1KPSB

Structural basis for e2-mediated sumo conjugation revealed by a complex between ubiquitin conjugating enzyme ubc9 and rangap1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
TDLSTFLSFPSPEKLLRLGPKVSVLIVQQTDTSDPEKVVSAFLKVASVFRDDASVKTAVLDAIDALMKKAFSCSSFNSNTFLTRLLIHMGLLKSEDKIKAIPSLHGPLMVLNHVVRQDYFPKALAPLLLAFVTKPNGALETCSFARHNLLQTLYNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for E2-mediated SUMO conjugation revealed by a complex between ubiquitin-conjugating enzyme Ubc9 and RanGAP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/protein transport
molecule keywords Ubiquitin-like protein SUMO-1 conjugating enzyme
total genus 48
structure length 156
sequence length 156
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 1kpsB00
3UIPC 2IO3C 1KPSB 2GRNB 1Z5SC 5D2MC 2GRRB 2GRPB 2GRQB 3UIOC 3UINC 2IY0C 2IO2C 2GROB
chains in the Genus database with same CATH superfamily
1ZBPA 4ACKA 3KSLA 4EBAA 5C2YA 3PREA 4N3CA 4G8KA 4UWKA 5BV0A 3CVNA 4TRQA 1K8KG 3E4BA 4GA0A 4CCAA 3LPZA 4UQXA 4GZ5A 1U3DA 3V79K 3PEVB 1TJCA 4WWPA 4L9PA 3S7FA 2R02A 3EHQA 2CHWA 2V0PA 3UT7A 3CVXA 2GRPB 3MCXA 3HHMA 2J8SD 3FU3A 5CCMA 2KCVA 3DSVA 3HXDA 4JHJA 1TJFA 3B7TA 3MV3B 4ACLA 3FEYA 4F7AA 2KCLA 2VYIA 5BT1A 1E96B 1MZCA 1XNFA 4URKA 3J5QB 4GZ6A 1TNOA 2C0LA 1X5BA 3HDXA 2VQ2A 3FUNA 3PNLB 1P5QA 1HO8A 4APOA 2XS8A 4GPKA 3D9JA 1H19A 4I2WA 3FUHA 4U8VD 3FTWA 4XE0A 4U04A 5CERB 4WNGA 4LNGA 2WB2A 3ASHA 2X6IA 3GYZA 3L6AA 4EZJA 3S7DA 2JABA 3TWUA 3FTXA 4NURA 1VDYA 3FHEA 3NQPA 1N4SA 4L2YA 4E85A 3SFYA 4BWRA 2L9BA 4CT0A 4GAAA 4ME2A 1O1SA 3QWPA 1LTXA 3WXXA 4GCNA 1S64A 4MS6A 2KZTA 4BTBA 4JB8P 4GYWA 3L54A 1NA0A 5JJ7A 3TWWA 4N5CA 2XPZA 2X6FA 2V5FA 4J0UA 3AG3E 4IYPA 1MQSA 1YMPA 2H6GA 4F6RD 2LXMA 5CRUA 5G05J 3U9WA 5AJLA 1WY6A 2WMNA 3CHQA 3OAWA 3ML8A 5BXUA 3FY4A 3FU6A 2P9KG 4GTQA 4J8EA 4U8YD 1MHQA 3URZA 5FWQA 2WXGA 2E2EA 3I4RB 5CEDB 4G26A 2IO2C 3ZVVA 4HI8A 3QC1A 5AN8A 4FULA 3RO3A 4CT4A 4BEPA 1OCRE 3V30A 3RJVA 4NQ0A 4N3AA 2WXPA 2YHCA 4XIFA 2WXIA 5ANLA 3MA5A 2J49A 2GROB 2PZIA 3CSFA 4G23A 3JYSA 5FJYA 1BLXB 4JW1A 4HI9A 4ZHBA 1TNUA 2HE0A 4IRUA 5JA4D 4KT6B 5CBOA 1SVXA 1YA0A 4O1OA 3MKRA 4FU3A 1PC2A 4FP7A 5C1DA 5CMYA 3UUXA 2I2OA 2J07A 2RFMA 4JD2G 4I43A 4EQFA 1SQMA 4ZFHA 2VSNA 4GZ3A 3E33A 3Q49B 4K03A 4CGWA 4U07A 2JLBA 2XPIA 3CQGB 4DLQA 1B89A 4HXIA 5AARA 4GZCA 3IV0A 2HM8A 2IF4A 1N0QA 2WXKA 2P9LG 1IHGA 1D8DA 1Z5SC 3IEGA 2ZIRA 2VJ8A 2P9IG 5EKQD 1K1AA 4DX6D 3EHRA 3Q9NC 3UXGA 2KXPC 3TWRA 4HBDA 1Y6IA 4C48B 2WXOA 4XX5A 3RRMB 3UMVA 2AXZA 4YNDA 2BF0X 4WNFA 3E32A 3DXKG 2LAIA 2AVPA 4NACA 4BTAA 5ENOD 4RLYA 1TYQG 3TGOA 1AP7A 1TNYA 4LUNU 4N2SA 5LX8A 3CVQA 3MKQB 4MRUA 4WWNA 3ZGQA 4C0MA 5EILA 3AG4E 2P9UG 3R9MA 2WVIA 5KJKA 2VTBB 1OUVA 3OTNA 3W9FA 1IXVA 5CRVA 4HOTA 2GRNB 4O1PA 3HVEB 3MEKA 4N5QA 2F8YA 3Q47B 4M7CA 5FQ4A 3IKOB 5D66A 3MJWA 3DRAA 3U4TA 5BUZA 4B8AA 1DVPA 2ILRA 4Z68A 3QKYA 1QZ2A 4LNUD 4HQDA 5EIDA 3LVQE 5JJ6A 3PRZA 5CECB 1TNBA 4CDMA 3APFA 5KJLA 1MX2A 3DSTA 3AS8A 3LEWA 3UX4A 2V8SE 3ISMC 3HVEA 2YQ8A 2FF4A 4GU5A 1EF1C 1JWFA 4L1BA 2A5UA 2IEJA 3C5RA 4EBAG 4AJWA 3UKRG 4ILIA 3LVRE 4HNAD 3JUEA 2FO7A 1BU9A 4CDNA 1E8ZA 5EN5D 2OEVA 5EYLA 2J4DA 3Q5MA 4EPZA 5AYWD 1FT1A 2VGXB 5ENPD 3UKUG 2DZNA 3SHFA 2H6FA 4GB9A 1E8YA 5CBNA 1SA4A 4DLOA 1IQUA 1Z3YA 2BTDA 4UWGA 5EX3A 4BERA 4K5CA 2ZISA 3SF4A 4XZ4A 2UY1B 4W9RA 3MZLB 3L82A 3UM3A 3HRAA 3RO2A 4ILHB 5JHAA 3FH5A 3CHMA 3Q4AB 1XGWA 2IY0C 5HRYA 3RU0A 3B13A 3SY2A 5T3RA 1OWLA 2WXJA 3KEAA 2CHXA 3LYAA 5BV1A 3E34A 4J6IA 1EPUA 2NSZA 3ZHEB 2FEZA 3RK6A 2V5QC 4WUYA 2LSUA 1OWOA 1WAO1 5E76A 5LCWJ 5A6CA 3CK8A 3ZNGA 3RAUA 2OCCE 3LY9A 4AY6A 5G04C 3DSXA 2XGOA 5ENNA 4HOSA 3G2UA 5AQ9A 3TXNA 1BPOA 4RSYA 3L22A 3D9PA 4EECA 3FTUA 3ZIMA 5HI7A 3PVLA 2BKKB 4GTSA 1E8XA 2PM6A 4BY6A 4FLBA 2GRLA 1HF8A 4I2ZA 2EINE 3B7BA 3Q15A 1ELKA 5H7PA 3S2AA 3E37A 4LNBA 5ENSD 3C3OA 4JHKA 4J8SA 3T8MA 3CHPA 5ARGA 4GTOA 4FADA 4UQZA 2ETBA 1TN6A 4GYOA 1RW2A 4ATGA 3AU4A 4AXHA 5ENQD 1Y8MA 3W9GA 2MYOA 1QBQA 3T9KA 1BI7B 2DZOA 3ONKA 5FT9A 3FUKA 2GRQB 2OVBA 1QYMA 2J09A 3SGHA 4I6JA 4CRWA 4AV7A 3AJIA 3ABME 2QZAA 3TG4A 5BNWA 1INZA 3EHNA 1DCEA 3NBNB 1HH8A 1JUQA 5HS0A 4HOUA 3SFZA 2R59A 4GA2A 4U8HA 3I5PA 4AOFA 4H7YA 3TG5A 3NB2A 5EDSA 4G1TA 3ZYMA 2ZU6B 3FUIA 3BG1B 4PUCA 3ZYKA 4G8LA 4LCTA 4EZKA 1KT0A 3DEOA 5FTPA 3PUKA 4YVQC 3LKUA 3SO8A 5LFAA 3EJNA 2PL2A 2I9CA 2WXRA 4J7WA 1N54A 2ETAA 3S7JA 4QFVA 5AENA 2WXNA 2VGEA 3Q73A 3BEEA 3ZU7B 3CHSA 4MKTA 4RQIA 1SZ9A 3ULYA 5FQ6A 3S7BA 1LD7A 3HXCA 5EYPF 3L9TA 3QJZA 3U64A 4BT8A 3AS4A 4KXKB 1H2UA 5D2MC 4I1OB 3EIQC 5B3SE 3FTZA 3DBSA 1OWPA 3PZ3A 5DIZA 1Z3XA 3AS5A 3UINC 3O4ZA 2V4LA 1A5EA 2M63A 2CFUA 4A3VA 2LO6A 2L0IA 1LD8A 3SFXA 3TL5A 1UN8A 4KMOA 4N3BA 2HYZA 1X81A 3FTYA 5FQ8A 5KWDA 3JQ0A 4KBQA 3PEUB 1NI1A 4TXRA 1UW4B 3ULEG 3FP3A 4DRXE 5FQ7A 4PS3A 2XRYA 5AIJA 2J4BA 3NOCD 3GZ2A 4J8YA 3HXEA 4RG6A 4AP2A 2L6JA 3NF1A 2GGFA 3CKCA 3R7QA 2AWIA 4DX2A 4JEHA 4KVOA 3CSTA 4HRMB 1N4QA 2QYJA 5B1AE 4UWLA 5FZRA 4I9CA 3D9KA 3FEXA 2FO1E 4P29A 1MJ0A 1NL4A 1JWGA 2KCKA 3KSQA 4MLPA 5KJMA 3SD5A 2Y0BG 3CHRA 2DIWA 3QWWA 4A3TA 2XGMA 2IJGX 1JCSA 2OVFA 2R2LA 3I3NA 2RD0A 2WXLA 1IYGA 3NOGD 2WQHA 2XZDG 4JPSA 2WPVA 4F3VA 4BSXA 3ZHEA 4BX8A 3JQ1A 4CDRA 1SA5A 5DBKA 5ENRD 3D9OA 2P9SG 3BUAA 4DPRA 3V2OA 2XEVA 3APCA 1UJJA 1W3BA 5D0QD 1KPSB 3LY7A 4O60A 3TAXA 3UM2A 4XKCA 2AJAA 3HYMB 4U95D 4JA9A 3UT4A 3PE4A 1MX4A 3CIAA 2XS1A 1HG2A 4L23A 4DX7D 4DX1A 3PS6A 2WXHA 1SW6A 2KM4A 4KYOB 3ASGA 2ONDA 1PY1A 1UN9A 4B89A 3UPVA 1MX6A 3CEQA 4TXQA 3CVYA 4LRZA 3RKVA 3HG0D 2H6IA 2IOLA 2X6HA 2KBXA 2BEDA 3HIZA 3AG1E 4GTTA 4KZ0A 3C72A 3FUJA 1HX8A 1FVFA 4Q94A 3SI5A 2LSVA 3FTVA 2QC9A 1JCRA 2CFZA 5AQBA 3AU5A 5FZQA 2ZGDA 5KCMA 4HRNA 3TWQA 4R7LA 1WDYA 1Q2ZA 1EDUA 3C3QA 2DYRE 2Y1LE 5FZSA 3FDHA 3QB2A 4FJYA 4ANXA 3IXEA 3G2SA 2VSXE 2XPYA 4JA7A 1KZOA 2X6KA 1NZNA 1OWMA 4ATZD 2L0TB 3DPDA 3R7RA 2JEKA 3TWTA 1S0PA 5KBAA 3Q7AA 2Q7FA 4XI0A 4N39A 2A5EA 2F0YA 4UUCA 4JHRA 3EUVA 3VTYA 4L7TA 4BT9A 4D10C 1BD8A 3FFLA 1TN8A 1BI8B 2OV8A 1N11A 2GRRB 2A4ZA 3DPYA 3F6QA 3D9NA 2DVWA 4OVUA 4WNEA 3D9LA 4I1AA 1N4PA 2C2LA 4GMRA 3P1UA 4LG6A 1HG5A 1FPPA 5LP0A 3ZYQA 3OXFA 3LJNA 2DYSE 4XEIG 2OOEA 3ZN3A 5KJNA 2FI7A 1FVHA 2VSYA 1FT2A 1G3NB 2CG3A 3ONLA 4F1SA 4Y6WA 4YDEA 1HE8A 3IHYA 1TN7A 4ANVA 2ZXWE 3ASNE 3CQCB 4B8CB 2RG8A 3ZEFA 3NAWA 1RZ4A 3PE3A 2Y4UA 5AQ7A 2VSOE 3L17A 1QNFA 4I17A 3B7UX 3TWXA 3CK9A 4F53A 5JMND 4UI9J 1U3CA 2Y4TA 4GTVA 4N2QA 3VLFA 3B7RL 4EZLA 4G2VA 1TR4A 2X38A 4KVMA 4UWFA 2YINA 2Y3AA 4YVOA 4IULA 3UQ3A 4WAFA 2XRZA 1N9AA 3SNXA 3CVLA 1IQRA 2IO3C 2MRIA 4U96D 2LXLA 4OVVA 4C9BB 4AM9A 2PQRA 4DX5D 4DUIA 3DSSA 4UI9C 2E0IA 3D9HA 5CCLA 1H6KA 2EILE 5B1BE 1V55E 3O48A 2EIKE 2P2CP 4I9EA 1N0RA 4MBGA 4PH4B 2R03A 3HXFA 2BKGA 4JEUA 4U63A 3PH0C 5M72A 3CHOA 2GRMA 3G2WA 3EU9A 3SQVA 2NYJA 2AW6A 2GW1A 2I6HA 2V4HC 1HFAA 3Q75A 3I4GA 3K9IA 4QQIA 2KC7A 3FTSA 4A1GA 1FCHA 4NIKA 5T8IA 3B7SA 3AAAC 5BXOA 3ZUVB 1D9SA 3U3WA 2AXVA 4LSZE 5JHBA 4OAUC 4E6HA 4U0ZA 3PDNA 3SZ7A 3ENEA 3BU8A 4UQYA 4OAVB 2EIME 1ZB1A 3ZPJA 2WMOA 4C0EA 3FUMA 5HKPA 3TXMA 2MOWA 4U7EB 2IOSA 4DK5A 4G11A 3C3RA 3EHMA 4FC8A 3G2VA 5ARFA 3QAQA 5BPPA 3CVUA 1KT1A 2PQNA 2AXUA 3QDNA 4A63B 5J08A 4BX9A 3Q9UC 1OWNA 3EDTB 1E7VA 3ASFA 2YHEA 3RIBA 4JZYA 1AWCB 1O1RA 3EIJA 1D8EA 1NFIE 3GW4A 2OEWA 3ZXPA 3V2XA 2VGYA 3D9MA 3ML9A 4Y6CA 4GTRA 3EU5A 3DSUA 3RRNB 3CKBA 5G55A 4CYMD 3BQOA 4LERA 5G2NA 3FUEA 3CVPA 4J8FA 2X3MA 2Y69E 3LXUX 1PAQA 2NXPA 1N4RA 1WG0A 3BG0B 2PM7A 4PDXA 2VTBA 1H0AA 3UIPC 2EIJE 2ZGGA 1H6PA 3WG7E 1S70B 3CVWA 5AAOA 3LDZA 3SBTB 4OYSA 4HB5A 5KNGA 4U0UA 3ULQA 4K5BA 3RRUA 4IN3B 3CK7A 5LOZA 2X6JA 5G04J 2LAHA 3TJPA 3RSEG 5A23A 3SBSA 3CGHA 2UWJG 1IKND 2LNIA 1QQEA 3GZSA 1EYHA 4GYYA 3D9IA 4CEMA 4PS7A 1YCSB 4AIFA 1HS6A 1OY3D 1H2VC 3QARA 4F1PA 1UG3A 2UY1A 5EX0A 4HLLA 3VTXA 2XGSA 4YDOA 4AEZC 1KZPA 2XCBA 1NA3A 3B95A 4B0ZA 2I1KA 4RVBA 3AG2E 4GMLA 2WQ6A 3ESKA 4PS8A 4HVBA 4G24A 4V3IA 5A7DB 2I1JA 2H6HA 1E7UA 2IONA 3MGBA 3ZKJA 4BFRA 4RG9A 3ABLE 1OCOE 4YDYA 3MX3A 1H6OA 2RFAA 2MHKA 3Q79A 3ZW3A 2CG2A 3FULA 4JVSA 4TUMA 4HFGA 3KS2A 2DCPA 2IFUA 2P9PG 3T5XA 4M3OA 3T5VA 2WXFA 4XKBA 5FINA 5T4YA 5ANRA 2DWZA 3PNTB 3HXBA 2XENA 2R17C 2XCCA 4FHJA 2BUGA 4ABNA 4DJAA 1JPLA 4K5AB 2WQ7A 1O1TA 3KEZA 3Q78A 2XQ0A 3FWVA 3DEPA 2B6CA 1N94A 1U2VG 3IBEA 3CVVA 3Q7FA 3X2QE 5ITZF 4B93B 3ESLA 3CLJA 3PZDA 5CEAA 3ZYLA 3JXJA 2DBAA 2R05A 2KZTB 4GMJA 4I6GA 3LCAA 1HXIA 3L08A 3N71A 1TNZA 3JUIA 1WM5A 1OCCE 3PZ4A 2WXMA 3DSWA 5D0OD 1YYHA 2RKKA 4JXTA 2FBNA 2YNQA 3FUDA 3NZUA 2P9NG 2HR2A 4XI9A 3TWSA 4AY5A 4EHMA 3P2BA 1OCZE 4HLEA 3G2TA 5AJDA 2IQCA 4BETA 4WNDA 5KNHD 3NZSA 4WWOA 1HU3A 4FJZA 2WM9A 5LCWC 4FLHA 3UIOC 4GTMA 1L5JA 3FU5A 4B94A 4FHKA 4Q69A 5AQAA 3JXIA 1S63A 1LF8A 1IHBA 4LEUA 4GA1A 3UI2A 3UTMA 3ZFWA 2P58C 5E75A 2NC9A 4O6FA 3UT8A 4NRHB 5CHEE 5BW8C 1N95A 4TUUA 4CGVA 4ANUA 3CR3A 4HORA 4A1SA 3FH8A 1HZ4A 3QK0A 3FH7A 3VLDA 2L6BA 3QWVA 2LUHA 4G25A 3DXMG 1NP7A 3ZXSA 3PZ1A 3UM0A 1K3ZD 2XEEA 4BESA 5G05C 3KAEA 1OT8A 3CV0A 5EIBE 3L13A 3C98A 2IU1A 2XHEA 3APDA 1DCQA 3LS8A 2QY7A 4U0SA 3V31A 2HO1A 1DNPA 5JJTA 1N52A 1DC2A 3U66A 2FULA 1MYOA 2CHZA 1ELWA 3R9AB 4I6EA 2F37A 3T8KA 3IHVA 4DI3A 1TEZA 2WXQA 3ZRHA 1OXJA 4HRLA 5CMWA 1ZU2A 1O5MA 5IY5E 3ASOE 1JCQA 4HOQA 2QFCA 5FIOA 4UWHA 5ENTD 3UM1A 3JCKC 3OXLA 3OXGA 1SZAA 4UI9K 4YDWA 2QYUA 2J9QA 2J08A 4APFA 3ASDA 3E30A 1UOHA 2EQXA 4TXPA 2KATA 2ETCA 4GTPA 4DI4A 2VGXA 3MYVA 4Q96A 1H2TC 3MV2B 4JC8A 4H7XA 2XZTG 3MKQA 1A17A 2C0MA 3ABKE 2PNNA 2F8XK 4HS2A 3PUJA 5HQ8A 3DWLG 3QNKA 4JL0A 4L2LA 4ANWA 1K1BA 3VLEA 4TV3A 2B0OE 1V54E 2XEHA 3FU0A 1UJKA 4GZDA 4CZ2D 1KLXA 4K0RA 3PZ2A 4AVXA 4I1MA 4ILGA 4A55A 4GCOA 3KD7A 1E90A 4GPMA 2R5SA 3FUFA 4KZCA 1Z6TA 3LJ3A 3GZ1A 3J5PA 4BSZB 3L16A 3TWVA 4J8DA 3D3MA 1GW6A 3LY8A 1ELRA 1E8WA 4FA6A 3QOUA 4X8QA 5J90A
chains in the Genus database with same CATH topology
3UIPC 2IO3C 1KPSB 2GRNB 1Z5SC 5D2MC 2GRRB 2GRPB 2GRQB 3UIOC 3UINC 2IY0C 2IO2C 2GROB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIP C;  2IO3 C;  1KPS B;  2GRN B;  1Z5S C;  5D2M C;  2GRR B;  2GRP B;  2GRQ B;  3UIO C;  3UIN C;  2IY0 C;  2IO2 C;  2GRO B; 
#chains in the Genus database with same CATH topology
 1ZBP A;  4ACK A;  3KSL A;  4EBA A;  5C2Y A;  3PRE A;  4N3C A;  4G8K A;  4UWK A;  5BV0 A;  3CVN A;  4TRQ A;  1K8K G;  3E4B A;  4GA0 A;  4CCA A;  3LPZ A;  4UQX A;  4GZ5 A;  1U3D A;  3V79 K;  3PEV B;  1TJC A;  4WWP A;  4L9P A;  3S7F A;  2R02 A;  3EHQ A;  2CHW A;  2V0P A;  3UT7 A;  3CVX A;  2GRP B;  3MCX A;  3HHM A;  2J8S D;  3FU3 A;  5CCM A;  2KCV A;  3DSV A;  3HXD A;  4JHJ A;  1TJF A;  3B7T A;  3MV3 B;  4ACL A;  3FEY A;  4F7A A;  2KCL A;  2VYI A;  5BT1 A;  1E96 B;  1MZC A;  1XNF A;  4URK A;  3J5Q B;  4GZ6 A;  1TNO A;  2C0L A;  1X5B A;  3HDX A;  2VQ2 A;  3FUN A;  3PNL B;  1P5Q A;  1HO8 A;  4APO A;  2XS8 A;  4GPK A;  3D9J A;  1H19 A;  4I2W A;  3FUH A;  4U8V D;  3FTW A;  4XE0 A;  4U04 A;  5CER B;  4WNG A;  4LNG A;  2WB2 A;  3ASH A;  2X6I A;  3GYZ A;  3L6A A;  4EZJ A;  3S7D A;  2JAB A;  3TWU A;  3FTX A;  4NUR A;  1VDY A;  3FHE A;  3NQP A;  1N4S A;  4L2Y A;  4E85 A;  3SFY A;  4BWR A;  2L9B A;  4CT0 A;  4GAA A;  4ME2 A;  1O1S A;  3QWP A;  1LTX A;  3WXX A;  4GCN A;  1S64 A;  4MS6 A;  2KZT A;  4BTB A;  4JB8 P;  4GYW A;  3L54 A;  1NA0 A;  5JJ7 A;  3TWW A;  4N5C A;  2XPZ A;  2X6F A;  2V5F A;  4J0U A;  3AG3 E;  4IYP A;  1MQS A;  1YMP A;  2H6G A;  4F6R D;  2LXM A;  5CRU A;  5G05 J;  3U9W A;  5AJL A;  1WY6 A;  2WMN A;  3CHQ A;  3OAW A;  3ML8 A;  5BXU A;  3FY4 A;  3FU6 A;  2P9K G;  4GTQ A;  4J8E A;  4U8Y D;  1MHQ A;  3URZ A;  5FWQ A;  2WXG A;  2E2E A;  3I4R B;  5CED B;  4G26 A;  2IO2 C;  3ZVV A;  4HI8 A;  3QC1 A;  5AN8 A;  4FUL A;  3RO3 A;  4CT4 A;  4BEP A;  1OCR E;  3V30 A;  3RJV A;  4NQ0 A;  4N3A A;  2WXP A;  2YHC A;  4XIF A;  2WXI A;  5ANL A;  3MA5 A;  2J49 A;  2GRO B;  2PZI A;  3CSF A;  4G23 A;  3JYS A;  5FJY A;  1BLX B;  4JW1 A;  4HI9 A;  4ZHB A;  1TNU A;  2HE0 A;  4IRU A;  5JA4 D;  4KT6 B;  5CBO A;  1SVX A;  1YA0 A;  4O1O A;  3MKR A;  4FU3 A;  1PC2 A;  4FP7 A;  5C1D A;  5CMY A;  3UUX A;  2I2O A;  2J07 A;  2RFM A;  4JD2 G;  4I43 A;  4EQF A;  1SQM A;  4ZFH A;  2VSN A;  4GZ3 A;  3E33 A;  3Q49 B;  4K03 A;  4CGW A;  4U07 A;  2JLB A;  2XPI A;  3CQG B;  4DLQ A;  1B89 A;  4HXI A;  5AAR A;  4GZC A;  3IV0 A;  2HM8 A;  2IF4 A;  1N0Q A;  2WXK A;  2P9L G;  1IHG A;  1D8D A;  1Z5S C;  3IEG A;  2ZIR A;  2VJ8 A;  2P9I G;  5EKQ D;  1K1A A;  4DX6 D;  3EHR A;  3Q9N C;  3UXG A;  2KXP C;  3TWR A;  4HBD A;  1Y6I A;  4C48 B;  2WXO A;  4XX5 A;  3RRM B;  3UMV A;  2AXZ A;  4YND A;  2BF0 X;  4WNF A;  3E32 A;  3DXK G;  2LAI A;  2AVP A;  4NAC A;  4BTA A;  5ENO D;  4RLY A;  1TYQ G;  3TGO A;  1AP7 A;  1TNY A;  4LUN U;  4N2S A;  5LX8 A;  3CVQ A;  3MKQ B;  4MRU A;  4WWN A;  3ZGQ A;  4C0M A;  5EIL A;  3AG4 E;  2P9U G;  3R9M A;  2WVI A;  5KJK A;  2VTB B;  1OUV A;  3OTN A;  3W9F A;  1IXV A;  5CRV A;  4HOT A;  2GRN B;  4O1P A;  3HVE B;  3MEK A;  4N5Q A;  2F8Y A;  3Q47 B;  4M7C A;  5FQ4 A;  3IKO B;  5D66 A;  3MJW A;  3DRA A;  3U4T A;  5BUZ A;  4B8A A;  1DVP A;  2ILR A;  4Z68 A;  3QKY A;  1QZ2 A;  4LNU D;  4HQD A;  5EID A;  3LVQ E;  5JJ6 A;  3PRZ A;  5CEC B;  1TNB A;  4CDM A;  3APF A;  5KJL A;  1MX2 A;  3DST A;  3AS8 A;  3LEW A;  3UX4 A;  2V8S E;  3ISM C;  3HVE A;  2YQ8 A;  2FF4 A;  4GU5 A;  1EF1 C;  1JWF A;  4L1B A;  2A5U A;  2IEJ A;  3C5R A;  4EBA G;  4AJW A;  3UKR G;  4ILI A;  3LVR E;  4HNA D;  3JUE A;  2FO7 A;  1BU9 A;  4CDN A;  1E8Z A;  5EN5 D;  2OEV A;  5EYL A;  2J4D A;  3Q5M A;  4EPZ A;  5AYW D;  1FT1 A;  2VGX B;  5ENP D;  3UKU G;  2DZN A;  3SHF A;  2H6F A;  4GB9 A;  1E8Y A;  5CBN A;  1SA4 A;  4DLO A;  1IQU A;  1Z3Y A;  2BTD A;  4UWG A;  5EX3 A;  4BER A;  4K5C A;  2ZIS A;  3SF4 A;  4XZ4 A;  2UY1 B;  4W9R A;  3MZL B;  3L82 A;  3UM3 A;  3HRA A;  3RO2 A;  4ILH B;  5JHA A;  3FH5 A;  3CHM A;  3Q4A B;  1XGW A;  2IY0 C;  5HRY A;  3RU0 A;  3B13 A;  3SY2 A;  5T3R A;  1OWL A;  2WXJ A;  3KEA A;  2CHX A;  3LYA A;  5BV1 A;  3E34 A;  4J6I A;  1EPU A;  2NSZ A;  3ZHE B;  2FEZ A;  3RK6 A;  2V5Q C;  4WUY A;  2LSU A;  1OWO A;  1WAO 1;  5E76 A;  5LCW J;  5A6C A;  3CK8 A;  3ZNG A;  3RAU A;  2OCC E;  3LY9 A;  4AY6 A;  5G04 C;  3DSX A;  2XGO A;  5ENN A;  4HOS A;  3G2U A;  5AQ9 A;  3TXN A;  1BPO A;  4RSY A;  3L22 A;  3D9P A;  4EEC A;  3FTU A;  3ZIM A;  5HI7 A;  3PVL A;  2BKK B;  4GTS A;  1E8X A;  2PM6 A;  4BY6 A;  4FLB A;  2GRL A;  1HF8 A;  4I2Z A;  2EIN E;  3B7B A;  3Q15 A;  1ELK A;  5H7P A;  3S2A A;  3E37 A;  4LNB A;  5ENS D;  3C3O A;  4JHK A;  4J8S A;  3T8M A;  3CHP A;  5ARG A;  4GTO A;  4FAD A;  4UQZ A;  2ETB A;  1TN6 A;  4GYO A;  1RW2 A;  4ATG A;  3AU4 A;  4AXH A;  5ENQ D;  1Y8M A;  3W9G A;  2MYO A;  1QBQ A;  3T9K A;  1BI7 B;  2DZO A;  3ONK A;  5FT9 A;  3FUK A;  2GRQ B;  2OVB A;  1QYM A;  2J09 A;  3SGH A;  4I6J A;  4CRW A;  4AV7 A;  3AJI A;  3ABM E;  2QZA A;  3TG4 A;  5BNW A;  1INZ A;  3EHN A;  1DCE A;  3NBN B;  1HH8 A;  1JUQ A;  5HS0 A;  4HOU A;  3SFZ A;  2R59 A;  4GA2 A;  4U8H A;  3I5P A;  4AOF A;  4H7Y A;  3TG5 A;  3NB2 A;  5EDS A;  4G1T A;  3ZYM A;  2ZU6 B;  3FUI A;  3BG1 B;  4PUC A;  3ZYK A;  4G8L A;  4LCT A;  4EZK A;  1KT0 A;  3DEO A;  5FTP A;  3PUK A;  4YVQ C;  3LKU A;  3SO8 A;  5LFA A;  3EJN A;  2PL2 A;  2I9C A;  2WXR A;  4J7W A;  1N54 A;  2ETA A;  3S7J A;  4QFV A;  5AEN A;  2WXN A;  2VGE A;  3Q73 A;  3BEE A;  3ZU7 B;  3CHS A;  4MKT A;  4RQI A;  1SZ9 A;  3ULY A;  5FQ6 A;  3S7B A;  1LD7 A;  3HXC A;  5EYP F;  3L9T A;  3QJZ A;  3U64 A;  4BT8 A;  3AS4 A;  4KXK B;  1H2U A;  5D2M C;  4I1O B;  3EIQ C;  5B3S E;  3FTZ A;  3DBS A;  1OWP A;  3PZ3 A;  5DIZ A;  1Z3X A;  3AS5 A;  3UIN C;  3O4Z A;  2V4L A;  1A5E A;  2M63 A;  2CFU A;  4A3V A;  2LO6 A;  2L0I A;  1LD8 A;  3SFX A;  3TL5 A;  1UN8 A;  4KMO A;  4N3B A;  2HYZ A;  1X81 A;  3FTY A;  5FQ8 A;  5KWD A;  3JQ0 A;  4KBQ A;  3PEU B;  1NI1 A;  4TXR A;  1UW4 B;  3ULE G;  3FP3 A;  4DRX E;  5FQ7 A;  4PS3 A;  2XRY A;  5AIJ A;  2J4B A;  3NOC D;  3GZ2 A;  4J8Y A;  3HXE A;  4RG6 A;  4AP2 A;  2L6J A;  3NF1 A;  2GGF A;  3CKC A;  3R7Q A;  2AWI A;  4DX2 A;  4JEH A;  4KVO A;  3CST A;  4HRM B;  1N4Q A;  2QYJ A;  5B1A E;  4UWL A;  5FZR A;  4I9C A;  3D9K A;  3FEX A;  2FO1 E;  4P29 A;  1MJ0 A;  1NL4 A;  1JWG A;  2KCK A;  3KSQ A;  4MLP A;  5KJM A;  3SD5 A;  2Y0B G;  3CHR A;  2DIW A;  3QWW A;  4A3T A;  2XGM A;  2IJG X;  1JCS A;  2OVF A;  2R2L A;  3I3N A;  2RD0 A;  2WXL A;  1IYG A;  3NOG D;  2WQH A;  2XZD G;  4JPS A;  2WPV A;  4F3V A;  4BSX A;  3ZHE A;  4BX8 A;  3JQ1 A;  4CDR A;  1SA5 A;  5DBK A;  5ENR D;  3D9O A;  2P9S G;  3BUA A;  4DPR A;  3V2O A;  2XEV A;  3APC A;  1UJJ A;  1W3B A;  5D0Q D;  1KPS B;  3LY7 A;  4O60 A;  3TAX A;  3UM2 A;  4XKC A;  2AJA A;  3HYM B;  4U95 D;  4JA9 A;  3UT4 A;  3PE4 A;  1MX4 A;  3CIA A;  2XS1 A;  1HG2 A;  4L23 A;  4DX7 D;  4DX1 A;  3PS6 A;  2WXH A;  1SW6 A;  2KM4 A;  4KYO B;  3ASG A;  2OND A;  1PY1 A;  1UN9 A;  4B89 A;  3UPV A;  1MX6 A;  3CEQ A;  4TXQ A;  3CVY A;  4LRZ A;  3RKV A;  3HG0 D;  2H6I A;  2IOL A;  2X6H A;  2KBX A;  2BED A;  3HIZ A;  3AG1 E;  4GTT A;  4KZ0 A;  3C72 A;  3FUJ A;  1HX8 A;  1FVF A;  4Q94 A;  3SI5 A;  2LSV A;  3FTV A;  2QC9 A;  1JCR A;  2CFZ A;  5AQB A;  3AU5 A;  5FZQ A;  2ZGD A;  5KCM A;  4HRN A;  3TWQ A;  4R7L A;  1WDY A;  1Q2Z A;  1EDU A;  3C3Q A;  2DYR E;  2Y1L E;  5FZS A;  3FDH A;  3QB2 A;  4FJY A;  4ANX A;  3IXE A;  3G2S A;  2VSX E;  2XPY A;  4JA7 A;  1KZO A;  2X6K A;  1NZN A;  1OWM A;  4ATZ D;  2L0T B;  3DPD A;  3R7R A;  2JEK A;  3TWT A;  1S0P A;  5KBA A;  3Q7A A;  2Q7F A;  4XI0 A;  4N39 A;  2A5E A;  2F0Y A;  4UUC A;  4JHR A;  3EUV A;  3VTY A;  4L7T A;  4BT9 A;  4D10 C;  1BD8 A;  3FFL A;  1TN8 A;  1BI8 B;  2OV8 A;  1N11 A;  2GRR B;  2A4Z A;  3DPY A;  3F6Q A;  3D9N A;  2DVW A;  4OVU A;  4WNE A;  3D9L A;  4I1A A;  1N4P A;  2C2L A;  4GMR A;  3P1U A;  4LG6 A;  1HG5 A;  1FPP A;  5LP0 A;  3ZYQ A;  3OXF A;  3LJN A;  2DYS E;  4XEI G;  2OOE A;  3ZN3 A;  5KJN A;  2FI7 A;  1FVH A;  2VSY A;  1FT2 A;  1G3N B;  2CG3 A;  3ONL A;  4F1S A;  4Y6W A;  4YDE A;  1HE8 A;  3IHY A;  1TN7 A;  4ANV A;  2ZXW E;  3ASN E;  3CQC B;  4B8C B;  2RG8 A;  3ZEF A;  3NAW A;  1RZ4 A;  3PE3 A;  2Y4U A;  5AQ7 A;  2VSO E;  3L17 A;  1QNF A;  4I17 A;  3B7U X;  3TWX A;  3CK9 A;  4F53 A;  5JMN D;  4UI9 J;  1U3C A;  2Y4T A;  4GTV A;  4N2Q A;  3VLF A;  3B7R L;  4EZL A;  4G2V A;  1TR4 A;  2X38 A;  4KVM A;  4UWF A;  2YIN A;  2Y3A A;  4YVO A;  4IUL A;  3UQ3 A;  4WAF A;  2XRZ A;  1N9A A;  3SNX A;  3CVL A;  1IQR A;  2IO3 C;  2MRI A;  4U96 D;  2LXL A;  4OVV A;  4C9B B;  4AM9 A;  2PQR A;  4DX5 D;  4DUI A;  3DSS A;  4UI9 C;  2E0I A;  3D9H A;  5CCL A;  1H6K A;  2EIL E;  5B1B E;  1V55 E;  3O48 A;  2EIK E;  2P2C P;  4I9E A;  1N0R A;  4MBG A;  4PH4 B;  2R03 A;  3HXF A;  2BKG A;  4JEU A;  4U63 A;  3PH0 C;  5M72 A;  3CHO A;  2GRM A;  3G2W A;  3EU9 A;  3SQV A;  2NYJ A;  2AW6 A;  2GW1 A;  2I6H A;  2V4H C;  1HFA A;  3Q75 A;  3I4G A;  3K9I A;  4QQI A;  2KC7 A;  3FTS A;  4A1G A;  1FCH A;  4NIK A;  5T8I A;  3B7S A;  3AAA C;  5BXO A;  3ZUV B;  1D9S A;  3U3W A;  2AXV A;  4LSZ E;  5JHB A;  4OAU C;  4E6H A;  4U0Z A;  3PDN A;  3SZ7 A;  3ENE A;  3BU8 A;  4UQY A;  4OAV B;  2EIM E;  1ZB1 A;  3ZPJ A;  2WMO A;  4C0E A;  3FUM A;  5HKP A;  3TXM A;  2MOW A;  4U7E B;  2IOS A;  4DK5 A;  4G11 A;  3C3R A;  3EHM A;  4FC8 A;  3G2V A;  5ARF A;  3QAQ A;  5BPP A;  3CVU A;  1KT1 A;  2PQN A;  2AXU A;  3QDN A;  4A63 B;  5J08 A;  4BX9 A;  3Q9U C;  1OWN A;  3EDT B;  1E7V A;  3ASF A;  2YHE A;  3RIB A;  4JZY A;  1AWC B;  1O1R A;  3EIJ A;  1D8E A;  1NFI E;  3GW4 A;  2OEW A;  3ZXP A;  3V2X A;  2VGY A;  3D9M A;  3ML9 A;  4Y6C A;  4GTR A;  3EU5 A;  3DSU A;  3RRN B;  3CKB A;  5G55 A;  4CYM D;  3BQO A;  4LER A;  5G2N A;  3FUE A;  3CVP A;  4J8F A;  2X3M A;  2Y69 E;  3LXU X;  1PAQ A;  2NXP A;  1N4R A;  1WG0 A;  3BG0 B;  2PM7 A;  4PDX A;  2VTB A;  1H0A A;  3UIP C;  2EIJ E;  2ZGG A;  1H6P A;  3WG7 E;  1S70 B;  3CVW A;  5AAO A;  3LDZ A;  3SBT B;  4OYS A;  4HB5 A;  5KNG A;  4U0U A;  3ULQ A;  4K5B A;  3RRU A;  4IN3 B;  3CK7 A;  5LOZ A;  2X6J A;  5G04 J;  2LAH A;  3TJP A;  3RSE G;  5A23 A;  3SBS A;  3CGH A;  2UWJ G;  1IKN D;  2LNI A;  1QQE A;  3GZS A;  1EYH A;  4GYY A;  3D9I A;  4CEM A;  4PS7 A;  1YCS B;  4AIF A;  1HS6 A;  1OY3 D;  1H2V C;  3QAR A;  4F1P A;  1UG3 A;  2UY1 A;  5EX0 A;  4HLL A;  3VTX A;  2XGS A;  4YDO A;  4AEZ C;  1KZP A;  2XCB A;  1NA3 A;  3B95 A;  4B0Z A;  2I1K A;  4RVB A;  3AG2 E;  4GML A;  2WQ6 A;  3ESK A;  4PS8 A;  4HVB A;  4G24 A;  4V3I A;  5A7D B;  2I1J A;  2H6H A;  1E7U A;  2ION A;  3MGB A;  3ZKJ A;  4BFR A;  4RG9 A;  3ABL E;  1OCO E;  4YDY A;  3MX3 A;  1H6O A;  2RFA A;  2MHK A;  3Q79 A;  3ZW3 A;  2CG2 A;  3FUL A;  4JVS A;  4TUM A;  4HFG A;  3KS2 A;  2DCP A;  2IFU A;  2P9P G;  3T5X A;  4M3O A;  3T5V A;  2WXF A;  4XKB A;  5FIN A;  5T4Y A;  5ANR A;  2DWZ A;  3PNT B;  3HXB A;  2XEN A;  2R17 C;  2XCC A;  4FHJ A;  2BUG A;  4ABN A;  4DJA A;  1JPL A;  4K5A B;  2WQ7 A;  1O1T A;  3KEZ A;  3Q78 A;  2XQ0 A;  3FWV A;  3DEP A;  2B6C A;  1N94 A;  1U2V G;  3IBE A;  3CVV A;  3Q7F A;  3X2Q E;  5ITZ F;  4B93 B;  3ESL A;  3CLJ A;  3PZD A;  5CEA A;  3ZYL A;  3JXJ A;  2DBA A;  2R05 A;  2KZT B;  4GMJ A;  4I6G A;  3LCA A;  1HXI A;  3L08 A;  3N71 A;  1TNZ A;  3JUI A;  1WM5 A;  1OCC E;  3PZ4 A;  2WXM A;  3DSW A;  5D0O D;  1YYH A;  2RKK A;  4JXT A;  2FBN A;  2YNQ A;  3FUD A;  3NZU A;  2P9N G;  2HR2 A;  4XI9 A;  3TWS A;  4AY5 A;  4EHM A;  3P2B A;  1OCZ E;  4HLE A;  3G2T A;  5AJD A;  2IQC A;  4BET A;  4WND A;  5KNH D;  3NZS A;  4WWO A;  1HU3 A;  4FJZ A;  2WM9 A;  5LCW C;  4FLH A;  3UIO C;  4GTM A;  1L5J A;  3FU5 A;  4B94 A;  4FHK A;  4Q69 A;  5AQA A;  3JXI A;  1S63 A;  1LF8 A;  1IHB A;  4LEU A;  4GA1 A;  3UI2 A;  3UTM A;  3ZFW A;  2P58 C;  5E75 A;  2NC9 A;  4O6F A;  3UT8 A;  4NRH B;  5CHE E;  5BW8 C;  1N95 A;  4TUU A;  4CGV A;  4ANU A;  3CR3 A;  4HOR A;  4A1S A;  3FH8 A;  1HZ4 A;  3QK0 A;  3FH7 A;  3VLD A;  2L6B A;  3QWV A;  2LUH A;  4G25 A;  3DXM G;  1NP7 A;  3ZXS A;  3PZ1 A;  3UM0 A;  1K3Z D;  2XEE A;  4BES A;  5G05 C;  3KAE A;  1OT8 A;  3CV0 A;  5EIB E;  3L13 A;  3C98 A;  2IU1 A;  2XHE A;  3APD A;  1DCQ A;  3LS8 A;  2QY7 A;  4U0S A;  3V31 A;  2HO1 A;  1DNP A;  5JJT A;  1N52 A;  1DC2 A;  3U66 A;  2FUL A;  1MYO A;  2CHZ A;  1ELW A;  3R9A B;  4I6E A;  2F37 A;  3T8K A;  3IHV A;  4DI3 A;  1TEZ A;  2WXQ A;  3ZRH A;  1OXJ A;  4HRL A;  5CMW A;  1ZU2 A;  1O5M A;  5IY5 E;  3ASO E;  1JCQ A;  4HOQ A;  2QFC A;  5FIO A;  4UWH A;  5ENT D;  3UM1 A;  3JCK C;  3OXL A;  3OXG A;  1SZA A;  4UI9 K;  4YDW A;  2QYU A;  2J9Q A;  2J08 A;  4APF A;  3ASD A;  3E30 A;  1UOH A;  2EQX A;  4TXP A;  2KAT A;  2ETC A;  4GTP A;  4DI4 A;  2VGX A;  3MYV A;  4Q96 A;  1H2T C;  3MV2 B;  4JC8 A;  4H7X A;  2XZT G;  3MKQ A;  1A17 A;  2C0M A;  3ABK E;  2PNN A;  2F8X K;  4HS2 A;  3PUJ A;  5HQ8 A;  3DWL G;  3QNK A;  4JL0 A;  4L2L A;  4ANW A;  1K1B A;  3VLE A;  4TV3 A;  2B0O E;  1V54 E;  2XEH A;  3FU0 A;  1UJK A;  4GZD A;  4CZ2 D;  1KLX A;  4K0R A;  3PZ2 A;  4AVX A;  4I1M A;  4ILG A;  4A55 A;  4GCO A;  3KD7 A;  1E90 A;  4GPM A;  2R5S A;  3FUF A;  4KZC A;  1Z6T A;  3LJ3 A;  3GZ1 A;  3J5P A;  4BSZ B;  3L16 A;  3TWV A;  4J8D A;  3D3M A;  1GW6 A;  3LY8 A;  1ELR A;  1E8W A;  4FA6 A;  3QOU A;  4X8Q A;  5J90 A; 
#chains in the Genus database with same CATH homology
 3UIP C;  2IO3 C;  1KPS B;  2GRN B;  1Z5S C;  5D2M C;  2GRR B;  2GRP B;  2GRQ B;  3UIO C;  3UIN C;  2IY0 C;  2IO2 C;  2GRO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...