4CT0A

Crystal structure of mouse cryptochrome1 in complex with period2
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
494
structure length
486
Chain Sequence
b'VNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVAANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRYPTOCHROME-1
publication title Interaction of Circadian Clock Proteins Cry1 and Per2 is Modulated by Zinc Binding and Disulfide Bond Formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Circadian clock protein
total genus 173
structure length 486
sequence length 494
ec nomenclature
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4ct0A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ct0A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ct0A01
1MC1A 2C5SA 3IMCA 3F3MA 2EJCA 2DLCX 1A8HA 1VBNA 3ZIUA 3CVYA 1JILA 2HGZA 2QJOA 4L2IB 2PG3A 4MVYA 1UFVA 3TZLA 3DLAA 4MW9A 5BNZA 1KAMA 1J70A 1P7PA 1H3FA 3TQOA 1SURA 1FYDA 1YI8A 4PBTA 1Q11A 1WXGA 4EG3A 1KH3A 4EG5A 1ILEA 4WNYA 1O96B 4MUHA 1WXHA 3FH0A 4ARIA 1IQ0A 3L93A 3MLAA 1G59A 3P0IA 1N3LA 2QTMA 3HL4A 3KFLA 3PNYA 4MQ6A 1EUQA 3H9BA 3X1MA 1F7UA 1H3NA 3RFFA 4KKVA 1ZH0A 4KPUB 4MUKA 1LW7A 5KHAA 1GTRA 1HYBA 1KQPA 4MVWA 3SZGA 3FG9A 1K4MA 4A91A 1WY5A 1R6TA 1MB9A 2YY5A 3AL0C 3H9CA 3FDXA 4PBSA 2O5RA 3FHJA 3JXEA 1I2DA 1O94D 1TYDE 2CUZA 3HGMA 1OD6A 3MXTA 4MW2A 1VL2A 1FFYA 4KR7A 1M8GA 3I05A 1ZUNA 3L92A 1N75A 4JXXA 3CLSD 4MUJA 4G5FA 3UY4A 4YP7A 2CT8A 4GU5A 1N2JA 5TS2A 1F7VA 5AHWA 1NSYA 4DDKA 2GOYA 4NAUA 1O95D 1IFXA 1JZQA 3CLUC 3COYA 2QJTA 4CDMA 2WQ6A 1J21A 1NZJA 4ZCPA 1OWNA 2JAXA 2ZP1A 4ZCSA 3CVXA 3ZJVA 3AIIA 3PRHA 1NUUA 1GZUA 1XJQA 2EL7A 1IRXA 3RJZA 5IHXA 4JZYA 1H1TA 1OBHA 4CT0A 4DDMA 4WSOA 3SEQA 1TQ8A 3CVUA 1JIKA 1T9GR 1KAQA 1TFUA 1QU3A 1CT9A 2PXHA 2J5BA 2H2AA 3Q12A 4MW1A 4Q93A 5LFAA 1PFVA 3ZJTA 1IVSA 4HPWA 4NZPA 4UZFA 3CLTD 3ISJA 3G6KA 1IHOA 3IVCA 1GN8A 4X0EA 4ND7A 4U7JA 3IMEA 2CYBA 5J58A 2PZBA 3AKZA 3SP1A 4DNXA 1N78A 2VTBB 5KWVA 1BS2A 1EFPA 4NATA 2B7LA 3PNBA 2BYTA 3VU8A 1QRTA 4I6JA 4DLPA 1EFVA 4MUIA 4BWVA 1JEEA 4NX2A 3CLRC 1K97A 2CV2A 5FO1A 3A04A 1F4LA 1OWLA 2D5BA 5J59A 1EXDA 2DR2A 1V47A 1GLNA 1TYCA 3H99A 4EG4A 1EE1A 3TZEA 2XRYA 4UZEA 1MJHA 1QNFA 1WZ2A 3IVXA 3X1JA 5K0TA 1RQGA 1ULHA 4ZT7A 2J09A 3LE8A 1LI7A 3KT3A 3GUZA 1NURA 3H05A 4JYZA 1N2GA 4AS1A 1NUPA 4EG1A 3UC5A 3ZXIA 3P52A 1NUQA 1T9GS 3NBKA 1M83A 4MWEA 1JECA 4TS1A 1N77A 4YMIA 4G6ZA 2QUHA 1GTSA 1QTQA 2E18A 3FNRA 3FOCA 4MWDA 3TQIA 2AZXA 1O5TA 3IH5A 3S3TA 3ND6A 3QTTA 3ND7A 4I6EA 2A1TR 1G8GA 2QTRA 4NDAA 1Q19A 4ARCA 4RPIA 3N2YA 5DASA 1YULA 4EFKA 3BL5A 1M8KA 2A1UA 3FY4A 1M8JA 3IOCA 4I6GA 1OBCA 3N8HA 4XSVA 3PNVA 1JGTA 3IMGA 2J4DA 1EUYA 1WOYA 4JFAA 3UOWA 2ZUFA 2XRZA 2AKEA 2IJGX 3CR8A 2QTNA 4HJRA 5EKDA 1G8HA 3K32A 2D54A 4MW6A 1N2OA 3CLUD 1KH2A 3M5WA 3RBAA 4QBTA 2Z3VA 3IVGA 4R2MA 2V0CA 3D6UA 1OWOA 2QUIA 3INNA 3DV2A 3RK1A 5IJXA 3COWA 1V8FA 1OWMA 1QU2A 2X0KA 5H7XA 3CVWA 3KT8A 4ZCTA 4JXZA 4G5YA 2WQ7A 2A84A 3Q4GA 3OP1A 4MUFA 1GPMA 1KKUA 3QTBA 5K0SA 1IH8A 4J75A 1JIJA 4MULA 2X1LA 5HG0A 1KORA 3SYTA 1Q15A 4CDNA 3H97A 4EGAA 4NAHA 1GAXA 4GRIA 1KP2A 3CVVA 1WQ3A 1N1DA 3RK0A 4ZCQA 1VBMA 3ZGZA 2A1TS 3OTWA 2BTEA 3ND5A 2PFSA 4MVXA 4QREA 1I6KA 1U3DA 3IUBA 3VRHA 3IOBA 4RUKA 4DDHA 5JBNA 3HZRA 3VGJA 1EFPB 3MUEA 4EG8A 4Q16A 2YWCA 4MWBA 2CSXA 1I6LA 2IP1A 1JZSA 1M8PA 1VLHA 3FI0A 4R0NA 5J5AA 1EFVB 4QRDA 1Q77A 3P0HA 2DERA 1PFWA 5F23A 2X1MA 2R5WA 2Z08A 2HMAA 4E1AA 2PZ8A 3P0JA 3ILVA 3CLRD 3FWKA 1PG0A 3CA8A 1H3EA 5DK4A 5H16A 2HZ7A 1J20A 5LLTA 4EG6A 1VBKA 4ZT2A 2H29A 4OUDA 1KH1A 2OV4A 2X3FA 3A05A 4MW0A 5KCMA 2NSYA 2DETA 1EJ2A 1J09A 1TEZA 1O97C 4ZT6A 2YWBA 1QRSA 3MMXA 1JEDA 3LOQA 2AG6A 4MLPA 1X8XA 1K92A 3COZA 4U8HA 1T6XA 3ZXSA 4K03A 3IOEA 3NBAA 4ZCRA 1KQNA 1F9AA 2JANA 4DE5A 3COVA 4HJXA 1KP3A 1MAWA 3DO8A 4MWCA 1JIIA 1XNGA 4MUNA 4S1OA 1LI5A 5FO0A 1J1ZA 1B6TA 1U0BB 1T6YA 4HK4A 4YBRA 1U3CA 2A1UB 4L2IA 2JA2A 4PBRA 3D6VA 2CV0A 2VXOA 3FETA 4YP6A 1QRUA 2WB2A 5HUJA 1M8FA 1I6MA 4ZT3A 1O0BA 1COZA 3A4IA 1N2IA 1XNHA 1O96A 3ZUGA 3RHSA 2WSIA 1IQUA 2PIDA 3TNJA 2J08A 2CYAA 4MUGA 1T6ZA 1OWPA 2NZ2A 1WKBA 3IODA 3X1KA 3E27A 4EF6A 2RE8A 3K9WA 4XFJA 4P2BA 3UK2A 2DUMA 1WXIA 3A2KA 5LM3A 3GMIA 1ZH6A 4KPUA 4MW7A 1KQOA 1WJGA 4DJAA 2TS1A 4MW4A 5DEOA 2I1LA 2PZAA 4AQ7A 3IUEA 2J07A 1N2HA 3ELBA 1MBZA 2GKSA 3AG5A 4YP5A 1U7DA 1O94C 4PY2A 3DPIA 2E0IA 5DB4A 3SDBA 1J1UA 4MW5A 2V0GA 1DNPA 4FZJA 1NUTA 1NUSA 3MLBA 3FIUA 4U63A 5FNZA 4CQNA 3CLSC 4MUEA 2D13A 3LCJA 1XNJA 4ZT5A 4XFDA 1PFUA 1R6UA 1YUMA 4K0RA 2RD2A 3SZ3A 1O95C 2CFOA 2IELA 1G8FA 2OQ2A 4EG7A 1JMVA 3ZJUA 1O6BA 3KT6A 4OJMX 3GLVA 4KR6A 1NP7A 1WXFA 4MVCA 4R2LA 1PG2A 2DPLA 2A4MA 3G59A 5HUHA 1R6XA 4J76A 1TYBE 2E89A 2CYCA 3KT0A 1PFYA 2ZUEA 3SEZA 1S4MA 5TGTA 3CLTC 2GM3A 2A86A 1Y42X 3N9IA 1NYLA 2YXNA 3Q10A 5TEVA 1U7XA 2Z09A 1MB2A 1WXEA 1M1ZA 2E21A 3HFJA 3N05A 4OUDB 2QUKA 1ZJWA 3AFHA 3QE4A 4ND6A 1O0CA 1JHDA 1QQTA 3U1VA 2A7XA 1N2EA 4F3RA 3AG6A 3UMVA 1K4KA 1N2BA 1MAUA 1NI5A 1YIAA 3C8ZA 1YIDA 4KR9A 2DEUA 2QJFA 1WQ4A 3TS1A 3HMQA 1YUNA 3PXUA 2QUJA 1O97D 3NV7A 3HV0A 1X6VA 4H3SA 2G36A 2O8VA 1TYAE 5TEWA 2VTBA 4MAFA 1MRZA 3G5AA 1QJCA 4F4HA 1IQRA 1D2RA 3IDFA 1KR2A 2A88A 4ZT4A 1MOPA 2DXIA 2CV1A
chains in the Genus database with same CATH superfamily
4Q1VA 4G9BA 1XZJA 1ZGGA 3MWLA 4PU0A 2QRPA 2CHVA 3NHMA 4YGYA 3U0BA 1A8IA 1EDUA 5JJ6A 2NADA 1RZUA 2XZPA 5ADWA 1VA4A 2PK3A 2DFNA 1C7JA 2QG4A 4HWOA 1K6JA 3SWWA 1BU5A 2FBNA 621PA 4QT4A 4P4SA 3JVIA 2ZS8A 4FEEA 2XY4A 3ON5A 4HMOA 3KSRA 5EIBC 1N7JA 4L72A 1ACJA 2YV3A 1WCXA 4FLMA 4QOIA 3V8BA 4WLOA 3RYFA 1R9JA 1ZNXA 2J7KA 4M1WA 3SR4A 1PTKA 4UU1A 2X1HA 3A9CA 4JMPA 3PNTB 2AEEA 2PS9A 2Q2VA 2HWUA 3WLTA 3EUAA 5SYNA 4URHA 3CW2A 4F3TA 2Q49A 4ZZ1A 1F06A 3ZJTA 5ALQA 5FEMA 4F8YA 3PDUA 4D8XA 1BVUA 4UEJA 2IZOA 2NP6A 4O4JB 3SY8A 1SHLA 2HPHA 4GMHA 4FADA 4RGQA 1C7ZA 4GUDA 4AVXA 1U7OA 5FHRA 4BFYA 3NIFB 2RGWA 5KSYA 2OD2A 3JVDA 4HQKA 3B1ZA 3D8SA 1IBCA 4EZJA 4HX2A 4EK9A 3SOZA 4C4PA 4Y98A 1QYIA 2WUVA 5AW5A 4KCGA 3ESBA 5ALTA 4IIFA 1Y3HA 1R6AA 4LZZA 1Y6RA 3EVZA 1Q1EA 3RS4A 4XLZA 4GXNA 2RCYA 2BBWA 5E7QA 4P1ZA 3DAGA 5LLSA 5BNTA 1S9DA 3FKJA 1MX2A 2FQXA 2XVMA 4N48A 3DEFA 1AVTA 4NZ9A 1KXZA 4W8GA 4XTRA 2C07A 3VHLB 3Q85A 3WTBA 4R9SA 3ADPA 1LUAA 2YXPX 2C82A 3ZEAA 4NMXB 4F6CA 5AJTA 3COWA 2E4XA 2LGJA 1JU9A 3TK1A 3EVGA 1GPMA 5ITWA 3KQPA 3A1NA 1XKTA 2HYIC 3NONA 2XS1A 1WW3A 3D3QA 4MJLA 1HMYA 5BRNA 2WF6A 4ZO4A 5DTJA 5ALMA 3CEMA 4RGYA 2UAGA 4WTOA 1EVZA 4UZSA 1PG0A 3PXXA 3EGIA 1H3EA 4XD7A 2HI0A 4WNCA 4ZVNA 4EUSA 3P26A 4DMUB 4CKYA 4Y6LA 1HI9A 4BLQA 2IOFA 3GEIA 4NAVA 2AJDA 5ALUA 4P58A 5FI5A 1XYVA 4AY6A 2DC1A 1ZOLA 2O2HA 1T9AA 3CZCA 1OYVA 2Y1LE 4TZTA 5HRAA 4ZDWA 5EIBD 3AJ9A 2P1DA 4ATNA 5MF6A 4V0NA 5K3OA 4UD2A 5KNCH 4KJZA 4LV6A 1XEAA 3ICVA 3NFYA 1FTQA 1OROA 3H5RA 1FNBA 3FDZB 4G4SP 5DSZA 1LNZA 4Q4DA 4LF9B 3R3ZA 3CO0S 3ZGOA 4CMAA 4Q9LA 3ND9A 1W49A 1OQAA 2C0CA 3ZXYA 5LDGA 1VZ2A 3OC0A 1Z0UA 5C8ZA 2O48X 4FGJA 4Z2YA 5CFRA 1AC5A 3K53A 2CCJA 3ML8A 4M6WB 3K30A 3TWWA 5C34B 3LWZA 1PFYA 2C83A 2O8EB 3CLVA 2WU3A 1E5XA 4UQXA 1K4KA 1Z3YA 3W9FA 2H2FA 4FMPA 1WHTA 3PF9A 3PT9A 4QTUB 1SUBA 3EHNA 1MOPA 4I5EA 3NHRA 1MFPA 3TQTA 2Z6AA 1JILA 1OU4A 3R20A 4GBJA 4Y9RA 5ALIA 1OB5A 4ABNA 2AXQA 3FU5A 1Q16A 3I8XA 4JBNA 3CZPA 3NX4A 3MB8A 1M6VB 3HL4A 1U2ZA 2C8LA 1M2VB 5LQKA 5GIOE 3OZUA 4UHHA 1X70A 4AM9A 4OXKA 5J40A 1S6YA 3KR2A 1WZIA 4D0RA 1N3IA 2XZTA 2REQB 2ZJAA 2WHQA 1Z36A 3QEBZ 3IVRA 4CXMA 3WAKA 4XJVA 1T0IA 2VNIA 3HZHA 3E0XA 2ROQA 1LK5A 1K9SA 4JENA 4JJ8A 1VMEA 1YZHA 3HVRA 3ECCA 3HVIA 1MW9X 2R79A 4L5CA 4YACA 3KE8A 5AO9A 3HKDB 5FA8A 3KTDA 1JH9A 4MV7A 4YT2A 1BS9A 4IDPA 3GCWA 3NW9A 4J0KA 2QRGA 4HB0A 3T38A 4RK1A 1XHEA 3K5PA 2R48A 3L7NA 4UEKA 3HHPA 5LU8A 2P9HA 3DAPA 3NV9A 2G9RA 3DNMA 1EG7A 4ZZ3A 2GCOA 1EXNA 1Z0KA 4KSCA 3TOZA 3C3YA 4BP3A 4NCJA 1JMKC 1UQTA 3R6LA 4EZLA 2ZRAA 1CS0A 4R9NA 4KGVA 4MO2A 2HK9A 3NC4A 1W30A 5IJ9B 3ML9A 2H59A 4CMCA 1FP4B 4LGYA 4RD0A 2NAFA 1XAGA 2VCYA 1JG4A 2GVZC 3QFSA 2QG9A 1NKVA 3UC5A 4HEHA 1N95A 2PCJA 3I9FA 1DHTA 3AFOA 3PGKA 4X1KB 4JCOA 3UVEA 1SHTX 3LWDA 4J16A 3EIFA 4EEXA 2GUWA 4U07A 1BI8B 3FOEC 4HMPA 1BOOA 4IUCS 2JA1A 4IX1A 3L82B 4KXWA 1AN9A 1G8HA 2KPOA 1EDDA 3W5IA 1V11A 3VYRB 2BGWA 5CHYA 3N75A 4L9SA 5DYIA 5AUQA 4IGKA 1YJCA 2WYIA 5D87A 3VX3A 2P6PA 3LYAA 4K9OA 1JJBA 2VJYA 3TWQA 3L6RA 1A71A 1TK9A 3FROA 3CR3C 1VI6A 5DJ5A 2Q3LA 1QGAA 2ZJ5A 5HSGA 1SGWA 5JBNA 3A31A 1UF9A 4X1IA 4OHXA 1CQIA 5TT1A 1U98A 2ZSUA 2I6TA 4PS7A 1W75A 1XEFA 3A9RA 2QB5A 2BZSA 4KQ6A 4GXTA 3E5RA 3B5EA 1RBYA 1RVV1 3A7EA 5EHNA 3UV7A 3REFA 1V9LA 1QHXA 1GADO 2HU7A 4RVFA 1ZPDA 3R5TA 2W6NA 4PVCA 4MGHA 4JITA 4YBRA 4I3GA 2WSBA 3QBTA 3TXAA 1MZVA 3QQ5A 2C8VA 3HCRA 4AY5A 2WSIA 2G4VA 2Q5JA 1CUDA 5DGIA 1OMOA 2J9QA 1H5NA 4I1UA 5M34A 1CVIA 4H08A 2XCCA 2PUDA 1QP4A 2ZZNA 3FA2A 4FX2A 3HR4A 4ENPA 3BD9A 1VHLA 5JDIA 2WQHA 4WCFA 4PO8A 2G8NA 4CQMB 2NM0A 3M5CA 2AXEA 3Q6NA 5KOHA 2PRZA 1G63A 2DPLA 4IDAA 3G7NA 1XAIA 1TYBE 4KBYA 3MZLB 3C85A 5BQ5A 4MMYB 3ZHYA 4FHZA 4IICA 1DCMA 1XCMA 3DUFB 2VXCA 1WQ1R 3U9WA 1QP8A 1AK9A 1Y5LA 3IP5A 5EWLB 1OAKA 3URMA 5CA1F 3QYPA 1WAO1 1H2FA 2CV1A 1VYHA 3Q8WA 4YP9A 2Q5IA 2FE4A 1ENPA 5D7NA 1RJWA 3A4LA 3L40A 4PIMA 1B6RA 1U2QA 2IOYA 3Q7PA 2RIRA 2NVUA 2NWQA 3BFVA 5DM70 1XRQA 2WXNA 1U6JA 3CHPA 4FN4A 5FNVA 5JXJA 2OLJA 2HRZA 4LPKA 3CRMA 3NQPA 3W2IA 2FSFA 4PXYA 2JGKA 4RCYA 2Q0HA 1Q2XA 3FNFA 1CYEA 2QX8A 2IEIA 4N2SA 3HCBA 3UTMA 4AMYA 1J2JA 3W7AA 4K40A 2AYZA 4KK3A 1JBKA 1E8WA 4DR5B 2ZITA 3PTLA 4W5HA 1AP7A 4ZU1X 1U2PA 2B8TA 3SC4A 5DCUA 4S1WA 3SZRA 3C70A 3PEYA 4PONA 4B31A 1KO1A 3NVKI 2JC3A 3ROMA 5EY5B 3ONDA 2D1RA 2C3UA 3W5JA 1GRQA 5DV9A 5E1OA 1ZX1A 3TMYA 1C30A 1EKXA 1LJ8A 3MJFA 1QRTA 1FVHA 1E7WA 2CN1A 2XEHA 3DF7A 4M9ZA 5EOVA 4TWRA 1I14A 2CUTA 3UJAA 5M72A 3B1FA 3KYDA 1XT6A 4KRFA 4EL0A 5FOQA 3O1LA 1R0BA 1YA8A 3PHIA 3B85A 1W0JA 3BWDD 5J2UB 2REXB 1P8JA 3BX1A 4BT9A 1DJMA 3HCNA 3ZYZA 3CQ9A 1RM5A 2Q5LA 3PUVA 4DZRA 4Y6QA 3DA8A 3O8BA 1U4OA 4O5AA 4UWGA 1ZHOA 3PNOA 3NLLA 1C9MA 3NM6B 2AF4C 4KXFB 2HA4A 4C5BA 3PUZA 2IUSA 5BNIA 2D54A 4JVNA 4IG9A 5DGDA 2FWAA 3FRHA 1IY8A 4EFLA 3QSYA 1GNTA 3TLEA 1CFJA 2KI5A 3AEQB 5TF4A 3UIPC 4HKTA 3BWMA 3U3OA 1YS7A 4NDNE 1FP1D 1H2RS 4GPEA 4L57A 5FLYA 3H5VA 4GLJA 3TVYA 1V3TA 1LB1B 1I0IA 3HA5A 3GLHE 4MVXA 3OHMA 2VHWA 2YN2A 4KHZA 2GBIA 5IAAA 2HJSA 3MM4A 3FJ1A 2XUIA 3D6MA 2CB9A 4XQEA 5E1BA 1A2BA 4OUDA 4I2WA 3OETA 4RKQA 3FTPA 2OQRA 3OQHA 4D9MA 1CZKA 2VT3A 2W98A 4U8HA 4L7TA 2O2IA 3FCEA 4LNHA 5KYGA 4CL3A 1RXEA 1G8PA 3TUZC 3D4IA 5JVDB 3P9KA 4OU5A 4R2JA 1Z62A 1U0BB 3JSXA 1CUHA 4LOHA 4NFHA 3JR3A 4YO8A 2FG7C 2NUTA 3QZUA 4PN7A 4KLRA 1XR3A 1ID1A 5LP0A 4XDHA 2KBFA 4MV5A 1C9EA 4JLJA 2HE0A 2R1TB 4HDSB 2WPVA 3A2KA 2R8YA 4KG7A 1IAQA 4AURA 3D7KA 1XL1A 1VDYA 1LVUA 4OGWA 1ID8A 4R68A 3T0GA 5FPSA 1RYFA 4I4CA 2YIJA 4F92B 1Z18A 2W00A 1LZLA 4GM4A 4N7BA 5TPZA 3M33A 4P7JA 3D9MA 3GRYA 4RS4A 2WJAA 5FORA 1JPVA 3GW8A 3D3MA 4Q4AA 1I4EB 1IOVA 4QX6A 1V7QA 4UEOA 3OUZA 2AKAB 1W2HA 4R1PA 3PUWA 4YJ3B 2XA9A 2OOKA 3PGMA 3ETJA 4ZK2A 1NULA 2ZT6A 4GE3A 3BGDA 1T25A 2HBQA 1NVGA 3AFHA 1YDMA 5JSFA 3IV6A 3NV7A 2N1MA 1XGKA 5FPQA 1J1IA 1AUOA 1XZCA 4ZDKA 2Q4DA 3L05A 5H4HA 4BRUA 4QYMA 4IVPA 1VBNA 5GZ3A 1K89A 3U49A 5IC6A 1BLXB 1A5SB 3DTVB 3IQWA 1IOZA 3MILA 3NDRA 1NJFA 1FYDA 1YI8A 3LYUA 4FHKA 4YC7A 3T7KA 3ZHRA 3V4ZA 3I61A 5HQ8A 4E3WA 4S0ZA 1B41A 3B5IA 4N5HX 4OVKA 4WY5A 13PKA 2M1XA 1HFKA 3R0IA 2VSXA 5T3RA 2FDRA 2OFOA 1I2DA 1OD6A 3PXAA 3FTDA 4N0PA 4XI9A 1Y1RA 2ZUUA 4Y6OA 3U44B 3VTYA 3OQBA 2JFVA 3NEPX 4W7HA 2O50A 1D9XA 2COUA 2J4CA 3H87A 4BRSA 1MDBA 1QUFA 4U2DA 2C2WA 1Y7IA 3KL2A 4MW1A 1C8VB 5EFZA 4MB2A 2BE7A 2D2IA 1U7TA 3AH8A 1XVLA 1DG9A 5G0SA 3KCQA 1GFSA 1LQ2A 4ND7A 5CDTA 4H1WA 1WR8A 1YDWA 1P80A 1HTTA 3VNSA 3TTXA 5HFNA 1GA4A 2R6AA 3EXFA 3TLGA 1KMNA 1BDIA 4JKYA 4KI7A 4FU0A 4WZAE 3QEAZ 2BR3A 1XNRB 4M98A 1IBKB 1RNLA 4N8DA 4L78A 3ZU4A 2C97A 2OCLA 1RJGA 5K0TA 5EJ2A 4QJ5A 1V5IA 4PQEA 3PXGA 2IIQA 1Q91A 4N4AA 3OUTA 3EIOA 2VJCA 4WD3A 1LK0A 2JEOA 2DPHA 1SUIA 1U0OC 3CCFA 3IUSA 1M6WA 2A1TR 2VUUA 2Y92A 2OHIA 1W0KA 1XDSA 2H85A 2V3VA 2YMMA 5IVPA 5HF6A 1B42A 4LSMA 4WNAB 2AXZA 3DPSA 4G5QA 1N2OA 3A4YA 1RLJA 3DV0B 4NC9A 2Y1OA 5EE5B 3NZUA 3LCRA 5CBKA 4WVFA 4J75A 4E21A 3PQ8A 4ZALA 4J8DA 1TQ4A 3L7CA 4JLAA 4RHFA 5GOZA 1Y3AA 3S2UA 4M1YA 4J0HA 4ANWA 1Y5NA 1OFIA 2GJSA 1JQEA 1NXWA 4KQFA 5F5LA 2GEKA 1LWOA 1HY3A 3MQFA 4OUKX 4GI7A 1TM4E 2OCXA 3GFPA 3GW4A 1TU4A 2YJNA 1ZSYA 3EAQA 4LMAA 2FHSA 4BIIA 2XMBA 3ZI7A 1YRLA 3GN2A 1SCQA 2RHLA 1TEZA 1ZP6A 4GECA 4JLDA 2F9LA 3GJ4A 3RYCB 1ZA1A 5L7TA 1ZVMA 2CW5A 1SG9A 2UWJG 4WJZA 2C7RA 4L8VA 1YF3A 3OXLA 3BL6A 3FMOB 2FPPB 5CYPA 1NNLA 4TLDA 4GPZA 1B6TA 5BNFA 1UR5A 4QU0A 2DHCA 3TOSA 1GTG1 3CX3A 4F2DA 1N2IA 1UAGA 5IX8A 5JUWA 2OEVA 3AM5A 2YXDA 3KKKA 5HM6A 4EJ2A 1RJ9A 1OT5A 3X0DA 3EGXA 3HFRA 2R7NA 4BLRA 3ULYA 2WAXA 2W42A 2LSVA 2DPYA 2IPOA 2FPLA 3C24A 4AJWA 1E6MA 4XKCA 2OB1A 1Z3CA 1Z88A 4A8HA 2G9VA 2B7BA 2OCCE 1PNVA 4YJKA 1VI2A 5AVTA 3MC1A 3PITA 4UHDA 3LQQA 4V3BA 3Q7FA 1E9RA 4WASA 1N4DA 4KR9A 4L9WA 1SCNE 1SOMA 1LDEA 1QH9A 4ECAA 2REBA 3Q3GE 3KKNA 2C9OA 1DCTA 3BK1A 1KR2A 4QWWA 4BLSA 3PKZA 4C2AA 2A67A 3GJRA 3LDZA 1IYZA 1QH0A 3HMKA 2NSJA 3PFNA 3FSJX 3U7HB 4MITA 2YW9A 5JA4D 1TTTA 5GOTA 1QSGA 4AJLA 2O2SA 5ELLA 2XAAA 5HYVA 2ZJBA 2JFPA 4EMUA 3P96A 3GFOA 4Z4CA 4EHKA 3JRXA 4DJFC 4GZCA 4MCAA 4P9NA 5JNRA 3JYOA 1YL5A 4JI6B 2R25B 3WRVA 2X76A 3IAS1 3ESDA 3CH5A 2O3UA 3Q5GA 3NVMB 3HYCA 4E7PA 4GEKA 3LUHA 3H2GA 1EE9A 1Z0JA 5C7IO 2FUG6 4U9UA 3AP1A 2PM7A 1XHLA 4F12A 2D5IA 4RVSA 1WMFA 2ACKA 1W29A 2HLDA 3K1ZA 3VR4D 4D1YA 1IXSB 4H7KA 4FHGA 3HXMA 3NG1A 3L7BA 3NHSA 2B25A 4CTOA 1RC8A 4Q21A 4P53A 4FCCA 3TLBA 4Q18A 4BGDA 1KU0A 3RT9A 3GL9A 3C4VA 4GR5A 1YYHA 4IVQA 4G81A 3AJ8A 4APFA 4L9RA 2M98A 1P0FA 2W2NA 4QA9A 1BYUA 4MINA 2BYTA 1SA0B 3U37A 4Q3NA 4AN0A 1OA1A 1V5WA 2WAOA 4RH1A 2PL1A 2CV2A 5CJPA 3GAZA 2E5FA 1NT4A 3OM0A 4KSYA 2W83A 4FIZA 1T2FA 2J09A 4CFYA 4R3WA 5KUTA 1NUQA 221PA 4NY1A 3ZZ0A 4KNYA 3R5SA 3ONLA 4Z7OB 1CJKC 2VF8A 4PYQA 1Z2DA 3ZGVA 1DC5A 5JS8A 3OLVA 5EIWA 2Y1EA 2FDXA 5K3EA 2QTRA 4IRXA 3UUWA 3E15A 1ULUA 1Q1AA 1CULC 1J42A 2HJ9A 1GCGA 2OHHA 1OBCA 4F2WA 4RSHA 2VP6A 4YJ2A 1SCAA 9MHTA 3SZUA 1Z74A 1EDZA 2QT1A 3OPVA 1KL7A 1K08A 5CK4A 1I3NA 3H1TA 2WMOB 1U3GA 1VIYA 1ECBA 1G5IA 5FNVF 1ONOA 1XU4A 4EPRA 3LPMA 4EYSA 3JD0A 1AZSC 2X0KA 4NG5A 3N39C 3S8EA 1DG3A 4ZZ0A 5H68A 3SYTA 1ZN7A 2JFFA 5C1DA 4JZKA 3VUEA 3DZHA 3PENA 2VAMA 3CV3A 3JQBA 2VA9A 4EHAA 3AOEA 1ZO8A 3AF1A 4EUEA 2PT5A 3JWJA 1UM8A 4PYRA 3W90A 4B4OA 1DKLA 1HDIA 2DBVO 1NVBA 5U1PA 3G8BA 3LM8A 1LTQA 2AJTA 4P0TA 5A23A 5TQ0A 1T0JB 4YYEA 3UGJA 1P5RA 1SBIA 4GI3A 3LEWA 4RV4A 3TVDA 3C3PA 5AW1A 1JQ5A 3IELA 5C7YA 4WADA 2VXOA 4BECA 1V5EA 2GDJA 1XPOA 3AF3A 4EHHA 2WG1A 4IGAA 2ZRKA 1IEXA 1T6ZA 2E7ZA 1Q44A 5FWDA 1R4MA 2GX6A 3O26A 2DBAA 3UT8A 1XRRA 3THWA 3FPLA 5KCZA 3H4TA 4KV7A 3ZZ1A 3KXIA 5LZ5A 4OB6A 3RVLA 5E8JA 2I8LA 1BH6A 3SR3A 1O1YA 1DQPA 1C81A 2OPHA 4BMSA 2H92A 3P2BA 2WNSA 4TWJA 1V7CA 2ONJA 2QKYA 3CHYA 3GLHB 1KMQA 5G4LA 1RJEA 3RSGA 5JJBA 2CXQA 2ZSJA 5CFLA 3OJCA 1M2HA 4HNQA 3VH1A 3WGNA 3QVSA 5JAHA 4ND6A 4EJ0A 2YIDA 5DNYB 1YQDA 1JR3A 1DWUA 2FPRA 2P9SG 4CM3A 3C3AA 3IOYA 2Y1DA 1MRZA 3G23A 4MMZB 4CT4B 5TY0A 3QG5A 4A0GA 3IIJA 3L5OA 3E03A 4HI8A 1DKNA 4KN8A 4O59O 2BTDA 1YKFA 4LX8A 3CNEA 5PGMA 1JFSA 3I9V1 5HZKA 1OX4A 4EL5A 1U0NA 4CMIA 2H0AA 4A1SA 4DCGA 4I50B 3NUQA 2P9ZA 3RLFA 4B17A 3K70C 5AQBA 2W0MA 1KVUA 4BFXA 3PC6A 5DGTA 2VZ9A 1Z7YA 3ESYA 3WY9A 1Z6QA 2Y0EA 1N0RA 1DBIA 4FKZA 1DJOA 5T3YA 5ECWA 1Y9JA 1Y7TA 3PZ3A 4KE8A 3BGVA 3ZE6A 1PQWA 2QZPA 4X65B 3G5UA 5L7WA 3RJZA 2W6ZA 3TQHA 5JSHA 5BR4A 4CCWA 2PXHA 1A17A 4BKUA 3EN0A 1OX5A 3T95A 2YY7A 1OFUX 3E33A 5TJ9A 4AWXA 1QH1A 4QBGB 3DXXA 2NW6A 2PKWA 3D3WA 2IZ5A 3S2FA 4HFJA 5IP5A 1H4SA 3VLDA 3T41A 1FPQA 1O89A 4NX2A 4P3KA 1YOVA 3QITA 1P9WA 2C20A 1Z13A 2VF5X 4Y9DA 5J59A 2O3JA 1E2BA 1BU9A 5JZOA 1R5OA 4E32A 5TC4A 1EH5A 1A9ZA 4D42A 4ROSA 2CVOA 2ZG6A 3QELB 1JECA 3TD2A 4CMKA 3VPFA 1U2DC 4GPTA 1XWFA 3C3RA 2O8DB 1KR5A 3L0PA 1AZTA 5IVKA 2QL5A 4EPZA 4XSVA 5KJFA 3ZBTA 4EMBA 1XRMA 3GOHA 1Z28A 2V59A 4FDUA 1KOLA 1JRLA 2WWIA 2JL1A 5FOVA 1JLLA 5AXDA 4FUTA 4RW0A 1JFFA 3EZ2A 4CR7A 2PJUA 1E92A 5KPDA 2X40A 4HT3B 1SCDA 1UPCA 3MBOA 1IN5A 4BLWA 3RABA 3BQMB 2EYUA 2B1JA 1ZC3A 4FFNA 3EDQA 1I2MA 1DAFA 2CLLB 4Y2YA 1MVOA 1AGXA 4S0XA 1ESMA 2C7QA 2PRSA 1Y4UA 4QICA 3QOWA 2C9MA 1YR6A 4WZAB 2JJYA 2P3QA 5KTNA 4M9RA 5AW4A 5E6RB 1X7XB 4OGLA 4QNRA 4KN5A 4R7TA 1O8CA 1TQ2A 3QF7A 3NVAA 1XELA 3W1VA 4C5AA 1BAPA 3MS4A 5BWBA 1WPQA 5IT4A 4UCWA 2I55A 2BFFA 2W43A 3ENEA 2PUEA 1TW2A 5LQNA 2CYAA 3B9RA 1BWRA 2LV8A 2AOWA 3K9BA 1WO8A 4DCOA 4KYIB 2KBEA 2OCYC 3FFXA 7MHTA 1YA6A 3AWDA 2A58A 4XI0A 1Z4MA 4B3BA 3PZBA 4HH1A 2F8YA 5AQ1A 1RW2A 1VSQA 2GMWA 5JIBA 2GPWA 4ER0A 4ETNA 4R1SA 2CD7A 2DX7A 5IBQA 5LYJA 4IKOA 1GA1A 3DZGA 3GWZA 2ACVA 2G67A 1ZK0A 5AD1A 1SC9A 1UT8A 3H7IA 3GAMA 3R7FA 3V6MA 3N2NA 3ADKA 4REQA 1GUBA 4DJTA 1U11A 3KVYA 4CM1A 4F8JA 1GPDG 2Q2WA 5AQ9A 3AKYA 1K9VF 3MQ4A 4C21A 4LJ4A 5BMVB 1XG5A 4IY1A 3MIZA 5AIJA 3IXMA 4PDXA 3EPKA 1DC7A 1DG1G 5ED0A 3CZ9A 5K09A 4Q47A 5T4FA 1KO7A 3WQHA 3DC2A 4QLAA 4C4ZA 1MKYA 3TM4A 2I8CA 1Z5PA 1FSFA 1DEOA 1UOPA 1YIOA 1SCIA 5EXTA 5FV4A 1IQ0A 2LR0A 5BSWA 1TZMA 2GZSA 5ILOA 1CUAA 4MQ6A 2P90A 2H7YA 2CVFA 3LSYA 5FBWB 3SXUB 5CEFA 3FVTA 2GTIA 2XF2A 1OE0A 2BUAA 3OQIB 3TZBA 4YJFA 3R6TA 3AFMA 2O5CA 4DWOA 2Q5EA 4ES6A 1EP1B 2G17A 2W11A 2J6CA 3KVVA 4ZTBA 1DB3A 1C14A 1SAYA 5DBOA 3RUCA 3W4JA 1BCSB 3ROKA 4ZVVA 2JVKA 3P4YA 3RVMA 5KU7A 3AJRA 1YB4A 4LTDA 2DSTA 4BV8A 3SHTA 1HO3A 3UWOA 4LYJA 2HREA 2FFAA 2HRQA 1X8LA 2C5LA 1NXXA 1QVZA 1UBUS 4IG4A 4EJFA 1DRUA 4JVLA 4OMCA 3I72A 4ZD6A 1PC2A 2XQJA 1EP9A 2UY1B 3NOVA 5AQ7A 3ANSA 3B1KA 4Y7CA 4RJKA 1RQGA 2FSVC 2PU7A 1KBZA 5JALA 3X1ZA 3DLCA 5BVGB 1KEUA 3A1SA 2YZNA 3BXZA 4D4JA 1GTSA 2O2GA 1GGHA 4MQBA 5CR9A 4C87A 5IT5A 2DGDA 4IEEA 1O5TA 3DEZA 1J5XA 2D2EA 1SEVA 3N0RA 3MWKA 4EGJA 4INAA 3U5ZB 3CJRA 1E6WA 4XH9B 2HLDD 1Z8NA 1P9LA 1R64A 2GHRA 2WEKA 1M34B 2IYZA 2LO6A 3N8GA 4E2FA 1XRPA 2EJWA 3AG1E 2ZT8A 5B37A 4HUTA 4IDHA 4RA9B 3DQZA 4EBFA 5F77A 5EWJB 1X39A 4WN9B 1Y1QA 4OEHA 3KOZA 4YPOA 5I7SA 1G8JA 2OBFA 4ZREA 2V6GA 2OZLB 2V4UA 3KSLA 2QMYA 1VFNA 3MGBA 4CDNA 4WAFA 1TJNA 1LVHA 3ZHVA 2D7JA 4JQYA 2HSZA 4J0UA 5K03A 1RYEA 2XQ0A 2EIJE 2QZAA 2WV7A 1NQWA 3LDGA 1JDZA 1O9GA 3M89A 1SY7A 2C9ZA 2ZRHA 1G16A 1LC3A 3IS3A 2IYEA 4GWLA 1NASA 4UMVA 2FKAA 4HDMB 4MRMB 3VSEA 5BQPA 1HG2A 2BI4A 2GK4A 4K9MA 3TLXA 3CR3A 1QQAA 4PO1A 1Y7HA 1MT0A 3Q1LA 3L16A 1DJLA 1RWBA 1OFGA 4LGCA 2QPAA 4J7CA 1PBNA 2Q45A 4N5IX 3J5PA 2GHTA 1VDMA 1OBFO 1D2CA 2QN3A 4EW6A 5HE8A 5EN5D 1FYVA 1T5LA 3MJRA 4DM7A 4AJJA 5EJMA 2BMJA 3SQMA 2XT0A 5GV7A 5JS1A 2J08A 5A4FS 5IULC 3IODA 2W2KB 1VP3A 3NYQA 4UVEA 5JYBA 5TLSA 3T9BA 1MOQA 5B55A 2OAQ1 2FG5A 4U63A 3PL1A 3Q8MA 4KOAA 4YJ2F 5ALXA 3QUSA 1ISJA 2NN3C 4AZ0B 3AEZA 5JZBA 5I7RA 3L7JA 1QK3A 4J76A 5A0FA 2RKKA 5FR1A 4G0NA 3R7AA 4JMLA 1KEEA 3R7BA 2VDKB 4HLCA 2XLBA 3THXB 2HIMA 3WYFA 1G60A 1DUIA 1SUSA 3PUIA 1EVEA 2HA7A 1BXKA 3CVJA 3OF5A 5K01A 1PEKE 2VTBA 1RQXA 1QJCA 3WLRA 3NYIA 1Z8DA 4HBDA 2NU9A 5KNBD 5JWHA 2Z98A 2DLCX 3OQ1A 2MYPA 2GRPB 4DX6D 4L2IB 4B81A 3BGOS 5JV5A 1UC5B 3K8YA 4CGZA 4E6EA 2GB4A 5HUQA 4H4EA 1JHPA 4CNBA 2L0TB 3SHFA 1T6NA 2R1VB 5EJ4A 3EJNA 2AFIA 4UNSA 3FN4A 1Z5NA 4DWVA 4PQRA 3BXPA 3QKSA 2ZYHA 3EUVA 3F6EX 3DH0A 4EENA 3QPBA 1M0WA 1ZVKA 4RQAA 7ABPA 1EINA 1SUFA 3GLGE 3EODA 4K6HA 1H69A 2J3MA 4MYSA 1VKOA 2FZWA 1GZ7A 3OVMA 4LKRA 3L92A 3ZQ4A 3KK0A 5AFSA 2XB2A 3BCHA 1JR3D 3P7MA 4LWQA 4E70A 4X8QA 4XEUA 3CVXA 3CQCB 3O4GA 1GKUB 4CV0A 4OBWA 2WTEA 5SZHB 4OLAA 1TFUA 2XDAA 2J5BA 2OEPA 1T29A 3MX3A 5KMGA 4FSXA 1RZ3A 2ZUCA 4BMOB 4JHJA 5I9SA 2HBYA 3G6KA 4TPKA 4UAVA 2QQEA 3CMMA 3ZI4A 2PWAA 3KAKA 2B78A 3DGFC 1ECGA 4HRYA 3JALB 2GTPA 2YYZA 2PKQP 1H6BA 4R0MA 1KVRA 2QD1A 3D7RA 4KIJA 4NENA 1XI2A 4IJKA 4EG4A 3C5CA 3RTEA 1HDXA 4AX4A 3AX6A 1J2EA 4UD6A 4D6PA 2HPVA 2IHNA 5AK4A 4ZEWA 1A9YA 3TAUA 1UJ2A 4B3HA 1NVXQ 4H1VA 1UCFA 4QTYA 3QNUA 1M1YB 5A2QA 3VXKA 4OX9Y 4YUWA 3FZGA 3EXIA 1ZA2A 2KYRA 3PT5A 3QKRB 3IAFA 4XWYA 2ZBEA 5A3SA 4NIMA 3DCJA 3NBFA 1ESDA 3QX9A 2C42A 1UN8A 3FBTA 3DAHA 4BJ1A 2BUBA 3FUFA 1YR9A 1ECFA 5FTJA 2XPIA 1KH2A 3M5WA 2VNJA 3AKDA 1WVMA 2QDKA 5KYKA 4AMVA 3OKAA 3KZCA 1I7PA 3B52X 5EQDA 3ORYA 3RYHB 1RCTE 1W76A 2HXSA 4AKIA 1MMFB 2Z4TA 2QN8A 4YDOA 4YDHB 4K2HA 4NBKA 5ISMA 3PU6A 3OF2A 2R02A 3QGMA 1UBEA 1P2GA 3AB3A 3AR9A 1SQ0A 4R8LA 4H9GA 2PKYX 2ZI4A 3RUIA 4DLRA 3ACBA 4MV4A 4ETWA 2ORIA 3L0IB 1LPPA 1ODKA 3ODPA 2J33A 3H2ZA 4M9UA 3FOBA 1XCLA 3Q0EA 3A7DA 4C4TA 2B4QA 3B13A 3EQZA 1W52X 4HGYA 5KDDA 2XD9A 4QVIA 2P9LG 4GTOA 3IHWA 2G9NA 3UB2A 1OIXA 3RIYA 5CNKA 3NO4A 3GUVA 3WGYA 4MKRA 5M5BA 3WIDA 1MH1A 2IO2C 2FXVA 5B57C 2QAGB 3HBMA 3C87A 4HVBA 4P4UA 3K15A 4WESB 4XFDA 3CUUA 3BZUA 5EYPA 2X38A 4DOMA 2O7QA 4PN3A 1U90A 2JFHA 4X61A 4L4SA 4P3PA 2GXAA 5H80A 1QGOA 3F6QA 3GRFA 1SUDA 4BQPA 5CB8A 1K7EB 2I91A 3HU2A 1JTEA 2BBSA 1I5EA 2OCGA 5TF0A 1E1YA 3DWIA 4G2VA 4HQFA 3WNZA 2OESA 1RYBA 5DTMA 2JHAA 2IYVA 2VQ2A 2EZTA 3G5AA 1RTKA 1WLSA 3B1WA 1OV6A 3F3SA 4RZIA 4IJUA 2YWHA 4MX8A 1VLZA 3UJPA 1XZEA 3JD3A 5K3SA 2J9YB 5DSXA 1JJVA 1E1KA 4DDTA 3LQRA 4F2HA 4HN4B 3CIFA 1DI0A 1HYGA 1KY3A 3URZA 4FDVA 1D2GA 2X8WA 2FG6C 3RVPA 3DMPA 4U0JA 2ILVA 2ATEA 2YQ8A 3IMFA 1ODIA 4ZEXA 3D6HA 3R9WA 3ABSB 4M76B 5M3BA 5JC1A 4YYZA 3H8VA 3DV9A 4MRNA 2Z9DA 3SYNA 4QPZA 4ZVRA 1RI2A 5LNK1 2XKBA 3B70A 3SKYA 3D9NA 4EARA 1JDBB 1T34A 2CC2A 4R2KA 5E95A 1DIOB 4NZPA 3KEAA 1IM5A 3G17A 4N40A 1LBTA 1ORIA 4J0EA 4U7JA 3HU3A 1P19A 1VE9A 5HBRA 3M2TA 4TLEA 2LAIA 4CG0A 4IVRA 4DPLA 1XCBA 2C3OA 3LUFA 1XD9A 4RK6A 3WGQA 2XB6A 4I46A 3CYFA 5KINB 4EBAA 3EAGA 3JSAA 4J4TA 5LYJF 2D2FA 1FQOA 3EZXA 1VQ1A 2I7TA 3R3JA 4XYLA 3PYXA 1UOQA 3OEEA 3A1FA 3UATA 2QBYB 4ZVUA 3H05A 3RPEA 1XZKA 3RUDA 1TXGA 4MWEA 4PPYA 2ZSDA 4ER6A 2VJAA 4Z9XA 3HRKA 3TQIA 3WSWA 4BVJA 3CIOA 5IYZB 4PG5A 3ND7A 4KMSA 2RGNC 3PJFA 4NDAA 1FFXB 4YX9A 5FJJA 3X1YA 4O3FA 4CEJA 3R9IA 3I8OA 3SE7A 3FY4A 4Q66C 3PNVA 1JGTA 4PHHA 4GZ6A 3NWEA 5JT1A 2F67A 4ZO8A 1Y8ZA 3EVTA 1RMYA 3C2QA 4OSEA 4A8JC 2Q1YA 3KYCA 3KB2A 2X9LA 2IUEA 3UV3A 4XPIA 2XADA 3TPZA 2YW2A 3FUNA 1P31A 5BQ3A 1E3JA 4RV9A 3WMWA 2Q3BA 3GDWA 5HQTA 3FHLA 2Z5FA 5BVHA 2V7XA 3C8MA 2GN1A 5HTOA 3VKUA 1ZI9A 4DI4A 4B4WA 4AJHA 5KPJA 3GO4A 4DAOA 1A4RA 3IKMB 4IFIA 1HNWB 4R0NA 4N01A 2V7PA 3CRZA 3EW7A 3N2LA 1IRIA 1LEHA 4DV5B 3ILVA 2ZREA 1CCWA 4J3NA 2FEMA 2V7WA 3MYYA 4CTJA 1A3CA 2FZEA 1ECPA 2ENWA 3GAAA 4BXOB 4L8YA 4QOFA 5SV2A 1QP0A 1FSGA 3VR4A 4GYYA 1ODFA 1Q83A 4CUZA 3N3BC 2D3WA 1PX0A 3RFUA 4QSMA 2YZGA 2PDAA 4NJMB 5K8IA 4AG5A 2JGEA 2QQ5A 1CP2A 1NLYA 4BTLA 4JJAA 1PNQA 10MHA 4IS3A 2FN4A 2C31A 2ZTSA 3HYRA 3S2ZA 4XIGS 1A8SA 4RPLA 3ZJ5A 4U2BA 3TNJA 4U7TB 4V0QA 1F12A 5KWIA 3FCUB 1M1UA 5IN5A 3MWJA 2PQMA 1Y3BE 1ZFNA 4BFLA 3K2QA 4KPGA 3E84A 3A9SA 4I55B 2FX3A 3L9TA 5BURA 4XYGA 5K6AC 1NAIA 1Z35A 3OZIA 3ZQJA 4RNCA 5B3AA 4WXRA 3DTTA 5CEEA 3GZ4A 1N3BA 2G72A 1XB2A 1XRNA 1SUCA 4M53A 1IZ0A 4BB5A 2OVBA 3U9LA 4B43A 1FFGA 4P38A 2GRJA 2QUKA 1E7SA 2ZRDA 3W2TA 1HX7A 4FOOA 5FLEX 3QU7A 4IAOA 3QOUA 4LV8B 4EHIA 1T2AA 2L69A 3IIIA 2O8VA 1MJNA 2FI7A 2CLHB 3BMQB 4QSHA 5JO9A 3PCXA 1SC6A 2ZYRA 2WIDA 4DBVO 4J91A 4JI4B 1AQJA 1FDTA 1M0EA 1UBSB 4GPD1 3O73A 1UKBA 3OU6A 1AWCB 2Y4OA 1ZUWA 2OZVA 2FZKA 1P6UA 3ICQB 4CLDA 2JLYA 2GCPA 4NCXA 1XQ9A 4QZVA 1YI1A 3REOA 5HS0A 3DO5A 2OYRA 2HF9A 4Z9BA 1XZMA 1VL0A 3TW0A 3CZAA 1XN1A 1XCOA 2EKZA 3C72A 4M1ZA 2BLLA 4AKHA 1YONA 2PFGA 2ERYA 4BVKA 3D8HA 4JBLA 1H1TA 3PRYA 1OBHA 3GI1A 4R1LA 2B69A 1QB8A 1C7IA 2E2EA 3L1JA 2FZCA 2HCTA 1G8AA 2ZRNA 2VBFA 2R5SA 3PXCX 5AH0A 2XTMA 3JY6A 3TRKA 1OXBB 1M7GA 5AI4A 1C8BA 1W4RA 2I1VB 5CJ2A 1RHKA 1GUAA 4LXIA 3P2JA 3C43A 4U6SA 1IHXA 2IHVA 2X2OA 2EKBA 4E85A 2C1XA 4ZRMA 4RK4A 1BXRA 1EXDA 2XS8A 2XRYA 2FP3A 4TXRA 2C2OA 4GI5A 4ZVKA 1SB8A 2OAGA 4JJGA 2CXTA 5F7JA 4HEA6 4ND2A 3I5YA 3PI6A 2NOAA 1H9BA 2RGXA 4V0SA 1G21E 3D3JA 3IHYA 1YR1A 2BGTA 4HP8A 1IXYA 2ADOA 1ZQ9A 3S8YA 4YQYA 2JCXA 5KYXB 3CVOA 3I9KA 1Y6ZA 3NANA 4R2MA 4N3BA 1P1JA 1RR6A 4CV1A 3ZK8A 2B5WA 2ZM5A 5FBRB 3FLAA 4NBRA 2J0SA 3ZQKA 3V1KA 3V4RA 3ONWA 1L4BA 4G89A 2JIMA 4COOA 4OHMA 2O0KA 2OB2A 1FPPA 1GGEA 4NAHA 4M8KA 5ALKA 3C3MA 2Q5FA 3U2QA 1R16A 1NJ1A 4KBFA 1PZMA 3SBOA 1NPTO 1XD8A 5KU1A 1PJ3A 4H27A 4DR7B 4QQIA 4HUQA 4EEZA 3PC4A 2VWHA 1VXRA 4GSYA 2I7CA 2OFFA 4A26A 3UGKA 1EIWA 3UZUA 2HT6A 3DBHB 4G0MA 4A6PA 4B85A 2G1JA 5I4IA 2C00A 3QC1A 1UIRA 5ICMA 2IOSA 3FVVA 5TV2A 4P82A 1I80A 4FK8A 1WA5A 2JJQA 5K4GA 3WKDA 3GGOA 3H7AA 3EIUA 3T9DA 3MA0A 3V8NA 3PPWA 2VIIA 3AETB 3UUGA 3CX7A 5ITSA 4JYPA 1BEEA 1M10A 5BW4A 1KPHA 2GYYA 1TYEB 1U6IA 1V7PC 4EH1A 4L0CA 4IMRA 1Q7TA 5NLLA 4EPTA 1FDVA 4B4VA 1YK0A 4MARA 1OX6A 1J99A 1PZXA 2NU8B 1LDNA 2DT5A 5D3MB 2AI1A 2R00A 4YRKA 3EDYA 3IC5A 1MJ5A 1C1YA 4DA4A 3MJVA 3CGHA 4P2GA 3KR1A 1CDOA 2GAFA 1SZPA 3NRBA 1Z4NA 3G13A 2PQ6A 2HSGA 5CLFA 5EJ7A 3OEWA 3TQRA 3D9LA 1NUSA 4X1YB 5EKXA 3CKLA 3TD9A 3PYMA 4CG3A 5C46F 3KTAB 1QVAA 2CFOA 1GDHA 3PVLA 4KXMA 2P1RA 3THRA 2G28A 1JXOA 1PS9A 2MYOA 1T8WA 1PZNA 1U0EA 5B7GA 2DFLA 1N6LA 4GBGA 2RHMA 4CIYA 3U3RA 2MSLA 3RKRA 4YI3A 2FFBA 3L7OA 2YZKA 1K8RA 5A71A 3EFOA 3GZNB 2OBBA 3TCNA 4L50A 4QGHA 1NOKA 2PWZA 3V3KA 4G09A 2B4TO 2ISCA 2KJQA 5BPHA 2UVPB 2C2LA 4FWBA 4EKDA 4N1AA 5C1OA 4QTZA 3FKSD 4D9HA 1ZVJA 2QW0X 5DU2A 1A1SA 5ES4B 1R0XA 4H17A 3FTWA 4BN4A 4WNYA 3WJ2A 2PBFA 3PNYA 3SQOA 4D41A 1GSOA 1I94B 2OBNA 5CFNA 3GRKA 3F3KA 2G4CA 3ORHA 1OCZE 2E4UA 3NBMA 1AS3A 4C9BB 4UUMA 2HMWA 2N46A 1L4YA 2WF7A 2C4WA 1CY1A 3JXEA 5HCIA 2C1EA 3G2UA 4OQPA 4YP7A 4OQLA 3N7TA 5DNEA 3DOCA 3HWWA 1NN5A 2GPJA 2QVGA 2ID4A 2IU3A 3CH6A 3MWDA 4ZIRA 1GEGA 5TVKA 5HW0A 4TZ0A 1JG7A 3Q12A 2ODBA 3WLHA 2I1QA 3KIPA 4PQGA 1SMKA 4MGZR 5EJ9A 2VWPA 5JSUA 3ROFA 5D0QD 2PSHA 4OREX 1T1SA 5AM4A 4EUFA 4NOKA 1UXGA 3UGTA 1EFPA 4O08A 2C2XA 2AG8A 4GKBA 5EYPF 3IEGA 3AMVA 2A94A 1G19A 3NIBA 3UXGA 2KBXA 4FFWA 1KYYA 1WVIA 3NTVA 1UK7A 2XCIA 3SR0A 2NXEA 1U1GA 2EQ5A 4KSBA 4FZ3A 2DZNA 3TH5A 2WKPA 4MEAA 2UXDB 3OBIA 5JJKA 1S8AA 2FLKA 1AMNA 3DEJA 1MX4A 1FVXA 2RHDA 5J63A 3WYCA 1AKWA 5BR1A 1I2ZA 3G2SA 3R6DA 3IPAA 3QVTA 3DAOA 2A35A 4JR2A 3GFVA 3LGXA 2H65A 4YAGA 1U2DA 1ZI6A 5T67A 4EY5A 4P80A 1U6KA 1ZVVA 1TGYA 2CSUA 2WTNA 2WJPA 1E7YA 3SHOA 3FNBA 3PZ4A 1PCXA 3WX0A 2R11A 1ENYA 1VMIA 1BW9A 3B7WA 2A84A 1KMHA 3KSDO 1A9SA 1YS6A 3R75A 4DWWA 4JA9A 1WW2A 1GL9B 3ITDA 4ZVLA 1FNMA 2AMYA 3DL0A 3OEED 5F73A 4AC9A 3KC2A 5IMSA 5HEKA 3SIPA 3EZ9A 3KD2A 3RRUA 3CR7A 1KFEB 1ZCJA 2C8JA 1WS6A 1VLHA 2JIOA 2ZRGA 1H2BA 3CPJB 2G07A 2UKDA 2Q7OE 1VLLA 4H6PA 1SJ9A 3TI9A 3VZSA 3P9RA 1PVDA 4KXYA 5KYUA 2OGWA 1NC1A 4LTNA 3JQ6A 2QTTA 2Y1XA 4RLFA 1HDRA 4HQRA 2IEDA 3DEAA 3HVEA 2W7TA 5CFQA 5CBPB 4HNGA 2QD2A 2IF4A 1ODSA 1YB1A 1QIKA 5LZ8A 1KSGA 4PLYA 2I99A 1RCUA 4V3CA 1M33A 3TLKA 1KGDA 1NWCA 4YDRA 2RAUA 5A2GA 4KQJA 3LY7A 2YMQA 1MGPA 2FHPA 1XAHA 2HSJA 4YDEA 4C3OB 3T8MA 5JWOA 1WKVA 1E8MA 1P2TA 1L5WA 3FMIA 2NNLD 4H4CA 2E0IA 1EM8B 2ECFA 3EXHA 3VU1A 2HDHA 2BFDA 1EJ0A 1QMPA 1YH3A 1T8RA 1K8QA 3UT5A 3VPSA 3T3IA 3D9KA 2VDMB 2R8EA 1HTWA 1OAOC 3BJZA 2RB4A 3VVCA 1ZN8A 1QGZA 5DBIA 3NNSA 4HDOB 1KMMA 2BKXA 2SCUB 2CLIB 1PL0A 2QM3A 3X2FA 2IY9A 2HRBA 5E6SB 4P4GA 3LA6A 3UA3A 4G85A 3RC1A 3REGA 3ZHQA 4YT8A 3OHSX 1VPTA 4RGVA 4EY3A 5KOJA 4NCIA 1SH7A 4CU2A 1SCUB 1WU7A 2ZJ1A 2H1RA 1T15A 4LE1A 1N3LA 4WGGA 2X4IA 4OY3A 4U00A 1W1UA 4GIBA 5KEIA 1E3TA 4XVHA 2WE8A 3TZHA 2UVQA 4I4IA 4RK0A 5I4CA 4N3AA 2CG3A 4BX0A 2CEAA 3F5QA 2CWDA 3GT4A 4MO9A 2JRCA 1L3CA 2P3OA 4TKVB 3I34X 2I22A 4Q3EA 4AJIA 3KZOA 2PVCA 1XLUA 4QFCA 1TD1A 2VNKA 2IZ1A 2G5GX 5FWYB 3L0CA 3NAQA 1Z5SC 4N0MA 2VP9A 2G7ZA 2M63A 3FH8A 3F8WA 3LTEA 4LSGA 1OR8A 3EIQC 4L2YA 1I7SB 3OCZA 4WMLA 3JD1A 4QO7A 2O2DA 2R2GA 1WP9A 2CLDX 3AKZA 1TAQA 4HWRA 1XDZA 2QGZA 3GF4A 4QG7A 1LU9A 4ECEA 2PUFA 3ZZUA 3RAEC 4DDVA 3PS6A 4LGVA 1V6AA 2DTXA 1HE3A 1QTNA 1RWPA 3P9SA 1VL5A 4BKPA 4JX9A 3FGPA 4CQLA 4F4JA 2AOXA 3K73O 2L9BA 1TAHA 1O1SA 1JE0A 4IEIA 2HADA 4XA8A 1E79A 3RKUA 3WRXC 1H4VB 2Q3EA 5KS2A 1BN7A 4LSZA 2V5UA 3RRYA 1UBHS 2FSVA 1XZLA 3V42A 4WNIA 1ODJA 1Y1SA 3CK9A 4DQDA 3TQCA 2PS0A 4IS2A 5KNBA 5ELXA 1BEUB 1XCPA 4J7XA 5AKJA 5KOHB 1RD4A 2BE9A 4JVSB 5KJMA 4FNMA 1ZM9A 3ISTA 2DIWA 1Q15A 3DHYA 3SIXA 1KAOA 1N3YA 2PIAA 1Q7CA 4Z7JA 2PJZA 4PF1A 1YFZA 2P9NG 4NPAA 3VRHA 3ABLE 1RCFA 3AF2A 1IUOA 3Q3JB 1DS6A 1TCVA 5KDOA 4OD0A 1I1HA 4YVQC 2R5WA 4IF6A 1J20A 4TUMA 1JHRA 1DX6A 5CLLA 3MJTA 3ZE9A 4MK4A 1RHRA 1V1MA 1MORA 1YBVA 4GSKA 4XGRA 2I87A 4DTCA 5LDHA 5B1BE 3HE3A 2PO5A 1RW4A 2XLCA 4EKIA 1Q14A 1VE6A 1UJ4A 1KK1A 1Q6YA 4DRZA 2CMGA 1RHUA 5KBAA 3CT6A 3RIMA 3VPDA 2R6ZA 2JA2A 1YB7A 1BFUA 2FPWA 1G21B 2VRBA 2EW8A 1Z83A 3ZHXA 2JBAA 2R6R1 2A5DA 1QRRA 3CUYA 3ZDXB 1WUKS 3GVHA 1L7DA 2UVDA 1WG8A 3EJWA 1Z6GA 2JIPA 1JXQA 1JL3A 3DQPA 4CDRA 4U9IS 4KACA 4DW8A 4C89A 1YD7A 1L4NA 1WCIA 4PSDA 1HDGO 3QFFA 3I9OA 2EZ8A 5GONA 3M3DA 2XTAA 1ZWLA 3EIHA 4XB6B 2AUMA 3PJEA 5EIDA 4X6XA 3D4PA 1RPZA 3TTVA 4DILA 3NBXX 1VKNA 2ZXFA 1WP4A 5GMOA 4O0LA 4N03A 5U4XA 2P9UG 1DJNA 1NYLA 2Y77A 4TS4A 2YBDA 3IJPA 4ZVPA 1HNXB 4GBMA 2IFUA 1VGQA 4ZI5A 4XKJA 3D0KA 3DNFA 1YRWA 2UZ1B 2RGYA 1CD5A 4W5JA 4GICA 3AZPA 5LQCA 4YAIA 1EI9A 3KV3O 1ZD4A 3W3AD 1TD9A 4MQ4A 4AY3A 1L8LA 2GLTA 2QJOA 2RAPA 3LPDA 4UHBA 3DDZX 3S1SA 2VG8A 3PEWA 5G4KB 4BV2A 4N41A 4CKWA 4PBTA 4IGIA 1J23A 4BMYA 3PP8A 3B3JA 4ALLA 1TUIA 4RLSA 5A0TA 4Q05A 4PLCA 1FP2A 4FWIB 3AHIA 1G59A 2YV5A 4YRJA 2YZ2A 3NWJA 1PJAA 3M81A 4H1HA 4URZR 1E4YA 5CHEA 3D9QX 1GNSA 3T5CA 4MS1A 5B6PA 2ZUBA 4TXLA 2ZQZA 4ER5A 1N75A 5BSEA 3TINA 1JV2B 2PWYA 1NZNA 5E6UB 1Z12A 2A59A 3AIIA 4PYKA 3I5XA 3KQKA 2VQSA 2ODEA 4R83A 4B4DA 3ZY3A 3W8DA 3SS7X 3WGJA 2A57A 3R8FA 1P4RA 1R74A 3BA1A 3RC3A 2X0IA 4BLTA 4X5OA 1R0WA 5I7VA 5LN1A 2M6RA 1W6RA 3H84A 3GT7A 5A4DA 4B73A 3HWX1 4MUIA 3GJ0A 3MN1A 5KJEA 1T3HA 3JCZA 2AK2A 4WE3A 3TZEA 4BFTA 2AW5A 3CF2A 4M7RA 1YTUA 2WIKA 3UHPA 3L9WA 2ZROA 4UASA 4YMIA 3QX3A 4IHKA 3T1TA 3FYTA 4GOLD 3BCRA 1TC1A 4ER3A 4X97A 1Q3TA 4MYDA 1IZZA 4XE0A 3E9NA 3K70D 4LRSB 1AQIA 2DHEA 1EF1C 1PIWA 2O1WA 4PS8A 3N8HA 4RFVA 2E6UX 3TW8A 1EFUA 3ABQB 3QY0A 4UREA 3QPUA 3OU7A 2W4QA 1AO0A 2JIZD 2AT1A 4FIDA 4QBTA 4RD2A 5GJCA 1R0KA 5CIQA 4DCVA 5I8PA 1D03A 1AGPA 1EDBA 1ITZA 1P3DA 5FADA 5HTKA 3QTBA 2V7VA 1TO1E 2HMTA 4KEAA 5JMPA 3A1CA 4DLKA 5CBNA 3KOUA 4OXRA 1W5SA 1L7RA 2VSYA 4OVVA 1N5DA 3V2OA 4EBAG 4CJXA 5CURA 1U94A 3L7AA 5JXIA 4JC8A 5J5AA 2R8RA 1U28C 4ZYXA 3UHOA 3FWKA 4MVJI 4NPHA 3OM1A 3OCJA 4TMVA 1XA3A 4FLBA 2BY4A 2X3FA 1GCOA 3RVJA 1QK4A 4M8NE 4RTSA 3IQGX 1EJ2A 3IRUA 4NNOA 5ECDA 4B79A 3ZDCA 1L5LA 4QDZA 4V1CI 4DC1A 1K92A 4HVLA 1CIVA 4JOCA 1M67A 3IB6A 5CBOA 1QVWA 5H5JA 3UG7A 1IVYA 2CK3A 4MWCA 3CIAA 3EXEA 1MNAA 3LCMA 4K5AB 3VV3A 4KZ0A 3UM1A 3CNOA 4KAXA 5F5XA 2HN9A 2I9PA 3ZWYA 4K9PA 1OFTA 3LA8A 2IQ5A 3OIUA 4NURA 4I1MA 2X15A 2XE8A 1Q1QA 1HX8A 3N3AC 4H7HA 4UQZA 2GN6A 4K8OA 3RS9A 4WDRA 1QQ6A 4D4GA 4HQNA 4BSZB 1E59A 1E61A 4BE4A 1MRSA 2DVWA 5DW3A 4D46A 2XPZA 1TO2E 3GFTA 4C0HA 1N33B 1ZXXA 4FFDA 4CF5A 1D0VA 4GXRA 4MS6A 2VT2A 1PFGA 3V1NA 1MO6A 1UJKA 4GLOA 4C0KA 3RRMB 4ZODA 2Y66A 3IR7A 4FHFA 1LF0A 3PZRA 1E63A 3I2YX 3LIIA 2EKQA 3IX7A 5B3KA 4BLOA 3BL8A 4WEOA 4O5OA 4B2PA 3HCCA 2PMEA 5A03A 2JK0A 1R3DA 5EUCA 1MAUA 1H2UA 4U2CA 2W22A 4L02A 3SVLA 4Y0VA 4F4HA 1X7YB 4J2HA 5HQJA 1DOHA 1RU3A 3B1YA 3BWCA 2GD2A 4U2GA 4NMHA 1TKBA 3LY9A 2IHZA 1MDFA 2QX4A 3UENA 1KO5A 3LHDA 3IT2A 3QU9A 1UXHA 4LRZA 2GN8A 4K9SA 5L3SA 3L43A 2H5IA 2PM6A 3WWEA 4QNMA 1B1CA 3EBOA 1Y9EA 2GFQA 3I53A 4H6VA 1E6KA 3W2GA 4G9EA 3O8NA 4P33A 2FO7A 4BASA 2O52A 3L8GA 3DW3X 1M0TA 3BDIA 4I19A 4HNRA 1F7VA 2GOYA 1YJQA 4DQVA 4JC4A 3MT9A 4OQXA 1I2CA 4Q3CA 1AHHA 5PNTA 2ZFUA 3Q9NC 3WYDA 2DVMA 2R0QC 2OV1A 5CB0A 3IDQA 4E2YA 1WG0A 2R44A 2JCVA 3I3SR 5AVQA 4NU0A 5KX5B 3P9NA 1RPJA 2PZLA 1AKRA 4GHWA 5ITVA 3WL8A 5DCWA 3LY8A 2D1FA 3CX6A 4B3TB 1HTBA 3G2PA 6LDHA 1N78A 3AUSA 3ZU5A 3HJGA 5DM2A 3B20A 3N86A 1U2TA 1VHDA 4LQCA 3SPXA 2QN6A 2Z43A 5IWCA 1HKHA 1OWLA 1FOEB 2JKZA 3QF4A 5A62A 1XQWA 4GMFA 1H2YA 3FUKA 2FSGA 2PAAA 5FZQA 1BE1A 1PT6A 2JZNA 2CJWA 3ASGA 5GWXA 4B3FX 2VPWA 1NDQA 3E9EA 1XEXB 4FXPA 3MFQA 2H2HA 2VN8A 3AYXB 4RPIA 2K7ZA 5IJ0A 3TOCA 1AQNA 3N8IA 4PG6A 1Z06A 8GPBA 4JFAA 3R8CA 1E4VA 1NFRA 4XB1A 1DCQA 1KRWA 3M6LA 4P0QB 4MS3B 1AKMA 1JYFA 4J1SA 5D2CA 2NO0A 1FW6A 2WZBA 3IHKA 4Y2RA 3HVUA 1MCZA 4HGZA 4LX0A 2DUJA 1WTCA 1OXKB 4YBZA 3P2IA 5DTRA 1T5OA 2DLNA 4REOA 3PVCA 3MG9A 3LX8A 4RHXA 3OLYA 5JS2A 2XCUA 2WVIA 2H6IA 4A8JA 5FBQB 1M2NA 3QJYA 1KQGA 2H1OA 4BX9A 1UKEA 2V4ZA 5ERYA 1ZMRA 3S40A 1E79D 1X80B 4KQXA 3U13A 5DK4A 4C78A 4RTRA 2I1KA 4YAFA 3A05A 2WBLC 3AJAA 2VUIB 5LOZA 3QW4B 3WLNA 3VAZA 3E5MA 3COZA 1W581 4Q5IA 3PPYA 3WXBA 4YCMA 3FGOA 4KVAA 3OTIA 4G1MB 4TUUA 1MC4A 4RZQA 3I5AA 4J2OA 1ZZEA 1T5HX 3DZFA 1E9VA 3S2EA 2ZI9A 5JZSA 2EHDA 5K3FA 5CITA 3WADA 1DO2A 3HXLA 4NBUA 3JW8A 3SF4A 1XNHA 2GWRA 1E7RA 3MRSA 3E3MA 2P2CP 1JR4A 4IOJA 3R0JA 3K9WA 2WHXA 1WXIA 1YJBA 4X63A 1JHUA 1RLUA 4BBAA 3TR6A 2PZAA 2D7DA 4F60A 3LDHA 5JHGB 2EIME 1AIPA 5IDWA 3HDVA 4EZKA 3SNKA 3EY4A 3ZLVA 1NJGA 4Q48A 1CY8A 4DVGA 3U4QA 2Z5LA 3FFBA 2CCKA 2GZAA 4PRKA 2CLSA 4MEJA 1SULA 4UAJA 4KL8S 3AY7A 2V1UA 2HC9A 2K4MA 3KSBC 1J8FA 4KR3A 3FJYA 2XT6A 1B6GA 4B3DA 1PJZA 2QI9C 1SELA 3KAQA 1RM3A 3WFZA 3DE0X 3IMKA 4XD2A 1IHUA 4KUHA 1P4JA 3DBLA 4E5NA 2MMCA 4D7AA 4URWR 4G5XA 4HUJA 5H70A 1T5IA 3OX1A 4E14A 2YBEA 4BE7B 1NN3A 3UFXB 4CNQA 2ASVA 4MYTA 4J7UA 3UO8B 2WWTA 1R0CA 3WSVA 3KB6A 1R6DA 2ZWAA 1PVVA 4HDCA 2F9FA 3M3HA 2O8CB 4TRMA 4JJFA 3LW8A 2HY7A 3U61B 5D00A 3O9MA 1OH5A 2XYRA 2EKLA 4FILA 4B7ZA 3ER9A 721PA 3EE6A 1G7RA 3AW8A 3H9CA 3FHJA 2X22A 1DDIA 1JJIA 1JPJA 4LV5B 3K1TA 1BH2A 1CXZA 2WZDA 3TOXA 4YV2A 3EFHA 2JHCA 3BH7A 2VHJA 5B36A 1OWNA 1EXMA 2YINC 1G6OA 1UWKA 3A1TA 4LJKA 2P9BA 1FMCA 3KFXA 2KLBA 1X7ZA 1KU6A 4MAMA 2ASEA 3PFKA 2COKA 2J3KA 1EWQA 1ZCAA 4HSGA 3ZWQA 3UWKA 1IN4A 2AX4A 3ZRHA 5DT2A 1XU7A 1PFKA 2W48A 5GONF 4Z3DA 2ZZMA 1DKRA 3D6FA 3OD5A 3HUEA 2FMUA 1W36C 2FGJA 2O8FB 4I4LA 1JDSA 4NTZA 2AZDA 3DOEA 1V71A 3W5AA 1VKRA 2GO7A 2K7FA 4C2TA 2AUTA 4MA4A 4N6GA 1HE8A 2NTNA 2AFIE 1PWYE 2JDID 3VSBA 2L2QA 1SRRA 1I5RA 2XA2A 4RTMA 4TTVA 4MQUA 3DBVO 1G42A 3FUMA 5AI0A 4DLLA 1CEQA 3OMXA 1QNLA 1EX1A 4JWKA 3TL5A 1EP3B 3IEXA 2R62A 4BZZA 1D1SA 2QVXX 8ABPA 5KWEA 4M99A 1QIJA 2PZKA 2AXUA 3LY5A 1EJ6A 5TMDA 2RB5A 1PHPA 5BN1A 2QR5A 3FKSA 4ZTUB 3RK1A 3A6JA 4XVRA 3RFTA 1XTZA 4V3IA 2WQ7A 2VDNB 5JYCA 3HKBA 4B6GA 5TMPA 5LBUA 4OH1A 1DRKA 4IDFA 5GV8A 2FQ1A 4QDJA 2J3HA 1YVRA 1RHQA 5K0JA 3KEFA 1JUDA 2JASA 3U17A 3GZTB 1NJ6A 2W2LD 4DLYA 3PUXA 3H2BA 4ZAWA 3EGDB 4F21A 4U96D 4JGBA 5GQSA 2XHZA 1X2BA 2XCLA 2F3UA 3TKAA 4IV0A 1YE3A 4AROA 2MSEB 3IJEB 3PLAE 5IM5A 5F35A 1EIZA 2ZBPA 1MD9A 3SBSA 2PLNA 4OQEA 2NV0A 2P5UA 3GFRA 3QAQA 2MR5A 2BC9A 1G8YA 4XEIG 2HEIA 4L9PA 4PZUA 5IABA 4BWFB 3WMRA 2KCLA 4G1FA 1JG6A 1ZONA 2OPBA 4LKOA 4P5DA 1Q22A 3C1UA 1KYVA 1C9KA 3F5MA 3A8TA 2JIBA 5B3JC 2JGFA 2RE8A 3VYVA 3FTSA 4HXFB 1RQLA 3VDMA 1AM4D 3IGFA 4DJAA 3SOPA 2PRKA 4BNXA 3WLFA 3T5AA 1VRWA 1B0ZA 2VH2A 2XUOA 3K9FC 4CQNA 2ZUWA 1H1LA 4MV6A 4D9EA 2JHGA 4US2R 2IELA 3G85A 2D1TA 3L54A 4KAAA 2AXVA 5AJYA 3TW4A 1FJXA 3RIBA 3VFDA 1FYWA 1O9BA 3L8HA 5HUHA 2YN0A 3EISA 4PLVA 2XGMA 5CJJA 5B58T 2CK3D 5JZ9A 3CF4A 4LVCA 2CCGA 3PEVB 2MHCA 1DJPA 4B6PA 1FDIA 5FV7A 2P6RA 2GERA 3HZOA 3L02A 4YV1A 1N6OA 2E5WA 4OM8A 3LYHA 1IQRA 3IDFA 5BYBA 3E9DA 4LYFA 4H31A 3TTSA 1B4DA 3R7NA 3V4LA 2OV8A 4MW9A 5BNZA 1YRAA 5KYVA 1Z45A 3TDMA 2WJGA 1Y1TA 4EKNB 3MQ2A 3M6XA 3DBOB 1W6UA 5DLPA 2P3LA 5EHXA 4MUHA 1MX6A 4A5OA 1V0JA 2HR2A 2P9JA 2VZLA 5LYYA 1DT3A 4QBFA 1E2KA 3JZIA 2P2LA 4TKMA 4O63O 1AK1A 4Z7NB 3UXYA 2WXHA 3W8EA 3KZVA 1K4MA 4WKNA 2GYUA 2QNIA 3EHMA 3OQVA 2BMVA 3CQGB 5EC8A 2JGMA 4M3NA 1WABA 4CMBA 3RU0A 2ID8A 1V3QE 2EEZA 2H1SA 5JSKA 4XJSA 1MENA 5ICEA 4MVJD 4Y1FA 4O60A 4TTSA 4AB1A 3M5PA 3BD6A 4KW7A 2NUPA 4GGPA 3HY3A 3PEUA 3EBLA 1XTKA 3NUGA 4PLHA 5EPOA 4JU9A 4NQ0A 1FUKA 3FCOA 5LFAA 5KJ6A 4DUYB 1NBWB 2BEVA 1KPIA 4RA6B 3HBLA 4QHYA 1G3NB 1LS1A 3ASVA 2CYBA 1E62A 1XZDA 4RY9A 1KS9A 5AXAA 1TLFA 2J8ZA 5DNWA 4JROA 3PNBA 2O2JA 2XVAA 4OOEA 1WXQA 4MRVA 3ELUA 1QBGA 1B23P 4DLXA 4L95C 1OPXA 3Q40A 4PZEA 5F5NA 2AC2A 1FRVA 2WFAA 5AK0A 3NBUA 2N75A 3VO8A 4JOSA 2C8KA 3GNTA 4G4JA 5FZRA 3RM3A 3K2EA 2O07A 3WZ2A 4JI7B 5HS6A 1WD7A 4A2CA 2BM0A 1T3SA 1E8XA 4QRIA 2DYRE 2E2WA 2FSHA 2PX3A 5A04A 3FAKA 1ZRSA 1T3GA 1BDBA 2N42A 3M70A 3C6QA 4MRAA 1NX6A 4TMTA 4O2LA 1OGIA 3AUAA 2Z3VA 1PWEA 3BMNA 1WY7A 4D56A 4PNPA 4RJTA 1SVUA 2OMEA 5AKZA 2CLKB 3VR5D 1OTYA 3FEXA 3FWNA 3L6AA 2L42A 5EJ8A 4G24A 4C6TA 4GMXA 4PGFA 2VDOB 2GEDA 3S2YA 4BJ5A 4G0UA 1XD2A 4I81A 3A2LA 3Q3EA 3CRQA 3W6ZA 4A0FA 1TJ3A 3E6AA 5L6MB 2DSNA 5LUAA 2R751 3WGZA 4RXTA 2DU8A 3VPAA 2GVNA 1JR2A 1UJJA 4QXAA 5JD6A 4MS4A 4PGGA 2VJMA 3O8QA 1V8PA 4YXFA 4LYEA 1YNSA 1H8ED 2BSXA 4Y6GB 4R40A 4DSTA 3JAKA 3K0CC 4Y2TA 5FFMA 4MIOA 1KJJA 1X8JA 2WRZA 2F37A 2QE7A 4OHBA 4B76A 4N12A 4HPJB 3UXMA 3CK8A 2C0PA 4BBZA 1CQXA 3H9GA 1O96A 2Y76A 1WKBA 3QK0A 4CF4A 3EZ6A 2JLWA 4BRWA 2Y99A 1K68A 4QTXA 2XWSA 4XWAA 2C2ZA 1TMKA 3QKIA 2ZSIA 5KVSA 1OZAA 3FOWA 1Z2CA 2QL9A 1G4HA 2WAMA 3KKEA 3GV0A 1QV9A 1GXSB 4FS8A 3F6YA 2X3YA 1OXSC 3GBPA 2VZ0A 4IO0A 5CA1B 5KYWA 4KYOB 4FDLA 5C32A 4RKEA 4EELA 2OQVA 2CYCA 4QJ3A 4B3XA 1REQB 2RK4A 3RC9A 3MJHA 2UYOA 2YJ5A 2YS7A 5MHTA 3SKXA 4OQMA 3HJHA 2XMDA 3OAWA 2IONA 4ZFNA 1IWOA 3H8SA 1LSUA 5E7JA 3NP7A 2W2QA 3H9UA 1KEZA 1KKMA 4UDOA 1TR4A 4DT1A 1OAOA 1E94E 2WKWA 3PDNA 3MPUA 4A03A 1U1FA 4I17A 1A82A 3BIOA 3GJSA 3G0DA 1R3UA 4KBQA 4BUCA 3HXOA 1Q74A 1SVNA 2BH9A 3P9XA 4U3JB 4L5JA 2QMOA 1C1DA 5GINE 1CR2A 4DBZA 4IQ8A 1JQAA 1TVCA 5JBIA 4KQEA 3OE1A 3BH6A 4GRAA 4UM7A 3GLGB 3PDJA 5IVDA 4I1OA 4J8EA 4C0JA 1RC0A 4LYYA 1E4OA 1V2HE 2Q4OA 5AVSA 1ZESA 4PRZA 2WTXA 1X38A 4I4TA 3U7EB 4PS3A 1R8JA 1NUUA 2P0EA 4UQOA 4A3TA 2H1LA 4JEMA 5FOTA 1LJLA 4OMFG 3KKPA 3U80A 4OJTA 4G0QA 3DLBA 4TMFA 2LRHA 4C7OB 3Q6MA 3MRXA 3RVRA 5BV2P 3KPUA 2OZPA 2FEXA 1O54A 5EHQA 2PT7A 4MHSA 3WL6A 5JH7A 2FMIA 3C14C 3A4VA 1JQDA 2LNIA 1PGNA 3DMFA 5HCUA 3IQXA 5KZMB 4Q3OA 3SXPA 3EIQA 3BAZA 3MUFA 4JFRA 3V00A 3TZCA 1PNTA 2P6MA 3IB3A 2Q28A 4ZQFA 3ZK9A 4P4SB 3IESA 4URXR 1D6MA 1PJQA 4YFVA 3RQSA 3WE7A 3PUJA 4GGMX 4RWZA 3FWYA 3KYBA 4IH4A 3T7AA 4G5HA 2GBPA 5IAEA 1AO3A 4TZ6A 4CM8A 4M22A 3S5UA 1ADFA 3JQ8A 4M1QA 2F64A 1OT8A 3CR8A 2R8BA 3RYFB 5EKDA 3DSWA 3W3AA 3D9OA 5EHZA 1YB2A 3HG0D 2QQ0A 3WRXA 4Q03A 1DCFA 2P0AA 3NB2A 3HO6A 2ZM6B 4C07A 1YHNA 4G0YA 1CUFA 2FE1A 2PMDA 1LBQA 4OGKA 1WF3A 4JLKA 5FUYA 4QQRA 3H2KA 3P45A 3UUFA 3PQ6A 1XAJA 2NIPA 4B6SA 3V2XA 2QY7A 4KE9A 2XUFA 2JPDA 3FTUA 3N6XA 3WWCA 2PZ8A 1W0CA 1PZGA 5IF9A 3Q7RA 1VL1A 1E0KA 3ZYCA 5A5VA 1WUHS 4JBIA 4XX0A 2VCHA 5I48A 1YFJA 2NSYA 1VE3A 3GCXA 3DE4X 3BSSA 1JHYA 3ADOA 2H54A 4TN5A 4LVOA 1TPYA 5JI3E 1T2NA 3P2OA 3UJHA 3IIEA 2E37A 2VRCA 1JQ3A 5TB5A 2FUKA 1F3OA 4ZVOA 4QFBA 4ZT3A 1CNFA 1R8YA 3DO6A 3ZUGA 1WPRA 1Z7WA 1RTTA 4L8FA 1W2WB 2VA8A 3VO9A 4DUIA 2ORWA 3QXHA 4XM1A 4B9AA 4DSAA 4TS9A 1N2HA 1J8DA 4YP5A 2H9IA 4AUMA 4B2YA 3DPIA 3OQNA 1MABA 1SIBE 3A25A 1L1QA 2ZCVA 3O83A 2XZLA 2H8KA 1DAPA 4GTVA 3SYKA 5ITZF 3H1PA 3FGNA 4QVGA 1ZK1A 4A6DA 1H23A 3HXTA 2QN1A 2WSSA 3WL3A 4F5WA 1X9IA 4AS3A 5TGTA 1SNYA 4M0KA 3AJIA 1PDOA 1QIGA 1QWOA 4S35A 2IHKA 4UQLA 2I33A 4JKIA 2DBRA 1FIUA 4ZZ2A 2EJUA 5B6IA 2J9GA 3UTDA 3ODGA 2JIZA 3H5LA 1NVTA 3AEXA 1V8OA 3GLIA 3CSDA 2OXTA 3SICE 1AH2A 4A1OA 3OPNA 2C2MA 3AVOA 3C4QA 2VQFB 3IMCA 1I32A 4DANA 4M3OA 2IO3C 5FUBA 3DVSX 4TVSA 2ALJA 2DG2A 4I5IA 1FQWA 2JAPA 1Y9DA 2RG7A 4EB6A 3C3OA 3Q47B 1N7IA 1W8IA 2WWFA 1QE3A 4YCLA 3JU3A 1V45E 3C45A 2VSXE 2NVBA 1YZNA 2LUOA 5I9TA 1D8AA 4JJEA 4R98A 4RTJA 3ZCQA 4UCXA 2I34A 3VO1A 2FWRA 3WGUA 2Y6VA 2QVCA 4MW2A 3CNQS 2WWGA 4X7BA 5K5EA 2C95A 2HQSA 1YRQA 1K7CA 3C6BA 4CDMA 1EWYA 1XMOB 4B40A 3L84A 4JUBA 4I99A 4MVJG 5FPTA 2CLFB 2ZE6A 3VGPA 1E6LA 4RHTA 1UKYA 2H7VA 3BB4A 2DLDA 3DZKA 4GOJA 4ARSA 4OFBA 3DOOA 2XZOA 3P0FA 3JATA 3OCXA 1WHTB 1BA2A 3IVAA 2FY8A 5E9WA 1CUXA 1OTXA 5F9HA 1QKJA 2KCVA 1U65A 2B7LA 1R0LA 2HIHA 3SI7A 3TO5A 1TX4B 4GX1A 2Z1MA 2CVQA 1MJHA 1E4EA 2IYYA 3GBVA 4BWGA 4WNDA 1Z17A 4F72A 4ZFHA 4G84A 1JB1A 1NURA 1QKIA 3GUZA 1E3LA 3QRWA 4I9GA 5AQEA 3IAXA 5IH3A 4O4LA 3DFZA 4MPRA 1P2BA 4FI3C 1GNPA 3FOCA 3BIJA 3QNWA 1BDMA 2UU9B 4UVHA 2QTGA 1HETA 3G2LA 2G1PA 3T7TA 2QHXA 1Z6ZA 2HB6A 2YJ4A 3RC2A 3OCUA 4UDNA 1KP9A 4M86A 2A5FA 3SC2A 2C9CA 1B73A 3BRQA 3A6FA 5HRYA 1CEXA 4RPCA 3OU2A 5IC5A 1HOXA 2O0MA 3P9YA 1FU7A 4FR0A 1P9NA 1BDJA 1ZJ5A 5CDUA 3QLJA 2WIBA 4BVHA 1TLTA 5B64A 5L7YA 2QQFA 3FPBA 1Q0RA 4HAYA 4JLVA 2GARA 1GV0A 1QE0A 5HKLA 3T3GA 5FOXA 2H3EA 4URUR 4PPNA 3KXPA 4RK7A 1IPFA 2NSZA 3F6PA 1FLVA 3HNRA 5CT9A 1SKAA 2GCOB 4WA8A 1TB4A 3WTCA 1IQPA 5DBEX 421PA 1GGKA 4TMKA 5LKRA 1CS0B 4C0AC 5KVVA 1C0LA 1Z4JA 1V6CA 4ZOLF 4TV3A 1YS1X 2AG6A 5EXDA 1QCCA 2MYTA 4W63A 3AB8A 2GD1O 1E2PA 4KQMA 3DOFA 3SM3A 1K3UB 3TWVA 4IIVA 4RESA 3EU9A 2J32A 1N6KA 2MMGA 2H9YA 3DT8A 3IVMA 1YAJA 5HF8A 3N5CA 3FOAA 4LN1A 4CT5A 2Y4NA 2P2SA 3OZCA 1T3ZA 2FUNB 1AU9A 4L85A 1P7ZA 5E7MA 2XEVA 3S70A 2NUBA 1V11B 1A4XA 3ABRB 4X94A 2OSBA 1GARA 4YJDA 1USIA 4M7CA 4W9RA 1T1GA 2G4LA 3FHCB 3TJZA 2Q0QA 1G17A 5JBQA 3LPLA 3T6KA 2A30A 3L9XA 4Z6KA 3D8BA 3F6CA 3BS4A 1D2AA 4U9HS 4HI0E 1KDVA 4PZ0A 4DIEA 4X1IB