 2CHZA 1QBQA 1SA5A 3FUKA 1OXJA 4UQYA 3UX4A 1EPUA 5A6CA 2BKKB 3QWPA 2WXFA 3LS8A 1OWOA 4CDNA 3AU5A 1W3BA 2P9NG 2NXPA 3D9OA 3UKRG 3EIJA 3ZVVA 4QQIA 5FQ7A 2WVIA 4IULA 1IQUA 4Y6CA 4CGVA 2NC9A 3ULYA 3V2OA 3BEEA 5CEDB 1ZBPA 2WXNA 2ZXWE 1ZU2A 3UXGA 2OOEA 4AXHA 2P2CP 3SHFA 5B1AE 2YNQA 1E8YA 1PAQA 3L9TA 4K5BA 1S70B 2C2LA 3NF1A 3C72A 4F7AA 4O6FA 3MKRA 5LP0A 4N5CA 1HH8A 2P9KG 3SD5A 2BEDA 2DBAA 3R9MA 4CRWA 3R7QA 2I1KA 3SBSA 2DIWA 1SZ9A 4IYPA 4UWKA 3QC1A 4ANWA 4AY5A 4WNEA 4EZJA 4ANXA 1SW6A 1H6PA 2F0YA 4ILIA 2DVWA 5ITZF 5M72A 1TYQG 1HG2A 4XI0A 1U3DA 4AY6A 4UQZA 4UWHA 1IQRA 1GW6A 5EDSA 3CR3A 3PE3A 4LG6A 5ARGA 3WXXA 2WQ7A 4HI9A 1FVHA 3HRAA 5A7DB 2WXJA 1DCQA 2JLBA 4AJWA 3HHMA 2MOWA 2J08A 4AVXA 3PE4A 4KXKB 3RIBA 1HX8A 2AXZA 3HVEB 5FIOA 3QK0A 4G8LA 4M3OA 3KEZA 2ONDA 5FQ8A 3UM3A 1S0PA 3WG7E 4PS8A 4BX8A 1OCRE 4ZHBA 1RW2A 2J4DA 3ENEA 5EX3A 4B94A 3UI2A 3MV3B 3MZLB 4I9CA 2Y4UA 2HE0A 4HORA 4G2VA 3ZGQA 3ZKJA 1D8EA 2BTDA 3ZUVB 1H19A 3ZIMA 5T4YA 2AVPA 3E30A 3DPDA 3ABLE 4BY6A 3EHRA 3V79K 2IFUA 2P9SG 5KBAA 2WMNA 3UM0A 2WM9A 3I5PA 1HS6A 5IY5E 3S7BA 5AQ9A 4F53A 1HXIA 3JYSA 2UWJG 4U8HA 3LY8A 4LSZE 1O1RA 4YDEA 2VSXE 2A4ZA 1LF8A 4HLEA 1YCSB 3V31A 3FUJA 5CRVA 5ANRA 4HOTA 3RJVA 2XGOA 4F1SA 2ZU6B 4GTQA 5JJ7A 2PL2A 4APOA 1AWCB 2X6HA 3LKUA 5EIDA 3BG0B 1TN6A 2XZDG 2XQ0A 4YDWA 1O1SA 1L5JA 5E76A 5KJNA 3LVQE 3AJIA 4KYOB 1A5EA 3LEWA 4A1SA 3DSVA 4TXQA 5JJTA 4GZDA 1BU9A 2X3MA 2GGFA 1V55E 1UN9A 4RG6A 5ENQD 3D3MA 1N0RA 1YYHA 5FINA 3B7BA 4J8YA 3Q9NC 4NQ0A 2L0TB 5LX8A 3AG4E 3SBTB 2ZISA 1N4RA 2QZAA 3SY2A 4A63B 3ZRHA 5BXUA 4OVUA 4XI9A 1TN7A 3ZYMA 4UI9C 2OCCE 4L9PA 5EYLA 2IEJA 3HXFA 5BW8C 2IOLA 2IONA 3DRAA 3PH0C 3HDXA 1Q2ZA 5EX0A 3ABKE 4ABNA 2ETBA 5FWQA 3PVLA 3RU0A 1NA3A 1FT2A 3LYAA 5J08A 2KZTB 1Y6IA 5D0QD 1PC2A 3FUMA 5JHBA 4JD2G 3CGHA 2VTBB 3ZN3A 2BUGA 5DBKA 4CDMA 1HF8A 4KZCA 4N3CA 2V4LA 2PM6A 3I4GA 2VJ8A 3CK8A 4BESA 4G1TA 3AAAC 1QQEA 3CHOA 4F3VA 3CSFA 3AS4A 2WQHA 4GZ3A 1KLXA 3SO8A 2OVBA 4HS2A 3EHNA 2GRQB 4WNDA 1NI1A 3FH8A 3IXEA 5D0OD 1BLXB 5CBOA 3FH7A 4HI8A 4F6RD 3LDZA 4N3AA 2A5UA 5CRUA 4HFGA 3ASDA 4ANVA 2Y69E 3MX3A 5EKQD 2HM8A 2CFUA 3KSQA 3ZU7B 1TNBA 2X6KA 4U0SA 4I6GA 3DSSA 2XGSA 4OVVA 3NZUA 3FUDA 4FADA 3DXMG 1DNPA 2PZIA 4UWGA 3J5PA 4MLPA 5HI7A 3OXFA 2AW6A 5FTPA 4ANUA 2V5FA 3FTZA 4B8AA 2WPVA 3O48A 4I6EA 2XENA 2I2OA 3ONKA 1JPLA 4ACKA 3FTUA 3Q5MA 4IN3B 2P9IG 4DLQA 1WY6A 2LNIA 3C3QA 5CCLA 3KS2A 3T5XA 3UM1A 4BTBA 2Y1LE 3S7FA 5CECB 2IO3C 3PZ4A 1UJJA 2ILRA 3T8MA 4JZYA 3S2AA 5T8IA 2KCVA 3JXIA 4C0MA 1EYHA 2ZGDA 1UG3A 3UT4A 5HS0A 4DX7D 3UIPC 2HYZA 3Q78A 3KEAA 1DC2A 1JCRA 5JMND 1MHQA 1N9AA 4L7TA 3JCKC 3CKCA 1N11A 5FZQA 4NACA 4N2QA 3NBNB 5C1DA 3D9HA 2MRIA 3PEVB 4DX5D 2MYOA 3G2SA 2XEVA 1SZAA 4MBGA 3EU5A 1LTXA 4K5CA 5BV0A 3J5QB 2GRLA 1QNFA 1S63A 5LCWC 1YA0A 2WXLA 3CHRA 5G05C 3ULQA 4WWOA 3NOGD 1KPSB 2PQNA 3LXUX 3QKYA 3Q4AB 4FA6A 5CERB 3PUJA 1QZ2A 3TAXA 3CHSA 3Q47B 3CVLA 3JUIA
chains in the Genus database with same CATH topology
2IO2C 3UIOC 1KPSB 2GRQB 3UIPC 2GRRB 1Z5SC 2GROB 2GRPB 3UINC 5D2MC 2IY0C 2GRNB 2IO3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO2 C;  3UIO C;  1KPS B;  2GRQ B;  3UIP C;  2GRR B;  1Z5S C;  2GRO B;  2GRP B;  3UIN C;  5D2M C;  2IY0 C;  2GRN B;  2IO3 C; 
#chains in the Genus database with same CATH topology
 1H2T C;  5FQ6 A;  3RKV A;  1D8D A;  3TXN A;  1HFA A;  1BPO A;  4EZL A;  1WM5 A;  5AQ7 A;  1QYM A;  4FU3 A;  4ILH B;  5BUZ A;  1XGW A;  3LPZ A;  2FI7 A;  4LCT A;  4FJY A;  3TWT A;  3CK9 A;  2FBN A;  2CG2 A;  4N39 A;  3CLJ A;  2VQ2 A;  4I9E A;  4XIF A;  4GYY A;  2IOS A;  1RZ4 A;  4GMJ A;  1S64 A;  4RVB A;  3SI5 A;  4DX1 A;  1TN8 A;  3EDT B;  4LER A;  2OEV A;  1UJK A;  1OCC E;  2J09 A;  2FO1 E;  3BUA A;  3X2Q E;  3NZS A;  2XCB A;  3C3O A;  3APC A;  4A3V A;  3L82 A;  1EDU A;  2IF4 A;  3B7T A;  3IKO B;  1JCQ A;  1H2V C;  3SFX A;  3PNT B;  2WQ6 A;  2DCP A;  3D9J A;  4W9R A;  2NYJ A;  3W9F A;  3NOC D;  4YVQ C;  4E6H A;  5EN5 D;  3UPV A;  3L6A A;  1SVX A;  4X8Q A;  3FP3 A;  2DWZ A;  3ASH A;  1EF1 C;  1LD7 A;  2IY0 C;  4NRH B;  4UI9 K;  2GRO B;  4J8D A;  1ELW A;  5T3R A;  3G2W A;  3GZS A;  3QAR A;  3ONL A;  5KNH D;  3LJN A;  3UKU G;  5CCM A;  1UW4 B;  4G24 A;  2RD0 A;  5ENO D;  1UN8 A;  2LXM A;  1X81 A;  2OVF A;  3FY4 A;  3UQ3 A;  3D9N A;  1PY1 A;  1YMP A;  3Q7F A;  1N95 A;  2QYJ A;  3E32 A;  4J8E A;  4AOF A;  4PH4 B;  1U2V G;  2XEH A;  3SZ7 A;  2VSY A;  4GCO A;  2KCL A;  4UWL A;  1WAO 1;  3PZ2 A;  3K9I A;  2LO6 A;  3N71 A;  3ZHE B;  2R17 C;  4O60 A;  4Q96 A;  4EHM A;  3I3N A;  3QWV A;  2XS8 A;  1P5Q A;  1N94 A;  4HQD A;  5E75 A;  3PUK A;  5CBN A;  1OCO E;  2LSU A;  3DEP A;  3PZ1 A;  3QJZ A;  1NA0 A;  4BT8 A;  2XRZ A;  5ENT D;  3PDN A;  2X6F A;  2CG3 A;  4K03 A;  2KAT A;  4FUL A;  4GPK A;  4DI3 A;  4C9B B;  5H7P A;  4DRX E;  4JHJ A;  3ML8 A;  2WXO A;  1OWM A;  2P9U G;  3CV0 A;  2EIK E;  4BSX A;  3SFZ A;  3B7S A;  2I1J A;  4CGW A;  4CYM D;  3KAE A;  2B0O E;  4XX5 A;  4TV3 A;  2X6J A;  4A55 A;  1IXV A;  4HNA D;  4N5Q A;  4A3T A;  2KM4 A;  3ESL A;  3L22 A;  2WXG A;  3APD A;  3CVW A;  2ETA A;  3T9K A;  4HVB A;  2KZT A;  4KVM A;  2R2L A;  2V0P A;  3Q15 A;  5D2M C;  4JPS A;  3RK6 A;  2F8Y A;  3PRE A;  5KNG A;  3VLD A;  4I1A A;  2VGX B;  4CZ2 D;  1Z3Y A;  4LRZ A;  3FTY A;  4GZ5 A;  3CVP A;  4G23 A;  5LOZ A;  1OUV A;  3D9I A;  1N4P A;  2WXQ A;  4HBD A;  1DCE A;  3AG3 E;  4DK5 A;  4UI9 J;  4GA1 A;  3OXG A;  1O1T A;  4GAA A;  3TL5 A;  1E7U A;  5LFA A;  4U96 D;  2L6B A;  3CVQ A;  3UT8 A;  1MJ0 A;  2EIL E;  3AG2 E;  4Q69 A;  1TJF A;  4BSZ B;  2IQC A;  2QY7 A;  4MKT A;  5JA4 D;  1G3N B;  1XNF A;  3FUF A;  1JCS A;  1FT1 A;  4PS7 A;  4JHK A;  2PQR A;  5KCM A;  2KBX A;  3CHP A;  4TXP A;  1N4Q A;  3GZ1 A;  3TWV A;  3FTX A;  2ZIR A;  3L17 A;  3UIN C;  1OCZ E;  3V2X A;  3CVX A;  3LJ3 A;  4L2Y A;  3B7R L;  4C0E A;  2AJA A;  1U3C A;  4XKC A;  4BWR A;  4PS3 A;  5AEN A;  2FF4 A;  4LNB A;  1V54 E;  2RFM A;  1TNU A;  2H6G A;  4J6I A;  3DEO A;  2XCC A;  4G25 A;  4WWN A;  3ZNG A;  3FU6 A;  2WMO A;  3D9P A;  4FHJ A;  3ZYK A;  4JHR A;  1Z6T A;  2HR2 A;  3FUN A;  2LSV A;  4AM9 A;  4M7C A;  1MX2 A;  2JAB A;  3TWW A;  1ZB1 A;  3E33 A;  3QB2 A;  3E37 A;  3EHQ A;  2P9L G;  4LNU D;  3ZYQ A;  2CHW A;  2DZN A;  3FTV A;  5CMW A;  4GTP A;  2OV8 A;  3U64 A;  5AAO A;  3Q75 A;  5BXO A;  2GW1 A;  3TWX A;  4FLB A;  4GTR A;  3E4B A;  4HRN A;  4AIF A;  3IV0 A;  5EIB E;  3R7R A;  2YHC A;  4OAV B;  2PM7 A;  4JW1 A;  2AXU A;  4H7Y A;  1OWN A;  4HRL A;  1NP7 A;  3IHV A;  2XZT G;  2V5Q C;  1NL4 A;  3MJW A;  2UY1 B;  4GTM A;  5BNW A;  1N52 A;  3ZXP A;  4B0Z A;  4J8S A;  2RG8 A;  3EUV A;  3CVY A;  3TWQ A;  4E85 A;  3GZ2 A;  5G04 C;  3UTM A;  2C0M A;  4RSY A;  3TWU A;  4RG9 A;  4YVO A;  1BI7 B;  2QYU A;  4N2S A;  3QOU A;  3SNX A;  5KJL A;  3DST A;  3MKQ B;  4JA9 A;  5B3S E;  4GZC A;  1MZC A;  4GU5 A;  4O1P A;  1BI8 B;  5CEA A;  4IRU A;  2C0L A;  3ZEF A;  5BV1 A;  1UOH A;  5J90 A;  1E90 A;  3VTX A;  3ESK A;  3U66 A;  2XRY A;  2FO7 A;  2Q7F A;  5C2Y A;  3S7J A;  1KZO A;  1IKN D;  1SA4 A;  2Y0B G;  3ASG A;  3Q49 B;  4WNG A;  3QNK A;  4UQX A;  5KWD A;  2E2E A;  2KCK A;  2XS1 A;  3UUX A;  3LVR E;  3CQC B;  3TG5 A;  3ZPJ A;  1WDY A;  2QC9 A;  2GRP B;  2X6I A;  2EIM E;  4EPZ A;  5JHA A;  5FZS A;  5FT9 A;  5LCW J;  4WWP A;  3CST A;  3VLF A;  4OAU C;  1ELK A;  5G05 J;  4EBA A;  5AIJ A;  2H6F A;  3HYM B;  3D9L A;  3PZD A;  5AJD A;  1SQM A;  3T8K A;  4DUI A;  2H6H A;  4FC8 A;  3JQ0 A;  4Y6W A;  3HG0 D;  3PNL B;  5KJM A;  2L0I A;  3RRU A;  5AN8 A;  4TRQ A;  2AWI A;  3FUL A;  3NQP A;  4BFR A;  2F8X K;  4RLY A;  3HIZ A;  4HXI A;  4I17 A;  5B1B E;  4OYS A;  3F6Q A;  5CMY A;  3PRZ A;  2VGE A;  2A5E A;  4WUY A;  4JVS A;  3Q7A A;  3ASN E;  3MA5 A;  4EQF A;  2GRN B;  2DYR E;  2IO2 C;  5AJL A;  4U07 A;  3U9W A;  1TR4 A;  2ETC A;  4GTS A;  3UM2 A;  2PNN A;  4KMO A;  2WXI A;  4PDX A;  4ATG A;  1H6K A;  3RO2 A;  3EIQ C;  3Q9U C;  5ENP D;  3ZFW A;  3V30 A;  3FTS A;  5ENS D;  4KT6 B;  5AYW D;  3QWW A;  3HVE A;  3FTW A;  1N0Q A;  3AS8 A;  4YDY A;  2FEZ A;  2R02 A;  3ZHE A;  1TJC A;  4BX9 A;  3ASO E;  1TNZ A;  4DLO A;  3KSL A;  5FZR A;  1H6O A;  2GRM A;  2XPY A;  2BKG A;  4GML A;  3TJP A;  4UUC A;  1OY3 D;  1AP7 A;  3L54 A;  4BTA A;  5JJ6 A;  2BF0 X;  4BET A;  3G2T A;  1Y8M A;  4Q94 A;  4JB8 P;  1B89 A;  3HXD A;  2WXM A;  2VSO E;  4EEC A;  4JL0 A;  3NB2 A;  5FQ4 A;  3IHY A;  2X38 A;  3DSX A;  4EZK A;  3SFY A;  1HO8 A;  1MQS A;  2WB2 A;  3CVN A;  3RRM B;  1Z5S C;  4H7X A;  1DVP A;  2HO1 A;  3QDN A;  2WXR A;  3UIO C;  2M63 A;  5HQ8 A;  4JEH A;  1E96 B;  2P58 C;  3OAW A;  3UT7 A;  4K5A B;  4N3B A;  4L2L A;  3LCA A;  1INZ A;  5D66 A;  3JQ1 A;  3UMV A;  2Y3A A;  4LEU A;  4FJZ A;  1X5B A;  2YQ8 A;  3CKB A;  1TEZ A;  2EIN E;  5G2N A;  4I2W A;  3C98 A;  5KJK A;  1E8X A;  4MS6 A;  3GW4 A;  1E8Z A;  1WG0 A;  2VGX A;  2YIN A;  3ML9 A;  4JA7 A;  4R7L A;  2XPI A;  4HB5 A;  4U04 A;  3VTY A;  2P9P G;  1JUQ A;  4U7E B;  4CDR A;  1FPP A;  3QAQ A;  3AU4 A;  3CVU A;  2KC7 A;  2I6H A;  5ENN A;  1FVF A;  4I6J A;  2RKK A;  2FUL A;  3IBE A;  4MRU A;  1KT0 A;  4TUM A;  3CHM A;  3ZYL A;  4G11 A;  4XEI G;  4BER A;  4BT9 A;  3SQV A;  5DIZ A;  1LD8 A;  4LNG A;  3AS5 A;  5AQB A;  1BD8 A;  4CT0 A;  4ZFH A;  3CVV A;  3P2B A;  3TWR A;  4HOU A;  3FH5 A;  1K8K G;  3HXB A;  4XE0 A;  4FLH A;  4RQI A;  3D9M A;  3CEQ A;  4JC8 A;  4DX6 D;  2J9Q A;  1N54 A;  2OEW A;  2DZO A;  1E7V A;  2I9C A;  4WAF A;  2VTB A;  2H6I A;  4GYO A;  3FUE A;  2CHX A;  3EJN A;  1Z3X A;  3B7U X;  3GYZ A;  4J8F A;  4U95 D;  4YDO A;  4ME2 A;  1IHG A;  2IU1 A;  4CEM A;  3TGO A;  3S7D A;  4GB9 A;  3DXK G;  3FU3 A;  3JUE A;  3Q73 A;  4GZ6 A;  1KT1 A;  3R9A B;  3APF A;  2XEE A;  5ENR D;  4URK A;  3BQO A;  3DSW A;  4GMR A;  3C3R A;  1K1B A;  2LXL A;  3SGH A;  4WNF A;  3HXC A;  3ISM C;  4DX2 A;  4ATZ D;  2EIJ E;  1MX6 A;  2IJG X;  2J8S D;  2WXK A;  3LY7 A;  3I4R B;  2R03 A;  4F1P A;  3KD7 A;  4DJA A;  3E34 A;  4GPM A;  1IHB A;  1TNY A;  3FUI A;  2UY1 A;  2QFC A;  4DPR A;  1K1A A;  3RRN B;  3MEK A;  3FUH A;  2LUH A;  4KBQ A;  2WXP A;  1O5M A;  4Z68 A;  2ZGG A;  4B89 A;  4V3I A;  2V8S E;  4C48 B;  1N4S A;  4HLL A;  3CHQ A;  3AG1 E;  3ZXS A;  4APF A;  3MYV A;  3CK7 A;  4BEP A;  2F37 A;  3DPY A;  2R59 A;  3Q79 A;  3PS6 A;  4HOS A;  3MKQ A;  4I43 A;  4CT4 A;  2YHE A;  3RSE G;  1D9S A;  4GTO A;  4K0R A;  4LUN U;  4UWF A;  2E0I A;  5HRY A;  4FHK A;  1OT8 A;  1A17 A;  4QFV A;  4DI4 A;  1FCH A;  3C5R A;  4AV7 A;  5G55 A;  3D9K A;  4GYW A;  4GA2 A;  4L23 A;  4CCA A;  3BU8 A;  3RAU A;  4L1B A;  5ARF A;  1VDY A;  3B13 A;  4J0U A;  1OWL A;  3MCX A;  2J49 A;  3FU5 A;  2RFA A;  3L16 A;  1MX4 A;  4U8V D;  1MYO A;  3PZ3 A;  3L08 A;  4PUC A;  4U63 A;  5G04 J;  3G2V A;  4JXT A;  3ABM E;  3O4Z A;  1JWF A;  3CIA A;  3PEU B;  4HOQ A;  4KZ0 A;  3FWV A;  3TXM A;  2VSN A;  3ZW3 A;  3ASF A;  3P1U A;  4G8K A;  3OTN A;  2DYS E;  2NSZ A;  2Y4T A;  2VGY A;  2XPZ A;  3DBS A;  3U4T A;  3NAW A;  4AP2 A;  3CQG B;  5BPP A;  5EYP F;  3FFL A;  3ULE G;  1E8W A;  1HG5 A;  4B93 B;  2LAH A;  3BG1 B;  2MHK A;  3FEX A;  4J7W A;  4P29 A;  3TWS A;  4U0U A;  4NUR A;  3TG4 A;  3DSU A;  3URZ A;  3B95 A;  2V4H C;  3FHE A;  2JEK A;  2LAI A;  5CHE E;  5HKP A;  1IYG A;  1HZ4 A;  2J4B A;  2XGM A;  3DWL G;  4FP7 A;  4A1G A;  1OWP A;  2J07 A;  2R05 A;  2VYI A;  4I2Z A;  4I1O B;  2B6C A;  3LY9 A;  4YND A;  4G26 A;  5AQA A;  3IEG A;  5AAR A;  3FEY A;  4NIK A;  4EBA G;  1TNO A;  3MV2 B;  3OXL A;  2KXP C;  4TXR A;  4D10 C;  4I1M A;  4KVO A;  4GTV A;  4HRM B;  1KZP A;  3EU9 A;  4XKB A;  5FJY A;  4B8C B;  3T5V A;  4GTT A;  1ELR A;  5BT1 A;  2AXV A;  4TUU A;  1NZN A;  2R5S A;  2XHE A;  3VLE A;  4U8Y D;  1H2U A;  1NFI E;  5EIL A;  3MGB A;  5ANL A;  4ACL A;  3FU0 A;  4O1O A;  4ILG A;  2WXH A;  3L13 A;  3SF4 A;  4GA0 A;  3W9G A;  3RO3 A;  2EQX A;  5A23 A;  2GRR B;  1H0A A;  4U0Z A;  1K3Z D;  4GCN A;  1JWG A;  4AEZ C;  1HU3 A;  2CFZ A;  3G2U A;  4XZ4 A;  3U3W A;  1HE8 A;  3JXJ A;  3EHM A;  4JEU A;  2L6J A;  3HXE A;  3FDH A;  2L9B A;  2CHZ A;  1QBQ A;  1SA5 A;  3FUK A;  1OXJ A;  4UQY A;  3UX4 A;  1EPU A;  5A6C A;  2BKK B;  3QWP A;  2WXF A;  3LS8 A;  1OWO A;  4CDN A;  3AU5 A;  1W3B A;  2P9N G;  2NXP A;  3D9O A;  3UKR G;  3EIJ A;  3ZVV A;  4QQI A;  5FQ7 A;  2WVI A;  4IUL A;  1IQU A;  4Y6C A;  4CGV A;  2NC9 A;  3ULY A;  3V2O A;  3BEE A;  5CED B;  1ZBP A;  2WXN A;  2ZXW E;  1ZU2 A;  3UXG A;  2OOE A;  4AXH A;  2P2C P;  3SHF A;  5B1A E;  2YNQ A;  1E8Y A;  1PAQ A;  3L9T A;  4K5B A;  1S70 B;  2C2L A;  3NF1 A;  3C72 A;  4F7A A;  4O6F A;  3MKR A;  5LP0 A;  4N5C A;  1HH8 A;  2P9K G;  3SD5 A;  2BED A;  2DBA A;  3R9M A;  4CRW A;  3R7Q A;  2I1K A;  3SBS A;  2DIW A;  1SZ9 A;  4IYP A;  4UWK A;  3QC1 A;  4ANW A;  4AY5 A;  4WNE A;  4EZJ A;  4ANX A;  1SW6 A;  1H6P A;  2F0Y A;  4ILI A;  2DVW A;  5ITZ F;  5M72 A;  1TYQ G;  1HG2 A;  4XI0 A;  1U3D A;  4AY6 A;  4UQZ A;  4UWH A;  1IQR A;  1GW6 A;  5EDS A;  3CR3 A;  3PE3 A;  4LG6 A;  5ARG A;  3WXX A;  2WQ7 A;  4HI9 A;  1FVH A;  3HRA A;  5A7D B;  2WXJ A;  1DCQ A;  2JLB A;  4AJW A;  3HHM A;  2MOW A;  2J08 A;  4AVX A;  3PE4 A;  4KXK B;  3RIB A;  1HX8 A;  2AXZ A;  3HVE B;  5FIO A;  3QK0 A;  4G8L A;  4M3O A;  3KEZ A;  2OND A;  5FQ8 A;  3UM3 A;  1S0P A;  3WG7 E;  4PS8 A;  4BX8 A;  1OCR E;  4ZHB A;  1RW2 A;  2J4D A;  3ENE A;  5EX3 A;  4B94 A;  3UI2 A;  3MV3 B;  3MZL B;  4I9C A;  2Y4U A;  2HE0 A;  4HOR A;  4G2V A;  3ZGQ A;  3ZKJ A;  1D8E A;  2BTD A;  3ZUV B;  1H19 A;  3ZIM A;  5T4Y A;  2AVP A;  3E30 A;  3DPD A;  3ABL E;  4BY6 A;  3EHR A;  3V79 K;  2IFU A;  2P9S G;  5KBA A;  2WMN A;  3UM0 A;  2WM9 A;  3I5P A;  1HS6 A;  5IY5 E;  3S7B A;  5AQ9 A;  4F53 A;  1HXI A;  3JYS A;  2UWJ G;  4U8H A;  3LY8 A;  4LSZ E;  1O1R A;  4YDE A;  2VSX E;  2A4Z A;  1LF8 A;  4HLE A;  1YCS B;  3V31 A;  3FUJ A;  5CRV A;  5ANR A;  4HOT A;  3RJV A;  2XGO A;  4F1S A;  2ZU6 B;  4GTQ A;  5JJ7 A;  2PL2 A;  4APO A;  1AWC B;  2X6H A;  3LKU A;  5EID A;  3BG0 B;  1TN6 A;  2XZD G;  2XQ0 A;  4YDW A;  1O1S A;  1L5J A;  5E76 A;  5KJN A;  3LVQ E;  3AJI A;  4KYO B;  1A5E A;  3LEW A;  4A1S A;  3DSV A;  4TXQ A;  5JJT A;  4GZD A;  1BU9 A;  2X3M A;  2GGF A;  1V55 E;  1UN9 A;  4RG6 A;  5ENQ D;  3D3M A;  1N0R A;  1YYH A;  5FIN A;  3B7B A;  4J8Y A;  3Q9N C;  4NQ0 A;  2L0T B;  5LX8 A;  3AG4 E;  3SBT B;  2ZIS A;  1N4R A;  2QZA A;  3SY2 A;  4A63 B;  3ZRH A;  5BXU A;  4OVU A;  4XI9 A;  1TN7 A;  3ZYM A;  4UI9 C;  2OCC E;  4L9P A;  5EYL A;  2IEJ A;  3HXF A;  5BW8 C;  2IOL A;  2ION A;  3DRA A;  3PH0 C;  3HDX A;  1Q2Z A;  5EX0 A;  3ABK E;  4ABN A;  2ETB A;  5FWQ A;  3PVL A;  3RU0 A;  1NA3 A;  1FT2 A;  3LYA A;  5J08 A;  2KZT B;  1Y6I A;  5D0Q D;  1PC2 A;  3FUM A;  5JHB A;  4JD2 G;  3CGH A;  2VTB B;  3ZN3 A;  2BUG A;  5DBK A;  4CDM A;  1HF8 A;  4KZC A;  4N3C A;  2V4L A;  2PM6 A;  3I4G A;  2VJ8 A;  3CK8 A;  4BES A;  4G1T A;  3AAA C;  1QQE A;  3CHO A;  4F3V A;  3CSF A;  3AS4 A;  2WQH A;  4GZ3 A;  1KLX A;  3SO8 A;  2OVB A;  4HS2 A;  3EHN A;  2GRQ B;  4WND A;  1NI1 A;  3FH8 A;  3IXE A;  5D0O D;  1BLX B;  5CBO A;  3FH7 A;  4HI8 A;  4F6R D;  3LDZ A;  4N3A A;  2A5U A;  5CRU A;  4HFG A;  3ASD A;  4ANV A;  2Y69 E;  3MX3 A;  5EKQ D;  2HM8 A;  2CFU A;  3KSQ A;  3ZU7 B;  1TNB A;  2X6K A;  4U0S A;  4I6G A;  3DSS A;  2XGS A;  4OVV A;  3NZU A;  3FUD A;  4FAD A;  3DXM G;  1DNP A;  2PZI A;  4UWG A;  3J5P A;  4MLP A;  5HI7 A;  3OXF A;  2AW6 A;  5FTP A;  4ANU A;  2V5F A;  3FTZ A;  4B8A A;  2WPV A;  3O48 A;  4I6E A;  2XEN A;  2I2O A;  3ONK A;  1JPL A;  4ACK A;  3FTU A;  3Q5M A;  4IN3 B;  2P9I G;  4DLQ A;  1WY6 A;  2LNI A;  3C3Q A;  5CCL A;  3KS2 A;  3T5X A;  3UM1 A;  4BTB A;  2Y1L E;  3S7F A;  5CEC B;  2IO3 C;  3PZ4 A;  1UJJ A;  2ILR A;  3T8M A;  4JZY A;  3S2A A;  5T8I A;  2KCV A;  3JXI A;  4C0M A;  1EYH A;  2ZGD A;  1UG3 A;  3UT4 A;  5HS0 A;  4DX7 D;  3UIP C;  2HYZ A;  3Q78 A;  3KEA A;  1DC2 A;  1JCR A;  5JMN D;  1MHQ A;  1N9A A;  4L7T A;  3JCK C;  3CKC A;  1N11 A;  5FZQ A;  4NAC A;  4N2Q A;  3NBN B;  5C1D A;  3D9H A;  2MRI A;  3PEV B;  4DX5 D;  2MYO A;  3G2S A;  2XEV A;  1SZA A;  4MBG A;  3EU5 A;  1LTX A;  4K5C A;  5BV0 A;  3J5Q B;  2GRL A;  1QNF A;  1S63 A;  5LCW C;  1YA0 A;  2WXL A;  3CHR A;  5G05 C;  3ULQ A;  4WWO A;  3NOG D;  1KPS B;  2PQN A;  3LXU X;  3QKY A;  3Q4A B;  4FA6 A;  5CER B;  3PUJ A;  1QZ2 A;  3TAX A;  3CHS A;  3Q47 B;  3CVL A;  3JUI A; 
#chains in the Genus database with same CATH homology
 2IO2 C;  3UIO C;  1KPS B;  2GRQ B;  3UIP C;  2GRR B;  1Z5S C;  2GRO B;  2GRP B;  3UIN C;  5D2M C;  2IY0 C;  2GRN B;  2IO3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...