4CT0A

Crystal structure of mouse cryptochrome1 in complex with period2
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
494
structure length
486
Chain Sequence
VNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVAANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRYPTOCHROME-1
publication title Interaction of Circadian Clock Proteins Cry1 and Per2 is Modulated by Zinc Binding and Disulfide Bond Formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Circadian clock protein
total genus 173
structure length 486
sequence length 494
ec nomenclature
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4ct0A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ct0A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ct0A01
2DUMA 4AQ7A 1F9AA 2D54A 3D6UA 1IRXA 2Z08A 2G36A 3TZEA 2A88A 1OWNA 1KH3A 2QUHA 1O95D 3GMIA 4MUHA 1GN8A 4F4HA 4EG1A 1N75A 5KWVA 1WXHA 3IVCA 4ZT6A 4EGAA 4CQNA 4JXXA 3CLSC 1F4LA 3IMCA 4MWDA 1M8JA 4S1OA 1TQ8A 1NP7A 4U63A 2QJTA 1MOPA 4MUJA 4YBRA 4DLPA 1IVSA 3ZJUA 1FFYA 4MW5A 1ZJWA 1KP2A 1VBKA 3CLRD 1LW7A 1WQ4A 1V47A 4NX2A 1J70A 1V8FA 2V0GA 1U7DA 2VTBA 1MAWA 1T6ZA 4NDAA 4QRDA 3AG6A 3IOCA 4UZEA 1NUTA 4R2LA 1QU3A 1M8GA 5TS2A 3RJZA 3FWKA 2QUKA 1NSYA 1O95C 1PFYA 1TYBE 1EFPA 3CLTC 1MB2A 4MUNA 3M5WA 2GKSA 4KKVA 3LE8A 1QQTA 2CT8A 3HGMA 1J20A 1XJQA 2JAXA 4HPWA 3ZJVA 3N9IA 3CLRC 2GM3A 4YMIA 3HFJA 3VRHA 1F7VA 1EXDA 2IP1A 5AHWA 5H16A 1OWPA 2H2AA 1EJ2A 3TS1A 3CVWA 3I05A 3INNA 1TFUA 3FNRA 1YUMA 2HMAA 4MAFA 1MC1A 4XFJA 4ZT5A 4WSOA 3JXEA 4HJRA 1WXIA 1KP3A 3AL0C 3BL5A 3FOCA 4UZFA 3ND7A 4MUEA 2B7LA 3SYTA 4EG3A 4MW4A 3UK2A 3AG5A 2O8VA 4MW9A 1M83A 3A2KA 5IHXA 1QTQA 2A7XA 4MW0A 1PG2A 4ZCRA 3L93A 1N77A 2CV0A 5DB4A 4ZT4A 3AFHA 4YP7A 1NZJA 2R5WA 2PXHA 3Q10A 1Y42X 3GLVA 2J08A 2EL7A 3ZJTA 1T9GS 3COYA 3DLAA 1WY5A 3FY4A 3G59A 4MLPA 1N2OA 4MWBA 2X0KA 1GZUA 1VBMA 1ZH6A 3K9WA 4EG6A 4NZPA 4JXZA 3RK0A 4ND6A 4EG5A 1T9GR 4L2IB 4KPUB 1XNHA 3ELBA 4U8HA 5J59A 4PBRA 4I6EA 3N8HA 1MB9A 3HV0A 4KR6A 1JGTA 4DE5A 3H99A 3IUEA 3VU8A 2A84A 2C5SA 3TNJA 1N2IA 3ZIUA 2A4MA 1NUQA 4G6ZA 2OQ2A 3MXTA 4G5FA 2DPLA 2TS1A 3HMQA 4DNXA 4PBSA 1JIKA 4MVYA 3RFFA 1MAUA 2DERA 1N78A 1IQ0A 1U7XA 4MUGA 3SZGA 2XRZA 5H7XA 1I6LA 2OV4A 3MMXA 3U1VA 3Q12A 1FYDA 1KORA 3QTBA 3X1JA 3OP1A 2CFOA 2D13A 1QJCA 4JZYA 1G8FA 1TYCA 4EG7A 2QUJA 4L2IA 1CT9A 2QUIA 4DDMA 4JFAA 1SURA 1WXGA 1I6KA 2RE8A 3RK1A 5F23A 4DDHA 3COZA 1X6VA 3A05A 2VXOA 5DASA 1O94D 3N05A 4R0NA 1IHOA 1NI5A 1O97D 3IVXA 2X3FA 1YIAA 5FO0A 3TZLA 1G59A 2DR2A 4Q16A 1OWLA 4OUDB 1X8XA 3F3MA 1KQNA 3CLUD 4BWVA 1YIDA 2E18A 1N3LA 1KKUA 1J1ZA 1EUYA 1WXFA 4EG4A 3CVVA 3FG9A 1YULA 4AS1A 5LLTA 3FIUA 5IJXA 1P7PA 4ZT7A 2RD2A 1O94C 3NV7A 1VBNA 2O5RA 3PNYA 3ZGZA 1O97C 1PG0A 4ZT2A 1UFVA 1ILEA 2I1LA 5DEOA 2DEUA 1NYLA 2PZ8A 2WSIA 1LI5A 3TQOA 3G5AA 1GAXA 1A8HA 1KR2A 2HZ7A 1JECA 3CLUC 1OWOA 5TEWA 1O0CA 3CVYA 4G5YA 4QBTA 4ND7A 1JIIA 3SP1A 1PFUA 4MWCA 4PY2A 4H3SA 1GTSA 2A1UB 4KR9A 1I6MA 2CV2A 3AIIA 1U0BB 3KT6A 1NUSA 1R6UA 4MW6A 4MUIA 1VLHA 3KFLA 1O96B 1JEDA 3KT8A 3UMVA 5J58A 2IJGX 1KQPA 4QREA 3IOEA 2CYAA 5FO1A 3VGJA 1GPMA 3PNVA 1N1DA 3MUEA 3A04A 3IODA 4XSVA 2AG6A 4PBTA 3FI0A 3MLBA 5EKDA 1K4KA 2AZXA 1D2RA 1JZSA 4ZT3A 1COZA 2BYTA 5HUHA 1IH8A 3IH5A 4CDMA 4E1AA 3H9BA 4RUKA 4A91A 4NAHA 5J5AA 4MUKA 1U3CA 1PFVA 1Q77A 5HG0A 1H3NA 3QE4A 3GUZA 3IMEA 4ARIA 2QJOA 1OWMA 1MRZA 3FETA 1RQGA 2CUZA 2WQ7A 2J4DA 2DXIA 1K97A 1M8FA 2A1TS 1H1TA 3PRHA 2ZUEA 2J09A 4YP5A 5KCMA 2A1TR 2WQ6A 2JA2A 3G6KA 4MULA 3IVGA 1I2DA 1O96A 1K92A 3C8ZA 1JZQA 2IELA 1T6YA 1GLNA 2PFSA 3LCJA 3RBAA 1KQOA 5KHAA 3L92A 2YWCA 1ULHA 1WXEA 4I6GA 2YWBA 1PFWA 1XNGA 1H3EA 1ZUNA 3N2YA 1JILA 1WJGA 1WZ2A 1MBZA 3P0JA 1VL2A 3PNBA 5TGTA 4DDKA 1MJHA 5HUJA 4R2MA 4ZCQA 5TEVA 4KPUA 3P0IA 3K32A 2AKEA 3ILVA 3COVA 1KAQA 1QNFA 3ZUGA 3UC5A 1KH1A 3P52A 2J5BA 3X1KA 2PG3A 1S4MA 1DNPA 5K0SA 1ZH0A 1R6XA 1M1ZA 3E27A 3SDBA 5K0TA 1N2JA 3MLAA 4HJXA 4ARCA 3UY4A 1IQRA 1B6TA 3OTWA 1M8KA 3IOBA 1J09A 4ZCTA 3NBKA 3AKZA 5LM3A 2NZ2A 3IUBA 3CLTD 3SEQA 1YUNA 4MQ6A 2NSYA 3QTTA 1N2EA 4DJAA 4P2BA 3SEZA 4ZCPA 1TYAE 4U7JA 4JYZA 4GU5A 2E21A 1QRTA 4HK4A 3FDXA 4K03A 2QJFA 3DV2A 3COWA 5BNZA 3FH0A 3CA8A 4RPIA 2X1MA 3UOWA 1N2BA 5DK4A 1U3DA 1OBCA 1WOYA 2D5BA 3H05A 3TQIA 4KR7A 4MWEA 1O6BA 1OD6A 3CR8A 1JHDA 1JMVA 1NUUA 3P0HA 2CYBA 1R6TA 3ZXSA 5JBNA 2DLCX 1EE1A 3KT0A 3ISJA 1IQUA 1IFXA 2JANA 3CVUA 4MW1A 1K4MA 2QTMA 3HZRA 4MW2A 3DO8A 3ND6A 2X1LA 4OUDA 1QRUA 1TYDE 4TS1A 1WQ3A 1NUPA 1Q15A 2E0IA 4YP6A 1Q11A 3ZXIA 2E89A 1JEEA 4FZJA 2Z3VA 2PZAA 5FNZA 2PIDA 3Q4GA 4MW7A 1O0BA 4K0RA 2QTNA 2A86A 1M8PA 1G8GA 2QTRA 4EFKA 1LI7A 3IDFA 4MUFA 4ZCSA 2YY5A 1EFVB 1N2HA 4MVXA 4WNYA 1QU2A 5LFAA 1Q19A 3A4IA 2CV1A 4I6JA 4MVCA 4J76A 4CT0A 4EG8A 1H3FA 1OBHA 4X0EA 1T6XA 3H9CA 4CDNA 4GRIA 1J21A 1KH2A 1N2GA 1WKBA 2ZP1A 3NBAA 3RHSA 1J1UA 2A1UA 2YXNA 2CYCA 1KAMA 2CSXA 4Q93A 2PZBA 2Z09A 2H29A 2V0CA 3S3TA 3ND5A 4J75A 1JIJA 2HGZA 4MVWA 4EF6A 3LOQA 3KT3A 3SZ3A 3CVXA 3X1MA 2DETA 3D6VA 4OJMX 2BTEA 2VTBB 4F3RA 2GOYA 1O5TA 3IMGA 4XFDA 1F7UA 3FHJA 2ZUFA 1BS2A 3H97A 1YI8A 1HYBA 1QRSA 1NURA 4NATA 3DPIA 3HL4A 1GTRA 1XNJA 1TEZA 1G8HA 1EFPB 3CLSD 2J07A 2EJCA 2XRYA 3PXUA 1EUQA 1EFVA 2WB2A 4NAUA
chains in the Genus database with same CATH superfamily
5C35A 3DAFA 3MOGA 3OESA 4MO2A 4OFWA 4OLHA 3V4VB 3NC4A 4MR7A 2JHGA 1P1RA 3IA7A 2DUJA 3KAPA 4QQNA 4CGZA 4YCAA 4IJ6A 3L7NA 1VBKA 5A06A 3WYFA 4YP1A 2Q8QA 2EZ9A 3LUCA 2L42A 4TUMA 1JB9A 3VYSB 4LEIA 4R7GA 2YOFA 3CLTC 3RF6A 1K7SN 3F9CA 4TVOA 4HNRA 3PVCA 3PQ5A 4BX9A 2H65A 5HW0A 5I8WA 3OLCX 2IY0C 1ZHHA 3HUFA 5G0TA 2J4CA 1CQPA 3DDOA 2COKA 2R00C 4UQPA 1MR3F 5FTNA 1FYVA 1T0UA 4M1KA 4M1WA 1TO2E 5A5VA 2AFHE 2RGXA 1TCCA 3O2QB 4URHA 4B89A 3MJ4A 3B2NA 3L8GA 4LYJA 2CFSA 4WGFA 4TZTA 2JGEA 3VKFA 2WBLC 1K86A 2IOFA 2VDPB 2V7WA 4R6WA 5T3YA 1D9ZA 5ANRA 1MB9A 2DQSA 2R4UA 3QARA 3EASA 1PSZA 1ZIXA 5H5JA 4FD3A 1QS0B 2BFBA 4I8DA 1EUCA 4UFOA 4NQZA 3LBYA 1NIJA 5DOVA 4KREA 3WDMA 4Z2AA 4OIFA 3O0DA 3ZIDA 2GJ9A 4U7FA 4C0HA 1MVOA 2ZBEA 4B6EA 1WZIA 4HNAD 1NNLA 3OP1A 2FXIA 4MDHA 3BG1B 5JPCA 2YJGA 1FBTA 3UJ6A 2H6EA 2NU6A 5EMLA 4DDMA 5KNDH 3FUNA 4UMVA 2WJWA 2ZYSA 7AT1A 3K6SB 3BFPA 1KLXA 3SY8A 2CFRA 2VP0A 1U8AA 2IYOA 4JD2G 3HPQA 1H6AA 4N0MA 1L8XA 1R6DA 3ZE6A 4JXKA 4QT4A 4KH0A 1P6UA 3M4XA 1B4DA 3JYQA 3MWKA 4ZAFA 1Y1TA 1J5XA 1GYQA 1RM0A 5KYNA 1Z22A 3WFZA 1QK5A 1Q57A 2C07A 4QBTA 2OOEA 4G4SP 1E1RD 2C4TA 3EUFA 1H05A 2AFIB 3HU2A 5K8IA 4ILGA 2OEWA 1PUIA 1PG5A 1H0KA 5KNCH 3MKQA 1RWWA 3AFMA 4QOJA 1MO5A 4EY4A 3LCCA 2ZGVA 3AF4A 3ELYA 3PNTB 2AQ8A 3O9MA 1VIDA 1FS4A 4TZ0A 1MUUA 2CNBA 2G17A 4R1MA 4L27A 1E58A 1Z73A 1AQ6A 1H1TA 4LGYA 1SW6A 5A0VA 1CUEA 1GSIA 3HQ4O 1H1LB 2QFCA 1U5BB 2BFOA 3SAJA 2FZKA 3DOHA 3NI2A 4NSNA 3E1GA 1XWFA 2ZUCA 2M6KA 1GNRA 4U2DA 4UFPA 1DC4A 1X80B 1DC6A 4MJ3A 3PCTA 5G41A 3ZCPA 3TLGB 4LNGA 1IOWA 5J40A 4R9SA 1TMKA 4TTPA 3IJEB 4PLGA 1UBCA 4IH1A 3PD0A 5AM2A 3CHMA 3Q7RA 4UUCA 1K3TA 3VR6H 1YONA 4G63A 4LNUD 1B6TA 5HQ3A 1CDEA 3GOQA 3E35A 4IDHA 5EXTA 1SQGA 3K70D 4WEOA 1GPJA 1QC5B 4KIWA 3FH0A 5JO0A 5AQEA 1JQJC 2ZVDA 1BVUA 2PUTA 1JKMA 1H9AA 1JMVA 4L4SA 2GILA 2FEAA 2B9VA 5EIDA 1AIPA 1S63A 2YWDA 3VO8A 1L5JA 1XXHA 2X2FA 1GGFA 4YRRA 3ZE1B 1U2GC 3L6AA 2NVWA 4EFMA 4LY0A 2W2NA 3Q0TA 1JKJB 1XJCA 4M9CA 4EABA 3FCEA 3TL3A 5I3ZA 1E61A 3UJ7A 5KJKA 1O8BA 3J5PA 2FX3A 1U9CA 1OI4A 1WCYA 3R3UA 2B35A 3O5AA 4RTSA 4PLVA 3EDMA 1W88B 4YDEA 3YASA 3LYLA 5C3MA 4FU0A 1PVOA 3NJRA 3HL4A 2YC2C 3DCJA 1VKZA 3KEMA 5EUCA 2LXLA 1H42A 3TNFA 4F6RD 3EXHB 4LKRA 3A6GA 4NEQA 3OF5A 4JI7B 3BG0B 1R6BX 4LY9A 1SUSA 3FGNA 3Q9NA 1L7AA 2VRBA 4MW5A 2W71A 3RWMB 1P2SA 2ZR8A 5CDTA 4GW3A 3OCCA 4TT8A 4J7XA 4X97A 1W44A 4GKAA 4ABYA 4IWXA 4QEKA 3OG9A 2PM6A 2NO4A 2IODA 4UU0A 5AHWA 1IHXA 3HI4A 1YCSB 1H4VB 4F97A 4WX2B 3MC1A 2B7LA 3RRUA 3A2LA 4Q5IA 3SYTA 1TF2A 2ZJ5A 3AG5A 2CLSA 2JKYA 3OIUA 3VVBA 4ZCRA 1YR1A 3NHJA 3KE9A 3DC7A 2ZVPX 4BAGA 1QHIA 1GCAA 1LNZA 3RV4A 3K0KA 1USKA 1KIFA 2CVHA 5DLQC 4CMHA 1ZBPA 4NZYA 4M37A 4R8KA 4QYIA 4Q7EA 4K6GA 5LQAA 3C3OA 1XAGA 5A4DA 2BKLA 5JASA 1JIKA 4DQDA 1FMCA 3Q12A 4BNFA 3V1NA 4MHOA 2R8RA 1SKUA 4LJSA 2KATA 1ZN2A 5BXOA 3MNFA 2OYRA 3HTXA 4R54A 5BNFA 1FK8A 1SQSA 1JDBC 3QKTA 3EC2A 4B8ZA 4EVQA 4J91A 1TMGE 3BGDA 1EUYA 1KO8A 2FQYA 3DZCA 3EAQA 1PJBA 1NV8A 3EXEB 3PNYA 3K35A 2XGSA 1KNXA 4HEQA 4C78A 3OIYA 1T4MA 2HA2A 3X2QE 1IIBA 3ISVA 3HU5A 2P7IA 4RGQA 3TCNA 4EB8A 3OJLA 3C6YA 3EBLA 4B7UA 4MHSA 3MUOA 3PEVB 2QTWB 4PBTA 4DR3B 3GEPA 4Q7QA 3RK6A 1MGOA 1U9ZA 4P3KA 5AHRA 3D5TA 3D0QA 1EVZA 3GA7A 2MYNA 4AMUA 3TL2A 2Q07A 4QPNA 3HKBB 4Y6GB 1J9GA 2R8PA 3I4LA 4HRMB 1L4FA 2X7XA 3STUA 3IVMA 3M3PA 3OO0A 1ZVQA 3RRNB 2PFSA 4U2GA 5FT9A 1DJNA 3VZRA 4JA2A 5K8JB 2WP0A 2X5OA 4FMBB 3TW0A 4TWAA 1DAPA 1U2RA 3L79A 4KPUA 4DLXA 4WT7A 4WOJA 4OSEA 3WRXA 4H35A 2B1IA 3JCZA 1QFJA 1UINA 4CMEA 1P80A 1U5CA 1KT1A 2W8BA 4YASA 3RTAA 1HDGO 3TQCA 4QUIA 2BFFA 2ZIFA 1GGKA 5BOSB 3OLYA 3ZZUA 3EXFA 5JNLA 2IYPA 4XASA 1LB1B 3DB1A 3SSNA 3ZK7A 1ZICA 5KJCA 3AUYA 1YK0A 5CCEA 4WKOA 2VNHA 4Y2QA 4RJJA 2F1KA 1NBAA 3KNZA 2G7MC 4B1FA 3BGVA 3T6KA 4K9PA 4ZFNA 2P6NA 3SYKA 3NGLA 3TMAA 3OCUA 3U4GA 2C00A 1SRQA 3ICWA 1H3FA 3VOBA 3SKVA 1CRZA 2R03A 3B5IA 2P1DA 4OO3A 5FLYA 3QPWA 4GMFA 4JJ4A 2XEHA 1SVUA 1ZK2A 5TIIA 3P8ZA 1K27A 3JVIA 3LY5A 4IRXA 2IRWA 1JLKA 3GFVA 5EIWA 2VUSA 1YE5A 4WW0A 2A67A 2H17A 4OGLA 1QLJA 3UG7A 2CHWA 2AOTB 3ZVKA 3TLYA 5E2AA 3QEMB 5IANA 3QXCA 1NR7A 4CVNA 3DW1X 4P4NA 2DYKA 5E6RB 2ID9A 4YQEA 4DV0B 1E6CA 4QAQA 3ZI4A 1IE3A 1ADJA 5FFFA 1HL7A 5T6BA 3CUSA 2D06A 1YKSA 3LQ2A 1ZJWA 1ETUA 1MJFA 4LF7B 5FYQA 1XALA 3L0SA 2REBA 3FB4A 1S8OA 3EPRA 4ZU3A 4R1UA 3DZJA 2PSFA 2ZJ0A 2YCBA 3TTVA 3WLRA 3RODA 5FNVF 3S7FA 1JBEA 3IDAA 5TMEA 1DQYA 1LBEA 2PUCA 1E79A 5FCDA 1EUZA 2YWGA 2Y1DA 1N77A 2X5XA 5EWJA 5AW9A 2DLDA 3DSRA 2P9YA 3UM9A 4RF4A 1VE1A 2BN4A 4WZBA 3IE1A 1L3IA 4MWBA 1N2OA 5FBWB 1E0DA 4ZI2A 4AG3A 2BUGA 4HQRA 4F4DA 4H4DA 3RREA 5CHYA 4HTFB 2QXYA 2F9LA 2WJPA 3WK8A 3K8OE 3ZWDA 2AH5A 4K2HA 1DIOB 4MRMB 2IF4A 2VXYA 3L04A 5EE3A 3GELA 1W25A 2O3UA 3E2IA 4JQSA 2G9VA 4U9IS 4J16C 1VHJA 5E9AA 4FNOA 4WNAA 1Z45A 1UPTA 3DEZA 4K6OA 4AVXA 1A4RA 2ZWIA 4CM4A 3TAUA 3ZJYA 3QBEA 3LYAA 2VWPA 2KSQA 2P5YA 5BMVF 4WBXC 3D8SA 5DASA 5LP6B 2GZRA 3U4TA 2II6A 1NVKA 4DB2A 3BIWA 2A9RA 1G8SA 1RBMA 4J7UA 3F3MA 2WIFA 1YIDA 4HMPA 2GA9A 2F8YA 4WXRA 2C94A 2OZPA 1VLJA 1Z35A 2WPDA 5LLTA 3L82A 3FPSA 1AUQA 2XTJA 5TXGA 5CM8B 2A5JA 5ALOA 3WY9A 3PQ6A 4MRAA 2N9UA 4KI7A 2IHZA 4CKEB 3JQ8A 1NR5A 2PZ8A 3CF6R 1ZJZA 3V46A 3PPVA 3A4VA 4B40A 1LWOA 4PZLA 1PF7E 3E18A 2QSUA 4E6HA 3HFGA 4KPFC 2DU8A 3SVLA 3VZCA 1IN6A 3H86A 1FSSA 4NRDA 4MCAA 3KKQA 3D3QA 3TJZA 3ABZA 4UAJA 3UQ3A 5CK4A 4CIXA 2V6MA 4DLTA 3OE7D 2JNWA 3RSSA 4AJHA 1TEXA 3RVKA 3CSTA 2I22A 3S2SA 3UFBA 3K9NA 1R0CA 3IUJA 1XRJA 3KB1A 1XU4A 4RWZA 2VG8A 4NPAA 2YL2A 1VE3A 4ZV7A 3EUEA 3AP2A 4PVDA 2OP1A 3HBNA 2E4UA 2FMIA 4FYVA 4K87A 4WTOA 3IKTA 1VXOA 1XR3A 4D4MA 2FFJA 2W2PA 4MYCA 1XLVA 1YJCA 4K6FA 1DNPA 2M1XA 4GWKA 1XA3A 5AJHA 4FDMA 2HRDA 4KQKA 4BO2A 4AJ2A 1SR8A 1LBHA 3T1QA 4EL5A 3DVLA 2E55A 3MM4A 1UJJA 4UBMA 1C1YA 2WI8A 1PR1A 3JWPA 2V7UA 4GA2A 1ZN7A 4GM1A 3GQVA 1N5IA 2EZ8A 1BW9B 4P80A 4XCVA 4K40A 2R8EA 3OCXA 2YJ6A 1YZTA 5DX8A 5HZMA 3CJRA 4WNDA 1K1EA 1SVXA 1V2HE 3IALA 2ZTMA 3Q11A 4CDNA 1PT5A 3I9NA 2ZR9A 2VQFB 1OF1A 1J1UA 1E32A 5FR2A 2Z2XA 2KLHA 1TO1E 3ZTYA 4UBLA 3SC3A 3I2HA 4WOKA 3NT2A 2E1PA 2P3LA 1GXSB 2ONYA 4LW8A 3OU6A 5ALSA 3VHRA 3UM1A 2PQRA 3QFRA 1G5TA 5F5NA 4NMHA 4XGIA 1U99A 2C9YA 1YVDA 1IBLB 1GU7A 8ATCA 3F2VA 2UYQA 2P9HA 2PGLA 4K6KA 4ZO6A 5AVUA 4NU0A 1NQUA 3FIJA 4WAUA 3VPAA 4M7OA 4CCWA 4E5YA 5A4JA 2H8KA 3ZZ1A 2NO1A 4RFLA 2HK9A 4P4SA 2FVXA 3M3HA 2NX2A 1WLYA 3ET5A 3HB5X 4AKHA 3SI7A 1D6JA 4FZRA 1RYFA 4PZ9A 5FWAA 4Q4CA 3EDRA 1R0XA 2B8JA 3OQVA 1N1GA 1VDYA 2ID8A 3WLSA 1H2UA 4G65A 3S7ZA 2FXVA 3NNDA 5LLSA 4WWNA 4C7XA 2QLTA 3PZ3A 5JEDA 2ONDA 4C88A 3F3KA 5YASA 1TK3A 2ZSDA 4XM1A 3G2MA 5NLLA 3N6VA 4MQEA 5F21A 1G55A 2QAIA 2CF6A 1GDDA 5CPBA 4RJTA 4CWAA 3IE2A 2G9ZA 2VJOA 3NO4A 3Q72A 4CFYA 3FR8A 1PY1A 2OQIA 2JJQA 3AS5A 3T8MA 5A7HA 3AUUA 3B8EA 3B70A 4JZYA 1NX9A 4PH4B 5HQJA 5I9SA 5HKPA 3RK1A 5K45A 4KXKB 4ZVQA 3QI7A 1G9XA 3H1BA 1Q92A 3CO5A 3O83A 1LPAB 4YR7A 4YAFA 3D6HA 1Y1RA 2D4AA 4DCOA 2P9QA 2EGGA 5AVSA 3DE3X 1VI2A 3W9GA 3KTDA 4BVHA 5TGDA 2J3MA 2EEZA 2HQBA 1YKGA 4KMOA 5F98A 4TQAA 2CJFA 3LWDA 1TK2A 4ZVRA 3CSDA 5LMZA 1M6EX 2MU1A 4B3CA 2I6FA 3WAKA 1Z74A 1Z88A 1R12A 4XIJA 1G3QA 3BMOA 2VEDA 2IF0A 4X24A 1NAHA 4D0LB 4HWGA 5FWNA 3P9RA 1QGDA 4CLHA 2JC3A 3A04A 4WEQA 4EPRA 2Y1KA 4V39A 4UHCA 2GSDA 3QP9A 4JHLA 1P7ZA 1Y1KE 3H19A 3CW9A 3RS5A 1DPGA 5J5AA 1G98A 4FU3A 4XTCS 4B6OA 3GLTA 3QLUC 4XVCA 1NBMD 4UTZA 2C5FA 1FW8A 5L40A 1SQ6A 2PX2A 4PYKA 3UAXA 4PLCA 4K2AA 3LPDA 2XGMA 3GPBA 3JAWA 1OXJA 5KJNA 2FUNB 1NBME 1R8JA 4RDIA 1V6CA 3L8MA 1ODKA 5DT9A 4PCVA 2H7CA 5L9AA 3IEMA 2R86A 4D4JA 1C9NA 4RHXA 3T4UA 2R7AA 4J94A 1HT1E 4LXXA 5FNVB 5DGCA 1PNTA 3O48A 2GD0A 4BLRA 4KAJA 4NONA 1SN7A 1ODFA 2J9QA 4K3VA 3KVRA 4PGGA 1N9GB 2VJDA 3N8GA 3O4RA 4B82A 4NG4A 2POQX 4YGYA 1VLQA 3IEXA 3AQ4A 2RDMA 4WXYB 1I5OA 2MTBA 4MA4A 5B1YA 3BHNA 3NT4A 5BPPA 2PXCA 1DU4A 4ERXA 3PDHA 4ZKDA 1ZU4A 3T99A 1UWVA 1SY7A 3HUDA 3TINA 4EB0A 3IDFA 2B98A 3ZHRA 1L4YA 3B9RA 2Y1EA 1AF4A 3WLNA 4HDMB 1WKBA 2BFCA 1IM5A 2C4MA 2B8EA 3UKJA 5BMVB 4HOQA 3NHKA 2XE4A 3DKVA 1T1EA 3O8OA 4DQ0A 3BERA 4JQZA 1JIUA 5MGNA 3SDZA 5AO9A 1M34A 4MZXA 2JLUA 3PRYA 3MAJA 4F3CA 3U7GA 1NW8A 2YMQA 1AQYA 4R1LA 2HK6A 1KSFX 2C7PA 3E9CA 1KY4A 5E38A 1WQ4A 3LW8A 4P7JA 1Y5RA 2KZTB 2D0DA 1OPXA 2LDBA 4WUTA 1U8YA 1OA1A 2QUKA 4Q21A 4Y1FA 5C9ZA 4QUBA 2IV2X 5CIWA 4QATA 4BWRA 1N9AA 3HV2A 2GEFA 1JLLA 3KAJA 3PF8A 2PM7A 4IP0A 1L7QA 4JYCA 1CY8A 4NAVA 4FD2A 1KMCA 3LT4A 4YJFB 5ECGC 1QH0A 3KETA 3MYVA 2BGKA 4GMRA 2WM3A 3Q78A 1AP7A 4HQOA 4XD2A 1NN1A 4ZO9A 4BO8A 5JSUA 3C70A 5C7IO 1PZNA 4R9NA 3NR2A 2F9FA 1FY2A 1H6OA 2JAWA 3COYA 4EY6A 4BNJA 4QBGB 1Z5UA 4GX1A 2RKBA 2XPYA 1ZP6A 2YZ2A 4P82A 1FLDA 1SAYA 4KN8A 2Q9AA 4BESA 2FPKA 4LVOA 5CM9C 4CM1A 4JK3A 3VU8A 3DO6A 3KWJA 4JI8B 3AGPA 3QKRA 3TG8A 4JLNA 1YMPA 1NFRA 4AG6A 4E4YA 1N0QA 3JQFA 4L50A 2WD8A 4GKVA 3N5CA 1EFRA 4HZUB 1BJRE 1FQOA 1VCOA 2K7FA 3TMYA 2QXUA 1Y9ZA 3DSTA 4FOSA 1S2NA 4AW9A 3M4JA 4MKRA 3HMKA 1EZZA 4PQYA 1M2OB 1ZL2A 1BH2A 1IPHA 4K88A 3WL4A 5EX3A 1KI2A 2YNMA 1WUKS 1UK7A 1MEEA 3FG9A 3AV3A 4KH1A 5CURA 5EQFA 2HV8A 2W98A 3U19A 2W6NA 1J56A 4Z6KA 4LYAA 2VYQA 2W4QA 5DYNA 1OWOA 2EZ4A 1AS0A 4LOHA 4BWFB 4BX8A 3CQ9A 4UASA 4FYWA 4JCOA 3QA3E 3HR7A 2XXAB 1O96B 2X5NA 3PNVA 5I8ZA 5AVTA 4J7AA 5DWVA 1FTYA 2DE0X 4PGFA 4FS3A 3LY8A 4HDCA 5HFAA 3CR7A 4QXQA 2B94A 1NDUA 4H6WA 2ODWA 1Q77A 5ECDA 4K05A 4QD3A 3THWA 4UVGA 5CAEA 4CDGA 1UBLS 5SY4A 4PX9A 1Z34A 4YI3A 3M6LA 2MR6A 4UHFA 4C4RA 1USWA 3QTLA 4QU9A 1TEVA 1E3EA 1SVNA 2PQMA 3ZH9B 2BDEA 2OB1A 3ZKJA 3PGMA 4Q4JB 1D6MA 2OCKA 1WPGA 4KN5A 1CUHA 4WXHA 1KEUA 1N5MA 2ZIGA 4AOFA 4AKGA 5T4EA 4JL0A 3KYIB 1U6KA 3L8EA 2XMZA 5TQVA 3LVQE 4MI1A 4D4IA 1RWNA 3OEED 3T7TA 3T5MA 5LQRA 1JLHA 2PGOA 4TGLA 2CVZA 4EQFA 4FS8A 1E2JA 3M6FA 1V8OA 3CPSA 3I76A 5FBHA 4IOKA 1VE7A 5IT4A 2B5WA 4H7PA 1D8TA 3IVAA 2Y9PB 2B25A 3JALB 3U1BA 2ZB3A 1QQEA 1FP1D 2C0QA 1IUOA 5FA5A 1Q0SA 2PHZA 1QLWA 3ZXIA 2R47A 2ZB8A 4JGIA 3AWDA 4LECA 3M81A 3PKJA 3H5TA 4Q24A 4FDAA 3KOWA 2RB5A 1KPGA 1C1HA 2NTEA 3E7DA 3VX4A 2EGHA 5KO2A 3UI2A 3H0KA 3HCDA 1DIGA 4NYMQ 4DC0A 3NUZA 4ZIRB 2W9XA 3CKKA 2P2DA 1GQFA 1J33A 3UJPA 5KQPA 4N3BA 3R7LA 2WV9A 4EA7A 3D6VA 3LZCA 3UM0A 5B3SE 3IO5A 3DFUA 3PCRB 5EE9A 1J42A 4BGEA 2BLNA 5B58C 1JBQA 5IUKC 2RHGB 4NCAA 2I62A 1BE8A 4NJEA 3TZEA 4KTVE 4RK6A 4LDAA 4J1TA 3N3AC 4WCFB 3GA5A 4S1OA 5KNDA 5C2YA 3EXHC 1U04A 5LZ2A 3A3YA 5E9WA 4UZEA 4O2BF 5BURA 3WC4A 1NQTA 4NOJA 1T8RA 3R3SA 3TL5A 2VSXE 5IABA 2HK8A 1O87A 3ASOE 4TMTA 4EIWA 1II9A 5TNXA 3BFVA 2FWBA 2ZZNA 4HZGA 3G2IA 4CLXA 3R2JA 4UKDA 4RGBA 1QQ7A 2IVZA 3WL5A 1GEGA 3KWLA 2OHFA 4MDEA 3ZHTA 3I8SA 3TCKA 2G07A 2MJLA 5KQGA 3VYRB 2EF1A 1NVWQ 1YBAA 3HVUA 2R62A 1T9GS 3PNLB 2VHJA 1G2IA 1FFDA 4U8HA 4RNDB 5AKZA 5FBRB 4E5NA 2MYOA 3BHJA 1N6IA 3HEMA 3Q49B 2QI9F 1SUDA 2XYGA 1C1DB 2D7JA 1Y3CE 3PFGA 1HL3A 4X1KA 4LXIA 4G5HA 2IVFA 1I94B 2ZM5A 3MGGA 4LYHA 4TRNA 4OGWA 4AXBA 4CMAA 5ARCA 1F6DA 2GEDA 1AHHA 1PR6A 3GRUA 1NHGA 5DTEA 4B4WA 1IBCA 1C7IA 2P3QA 1A8IA 2UYOA 1D2NA 16PKA 3KSRA 3R75A 3TNDA 4QSHA 4OK6A 2QTFA 3DXFA 1WOMA 4HDOB 3MWYW 1N57A 4ACBA 4BWVA 2CXXA 1P0IA 3VR6A 4GP9A 4J03A 4JYAB 1SXGA 1RYNA 2CVFA 3V8BA 2JB9A 2XUKA 1RACA 1CTQA 1TECE 3H1TA 4F3TA 5C5IA 2G67A 2QP3A 4V3CA 4CMJA 1W7AA 2D74A 5EIBD 4BE9A 1YFZA 3AIKA 4QTUB 3TJMA 4ZXPA 4ND7A 1I6MA 5CMYA 3JVEA 1W3BA 4Z4FA 4KQXA 5CRIA 4G86A 4YRAA 3ZBPA 5EIBE 2CE2X 2PGNA 1SCUB 3HCFA 2AG0A 2JDID 3N8IA 4FHDA 4K26A 4U4AA 3QLTA 5K1ZA 2FE4A 1M9NA 4MGKR 4BNKA 3B9BA 5L3SB 3CZQA 5CGQB 4AXXA 2A0UA 2D1SA 1DG3A 1Z12A 2W2VA 3AJRA 5G04J 1ANKA 4KUGA 1IHUA 1WM5A 1NZNA 1R8QA 4M6WB 2X86A 4YACA 3UV7A 3JXJA 5AHKA 4LJKA 4PAMA 3GXBA 3G2QA 5HBGA 4IRMA 2C9ZA 2HQ1A 4LN1A 3MCWA 3OOWA 4MS4B 5F9HA 3HWX1 3U39A 2FE1A 2ZITA 3G2JA 2Q45A 5LYJF 3AKZA 3FHEA 3S1AA 3JARB 1BN6A 3VXKA 5KNHD 2F9MA 4HDSA 3MWLA 3WYDA 3EWAA 3GPDG 5DTRA 2XGJA 2A58A 4F8JA 2ZAMA 1BCRA 5CYOA 3CUUA 4BNVA 5BRNA 4DZRA 4LV6A 4DIBA 3KL4A 2IHVA 1PR2A 3O1IC 4DDTA 5IKEA 3A9WA 2VWQA 5TX7A 4EY5A 3VYUB 3WLFA 1KL7A 3SGLA 3VYTB 3GJ3A 1XO1A 3D64A 4HB3A 1J97A 4DADA 2QMQA 3D7SA 3O2SB 3K8ZA 4DPMA 4CF7A 1V54E 3LXRA 5C1PA 1T9BA 1DEHA 3OJFA 3QVGA 1HZJA 3VH4A 4HUQA 4BEWA 1ADCA 2FZCA 4S1VA 1S89A 2FWRA 1E4YA 1XD8A 4OLJA 5A71A 4BECA 4M9SA 4QOEA 2HHAA 4NATA 1VDMA 3OM0A 1E8WA 3ME5A 4HDKB 3EHQA 1Q1GA 4GDMA 2NM0A 4RANA 3JR7A 4TZKA 3GJQA 1AA6A 2ETXA 4Q9DA 3I9FA 2ZUSA 2WVAA 2GHTA 4DYVA 4XFKA 3SSOA 3BMCA 3WRYA 1T2FA 3S40A 1J8MF 2D1TA 2D2XA 3BDIA 4OQNA 3H1AA 3C98A 3A6LA 1XDSA 1RWPA 3IA2A 1FDVA 3V8PA 4MV0A 4R83A 2IS2A 4TRJA 1I36A 2C2OA 3BGWA 4HATA 3PFBA 2QY9A 3GDGA 5BVGB 3DUWA 1ZGHA 3VM6A 2VAXA 4JMPA 1WEKA 4MV6A 4I43A 2J9YB 3V9AA 2WWGA 1M1YB 3SQVA 1N4AA 2UZ1A 3SIRA 2IV7A 3I01A 2GF9A 2A5YB 4IRUB 1KJIA 4CM9D 2V8SE 2HNKA 5CGZA 2B5VA 4F3YA 2YXPX 3DG9A 2FI7A 5U9CA 2R05A 3FJOA 4EEKA 4Z9YA 5BNTA 1ZHOA 1B16A 3H6KA 4NCIA 3FU6A 1FQWA 5JR3A 3F78A 3H99A 5JJ6A 2RGEA 1AKMA 3LBFA 1NUQA 4KLRA 1YQWA 3SJBA 2MHKA 3HXPA 4NH4A 3X1JA 3S7DA 2WUVA 3CH7A 4ZP1A 4L2IA 3DWIA 5FH9A 4FFLA 4DIEA 1N36B 3L7OA 2WVIA 3TRJA 3UQZA 2DR2A 2B8NA 1N2ZA 4F2HA 2RB4A 2DQZA 1QKJA 3EF1A 3AZQA 2DBZA 4A6PA 3QF4B 5LP6C 3FNIA 1SXPA 2XI4A 4DNQA 5ALPA 1BA2A 5B37A 3BDVA 4B34A 2WLTA 1LRKA 4KQ1A 4E2XA 1QORA 4OBWA 2CXSA 1T2EA 2OO7A 3G0BA 2R1TA 2AF3C 4IXTA 2W4IA 2W6QA 1RQPA 4RY8A 3VKWA 3HDXA 3A1FA 2JFQA 3WMRA 3AG2E 5BSUA 2ZPUA 3OAAA 3OZ7A 1QHXA 1W0JA 1NTOA 4B6RA 2PS1A 4ZEVA 3IBCA 1B43A 1JDVA 5K3EA 2PKEA 3NVKI 2YJ5A 4B7CA 1P5FA 4DLZA 1L5GB 2GFIA 1QKKA 1TR4A 3FWHA 3K9CA 5D6NA 3NDPA 3QBTA 3SU8A 4O2BB 4MZDA 1ZVKA 4TTVA 3VPXA 4DYDA 2XOKD 5K3CA 4TMXA 1XHLA 2PG3A 3WIOA 3KTOA 4XB2A 1JU3A 3HCOA 4INOA 3PQDA 4HJXA 4KPGA 2P6UA 3UY4A 2JFFA 5CBPB 3LBAA 1DKNA 3E48A 1SKYB 4HHEA 3SEQA 5IVKA 1HLGA 3KSMA 1UJBA 2P9SG 3T4PA 5EJ8A 4HGRA 3FCAA 1J1IA 1DCMA 1K68A 4M46A 2F55A 3EQ7A 2UZIR 1RI4A 2GRUA 2AQIA 2RGGA 4BU1A 3OT1B 1KYQA 3C6QA 2O2DA 4D1YA 4DJJA 1IY8A 3GP8A 2A9VA 2HYDA 4LZPA 1GL3A 2BGRA 4B45A 5LC1A 3K9FC 3GLHE 4URUR 5KOJB 5FI5A 4RTRA 2CVPA 3D1LA 4FN5A 4AJ9A 2YY5A 3UUXA 2QHXA 3PC8A 3ABME 4QODA 3DBSA 1T6XA 1DBQA 4PS7A 3RHSA 3F1LA 5A04A 3ZWOA 5I7RA 2YC4C 5F1KA 4CMIB 1Z4PX 2Z09A 4MRUA 1AHNA 2UV8A 1CUUA 5G4KB 3BSSA 1YFLA 3K5IA 4QXRA 2G5TA 5FL3A 1RRMA 1C0IA 4R1OA 4KFCA 1BXRB 1F7UA 3EPLA 4F38A 4G0XA 1ZNXA 3VTAA 3RABA 1CVIA 1ZK3A 1A2KC 1H8EA 1JXQA 2ZJ6A 4KRGA 4NBNA 4I2NA 4U3JA 1CETA 3GUUA 5JQWA 3UNXA 3GLGA 2IZZA 1OLOA 1EKXA 1PJ3A 1N34B 3MWDA 2WSMA 1RJ9B 1VKOA 4MJLA 5B2ZA 2GROB 3LVFO 1W0KD 2IA5A 4AXHA 4QLBA 4DLSA 2V03A 4G5QA 1ABBA 2P9GA 3WP0A 2F8XK 4MBGA 1F0PA 3ESRA 2O2XA 2HCBA 1AV7A 1N6OA 4MAFA 2HUNA 2BEJA 2CHXA 4G0PA 2G1UA 4RD2A 3THXA 4BRUA 4GTQA 1YR6A 1SCIA 1Z6ZA 4L73A 2AOXA 5GINE 2XTAA 4MR9A 3O91A 3HKEA 4M38A 1J4AA 5DKFA 3TX2A 3KPJA 4JZKA 3SMVA 3ZXXA 3G59A 4M8KA 2X0KA 4RKFA 1AWCB 1CUWA 1T4CA 3MYYA 3DOUA 4W7SA 2WTUA 4L23A 2E4XA 1U8CB 4K3UA 3MVEA 4R5HA 5LYJB 2MSKA 4GX2A 3ADOA 1JLRA 3EEFA 5CVJA 3C14C 4MH0R 2WICA 2VHTA 4RK7A 1ZITA 3E61A 1PK8A 4GWGA 4HFRA 1GPH1 1J0CA 1Z8NA 3QIAA 3SQLA 4RXMA 2FO1E 1X7DA 4J0JA 4W9NA 3PICA 3SC6A 4I4IA 4KLCA 3G0OA 1SKMA 1C7JA 3W7VA 1HMYA 1YZYA 2RSLA 4X71A 3NRCA 1UXJA 1G2OA 1FFEA 1M2EA 2WJGA 2P4HX 5JHAA 3DT9A 2WMOA 1O94C 7REQB 5CXQA 4P0PB 1BRTA 1YCHA 1GPKA 4C6TA 4GYJA 3EDOA 3I2GA 4CFSA 6ABPA 4L02A 5DP2A 3HCCA 2GN2A 1HDIA 3EPJA 3EAFA 3QPVA 3IYLW 3WGOA 1D7AA 3AXTA 3GLIE 5LP6F 2ZYWX 1HYGA 2W0MA 3ASHA 3LUDA 1P4RA 4QREA 1CBUA 4YDSA 4WE3A 1KMHA 5LCWC 1M6VB 1Z4JA 3QUQA 2B6HA 2PJZA 4EPYA 5BNIA 1E1MA 4IEEA 4GZ5A 2HDWA 1UZMA 1ZG3A 3HADA 4DIOA 2DVMA 2WNHA 1L8LA 1WBBA 1S96A 2PFGA 1HDZA 4XQEA 4G25A 3HUEA 2JFXA 1O08A 1WABA 2QGNA 1E9VA 2V6GA 2MSNA 1A4UA 4NS4A 1BDMA 5AJTA 3STTA 2RBEA 1RHUA 1IK6A 4BO3A 1COWA 5FPKA 4ENTA 3K1JA 1OMOA 4Q6WA 5CB8A 1KH1A 3PITA 1LA2A 1XZHA 4B0ZA 2YHIB 1A5EA 3A8TA 2NTJA 5CMWA 2FLWA 4M86A 1Z2NX 2V45A 4BO4A 1G5PA 5ICMA 3DMTA 4FFBB 1JR3A 2OAGA 4BSZB 3EU9A 4JJAA 4XQCA 4OLBA 1BIFA 2OB2A 1QXSA 1L5QA 3OSZA 4I8XA 4L4XA 2FDCA 3FMFA 3G2HA 3CA8A 2PEYA 3DL7A 1C7FA 4PEVA 2WXMA 3IEKA 3DYIA 3IQZA 1BGXT 4CQMD 2PGXA 2ASEA 4YAWA 3MCVA 1ZM9A 2IU4A 5C7OO 3S4YA 1UT6A 1OILA 2JLRA 4FYMA 4MPDA 5D00A 1HG5A 1JYFA 4Z54A 1JQAA 1UQTA 3MQ4A 5CJJA 1HKHA 3BAZA 3DSSA 3ZGQA 3OTIA 5DM4A 3FKQA 4FGKA 2YWEA 4CT0A 4WK6A 5IH7A 1I6WA 5ILOA 3GUHA 1C1XA 4ZKEA 4IGFA 2HDHA 1MU0A 5J63A 2ARKA 2YXNA 2CL0X 3UW1A 2QMHA 2X6TA 3BD8A 2N47A 1DEOA 3NALA 1V5IA 1Z6QA 4OXYA 1U4NA 4WKBA 4LF5B 1H6CA 4QSMA 1DTWA 1NBOA 5EWLB 3L8ZA 3H5NA 3P19A 4EJSB 1VSVA 1H5NA 3AJ9A 3KTAA 1Q95A 5H68A 5IH3A 4EJ6A 3LXMA 4E94A 1JG4A 1NLUA 1TQ8A 4I1AA 4FP9A 3RTDA 3CIOA 3V2UA 1J70A 4ER3A 2VK2A 2VP9A 4D97A 5B2FA 1NM5A 3G49A 4PCUA 3K9LA 3SQXA 3NWEA 1EFDN 4RTNA 1XRPA 4RW0A 4CTJA 2X22A 2GBLC 5DRYA 4OAVB 2M98A 2DECA 2R44A 4JEMA 2JLSA 2PSHA 4JXJA 3AX6A 4GR5A 4XPIA 2CG3A 1HNXB 1GA1A 1SKQA 2LW7A 3AVQA 4RVDA 1SG6A 1OJLA 3ZS9A 1L8AA 2CFIA 3TB6A 1TJNA 4PF1A 1E2GA 4JD5A 3KYDB 4N39A 2WM8A 3DP9A 1H65A 5JLAA 4O2LA 2FSUA 5DTIA 2PAFA 1C80A 3FDFA 2JS7A 2RKOA 2VJKA 2X8BA 2P9FA 3EN0A 1D07A 4BB0A 3M89A 3EVTA 4DE5A 3ZGNA 3I52A 1F0KA 3H0CA 3DKRA 2OBYA 4E1VA 3Q5DA 5K5EA 3UCEA 4DLKA 4UMDA 3AETB 1NVBA 2XE7A 1HU3A 3TOCA 3JQ6A 3TIVA 2C61A 1HEIA 3IHWA 3A4TA 4OP3A 4N8DA 4WH0A 1QYCA 2ZROA 3LL4A 4K46A 4GT1A 4DBLE 3ENVA 3QM1A 4PDXA 3B9QA 3A6HA 1ZCJA 4B46A 2O2YA 4OHWA 2SBTA 3CV0A 4I9HA 4KSBA 3CKLA 3MJEA 1H69A 4RGVA 3UWPA 3DJYA 3IR5A 3O7WA 3HO6A 2HMWA 1JFVA 3LX4A 2F67A 1NF8A 4RHCA 5HE9A 4FHZA 1IY2A 3G5AA 3KKNA 1HRKA 3HB7A 4LF9B 3ERCA 4PPNA 2FPXA 2WMYA 3QG1A 3OM8A 1HE1C 4OHVA 1KEZA 1EXWA 1USUA 3KT8A 3PQFA 3IOEA 3DE7X 2YNQA 1B8OA 4HOYA 2WAAA 2ZUUA 3ECSA 3W4IA 2AWOA 3ZHSA 1DS6A 3QI2A 3ZY5A 4KLNA 4E1AA 3ZX5A 3CZ9A 4IIXA 3CIAA 1JWGA 2JHPA 1KZ9A 2DXIA 1SNYA 1L1QA 5FDFA 2OTCA 2PNJA 3D8UA 4XA8A 1ESNA 4BMNA 3O47A 1ZJYA 5A02A 3VU1A 1NPTO 1PR3A 3ZZTA 5DM1A 1P1JA 4LSWA 1Y8AA 1L7PA 2JEZA 3D2BA 2ZZKA 5ISMA 4JS0A 2QAJA 2BFAA 1EUDA 5LZ4A 4N0PA 3TCXB 3ZR4B 3GZNB 2I3GA 1U1FA 4G9EA 1F6WA 2QTBA 3BL6A 3E8MA 4L9WA 5AKYA 3D4LA 4URYR 3KLOA 2JHAA 2L18A 1L5SA 1NDHA 3FMIA 1U7UA 3UJDA 3CQCB 3BMQA 5JHHB 4X1IB 2C5AA 2FVYA 4EKNB 2GM4A 2AEFA 2H8GA 3GGGA 5T3RA 3PS6A 4YS6A 1YHNA 3EA0A 3RT1A 1JKXA 4ZARA 2NP6A 1U3DA 2D5BA 3U3WA 1R6AA 3DSWA 3RSCA 1XTVA 3SWWA 3HA3A 3G0HA 1AZSC 2CL7X 4AU1A 5KX5A 4WACA 5EKSA 3SYMA 1SXJB 1XJWA 3DO8A 3EG9A 2EZTA 1E2QA 2L0IA 3ZVMA 2REQB 3I04M 5ENQD 3W04A 5AK0A 2VUTA 3ANMA 2XHEA 2WT9A 1E60A 3A4IA 4H1WA 3NFYA 1DRVA 4BLPA 5KYVA 4BX2A 2V7QD 3WXMA 5JUWA 1TU4A 3EZLA 3G2LA 1ENPA 5CCLA 2IS4A 5MHTA 4EX7A 4WBNA 2YOGA 4IUBS 1JBKA 2NZUG 2ZUBA 3LQYA 4JJ8A 2Y1LA 4GMKA 4RZIA 3BMNB 3FHJA 2GK7A 1TC1A 4HVLA 1XNJA 5FPHA 3EDTB 2HLPA 3FZGA 1K66A 5CA1A 4I1SA 3T5AA 1RAIA 5AJVB 3N87A 5KYUA 4O6FA 1OFGA 4JPSA 1DBVO 3QRWA 4LDPA 4UI9C 1HETA 4H0NA 2VYNA 1E9BA 3HLTA 2G06A 2LCQA 2ECQA 3HSYA 5DM2A 2ISSD 1P1CA 2X7HA 2BGMA 5CBOA 2LXNA 5JXGA 1NSYA 2ENWA 3FSGA 3KD3A 4WCFC 2Y0DA 4GI1A 1BGVA 3W3AA 2M1ZA 4Q1AA 3TWSA 5DYWA 4ZVNA 5EPOA 4RCYA 5BVHB 3OJCA 4TXMA 2H6IA 1NBHA 3EPHA 1ZUHA 4Y18A 1Q1ZA 4F3KA 1EHCA 1SZDA 3IAFA 2AIRA 1FTGA 3TQSA 5REQB 2AF4C 3W2IA 2IX3A 1E7VA 1D2AA 3GDWA 2FPGA 2QW8A 3R3XA 3EEYA 4Q9IA 1ZUNB 1WB5A 4EG6A 2ZJAA 1KYIA 1QQ5A 4MS3B 2RHDA 4NK4A 1IZZA 2FBNA 5DVZA 2DWZA 1FUUA 3Q6MA 3TWOA 5EEGA 4FPXA 1EJ0A 2XCUA 2SCUB 2MYUA 3ENWA 4Z1MD 2AXEA 1MC8A 3MXTA 4Y2RA 3ZY3A 3IXLA 1MXHA 8AT1A 1Q2UA 4MV1A 4MUGA 1KORA 2O4UX 1PKEA 1MT0A 3TXNA 1X9GA 3UWMA 5AVKA 3O6VA 3PS9A 2O8NA 4JVLA 4YMVA 1X87A 4K9MA 3WG7E 2I3BA 1YV9A 2FUCA 1T9KA 4FNAA 4N3AA 3RAGA 1E9DA 2VCHA 3DOCA 5LUAA 3WBFA 4K9LA 5ED4A 4ZT7A 3GFFA 4CKZA 3CW8X 1EXNA 3ZGZA 3AY6A 4BP1A 1UWKA 2I4IA 1SHZA 2W70A 1A69A 2P30A 1TYZA 2D2FA 3BUSA 4OSOA 1UBJS 2B4TO 2Q6IA 3OM1A 2F4VB 3H16A 2CLFB 1FZTA 3LTNC 1N0WA 1QHFA 2JD0A 4NCHA 3FAKA 2ZIWB 3M9WA 3R7NA 4MP3A 1U0GA 3IRUA 3NKFA 1EBUA 3S2EA 1G21E 5F9MA 1ZI9A 3VOAA 3M6VA 3N7TA 1W5EA 2HIHA 1ONPA 5KVVA 4GZDA 3FVWA 1C3JA 1JXAA 1Z4OA 3HDVA 2DFVA 3HO8A 2EIJE 3J81A 2XKKA 2Y69E 2K87A 2ZEJA 2KPOA 2VTDA 5JI2E 1JH8A 2CB9A 2HQOA 3IP6A 3UXMA 5EOVA 4R2MA 2HJRA 4TLLB 2ZI5A 4M9RA 1Z7EA 1W85A 3O21A 4WCDA 3ZI0A 1WETA 4WY2A 2DYRE 5FEMA 5KKNB 2YVUA 1WHTB 3HCEA 3B51X 4EEZA 1QYRA 2H5IA 1L4GA 2BZSA 4RF5A 1Z5VA 3VKVA 3I32A 1YVEI 1Z6TA 3HCWA 1VI5A 3TKLA 4MO9A 2B36A 1RRGA 5EQDA 3KEQA 4LIPD 1REQB 1GTG1 3DNPA 3ZXSA 5JBNA 1SPXA 3WJAA 1D9SA 1A8UA 5ILQA 5AKHA 1IY0A 1QYDA 2HUPA 1XQ1A 4DV3B 4C4SA 2LPMA 5BYBA 4Z3DA 4PRYA 1M0WA 2PM8A 1DO2A 2WB4A 3X1DA 4UQLA 3V31A 2O1EA 3GRKA 4R1TA 3SM9A 3WGIA 5IWAB 2A59A 4L6IA 1SOVA 1X7XA 1Q7RA 2JJ1D 4BMXA 4CIWA 3UMBA 4R7ZA 4X0EA 3HNRA 4MYSA 3MBOA 1VLMA 2AMLA 1F1JA 4UEOA 5A5GA 3NBXX 4L7QA 1U7HA 2WD9A 4LBVA 4CT4A 1U28C 221PA 1CUAA 1XF9A 3NIFB 4DMLA 1UBRS 3JQ7B 3RFVA 3JSAA 3DYVA 4AO7A 3KPVA 4NMWA 5AJWA 3CU5A 4Z9XA 1V45E 1HMPA 4U02A 4EUFA 3V6LA 3ANNA 5KTRA 1AT1A 2B92A 1BVYF 3CM0A 4D9GA 3UT5A 4J8YA 2BFNA 2DKOA 3TWUA 1ZUIA 1S0PA 3UC9A 3KZMA 2A9KA 1Y89A 2OD7A 4U63A 4RCVA 1X9HA 4CLOB 1T8SA 2WXRA 3Q73A 3P1UA 1LVUA 5HJ5A 5SYNA 2JFZA 3IAUA 1BTOA 1T2AA 3A6EA 2GVZC 3I0MA 1XTJA 2CF5A 4JKOA 4RVNA 1OFTA 3N1UA 5LOVF 3OFVA 2E87A 4ZK2A 3G02A 4DMKA 3T7EA 4MW9A 1P7CA 4DY4A 1WDWB 1JAIA 1EFHA 3WBBA 4EX6A 3RYIB 5EQTA 2AJ8A 1GCGA 5EVJA 1XMPA 1HG0A 1KI6A 2P91A 2JW5A 2RHHA 4U7GA 1PT8A 3F4BA 3H0EA 4X64B 2AKAB 3TBFA 3B85A 2XQFA 1OXTA 4KVOA 2JGJA 3JQBC 2XCRB 3AKCA 2UVPB 4ZC1A 5LBUA 4TLAA 5EY5B 3TXYA 2A4MA 4GH5A 3U7HB 2QLBA 2L6JA 3B7BA 2EKLA 3NU1A 1IWBB 5FTJA 2SNIE 4RY0A 1YASA 2RGUA 4BXOA 4Z86A 5EINA 2OZEA 1CT9A 2Y0BG 2WJJA 1L4BA 3N2ZB 4ZA2A 5C1OA 2C4HA 1AURA 2O52A 4BO6A 1NI5A 4BTLA 1V43A 4KN9S 1HE4A 4TRMA 4W9MC 1XD2A 1WXFA 3FU5A 5FWXB 1Y5NA 4RSYA 5FUWA 2JHFA 4R9UC 1Q91A 1TUBB 4ALLA 4CN9A 2FW0A 3FRJA 1MABB 1LBIA 3QELA 1NSTA 1THGA 3ZU5A 1K75A 1WP4A 4NCNA 4W9RA 2CXNA 5CX1A 2ABWA 3M4YA 2D5LA 3B48A 5G53C 2AYZA 1P9WA 5KC8A 4DXAA 2OCLA 3RS4A 3OHMA 5THKA 2WE7A 5KYYB 2XQ0A 2ZSJA 1XIVA 2N3ZA 3VPFA 4JJZA 5HZHA 1C0EA 1U3GA 5J5CA 1IYGA 4WKCA 5JJ7A 3FAZA 4LDNA 1GN9A 1TMYA 4HKTA 3LPZA 2I9PA 4KR0A 3WLPA 3H4TA 2XD9A 2ZJZA 4NFSA 1F12A 5DM0A 3RHZA 1C14A 5L3QA 2JEOA 5IS2A 3SI5A 1NMXA 3C41J 4JBGA 3QK7A 4K28A 1SELA 1TVKB 5F78A 3UT0A 1NJ2A 1W5TA 5HUQA 4CR7A 3DZHA 3GFOA 3D9LA 4X45A 3QJYA 2KS6A 3TFOA 2BISA 3P96A 3BILA 2QB5A 3OTOB 3OY7A 5CYPA 2HCRA 2UZAA 4TKLA 4XM2A 3A1DA 3G8BA 3KEOA 1R6XA 3JPWA 4WERA 4TN5A 4K9KA 4K5BA 1NJ8A 4XDZA 1TJ5A 2Q4DA 1V7ZA 2BC9A 2FFAA 3FCCA 3KYCA 1F2TB 1P33A 4D3DA 1E1DA 3R9AB 1FX0A 2I4NA 3QX3A 4E4TA 4UVDA 1UBMS 5K6AC 1V0JA 4IL5A 3SHFA 1SUBA 4EBAA 4L51A 4S3MA 1AVTA 2GEKA 2AYXA 1CIVA 3TW8A 2CXRA 2X1LA 4MX8A 3WLJA 2JIPA 4LYDA 1CUGA 2YBDA 3NAGA 3KAKA 2IP2A 4NYJR 5FD8A 3UPUA 2AJDA 4IHQA 3EY4A 4XB6B 1OI7A 3FZYA 4QWWA 3X2SA 4QOFA 2YN4A 4LGMA 1H4TA 1DKLA 3OA2A 3P9XA 4N6NA 5L6MB 2VJAA 1U8FO 2QI9C 3EVGA 4LJ5A 3JQGA 4KXUA 1XZQA 5LJIA 3MT9A 1TN6A 2KCVA 1UBSB 3O3OB 4IVPA 2CMHA 1VOTA 3HY4A 5AXDA 3R7DA 4G0YA 4Y2YA 1V37A 3FH8A 4IS3A 3ORRA 5CTAA 4MKGA 1K0UA 4EZKA 1PDVA 2ROQA 4HGZA 1NVTA 1H0HA 5CNMA 2AHOA 3V2GA 2V9PA 2IO3C 3CHPA 3AHCA 3UOGA 4DCSA 2WSBA 4JXXA 1C8LA 3CVQA 1V3QE 5KMGB 4INZA 4RTJA 4HWPA 1LW7A 5KOHB 1CF4A 4MARA 2FLVA 4H6XA 2DZOA 1Z2EA 3OWXA 1P1KA 2BZ0A 5AJDA 3F6RA 4M83A 1VYTA 4FCCA 1B6SA 2AR7A 3BFKA 3DZIA 2RARA 3MBIA 4ZT5A 1KOLA 1W8DA 4CTOA 4Z4QA 2AFHB 3VNAA 1BQEA 3RSQA 1M6HA 2PMDA 3DONA 1P4AA 4PICA 4WCVA 3B1XA 1T8WA 4R9VA 3GMDA 4XE5A 3IE0A 1W5FA 3ETGA 4UQOA 3B7RL 4IXDA 4A26A 1U1DA 3T7KA 4B35A 3FTFA 4HCJA 1XU9A 1QVWA 4IYRA 3OU2A 3BIOA 2O0LA 1L7NA 4NS1A 3LZDA 3PT5A 1TA0A 4PC7A 5DLPA 2V98A 5B30A 2TS1A 4GLJA 2G76A 4I9GA 4N4AA 5EPEA 2R17C 1N7HA 2BBOA 1T1SA 4BIMA 1K2VN 1N1MA 4HNAB 9ABPA 2I65A 1XBTA 5I7OA 5KVSA 4QFDA 4WFKA 3CE9A 2C31A 4GSKA 4D3XA 4NHEA 2AG8A 2XMPA 3O8LA 1A7AA 1PGQA 3R6TA 4NCBA 1O89A 1DWUA 1CPYA 2GWHA 4Z4EA 1OKKD 2QRQA 2JZOA 1EGVB 2QR5A 2PGAA 5FI0B 3TWRA 2PJDA 1OZGA 1JA9A 4OK3A 3AERA 1BHJA 4YLGA 2XH8A 3RO2A 1H2FA 1ZNWA 3N70A 3FVQA 4Y2PA 1EFLA 1IC6A 4K1XA 4KFUA 4MIOA 4MWCA 4DLOA 5KJMA 3E4BA 1OTYA 5T8IA 1N5KA 4BQIA 2O2SA 1JEYB 1IZ7A 2G1PA 3UHAA 3FUHA 3F49S 5IYZA 1WXXA 1C0PA 3H84A 3RFTA 3PXDA 1SUPA 2VHUA 1UXKA 2HA6A 4DFDA 4CCYA 2P7HA 2WUEA 1D2GA 2VP6A 4HXFB 5ALUA 1DJOA 4OAUC 5AJZA 5EC8A 3AW9A 1Q0RA 2V74B 1I7NA 1U9IC 2FWPA 4ASUA 1NA0A 3JAKB 2ZATA 4JSTA 2GCNA 3UTCA 4OJKA 3V3TA 4U7TB 1ITZA 3TXMA 2WU3A 3LP8A 4U7WA 4FM9A 4HS2A 4ZRDA 4IJWA 2J6BA 3H1EA 4QVKA 1ZWKA 3T7AA 4AP6A 3L7BA 4J0FA 2WOOA 2DPMA 5DGHA 1IL0A 1HE3A 1E3QA 1L5KA 2BIFA 4LNUB 4PLHA 5LOVB 5CA0F 3DXMG 5U4QA 4DJAA 1JAYA 1K1AA 4DLYA 2JEKA 3Q7EA 3ZTWA 4DN6A 4F71A 4UJ3A 1G3NB 3K70B 2Y2UA 4G97A 3NJ4A 3U44B 1GPDG 2GZDA 4RPCA 4ZYWA 1WZUA 3IUMA 1Y1PA 3ON5A 5CNIA 1NUUA 3LDGA 2ZBQA 1D6NA 4CMKA 3R76A 4ML3A 1XQVA 1A82A 5ICCA 1SK9A 4FJ1A 3DP7A 2IDMA 1JEEA 3O8QB 2P2LA 5U4XA 3CNHA 2JZCA 4PZ0A 1XPOA 5CRVA 3R0JA 3JWHA 1W581 4R40A 2QENA 2O9JA 2QA5A 3NEJA 3PUXA 3A3OA 5KNCA 3A25A 3D9QX 2H1OA 3TOVA 2PAAA 1E96A 4HSEA 1LPBB 3KD7A 3LKZA 4RABA 1RVV1 5DXFA 1U1CA 3FBTA 3IPCA 3HHMA 3E9NA 4OJQA 3W5JA 1AQNA 5A1TA 2X0IA 4OGKA 4YO7A 4C48B 2CHFA 3B12A 4MKIA 3MWEB 1RC1A 3PDCA 4F6RB 4ILEA 5CT9A 5IM4A 5IEJA 3Q1KA 3TRDA 4PG7A 4KE8A 3P5SA 1J22A 3JQCA 1YI1A 3ESAA 1UW4B 4EJSC 1BWRA 4UFNA 1YZ3A 3U2QA 1MN6A 4GXRA 4AJWA 3WL3A 5F4BA 4TUYA 3BJMA 3VPBA 2OCDA 1HFJA 5J4HA 2WD7B 3W5UA 2IWRA 3LY7A 1VPEA 2A3RA 1THTA 3VYWA 2EYQA 3CY6A 2YN0A 4FFMA 4ODIA 1NXPA 2ET6A 3LY9A 2QRLA 3GZ4A 3WGJA 2QDKA 2H48A 3DD5A 5DNYB 1HS6A 2H52A 3DKIA 3FUCA 3O31A 1N4QA 1GG8A 3AM5A 3NBMA 2A78A 4EQ6B 2WM9A 4PU0A 1QO9A 3AMVA 4RPHA 1BHSA 2NUPB 1FJGB 1O9BA 1RLUA 1NF2A 3RK0A 2ERCA 2BSQA 2BEVA 4HQFA 2WVJA 3C8DA 2BWJA 3L1JA 3E37A 4EJ2A 4QEZA 4JT8A 2ZVJA 3DPDA 1ZNQO 2JK1A 1YI0A 2ACWA 5CIQA 4EENA 3A6ZA 3ND8A 3RT9A 4YV7A 1BCSB 1FC0A 2HIAA 1QH9A 2C3OA 2D6FA 5JYCA 4AWXA 1QZ3A 4KJZA 2GD1O 1X14A 1AU9A 2WFAA 4XIIA 2LP4Y 4INJA 4QE3A 3NHLA 4JFAA 1WG8A 3Q7QA 5ES4B 2K5UA 2ILVA 4WLUA 4QUHA 5L4LA 2DM6A 4XKCA 1CQIB 4PQRA 4JBNA 4GGOA 1J1ZA 1TADA 1QFMA 1PZGA 3FIUA 1P7PA 2E82A 4BT8A 2GPSA 2GLTA 3MINA 4MUAA 3BRWD 3K96A 1HX7A 1LLQA 2ZIVB 2R5SA 1KVUA 3LRTA 1AOXA 1RADA 3HA5A 1H23A 3RARA 3TI9A 2IJGX 2R87A 1XROA 2D0PB 2WVHA 2QTAA 5CEAA 4A27A 1U2EA 1NF3A 1TVMA 1TJFA 4OL9A 2AR0A 2IXBA 3VLDA 3O9VA 1VIAA 2Q62A 1TZCA 4IJQA 4F2WA 2CFTA 3P94A 4A3SA 3ETLA 3DAGA 3IHLA 2I4TA 3OQIB 4D6PA 1WULS 3KR0A 1HURA 2DSNA 2XPIA 3N75A 2LV8A 3U3DA 4BMPB 5DYTA 4QQ8A 5JVDF 2VSOA 2NU8A 2YY7A 3FWYA 3HDQA 3OMWA 3UO8B 1Z18A 1FIUA 1IK4A 1QIHA 3AKDA 3L7CA 2OCBA 3BKXA 2VH1A 1QK4A 2QZZA 5B55A 1HYHA 5KSOA 4KXLA 4BMDA 1DAGA 1IQRA 5B3JC 3B1KA 2IXEA 3IUBA 3MD9A 4RHFA 4E3ZA 1S2OA 5IX8A 1JHAA 2LUHA 1HEYA 2C7RA 4DA0A 2V4ZA 4R01A 3L9WA 3DDHA 2A1IA 3VZQA 2DYSE 4FYPA 4GR9A 3GBVA 4ZVVA 1ECLA 4B2YA 3D3EA 3FTDA 2EV9A 3G7UA 5EFOA 3QGMA 4PN3A 1HY3A 2DLCX 4QJBA 3ACBA 3STYA 5JYDA 4IJ5A 5C4MA 3C3YA 1XVVA 3P2YA 1KDZA 4GPD1 5LIRA 1O0BA 2BKVA 2B83A 5IEBA 3C7KA 1ZW1A 2GVNA 1SXJC 2R2GA 3ZBUA 3W9UA 4EO9A 4G0MA 1BN7A 5BXUA 2FWIA 4KQHA 3GARA 2EZUA 2IO2C 1ZMXA 1EVYA 2QYTA 4HXIA 3B1VA 1KQFA 3W5CA 4OHFA 3AVVA 2V58A 1TL7C 5A4AA 3TLMA 2R59A 5LKAA 2Q1XA 4AP5A 2B2NA 1FNDA 3VO9A 4B3TB 2IHUA 1X2BA 1P7WA 4EJMA 3H2BA 1BJKA 4RE6A 1XZNA 3ASDA 3O8CA 4YQZA 1RIIA 4X7PA 3W2TA 1CQJA 1TM1E 1NVXQ 2ZR7A 2XUIA 1KEEB 1RRKA 1RJGA 4IDCA 3ZGLA 5D8DA 4OHZA 5HTOA 2X5KO 4O63O 1QPGA 3MJDA 1QFZA 3JQEA 4H2DA 1DAEA 4OM8A 1AA9A 5JH7A 2CKMA 5LQUA 1KRWA 3T3HA 4HPJB 5IUJC 4DR5B 2HEGA 2HR1A 1G2PA 1QQTA 3NOOA 2Q0SA 1OWPA 4D8XA 2FP4A 2HMAA 2XIQA 1TNOA 6REQB 5K20A 4CEIB 1UMDA 1S5PA 3QNUA 4BZXA 1HDOA 4YMTA 1K9VF 4BKMA 2VPWA 4B93B 4P3PA 1OAOC 1KZPA 3DTNA 1IPFA 1QE0A 1KAHA 2J6HA 2BM0A 1T5BA 5FUMA 4XJXA 3HJHA 1Z0IA 1KDOA 5E1OA 3OEYA 3W8DA 1XMVA 2H1IA 3BXOA 3IEPA 2BTDA 4X5OA 2YZKA 1JF8A 3HWRA 4G0NA 2Q2VA 2P9PG 5CA0B 3K0CC 2OMEA 4ND5A 2V4LA 1IQ0A 1DQZA 1V9CA 4OLAA 4NECA 3DGEC 1H22A 1TLLA 3R5XA 2C03A 2NPOA 1R00A 3BQMB 1YGPA 5EZSA 1IUNA 5AICA 1GQOA 1I6KA 2BM9A 3V48A 1D3AA 2VSFA 3SF0A 3W9FA 3CR3C 2X6HA 1LJ8A 3WISA 1FX1A 5FBLB 3PF9A 4KEAA 2HCJB 1NUHA 3HYLA 4R6XA 2JI7A 1XRMA 4KR2A 1C9JA 4ZDWA 5HM8A 2WG2A 2QAGA 1YSCA 4N9WA 3PA6A 4B47A 1C9YA 5CDGA 1OVGA 2VTVA 4TT3D 2VAPA 3W6OA 2W83A 3BIJA 1EPUA 2PT7A 4LG1A 3VVMA 1UPFA 4LOAA 4MUIA 1VLHA 4CODB 4BPRA 2CK3A 2J3DA 3BE6A 5JDIA 2OO5C 4LJAA 2X6JA 5BN1A 3MSCA 5HKBA 2GCEA 1IN1A 3NTVA 3JWJA 3NM5A 1OXMA 1PJ4A 1Z5GA 4HAZA 4BN4A 1W5AA 3RUAA 4IMRA 4JOSA 3ABQB 2PLAA 2ZUEA 4BLQA 3IC5A 4M1EA 4RFSA 3H2GA 1Y6QA 4OHOA 1NOIA 4KFSA 2FN4A 1RMYA 1ZD4A 3KQVA 4JKIA 4IH4A 3GFQA 2X2EA 1UBKS 4M76B 2RHBA 4A8JB 5BWMA 4FZVA 5AUNB 2OXTA 3TYXA 5HUJA 3GJXC 3P0IA 4OHYA 1FUIA 4FEYA 3VISA 1Z6YA 3UFXA 2FZEA 2P77A 4JB0A 2ZIXB 4Q19A 3GDOA 3MT0A 2H07A 2YYSA 1YUNA 4MSUA 4AAYA 2CL6X 2VRCA 1Z6GA 2ST1A 1RWVA 1DQPA 2DPGA 3OOJA 4NHOA 1EH5A 2EQXA 2C8JA 5H1YA 4URFA 3CH5A 3KDSE 3VH2A 2QTVB 5BUZA 4BNNA 4DUPA 2CHEA 4JODA 4OSPA 2H4YA 1JHDA 2V3VA 1PV4A 2O2ZA 2DVWA 4RQIA 1YJAA 2PX8A 5AW7A 1WQ3A 5EWMA 4YRBA 2GYWA 3R24A 1IULA 5F2EA 2E1RA 4LHEA 2WXGA 2VP4A 1HGXA 4B2LA 3ONNA 4LZAA 3OIVA 4WXPA 4NJMB 1NRIA 4UQXA 2CWDA 1RWMA 2PCLA 3U13A 1KH2A 2Q1WA 3QSGA 3QWFA 1ECFA 3ML8A 4AX4A 2XDQA 3PEUA 2WLSA 1ONOA 1H66A 1QVRA 5D85A 3C6XA 4Y2GA 3Q7FA 2I2AA 1IUKA 3AUJB 4XJTA 3TE7A 3RT7A 3FU3A 4KO2S 5AAOA 4FLEA 1E1LA 3W9BA 3UJ8A 1F9AA 4QGHA 2B30A 1E7YA 4KO3S 2XXJA 4YCDA 4ZU6X 3KPYA 4G5GA 5IJ9A 2FSIA 3NYRA 1T9ZA 4CUKA 1B00A 2P0EA 3RU7A 1RXEA 3E30A 3I39X 5KJ6A 3CLJA 1DAKA 1M8JA 2RH9B 4UUNA 3HDTA 4R7LA 1JQEA 5AOVA 3DMDA 3H4VA 4FFDA 3RJZA 1SULA 4XYBA 1RR6A 2HBYA 1QX4A 3L0IB 1LDEA 4GMLA 4RPGA 3MF4A 1X1TA 5DNDA 3D6AA 4MHTA 1VB3A 3WNBA 1VHDA 3R6GA 5HF6A 1JS1X 2SECE 2JEYA 4IO0A 5LZ8A 5K3BA 4BYGA 3WYEA 2NU9A 2QVGA 5ETJA 2CY0A 3NHPA 2ONCA 4F9GA 1UFRA 5JVDB 3AFHA 5TQ0A 3K71B 3EIXA 3NQPA 5LP1A 4QDXA 3MS7A 3DLAA 4H1TA 8OHMA 3IHYA 1N2XA 4RKWA 3RLFA 1UDRA 3GW4A 4LJRA 1IM2A 3AM4A 2V3CC 3TAXA 2O6LA 2C99A 3OXGA 1FXSA 3TTSA 1OCCE 4Y0NA 1PWHA 3SKYA 1LF8A 3GAFA 2ZYRA 4PYLA 2JGAA 3RTCA 4LBZA 1O2DA 3SKXA 5ENZA 1MAUA 1TDJA 3UPVA 1M5RA 4Q34A 1MQ9A 3P26A 3LBIA 2OESA 2UKDA 3FOZA 2Z5FA 1S8NA 2GPJA 3AVPA 1UM8A 2HAEA 2HY7A 3Q1LA 3BCHA 1WVMA 4O2RA 4HF7A 1IOZA 4TYYA 2IPOA 1XZMA 5LCXA 5LX8A 2RD2A 1EVEA 5EP1A 3QITA 4LFAB 2IPXA 3LVBA 4AZVA 5AQ9A 1D4OA 4HEA1 3U0VA 2CHVA 3R9XA 1D2CA 1MW9X 2HNBA 3R1IA 4OKNA 1GOTA 4IFIA 3V1MA 1LFAA 1I7LA 1L0BA 2CEKA 4H18A 1YHZA 2O2HA 1UMKA 3TGWA 4PINA 3R20A 3OCVA 3U1TA 2BM8A 3P1JA 3QUTA 4F7DA 2FN7A 1LC0A 2OXRA 1L9XA 4U7EB 2Z43A 4LWOA 3BJIC 2J8ZA 4YYZA 1Y9JA 3OTNA 3ZDXB 1Z17A 2DY1A 2J0UB 1HSZA 4U0UA 2VSYA 4EFLA 2VQEB 4I6GA 2H2DA 3MTQA 2FR0A 5F64A 3ZEIA 4BNHA 2O8CA 3T9KA 3M33A 2GPWA 4BZPA 1OCEA 1Y5MA 1VHQA 4W5JA 3ANXA 4ARBA 3DFMA 1SC6A 4CTKA 2DF8A 4H08A 1WSBA 1TGYA 1LF5A 4OBBA 5H7PA 4FFOA 3O74A 3CHOA 2ZTSA 3OTWA 4KAFA 3MD0A 2PEZA 1VRVA 3REQB 3MZLB 4Q4DA 3CVNA 5E95A 3NDBB 4NBRA 2BP7B 2XZDA 1G2QA 3EHNA 1H2AS 3FDXA 4K03A 3T15A 3NUQA 5EHGA 3RYHB 5ARFA 1U1GA 3TI7A 4CF3A 4EW3A 3HVHA 1I4WA 3U7QB 1Q6YA 2QVZX 5DN6D 4M9QA 4PG4A 3QX7A 2QV0A 3NUGA 2TECE 2WWIA 3VOTA 3NPAA 4BRSA 1KETA 1WZNA 2P9BA 2VS1A 2G5GX 5AKLA 3WXXA 2XNDD 2AC7A 4MVJG 1R0ZA 5CFLA 1LQTA 4B8YA 3K0FB 5AUPB 1E7SA 1KC3A 4WRRA 3GVIA 5HDQA 2ZR0A 1KARA 2CLIB 3RSEG 1UK6A 2CXUA 4LDZA 3CS3A 3SS7X 3NHBA 3VR5H 1E2PA 3DHNA 3URZA 1E7MA 2H29A 2AVPA 2IFTA 5G1OA 5SV2A 3HR8A 5T57A 4QWMA 3OQBA 2Z9CA 3U26A 3D1JA 2PX4A 3NANA 3EU5A 1R15A 4J2TA 2YVAA 3KLBA 4A3VA 4H7DA 4PQFA 4TXHA 1X1CA 3Q8KA 2IYQA 2XKBA 3P0FA 2PRZA 1V41E 2ZPTX 4IV5A 4MWDA 2FK8A 3QYFA 3RC8A 3H4IA 1CUJA 1GG5A 1UC4B 3PPYA 4G01B 2CG2A 4BO0A 1CY0A 4KR3A 2IYYA 4P54A 5GONF 1IEQA 2HC9A 1NI4A 1EJ2A 5BWLA 3I05A 1YT5A 3IUNA 4QL3A 4UZFA 4Y1RB 4GKBA 4V38A 2FPOA 4EG3A 2H31A 3DPSA 2Y6UA 1HZ4A 4E85A 4DR4B 3VTXA 1X74A 1H19A 2CD9A 3K6JA 5HKKD 1TW2A 3GLVA 1UK9A 1U98A 2O1XA 1H9CA 2VAMA 3ANSA 1OREA 2HADA 4UJ5A 2GM9A 5D86A 2I34A 4WZAA 2WHQA 3P9PA 3VZPA 5G40A 3ZWXA 4QTZA 5CJ2A 3FTPA 1JGTA 2EVWX 5AWFC 3I1IA 1B0UA 3NHWA 4OA5A 2VP3A 2PMWB 2W6JD 5LPNA 2PO5A 4G09A 5EZYF 3MW8A 1Z9BA 4ITUA 1K8QA 2P69A 3AUSA 3RGWS 2G4LA 4I2VA 5K3FA 5K09A 1T5SA 1GZ7A 4PLFA 3U3XA 4MIYA 1I3OA 2C29D 2X8WA 2MCFA 4ZV4A 3PYLA 3WSTA 3L1KA 2CVQA 4MV5A 2P79A 2J3HA 4G8BA 3HXMA 1E1KA 4KMSA 3ADPA 4NCXA 1O57A 1FXWF 1XJ5A 1SU7A 5FWYA 3RUIA 2HV9A 3LX6A 4YUAA 3ZU7B 1PHPA 4KXWA 4I0WB 4LV8B 4BNTA 4XWKA 4J0HA 2P6PA 3SX2A 3QW2A 2SKCA 3RSFA 4DAEA 4PX2A 1R88A 1UZUA 3U3OA 2B82A 1ZGZA 5D2MC 3BWXA 1TLFA 2FR8C 3GEDA 4TS4A 1P1IA 1O4WA 3RS8A 5CLQA 1DQNA 5CB0A 3CZRA 3M1LA 3EOAI 4MJ7A 4WXMA 3D9PA 2X6FA 5EEHA 4XSVA 2JGLA 1F9EA 3ITEA 4Y6PA 1V11A 3SX0A 3IT2A 5HUHA 4BCBA 1LXCA 4ZXFA 5AK5A 1OVMA 3KOUA 2JJYA 5ALMA 1U3CA 4GRAA 5FF9A 3OZIA 5K8VA 6Q21A 4AJ4A 5JSQA 1US8A 1DL5A 2GTHA 4KVAA 5MN4A 2C1EA 2D7DA 3FNHA 5DTJA 3I9KA 3PZBA 1DI0A 1H2EA 4J8PA 3C48A 3I58A 1DCQA 1H2HA 2G0AA 5L4SA 4NH0A 3VNVA 2B0OE 1HE2A 2FDXA 4RORA 2Y9MB 3V1UA 4KQFA 2GNPA 4WGGA 4HNGA 4AZ3A 2NZ2A 3PJGA 3LQ1A 4B9AA 3QKUA 2NIPA 4QJIA 1OLUA 4R71A 3BVPA 4LI3X 3NTUA 3DBOB 1G5IA 2EBWA 5TC4A 3PGVA 2HLHA 1TZJA 3A0UA 4NNPA 2GN8A 2FW8A 4ZCIA 1KEVA 4ITVA 3AFNA 4ESVA 1OD6A 4ARSA 1BE6A 4YHBA 5FOVA 3K70C 4XUCA 3ZDRA 3KBOA 1UK8A 5MFPA 4OJNA 3SLRA 2VFAA 4RYLA 1KF0A 4GI7A 2IZ7A 3E3MA 1CEXA 3SCZA 2Q6LA 1OPRA 1G8AA 3SF4A 2JA1A 2W6OA 1Z36A 2ZUWA 3NF1A 1KY5A 1LBSA 1Z6PA 2GRQB 2WPNA 2ZSIA 1M10A 1JWBB 1E3TA 2AFIA 4D4GA 1VXRA 2D3WA 2Q9UA 4UOQA 1M66A 3PTAA 4BASA 1BRMA 2EBFX 1XA0A 1UJ6A 4XR4A 1EDBA 2GPYA 4FW9A 1UBNA 2XRYA 3BS4A 5BSKA 3ANTA 3BWVA 4AO6A 3V4OA 2MOWA 4PPGA 2LCIA 1JHQA 1OWNA 5AJLA 3O4GA 2BHSA 3K05A 4MGEA 1I3KA 5L3VA 4O0MA 2VKTA 3QDNA 1DIAA 2VH5R 4UXIA 1QVAA 2H1SA 4DSAA 1I5RA 2VATA 3KOOA 1BDJA 5B5SA 3WVNA 2RAUA 1DBWA 1AMNA 4PAGA 3IP5A 4XQ9A 5LQKA 5JWHA 3F6CA 4KYUA 2ZCUA 4FNGA 2ZULA 1BD8A 4IW3B 4JB8A 1IVYA 2IBMA 2QGFA 4DUGD 6ADHA 1ACJA 4ZCMA 3BDAA 3TG4A 1SKAA 5DXAA 1GVNB 1LVHA 3FDZB 3EX7C 4ONEA 3AF1A 3DMRA 2E7ZA 5B53A 1CJVC 4N0DA 1QUFA 1V35A 2Q2QA 4KSYA 3IO3A 1P5JA 5KWIA 3I5AA 3KQWA 5D3MB 1JKJA 4CMGA 1ENOA 4HGOA 4LJ8A 1Y7TA 2B5OA 1ZJ5A 3U1VA 4FFWA 2IUYA 4W1SA 2B21A 2JGMA 2Q2OA 2R6R1 3B1ZA 1UWCA 1E7WA 1A9PA 1RZRD 1E1CB 2WW8A 3L4EA 3IBFA 4KLAA 3P9SA 4MUMA 3H04A 2C20A 4CETA 3B6IA 1WS6A 5TY0A 3PRJA 5KTNA 4WK2B 1NVDA 1CF2O 4G2TA 3TQHA 4MA0A 5FOQA 4HQNA 5BXQC 2RD0A 5C8YF 3F73A 3EXHA 1UFVA 3WGYA 3FPFA 1ZM2A 2VJLA 3DTVD 2VDWB 3ZNGA 1ZCBA 3E0XA 4TTQA 3ZX4A 1WCV1 1QH1B 1IVNA 3CYFA 2IUEA 1X1RA 5JARA 4E32A 4XUDA 1GYPA 3IAXA 2ZIRA 1SQMA 4YDOA 1BVHA 3FOWA 2B0CA 1BS9A 5HK8A 5LQNA 2GARA 4V0LA 4PV7A 4ZT3A 4C2UA 2X8LA 4QLOA 3CPHA 4B4VA 1QTIA 5EFZA 2J32A 4NAHA 1QCCA 2Q29A 5DOZA 2ZRPA 2YH2A 1O3YA 3E1SA 1BQ3A 2AX3A 3C3WA 3A4LA 1QZTA 1KYXA 5CVEA 2M6LA 5BYAA 4CHGA 4X66B 2QWXA 4I17A 5BN5A 2OV2A 2C97A 3UJ9A 4HUTA 1T6YA 2QE7D 4BO1A 5CCDA 5IZCA 5JCOC 4BZWA 1CUDA 1MHTA 1TN8A 1FRZA 1NXXA 2P3SA 2GPBA 3HZZA 1PR4A 4DBLC 3C5CA 1FF9A 4FSDA 4EB6B 2NAFA 3LG2A 5GONB 1F8GA 3MT8A 4FHKA 1DFHA 2R8XA 4RDHA 4A2PA 4E70A 2BFMA 3ZIAD 4F1JA 3NBKA 1VBFA 3V79K 1I2BA 4HGQA 4CIAA 5DNCA 5E75A 2P6OA 1X3LA 3V7FA 1JHUA 2J8SD 1E3WB 5BV0A 2JKVA 2R9VA 2R1UA 4UE3S 1JH9A 3DOEA 4JNKA 2H18A 4F72A 4J4BA 4GE0A 5CBKA 4FDLA 4M0LA 3UENA 1YH3A 3VDXA 2XUGA 3NHRA 3DOOA 5AKGA 4FFRA 3VUFA 4DV4B 1YFKA 3SJCA 3MQFA 5HHTA 3B95A 1L4EA 2ORWA 5KYXA 3AO0B 4PLWA 2AWIA 4R84A 1UN9A 5EZYB 4ENRA 1C9EA 4C05A 3ZU3A 1GCIA 2CGEA 4CKBB 3OJEA 1YCDA 3MJRA 4F9EA 2ZSAA 2R68A 2NG1A 1XMOB 1FLNA 4G0WA 1KERA 3NKLA 2EERA 1DUSA 2BTEA 1GYRA 1DTSA 3M2PA 1Z3XA 2O7NA 2JCVA 3I01M 4GZ6A 4EGJA 3T1TA 3UMJA 3F5SA 4P29A 5JCZA 3D1VA 3CK7A 3IBEA 3Q7IA 2I3ZA 4JYMA 2BKGA 3RCBA 4N5QA 2WSSD 5IXYA 1JPUA 2QRKA 5KPJA 3RRXA 4GC5A 2IYTA 4XKBA 2B99A 1FRQA 3PFKA 4B71A 3ML9A 3II6X 1ZIYA 4GTOA 2IIPA 2RK4A 4UQZA 5HE8A 3STXA 2CT8A 1XJQA 3DJFA 3OZGA 3PL1A 2Y1XA 3R09A 4EQZA 2WXQA 2AJTA 4BTAA 1RAFA 3AONB 4A1FA 5DHRA 1UN8A 2EW8A 4I2WA 2WF8A 1LF0A 3OQPA 1H5UA 4DX6D 4NURA 4HLLA 3DLTA 3M34A 2LXMA 3SC2A 1Z62A 4YRMA 5BOSA 3WDLA 4DMUB 2OBFA 2C82A 4DM7A 3TLZA 1AZWA 2C96A 4UWFA