4CT0A

Crystal structure of mouse cryptochrome1 in complex with period2
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
494
structure length
486
Chain Sequence
VNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVAANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of Circadian Clock Proteins Cry1 and Per2 is Modulated by Zinc Binding and Disulfide Bond Formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Circadian clock protein
molecule keywords CRYPTOCHROME-1
total genus 173
structure length 486
sequence length 494
ec nomenclature
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4ct0A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ct0A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ct0A01
1UFVA 3DV2A 3SEQA 1PFYA 3COYA 4HPWA 3VU8A 1GTSA 3IMCA 3UMVA 3AIIA 1IVSA 3HMQA 1YIAA 1H1TA 5IJXA 2CYCA 4JXXA 3U1VA 4MVYA 3IOEA 1N2BA 1I6LA 3Q10A 3ND5A 4ZT2A 3IUBA 1IQRA 1EJ2A 1GAXA 1JIKA 3MUEA 2DXIA 1KH3A 5KCMA 1N2JA 2R5WA 3P0JA 3FG9A 1JECA 1WXHA 3X1KA 1JIJA 3BL5A 4G5YA 4MQ6A 3PNBA 1K92A 4WNYA 4ZT7A 2ZP1A 3F3MA 4MWCA 4MW1A 1JEDA 1JGTA 4RUKA 4L2IB 4YP6A 3Q12A 3LOQA 4YMIA 1T6XA 4FZJA 1H3EA 4ARIA 3FOCA 1OBHA 4KR7A 1OBCA 1ZH6A 3G6KA 5J58A 2A4MA 3L92A 3ND6A 1MAUA 3ELBA 3PXUA 3CVXA 1GLNA 2YY5A 1EXDA 4KPUB 2IELA 3KT0A 1T6ZA 1KAMA 1N2GA 4Q93A 2VTBB 1PFWA 3QTTA 2J5BA 1NSYA 3ZJUA 1TYBE 4K0RA 1S4MA 1WXIA 1NP7A 2G36A 4P2BA 4R2LA 2QTRA 1CT9A 2EJCA 3HGMA 2A1TR 5FO0A 4TS1A 4U8HA 4NX2A 1M1ZA 3HV0A 3IOCA 1WKBA 2A86A 3MXTA 2CV1A 4EFKA 3IVCA 3N8HA 3S3TA 4I6JA 2PIDA 1TYCA 3I05A 3CLRC 2CV2A 4MUNA 3FWKA 1G59A 3PNVA 3H9BA 1U7DA 4HJXA 3RHSA 3VGJA 3X1MA 2ZUFA 3GLVA 1Q11A 1DNPA 3CVVA 3SZGA 1BS2A 5FO1A 1KR2A 4DE5A 4EGAA 3KFLA 2XRYA 2QUKA 4MW4A 5J59A 2D54A 1WZ2A 2QJTA 3CLUC 4YP7A 1O6BA 4QREA 2I1LA 5H7XA 1EFVB 4PBSA 3TS1A 1M83A 1K4MA 4CDMA 3IVGA 4OUDA 3FY4A 1O97D 3ZXIA 1X6VA 1O95D 1G8HA 2BYTA 1U7XA 2JANA 4MW9A 4EG3A 4F4HA 2Z08A 4MUJA 3P0HA 3H97A 1ZH0A 1JMVA 2Z3VA 4ZT5A 3ILVA 1N77A 3RBAA 4A91A 2DPLA 3FIUA 4UZEA 2BTEA 3ZXSA 3DPIA 1TQ8A 2HMAA 1J20A 2A1UA 2PFSA 3Q4GA 4WSOA 3AG5A 1NUPA 3OP1A 1O96A 2O8VA 2WQ7A 3COWA 4MVCA 3SEZA 1OWNA 2CT8A 2AZXA 1G8GA 3NBKA 1NI5A 1I6MA 3DLAA 1TYAE 3IMGA 1IHOA 3MLAA 4MW6A 1NURA 3ZUGA 4U7JA 1M8FA 3IODA 4NZPA 3IMEA 4NATA 3IVXA 4NAHA 5KHAA 3FDXA 1R6UA 1O0BA 1H3NA 1FYDA 4MVXA 2E18A 3TQIA 1EFVA 2CFOA 2NZ2A 4G5FA 5HUHA 2ZUEA 3HFJA 5F23A 5K0TA 3CLRD 3N05A 4OUDB 2YWBA 2PZ8A 3RFFA 5FNZA 3N9IA 4J76A 3A04A 1QQTA 1I2DA 1T6YA 1WJGA 4MWEA 5HG0A 3X1JA 1ILEA 2A88A 2J4DA 1FFYA 1OD6A 1H3FA 2GOYA 3CLUD 5IHXA 3GUZA 4UZFA 4K03A 2OV4A 1YUMA 4H3SA 3FH0A 1KORA 2PG3A 3LCJA 4KPUA 3QE4A 3C8ZA 3RJZA 3KT6A 4MUEA 3HZRA 1VBKA 2DUMA 3RK0A 4XFJA 1JZSA 2OQ2A 2AG6A 3CLSC 3UOWA 1GTRA 3UC5A 2JAXA 5EKDA 5TEWA 4KR6A 2WSIA 1LW7A 3INNA 4RPIA 4MUKA 1QRTA 2J09A 1F4LA 1IQ0A 3SYTA 2B7LA 4EG5A 2QTMA 1KH2A 2CYAA 3LE8A 1PG2A 4HK4A 1KQNA 3FNRA 1KQOA 3COZA 4R2MA 5AHWA 3AG6A 4HJRA 2DLCX 1A8HA 3PRHA 2X1LA 3AL0C 2PZBA 1N78A 4ZT3A 1F7UA 1GZUA 1VLHA 4I6EA 1WQ4A 4I6GA 1NUUA 2IP1A 4QBTA 1R6TA 2AKEA 1VBMA 1XNHA 4ND6A 4ND7A 1MAWA 3VRHA 3HL4A 3TNJA 3N2YA 1JILA 1O5TA 2QJOA 3ISJA 4X0EA 1QU2A 1EUYA 3MLBA 1V8FA 1X8XA 2A84A 1OWOA 1KAQA 1NUSA 1TFUA 1YULA 1J21A 4PY2A 3IH5A 4JYZA 3ZJTA 1KH1A 2QTNA 2A1TS 4MWDA 5LFAA 2A7XA 3ZIUA 1HYBA 2CUZA 1QTQA 1ZUNA 2WQ6A 4R0NA 2QJFA 4ZCSA 4EF6A 3MMXA 1N2HA 2H2AA 1IFXA 4EG6A 4ZCRA 4GU5A 3H99A 5BNZA 4EG7A 3K32A 1MRZA 2YWCA 1N2OA 2D5BA 2X1MA 2V0CA 4Q16A 2J08A 5JBNA 4JXZA 3JXEA 2YXNA 1YUNA 1T9GR 4ZT4A 4MW0A 3P0IA 2NSYA 1KKUA 4EG8A 1U3DA 1B6TA 1J1UA 1MB9A 1F9AA 1WY5A 2RE8A 1K4KA 1D2RA 1IH8A 1EE1A 1O94D 4CQNA 3SP1A 4YBRA 2XRZA 1OWLA 3E27A 1JZQA 4U63A 2CYBA 1TEZA 1U3CA 1Y42X 3CR8A 2V0GA 3IOBA 3L93A 2E89A 2EL7A 2E21A 2TS1A 1NUQA 1PG0A 1U0BB 1N1DA 3ZGZA 1N75A 3IUEA 2O5RA 2DERA 2PZAA 1WQ3A 1XNGA 3CVWA 1VBNA 3KT8A 1NUTA 3FETA 4MW7A 5DEOA 3AKZA 1M8KA 2A1UB 1QJCA 3NV7A 4XSVA 2QUJA 1KQPA 5LLTA 1SURA 4MAFA 4DJAA 1M8JA 4S1OA 3DO8A 4KKVA 1O0CA 1XJQA 1NYLA 4YP5A 4DDMA 1WOYA 2GKSA 4PBTA 4E1AA 1M8PA 1MOPA 1R6XA 4ZCTA 1K97A 3P52A 1QU3A 5H16A 1QNFA 1QRUA 1JHDA 3CA8A 1YI8A 1GN8A 1KP3A 4ARCA 1Q77A 3TZEA 4DLPA 1V47A 4DDKA 3CLTC 5HUJA 1N3LA 4ZCQA 3CVYA 1IQUA 3CVUA 4MUIA 4JFAA 4DNXA 3KT3A 1O95C 4XFDA 3CLTD 3FI0A 2DEUA 3A05A 1N2EA 4MLPA 1RQGA 2VTBA 4MW5A 3TZLA 1O96B 2QUIA 3G5AA 1MC1A 1EFPB 1JEEA 3NBAA 4ZT6A 2CSXA 3COVA 1PFVA 1EUQA 3K9WA 4MW2A 3A4IA 3CLSD 1LI7A 4AQ7A 1WXEA 1G8FA 1M8GA 5TEVA 3ND7A 2RD2A 1OWPA 3H05A 1ULHA 2PXHA 5K0SA 3UY4A 1OWMA 5LM3A 1O97C 3SDBA 1PFUA 2QUHA 3A2KA 1GPMA 1LI5A 1T9GS 4NDAA 4QRDA 4MULA 4GRIA 4EG1A 3IDFA 1TYDE 3ZJVA 1JIIA 2D13A 1ZJWA 1J1ZA 3D6UA 2WB2A 5TGTA 3OTWA 2J07A 3UK2A 5KWVA 3D6VA 4MUFA 4KR9A 4G6ZA 3AFHA 1YIDA 5DB4A 1N2IA 1I6KA 1J09A 1O94C 4PBRA 2DR2A 2C5SA 2VXOA 1F7VA 4J75A 4MVWA 2JA2A 4ZCPA 2HGZA 5J5AA 2H29A 3PNYA 1P7PA 4CT0A 4MUGA 1MJHA 3SZ3A 3FHJA 4L2IA 4CDNA 3G59A 1J70A 2CV0A 1MBZA 2IJGX 2GM3A 2DETA 3GMIA 1QRSA 1Q15A 1MB2A 3RK1A 4BWVA 4AS1A 1WXFA 5DK4A 4JZYA 3QTBA 4F3RA 2E0IA 1Q19A 1IRXA 5TS2A 3TQOA 2Z09A 1NZJA 1EFPA 1VL2A 2HZ7A 4DDHA 1COZA 1XNJA 2X0KA 4EG4A 4OJMX 4MUHA 5DASA 1KP2A 4MWBA 3H9CA 2X3FA 4NAUA 3M5WA 1WXGA
chains in the Genus database with same CATH superfamily
4RK7A 3UFXA 1HEYA 4HQ0A 5CVDA 5FWYB 4CKZA 2DPGA 4W99A 4H31A 1KPSB 2YW9A 1YBHA 1B26A 4QUKA 4XYMA 3UPTA 3JQFA 4BO0A 1WV0A 2GF2A 1V9CA 3IV6A 4M8LA 3B1WA 1V3UA 2QRHA 4X1YA 2IXTA 3KVNA 3G2VA 5CDTA 2QQGA 3BFVA 1DAKA 1KZPA 3LHIA 1BAPA 1RI2A 3T1TA 3X1XA 2OOEA 3CK8A 4DI3A 2QPLA 3BJZA 3GZ4A 1GIAA 1NBOA 2XNKA 3FFXA 2WUEA 5MN6A 3KQMA 3MCWA 3EZLA 2IU6A 2GW1A 2BN4A 2FN9A 4HMQA 4HWOA 3OKPA 3LI2A 4E32A 1UJ6A 4FP7A 2WF8A 4XKCA 1KI4A 3D9KA 3HDHA 2IQCA 3BVPA 3FG9A 1JECA 4H0CA 4W6ZA 3X1KA 5L53A 3VJMA 1HA3A 1ZJ6A 2WQZA 5A7GA 4XFKA 1QS0A 4I17A 1E9FA 4FGSA 3ZIMA 3CC8A 3SMQA 5TMDA 2MJLA 2NSLA 1N6PA 3IE0A 1KOFA 3SK0A 4KLZA 1QBGA 1RXCA 2QVZX 2XJ4A 3GLTA 4M8SA 4TUYB 3ZHQA 4RTQA 2WMYA 2R7KA 5GZ1A 4C2AA 2B4RO 2EFJA 3PR1A 4OIMA 2OAQ1 1BE6A 2XTAA 4KBGA 2ZU6B 3JXIA 3WP0A 4DCTA 4C0BA 3TTWA 5CA0A 4F84A 1C80A 1ZNZA 5F2OA 5I3CA 1V3QE 3KQNA 3LT1A 5D2CA 1QOPB 4LRSB 5JHBA 1QWOA 2VDVE 4HWSA 4RPHA 5K4HA 1W19A 3AF1A 3GT0A 5C8ZA 4Z3OA 5D3MA 3TXNA 1Z2EA 4U8VD 5A6VA 1PSZA 5M7EA 1XPRA 5B4VA 1QC5B 3CLJA 4QRHA 1U4OA 2QROA 1X14A 1OT8A 4UCWA 1VYHA 1XYGA 3V7NA 3WWOA 2QTRA 3G02A 4N39A 1O6CA 3WNVA 1XEWX 1M1ZA 3Q9NA 5LYYA 1XJWA 3E4CA 4YJGB 5KOHB 5CVUA 2ES4A 5JJ6A 1QRDA 2YQZA 3VOBA 4D8YA 3HG7A 1WB9A 4KK3A 4DFDA 3DC7A 4JDUA 1XK6A 4UU7A 2Y0DA 2VNKA 1L7NA 2ZSUA 1GQQA 1OAOA 3G7SA 2JC3A 4OSEA 5REQA 1ZJYA 3D0RA 3WI7A 1K0UA 3THYB 2DF8A 4H7JA 2PL1A 3Q4AB 5DXJA 2CCKA 3SF8A 1OZGA 2BJHA 3BTOA 4E5SA 4KQMA 2HIHA 1HH8A 5C8YB 3NHLA 1UPCA 4S0ZA 3WOHA 1WZ2A 3T3OA 2HLDA 1FQOA 2FULA 4FFNA 4G5OA 3IV7A 4ZU6X 3WLQA 5DRTA 3BDIA 5KWEA 1FJXA 3O2QB 4L75A 2Q62A 2ZQZA 3MGGA 4OP1A 3F7MA 1K7EB 4NAVA 2D8MA 2Z2IA 4KP7A 3ZWKA 2NYVA 2PVSA 4YDSA 2X38A 3JQQA 4UPEA 3HVEB 2CVQA 4YR7A 1O97D 3NHKA 4WBNA 1U1CA 1X7WB 1LBSA 4LOAA 4FGLA 1K4YA 3X1WA 8GPBA 5DULA 4HAIA 3DNFA 4QEDA 1C4XA 1TQHA 3MCXA 2LWIA 4XGNA 4DOMA 2AG0A 3RRNA 2BFWA 2V4UA 1SUEA 1TEHA 6GPBA 1ZCAA 5IC4A 1H42A 3DPUA 3QQPA 4JCCA 1UMCA 4WNGA 1IZ7A 3GUVA 4N7MA 4UZEA 3R9XB 1HORA 5F2KA 1PL8A 1Y81A 4I8DA 1T35A 4KQEA 2B0JA 3MWFA 4IILA 4MROA 4D41A 1DEHA 1GPBA 2Z5LA 3UO8B 1MP0A 3IQDB 5KKAA 3UJ3X 1NR5A 3UK1A 4J2OA 3F78A 2X0DA 4I9NA 1E8DA 1TZJA 2JAOA 3R7LA 2HU8A 3GGDA 1GGJA 4MVCA 2BJWA 2IUYA 3B89A 4R6WA 4RK5A 4YLEA 1ZGCA 3BF8A 5DM0A 1BC5A 4M53A 4AMVA 5JATA 4MAMA 3SBEA 4FADA 4E4YA 2PUWA 4AY5A 4L2LA 1A9XA 4WN9A 3GT7A 3HI4A 3ZHSA 2B2CA 4BLVA 5B4UA 1TZMA 4JHJA 2JJ2A 2OBLA 3QPDA 5AXCA 1PUXA 5HFJA 3WIOA 1JEYB 3OKAA 1WP4A 2RHOA 3QU2A 2IS4A 3R0VA 3QXJA 2BI7A 4ZDWA 1UUFA 2XE6A 3OETA 1P1CA 4KWHA 4RQIA 4ZO4A 2QX9A 1SKMA 2WPNA 2EEZA 4BBZA 3ZE6A 5A4FS 1WAMA 2OFFA 2Q3LA 1C1HA 3K92A 4G07A 3UMRA 2JLSA 1SXJA 2A0WA 4EW6A 2WINI 1U8UA 3WFZA 1MIOA 4QKQA 1YA6A 4FUTA 5T3YA 3WHPA 1R0XA 4AJNA 4P3KA 1FSSA 3HEMA 3BG0B 3W8EA 3TEFA 2K2WA 4IUDS 5ARBA 2ZRNA 3N74A 1QQTA 2YVLA 1YFZA 2LNDA 4C88A 5JSZA 3D1LA 5C34B 1H6KA 4EENA 2C7VA 2AOUA 2NU8A 3BAZA 3DYBA 1W96A 1FFYA 5K8IA 2EQBA 3LLVA 2GXQA 5E7JA 1YA4A 4LOLA 4JKYA 5HFAA 2QMYA 1BWQA 3VZDA 4AQYB 1Y9DA 2EBFX 4I5GA 1PYOA 1V95A 2G77B 3CNHA 5FV4A 4V0OA 3MJEA 1UKCA 1W76A 2LTAA 4C0LA 5JQWA 3IUQA 4Q47A 3KQQA 4B7ZA 1QIIA 4AJHA 4LJRA 1J9ZA 1PWZA 1XLTA 4LHEA 4D3YA 4J3FA 1A9PA 1Q3TA 2YUIA 3AS4A 3IOMA 4V03A 5EPUA 4BEJA 2X58A 3OJCA 2R2LA 1CP2A 1FF9A 2DFTA 2ZRAA 1EYZA 3JV7A 1L5FA 3SS8A 1Y3CE 4XEUA 3EWSA 3WJ1A 4DDTA 3WNQA 4EB6A 1QX4A 3R3UA 1RMQA 2Q1YA 1U4NA 4RPIA 5EZQA 3ZHOA 4XJSA 5KDLA 5KOIA 5KKNB 1IXVA 3ZGOA 3T4XA 3A58B 4RESA 1BCRB 4H08A 3F49S 2Q1UA 2ZS7A 4WK0B 4R1MA 4BNHA 2ZAMA 2OVFA 1YB5A 1MQAA 4P0TA 3AKEA 2ZJFA 3H5TA 1H0KA 3T5CA 4I5FA 1P5FA 2GCIA 1B73A 1GVHA 4ITVA 3LT2A 2Y67A 4L07A 1HYQA 3L8EA 3L7YA 3TH5A 2EX4A 5JA4D 4OPMA 3HUFA 1MO3A 3Q40A 2QJRA 2G40A 2B83A 4GXQA 4TSFA 2R1ZA 3D6JA 3W1EA 3U7EB 4DJFC 2JB9A 1WKVA 4M1QA 1Z5OA 3NTVA 4QBTA 1GZ7A 1K06A 1HG1A 2RHDA 1P5RA 1VIMA 3U49A 3D4PA 1L7AA 2C2OA 1CQIA 1U9IA 4C2TA 4C7OA 1L5JA 1WG0A 1LPNA 3EFEA 4OA5A 2X5NA 1LUAA 2ET6A 2C7BA 2Q8QA 1UZNA 3ZCRA 1NYTA 3MTGA 3Q73A 1D8AA 1SVMA 2D0OB 5KAMA 1DXYA 4JPSA 1G20E 1VP9A 1T2FA 3JQ8B 4KGDA 4LZPA 5ERXA 5HF8A 3TCKA 4B83A 1XJ0A 4ZCMA 4E6PA 3L7CA 3KYBA 3B6IA 3AR5A 3ABIA 4QO8A 4C07A 2DWZA 5DM2A 2WAYA 4IVNA 4MARA 4X8LA 1TIKA 2EZ8A 1THZA 2FZ4A 1E7UA 2OZLB 3GRPA 1UBCA 1OGYA 2W6MA 1TT5B 1YE8A 3GFFA 2VBIA 5FEMA 5CA0B 1Y8ZA 3I4GA 4KEAA 4L1BA 1IDOA 1EAMA 2J6IA 2MMCA 3DM5A 4MWDA 4HSGA 4X90A 4XIGS 5J2UB 2ZRLA 2CUZA 4NPAA 4S1VA 5ALHA 5JCXA 2PHZA 4X6UA 4CT5A 5CB6A 2VSXE 3EIQA 3PIIA 4HFMA 2P6RA 4LJ5A 4OHVA 2GK3A 2HDWA 1HDZA 4YYZA 5KC9A 2BGTA 1X7ZA 5ADUS 5TPZA 3UHAA 3O21A 3DAPA 1ZEMA 2H9AA 5PNTA 3UGTA 3KXPA 4JITA 2XAAA 3MTDA 1P74A 2X8JA 4IEEA 1SVLA 3X2SA 1UXOA 3K71B 4JP2A 1J0XO 3REQB 3ZN3A 4R2XA 4R69A 3CVLA 1B0AA 1XRLA 3HXFA 5J43A 3CIAA 4YRNA 3DBRB 1MU0A 4I50F 1XU7A 1XMQB 4OAQA 3U4CA 1OV4A 4N4AA 1O94A 2LUOA 2MOKA 3LY8A 2HK9A 3DZCA 2I78A 4WDRA 2PM6A 2OO5A 3N7UA 3PREA 4G1TA 5G0VA 3PEYA 2W2LA 3LOPA 4HRVA 1GM5A 1PDVA 4MB6A 3QKRA 1HYEA 2WZQA 3C3YA 4C48B 1K4KA 2IXDA 2JS7A 3QKRB 4OP2A 4WKNA 2FZEA 1QV9A 3CR3A 4CQNA 1LDMA 3HKBA 4KO3S 1N6RA 2YINC 4YA6A 3WZLA 5FORA 2VXBA 4EK9A 4LF9B 2POQX 3CSFA 1P5HA 5ALIA 4PPQA 3MX3A 2P9HA 2Z1DA 3CONA 4WBNB 5AW5A 1IBKB 2CCGA 4C4XA 3E03A 2WHYA 1LB1B 3QYJA 4URFA 1NUQA 1Y8QB 4QATA 3HJNA 4UU0A 4UUPA 2CJPA 4J0CA 3PX7A 2GJSA 3T8MA 2B61A 3BSWA 4LEIA 5IEJA 2P9YA 5CFQA 1U5BB 3HRKA 1QRAA 2WA2A 2WTXA 3CUEF 3KYJB 2Y4NA 5ILOA 2X2EA 4JLWA 4AJKA 4F4DA 2O8DB 2H5EA 4CRWB 1N4SA 2FFQA 6YASA 4RPCA 1UKZA 1JTVA 2ZW9A 3BGSA 3U39A 1S02A 1XB2A 1M0SA 1R5NA 2BI8A 1X7DA 1HBJA 3KVYA 3VPSA 5CM9C 4CKEB 3MINA 5AM5A 3OUZA 4HL6A 5LLTA 3T1QA 5CDFA 4BRWA 4UFNA 1UXIA 5E6RB 5JBIA 3PUIA 4RSMA 3AFOA 3PCXA 1Y3FE 2XB8A 1BKDR 2GJKA 4OGKA 3NRBA 4NYJR 4Q3NA 5GQSA 4D5GA 2YOFA 2FFRA 5A4MS 1R6BX 1A9XB 2H4HA 1RZVA 3EMBA 2VPTA 4RWEA 1SWVA 4B3BA 3UMYA 4PBTA 1IBRA 2EG9A 4HXIA 4QUBA 4XUGB 1MEOA 4NCXA 2PYZA 1ISPA 2EC5A 5E76A 3Q6MA 1K3TA 1SAYA 4LXGA 1PCXA 3S2ZA 1I10A 4LF4B 5AQAA 3BXOA 1N4AA 4BNDB 4J8FA 1VP3A 4J2TA 3AQ4A 5D85A 2I87A 2ILTA 4WLVA 2KM4A 3CVUA 5C5IA 1SD2A 1XZGA 4MDEA 1MZPA 3B6MA 3GN1A 4TTRA 3AWDA 5I9MA 5IWAB 2WW8A 1XJ5A 3EC1A 2N75A 4ZXFA 3W8RA 3AVYA 3AEQA 3SZRA 1G5FA 1UDCA 3B8EA 2F3UA 4BLSA 3OI7A 2EFEB 2R17C 3BCUA 5GVRA 1AUPA 3L4JA 4B8CB 5ALDA 4KOEC 3TSYA 1VB5A 3QNKA 1ADGA 3D2CA 4KQ9A 2BMWA 1C1DA 3H3XA 2VWHA 1NXQA 2P9PG 5CYPA 5AICA 2ORWA 3IBTA 3OZEA 1QG6A 1XXHB 4X1IA 4F2HA 2X4GA 4OB8A 5A4KA 1X8LA 2IOQA 1OY1A 2EIXA 4UUAA 5H83A 4AQ7A 3QKSB 3BXEA 3PFGA 4H0FA 2B37A 5ILQA 2IY7A 4E30A 3B7TA 1AUQA 2F90A 1MTZA 3D3EA 1WKCA 3MCTA 4JXKA 1SVXA 2XCTB 4JXTA 2ONKA 4V3IA 1EI9A 3L8CA 2ZBUA 2FEXA 5EYPF 3MQFA 1PDOA 1IY8A 1F2DA 1SQMA 4HCJA 2YV5A 4UAGA 4ZU3A 3SDBA 4ETMA 2XUOA 4QOIA 2FF5A 3OH8A 1QR2A 2OQIA 1BPOA 1SBYA 2WIJA 3RTBA 4D8UA 1TJ3A 2XUZA 3OUTA 1UOHA 3ID6C 1GO2A 1SMKA 3AZQA 2C4WA 3IDFA 1MO4A 3T3DA 4FZ5A 4GUAA 3TOXA 4DAOA 3THOA 3R8XA 2GJAA 3UK2A 2JGDB 2VPZA 1IXZA 4YQFA 5KWVA 1UDWA 1YSCA 2PMBA 2J7PA 2DSTA 4EUSA 5IU6A 3B7PA 3I53A 3QWAA 2WXFA 2CB9A 2HA4A 2IYEA 2Q0XA 4V39A 1A8SA 1B6GA 4XD7D 4DVGA 4DC1A 1RIIA 3C6MA 3VVLA 3EAGA 2DR2A 3PCTA 3GDHA 3I83A 1LRJA 3B5IA 3OPYB 3RVKA 3E2IA 4Q00A 1G3QA 5EKXA 1OC4A 2DBYA 4OQEA 3E5RA 2H57A 4ZV4A 3URZA 1FFSA 1OFIA 1NE2A 4YCBA 4BQQA 1YZTA 1UEXC 2ZROA 4XGIA 1GWNA 3ASGA 3LSYA 2XMZA 3ZW9A 2J59A 4C78A 1V6SA 1AQLA 4JL0A 1V7CA 1JDNA 4UMVA 2LAHA 1MDBA 3AB3A 3ENVA 1Q0PA 2J3JA 4HAYA 5G2OA 2R8XA 3UATA 3DLPX 3AEUA 5DT2A 4DA4A 2JJ8A 1E3IA 1QF9A 4CG1A 3MKQB 3E15A 3ERCA 3OSZA 5K3FB 3WDLA 2PQMA 3A28A 3G8YA 3L0PA 5B3JC 5LLSA 3J80A 3STTA 2P0YA 3Q5GA 1COZA 1FNNA 3Q7EA 4IYJA 3WKCA 4CR8A 5L95A 2X0KA 1JHZA 4KIUA 4BVLA 4C3UA 4V0MA 3VFDA 4YJKA 1GG9A 3RT1A 4ENPA 2DY1A 2IPMA 5DZSA 3WL8A 1CJMA 2GTHA 4CMIB 4TUUA 2XQIA 3OLYA 5J4KA 5ELXA 1G9XA 4KIJA 3G2NA 1JJAA 1PQYA 1UAYA 3UWOA 1WXGA 3MJWA 2WWGA 2JBHA 1GLGA 3G1WA 3KQWA 3Q3IA 1KARA 3COYA 4IHKA 5BNTA 1DT3A 1BG6A 1RXIA 4O2BF 5D66A 1D4FA 4S1NA 5CP8A 5T5QA 5E2IA 5DISB 1RRCA 4XXHA 1VJDA 5BQXA 5E8JA 3TCNA 3V7WA 3BILA 1H1TA 3ACBA 3T1YB 3AVOA 3EZ7A 1Z82A 3IOEA 2MWMA 3DTVB 4FIZA 5JAHA 4I55F 1CR2A 2EKPA 4HYEA 5A9SA 1KQFA 1XL0A 3G2IA 3HWX1 1FPPA 1P0PA 2OBXA 3ZDFA 1O8BA 1TJ4A 1OC2A 3BSSA 3ND5A 1NATA 4RGVA 4MQMA 1Z2PX 1TCVA 2JGDA 5FRDA 3T0FA 3MSCA 4LBVA 4CGYA 2ZS9A 3KKKA 1VLZA 2JEYA 1COWD 3JD2A 4XJTA 1AVTA 1XTSA 2XX3A 3LC7O 2VAPA 4DSZA 1ECFA 1QUEA 1ZN2A 3PHLA 4RYLA 1RHMA 3DFKA 5EMHA 3VVBA 4C4SA 2NU7A 4MA5A 5JWHA 1B89A 3BL5A 3I72A 1JFRA 3ZZNA 4F60A 4TS4A 2OG1A 2Z57A 1ZL0A 2FMHA 4RG6A 2VP3A 1E2JA 2ZK7A 2XCQA 3IXMA 1D8DA 4FDUA 4MWCA 2FQWA 3VA7A 2AWNA 3OZWA 4F4IA 3AHDA 2E5FA 3C43A 1SO8A 4IQ4A 4BNNA 4BCCA 3ADCA 1O6ZA 2ZYDA 5HXAA 1T6XA 5CD1A 3O95A 4B6JA 4OGFA 3LUHA 1IHGA 4MUXA 2DKFA 2Z9DA 2X6JA 1P91A 5IYZA 4PTZA 2YBDA 2XUPA 3NAMA 1SUSA 2O7NA 3ZGXA 3R40A 1M10A 4RX1A 4JHKA 3ZE8A 4GIBA 1WSAA 2VKQA 5IP5A 2WPDD 3WQSB 3VSAA 4MIKA 5DNUA 4UNRA 5TMPA 1JEQA 1J8VA 4O3MA 4EY3A 1FFEA 2BI4A 2BFDB 2LRHA 5I7AA 3M3PA 1AUVA 1WUHS 4OAPA 3VPGA 1JWLA 4DRYA 1ARZA 3T5XA 2HK8A 4CM4A 3D8RA 4NARA 2PV7A 3UJ8A 4A10A 2HNAA 2R1TB 3QI7A 4PWZA 1IJKA 2O06A 1TADA 3EXEA 3GZJA 4PYJA 4NX2A 3OTQA 1UL1X 3IOCA 4RQAA 5TV2A 4FK8A 4M9XA 5F7OA 4YJGA 4QNNA 4TZ6A 3U4TA 1FTNA 1AKWA 3PWTA 1DBPA 2WIBA 1I4WA 3ULEG 3A2NA 3PDWA 4I4TB 5DBIA 3WWPA 4F9TA 5BRJA 5JANA 1DIBA 4AUEA 1Q0TA 2PL2A 1XHEA 1Y3BE 1Y8RB 2VJOA 3GBSA 1NSTA 2I7DA 3CH4B 3NANA 3SSMA 3TLMA 1ZLYA 1JAIA 1OFUX 1RLJA 2AW5A 3KSRA 3VXKA 1SEVA 1TF2A 2HK7A 3IXQA 4GMJA 4IGEA 3T9EA 5H7XA 4CTJA 4IRXA 4JDPA 3EDCA 3WQHA 2O8CA 3FWVA 3KQSA 3T5AA 4DLQA 2E4YA 1M83A 3QC1A 2LR0A 4GVLA 1US8A 4OKNA 2AN9A 4FDTA 5SY4A 1TF5A 4AN1A 3KKOA 1JUDA 2NSZA 2E37A 2UXCB 2CDCA 2M2IA 4U2BA 4YFVA 4D9IA 3TGPA 3ONDA 1I4TD 2AJCA 5FADA 5HE9A 1ZHHA 2I6SA 2HK6A 2PL9A 2Q5FA 3LHFA 4EGSA 2EL9A 4IDOA 2PKCA 5IXJA 3U3XA 1VRWA 4LXYA 1ZH0A 2EGHA 5KYGA 2HF8A 2J3HA 4NSNA 4EEZA 4KQGA 1G9SA 2VHZA 3ICWA 4JLOA 1YDEA 1UZLA 1NMYA 4FHDA 4RKFA 2CDNA 5K8TA 1RYYA 2ZWMA 5T64A 1MW8X 2ZDHA 4ILIA 5FTPA 2NX2A 2UYYA 3AY6A 3AR9A 3DPIA 2HMAA 2E87A 3LQQA 2G9RA 4MGIR 4KQKA 3T5VA 3T9BA 3U7RA 7ADHA 5KTPA 1E8NA 4J49A 1CRPA 1X7HA 3BJIC 4PVDA 4RXMA 4RLSA 3DE0X 4R2KA 1SGWA 5F3RA 4MJ7A 4ZOLA 4UM8B 2XMQA 2WNSA 2JH9A 3V4OA 1XDSA 2QP4A 3TDKA 1P8JA 1LWNA 1Z8HA 3COWA 5HDQA 4BOYA 3RVOA 2W0SA 5FLXA 5AK6A 1IWOA 3RUAA 1P3DA 2JZOA 1ECPA 4LVCA 4MRMA 4P9NA 5JDCC 1MVOA 2J9QA 4EABA 1IHOA 4AP9A 4EQZA 5FZQA 1G6HA 1GG2A 4FFVA 1KXJA 1XWIA 3NBUA 1OZ0A 1Y33E 4KXNA 4WY2A 1JG1A 3EHEA 3UMCA 4E2FA 4YX9A 3O0DA 4L3WA 4E3ZA 3G82C 2X15A 4LDAA 3AHIA 3CHOA 3R76A 3MT8A 5HI7A 2LXNA 4ON9A 4HORA 3D2BA 3ROEA 3OLVA 1WUTA 4E21A 1MT0A 1ZC4A 3WK4A 5EPOA 3D02A 1XTJA 4QOJA 3C3KA 3RC3A 3PFKA 3TRFA 2C5BA 3CHRA 2AMLA 2VYVD 4JUCA 3HVKA 4RO0A 3L0OA 3JQBC 4BRUA 3PDIB 1U5AA 1SPBS 2Y0BG 1C8LA 5C1BA 3B2EA 3K0EA 3TECE 1KZYC 3CW8X 4EDFA 1Q7EA 2QRMA 3C1AA 4GSYA 4CNBA 3DMNA 1NA3A 1A7KA 2BFEB 5LZ8A 3RFFA 4E70A 1AZLA 4M54A 1Z4LA 2GZSA 1PGPA 3CURA 4R8LA 3JQBA 2GAOA 2D59A 2JCVA 4IH4A 3KS2A 3MMPA 5SZKB 1COWA 4HI8A 3QWHA 1VDYA 2EF1A 1JMYA 1SD5A 5IANA 1UJ4A 4DUIA 1E9BA 3I6BA 4IJMA 3DSWA 3L17A 5HCIA 2JLAA 2XCLA 3UMFA 3K7EA 1SEPA 2JFPA 2AD5A 2DPXA 4QVKA 1FDUA 4C0KA 4J8PA 3QWFA 3E4DA 3P2EA 1EWRA 3M4YA 4KYIB 3W6OA 4F8EA 4I46A 2JLWA 3UXGA 1ELKA 2W2XA 3G2HA 1SRQA 1TL7C 3NYQA 4H7KA 4IGIA 4N0EA 4V3CA 3BUAA 1N0UA 2NO1A 2A14A 2E2WA 4EZIA 3OZFA 2P9SG 1NT4A 2ZYWX 3GN2A 3KVRA 2O1EA 4MNTA 4PO3X 4RMHA 3ENQA 5K3FA 1LQUA 4FBGA 5CHEE 3DP9A 5FOWA 3AJ8A 4FDLA 2AG6A 4DVJA 4ME6A 4JC5A 1U0GA 1A71A 2GPYA 1IN1A 4YV7A 2MYNA 5KEIA 1FFCA 4BUZA 2O3RA 1OTXA 3O4RA 2OD7A 2TSYB 3DBLA 5DLDA 1Z3XA 4D0SA 3ESKA 2B7LA 1CULC 2P9UG 4LRUA 5JD5A 2KBXA 2RGNC 4O4HB 3EW7A 4CI0B 2E4XA 3N3AC 4M7WA 2I6FA 1MO5A 3B2NA 1I2ZA 4L72A 4IG4A 5B36A 1JCSA 1HRKA 1A9SA 1TVCA 4QIHA 1L4NA 1J07A 1N3IA 1RHQA 2AV6A 2KMLA 1CUGA 2IYOA 2ROQA 1SVOA 3H86A 3PRHA 2PZBA 4B6FA 3P19A 1Z6TA 1DAHA 1YQUA 4LG6A 1OLXB 3OFNA 3PWZA 3EAQA 1QWSA 5K9ZA 3I73A 1K8RA 2AEEA 2EZUA 4IRUA 1VSBA 1YZVA 3FMPB 3ZFWA 3GLSA 2ZB3A 1J49A 4IFIA 3S5UA 5BWLA 2V6BA 4CLHA 4ZV7A 1WQ4A 4XUEA 3VR5H 4L6AA 4R40A 2IP1A 2O6LA 4BFRA 1L3BA 3U7IA 3VX3A 1B41A 2V6MA 3ANMA 4BVBA 4HAWA 4QFCA 4WLUA 1YNSA 3T38A 3VRHA 2H48A 3TNJA 2HXSA 5B7GA 2YHEA 1O5TA 3C39A 5DOVA 3CO5A 2AFHE 3TLBA 1EXWA 2HWYA 5DLPA 4NK4A 4EJFA 2Q29A 3ABLE 3B3AA 1R4NB 3BTUA 3QKSA 4KZKA 2NXCA 1PFKA 2HLDD 3C24A 1ZD1A 2A30A 4OAUC 1VYTA 4YDEA 1QHHA 3GCXA 3HEAA 4ANFA 3ZJTA 3LC1O 5EIBD 1Z63A 5LQJA 1NKSA 4N0PA 2CMDA 4HLLA 4HRYA 1ECLA 2RGUA 5LFAA 1Y4ZA 2JLZA 5KDDA 2P9BA 2DC1A 2JRCA 2VCHA 2DPHA 1LLUA 3NJ4A 5IKEA 3P5BA 4FQ7A 2F4VB 1EG7A 4H7DA 1KEVA 4EMTA 1QK5A 2EX0A 1B2LA 4DQLA 1HDGO 1BW9B 1X1DA 3JVVA 1L3CA 3ABKE 2FR0A 1XAIA 4X60A 3EQ9A 1JHVA 3OCZA 2O5CA 1GQYA 4PNZA 4MS3B 2LXMA 4E4RA 5HS6A 5F3WB 2OXFA 2X9VA 3CZ5A 1MX5A 3RVDA 4D81A 2X1MA 4YMSA 1GZVA 5JBNA 2OHHA 1TNZA 3TL3A 1RAGA 1SZAA 1BS9A 3FN4A 1PI3A 3TEJA 2NUTA 3F6EX 3WRXA 3W4IA 3BZBA 1Q6ZA 1TFRA 3DR5A 3NV9A 2F0YA 3FFLA 2WT8A 1BSVA 2P2YA 5ENVA 4OHRA 3RS5A 1R37A 3HVHA 4EQ6B 3UOAB 4ARAA 1LCIA 3HGTA 4O59O 1UZUA 5CW2A 3SQLA 3L04A 3APFA 4YAOA 5BN4A 3I3SR 5IPFA 2AC4A 4FI3F 3W77A 1VLMA 2WHEA 4LRZA 3UK6A 5K6RA 2FCAA 3MZLB 2X7JA 1UBHS 1RCTE 5CK4A 3K53A 3VAYA 4ZYLA 1XOIA 2J0SA 1JZQA 4N03A 1YBAA 3JYOA 5BPPA 1TT7A 4OA8A 3UA4A 1U3CA 3CCBA 5IJ0A 1GKIA 3H0KA 2X4LA 1M2VB 2J7KA 2HO1A 5G4KB 3KTAA 3HN7A 3LVFO 4XH9B 2CXOA 1AMUA 4AMGA 4E6HA 4KBFA 1CDEA 1MVLA 3K9LA 1E1LA 4YO8A 2CXTA 4JBGA 3ZGZA 1MZVA 3W2IA 2Y76A 1ABFA 1I9GA 1MENA 1Z08A 3DHEA 2G28A 4RMIA 3G2PA 2VGXB 3UM9A 2WD8A 2Y68A 3KT8A 4F3KA 3VSDA 4NZYA 4N5DA 4ANVA 4AAYA 3UINC 3DZDA 1AN9A 4CRWA 1YVRA 2X0IA 5EIWA 4IYPA 2GTPA 1RFLA 1DTWB 1MH1A 5AW6A 3L8ZA 5G04J 5IBRA 4F8JA 4GKAA 4IFTA 2OQVA 1E1QD 1GXSA 5I4IA 2D1QA 2O07A 3WMRA 4B3GA 6LDHA 1KKLA 3W6UA 1R2QA 3UXMA 4UEQA 3QLVA 3AJIA 4S12A 2Q9UA 2IXAA 4IQ8A 2I66A 2VDWA 3R6DA 3NS7A 1T3ZA 5D0QD 1F2UB 4BDTA 2PZEA 1TN7A 4QNRA 4BBJA 3WL4A 3Q7IA 1RJEA 2DLDA 5AQ7A 2HYDA 3LQ2A 3T9FA 4CE6A 2C2LA 4E5VA 5IDXA 1ES9A 1DWUA 3QU4A 2JGFA 1T5SA 1PQUA 4E1AA 4CMKA 1JIVA 1LK0A 1BKSB 3HR8A 3V1YA 1T43A 4YAUA 3DCJA 5DGHA 4RJLA 1DX4A 5EOVA 4JY7A 5I7EA 4KWCA 1DGQA 1EIWA 4FLHA 4Q7EA 1OTYA 1RQXA 1RWOA 3QLUA 4UXHA 3KQUA 2X3UA 2JHPA 1XTIA 4IRMA 2C2WA 5EYPB 4ASUA 1IDN1 3CX3A 1Q22A 4GGOA 5B12A 3BIXA 2FN3A 2GFIA 5MN5A 3P2OA 2H4YA 3WMGA 4DUGA 3H9EO 1YCHA 2CLEB 4KG7A 1RKUA 3P9ZA 3I9FA 1RRVA 4ND2A 3Q7AA 1NVMB 4N5NA 1SQ5A 5IMSA 3L1VA 4L5CA 5JZBA 3EIWA 1SUBA 2DX7A 3B20A 3FSJX 1JXQA 2PH1A 3TIFA 3TZLA 1W2WB 4GX0A 5D84A 2CUTA 4ZZIA 2HJRA 4HDQB 1ZU5A 1L7MA 1LV8A 2JW5A 2Y27A 3FWHA 4TYMA 3TTTA 4WGFA 5AKGA 1EX1A 5I9SA 2IC5A 2QW8A 1E1YA 2QAGA 3FSRA 4UTOA 1UPXA 1KJ8A 1SCUA 1NA5A 2PBFA 4MW2A 4LYJA 4J6IA 5JTTA 4DJJA 3GEBA 4Q4JA 1A88A 1BI7B 3ZBQA 1FTSA 3MWEA 4C1BA 2OWDA 3TWTA 2GNOA 2ZSEA 4K9SA 5ETJA 2P6PA 1UWKA 2CD7A 3K5IA 3A6KA 1NBHA 1TKAA 4JL6A 1KRHA 2V7VA 4UEKA 3O31A 5F7ZA 3GGPA 2AEMA 3TW8A 2A8YA 3EISA 4JL8A 5L45A 4MYCA 5JVDB 4PTLA 2Q0SA 2QPTA 3ES9A 4HUJA 4LJ8A 4WAUA 4CM7A 5E6RA 5BUCA 2NTJA 2X9NA 3OMWA 3NT5A 4FSHA 3TEMA 4ER0A 2LDBA 2RH4A 1SCQA 1AKNA 3B7GA 2WB2A 3KYIB 2AWIA 3CZ4A 3KYDA 4U7WA 4X1OA 2HEIA 2PKRA 2E6UX 2ZJYA 1CXZA 4FE7A 4I1SA 4PZUA 4TN5A 4Y0AA 4YAWA 4C7VA 4UARA 2GGFA 2GZ2A 2XBUA 2CXPA 3Q41A 1XUOA 4X24A 3T7IA 4BLOA 4Y1GA 2QN3A 2VZ0A 5E7QA 1IUPA 4D9HA 5F1YA 2GDZA 1EMDA 3GGSA 1RXSA 3JQFC 1SCBA 2P5YA 4LE2A 2C5SA 3QPWA 3H6GA 3DMYA 1A3CA 3HSYA 3WTBA 3AR6A 4O1HA 4WZ6A 1KGDA 1XZMA 3A4VA 1KS9A 2P6MA 2Q3CA 3IILA 3RS2A 4CG2A 2GKOA 3KYCA 2A57A 2W2OA 4LCEA 5CM2Z 5FX2A 3NTRA 5KVVA 1C3EA 1NF3A 4WEOA 3ONVA 3OTOB 1Y6FA 5EESA 2ZDGA 2BTQA 2AE2A 3GRAA 2VBFA 1AD2A 3GROA 4I2NA 3ESBA 4O4LA 3U3WA 5EHZA 3BRQA 5HQTA 2NTEA 2QLLA 1V9LA 2QD4A 2ILRA 3IHWA 1CUIA 2PWBA 3TIVA 4MEAA 1EM8A 3ZVKA 5FBVB 2E0IA 1TA0A 1Q19A 3DMGA 4OL9A 4YDQA 2CKMA 1MOQA 1SXPA 3RRUA 3T3MB 2E4AA 4ALKA 4YHBA 3CHPA 2ZE6A 1E0KA 3PVCA 2C77A 5ARCA 3IAUA 2E85A 4JD2G 1W85A 1U0JA 4MWBA 1XPOA 3ULKA 4NAUA 2V4HC 1QQ7A 4Z5XA 1LF0A 3GT4A 2DUUA 3AI2A 3FOBA 4UWLA 1JHAA 3NBZC 4A8JC 2C3OA 2ZM6B 1PSWA 3C1UA 3HYCA 2IEDA 4KRGA 5FFMA 5LDDC 3ADDA 3DGEC 3QHPA 2H5LA 1Y6ZA 4QJIA 3BJRA 4W7IA 5G55A 2JFWA 4Q9JA 1HSZA 1LTHR 1KMMA 3QG1A 2H1LA 3TTXA 4Z68A 1OKKA 3IAFA 5AQEA 4UI9J 4MDYA 4KH0A 1EGHA 3JQAA 2E7ZA 5FL3A 5BV0A 1DAGA 2R6ZA 3I52A 3V2GA 1T8UA 1U2PA 3HB5X 1KFJB 4V3BA 4LC9A 1T0BA 2WKQA 1XZLA 3EEQA 3O92A 4JB0A 4JLDA 4U39A 3ZQKA 4BMNA 2J3IA 5K51A 3HE3A 3FTCA 3PUWA 4UQOA 5JVDF 1TNBA 1N2JA 4X7RA 2R5WA 1WXWA 3ILXA 5GWXA 3WA6A 4DA9A 3GLFA 3G0BA 4BN4A 3QXCA 3ET5A 2OCCE 3BXZA 4AECA 1K92A 2I6QA 4CPDA 4JA2A 4LYGA 5JFGA 4D0LB 4D43A 5BSEA 4R1NA 1KE2A 3V80A 5LMNB 1K08A 1JFTA 4H7HA 1VGRA 5JMWA 3HDJA 4QQNA 2XKAA 5E4TA 1EZ4A 3MS2A 2Q4DA 1STOA 4OAVB 3ON5A 4JJ4A 5L3QA 4QDZA 1H3EA 3CV3A 4IIXA 1F38A 3H1TA 4JB8A 4MCHA 4ID9A 4LHSA 4XWAA 1Y4DE 3U4IA 3PXUA 1GLNA 4BNIA 2YY5A 2W4QA 3AQIA 2WM9B 4KMSA 5GJVC 4EHHA 4Q6BA 3KT0A 5F7JA 1EM8B 1NVAA 3MKQA 2G5PA 4N7BA 4DR1B 2YWDA 1XD8A 1ZM7A 3HXEA 3NJ8A 5EE0A 3E70C 3M4JA 4KV9A 1EU1A 1DIAA 3J5PA 2YHIA 1QIMA 3FZQA 4RCYA 1FRZA 5B2ZA 1NP7A 1OT5A 3K1TA 1CUBA 3QNWA 4L0QA 4JQZA 1QTIA 2F62A 4XI0A 5CFZA 5LQCA 1CDOA 5CBPB 1VIAA 5LX8A 3IHYA 3NZSA 1Z0DA 2IZ7A 4L27A 3RBXA 5BY2A 1JG6A 1XRQA 5KTNA 1GCOA 1Z22A 1VPDA 2Y1OA 4K6CA 1XRPA 4DR5B 3HTXA 3EBOA 5AI6A 1WIWA 2X40A 3ZGLA 2PBRA 3RHSA 4UQPA 5HOEA 4MQEA 3FHEA 3GX1A 1KDTA 1YB7A 3DKVA 2HX1A 3H19A 4PGMA 3SZGA 2UKDA 3HGQA 2QRQA 3HPRA 3B38A 1IZ8A 4J1TA 3QVVA 4CGWA 4RD4A 3RVNA 1U0SY 2BWJA 3G2UA 4OGGA 3IR7A 4FNOA 4YPVA 2QT1A 4XAQA 1SXJE 2VRCD 4YHHB 1ABEA 2OFOA 2H5JA 2G83A 1NR1A 1YU9A 4C0EA 5L7WA 2UY1A 4CMEC 3LM8A 2LNIA 4IDNA 2XQ0A 1M54A 4JI0B 1Z8DA 3OPQA 4D6PA 4OUDA 2JI7A 3A6PC 1BXZA 3DQPA 3M9WA 4EJSA 4NCBA 1PD1A 4KGXA 5BR8B 3WDMA 2B78A 3F90A 4C3ZA 1C7JA 1D8TA 1DDOA 1DEKA 2C3UA 2VBGA 3BXFA 3FSGA 1A0OA 1T4GA 5JJCA 1V96A 3TL2A 1OREA 1GZ5A 3TLZA 4S04A 1I7SB 3JYNA 3QEJA 4WXYB 1HDYA 3IALA 2IQIA 3P0HA 4H4DA 5EVCA 4RVUA 2JFOA 5HCUA 5J4VA 1M74A 4JLUA 4ZT5A 4S05A 2G80A 3G2QA 3KR1A 1Z0SA 3EVTA 2ZUBA 4HQRA 4R1QA 3RIXA 5FP0A 4ZVPA 3AV3A 2P2SA 1O2DA 2PUGA 5L3SA 3U64A 2CXQA 4CCSA 2B8WA 1YZNA 5T41A 2XMRA 1YRWA 3V7FA 4MUMA 4AMYA 4ETWA 5DNDA 5EHGA 4PHGA 5G4LA 4UJ3A 1GR1A 2FPWA 5BOSB 5JHHB 3BZWA 1SIOA 5HKOA 2KYRA 1U65A 4OHUA 3HVIA 2XF8A 4G56A 4OSOA 3QBJA 3K2EA 3T61A 5KJFA 1NG9A 2C7OA 1JPVA 3R4CA 4MINA 1VFPA 2G4CA 4OREX 4JLPA 6ABPA 1ML4A 2PSHA 1V2GA 4G0NA 1IG0A 4PR3A 4R2HA 2O54A 2ODNA 2V03A 4N5HX 3V34A 4K9PA 4RIGA 2WWHA 3DFZA 4MW6A 3RTEA 2BRUA 1WZUA 2ZYIA 3JAKB 3DOFA 4FX5A 1R88A 3AUTA 4DPLA 2EKDA 5K8CA 3VH4A 4V0RA 3PZ2A 1W4AA 2MSWA 3I4FA 2F64A 1DWOA 1O7JA 4Q82A 1PNVA 3EIHA 4EI7A 4YALA 4F6LA 2Z5VA 2IIQA 5IK2A 2I6GA 2B5OA 2FEPA 1CB7A 3FUUA 1FFAA 3IKJA 4RF4A 4FB4A 1XZ8A 4TKLA 4A6DA 5JNUA 3ZGQA 2DBAA 2P9EA 1Z5UA 4PF1A 5FUYA 1FYEA 1SUIA 2GM9A 5AO9A 2I1KA 5G2NA 3PGLA 5CDHA 1D0VA 1ZHOA 4Z53A 3N05A 1S5PA 5CA0F 2C4UA 4JBXA 4BPRA 1W3BA 2VH2A 1DKUA 3DMHA 4PLHA 3ZNGA 4HN2A 4ZRNA 3SI7A 1IHXA 3AF5A 3LCCA 4EDHA 2VNIA 2GVZC 4X6YA 1KRXA 1TVMA 3UUGA 1U90A 5HZGA 1Y89A 3ZHVA 3GVHA 1A9OA 3F7NA 3RYHA 4DTIA 3EWAA 4YNBA 5K6TA 2X41A 5I48A 3LLCA 3QNUA 3AYZB 5A6SB 2I4OA 3HCCA 4L15A 4H1WA 2PSEA 3VUFA 4MBGA 3E9RA 3X3HA 5ALUA 1SOMA 2ZWPA 3SF4A 2DYSE 2Y1DA 1K6JA 3A6ZA 1XTZA 3L1HA 4LC1A 4PC2A 3JYSA 1KDVA 1MRSA 1YUMA 1Q5PA 2X9GA 4MV6A 2G08A 4F86A 1VKRA 2VJNA 1E6UA 1XDBA 3EYWA 5G0TA 5JEEA 3KPUA 1AKYA 4DA6A 2BM0A 4IXMA 3BCSA 2AW6A 3ZKWA 4NH4A 5JPDA 1G8JA 4H0NA 4KO4S 4V1CI 3N7TA 3H6HA 3BORA 2ZJ1A 1EKXA 4PZYA 421PA 1T4CB 5BQFA 2XE7A 4TS3A 2DQSA 2Z5FA 2AR9A 3FULA 4HAUA 4OATA 3UENA 5ICEA 3HUDA 2PT6A 3S2SA 5DWDA 4NBUA 4WXRA 1PLJA 2WP8J 1GPAA 4F4JA 1OX4B 1ZW1A 2B3DA 4GLLA 1YJCA 5FUXA 3V1NA 5KSPA 2VP4A 2VTEA 2WICA 4W1RA 1DC7A 1KH2A 3LE8A 4IXTA 4XLTA 1GT6A 1CPYA 2RK4A 1K5HA 4HK4A 1LK7A 4U2EA 4OYSA 1MG5A 3M6UA 4S2EA 5H02A 5BV7A 3HJRA 2EHJA 3IAHA 3WGYA 1M72A 4B3TB 3HHEA 3EEYA 5B6IA 5LP6B 1NLMA 3PQEA 3M6WA 4DJTA 4DLTA 3R75A 1TJ5A 4YPFA 2CW5A 3ZK9A 5KU1A 3ONWA 1WX1A 2VAMA 1N78A 4BHTA 1Y9ZA 5FIUA 3WMEA 5A3QA 3T7DA 1ZUIA 5JCPA 1VC2A 4AIFA 1E6WA 2Q9CA 2ZU0C 4WH0A 2HMVA 2R4QA 4RSYA 3LMKA 1JN0A 1TDJA 3H8VA 4A26A 2MT9A 2CK3A 1G16A 1HH4A 4BEBA 2QX6A 5TT0A 3VV3A 2GGSA 1VIVA 1CU1A 2RAUA 4C6HA 5EXTA 3O3CA 1TOAA 5ALLA 2GFQA 2IHKA 2V58A 3N2YA 1SC4A 1G66A 3BWVA 3GP5A 4XI9A 4WCFB 5GONA 1EFDN 5BXOA 3RADC 1FU4A 5C52B 3ISJA 1MJ5A 4HQFA 1N6OA 1NZDA 2EFCB 5AVWA 1ZR4A 1RZRA 4PPGA 1AT1A 1AQIA 4HDNA 3RRNB 3K35A 5AJXA 1Z2DA 2Q8PA 4JT8A 3PGXA 5D6OA 3PQ2A 1ULTA 1QVAA 3KETA 5L4NA 2AOTB 1LLFA 1N0VC 4KOAA 2QQFA 2YFYA 4PS1A 2PMEA 1Y3AA 3I9NA 2XEHA 3AH8A 1POWA 3ZIUA 1FVOA 3H5WA 3BREA 1AXRA 1V16A 2PJDA 3AF2A 1VDMA 4MITA 2QJFA 1P7CA 5G1OA 1P2GA 4DMHA 2KATA 3VTYA 3NUZA 4UBKA 1AP7A 2VOJA 3FCEA 3S1SA 1IFXA 2BVNA 1Y5LA 3KB6A 4I5DA 2IYRA 1F6BA 3H8WA 4FMCB 4DCJA 2C88A 2FPPA 2ZRMA 2F2TA 5EWLB 4KN9S 4CMEA 1S3FA 3LF2A 4J7XA 1ODFA 3SQMA 3F6CA 2V0CA 3NDPA 4GTQA 4Q16A 3T5PA 5J23A 5KNBA 3QJYA 1FT1A 1GPNA 4K6OA 4CL0A 5E2AA 1JV2B 3K9IA 2H1OA 2YCLA 3L6CA 1LU9A 3S8YA 4ZTZB 2Y4UA 2O3JA 1Z83A 1Z35A 1BXGB 1ZMBA 2AX4A 3K8YA 2X19A 4FUQA 4B0PA 2WV9A 4BLRA 1RRGA 4DG8A 2FR8A 5KNDD 1N7HA 4EHMA 2VSXA 2F3SA 1TPYA 1U9CA 4MKRA 3U3JA 3GEDA 4Y2VA 1N2CA 5THQA 1K7XB 2Q1WA 5TGZA 5IRCD 4PIMA 4NEHB 4ZDIA 4ESVA 1KEPA 3KPVA 1P1HA 2JJQA 3KTFA 2WQHA 1Z33A 1GTG1 3HWRA 3PHHA 5D1HA 3SP1A 2EKLA 4V24A 4B3XA 4EELA 3AERB 2C59A 1GGNA 2GILA 3M3DA 5B2FA 3EU5A 4QWMA 1KOLA 2IOLA 4QOEA 4YQZA 4HDRA 2AC7A 4C4AA 3LECA 3V8QA 3J5QB 3UI2A 4RY0A 2Y3IA 1R0LA 5LBUA 4HMPA 2EJVA 3L93A 1QQEA 4S0XA 3ZCPA 3H1GA 5C51B 1XXHA 4KV7A 2F1JA 3GR6A 3RT9A 3TRKA 1YGPA 1D2EA 3GEPA 2P9JA 3T7KA 4UC0A 3R0JA 4ZVRA 3GZTB 2UV8A 2DE0X 4NMHA 2AF3C 2O3TA 4ZK2A 2HNBA 4DMCA 1M6HA 1FJHA 3GNQA 2RKBA 1RTKA 3L5OA 3QOUA 2C1EA 2YJ6A 4ZVTA 1TTQB 1N6NA 1H0RA 3UJ7A 4GW3A 2IEGA 2LE0A 4J07A 4RHFA 2ZIXA 3AT1A 4WT7A 5FBLB 2VT2A 1XAGA 2CJYA 2X4DA 4Z4HA 4PS7A 2GZMA 4HD8A 4KTVE 1RYEA 4PUCA 3IUNA 3PT5A 5TB5A 2IPXA 1YR9A 4PGFA 1JEAA 3TWQA 1ZBDA 3LAWA 4M87A 4UNPA 1A7AA 4Q6WA 1QAQA 3TCXB 1E5DA 3ESQA 2HY7A 2V97A 5DHSA 5FQNA 1JX6A 4FBMA 4NPHA 1C41A 1PQPA 2FPGA 3QITA 3HXKA 3FOEC 3VKFA 2YINA 2P8SA 3VSEA 1CV2A 2ZB7A 3C3RA 4U07A 2I34A 3QVWA 5AH0A 4DIEA 1H2UA 4CGZA 5GY7A 1XN1A 4OHOA 3O91A 4AZTA 3FR7A 2J1LA 3Q3VA 3OFJA 2OUKA 4M6WA 1LV7A 3LA8A 1CS0B 3TZEA 4FOLA 4KO1S 4LSGA 4AJOA 4CTOA 3OAAA 4ZJUA 3WQRA 3A9WA 1N3LA 1QHGA 3LV8A 3HZOA 3TQHA 2Q5CA 4LY6A 3TZCA 3WISA 1H4SA 4AKGA 5HF9A 2QBYA 4DREA 3K2IA 1EE9A 4XDGA 1JR6A 3UHPA 1MXFA 3AG1E 3AU8A 4UE2A 2XUDA 1VJ0A 1D0SA 3EN0A 1GW6A 5DNEA 5F4BA 1HXHA 3DJFA 2WYWA 3M1YA 4RBNA 4DCUA 3GJ8A 1Y5NA 4EM6A 2C7RA 3OQIA 3S2YA 3W2HA 1D03A 3NHYA 3NHSA 3B60A 3ZWNA 4ILGA 2OBYA 1PVDA 2NGRA 4UUMA 4MYRA 1E89A 1NVGA 1TO2E 4OAOA 2H6EA 2I9PA 1EJBA 1LBHA 3ICPA 4YP0A 4C6TA 4IPTA 4B2IA 1OI3A 1I0LA 3E7PA 3PC8C 2QMOA 1L5QA 3ZIDA 3KKMA 3Q1KA 2NTYC 5AKEA 4CM6A 4DN6A 5B7PA 4RKRA 2CNBA 4FOOA 2O8EA 5FPHA 4EHDA 1GZ4A 1S7GA 1XZAA 3TMAA 4UEWA 3Q7PA 4MJXA 3WJAA 1Y3HA 1DPGA 1D7AA 2YIMA 2OUIA 1BDHA 2Z2JA 2X0NA 2HRZA 3RIYA 3KUXA 2GDJA 3LNTA 4XGKA 4B47A 3BRCA 1XU9A 2QTGA 3KQVA 3O8NA 2GKGA 3EZYA 3JQ7B 4Q4LA 2Q7DA 3PZBA 1LI5A 1UT5A 2ZZKA 1HS6A 1Z6YA 5CLIA 4MR9A 3TJZA 5CA1F 5HKKD 4BXOB 3OAWA 2FO7A 1YHYA 2VSOE 3GW4A 1GAJA 1RYNA 3CPHA 5E2BA 2I4LA 2DY0A 2WDPA 2R87A 3DXZA 3I5XA 4KHZA 4UDOA 4MB2A 3FVTA 3DW1X 1KPHA 3QUQA 2IONA 1BNCA 3RREA 3QZUA 1SHKA 2FEOA 4LN1A 3A26A 2WB4A 4ZVUA 1Y8CA 1Z9BA 2RIRA 3QLEA 4YLGA 5C7IO 5DM70 3TMYA 1CQZA 1P2TA 3IB6A 3EF3A 1YKGA 4IDBA 3EB9A 4Y9RA 2O5EA 3PNSA 4BQRA 2AUMA 3ZVNA 2A0YA 5AAOA 1KYWA 1K63A 2PY6A 4X00A 2NU8B 4JI1B 3ZXYA 2W6QA 3AFIA 4E85A 1DRWA 2VF7A 3VPHA 1KOGA 4MUGA 4UQZA 5JS7A 4GZCA 2LIVA 4XX5A 3P26A 3BH7A 4KQXA 1AB5A 1HDCA 4UKDA 1F20A 1RTTA 3K0FB 1ISJA 3KXLA 1U8EA 3TDMA 1JI3A 2PK3A 2IYXA 1E8YA 1CE8B 1AA6A 5EL0A 2QN9A 1P29A 3AFNA 3EGOA 2JBAA 4LJSA 4HG2A 4ZQCB 1K8ZB 2I6XA 3FWZA 1SBQA 1E69A 1T1RA 4K3VA 2CUKA 3RJTA 1RZUA 4RVFA 4IOMA 1DJLA 1HT0A 3OZRA 3TQOA 1R10A 3E1KA 5JNRA 3BULA 5JC8A 2RSLA 4BNJA 1I30A 2OAEA 5D2MC 3NUGA 5ALNA 3OU2A 4WLOA 4YRQA 3U5TA 2SKDA 3WIVA 2EJBA 5JJTA 2DYRE 1N5RA 3PGJA 4GH5A 3E9YA 3DXMG 4LZAA 5BW6B 1V8ZA 3TKAA 4DIOA 5C46F 5KSYA 3CT6A 2OKCA 5ELLA 4BESA 1ZUWA 1PNQA 4BGEA 1XLTC 4EHIA 3FTQA 2VWPA 3NXKA 3RUHA 3A0UA 1NN3A 2IUFA 4AP5A 5IH7A 4GECA 2ONYA 5ECGC 3KK0A 4J16A 2WR8A 4XYLA 2DT5A 4QWWA 3I6YA 4WW0A 1OIWA 5JY6A 3TRHA 1DAEA 3D0KA 5FOTA 1PK9A 2RGYA 4WOJA 4AO7A 2XMDA 2I9KA 2IHYA 4ETNA 5AVVA 4WECA 4BMXA 1OAKA 1QFMA 5AI5A 4EMUA 1E0AA 3E6AA 1A2QA 5KYXB 1H4QA 4B3JA 2HT1A 2JAHA 4Z4FA 4E13A 2C03A 5YASA 2ODQA 1UK9A 3FTVA 3LSTA 4TLAA 1I8TA 2QYSA 3BBLA 3UWKA 4RY9A 1OFTA 4CQMA 4HLEA 3ZNQA 2EJWA 2NVWA 4Z7JA 1NOJA 1U81A 5G02A 4Z4IA 1ZSVA 5BWBA 3CIOA 4LCTA 1OPXA 4OHZA 1LF8A 1UKVY 3ASOE 2NW6A 3PICA 4IY1A 4KUHA 3S8EA 2RAFA 3ISTA 3WLSA 4R1PA 4CKCA 2G4LA 2UVPB 3GFBA 3NHWA 2F8TA 1XSEA 3R3YA 2E48A 1NW9B 4BQIA 3G9TA 1BX0A 3G5UA 4E2YA 3RVBA 1E9RA 2L0XA 2KB0A 1K88A 3MERA 3AUXA 1AMOA 3JXJA 2VDQB 2QRVB 1X80B 1YS7A 1QLHA 5ALRA 3CVXA 2IEAA 2W83A 2HSWA 4KPUB 5FI5A 4DPKA 2AMJA 5D3ZA 3AM5A 3IS3A 1T6ZA 3DT8A 3KOZA 4I08A 5C0OE 3A7DA 3TUJC 4D9FA 1K6EA 4EL5A 1CYEA 2XKBA 2PN1A 1P1JA 1RCFA 2W9XA 4BAUA 5LD2C 1ZK3A 3WDKA 1YU6A 1NI1A 3U9LA 2H1SA 1VI6A 2J0UB 1PR3A 2AI1A 5A4IS 5LQKA 2VP6A 3LF1A 3FTFA 1V0JA 3HGMA 1NZNA 1YYHA 5KJMA 1U02A 1WR8A 2VDMB 3E2PA 5FO0A 3T4UA 2EDCA 1GYRA 2IH5A 3TBKA 1E9VA 1SCUB 2KS6A 2QTLA 4IOJA 4EBBA 2I71A 5JECA 1LPBB 1KXZA 4I6JA 2YXBA 3B3QA 1YJ5A 2AYXA 4YDYA 4MZXA 4ND8A 5IKPA 4QELA 5IFLA 5AM4A 2RARA 4CLOA 1GNLA 3CJTA 4GTRA 5DHTA 2LUHA 5FJJA 1XVAA 2GBPA 3PUVA 5ENPD 3A11A 1E1RD 2FOXA 5LP6A 1YCGA 3IP5A 4MJLA 4WFQA 2Q3JA 4NCHA 2UZ0A 4U0JA 4Y30A 3WXBA 1V2HE 2O50A 4P58A 1NSFA 1XYYA 1XGWA 4RD1A 4OFXA 4D99A 4HZUA 1J00A 4WUTA 3SC2B 2W37A 3KBBA 4ZIRA 4MTLA 4MRUA 1UIMA 2F8XK 1QP8A 2ZRQA 3ECCA 4QPPA 2BUAA 5FPTA 4D7AA 1AHHA 2OCYC 1Y4SA 4QXAA 4R1UA 3C1TA 4EZKA 4CQJA 1Y1TA 3F6RA 5CRUA 3SFYA 3TXAA 3C45A 1T0PA 3TLGA 3ZWBA 1PJ3A 1L7PA 5J5CA 5LDGA 3LWBA 5HM6A 3FNBA 4EY5A 1A1VA 1G8HA 4HWPA 5KQSA 3PQ5A 1QS0B 1SQSA 2VRBA 5AJLA 3LPZA 2ZWIA 3CWZA 4GBMA 5DBFA 1KYZA 1NVFA 1ND6A 3U3KA 2Z08A 4EO7A 4UM9D 2ZJBA 1BRTA 3MJTA 2JHAA 4WPGA 3ZJYA 5F98A 4TKZA 1PUIA 1LH0A 3C3MA 2P91A 2YV1A 3ITEA 3RVQA 2W8BB 4F3NA 2IH4A 3EAFA 3JRNA 3ZXSA 4RS4A 4WXEA 5CD9A 3TW0A 3VU9A 1LTXA 3KLOA 3GPCA 2DFVA 3QFHA 5AXDA 1L4HA 3FUJA 1NUPA 3WYGA 3H2IA 3ZJ5A 1E4OA 5IDQA 1AUXA 3ZYMA 1QV7A 4TTVA 2WQ7A 2MYOA 3PQDA 3ABOB 4ZPXA 2O0HA 3N2LA 5CT6A 3APDA 2VFAA 2KCLA 3BD9A 3EFHA 1G8GA 1Z34A 3T7AA 4AYWA 5J1SB 1OFGA 5CBPA 3VPBA 1NI5A 4L0MA 1OAAA 1U3GA 2PEZA 4GC5A 3BE6A 5AJVB 2RG8A 2G71A 2PS3A 5FOUA 4X64B 1M0EA 2YYAA 4Y9DA 4F71A 5IVHA 2A9VA 2OO7A 1F8YA 2EWMA 2PZGA 3LW7A 2ZAYA 4QDOA 5TF4A 2Z2KA 2C97A 4IWXA 2NPFA 3RD5A 1JDUA 1FZTA 2EV9A 2ZSFA 1GPKA 4JKOA 4BE7B 3THYA 2HTEA 1JWGA 2CFZA 1M8FA 3GEHA 4L85A 4KCGA 1FFBA 4NZPA 5LZ5A 3ETHA 1U11A 1NFRA 5KNCA 1WMDA 3AS8A 2IIPA 3WWZA 4Q19A 4J0UA 4A8TA 4MVXA 3ZHUA 5EX0A 3IKTA 1CEYA 4BN0A 1BJTA 4LIPD 5KDOA 2HSGA 4M7CA 4HDOB 4LBZA 5DYYA 1EFVA 4L9RA 3MRVA 4FTWA 4YS6A 3EXG1 3LVQE 2FFBA 3A3OA 1NVXQ 1YJAA 3D8HA 3E5MA 4KN8A 4EI9A 5F23A 3BUSA 1V8BA 5E95A 3L7MA 3AERA 2VHEA 4OUDB 4QUEA 3O83A 1LPOA 2B1RA 2O7VA 3PENA 1W4BA 2W22A 4O2AF 4RGYA 2PGOA 3HFSA 5MFPA 5E4FA 2IF2A 3ZYQA 1WJGA 4P7KA 1A9ZA 1PEYA 1SC6A 2KQUA 2DQZA 2P8JA 4FM9A 2AEJA 1V8OA 3K5HA 4DANA 4OH7A 3FEYA 2ZQYA 3I64A 1Q0ZA 3NVAA 3VR4D 4ARZA 3U7GA 3CQGB 3FKSA 3L7DA 3LCAA 1RAAA 2QIPA 5DBOA 4FU3A 1B3BA 1E98A 3U7QA 4YPOA 3RO7A 1Y1KE 4P93A 4XWYA 4HYQA 4CEHB 3FUTA 2XOEA 3E9ZA 1NVKA 3DDOA 1I1HA 2QTHA 4L1KA 5T7BA 5ENRD 1VJRA 5JDIC 4EB3A 2MIIA 1E1CA 2ZBDA 3L6UA 2UXBB 5KYUA 4JN6B 5KVQA 5KNCH 1VBKA 2FZVA 3GMSA 3PF9A 5JE8A 4P1ZA 2OQ2A 1TUBA 5DHRA 4Q02A 3EHDA 1IN8A 1SVWA 1XTQA 1SOWA 5HF5A 4L78A 5BR1A 1HX8A 5TEWA 3E1GA 3GO4A 3NUQA 2WSIA 3PRKE 2QQEA 4IL5A 1DBRA 4HQKA 1QYDA 2HJHA 4E12A 4NNJA 3TLJA 4G23A 1GNSA 4GOKA 4JBHA 5A04A 1MFZA 2YN4A 1U1IA 3AL3A 3ADKA 2PZFA 4BLTA 1E3WB 2XDWA 3JYPA 5CFPA 2JAPA 4I1IA 3MIIA 1RQLA 3PKZA 1PP4A 2HA5A 1GU0A 4D02A 4GPKA 4LDRA 3FP3A 4CM1A 1A8HA 4M0LA 2Q3HA 2X1LA 5CMLA 1CEXA 2F00A 3EQ7A 3WGVA 4G5XA 1P2FA 2QLJA 3L0SA 4US0R 3PC8A 1YB2A 4IRUB 3WB1A 5JWOA 4WOBA 5AM2A 4A6EA 2WWYA 4NR0A 2PS9A 3KZCA 4EHKA 4FCCA 3C5EA 3JS5A 5AVKA 3EA0A 4TV9B 2GF0A 5LB2A 1Q21A 4KITB 4QPCA 5DNYB 4P38A 4NMLA 2XOXA 4PXAA 4Z0HO 1TAUA 3H84A 1L5KA 2OK7A 2P2NA 2UZIR 1NUAA 3DV0A 1QP4A 2IOFA 2Y66A 3DO5A 4KVZA 2RIPA 4Y6SA 1QYMA 3BYZA 1DAMA 1KI9A 3N76A 3CRVA 2OCLA 4Q4HB 2CEAA 2QJOA 2ZSHA 3R3SA 3MT7A 4F3YA 4K5BA 1A4XA 2YR0A 221PA 2BFFA 2P79A 3HNOA 1S8AA 1UANA 2Q6IA 4UQYA 2IODA 1GKKA 3QH4A 3V7UA 3K30A 1LWOA 4P4SB 1LZKA 1E5QA 1S8OA 3GLUA 1W1WA 3DAYA 3MC1A 3ESYA 4C4YA 3W9GA 4OF4A 5DU2A 4WLEA 4KXKB 2PX2A 4A0RA 2QXYA 3GEMA 4WE3A 2ZJ4A 3R9MA 4JYZA 1CZRA 4HLDA 4FWTA 3OTGA 5DHUA 4TUYF 5F3DA 1TEVA 4J3NA 2RONA 4ECEA 5AIJA 4OJNA 2NTNA 3DPYA 4G01B 1LBEA 1LVUA 4P81A 3MQ2A 5CEAA 1T4BA 5JAPA 3W5CA 2EQ5A 2IS1A 2XDQA 3LUBA 2P4HX 4ZCSA 1G2OA 4CT4B 4ZMBA 1RLOA 3AVXA 2MSCB 2VJLA 2JFFA 2VRWA 3GUYA 3HVJA 4G5GA 1KZHA 3HM9A 5H8WA 3C7DB 4G1CA 4PNEA 1FPMA 4QZVA 4MRSA 3IOYA 4JOQA 4HEHA 5J40A 3SDZA 4JIMA 4B0OA 2D2XA 3LQ1A 3TLXA 3V8EA 1FXWA 4RABA 4EG7A 4H1UA 1Q2UA 2LXLA 3W6NA 4DA7A 3R74A 3IAS1 2X86A 4G97A 1KNXA 4HYTA 1QGAA 3HA7A 2F3TA 2COKA 3FLEA 3C85A 3I42A 4P5EA 4LV6A 2W43A 1N9GB 1ZU4A 1NRIA 2BKKB 1U3UA 5AKLA 4AXBA 2N0SA 1BYUA 3G13A 2DWUA 2IPNA 2NSYA 3FPAA 2JIZD 4FS8A 5GONF 2NNWB 3BQNB 4RVSA 4DC0A 2R84A 4FHZA 2IBSA 5EINA 2XPCA 3EOZA 4RTLA 1K0FA 1WU7A 2ZDQA 5DYIA 1W36C 2GN2A 1F9AA 3DE3X 3FYCA 4RV5A 3GRRA 4XD2A 3CF4G 3ZN2A 1GCAA 1HZJA 3SX0A 1W4CA 1XAHA 4PH4B 1OXJA 5BT9A 3ZVLA 3O8OA 1Z0AA 2HPHA 3NFRA 2Y4OA 5E7MA 1M1YE 2Z4SA 2AMFA 3UT0A 4KWIA 5KYKA 1Q20A 4K9DA 4YT2A 1T2EA 1IZZA 4ZHBA 3E27A 3WZMA 5C8YF 1CLUA 3VTAA 1Y4UA 2EW1A 1EF1C 3TOVA 2PAAA 5THXA 1ZAYA 2Y1EA 3GPDG 3B1KA 4KQIA 5KB3A 2ZRJA 4W1PA 2TS1A 2W2TA 3AAAC 4KXVA 3S2GA 1KLXA 3I62A 1N1DA 4QHTA 2GNPA 3VAZA 4S2UA 3ZX5A 5ALTA 4ENQA 2Y93A 4WESB 6ADHA 3A4LA 3WHLA 3UK0A 3ZH9B 3G6WA 2REXB 4PIVA 2RDMA 3I2IA 1VJ5A 4PSUA 4RK1A 3RAFC 4QX6A 2OBNA 2BR4A 2L2QA 1PKXA 2V8SE 4YBZA 2WEKA 1KNQA 5J2TB 4ACLA 4IUBS 2FEMA 5CTJA 3WYEA 4DY6A 2IVFA 1NV9A 5DEOA 1NRXA 3IKMB 4IIBA 1OI4A 3AXSA 4FA6A 4G63A 4J7UA 4ED9A 4UNQA 4C01A 1XTVA 4JEIA 4MAFA 4PYRA 3LOUA 1W5SA 3EVAA 3QBVA 1E2GA 4MEJA 1V4NA 1EP3B 3DSTA 5JHGB 5G0UA 2FQYA 3DSRA 1C30A 1XO1A 2HADA 3CB2A 3D2LA 3S0JA 2VQEB 3I5PA 2BBSA 3V1KA 5KBYA 4YP5A 3B1JA 4KPFC 3GLQA 3IUYA 3UM0A 2XE8A 3GFPA 1FY2A 3EVBA 4TMTA 2ORED 3D6FA 1J0CA 1OXMA 4YGXB 4O29A 3REQA 4WA8A 5DYTA 2PUTA 2JGIA 2P3OA 3SC3A 3UGQA 5ENZA 1VL0A 2GWHA 2XPYA 2H2HA 3KZOA 5GVSA 5IVKA 2G1AA 4EY8A 2BP7B 4QJBA 4ARCA 4J03A 4CTNA 1WUYA 3EXHB 1V47A 5KHLB 3Q9UA 4CM5A 3PE6A 4XZ4A 4CZ2A 4IJQA 4KFSA 3PV0A 1IOLA 5JHAA 2P9IG 2XUJA 4TTAA 3DMDA 4FQ5A 2HXGA 3ZCQA 1Q74A 4UHKA 3LXXA 5CCMA 4NU6A 2PSSA 3AONB 1CUUA 2JIZA 4HNAA 4EZJA 2O2IA 3LDGA 3IBEA 1I2MA 2HMYB 1SUPA 3OE7A 5FKJA 2VDNB 4CU2A 1XZKA 4MH0R 4MLPA 3C6XA 1JVSA 3GZSA 1KZ7B 1RW4A 3F3KA 4Q39A 2XCRB 3PB3A 4IHJB 5D00A 1Z16A 1F9EA 4ZI2A 1SOUA 2E3JA 1XTBA 1ZJ5A 2X8WA 1LD3A 2ZPUA 4P7FA 4KXXA 4U2DA 4V0ME 1NX6A 2G09A 1W73A 1N5KA 4PN3A 1PL7A 4LY0A 4GMLA 5TJHA 1WQ1R 1IN5A 3ELUA 5TPZD 4KI0A 2HQBA 4DRXE 4EY4A 5DM1A 3ZC3A 1M2NA 2WTUA 1Y7LA 5EJEA 5IAOA 1X38A 4G1FA 3SKYA 2Q50A 3TQSA 3LL7A 3ZZTA 1AK9A 2DULA 2CHUA 1SRRA 7GPBA 4HRNA 3DXYA 3ESAA 1WPQA 3GY0A 3I6IA 4EO9A 5LJIA 2AOTA 1ENYA 2XUAA 2XKJE 3QTLA 1V35A 3KJXA 4K8OA 3RRBA 3GUHA 4RDIA 3L77A 1LGYA 5EAIA 4U0UA 1Z2OX 2QUHA 1I7DA 2PVPA 1ULSA 2XPIA 3ZZMA 4IJ6A 4LW8A 4YDHB 4DCGA 2AK3A 1BVUA 1NBAA 4MO9A 4CJXA 4YXWD 4HZUB 3DQZA 1N94A 3BRWD 5TGTA 3OTWA 4A0GA 4GPBA 4AX4A 1BLXB 2AFIB 5LP6F 3A1DA 3F73A 4Y2UA 4XWTA 3ILYA 5HMLA 2IV3A 1ZA1A 1TD1A 1Z4QA 2B4KA 3RAJA 3W0LB 3OESA 1LSUA 1EX6A 1YMQA 2NUPA 2I2XB 2YFQA 3UANA 4C0AC 3IDSA 4E2XA 1WLYA 2JEOA 1RQNA 1VHTA 1SIUA 2YVQA 4NK5A 4TN1A 4XWGA 3EFOA 4ZCPA 2QFCA 2A4KA 1FUYB 2RAVA 3FYDA 5K99A 2C7QA 3KOOA 1TYQG 1JFVA 4LJ9A 4W5TA 1OF1A 3CYFA 3D6TB 4ZI7A 3G59A 2V9CA 1UWCA 4A8HA 1E8XA 2F3PA 5KSWB 1SXJD 3SSOA 5D5QA 3VH3A 3TWRA 2WHXA 1EVJA 3FMFA 4MRNA 1UDBA 4B3IA 4ETIA 4A2CA 1Q7BA 3I6QA 4AS1A 2AMVA 4LMBA 5DXAA 4JZYA 3NF1A 3D3WA 3KVOA 4RC9A 1WZEA 4FHCA 3QE2A 2O2EA 4TGLA 4M1TA 2FZLA 4RVBA 1Q3KA 1QMGA 3RQIA 4KWTA 1A2KC 3U1TA 3GJ5A 5IJWA 2FMFA 2AN3A 4DDHA 2QSUA 3STUA 4HN4B 4OMUA 5BV1A 1DO0A 4NY1A 1FLVA 1VZ3A 1H93A 3H04A 1WVGA 1AK2A 2Q9BA 3GLIA 2ZJ0A 3V9AA 3LWDA 3GJYA 4IKOA 1B00A 3CHMA 3TD6A 5K3DA 3O73A 2B21A 2W6IA 3U80A 4MKTA 1EDEA 1NLYA 1HWYA 4C5AA 1A2OA 5K0LA 4F6CA 3PUKA 3QYAA 5FJIA 4C5CA 3ORYA 3WLNA 3RKUA 6REQB 4N41A 1J2UA 1OX6A 5EJAA 1UC9A 2HCBA 3D5QA 4QAQA 2OOKA 3OIFA 1FZQA 3HMQA 4HUTA 5E0OA 2X3YA 2Q99A 3RWMB 1YIAA 1EXVA 2WVIA 1YZ3A 3RBZA 2ZYVX 5F76A 5AKYA 4BECA 1BFDA 4WFIA 1SXHA 1C0PA 1I6LA 3I1YA 2WT9A 1HYHA 3HUUA 4IYRA 2UUAB 3CHSA 4MV5A 3EGEA 1P4HA 1MGPA 1A2BA 1TMGE 4HXEB 2WNIA 4LX0A 2CBGA 2HCTA 4RQTA 1HY3A 3BMNB 2EIME 5EE1A 5GJCA 3ZDXB 2AB0A 1U2SA 5KCMA 5K8JB 3IQWA 2VHUA 1QCZA 3CO0S 3EQ8A 4KVAA 4M98A 3RHTA 1FQWA 4V2IA 5FOQA 4FHGA 5CBOA 5AI0A 1TRHA 4MAAA 3PNBA 4N5MA 3DONA 2ZP1A 2FQQA 2ZPAA 4AI6A 1XA0A 2VHQA 3Q9LA 4QOHA 4EZEA 3GZNA 3O4IA 3MRTA 4NJMB 3FWNA 4OVVA 2JFXA 2ZVPX 2NP6A 2QRGA 2YS7A 3UMBA 1XYVA 3I5UA 2Y1FA 3FOCA 4R01A 1GPWB 4TV8A 4UHBA 2PA0A 1G98A 2RCNA 3M7IA 1QHHB 1ZH6A 3GFSA 2IWRA 2FN4A 2OAGA 2DECA 4B1FA 1EXDA 3EULA 4JI7B 1PEDA 3RPEA 2Z56A 4D42A 4DARA 4ENTA 1HFJA 2XECA 1M2JA 1NUHA 2JCSA 3QV2A 3EPLA 2H1FA 1N2GA 1C9KA 1DINA 4X6XA 5EJFA 1P72A 3BIWA 1TA4A 3OOEA 3R9WA 5F9FA 5K3OA 3PBKA 1A4UA 1LZLA 2QZPA 4NU8X 4DAEA 4YMLA 1IKND 3E4BA 3DXKG 1QO7A 3DVAA 1IHBA 3MEQA 3N2KA 1VI2A 2R1TA 5A71A 2CLOB 4F6RD 2O4CA 3L1UA 2R2AA 3MBOA 2VSNA 2WJ6A 3IVCA 3KEAA 3MILA 1ODCA 3C5HA 5ER9A 1RWKA 3L1IA 4B89A 3PT9A 3L4BC 1II8B 3NGLA 1PD0A 1E3WA 1MVNA 2VGXA 2D7CA 1ZD9A 1D6SA 5CB4F 2ZUFA 1JDVA 1GSIA 2O14A 2UXDB 1ZJJA 2ERYA 4O2AB 5ALGA 1OCCE 4QAJA 4R0MA 3EHQA 3OM0A 1KR2A 1K6XA 4P3PA 3IQZA 2PUHA 4J7CA 1T2VA 3RIBA 4M0KA 5BXQC 3H17A 4OMDA 1TM1E 2Y1LA 3SXPA 4NDZA 4R9UC 1UF9A 1T3LA 4R1SA 1QANA 2JRLA 3FSEA 3WWYA 1JHRA 3CKLA 4IFBA 2AUTA 2XEDA 3R0ZA 3ZEFA 1QH8A 1G21A 1WNFA 4LZNA 2QL7A 3Q5DA 3IELA 4ND3A 5FEUA 4GT1A 1UXHA 5DHAA 3WTCA 1KVTA 2EGUA 2BHRA 1XCPA 3H7AA 2R5NA 1YL6A 1CJVC 4QE3A 2W7TA 4PZZA 4D5EA 3D4IA 4I0WB 2HLNA 3CK9A 1DI0A 1M1XB 2XD4A 3AEKA 4G4SO 1NW5A 2R8ZA 2JATA 4K9QA 4BATA 4CF4A 5MN4A 3PNLB 3B6KA 3M4ZA 1MJGA 5CAEA 1W6RA 4MW9A 4EG3A 4ZCIA 4D44A 4FOPA 2KCVA 1CS4C 3EHMA 2V65A 3I9JA 3F8WA 1IUNA 2KBFA 3JD4A 1G1MA 3FYUC 1HF3A 2C31A 3KZNA 3ZD8A 1X8KA 4DNQA 1WCIA 4F4CA 2DFNA 2P9QA 2Z3VA 3UFBA 4NENA 4MYDA 3SDSA 3L7OA 2XSZD 3E3LA 4MCIA 1JDPA 4NHOA 5DM4A 5KHOC 1YJBA 4OQLA 4EKDA 2OR3A 1L8QA 1ZY2A 2I54A 1SQFA 2VZ9A 2IUEA 4IV0A 3L82A 1TQ8A 1XDZA 4WNAB 3R3XA 4YJ3A 5DW3A 1UM9A 5CXQA 1KTIA 1HF8A 1BHJA 1YZFA 2HKIA 1E2MA 1O96A 1MB0A 2REBA 3AJAA 4LXQA 5AOVA 3TKLA 3AG2E 3D7KA 3C7CB 2BEUA 2VKTA 1SVIA 5H68A 4LOIA 2AZXA 1QE0A 1NN1A 2ZIEA 3N2KB 5MGNA 3L84A 2ZSJA 3C3OA 4P7BA 3WHIA 2VJBA 2HHAA 3OZSA 1DBIA 3RR2A 3U56A 1NT2A 3CVPA 4GCNA 5FV7A 2QD3A 1W5TA 4GAAA 4WCDA 2IZ6A 3UC9A 1N1GA 4CYMD 2XVAA 3JTMA 3QLUC 5EGNA 1ZOSA 4UCFA 4OJTA 4B09A 1HLFA 2H4ZA 2ZPTX 1J8FA 5FUMA 5H80A 2HIAA 1JIQA 1L4MA 1GZ6A 2WU3A 4L6CA 2EFHB 3OM8A 5I01A 3Q15A 3LCUA 3Q3HA 4FYPA 1NGSA 2QXTA 5IAAA 5DTEA 4J8DA 3UM2A 3JQDA 3BE8A 3MQ4A 2TMYA 1I7LA 2ZS8A 1ELWA 1W8IA 1X9GA 2I3DA 5FI1B 1UKBA 1MH9A 4MVJI 5HIKA 1MHPA 3L6DA 4O1OA 4RZUA 3ITKA 4CQLB 2NADA 4YAIA 1M5RA 1N5DA 1NC3A 3D6HA 2QTVA 2WJJA 3TFOA 1JHYA 2YNMD 2VK4A 5JCOA 1DQYA 4L4UA 4E5MA 2RGWA 2PYDA 1UP7A 4K9LA 4RPGA 3W8NA 1ZFNA 4XDYA 4ZEWA 3D4OA 2C7GA 4QYSA 3UAVA 4XM2A 5FUQA 1ILWA 4HEQA 4PYNA 5I3ZA 3AU5A 3CUKA 4RACA 3VBCA 1KORA 1IPFA 2COUA 2PG3A 1IZYA 4KPUA 3TL6A 3EX7C 3ILHA 4GRDA 5GZ6A 1CC1S 1FMTA 4Y1RB