4CT0A

Crystal structure of mouse cryptochrome1 in complex with period2
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
494
structure length
486
Chain Sequence
b'VNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVAANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRYPTOCHROME-1
molecule tags Circadian clock protein
source organism Mus musculus
publication title Interaction of Circadian Clock Proteins Cry1 and Per2 is Modulated by Zinc Binding and Disulfide Bond Formation.
pubmed doi rcsb
total genus 173
structure length 486
sequence length 494
ec nomenclature
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4ct0A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ct0A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ct0A01
2YWCA 4QREA 3ZJTA 3H97A 3X1MA 3ZIUA 1M8KA 4OJMX 1O95D 3NBKA 1X6VA 3RHSA 5HUJA 3CLRD 1IRXA 5J5AA 1J21A 3COWA 1OWOA 2VXOA 2OV4A 3AIIA 4MUFA 2JANA 1IFXA 1TFUA 1OWPA 4HJRA 4MWBA 1T6XA 4ND6A 1T6ZA 4DDMA 4QBTA 1JZQA 1EXDA 3CLTC 5EKDA 2B7LA 1QU3A 5BNZA 2J08A 4MUHA 1TYDE 3MLAA 1IH8A 2DLCX 2J07A 3PNYA 1MOPA 3JXEA 4ND7A 2GOYA 3QE4A 1MJHA 2HZ7A 2H29A 4MUGA 2VTBB 3H9BA 2Z08A 1T9GS 3DPIA 4MUEA 5J59A 1O94C 3X1KA 2CYCA 3ZXSA 3AFHA 3MXTA 3TQIA 2QUHA 4EG3A 1Y42X 2CFOA 3M5WA 3IMGA 4CT0A 3IODA 4E1AA 4RPIA 1N2EA 1JECA 1YULA 3D6VA 4NDAA 3KT0A 1YIAA 1R6XA 1O0CA 4GRIA 4MW9A 5FO1A 4PY2A 4CDMA 3CVYA 4U8HA 4XFDA 3PRHA 2CT8A 4NAUA 1NP7A 1KAQA 3NV7A 4A91A 1ZJWA 3TS1A 3CVWA 2D54A 1I6MA 1T9GR 3CLUD 2A1UB 3IUEA 1N75A 1TYBE 2CV1A 2YXNA 3P52A 2CUZA 1G59A 5J58A 4I6GA 5KWVA 1JMVA 1VBNA 4QRDA 1M1ZA 2X0KA 3L92A 3Q10A 4MW4A 2A4MA 3A05A 3FETA 4ZT4A 1MBZA 1WXFA 5LLTA 5LFAA 3COYA 2NSYA 2O5RA 4DDHA 2CV0A 1EFVA 3MMXA 1VBKA 4MW7A 1JZSA 2A86A 1OWLA 1JEDA 1S4MA 4EG8A 4F4HA 3FDXA 1R6TA 2RE8A 1YIDA 4I6JA 4X0EA 2ZUFA 1WXGA 1H1TA 1SURA 4J75A 1JEEA 2QUJA 4DJAA 1GN8A 4KPUB 1O5TA 2DUMA 3AKZA 2O8VA 4MAFA 1O96A 3KT6A 4ZT3A 3UY4A 1N2BA 4DE5A 1H3EA 4UZFA 1OWNA 2BTEA 4RUKA 1WOYA 2ZP1A 1TYCA 2DXIA 1I6LA 1N2GA 2JA2A 3K9WA 1WQ3A 2PG3A 1QRUA 1LW7A 4JFAA 5LM3A 3FG9A 4XFJA 1OBCA 1LI5A 1N2JA 3ISJA 3G59A 4TS1A 1MRZA 3N2YA 1KORA 1U3CA 4DLPA 1U3DA 1IHOA 1WXHA 3ZUGA 3SYTA 2Z09A 3PNVA 1O0BA 1H3FA 1J1ZA 2PXHA 1PFVA 3RK1A 5AHWA 1PG0A 2WQ7A 4KPUA 1KAMA 5TEVA 1GAXA 1MB2A 1QU2A 4MVXA 1J20A 2Z3VA 2A88A 1G8GA 1VLHA 3SEZA 3IOCA 3N05A 4PBTA 3H99A 1M8JA 5IJXA 2YWBA 1MAWA 1ULHA 5KCMA 2WSIA 4MVCA 3ZJUA 5FNZA 4YMIA 1KQNA 1PFYA 2WQ6A 3CVVA 4JZYA 3AG6A 3IMCA 3QTTA 1R6UA 3P0HA 3HFJA 1VL2A 2V0CA 3MUEA 1JIKA 3FWKA 1NUSA 3HGMA 2IP1A 2PFSA 3H05A 1NZJA 4PBSA 4U63A 4MQ6A 3CLUC 3VGJA 2A84A 1CT9A 2QUIA 1NI5A 3FI0A 1WQ4A 4MUIA 1KH2A 3G5AA 1ZH0A 1JGTA 1GPMA 3UK2A 3TQOA 1PFWA 3GLVA 1MAUA 1MC1A 1EFVB 2DEUA 4YP7A 2XRZA 1M8PA 3UOWA 1K92A 3TZLA 1NSYA 3DO8A 1I2DA 4EFKA 1WZ2A 1XNJA 4EG6A 4FZJA 2X1MA 3P0IA 4HK4A 4EG4A 2WB2A 1WKBA 2QTRA 4K0RA 1O6BA 3UMVA 2CSXA 3OP1A 1JIJA 1M8FA 1KQPA 1WXIA 3BL5A 1M83A 2QJOA 4JXZA 3IUBA 4YP6A 5H7XA 3COZA 1GTRA 4HJXA 2X3FA 3A04A 3ND6A 1PG2A 3HL4A 4KR9A 3COVA 1YI8A 3N8HA 3FY4A 4YP5A 5FO0A 3S3TA 1B6TA 2J5BA 4U7JA 3FOCA 2H2AA 1T6YA 1Q11A 4EGAA 1F7UA 1F7VA 1QRTA 1YUNA 4WNYA 3DV2A 1OD6A 4MW6A 1ZH6A 1N1DA 3D6UA 1N2IA 1F4LA 4NZPA 4MWDA 1EJ2A 1J09A 4MUJA 2QTMA 2CYAA 3FHJA 1KP2A 1YUMA 4KKVA 4Q93A 1UFVA 3FIUA 4ZCQA 2BYTA 1J70A 1MB9A 1JILA 1K4MA 1NUTA 1KR2A 4ZT6A 1FFYA 3X1JA 3IVCA 1JHDA 1GZUA 2CV2A 4AS1A 2E89A 2GKSA 3ZJVA 1EFPA 5HG0A 4L2IA 1QNFA 1KQOA 3A4IA 3HMQA 5TS2A 1QQTA 3A2KA 4GU5A 4WSOA 3N9IA 1IVSA 4F3RA 5DB4A 1KP3A 1IQUA 3FH0A 5DASA 1XJQA 1EUYA 1BS2A 3RFFA 1NUQA 4NX2A 1K4KA 4ZT7A 1K97A 3AG5A 2I1LA 1WY5A 5JBNA 2DETA 4MVWA 2D5BA 2QJFA 2QUKA 1DNPA 3HZRA 1FYDA 2A1TR 1GTSA 3DLAA 2GM3A 3AL0C 5IHXA 1NUUA 3MLBA 4OUDB 4NATA 1N2HA 1OWMA 3ELBA 4PBRA 2J4DA 3SZ3A 1KKUA 1O97D 4MUKA 1V8FA 3CLSD 1JIIA 5TEWA 3IMEA 4JXXA 3IVXA 3CLSC 1KH1A 1COZA 2E18A 4MW5A 1Q77A 2C5SA 4OUDA 1O97C 1U0BB 1ILEA 4G5FA 2EL7A 3IOBA 4MULA 1QJCA 3OTWA 5TGTA 3SZGA 4MVYA 4UZEA 4K03A 4CDNA 5H16A 2PIDA 1NUPA 3Q4GA 4G6ZA 1G8FA 3ND7A 1O94D 3KFLA 3LCJA 1RQGA 4S1OA 2DERA 3G6KA 2VTBA 5DK4A 2TS1A 2CYBA 4H3SA 3IH5A 1I6KA 1U7DA 2RD2A 1IQ0A 2PZAA 2AG6A 1N2OA 1D2RA 3Q12A 3CLTD 3SEQA 3K32A 3CA8A 3KT3A 1V47A 4KR6A 4ZCSA 2AKEA 4DNXA 1TEZA 2QTNA 2YY5A 3U1VA 4EG1A 4KR7A 1P7PA 4EG5A 2A1TS 1N3LA 3CLRC 3H9CA 3VU8A 2D13A 2OQ2A 3KT8A 3GUZA 1IQRA 2ZUEA 1KH3A 1O96B 3P0JA 2IELA 2HMAA 2DPLA 2R5WA 4MW0A 2V0GA 4XSVA 2DR2A 1H3NA 2NZ2A 4ARIA 3ILVA 3TZEA 4MWCA 4ZCRA 1N77A 3IDFA 3SP1A 1ZUNA 1GLNA 3TNJA 5HUHA 1NURA 3E27A 4Q16A 4R2LA 3SDBA 4ZT5A 2A1UA 1QRSA 1TYAE 3PXUA 3CVXA 2X1LA 2A7XA 1EE1A 4MWEA 1U7XA 3IOEA 5KHAA 3C8ZA 5K0TA 2EJCA 2E0IA 3I05A 1HYBA 3RJZA 3CVUA 2XRYA 1N78A 4P2BA 4EF6A 1Q19A 4ZCTA 1A8HA 2QJTA 4I6EA 4BWVA 1NYLA 4G5YA 3ZGZA 4MW2A 3IVGA 1WJGA 3F3MA 4EG7A 2AZXA 1Q15A 4L2IB 3LOQA 2J09A 4R2MA 1LI7A 3FNRA 3ND5A 1EUQA 3RK0A 1M8GA 3GMIA 4ZT2A 1PFUA 1G8HA 1J1UA 3PNBA 1F9AA 4YBRA 3LE8A 1X8XA 3VRHA 5F23A 4MLPA 3INNA 2G36A 1QTQA 4JYZA 2PZBA 3ZXIA 4MW1A 4CQNA 1WXEA 5K0SA 1XNGA 2E21A 4ZCPA 1EFPB 2JAXA 4NAHA 3NBAA 4J76A 1O95C 2IJGX 2PZ8A 3RBAA 4AQ7A 4MUNA 4DDKA 3CR8A 3L93A 3QTBA 1OBHA 3HV0A 1VBMA 1XNHA 3UC5A 4ARCA 5DEOA 1TQ8A 4HPWA 4R0NA 2HGZA
chains in the Genus database with same CATH superfamily
3K2IA 1FDTA 1O1RA 1QGOA 2VT2A 4EKDA 4U04A 4XCQA 4NK5A 3UAXA 1BS1A 1U5BA 3IS3A 3BQ9A 2MOKA 2JIDA 3IKOB 1YCFA 1SVIA 1Q92A 3L5OA 2PVSA 3PCRB 3GJ4A 3MD9A 4KKXB 4F5WA 1H4QA 4UXJA 3L46A 1KDRA 1ESCA 3IIEA 4IDCA 1Z17A 3MIZA 4KI0A 3M5CA 4LQ4A 5HF6A 4EVQA 5G2NA 4R69A 5CHEE 4LVOA 4MUFA 4BBAA 2PUTA 3R7DA 1S0PA 1YV9A 1DT3A 2YWXA 1CZKA 1QJ4A 4WASA 4ZI5A 3IBCA 3IAAA 1C3EA 4JSYA 5ECWA 5HS0A 1T29A 2WYVA 4KXQA 1PJAA 2X86A 2OORC 4PNPA 3V1YA 3P9NA 1XDZA 4JL0A 4D9MA 1S2DA 1O6FA 2B83A 2FN8A 3E1GA 1MJHA 1HE8B 1OFIA 1QIJA 2C8KA 3BWXA 1YHNA 3K53A 3ZJ5A 4E03A 4GTVA 3DH0A 5E76A 3JYPA 3QVKA 4MUGA 3HSKA 1NLYA 1ECPA 2J4FA 1MU0A 1IZYA 1FVXA 3K73O 3MTQA 3ZDQA 1SU4A 3GQVA 2CHZA 3ZHEA 2RHMA 4I08A 4LNUA 4CEMA 2NOAA 3BXPA 5D5QA 3FSJX 2X8LA 3OT5A 3VR2D 1IXKA 1GRNA 1V6AA 4DA9A 4YYEA 2Z8XA 4BN0A 3UHJA 4WL0A 3SQMA 5JNRA 2YHSA 4BO4A 1PD1A 1GXSB 2AMFA 3BCRA 4ZOEA 3W2IA 5C1IA 4BE7B 2R7KA 4UQXA 3EVFA 4I66A 4KFUA 3MSXA 1PFQA 3GJ8A 3JQAA 1DRJA 3FKQA 3IAHA 3JWHA 4R51A 5K2MA 1ZX1A 4AY3A 3EIWA 4C9BA 3FTVA 3ODPA 1D4ZA 4DV2B 2EBUA 4M7CA 2HCFA 1Y82A 5ESDA 5FO1A 3RB8A 3N8KA 1BA3A 2HBZA 2VDUE 2X9GA 3TLGA 2R0QC 1LK0A 1PR6A 2BMJA 4ZQHA 3WDSA 3H5VA 4DSAA 2IW1A 1K27A 3I9LA 3VTXA 2Y66A 2HEGA 5BN5A 1PUIA 1A4XA 5FUBA 2Q21A 5BY2A 2BZ0A 1BKSB 3GFPA 3P2IA 1SUWA 1W88B 1NVKA 1EVKA 2NUTB 3OEHA 2ZXFA 2GROB 1GWNA 1M1ZA 1RFGE 2HQBA 3FNBA 4OM8A 2ZEJA 1GIAA 3FETA 4YCMA 4F4CA 1KO4A 3HCAA 5JH7A 1E4VA 1Y5NA 2G0TA 2WVAA 1PJ4A 1QHEA 5AQBA 1X7ZB 3IJ5A 3M49A 3N3BC 1KS2A 2X40A 3P9CA 5FA8A 3KSLA 1VPEA 2G9RA 2IOYA 3G2PA 4B7AA 1QAOA 4NBVA 1GQOA 3RTAA 1PL0A 3BFJA 4ZHSA 5KNLA 3GOQA 4E6PA 1C3JA 1DUVG 1GR1A 2V55B 3IQHX 1H9CA 1HH4A 2WICA 2CLCX 1DAOA 4Y2GA 3VTYA 2BZGA 4RA9B 1JBKA 4B74A 2P2ZA 2ZWPA 1FYXA 3A8TA 1K7FB 2YUIA 4GHWA 3CUWA 4M83A 5G3ZA 4D4JA 2C7PA 1IXSB 4YR7A 1QFMA 1Z2PX 4NV1A 4L28A 1WPRA 3WLFA 1XZ8A 4JV5B 4KSCA 4KQ9A 4OBWA 4BKRA 1Q0PA 1GKLA 2EG5A 1ZU2A 3TRJA 4TQUS 2HOQA 4F1PA 1CY1A 2ID7A 1X8KA 2P3SA 2RJOA 2XZPA 3NNSA 4PAWA 3JWJA 5ADVA 3FNQA 2I6XA 1UFRA 1UBFA 1MEEA 1JT2A 2IEZA 2PG3A 4OLBA 3ESZA 4G37A 3NYWA 3ODGA 4PPGA 5TMEA 5TXGA 2EBWA 3GVPA 4CVNA 3Q9SA 4S1PA 3EDOA 2ONCA 3QVGB 3T4EA 5M72A 1DKLA 1V41E 1WE2A 3K0CA 4YHBA 3BULA 5ICFA 2NPFA 4DC0A 4EPRA 3TG5A 5AYVA 3E8MA 5SY4A 1V9CA 1IIRA 1SHJA 2QL7A 1CZUA 2GKGA 4HQOA 3F74A 5JWOA 2XQKA 4FYWA 4P3YA 1ZM9A 4KU4A 1CRPA 2O07A 2TRSB 4IHJA 4R6WA 1KU6A 1V5IA 5IJ9B 2VP9A 4O33A 1AQLA 1N8KA 4LTDA 2F67A 5K3FA 2WJAA 5J4KA 4YFYA 3DRAA 1ZI6A 3MKRA 1M6NA 2NZJA 4MPDA 1FTQA 4LHEA 1SVXA 2EJUA 2IYAA 1EHIA 3EA5A 1N0WA 3H2GA 3KOUA 4G1VA 3OH8A 2XPIA 1K86A 5ALQA 5J2TB 2JARA 3EIJA 1YRWA 4ZYVA 3MGBA 1LW6E 1S4QA 2O8NA 3RYIA 3QKTA 1ANKA 1NQAO 1AUQA 1LV8A 1KOFA 1VCMA 4QOJA 5BXOA 5CHEA 1L8XA 3KXIA 2ZUBA 1A9TA 3KZKA 1C9YA 3EVEA 4KEAA 4A8TA 3KR1A 4DC9A 3FZEA 4Y7CA 5TVGA 3VKUA 1W0CA 2ZRCA 4WA8A 3NUGA 1BX0A 1V7PC 3IMCA 5SZJA 3W2GA 4YVQC 2CVZA 2M1ZA 3BMQA 4C9BB 5LCXA 4EZBA 1VL2A 4REQA 1VJ1A 5AI6A 1H1DA 1MT0A 5CCLA 3EHNA 2LP4Y 4IEIA 4D57A 5CA1F 5HW0A 3AX6A 5DTQA 2AZ4A 4Z4CA 1O2DA 4LY0A 2VL7A 4PVDA 3S2IA 1U0RA 3QWBA 3HDXA 5I9MA 4BNMA 1IJBA 2QI9F 1IKND 1B2RA 2OHFA 4EB0A 4LHZA 3ESQA 1IBKB 3DPYA 1SXJC 5FDFA 3CKBA 1EQUA 4RJIA 1YJ8A 1DG3A 1U7UA 2QMUA 4Y2SA 4OXKA 1T15A 1PQ4A 2AQ8A 3E7DA 5DLQC 1H4SA 4KWEA 1LSSA 1R74A 3BILA 1E2EA 4L4SA 3DUFB 4E0BA 1NBIA 3OPYI 1QRAA 3GFOA 1V9LA 3W6PA 4HYEA 1I2DA 4EFKA 4M53A 1S7CA 4RTOA 2VT3A 3D2LA 5AK0A 2VRWA 1T2FA 3TUJC 3BJIC 3C1AA 3MX3A 2PO7A 3H42B 3GMDA 3R9IA 4J0QA 5K0JA 4LKRA 4LQCA 4EJFA 3CF6R 1CDDA 2B1IA 4L4RA 5HF9A 3UMYA 3GJTA 2XHEA 1BWPA 1Q7GA 3BL5A 4JXZA 5T8IA 4RG6A 3MCWA 1K7SN 2EP8A 2GSWA 2P6OA 3A04A 3AJ8A 3M6XA 4N5HX 3C3AA 1LWNA 2OBXA 4L5YA 3MGAA 2WILA 1O89A 1DTWA 1WR8A 3C3EA 2VHCA 2WSBA 1HI9A 4FHGA 4DLTA 1HNZB 1QYRA 2PUCA 3TW8B 1AO0A 4BE4A 1E7RA 2B4YA 2C2XA 2OC4A 5IW8A 2IV7A 4OHFA 1PD0A 3QHPA 2YOFA 3TFOA 3KQOA 3PJEA 4LSGA 4YAFA 1R5JA 4ANXA 3BSYA 3WP1B 4YAKA 3DPDA 3HFRA 2PNJA 1L5ZA 4LE2A 5H70A 4EI2A 1JSCA 2IOFK 3ESBA 1GYPA 1ENOA 3ST7A 2WMOA 2AF4C 3F5DA 4GL4A 1L7DA 3U4IA 4XZ3A 5HPYB 5E9QA 3LT2A 3OMXA 5J4HA 4BMOB 1J5PA 4CTNA 4BP1A 3JV7A 1RSZA 1VMIA 2OLJA 1SM4A 1TTTA 4RFSA 4BFLA 5KX5B 1YR3A 3D8UA 2ZI3A 1RYYA 3U3OA 3WL3A 5MN4A 4U4AA 5SY9A 1RHQA 3TMYA 4ZCQA 1DARA 4EJSC 1TECE 1S1CA 3ZCQA 3PQFA 3AT1A 2Q9CA 1T6BY 4HWPA 4N01A 4PG5A 4WIAA 5DWDA 5F5NA 1LPMA 1XLWA 5KJKA 1VECA 2H1IA 4Y1EA 4DYHA 4WFQA 3S4YA 3ORHA 1YDFA 3CR7A 3B5JA 3FGPA 4PLCA 4F96A 2AFIA 3GJ7A 3OCXA 4J91A 4PANA 3DBVO 1WY6A 3T9AA 1T4GA 4FHDA 5K7SA 1A7UA 3IEVA 2BRUA 3IAM1 3CK9A 3K9NA 5K1ZA 2V6MA 3O2NA 4ML3A 4U7HA 1ZD1A 3W0LB 4ZV9A 3IDZA 4KOAA 1JQDA 4OH7A 5JZMA 4B3JA 4D0GA 4WFKA 3OPQA 1GQFA 5GJCA 3VV3A 2GHQA 3P94A 4KUEA 1V1MA 3WL5A 4BEVA 2ZTUA 2LDXA 1J00A 3AR5A 1IM2A 4I9EA 1JG4A 4OUKX 4MS3A 4E5YA 4Z68A 3SS9X 5KVAA 1I4TD 4Y2RA 2HV9A 3HEBA 2AA3A 3TL3A 4E4TA 1K4KA 1JHPA 2J6IA 3QU5A 3IHYA 3NYQA 8ATCA 5KNBA 2RDMA 2ZI4A 2BJWA 1SQMA 1RXEA 3LY5A 1U1EA 1Y1KE 2QL6A 2LIPA 3Q78A 2QJFA 3QEKA 4HDSB 4UMDA 3GUUA 4U8GA 2GEKA 2KZTA 2FMFA 3G2JA 3LBYA 1FRNA 1GZ6A 1EX6A 2R7AA 4I46A 1XVUA 5EIHA 2PX0A 3NZEA 3C8MA 2PA3A 2GW1A 5LVAA 1RT9A 5IEBA 3LDUA 3PEWA 4XOUA 4HNHA 3QPUA 2KBXA 3O1LA 4D02A 3IUYA 1U7ZA 1RVDA 2QM3A 4EMSA 5CCDA 5JSHA 2NZXA 1M1NA 5IBQA 3E8XA 3MT9A 1UJ2A 5MF6A 1II8B 1UAGA 1WBJB 3CLSC 2I4LA 3IVXA 3JALB 2D1YA 3PD0A 4RBNA 4DCOA 2VWHA 4RVOA 2WT8A 3FBGA 2CXXA 4BEJA 1QP8A 4DIDA 3HU2A 4OB6A 4XGRA 1DEAA 4Y2PA 1QJCA 3PF8A 4FP7A 2M6KA 3C43A 1ZIDA 1QKKA 4QEDA 1REQB 3U48A 2C4NA 3DE5X 1WCWA 4QZVA 2XMPA 3U39A 2RKKA 2GRAA 2W4QA 3J81A 4TXMA 4N1AA 4GR4A 5HTKA 3ABSB 4ERNA 2VTBA 2DYSE 2HRQA 3HXOA 2J3HA 2JZOA 2Y1LE 3F67A 3OP4A 5JADA 4F7DA 4H3SA 4PYQA 4UD6A 2V4LA 1XN1A 4D43A 1X80A 2W90A 1HO3A 4X91A 4ZRNA 3LXXA 5CTJA 4KQMA 3SWWA 3E9ZA 3OPNA 3WGGA 1R6DA 3M33A 1ZG3A 1EVJA 4RVSA 4NQRA 2IOQA 3LM8A 1NW6A 3GHHA 3SHVA 3PJGA 2PNNA 1CQIA 4ZTBA 5BOVA 5LZ2A 3AESB 3W5AA 1OR8A 3Q1LA 3LCMA 4CF4A 2O8BB 1A2BA 1S89A 1M10A 1SXIA 2VF4X 4YJFA 3M9WA 4MRMB 3VSBA 4KQGA 3OOSA 4E08A 5HI7A 1I2CA 2FQXA 4BEWA 1VIAA 2HJGA 4HQNA 3CZQA 4Q4AB 1U4NA 1SMKA 3DFMA 1POXA 4B3FX 4BOYA 3URZA 1Z5PA 1F51E 3BMNA 1O9BA 4W8OA 3MV2B 3WLEA 4LVNA 5CIWA 4YI3A 1YNOA 1T9AA 3OZEA 5TQ0B 2KJQA 5LP6A 1Q5PA 3WRYA 2H7XA 4FULA 5BVGB 3NJRA 3LKBA 4P7JA 1HG5A 3M82A 2Z6AA 2GJ4A 1JHVA 5EC8A 4OB8A 1E92A 4LOHA 2XPYA 2IQIA 5EIBC 3RUAA 4XSVA 3EZYA 3DUWA 4IKOA 2VHEA 4WNDA 3M5PA 3GEGA 4O59O 2GZHA 2NZ2A 3OM1A 3WS7A 4IIEA 3SP1A 4HXGA 3CPEA 3APFA 1CUVA 1GLNA 1TPZA 2H48A 3B9PA 3CX3A 3CEHA 3C1TA 1IATA 3LQFA 1YFLA 2GN0A 1CUIA 3OETA 4JGGA 4Q16A 4AFNA 3VJRA 3FUXA 3FU5A 4I55B 2ACKA 3THXA 1RMQA 3S1SA 2GRNB 2P78A 1PKXA 2R2LA 2C99A 2PQ6A 2ZRDA 2FULA 3KS9A 4JBGA 2A9KA 4KN8A 1UDCA 3FGNA 2AJBA 3UKDA 3CVXA 5DHSA 3VVMA 3UW3A 1E60A 2EEPA 2HA2A 3VYSB 3LVBA 2WIJA 2IE0A 3DBLB 3TQSA 3HFSA 3UMBA 3FVTA 2JIZD 4FB4A 4Y9DA 1KSJA 1TD1A 4N03A 1G8YA 3NBZC 4GSLA 4I14A 2DC1A 3PPIA 2ATVA 5FXMA 5JAIA 5LP0A 1HNNA 3HL0A 5COQA 4DMRA 3KAJA 4ENVA 1ZGGA 1C3OB 4OU5A 3A06A 6ADHA 4B5LA 3FUCA 4DA0A 3RUHA 2JFOA 4MDHA 3L8FA 1U7WA 2JJ2D 4KDEA 5ENTD 1Q15A 2Z8YA 1XA4A 5AD1A 5HIKA 1VM6A 5CB8A 3OY2A 4EX7A 5ENDA 4NYIQ 5FR2A 3F7NA 1SA4A 2OXEA 4EZKA 4FCCA 1IJKA 5BPHA 3K15A 2YNQA 3JD2A 2W0SA 5JXWA 1DWPA 2QEQA 3HJUA 3CS3A 3UQ3A 4IHKA 3OQBA 5HQ3A 1USKA 2I4RA 2ZJZA 1ZXLA 2WPNA 1HORA 1LK7A 1Z2NX 1KDPA 2MSDB 1JSZA 1BMQA 3HRHA 1XXLA 3VRHA 1QTQA 1RWWA 1RLUA 1ISMA 2OGUA 1Z39A 3VU9B 4DW8A 2PZBA 4EQ6B 2I8AA 2XGGA 4C0EA 1DUIA 5G1NA 4EVRA 5K8CA 3CJTA 1YSCA 1TPYA 3H2HA 4Q6BA 1LFAA 1XNFA 2R8OA 2Y1GA 4EB6A 4EUNA 2NIPA 2YHAA 3ZLTA 1U8FO 1WB5A 2ZI7A 5BW8A 1NPTO 5BV7A 1W44A 5JRDS 3UPTA 2FPLA 3A9VA 1FT2A 1E1KA 4YAGA 1MD9A 4TKUA 2W37A 3B9QA 3LXMA 2Z30A 4FP9A 1LLUA 2H4ZA 4YDSA 2GPNA 4C7OB 4OIFA 1JWGA 3SHFA 2IYRA 3JD0A 2Y76A 1GGNA 2NUPB 3AONB 1LX6A 3BK1A 3GNTA 4NR0A 1ODIA 3IE1A 1G8JA 4HP8A 3U40A 3IQGX 3LBIA 4P7KA 4A26A 3PTAA 2UU9B 4EJ6A 2AHOA 1ONBA 1Q3HA 2JBAA 5FNVA 4Q1BA 1ZAKA 4F2DA 3L7NA 3WB2A 4I9NA 1Z2EA 2UYCA 2ZIEA 5M5BA 3PLAE 1I2MA 1M8KA 2LNDA 2PX8A 4NC9A 3OJOA 3MJCA 3DE6X 3F78A 1EEHA 4YLEA 1BW9A 3DUFA 4JX8A 1RPZA 2X6JA 4J90A 3AV0B 3WNQA 3KZ1E 2J9XB 1EFRA 3GHYA 5AICA 4BV3A 3FYUC 3R3JA 2QYUA 1MLDA 1N8SA 3DZHA 3IEXA 3GZTB 3U66A 4QPNA 2P9KG 2RGYA 1CQPA 3WK8A 4DDMA 4KFSA 3NB0A 2B9EA 1AK1A 3PNLA 3FCAA 4TWZA 4WEOA 3V33A 2GSDA 4KPFC 3MLAA 2QG9A 4E5NA 2FPIB 3BEEA 1DKPA 4NZNA 3RIBA 3AVUA 1EDBA 1TNDA 1E58A 4CNBA 3PU6A 1SQ5A 5HQ8A 1PGOA 3LPDA 1HT2E 4AKHA 2AWOA 3F6PA 2H29A 5KNDH 1CCWA 2D2VA 4R1LA 2B1GA 4OH1A 1VIYA 3H9BA 5HM8A 1HMPA 2Z08A 3O8QB 3ABLE 4YUXA 5JNLA 2B0OE 2FN7A 5JHAA 5J59A 3VO8A 1FSGA 1OHHD 3FI9A 2GD0A 4KJXA 4OBEA 4Z9AA 3X1KA 1ZL0A 3CNLA 3RC7A 4JLMA 1XELA 1JQJC 3S29A 3KYBA 3OQPA 2VTEA 1EVZA 1U9CA 2V4MA 4HPXB 3FHTA 1AA6A 4Q7MB 3FTZA 4B8YA 1T1GA 2B69A 2P68A 2QMYA 4JYBA 4HV4A 3NHKA 1BA2A 5L7YA 1YULA 3MINB 5HR5A 1YZNA 5BVHB 1OXBB 1P45A 3EXAA 3E8SA 2UXDB 3WYGA 1TJ5A 2H2FA 1H2WA 3A26A 1SXJD 3DNPA 1VG9B 1W4RA 1YIAA 2V74B 3MRXA 4GRIA 4C6TB 1V6CA 4LUCA 4DMFA 3L7YA 3FU3A 1KO5A 1K68A 1PW7A 4LV8B 1CY0A 3FEXA 4C4PA 5KYNA 5F76A 4MVJE 4CT5A 2ZITA 4DIFA 3KDPA 2VNHA 4RKRA 3M1YA 1GZ5A 2J0EA 2SICE 2FUEA 3EISA 4B9EA 4YV2A 1CZNA 3MWJA 5FBQB 2GPYA 4FD3A 1RYZA 4XKBA 5HIMA 4PCUA 4KH0A 3ZDFA 3A6DA 3L04A 4ZOAA 5DLEA 2R85A 1ID8A 2GAAA 1ONNA 2FE4A 2QQFA 4MQ4A 4FKBA 3JQFC 4IDHA 5MGBA 3O8DA 3W9SA 1RW2A 4RPLA 3D6FA 2VBFA 4DGSA 1Y7LA 4NBLA 3B3JA 1R10A 4EMBA 1U3WA 2W2OA 4RY9A 3PZDA 4CFYA 3GC6A 2IYSA 4XJVA 3KYIB 2PUGA 2MU1A 3U31A 4AECA 5H9WA 1I3LA 1HNXB 1H1TA 1YAJA 3T7RA 4AL4A 4DV1B 2NX2A 1XMOB 3D4BA 1JEEA 5HNKA 2HA7A 4UQLA 4BT8A 4JJ8A 1NVDA 4OQLA 4YAWA 1X94A 3ZU2A 1LC3A 3ZY3A 2XXAB 3DPUA 4MEAA 1GCUA 4ZOLF 3I2IA 3X1XA 5AM3A 5LKAA 4F4JA 1C1YA 1H3EA 1SXQA 3FUIA 2R87A 4XPIB 1G42A 3VDRA 4EO9A 4CCAA 3IEKA 1QPZA 2QUAA 1YWGO 5E8RA 1J8YF 1WOYA 1UWKA 2BGRA 2FR8C 2HBRA 1Z8DA 2QIOA 2Y1FA 2Y77A 1IZ0A 3F4LA 4QWWA 4UMVA 4TZ0A 2VDPB 4JLNA 2MTBA 4JSTA 4MJLA 4NCJA 2GEUA 1SC4A 1F14A 1UT8A 2EOAA 1FXWF 3FGOA 3EBPA 3OLCX 2C83A 3CKLA 5AIAA 1T6NA 3R0ZA 3R44A 3BH6A 1UPAA 3QKUA 4G0PA 3DYBA 4M0FA 1D7OA 3ZTTA 1HL3A 5FIOA 2F3UA 3KKLA 4Y6RA 4HVAA 4JLDA 5FOTA 5L95A 3FFWA 2OCCE 2CJWA 3UAWA 3PDIA 4R2WA 3KOWA 1JT9A 3REFA 1JHOA 1B76A 2YS6A 1IB0A 1U2PA 3N2YA 1SCJA 1T4MA 1M6EX 2P5YA 3TNYA 2REQB 4K9QA 4DLSA 1CF2O 2XYPA 4GLOA 2GB4A 4P84A 3CVJA 3GFBA 1G8SA 4NJEA 5EUBA 2YXEA 2WB4A 3V4OA 4AD8A 3BMOA 4MTCA 1BNCA 3OZIA 4OGGA 2ZAMA 3ETJA 3NETA 1JYSA 2V9CA 3SYNA 1CR1A 3A4YA 3W5HA 4GSKA 1TGYA 2BLLA 5FNVF 3TN7A 3NT2A 4BGIA 2VJ8A 4E33A 2FMTA 3AU4A 4QU5A 4HNQA 2W2QA 1ZGZA 4YI5A 5H68A 2H8GA 2CJWB 3K1ZA 5EZYF 4P38A 1ID1A 1NXPA 2ZW9A 3C48A 1AJEA 3ZU5A 4EBBA 1VPVA 2JGLA 1B1CA 3ET4A 3ZY4A 4UEJA 3NBXX 3BSFA 3UJ8A 3NFYA 1THZA 5GZ6A 5ICSA 3ECCA 3L02A 2B1JA 3SO8A 3A9TA 4CM1A 3C70A 4MVCA 5CA1A 2PKEA 3AUSA 1J6UA 4FHCA 3U09A 2IXTA 1KQNA 4ESEA 1IU9A 1N33B 2G5GX 3ACCA 1E3WA 3TL6A 1QPBA 2Z2YA 4H1UA 1DEXA 4ZDIA 1HWYA 4K05A 1OUVA 2EQAA 4JZYA 3SE0A 1N2CA 4TLAA 1TM3E 1A77A 4TLMB 4JI3B 4RVBA 2G28A 3KYDB 4KXFB 3E37A 3DZ8A 1UPCA 5EGSA 3R7AA 3UT5A 3WWYA 2AW3A 3OTOB 3NBNB 4J6EA 2XXJA 4UNSA 1T3HA 2ZVPX 1OT8A 5SYAA 5FZQA 1AKWA 5U4QA 3U17A 2CXRA 1H65A 4US2R 1C8LA 2V7TA 4DAOA 4XD7D 3A32A 3UMFA 1STOA 3QK7A 1ZD9A 4RVNA 2FG5A 1W1WA 2L19A 1EK2A 2AXZA 5A04A 1ADGA 1E0SA 2ZE7A 3FI0A 1DIHA 2CXHA 3RK4A 4A1SA 3G5AA 1XCPA 1J8QA 3IJPA 3QF4A 4LEUA 4P9NA 3OJEA 1RM4A 4ZAZA 4RM2A 3BA1A 2ZJFA 4MQMA 5ILQA 1VKRA 4QJ5A 5FTMA 1BROA 2BEUB 1MC1A 3DDSA 3DOHA 4EWLA 3DR5A 2DUJA 4AP9A 1U28A 5FBWB 1K3TA 1UP7A 2ZYDA 4LMPA 5EN4A 3S44A 2IFTA 2I1VB 3G7SA 4RA9A 3KVYA 4DMHA 3C6KA 5AFSA 4JYAB 4JC4A 4BZPA 1MC4A 1NBHA 1JA1A 4W1QA 1NOIA 3WAJA 4LCTA 2K4MA 5K3BA 2ORWA 9ATCA 2VGYA 1WKBA 4D92A 4KPGA 5KYXB 2O7QA 2XNJA 3ZZ1A 4H3KB 4C7JA 3K35A 5AVKA 1NLFA 1DGQA 3T3PB 1ESNA 3ZXXA 4X94A 3BC1A 5KJ6A 2ZJ1A 3AHGA 5M7EA 2XMGA 2WJYA 2R5SA 3LFUA 3J7TA 3LLUA 1X3LA 4MGYR 5HS4A 2HMTA 1MH9A 3N3AC 1V3UA 5A4AA 1QIEA 1SIOA 2Q1UA 4XGNA 4DQXA 5FT9A 4HT3B 2VCHA 2XE4A 3OUUA 3FPBA 4B3XA 4DOMA 3GZNB 2AI1A 3KSRA 1WXQA 1M2VA 1NFIE 1JLRA 3HCBA 2XWBF 1FPMA 1NA5A 4A63B 2C00A 4RXTA 4WLUA 3T7EA 2IV3A 5IKPA 5MHTA 1IUOA 4F11A 3AUUA 1RLIA 1MORA 2QX6A 4Q37A 4KLRA 3H13A 2HJVA 3PFIA 4R1PA 1ZUD1 5AYWD 4W4TA 3EHEA 3JR7A 4MYTA 4C7MA 2FQYA 1W36D 3HCCA 4HYQA 4KC0A 1B3RA 1C9KA 1T8SA 2JPDA 1NW4A 2P3OA 3GAMA 2VNSA 2YN0A 5MFZA 3GBSA 3CVPA 1P74A 3FRJA 3GAZA 3JARA 3P27A 4IX1A 5T5QA 1Z6AA 1U7PA 1ZONA 4Q93A 4WXRA 4PZYA 1UFVA 2YXLA 4A0GA 2GN2A 1SK9A 3FIUA 3UJ7A 3CWZA 4LQLA 4E2XA 5J2TA 1EUCB 1FFAA 4B33A 2B0JA 5JRJA 2A5DA 1G5IA 1YZLA 2ZYRA 4GQBA 4HDRB 3KEOA 1C41A 4JEMA 4PC2A 4RVFA 3UJPA 1IWPB 1HYHA 3WL4A 1PR5A 5AO9A 2CJXA 4J7XA 3K16A 4CLRB 5KIAA 1U1GA 2WU0A 3CHOA 8GPBA 1WCYA 3HXKA 2DFNA 1CTQA 3JWGA 1VHJA 3SBEA 3W6OA 2CC2A 2FMUA 3NH6A 4WN9B 3UFXA 4QFBA 1NJ8A 3EODA 4JD5A 4RK7A 5I7OA 2PXCA 1E0DA 5G04C 1VMAA 5LUAA 3NWEA 1A9QA 2UZ0A 3O82A 1XAGA 5BMVA 5T7BA 4G0MA 2LNIA 1TAQA 4ALKA 2W2PA 2YUTA 2WEKA 4LA4A 1CJBA 2B82A 3BXOA 1X42A 1LXCA 1M6VB 5CT6A 3UM9A 4B09A 2ONZA 8ADHA 3INTA 3HBAA 2V3WA 4HGQA 2JJYA 3GLGE 1K1AA 5TE9A 3RJTA 1GDDA 1BEUB 1ZGCA 3MMZA 1IY9A 1KTIA 4XDHA 3S7ZA 4CI0B 1GNVA 2ZLBA 1SG9A 3EC7A 3PC8A 4N49A 1XA3A 4WINA 3CIFA 3GYBA 1J8MF 3JZFA 3HKBA 3NPMA 4BO0A 3PX3A 3UT7A 5CX1A 4C05A 4B8AA 2WW8A 2Z2JA 1JH9A 4X3OA 4YT2A 5IVKA 2I4MA 1E7MA 1UJNA 1VB3A 3S8YA 3AO0B 4I1RA 3RUCA 5IHXA 3JQQA 1R3DA 4LDRA 4O2BA 5K0LA 2IVFA 1IPHA 5FOXA 5BXYA 3T5XA 4GYKA 1P1IA 2FEZA 5DGTA 4YRAA 2H5JA 4BN5A 1VOTA 1PEYA 1RD4A 2DPGA 3F3SA 3KZXA 1KKUA 3RIYA 1PQWA 3KXKA 3ZK9A 5CIYA 1C7JA 1EM6A 1OHHA 2L82A 3WVNA 4D81A 1V35A 2W93A 2XVZA 3I34X 1Z3XA 3RHZA 1AQJA 1KH1A 5HQ3B 1VXRA 4OUDA 2R7MA 3R77A 3E58A 1VL6A 4O8ZA 1IXZA 1UQUA 3BRWD 1A95A 3D4OA 4DR6B 2CXUA 3A1SA 1S2MA 4JOBA 5A1TA 1EEXB 1NFFA 1Y3DE 2WTBA 2DYRE 3QU4A 4QNNA 3R9KA 5A1JA 2VH2A 4CLEA 4AJ9A 1WCXA 3ZGOA 3ORQA 4R3WA 3RTCA 4R8RA 3RU7A 4JI7B 2W4IA 2F3RA 4G6ZA 4PYKA 1W88A 5KBYA 1YS9A 1AMUA 3UB3A 1Q0SA 1RQGA 2ZJ6A 2PSJA 3DMDA 5EKSA 1Z0ZA 1WP4A 3G89A 3PRJA 2AWIA 3H1PA 2ZJ3A 1M6YA 5CB4B 3TSAA 2QI9C 2YV4A 4I4LA 4RK6A 4FWIB 2BMVA 3SQWA 1EQ2A 3EGXA 3Q9UA 2Z95A 3JQ0A 4OY3A 5CB4F 1IHBA 3AJIA 4E07A 4RJKA 2F00A 5K8JB 1HF3A 2P9YA 1DAHA 2GUWA 3DDUA 4KR6A 4L50A 1E2NA 1NW3A 2E7ZA 2O2JA 4UQOA 5CXUA 2AKEA 3JQAB 2QXUA 1FFXB 1D04A 2E85A 2R4UA 1AQIA 1VI5A 2ZI6A 4Q4HB 3WI7A 2VR1A 2A1TS 3DTTA 3HSSA 3OBIA 4GC5A 4R05A 2WF9A 3H9QA 4PYIA 5E9AA 4CKXA 1XZLA 5G0UA 4Z2AA 1YYHA 3ESRA 4ZGWA 2H51A 4TXNA 3EHRA 3TUZC 1N4DA 1IPFA 3WX0A 4AXHA 1A4IA 1JKJA 2B6HA 2FPRA 1K0UA 3DBHA 3E3MA 5DYIA 4CUZA 4DLZA 1N5IA 1UMBB 1YACA 2IELA 4ZI7A 4JI8B 4BWYA 2UYOA 5BRNA 2QVXX 3T4PA 1XTTA 1YJ5A 3D2BA 5AXAA 3U7RA 4AC9A 4GXQA 1HLGA 3T5BA 3P9QA 3Q5EA 3QVVA 1TKCA 3G8AA 3O4ZA 2VPWA 2XCIA 1Y6JA 1CQXA 1L4KA 4WKGA 1EFDN 4E5UA 1AC5A 1M2NA 4R40A 4POOA 1LPAB 3EIQA 1Z3IX 4WXMA 5AUPB 5K8TA 1E2LA 1GUDA 2JHGA 5IT4A 4JT9A 4QXQA 4QOHA 2A1UA 1B6RA 4JB3A 1ML3A 4DF3A 1ZC4A 3NATA 4PNEA 4ZO7A 4V0RA 3AI7A 4TMYA 5BSRA 2WTXA 4OQMA 3SZOA 2Z58A 3C3JA 3O8BA 4FJ2A 1U99A 3IOEA 2HU8A 4JB2A 1TZMA 5A0FA 2QSYA 3BH0A 1N5OX 1QGUA 3GW8A 4XJSA 1TKBA 4DDUA 2BUCA 3IBTA 3GP8A 2FTKE 3EFHA 2O4UX 1J06A 4R9RA 2FSGA 3RF6A 3L9TA 2HPZA 2HWWA 2Z8YM 3B6IA 3R2JA 1T8UA 1PN3A 2VK2A 3PQEA 1HQDA 1VIVA 3A37A 4OYRA 1WXXA 1C3OA 3GLKA 4FOTA 3P71T 3UUEA 5ALOA 3USZA 1NJ2A 2UV8A 1B42A 1Y63A 3H9EO 3FPAA 3MFYA 4MYDA 3KD7A 3JQPA 3L5KA 2PSFA 5DWVA 3FOBA 2VZ0A 1V2HE 1AKVA 3GMIA 1SKAA 1GQQA 3H7IA 2YVKA 1CUCA 1DFHA 1E7VA 4IR7A 2IY0C 4JNCA 3UKRG 1OC2A 1GFZA 1U11A 4YBRA 2HHHB 2IS2A 4MUXA 3WR5A 2BD0A 5CYFA 3ZGVA 1GJRA 2ZSIA 4LDJA 5J3JA 1OVMA 3SXUA 4J07A 1FB5A 1O8BA 5FLYA 2YV3A 3VMFA 3SJZA 1X38A 5TY0A 2IUYA 5I7EA 2F37A 5BXUA 1DTSA 1FPQA 1NIJA 2QN2A 4G0YA 4V03A 3CPJB 4XQ0A 3VR6H 1Z2CA 1CUEA 1J42A 3SU8A 4BNXA 1WDLA 4AP2A 3OZXA 2X5KO 4EZEA 4X1YA 3EX7C 4N76A 1ULAA 4F12A 3A2MA 3PRZA 1UPTA 1QIHA 1VHWA 1WZNA 1OLUA 1YRYE 2FFAA 3AB8A 3PC7A 3AJAA 1Y9JA 3VLFA 1ZPDA 1CDEA 1JI3A 1GCOA 2XNDD 2NUBA 3ASYA 4O5OA 2IXEA 4M1OA 4UMFA 3DOUA 4J8DA 1JI0A 2G1PA 2QRNA 2VZEA 1XDSA 4KQFA 4WCVA 4WADA 4ILIA 1KDYA 4OOEA 1D2AA 1G20A 2OD2A 221PA 3H97A 4NFLA 4P31A 2VDRB 4G1MB 3V7FA 3SLKA 3WC4A 4D80A 1QX3A 3Q88A 4F6RD 1ZKDA 3WRWA 4Q47A 1O1YA 3ZX5A 2CZQA 1HMYA 1ZICA 1F4PA 2WTAA 3LQKA 4OVUA 1OWOA 3TOZA 4JUDX 1EVEA 1RI4A 4H0NA 3R1IA 3U0VA 3LDAA 1J8VA 2IZ7A 3HJAA 3JRXA 4JJKA 4QGAA 1W8DA 1BWQA 2XPZA 1A9RA 1N6IA 2JGAA 4XWOA 4IXNA 4RWZA 5G04J 5C8DA 4MRRA 4NJOA 1TW3A 2I5PO 3JQ8B 5EKDA 1RWMA 4H7JA 1W9MA 2CCJA 2BFAA 2VC2B 3GUYA 4M3NA 2PGLA 3KFVA 3DE3X 2Z8ZA 2X1HA 4I4IA 5LKRA 2JLWA 1I1OA 5CLIA 1W19A 1YBMA 3H1FA 4UAJA 3LDFA 4PX3A 3GLHE 2UZ1A 4E3ZA 1ZNZA 1P91A 1JMKC 1U0JA 5JH7F 1MX2A 4KQ2A 1CS0B 1UWCA 3DXFA 2FZVA 4K6OA 1HDIA 3O21A 1CJMA 4GM4A 2WXQA 4HQLA 5P21A 3V31A 3NHSA 4ACKA 1CXZA 2R7LA 2B94A 1B8UA 2WAXA 2AC4A 3IMGA 3JQ7A 2WY2D 3ZPXA 2PD6A 4RPIA 3FFXA 4R1SA 2ID9A 5EGNA 4ZTZB 3AIKA 4MGEA 2WXNA 3NTXA 2B37A 3NGXA 2BHTA 2WTEA 2PRIA 4GNKA 1QBGA 3F46A 2JEYA 2XCTB 3EDCA 5DNCA 1OZGA 1NZFA 5JC8A 1BXGA 2QE7A 3DXMG 2HHCA 1VI2A 1ZOPA 3IV9A 2CT8A 3EWSA 1AA9A 4L85A 2GHRA 2FB9A 4OQDA 4QQFA 2NT4A 3EE6A 3CXRA 3WY9A 2ETXA 4JU9A 2Q8PA 3CCBA 3Q0TA 1ZNXA 1DX4A 2QNBA 3O93A 3IBSA 4NU6A 1SQ0A 4QODA 5IKMA 2TMGA 3KJIA 4HGYA 1GL3A 2ZIRA 4JMPA 5ARDA 2NU9B 4DLNA 2PMFA 3GRAA 4HADA 1E5LA 1Y81A 3TJZA 3RRMA 2FNAA 1V39A 3NHAA 3NHPA 4F5DA 4IX9A 3ZNOA 3QOWA 2YYSA 2W6OA 2D7JA 2PZFA 5KTKA 1U2RA 3Q6MA 4MKGA 1MOZA 2NXPA 3ZV6A 1Z4PX 2AXPA 4JBYA 1HURA 3JAWB 2YR0A 2R8PA 1GZ7A 2OHJA 4S05A 5JCPA 4UI9C 3J5PA 5CXXA 2SBTA 1ZZGA 3KAKA 1SOAA 5DIFA 4MMYB 1FX1A 5C80A 4GX1A 4WLEA 5CLJA 4BQFA 4LWZA 4MAFA 2WV7A 1A5BB 1C8KA 1G8AA 1RJ9A 4FDVA 4KLAA 1SUIA 4XLLA 2ZUUA 4ZANA 2HRCA 2ICAA 3H6HA 4UZFA 4N47A 1I14A 2B25A 2ZT5A 1R4MB 2G04A 3PS6A 1PV4A 4BN4A 4LX8A 2BTEA 3DOCA 4RUKA 2M6SA 3T7CA 3L82A 1NMYA 2WTNA 2ETBA 3F6YA 1UBSB 4K9DA 2CFRA 1GU0A 3BTSA 5GM2A 3WAGA 3D5EA 1FBNA 1FTWA 1QWSA 2JHAA 2LR0A 3BBLA 3QMPA 4V3CA 5E0OA 4FQ7A 5EOVA 3RM3A 4B4DA 2VHUA 4BLVA 4NQ0A 2JIMA 3I5PA 3SMQA 1ZDMA 2FCRA 5A5FA 4B3DA 4NCBA 5KQGA 3ZWXA 2IXDA 4YJFB 1IZ7A 1G7SA 1LW7A 1DL5A 3NAQA 4ND2A 4BFRA 3NHYA 2CL0X 5FEMA 1UL1X 4LSMA 3TJMA 1PEAA 4HATA 3V8PA 2OVFA 1F5SA 2FFRA 1N2JA 1LNSA 2HUNA 3VPCA 4INZA 2XF2A 2IEAA 5KVQA 4DRXE 1RLOA 2IT1A 1N95A 3I6QA 4FBGA 4GXTA 4YAJA 1E6UA 1L7MA 1SVOA 5AW1A 3PFFA 5ES4B 1YF3A 1U3DA 4TX1A 2TYSB 2OCDA 3HWX1 4U0JA 4S0XA 4WV3A 4CG3A 2YIVX 5DM1A 3RFUA 5BN3B 3PEUB 1G3RA 2IYFA 5B58T 1UOQA 5K05A 2VDOB 4Y1RB 1T4BA 2Q3CA 1W52X 1CEQA 1OCZE 1FLNA 1W5BA 2HB6A 3NYIA 4BBJA 1P5JA 2BKXA 1RWOA 2NQ8A 3CEJA 3Q5MA 2C8VA 3C7TA 3NC4A 4Q3DA 4B6OA 1NDUA 2QZZA 2G7ZA 1CRLA 4BVHA 4C0HA 3PGMA 4OXQA 1YCGA 3QUTA 3C7DB 4WKPA 4ZPJA 3RYTC 2FHPA 5JZSA 1HT1E 2PX3A 1ZIOA 1Z5ZA 4U0KA 1KZGB 3RAJA 4B7UA 2I71A 4JP5A 1GUAA 3F6CA 3LA6A 1TJPB 1A5AB 3UI2A 1USUA 1R27A 2XA1A 4O02B 4ZYTA 5AJTA 4G07A 4MS6A 1KTVA 2WIDA 5M2QA 4G5XA 2WQ6A 1CRZA 2QD5A 3FN4A 4HBZA 4B3IA 1JFTA 1NA0A 2VZ8A 3MV3B 1OXUA 1EXNA 1YVEI 3RSQA 1TQHA 4LC9A 2EGGA 1GCGA 2FWIA 1JV2B 4YONB 2YOHA 3P1UA 2OK8A 2ZSFA 3IA7A 4I5GA 4MQFB 4UC0A 3BSSA 3JASA 1F1JA 4ZI7B 2I29A 1C2YA 2DFPA 1TM1E 3KC2A 3GPBA 3KPWA 3F5FA 3E2MA 4ARZB 3ZCTA 2O50A 4IIJF 2HWUA 4E09A 5AW5A 1RAIA 1HU3A 2I3BA 2AOUA 1KI6B 3S7DA 4WY2A 2P4QA 4C07A 5MDHA 2HQOA 3K1JA 3TYXA 1XAJA 2HMWA 4HFGA 1G9XA 1W25A 4GYWA 3PCXA 4G0WA 3O7WA 3QK0A 1NI5A 4GMFA 5I9IA 3RARA 4BU1A 2PXAA 3BHIA 1JGTA 2O3JA 1G21A 2R6R1 2W6JA 3EVGA 3OT1B 1FJXA 1GPWB 4EZLA 2RHJA 2H6EA 1RNLA 3LH5A 4B83A 4P29A 1IN1A 3AP1A 1JWAB 1E6CA 2NYJA 4PQGA 1P9LA 3TBHA 2L2QA 2EGHA 2UYGA 3IULA 2P35A 2J31A 5CA0F 1I3MA 2YZKA 3PC2A 4IH9A 4EG6A 2GTHA 4PYRA 2IU3A 2F43A 2ISCA 5JR3A 5C4MA 4YIHA 4KQKA 3ILHA 2IYVA 2VA8A 1A96A 1G1AA 2YVLA 3AK4A 1W4AA 2BY4A 3OP1A 4FDLA 1A9XA 2H4JA 5ALZA 1MO4A 1P5HA 3F6EX 4DMUB 4Z51A 1UZNA 3O8CA 2XADA 3COZA 3R6LA 4HJXA 2Z5VA 4IKPA 2I6UA 2E4AA 2GO1A 2ZSUA 3ND6A 4J0DA 4LBVA 3A1NA 4EABA 4RZQA 4AKSA 1JLKA 2ZIVB 3TLGB 1X1RA 5JCOA 4E5KA 1FMLA 2D2IA 1J7JA 4ZJYA 4HDKB 1DQNA 3V8BA 3U4MA 1QVRA 2X5XA 5EE0A 1A82A 3LRXA 4HRVA 2GESA 1DMSA 3NONA 1KDTA 2XJ4A 3WYFA 3BGIA 4BO2A 1MPTA 4NE2A 1ENZA 3MMNA 3NOQA 5JAZA 3OQIA 4H77A 4HS2A 1OB2A 2RJ3A 3OFJA 5DBHX 7GPBA 3JVEA 4B6JA 1KZ6A 1T10A 1N1DA 3OZ7A 2EKPA 3DONA 3TGOA 3C7KA 3PD1A 3T5CA 1XMSA 2FUCA 2F7SA 3TWXA 3W2TA 4LZPA 4HS4A 4ER7A 1OMOA 1Z7WA 2O2GA 2QZSA 1ZOIA 3GFSA 3RWMB 3EPPA 4WK6A 2AI2A 3QENA 1M2GA 1E98A 1YGYA 3ESCA 4DR1B 1WMDA 1UC5B 2QORA 2JK0A 4KE7A 3NG1A 1S2NA 2O7RA 1BC5A 1FA9A 3RT1A 5IPFA 1QYCA 5LCWJ 4NG5A 2XKKA 4NHEA 1TMYA 1AN0A 1VBFA 1B41A 1K4MA 2Q6IA 1CIPA 5DHTA 4ZMSA 2F8TA 3UBMA 4CG2A 6CHYA 4OL9A 1C7RA 4YDOA 1K4YA 3N74A 4H18A 1UM8A 1NONA 1MKYA 4Q1VA 4ZARA 1FUEA 2FZCA 3OQOA 3I9FA 5FQNA 1NULA 3TSOA 1MJGA 1QHGA 4R31A 4NBSA 2X6HA 2H2HA 3SHTA 5A5DA 1EESA 1WABA 4LJ8A 3AEXA 4EENA 4CMIA 3ZYCA 4IRUB 4M9RA 3TGPA 3GPLA 3LPLA 1PBNA 3EF1A 3QVMA 3THRA 1HRDA 3CF2A 4MRVA 2XE6A 4FFOA 2ISQA 5AM4A 3ELUA 4D98A 1YQGA 4TXJA 3A31A 3I3NA 4KRXA 4U6SA 3ZGLA 4WXEA 1XYYA 5HX7A 1CS4C 4C0KA 3KTAB 4EHDA 121PA 4F1JA 4MKZA 3U3JA 1HOXA 4A15A 1ECCA 2HD4A 2HCJB 4HVTA 5EMNA 2Q99A 3FTDA 5T8KA 1NYTA 1K7YA 4HMOA 3VMMA 4IO0A 3L0CA 3DLAA 5KNDD 5G41A 5I5GA 3S2SA 4TL8A 4YASA 2RK6A 2FPWA 2Y2VA 3KQYA 2Z3WA 5TMBA 4E1BA 3NAWA 1WDMA 1BXRB 3JYSA 2RIPA 5JECA 4K9LA 4PHCA 4NATA 4W6ZA 5K09A 1XEAA 2F9FA 4RQBA 1TX4B 4LRXA 3TZBA 3W8EA 4EGJA 3DNMA 4GWGA 1PS9A 2VCEA 1X1SA 3HB4X 4N12A 2ZREA 1T5HX 3CLSD 4UU8A 4GI2A 2X14A 1ZM3A 3R3HA 1AF4A 1DAFA 3G2KA 1Q44A 2OFWA 3RSHA 3B6EA 3WGOA 4D8VA 1XU7A 4B75A 2QPLA 3HUUA 3MTIA 4D56A 4JI0B 4CMEA 4BFSA 1CERA 4CR7A 4AI6A 4P35A 1G2PA 4K2AA 1EVLA 3EG9B 2IODA 1G2OA 3IGFA 1A9ZA 4PFJA 3P2OA 4P7GA 1IJEA 3HDGA 3HP1A 1H8HA 4LJYA 5FI0B 3UXYA 2HA6A 4DV5B 2WUVA 2AW5A 1J49A 2SCUB 2SKDA 4GWKA 2ORIA 5FL7D 4J1TA 5I6DA 1PWZA 4WNCA 5CVEA 3ZWMA 1TE2A 1PJCA 1Z13A 3ZK7A 5JTUA 1JAYA 2YHIA 1TB4A 3D7SA 3O48A 1YMQA 4FWBA 4TLBA 4A03A 4QJIA 4ESOA 4M2LA 2O20A 2PZAA 2FEOA 1XQVA 2AOVA 2P40A 4URFA 4ZVPA 4IVPA 1UPFA 4YDWA 1TU4A 5ALRA 4TYYA 2V7BA 3RKUA 2ZT7A 3CLKA 5DDIP 1NVEA 4TXHA 1IE3A 4IVQA 3K32A 3SHWA 3KKOA 4F5ZA 3M6UA 1PI3A 4M0UA 3B78A 1Y3HA 2Y0EA 2VWPA 4K6MA 2W2LD 5CBNA 4P7FA 4UTRA 3APCA 3CRRA 2UZAA 4TVBA 1KVUA 5DM0A 2FZEA 2HSJA 5D1NA 1O4WA 1YE3A 2GPBA 3WHIA 5ITZA 4JI2B 3DBRB 4G26A 1SVUA 1RMTA 1XZFA 2W2VA 1VLLA 4ON9A 3JTMA 1UBKS 4KSYA 3KQKA 1TM2A 1U5BB 4LRWA 1LBHA 4JJFA 3AHEA 1KOLA 3FIJA 3RIGA 3URKA 3ZWCA 4F71A 3ONEA 4B45A 4KVMA 1E61A 4D74A 3HUEA 1HC7A 2X0RA 3UJBA 1Z5WA 1W2WB 1YS1X 4ILGA 3P9ZA 5JMTA 1CU1A 1YDGA 2ZXWE 3CRMA 4MV1A 5A3QA 1V4VA 2XTAA 5A0TA 1PZGA 1RWKA 2AYXA 2AFVA 2IKQA 1LPOA 1EWTA 3FDZB 1WKCA 3LBHA 4DM3A 1FQOA 5AIJA 2PT7A 2XB8A 1XWWA 1P6XA 1RBMA 3R5FA 3E0XA 4RK4A 5B3JA 4QYTA 3U7GA 3A9CA 2AL7A 1GUFA 4IJKA 4HRMB 2XTZA 2Q1XA 1LC0A 5CMLA 5HUHA 4LPSA 3UGQA 3ASVA 1QDLB 5D00A 2X5JO 1NVBA 3B1YA 4BZQA 1C29B 2WFMA 3OX3A 2FZLA 5ANRA 4FDUA 4AQDA 4ZEXA 3OXFA 1LQ2A 1QRSA 4F9TA 5EYPB 2UXBB 5H4GA 4CMCA 3HJGA 4AJKA 5JT1A 3VUFA 5DXAA 2JGIA 1G41A 1KO8A 1J4AA 1Z2DA 2N9UA 1TZBA 2ENWA 1Q1GA 5CG2A 4TRRA 3VKGA 3ZXUB 1RQRA 3BTOA 3G5TA 1VCNA 4N0PA 5HVNA 3UAYA 2FMIA 2MDTA 2UZ3A 3VR0A 1A9XB 2ILVA 2Y4TA 2F9LA 1EFHA 3ZWNA 4DRZA 5H8WA 3BICA 3C8HA 4RH3A 2I2AA 2R68A 1QM5A 1H93A 3LF2A 3G49A 4PNHA 4P0PB 4I6EA 3I04M 4CL8A 2I2WA 3FLAA 5AW2A 4MW2A 2GRRB 4EG7A 5BYKA 2VBIA 4K81B 1AKRA 2SKEA 3RLFA 2C2WA 3W6ZA 3W2HA 4KTVE 4Z4IA 2OHGA 5T67A 2GGFA 4IW3B 5CGQB 1OT5A 1E3TA 1Y8QB 4EVSA 3RK0A 2BFEA 3TX2A 4EKNB 4IMJB 4OA8A 1G8HA 4IGFA 5FA5A 3D7MA 2R1VA 5JAQA 4GTQA 1QIMA 1WX1A 2XA9A 3PNBA 4B79A 4U2FA 4JBHA 5J1SB 1IAQA 2DWUA 3KKPA 3UV3A 2ZWOA 4C6RA 2LUOA 4HWRA 4LJRA 3VDXA 3IO5A 3L6RA 5GZ1A 1HDYA 3TIGA 5FQ8A 4KVGA 1MABA 1QO0D 2EF0A 1G20E 3A6JA 4D4GA 3JQ9A 2J59A 4YCCA 3HS3A 3A3KA 2QBYA 2RB4A 1ZP6A 3MWDB 3VO1A 2PZ8A 4AICA 4UNPA 1NNSA 4FONA 1I1QB 1MB3A 3L93A 3G5UA 4NICA 1EHCA 3LL4A 1YJXA 2CLHB 2VJCA 5CGZA 1S8NA 2PAAA 3GEMA 1ZGBA 1K3FA 3HDHA 3ZHZA 3EQZA 3GH3A 5LP1A 3TR0A 1N25A 4Q9IA 5JBQA 4A2QA 1YRQA 2B61A 4MK4A 4S2UA 3IP1A 1HYEA 3QVOA 5C2YA 1WNFA 4GDMA 5DX0A 1R8YA 1KEWA 3FUWA 3U44A 2V9PA 4DR4B 3VTFA 3T34A 2GRQB 3A6ZA 3FB4A 3BDAA 1PAUA 3OURA 4U7FA 1D5CA 5JFGA 1IOZA 3A6HA 4P4SB 3UGKA 4JLVA 2YY6A 3UGTA 3RHSA 1N7JA 4FADA 2CLKB 2RIRA 5A9TA 1BX1A 1NUAA 1NDHA 4HLEA 1V25A 4PF1A 1A5SB 4QPDA 1LEHA 4ZKEA 2NUAA 2VJBA 1W30A 3AG3E 2JANA 4BLWA 4URUR 3O83A 3N53A 1JUQA 1TT5B 4MWBA 2YRXA 1KI8A 2JAHA 2ZRIA 3GT4A 3UATA 4HGPA 4UHHA 4OHVA 3TCXB 2PM6A 4BFVA 4UDXX 3SBDA 4I8XA 1TVKA 4JJAA 4BLTA 3GX1A 3UWMA 5FZSA 2MR6A 1ZD2P 2QD4A 4X6YA 4AYWA 4LFCB 4BO9A 2R5NA 5ADUS 4E70A 2HNAA 1OI2A 3KELA 4ZREA 1SC9A 4C0SA 1PEDA 5CM2Z 4CKWA 3SVLA 4RYDA 2LIVA 5J5VA 3RBXA 3KOXA 4CV3A 1G6KA 4OFZA 5JZBA 4YIKA 3DPIA 3IMFA 4B43A 4MQBA 3A4NA 3AFHA 4XM1A 4AX8A 5ITZF 1F6BA 4G81A 2HJSA 4UM7A 4F1KA 4EVIA 1KP9A 2Y0CA 3TQQA 5AK4A 1RCTE 3JQGA 4MKIA 1X87A 2NPIA 4PQFA 1HFKA 4JIGA 4BNKA 3QJYA 2YWDA 2F9MA 2MR5A 2PDAA 3AETB 1N2EA 1JECA 1RM5A 4Z4FA 3ZLBA 1ZVQA 4XQGA 1AQYA 4O4LA 4Y9RA 1M6HA 2BEUA 4JFRA 3DP9A 2Y1WA 4I5FA 3WKBA 2VYIA 1S5PA 1DWOA 4JT2A 5CU7A 3EPRA 1I0IA 5CEDB 5DNAA 2QR5A 4ACBA 3MCXA 4IJQA 2JNWA 1WDKA 3O4FA 3GFRA 1XVTA 3LFTA 4MS4A 4XQEA 4XR4A 3TE6A 1XLVA 2GYUA 3RSZA 5DM70 1X7XA 2VDKB 3CNNA 5I48A 3VV2A 4UAUA 1Z4KA 1CBUA 3CVWA 5K3CA 4UM9B 4YMLA 4BB9A 2W2KB 5GVSA 2G82A 1J23A 2B8TA 4BP8A 4NZZA 5I7VA 2QE6A 4AZSA 3TTYA 2PT6A 2P9LG 3N07A 1TO6A 4KXMA 5EZQA 3CSFA 3TQFA 3VR6A 3ZCUA 4CKCA 3PUIA 5KWVA 1JMVA 1J25A 2ZSHA 3EF0A 3I23A 2GZ2A 1VHLA 2X0KA 2NO1A 2BKUA 2EBFX 2W4MA 3KU4A 4OVKA 5LLTA 3MT0A 5CDUA 1E3WB 2C4TA 1K8QA 1TKAA 3ABQB 1H66A 1WXWA 5CJ2A 4G1FA 4U2BA 4BNDA 5KKNB 4X64B 3OO1A 4FB5A 2I0FA 4RZ2A 1JEDA 1S4MA 4REMA 4F4HA 1PWEA 1CFZA 1J2YA 2YJ6A 4R3UC 4MZXA 2FO7A 1AKEA 3ZBUA 4F6CA 2WU3A 5K99A 1L5WA 3CQ9A 3PA8A 4DV0B 2A57A 3AF0A 1EZ4A 1FNSA 3RV4A 1FVHA 1NI4B 4F21A 1E3DA 1SU6A 2WFLA 3HI6A 3I4LA 5A62A 2AD5A 4M98A 4GDFA 3NEJA 5FH9A 2DWZA 3TM5A 2I6TA 2IK8A 4JDPA 2JZNA 3AJ9A 1F17A 1JE1A 3ROGA 2RK3A 1QFZA 4LF9B 1EDZA 3RAEC 5KOJB 4LYFA 5HHTA 4YJ3A 4MSUA 2KM1A 2PNFA 3FTCA 2AUNA 1WV0A 3HCEA 4M8SA 1V16B 3ENZA 2FWAA 3I4CA 4LDQA 1IK4A 3L22A 2ZUTA 3O73A 1E99A 4YV7A 1KIMA 4UNQA 1DO0A 2IPAB 1PRYA 2H07A 1WOMA 3ED1A 3HGQA 3TW0A 1W94A 4XFJA 1YU6A 4RV9A 1AK2A 1UXJA 2VOEA 1PJQA 3ASUA 3UV7A 5BT8A 5HUJA 3CNOA 4MHTA 3JQ8A 1E89A 1ZGHA 1ODJA 1X9HA 4CGZA 1FFEA 1YB4A 4R2JA 3W78A 1UWLA 1ONOA 1RAAA 2EKDA 2WSLA 1WXHA 4JQCA 1KI9A 3HQ4O 1FX0B 3KLPX 3LU1A 3PNVA 3V1TC 1HRKA 1J56A 5B2EA 1O0BA 1MYOA 2JATA 2GVNA 2J3KA 1H2XA 1T4CA 2O9JA 4UXHA 3IV7A 4JQYA 3N6VA 4WBNF 3BE6A 1TCVA 4FHZA 5F78A 1J20A 3HVRA 1IN8A 1CUJA 2V4UA 5AWFC 4IOLA 4D6PA 3H3FA 1GN9A 2G1AA 1U2GA 4I7EA 1XCMA 2DHDA 4DNOA 1K98A 5CBOA 5KYWA 1N57A 3CXUA 2W2LA 4I55A 3JATB 4H7EA 1YJAA 4D9IA 2ZJ4A 2ODEA 2X6KA 1SKUA 2QN6A 4HAWA 4J0CA 1KMCA 3GA5A 3W3AD 3HI4A 1U0HC 3HP7A 3RFTA 2HRZA 1KXJA 3GR6A 2VJNA 4RZSA 3IUJA 2YXDA 2A5FA 2D0OB 3IVAA 2W70A 1WMSA 3HO6A 3KLOA 4MP8A 4Q5IA 4DXAA 5FBVB 2C7BA 2JRCA 2QRVA 3AETA 3H5IA 3R9XB 5K4GA 1K6MA 3BD8A 1GV1A 3IKVA 2NLOA 4EY5A 4GH5A 3N0RA 1RI2A 3JAKB 4JQOA 4OQYA 1Z0UA 2GFHA 2I1QA 2IU4A 2ZBQA 3WYAA 1CT9A 3E22A 5IM5A 3P9RA 2GK3A 4N40A 4QPCA 1CY6A 2H31A 4FX5A 4CBVA 2ZETA 5EP1A 4OQQA 3ZCPA 2IRWA 1EAYA 4Q7KA 2I03A 3I5XA 2HI0A 1P0IA 3GYZA 3CH4B 1M0WA 3ETDA 3IQEA 4R4JA 4Y67A 5I9NA 4H2DA 4RSYA 3BG0B 2HIGA 4UQPA 3S28A 3UH1A 4AF6A 5AVYA 3ZD6A 3WK6A 1DIAA 3BWCA 3QITA 2F0YA 3EUFA 4P80A 4QDJA 5EKXA 3TZLA 3VVCA 3AR3A 3KOMA 4F72A 3L8DA 4CMKA 3ISMC 4UUQA 1XP5A 2QTGA 4UUPA 3OIWA 1UBNA 1NU6A 1OTHA 1R4NB 3FLBA 3B7BA 4LXIA 5DHRA 5JW6A 4OQ4A 4GZ6A 4YQYA 5E75A 1RLMA 2IXFA 2N1MA 2C2ZA 3A6FA 3QGMA 4KG7A 3AG1E 2PQ0A 4XTCS 1HZZC 1KQPA 3ZHQA 5BR1A 1SXJA 4HUTA 1E0AA 1DCEA 1MFPA 3LGSA 1U5AA 3HL4A 3R5KA 3WJAA 2OG1A 3PZ2A 2B7CA 2IOFA 2VAWA 2WZQA 3COVA 1OFHA 5LA6F 3BA6A 1FP1D 2OCXA 3BMXA 2O7VA 1U3GA 3T7KA 3T8KA 2PBLA 1JHMA 1NP6A 1PJ3A 1L1FA 1ECLA 2FRDA 5JPIA 2CUNA 1NQUA 5JBIA 2ACVA 4KZCA 3HYMB 3ZVLA 2H2AA 2PWZA 1PY1A 1A2OA 5EE9A 1WHTB 3IHKA 3S2FA 3TWTA 1U4SA 3RYHB 3U4DA 3E53A 2GCOB 5DJ5A 5BSHA 4UOQA 5IARA 3ZY2A 1LTXA 1D3AA 1JQLB 1FEZA 3FDJA 3HCFA 2BGTA 3M1IA 1KE2A 3RS8A 4JELA 2RAFA 3HR4A 5CVVA 2VAPA 3VPDA 4ALIA 3VH2A 1SW6A 2IVZA 1P9WA 5C4IA 4IXWA 4EZJA 2Q0XA 1V45E 4AX4A 4CLDA 3U7IA 4OAVB 1P2UA 1GQ2A 1QO0A 1YD7A 2DT8A 2GCEA 4KFCA 1FTYA 2CYAA 1HTTA 4A8PA 2JJQA 5J90A 2BMEA 2ZUVA 4MV3A 2ZXUA 1NG9A 1GZDA 3PR3A 2QRUA 2HIAA 2P4SA 3B5EA 1A2QA 3ENVA 3ZLUA 2X9QA 4UI9J 5I4IA 3GN2A 1X2BA 1B15A 3IAM6 1MQAA 2M32A 3NTOA 1WMEA 1EK0A 1KJYA 3L0ZA 4KYUA 5DP1A 4BERA 1GPBA 2QLTA 4CGVA 2RAVA 3LQRA 4LAFA 3UAGA 1MZPA 1BOOA 3P19A 1SEVA 2E89A 3JRWA 5F3DA 2GBPA 3IJEB 1JFRA 1GVHA 1KYQA 3C98A 4NBNA 1M74A 1XJ0A 2OXCA 4ZWNA 3RSLA 4Z1MD 2QR2A 5IT9A 4JLUA 4WDQA 1EH5A 2Q9UA 4G4GA 2OD7A 1BHJA 3HMQA 1QCDA 2H1WA 1Q84A 1UFQA 1YB2A 4H7KA 4AO7A 5CVTA 3D6JA 1CS0A 1PBTA 4Z0TA 4KXNA 4L78A 4Q9KA 1J9ZA 2HXSA 4NARA 4S1NA 2GGSA 1QBQA 4EAAA 2PRZA 2GCGA 4ADSG 2OCPA 2G71A 5BSKA 1T0UA 4QICA 4ILEA 3T5PA 1KI4A 1LNZA 3RAGA 3PVLA 1JLLB 3WYBA 3QWWA 4CKEA 1L7QA 1IZZA 3R76A 4HG2A 4PRYA 1W6RA 4PV7A 4U7GA 5JNTA 3SQXA 4BRWA 4GI3A 3DQQA 3G2TA 4U2DA 3TECE 3FULA 3RANA 3ZN2A 5KX5A 2GM3A 3LOUA 4M0DA 1WLYA 5ALNA 1GKIA 1MIHA 4KYVA 5C7IO 4GYOA 2Y0PA 3CJQA 1TQ2A 3MGKA 4L22A 4PSUA 4V39A 1T0BA 2X8AA 3AOGA 3PNKA 4H27A 4OUDB 5BWCA 1OWMA 4M1EA 4L0QA 5B12A 2PGIA 1AQUA 3SZ3A 2V7VA 3IXQA 1Y6RA 1NTRA 1V8FA 1N9GA 3JWIA 4LNAA 5T3UA 5B2FA 1KYXA 3NTLA 2H06A 2P2CP 2BDEA 3WNDA 1HDOA 1RPAA 4UNRA 4KR0A 4HRYA 3I8OA 1B8OA 1AKUA 3L13A 4F53A 1O97C 1WDWB 2IIBA 2OM6A 3GARA 4A2PA 5JSZA 3C5VA 1GFWA 2FP4A 3LCUA 1UJJA 1BLXB 3HG7A 3LZCA 3SFYA 1OZ0A 3KB2A 4GMGA 1ZI8A 4MULA 4QL3A 3MYVA 3DXZA 4Y18A 5HK8A 1L5FA 3ZHOA 3DP7A 1XMJA 3KJZA 4NH0A 5BT9A 4D8TA 1OZAA 4DDTA 5M29A 1ELKA 4J3JA 3D1VA 1CY7A 3ZI4A 1YZUA 1MW8X 1FDUA 4NS4A 1S1MA 5EMMA 1E79A 1PZFA 2R5FA 4U0SA 4ALLA 4O2AA 1SCAA 4DZRA 5EXEA 1Z8FA 3I2HA 1XZJA 1I9GA 3MOGA 2QDXA 3O0DA 4J4BA 2ZUWA 4Z5XA 5KS2A 3NHJA 2AVDA 4O4HA 1TKRA 5I7SA 1WUKS 1P2SA 3NQ41 1SQGA 2C1XA 3WGQA 1MV8A 4Y0AA 3K72B 2L69A 1WRBA 1OJ7A 1XRPA 2PZLA 1G8MA 1OXMA 1PJBA 1RAEA 2ZE5A 4R98A 2WMDA 2F59A 3D0KA 2BUBA 3U37A 2FEMA 5KNBH 2I8CA 2Q46A 3SZMA 1V47A 3FH7A 5EJIA 3AZPA 4KAAA 4BB5A 4PGHA 1C9JA 1F5NA 2WXPA 1ZY2A 2X7XA 4JODA 4HYTA 1RCUA 3DBOB 2QTNA 3BGVA 5CX4A 4D7AA 2DETA 3IP7A 1KNXA 1J2UA 3K6JA 4IG4A 4KR7A 1NC1A 1DXOA 1P7YA 2ZUCA 4YRFA 4HCJA 3ISTA 2AMLA 4PO8A 2ZBPA 4X63A 1ZOSA 4JEUA 2BH2A 1L6IA 2WJ3A 1PTJC 3U1TA 4I1YA 1V8BA 1Q22A 1QH9A 2E82A 5L8VA 1SXJE 5E1OA 4TV8B 1AHPA 3UICA 3IPRA 2CLMB 3L8YA 1ULBA 2HNBA 3AHHA 1XSEA 4L95C 5BRAA 2GAIA 5CR9A 1XNQB 2CLOB 4MLDA 3R40A 3DYVA 5LOZA 1M2OA 2DFDA 2ERXA 1HXHA 1EPUA 2F8YA 2DOKA 2HFKA 2OV8A 2XR1A 4Q66C 3B13B 3SC4A 4D6YA 4J7AA 1E4EB 1RBQA 1OPXA 1ZMRA 3LVFO 5D6NA 2YN4A 4EHFA 3TNJA 3PWSA 5IFLA 4QSHA 2XUQA 4RYLA 4PCAA 1NW8A 1GV0A 2JGFA 4F3VA 5A3JA 1JH8A 2VDWB 3H0CA 1RWBA 5JOQA 3JD3A 4US0R 1JVSA 4N82A 2ZR7A 2X0EA 1UUFA 1P7ZA 4AUMA 3NKLA 3RYIB 3L16A 2CEAA 3O4HA 4H7FA 2O06A 2X1LA 5C34B 3G2OA 4BO5A 3HADA 3LUKA 2OHIA 2OCYC 3KAEA 3QKYA 2ZIFA 1VDMA 2ZU0C 1YZHA 3U5TA 1YI1A 1C4WA 2CHFA 3I05A 5JATA 4JLPA 2FLKA 2CE2X 3EZ2A 3RSOA 2VNIA 3OEWA 1Y5MA 3F3YA 3FVRA 2C04A 3JR3A 2QX7A 4QUEA 1PT7A 4BECA 4WESA 1MJ5A 1NXVA 1U4OA 3AU8A 3AW9A 3RTGA 5K51A 1Z6TA 4EY6A 3EXHA 4BUJA 4MI6A 2GRLA 3MB8A 4KSBA 1PT5A 2Y05A 1N11A 4P0TA 4LEIA 5KTRA 3V7NA 3FNRA 4YQEA 3NF1A 4NYJQ 1P60A 2JFFA 3L1UA 3ZU3A 2BFEB 1EP2B 3DSTA 5KYTA 4G0QA 4Z9BA 5FPPA 4H3VA 1PG5A 1ULTA 2NP7A 5KJEA 2GPSA 2AW6A 2D6FA 2X8JA 1SZAA 3VXKA 4E7OA 2BEWB 3HACA 4IMPA 3X2FA 2AJCA 3DWIA 2Q5CA 4N6GA 3IT0A 1E6LA 5LQDA 3QLVA 4ER6A 4HLUC 1NAIA 4NF2A 4V0MA 5JSZB 2ZPAA 3TCKA 5EZ5A 3CSDA 3UNXA 3MEQA 1I32A 2IBMA 4J8YA 1PJ2A 1NVVQ 1SKYE 1JN0A 1XK6A 1ZNQO 3O92A 2BGWA 5K4HA 2C4HA 5EUQB 5JS6A 1THTA 5EJEA 2VN8A 1VCIA 1KYIA 3VAYA 5GGYA 5KJ1A 2WYIA 4GKAA 4L7TA 4BO3A 3MSCA 3M2PA 4TSKA 1U2DA 4U9UA 2CJPA 1Y6GA 3IUMA 5GVRA 3WTBA 3FKSD 4RHFA 5CW2A 4CKYA 2EWWA 2AN5A 1BVYF 1QV9A 2OGWA 4GO1A 4NCKA 2C5HA 4FN4A 1O57A 5BORA 1RE0A 3HN2A 5AVUA 1JCQA 3T5MA 1V43A 1YDEA 5GIOE 1L5NA 1S70B 1ZITA 1SXHA 4IEFB 2K7FA 1A72A 1Y33E 1D8EA 1E3LA 4Q9LA 3T3NA 1WU7A 4DA6A 4BX3A 4O2BB 3IOYA 4PRKA 1JR3E 3EXFB 3WKDA 3QYPA 3D2CA 2C9YA 1JDSA 1G0NA 3GEHA 4GT1A 3TPZA 5HZGA 4O8CA 1CP2A 3L77A 5G0VA 2JBWA 2IYNA 4WT7A 4DK5A 4BNGA 4D3DA 5IUJC 2CFUA 4QUIA 3D6AA 4QFVA 3HFGA 1GYRA 4YJHA 3UJDA 2H1VA 3AB3A 1TEXA 5FPQA 3RYFA 4HB2A 1OQAA 5CHYA 4Y1FA 4O08A 2WR8A 1O94C 3YASA 1P2DA 1UODA 3GDOA 4MYRA 2ONJA 3ZXSA 3NRCA 4QUAA 3U4QA 1ZGJA 2W22A 1HZ4A 3D3QA 5GINE 3HXCA 2F55A 3CIAA 1Y42X 2OUIA 3ESKA 1PVVA 3I01A 2JLZA 1IAVA 1W46A 2DPYA 4IGKA 1DC5A 1JDNA 3HVEB 3HCPA 2CG3A 1INZA 3AUTA 2UZ4A 1BOFA 1CWUA 4N65A 1ZR2A 2IX3A 4N41A 4NDAA 4XIFA 2ERYA 4HORA 2C88A 4MS1B 4BFYA 3F4KA 2DWCA 2XXAA 1SAYA 2R2GA 3CVYA 4P93A 4PAGA 1U8UA 4DR7B 2NYUA 1GSIA 3E48A 1R9JA 2PUWA 3ZQ6A 3STWA 1Z36A 4AJWA 1NYRA 3CPHA 5BMVF 5BQXA 1YS6A 1CHNA 3NHFA 4XH9B 4XIIA 1D4AA 2G08A 3BEOA 3TLBA 4DAEA 3WLTA 4MEJA 1OGIA 4GEKA 3WB9A 3N2EA 3QVXA 1K3ZD 1KBQA 2QB5A 2Z57A 4FSDA 4I6GA 2F8LA 4WOPA 5JXIA 3AKCA 3N0VA 2ECQA 1FMCA 2VHVA 3A1VA 5EZYB 5CFQA 2FPUA 2QNRA 2XYQA 2VP3A 5LOVA 1ECBA 4KK4A 1X2EA 1QFJA 1P31A 4N3BA 4U0UA 2XOKD 2E4YA 2NSYA 2ZIXA 3DVRX 1OX5A 1UK9A 3B20A 2LW7A 4DDHA 5FTJA 2BHLA 3MMXA 3OZBA 3GV0A 3AY3A 3IEUA 3GLQA 1KARA 1ZVJA 4HEJA 2G9QA 2OQRA 4AZVA 4ND8A 1I7LA 1ZXBA 3G8DA 3PL5A 4RF3A 3PQ7A 2V3CC 3A70A 4Y9SA 4KOEC 3I5YA 1XX6A 4TLDA 2P9FA 4UDNA 5CK5A 3TG2A 1YZYA 3CUSA 4IH4A 2BTQA 3W3AA 2AMJA 2FFBA 3ETLA 3NH9A 1C1XB 2R3SA 3MTBA 2PL5A 5DO9A 3WIDA 3CVLA 3S2EA 3LS8A 4HKTA 3I64A 2CNOA 4OU4A 1OPRA 3BIOA 4BJ1A 2G4CA 2J7KA 3D3EA 4IRUA 3EA0A 2C9ZA 3KJGA 3S5JA 1TYCA 3OEYA 3TK1A 3N2NA 4V2UA 2Q2QA 2PUAA 2P5SA 1MGPA 2GD1O 5HFNA 4AK9A 5BSWA 1M72A 3D9KA 3EEOA 1GA1A 3D7RA 2XGJA 4J8SA 1GTJ1 4A3VA 2B7BA 1UJ5A 2CBZA 4HEQA 4QBKA 1J97A 3SYRA 3ENNA 1Y3BE 4B2YA 5LM3A 4J7UA 4IGEA 1NL4A 2HWXA 3VX3A 4D0NA 1Z3YA 2WVJA 2C4WA 2O8DB 3R20A 3STTA 3NNDA 2J5RA 3WA6A 4H17A 1R8XA 1ZA1A 4G2NA 4Y6LA 1SG6A 1ISRA 3ASFA 3EOZA 2QLNA 2O48X 4JBXA 3BREA 2BFBB 3OECA 4JU8A 1NMZA 2X8WA 3BB1A 2CVFA 4A0FA 2QTVB 4EKYA 2NAPA 3ZYMA 3SIWA 2AYZA 5E6RA 2PBZA 3GVIA 4G23A 2WK1A 3D9LA 3AUFA 4KBGA 3FTEA 4B81A 1LB1B 5ESXA 4W8HA 3ZCSA 3PHIA 5HMMA 2HO1A 1Q12A 4HFRA 2G9NA 4ALMA 3AF6A 1DI0A 4D8XA 4H60A 2R8ZA 1GPAA 3A1DA 2FI1A 3EIFA 5FWXB 3CQGB 3OQIB 3M1LA 3VDMA 4U8VD 3OLVA 3LKVA 1U81A 4Z9FA 1QZ3A 2ZSDA 5A3SA 1ZHHA 4XWAA 5KNCA 3B2EA 4FLEA 2WKRA 3ZJUA 4JLBA 2W98A 5JPDA 4YQFA 3IILA 4RIIA 3MHPA 3QHAA 4MKRA 5C35A 3THWB 3MJVA 3OFVA 5A02A 4R41A 5KTOA 3B8HA 3AG6A 3NEYA 4LRTB 2R1ZA 1NRIA 4LJAA 4AUNA 3QTTA 4XWGA 3G8BA 4XLTA 2K2WA 4BNWA 1DBQA 2A14A 2GZMA 3VHLB 2OHXA 1XXHB 2XBLA 4N48A 1NKSA 4HVCA 2HJWA 3IPLA 3D7NA 3UB4A 4EHAA 5EDSA 4PAMA 4D8UA 4U63A 1JHYA 2XIQA 3CLUC 2QG6A 3CLHA 3LNTA 1WAMA 3HPRA 4PZLA 1SGWA 1KEEB 3B7PA 2YHUA 2NSDA 2XJ9A 4NYJR 1CJKC 3DHEA 3DVLA 4X92A 1KZHA 4XYLA 3FTPA 1HFEL 3BQOA 2LBPA 2YINC 3Q1KA 1YAHA 2P9UG 4GM0A 4MUIA 4D9GA 3OOYA 3RRYA 5GJBA 2DJ5A 3OU2A 1JSXA 5EXXA 4RTRA 3U60B 1E1QA 5G0TA 4K8RB 2VDQB 1N9AA 2RGXA 1CYEA 3OLYA 1H2YA 1WF6A 2CVOA 4GMDA 1Y9DA 1QO9A 1DSSG 3B5IA 3BZUA 3CUUA 3FBWA 3UM0A 1GXSA 3K92A 4INOA 3PWKA 3LLSA 4EELA 3Q6IA 3OJWA 4FFWA 5AJHA 2APJA 2QP3A 4C0JA 5LR6A 4CV1A 4QYXA 3OVMA 3C8DA 2CD9A 2CNWD 3DKPA 5ALFA 4OHPA 3A6GA 3DHWC 4TTTS 5K0GA 2ZBRA 1BN7A 2D62A 4GGMX 1YQ9A 1WW2A 4Y9TA 4AP6A 2XVXA 3WQHA 4ARZA 4QDOA 1AF7A 2G1UA 2GZ1A 4YP6A 3ES9A 3ONKA 4C3OB 1Q0TA 4NRHB 4ARVA 4CR6A 4GOOD 1Q0UA 1JPVA 3FJ1A 3N8HA 4FIZA 1N6OA 3LGXA 4PZDA 3K70D 2O4CA 2PUJA 2WFAA 4XRRA 4DG5A 4C0AC 4DIOA 2WYHA 4EQFA 4JUAA 2O2HA 5FTPA 2P9IG 4EY3A 2KCKA 2WWRA 3EQ2A 3PUKA 1XR3A 3V1KA 2IXAA 5DLYA 1CRWG 1D0VA 1ZL2A 2Q62A 5HJ5A 4PSVA 5J08A 2PQRA 3KSUA 1TK9A 1V11B 4BB0A 5F2EA 3RBZA 3SIPA 1FJGB 4UWFA 1RAGA