4CT0A

Crystal structure of mouse cryptochrome1 in complex with period2
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
494
structure length
486
Chain Sequence
VNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVAANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of Circadian Clock Proteins Cry1 and Per2 is Modulated by Zinc Binding and Disulfide Bond Formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Circadian clock protein
molecule keywords CRYPTOCHROME-1
total genus 173
structure length 486
sequence length 494
ec nomenclature
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4ct0A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ct0A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ct0A01
4EG7A 4MUHA 2QJTA 3D6UA 4E1AA 4ZT5A 3HV0A 3TZEA 1KAQA 4I6EA 1MAUA 4CDNA 1N75A 2QTMA 5LLTA 4MUIA 2ZUFA 1N1DA 1I6MA 1H1TA 3FOCA 1G59A 2AZXA 2WQ7A 3FNRA 1U7XA 3VRHA 3N2YA 4MVCA 1O96A 4EG8A 3IDFA 1KORA 5F23A 4XSVA 3Q4GA 3KT6A 1EUYA 4NATA 3RK0A 2Z09A 3CA8A 4L2IB 3ZUGA 1WXEA 1YIAA 4MULA 1O0BA 1OBHA 3UOWA 2X0KA 5FNZA 4ZCPA 1T6ZA 1R6XA 3G6KA 5J5AA 4MUGA 5K0SA 4NX2A 4WNYA 1KP3A 4KPUB 1K92A 5DB4A 3UY4A 3CVYA 3ZXSA 4MVXA 4QREA 4A91A 1OD6A 4DNXA 3COWA 2HGZA 3DPIA 4MW0A 4K0RA 3UC5A 4G6ZA 3U1VA 4KR6A 1OWPA 3HZRA 1H3NA 2GM3A 1QU2A 2X1LA 3AG6A 1NUSA 1KH1A 4ZCTA 1S4MA 4HJRA 4MW4A 4DLPA 4YP7A 3FETA 1O97C 3Q10A 1EE1A 4F3RA 4DJAA 2BTEA 3IODA 2A7XA 3CVXA 2C5SA 2CFOA 4AQ7A 1KH2A 3CR8A 4YP6A 3PRHA 1CT9A 3X1JA 1J20A 5KWVA 3P0HA 4HJXA 3TNJA 4Q16A 4JYZA 2OV4A 1VBMA 1YI8A 1FFYA 4PBTA 4MWEA 4EG1A 4JXXA 1Y42X 3INNA 3L92A 1F4LA 1QNFA 3ZXIA 4MW5A 1PG2A 3KT3A 3Q12A 4EG4A 2JAXA 1G8GA 3P0JA 1VBKA 2CYBA 1PG0A 1V47A 2R5WA 4PBRA 1GPMA 1RQGA 3CLRD 2PIDA 3HL4A 2A4MA 4U8HA 3AFHA 4DDKA 3QE4A 1J1UA 1YIDA 3DLAA 2J07A 5BNZA 1O95C 4HPWA 2VTBA 4PBSA 5J59A 1G8FA 4EG3A 4YBRA 2ZUEA 3DO8A 1O94C 1GTRA 1IH8A 2J09A 4OUDB 2NZ2A 3CLTD 5TEWA 2PZBA 3BL5A 1QTQA 1OWOA 3D6VA 2EJCA 3HFJA 1WOYA 5TEVA 1JHDA 1TFUA 1MB2A 1LI7A 4ZT3A 2RE8A 2JANA 3IMGA 1G8HA 4R0NA 2YWBA 1JMVA 1DNPA 2E21A 4TS1A 2J5BA 2VXOA 3SZGA 4ND6A 1X6VA 1XNJA 5H7XA 5KHAA 3SEZA 2VTBB 4EF6A 3RFFA 4NDAA 3IMEA 1U3CA 2H29A 2GKSA 3UK2A 2TS1A 1M8FA 1JGTA 2H2AA 1MBZA 3FDXA 1N2OA 3FY4A 1JILA 3L93A 2A1UB 3ZJTA 1J09A 4H3SA 1WXFA 1K4KA 4HK4A 1K4MA 3CLUD 1LW7A 3ND6A 1QQTA 4NAUA 4QRDA 4ZT6A 4I6GA 5LFAA 1WZ2A 1J21A 3ZJUA 1XJQA 1NI5A 1I6LA 3CVVA 1O0CA 3LOQA 1N2BA 2I1LA 4MUJA 1EXDA 3SYTA 1JIJA 3PXUA 1MB9A 3NV7A 4YMIA 1O95D 1JEEA 1ZUNA 3RJZA 1PFVA 5K0TA 4NZPA 2WB2A 2PG3A 4MW6A 1TEZA 1T6XA 4RPIA 2AG6A 2XRYA 2O8VA 2V0CA 3VU8A 2YY5A 3SZ3A 5JBNA 4EFKA 3CVUA 1NSYA 1P7PA 2E89A 2A1UA 1JEDA 1NUPA 2DUMA 1TQ8A 1IFXA 4MVWA 1QU3A 2HMAA 4P2BA 3N05A 4MW1A 3K32A 3CVWA 1VBNA 3A05A 4MQ6A 2Z08A 1M8KA 4UZEA 4MUNA 4NAHA 4MUEA 3SEQA 3LCJA 2DLCX 4MUKA 5HG0A 4I6JA 2BYTA 3IVGA 1N2HA 2QJOA 1N2IA 3OTWA 1Q15A 4GRIA 2D13A 1WQ3A 2PZAA 1MJHA 4MLPA 4MWBA 4ZCSA 4DE5A 1KQOA 1JIIA 4MAFA 3VGJA 1GAXA 3E27A 1T9GS 3ILVA 5TS2A 1NUTA 1EFVB 3P0IA 1F9AA 2PZ8A 1SURA 1TYBE 4ZT7A 4MVYA 2A1TR 2CYAA 3UMVA 1O5TA 3ZIUA 1N78A 2A84A 4U63A 4MWDA 2RD2A 3I05A 1KQPA 5HUJA 3LE8A 4GU5A 1BS2A 4PY2A 4EG6A 1ZH6A 4J75A 4ARIA 1OWNA 1VL2A 3H99A 3COZA 3NBAA 4J76A 5H16A 2CV1A 1T9GR 2OQ2A 4Q93A 1IRXA 4S1OA 2B7LA 1MOPA 4CT0A 1WKBA 3IOCA 4EG5A 4G5FA 2QUHA 3MLAA 3CLTC 1N77A 3TQOA 1NP7A 3SDBA 1IVSA 2QUKA 2QUJA 3COVA 1O6BA 1JZQA 2DEUA 4KR7A 5AHWA 1Q19A 4ZCQA 4EGAA 1WJGA 3K9WA 2QTNA 3PNBA 1U7DA 1EFPA 1NUUA 2CV0A 4WSOA 5HUHA 3PNVA 1F7VA 2XRZA 1KKUA 1KP2A 1WY5A 3AIIA 3GMIA 5FO0A 3MXTA 1NURA 4MW9A 1EUQA 1WQ4A 2EL7A 1M8PA 1IQ0A 2PXHA 1QRUA 1JZSA 1N2GA 2CYCA 4CQNA 3FIUA 1WXIA 3IOEA 1GZUA 1T6YA 1B6TA 2QUIA 1YUMA 1YULA 1IQUA 2A86A 4F4HA 3QTTA 3G59A 1H3FA 4FZJA 4KKVA 2E18A 1N3LA 3IH5A 2IELA 3IMCA 3KT0A 2DR2A 4ND7A 3ZGZA 2X1MA 4XFJA 3N8HA 2GOYA 3P52A 1R6TA 3FI0A 4MW7A 3IUBA 1X8XA 1OWMA 1A8HA 3DV2A 3RK1A 5TGTA 1N2EA 1VLHA 3TQIA 1GN8A 1O97D 3CLRC 3AKZA 5DEOA 1MRZA 3F3MA 4JXZA 2J08A 3ELBA 1KH3A 2QTRA 3CLUC 2J4DA 2NSYA 3RBAA 1QRTA 4ARCA 3G5AA 4BWVA 1TYCA 2G36A 1IHOA 1ZJWA 3IVCA 1M1ZA 3ND5A 4YP5A 2IJGX 3CLSD 3A2KA 3SP1A 4JFAA 2YXNA 1M8JA 1OWLA 2IP1A 1O94D 1YUNA 3TS1A 1UFVA 2YWCA 1MAWA 2A1TS 4ZT4A 4JZYA 2QJFA 4OJMX 2DPLA 3IOBA 3CLSC 3NBKA 3ZJVA 2AKEA 1MC1A 3AL0C 1Q11A 1R6UA 3FH0A 3S3TA 2O5RA 1PFYA 3H97A 4DDMA 1TYDE 1ZH0A 4KPUA 4U7JA 2ZP1A 1OBCA 5DASA 3JXEA 1I6KA 3M5WA 1PFWA 2X3FA 3HMQA 3KT8A 4MUFA 1EJ2A 4R2LA 1J70A 2DERA 1M83A 4MWCA 1WXHA 2JA2A 3HGMA 1WXGA 3IUEA 3COYA 4L2IA 3QTBA 4ZT2A 1TYAE 4ZCRA 3H9CA 1ILEA 2E0IA 3RHSA 4RUKA 4K03A 1NYLA 2Z3VA 3KFLA 3A04A 5IHXA 3H9BA 2D54A 1ULHA 2WSIA 1GLNA 1N2JA 2CUZA 1QRSA 1KR2A 3MMXA 3X1KA 2DETA 4G5YA 1GTSA 1XNGA 1Q77A 1EFVA 2CV2A 2WQ6A 2CSXA 3TZLA 1PFUA 4XFDA 1U0BB 3MUEA 4QBTA 1O96B 5EKDA 3FHJA 2D5BA 3ND7A 1FYDA 2V0GA 3IVXA 1IQRA 4OUDA 4UZFA 3N9IA 4AS1A 1XNHA 1QJCA 4R2MA 4X0EA 3C8ZA 4KR9A 1F7UA 1KQNA 1D2RA 1EFPB 3FG9A 3GLVA 1NZJA 3FWKA 2PFSA 3GUZA 1V8FA 1HYBA 2HZ7A 1COZA 5FO1A 1I2DA 1J1ZA 3OP1A 2CT8A 1M8GA 3AG5A 1U3DA 1LI5A 2DXIA 1K97A 5DK4A 3X1MA 5J58A 4CDMA 1JECA 1NUQA 3PNYA 3MLBA 1H3EA 1JIKA 5KCMA 1KAMA 5IJXA 3A4IA 2A88A 4DDHA 3H05A 3ISJA 5LM3A 4MW2A
chains in the Genus database with same CATH superfamily
2H59A 1RW2A 1J9GA 5AWFC 2LXMA 1KT1A 2ILRA 3M9WA 2W83A 4E30A 5IXJA 1P5RA 1KAQA 2RC5A 4GPBA 5IUJC 4DHWA 1OLOA 2F1KA 1Y5MA 2WQZA 2WXLA 1NOIA 2Y99A 3SC3A 1GCOA 1SU8A 4E2ZA 2QE6A 1AH2A 3QKIA 3TGLA 5J9FA 5HILA 1YVEI 2BF4A 2HJWA 3BXOA 1YE8A 4E32A 2QK4A 4WN9B 2G04A 2QLMA 1IU9A 1XZBA 4YB8A 4L5CA 4F8YA 2PKQP 2HXGA 3AESB 3CRZA 4A3VA 1N5LA 5EJ9A 1UT6A 1D0SA 1RRVA 1DJLA 4EGSA 3KG2A 4QUGA 2FPKA 1T5LA 2Y0CA 4FNOA 3JYOA 4XSVA 4KREA 1NW8A 1EUYA 4IQ8A 1Y1SA 1E5XA 1JDSA 3CRVA 3QENA 3NALA 5GZ1A 1USIA 2JH3A 4D9FA 1JJBA 1WXEA 5HIAA 5JO0A 2ODQA 3BHIA 3EA4A 4ZYVA 3KXIA 4ESVA 2XH8A 1Y5RA 3B3QA 1L7MA 2D5AA 3PGA1 4HB4A 4PC2A 2IHKA 3T9FA 1QYVA 4RQBA 1D4ZA 3OLVA 3EMKA 1NA0A 3K96A 4YJFB 1VE6A 3RTGA 2M32A 1Z0SA 2O05A 1HYGA 1KJIA 4A2WA 4EM6A 1AT1A 1ZM3A 3QY9A 4ND5A 3H83A 4PFSA 4UCXA 1OD6A 4FGUA 3WLFA 3WKEA 3ZD7A 3K4PA 2UU9B 2YRWA 4IRXA 3MS2A 1EEHA 3FKSD 2R8ZA 3HA5A 5J5CA 4C05A 1T1GA 3K35A 3DMPA 2WA1A 5EZYF 2P6MA 4BX3A 1V5FA 1HO8A 2BEUB 2F59A 3BWCA 5KMGB 2PKYX 4YP7A 4TTTS 4LYEA 4BQIA 3PKIA 4UDYX 2EDCA 1VQ1A 3OAWA 2QV7A 4TLMB 3JWEA 2ZJ6A 1CDOA 5CEDB 4MI6A 3ZJYA 4NH0A 3DC2A 4AP6A 5AW6A 2IYLD 1E1YA 1RT9A 3EY9A 1XU9A 2H85A 2JFWA 4JR2A 3GUYA 3R9KA 1KO1A 3VU1A 4AMGA 2YRFA 2JZCA 1YQEA 2EIXA 1KJ8A 3EGWA 5BWBA 5JFOA 1CT9A 1UJKA 2B4QA 2O8DA 1TC2A 4L4XA 3DVLA 2C2LA 1CR1A 4G1BA 2DPHA 5LMZA 2DKOA 1TEHA 2HF2A 1WXDA 3CLVA 4I55A 3GRCA 1JPUA 4HGNA 4UDOA 4C9BB 4ZI7B 5BV0A 4I36A 4MKIA 3O4RA 2BHTA 4JX9A 3QWVA 3M1IA 2Q4DA 3CGHA 2HSDA 1MU0A 3F2IA 3MKRA 1L5RA 1L7DA 1MA3A 3NWEA 4L8LA 4NPCA 4B6RA 3MERA 1ID1A 2P2NA 1AS3A 3P2YA 4X1IB 3HKCB 3LW7A 1GSHA 4J1QA 1GPWB 1P17A 2FPUA 4HAXA 3L0SA 4HZGA 4G0VA 1QNFA 4UBNA 1ICIA 2WF9A 4Y9SA 1UJ5A 4AXXA 5BR8B 1P1RA 2VPIA 4PZUA 1LS6A 1FUKA 2CYBA 3AF6A 5F5LA 2FPGB 2W0MA 5FQ8A 4W8OA 3EIQA 4X7PA 5K0EA 4IW3B 2BFEA 4XIFA 5TJ9A 4TKVA 1THGA 4CIYA 2EZ4A 5B1HA 1YCGA 2O8DB 1GAEO 4KLAA 4EH1A 3MTQA 5JANA 4DLQA 1E79A 1E3JA 2XTNA 2YS6A 4OA8A 3EPLA 3SLRA 1YJXA 1W5BA 2B0CA 1YR2A 1EIWA 3R5KA 3N2KA 4RA6A 4RLSA 2H00A 5I8ZA 1RLJA 1EWKA 2X22A 3KZNA 1UK8A 2WEKA 4RJ2A 1WOMA 3S28A 1ZD8A 3UJHA 4EHAA 2V7QD 3HFSA 4DY6A 4IV5A 4OQLA 1JHXA 4LOLA 3V9AA 2R85A 5HF9A 3UOGA 2HM8A 3W3AH 3A8TA 4KOEC 4Q24A 3SFYA 1P8JA 3NHKA 1YDFA 3BAZA 4QRHA 2J09A 1HZ4A 2OB1A 2J0UA 4YMTA 4ZDJA 1BDHA 4ILIA 1N8TA 1V9LA 1T0IA 4U1RA 2IDJA 1MRSA 1NJ2A 2FMFA 2VDUE 4PHHA 2HK7A 2EBHX 3RVQA 4HEA6 5CA1A 4G37A 1QV7A 3BQMB 3D8SA 3EVBA 5FULA 3ZC3A 1WPQA 2RGGA 3WYCA 3ZW7A 1G8HA 1A5ZA 4AXBA 5HWSA 4G9BA 5A2GA 5KWDA 3QNWA 4M53A 2NTVA 2VJDA 3OMLA 2B4TO 1CRWG 5CYPA 5FL7A 3BWVA 3CHYA 4H7XA 1VHJA 2WHPA 2BZ0A 1KY4A 2N3ZA 2VXOA 2J85A 5JXWA 3SYLA 4QTXA 4HX2A 1HT0A 4CV0A 1F0YA 3WFJA 3M5DA 5CIWA 4C5AA 2WLTA 1BA2A 4F92B 3LDZA 1P9WA 3WA7A 4EK9A 2UXBB 5D5QA 2XPIA 3LCUA 4WJZA 2XENA 1VA5A 3AP1A 2ZWIA 1TVMA 3VZQA 3AILA 3ZGLA 4WNFA 2QTVB 5KOHA 2L6BA 4E3WA 1WY6A 2WOOA 3KAKA 3NHFA 3OEHD 1IHUA 1PN3A 5HBRA 2CB9A 4IVPA 3E9QA 4ZDWA 2QR5A 3LM8A 3WBKA 4RTLA 1T13A 1HE8B 2WAYA 1K4MA 1J7KA 1W1UA 2Q2NA 4NAUA 1SY7A 3DMYA 8ADHA 3LS8A 1GUFA 2YMQA 4FMDB 5ULLA 4DS3A 5IFLA 2ZRGA 4P31A 5FI1B 2X77A 2GCIA 3UAGA 2Y1LA 4UM5A 3ANLA 1M72A 5D51S 4ZREA 5FA5A 1L7QA 3VTKA 4DXAA 5J23A 3WISA 1VP3A 3D43A 3BMCA 1NXOA 2W6PA 3IUSA 2YWHA 3JYSA 1W4LA 2HBYA 3MINA 1FRVA 3ROMA 5ER6A 4YR7A 3Q15A 3HCBA 1KYTA 2ZTVA 3MYYA 4B3DA 5CTJA 1TEZA 5DTJA 3LOPA 2AG6A 4B44A 3VR2A 3AMVA 3VV3A 4TZ6A 2XECA 4UPVA 3II6X 3ISMC 4B8CB 2X6KA 3PUXA 4UQXA 1P7PA 3FCSB 3RI3A 2BGWA 1U3FA 1QIMA 4CKXA 4TYMA 3IYLW 5K3OA 3KYDA 2XXAB 2ZM6B 1ZB1A 2XA9A 4RK5A 5GJWC 4LJAA 4X00A 5BT1A 1QRDA 1THZA 1CPYA 4KRGA 1BU5A 1C8VB 4ZDIA 4HQKA 1CRQA 1KPIA 3CNHA 3IIEA 3P9IA 5TT0A 2P2CA 4RJKA 3WVNA 2C7OA 3AKYA 4L2YA 3EF1A 4MUEA 1B14A 5EKTA 1TRKA 1T2CA 3NEAA 5DSZA 1QS0B 1E4OA 4P93A 4OYYA 2W2TA 1GNQA 4E21A 5IAGA 3U4MA 5FJJA 2HA7A 2RAUA 3BCSA 4RIHA 1CE8B 5J5VA 1SXJD 1VRWA 1K3TA 3C15C 2I6HA 1MP0A 2ZSEA 4UXIA 1TM4E 2A5FA 4WDRA 4U95D 3PDJA 3BG1B 1JDNA 2JJYA 4CETA 2F64A 5MFZA 1QCDA 5EX0A 3VTXA 1G6Q1 3OICA 4CCAA 1JIIA 3GUHA 4Q69A 1K86A 1UDBA 2RKWA 3K2EA 3KCNA 4OYHA 2WIGA 2HF7A 4V0OA 3SLKA 3ZE0B 1T9GS 4C0EA 3OQIA 4FDTA 4DCOA 1W0JD 1AURA 2Q6IA 1BRMA 3EIEA 1O87A 3H17A 1G1AA 1TYBE 3PDIA 3H8JA 5BYBA 2H5LA 4YRCA 1TJ4A 1NIJA 3BB4A 3BKWA 4XASA 1VG8A 5DNUA 3NOOA 1DTEA 2G7ZA 3UMVA 2WUFA 1N78A 5EIAA 4HLEA 4L0MA 5FD8A 1KMMA 1YDGA 4QUDA 3W7BA 5KDOA 3HUTA 4LMRA 4AJLA 5CRVA 1E32A 4L23A 1HLFA 2CLEB 4RIIA 5H3HA 3V8NA 2VFAA 4I9UA 3SNHA 4YLEA 1J8MF 2X2FA 3TZKA 1E62A 3A0UA 2DY0A 4U0KA 5CT4A 1Y6QA 1MB3A 3N59A 5B7NA 1B7GO 3GLIB 3FCEA 4QGGA 2IYUA 1GG5A 4XWGA 1PZMA 4MV4A 5H16A 4GA2A 3Q4AB 2F37A 1SC3A 2GB4A 2PBZA 2R7LA 3QPDA 4J7AA 4A0GA 4TSFA 3UG7A 3OZGA 4RK1A 4HT3B 4D97A 4OM7A 1FVOA 3OT4A 4V0KA 1XK6A 1N77A 5LQRA 4RKFA 1W0CA 3AHHA 3LVBA 1M1UA 1ZI8A 5D01A 1OXUA 4MRAA 1YOBA 2WR8A 3Q11A 1KAOA 3VR5A 2YNQA 1Z47A 2DCPA 3U37A 4PG6A 1JXOA 3ZXYA 1H42A 3WL7A 4RELA 4BNNA 1HRDA 1N0HA 5SY6A 4UASA 1RAEA 3ZXUB 1Y8RA 1EFPA 3FYSA 3CO5A 5FR1A 5TB5A 5B3AA 2VUIB 4A7PA 3GA7A 2R2GA 1T10A 4G84A 2ZPUA 1G16A 3V30A 1M8PA 4QNRA 4P4NA 1KZYC 5AOVA 3IPAA 4F93B 1I1QB 2FSPA 4UQOA 2DYSE 2V5FA 1T3ZA 4JJZA 4J8EA 4W5TA 2Y2VA 2C3MA 1RPZA 3ZWKA 1BG6A 2CF6A 4YDRA 4YO7A 5IF3A 3CIFA 3UHFA 4X54A 2FEKA 4IEFB 4Q6BA 3OWXA 5BRNA 5E4TA 2Q5LA 4FC8A 4FDMA 4AW9A 3QTTA 4Z7QB 4N76A 4NBNA 1EDZA 1A9QA 2EINE 2E5WA 5H5JA 4B6JA 7MDHA 3V4LA 4CQLA 3WTCA 2PAAA 5H0IA 3D9QX 5E2BA 5C31A 5CB4A 2HRCA 3G8AA 3KQWA 3PGVA 2ZROA 4EL0A 2BJWA 4PZ9A 1XU4A 3TQRA 1M2OB 3NHBA 1W4BA 4Q7KA 4IV0A 4YHBA 2PQ2A 2Q6LA 1KDRA 1KDTA 1GSAA 4BVFA 5EZYB 3B1KA 3BG0B 3BJMA 2PX2A 5IJAA 2B5OA 3PX2A 1BA3A 3OKAA 2VP3A 3TQCA 3CISA 1KMHB 2NSLA 4OIFA 3ZWBA 4D6PA 1CJTC 1JQLB 1Z5ZA 2C29D 2ZYSA 1PDVA 3L0DA 1SCUB 4DANA 1DQNA 1GFIA 3GFTA 2QM0A 3TUIC 1QFMA 1V37A 1XMSA 4PS7A 3B9QA 2ZZMA 4AO8A 4EEZA 4BO5A 1ZVVA 3R44A 1FYXA 2TMGA 3HBAA 1HDIA 1B0PA 2CWWA 4V0QA 4ZVOA 4BO1A 4IDAA 4CEJB 3F1KA 2CNWA 3JYHA 4W1SA 5AOCA 2O8BA 4O4HA 1MCZA 4B4OA 4GOMD 2V7TA 2C1XA 3VBCA 1GQQA 1M8JA 4R2HA 2AR9A 2X2PA 4DUGD 3V7WA 4KIJA 3VDQA 3C3OA 3L4SO 2X13A 4W5NA 3LP8A 1PG5A 2CXTA 2H1HA 2R8OA 3REQA 3WRYC 3ZIAD 3MWDB 5IM4A 3TEFA 2AC7A 4W9NA 2QLJA 2PANA 2W2LA 4KWHA 3DM5A 3QF4A 4PH4B 4N5HX 4EGCB 1W44A 1QQ6A 1YE3A 1L5GB 3GEIA 2C99A 1X9HA 5E9JA 2JGJA 4AUEA 1IWPB 4YCNA 4RH0A 3K71B 2JZNA 2G09A 1WKVA 2GBLA 4RD3A 2X1VA 3L9TA 3B20A 1MX4A 2V55B 5A5GA 2DLNA 4KR7A 4XDZA 2KCVA 4PZDA 4AF6A 2Q5HA 1EFHA 5C8XA 5FP0A 2B8EA 4OY3A 2X3FA 1VI2A 2JCSA 3T54A 4MUFA 3H8WA 4KTVE 4P5EA 3UK0A 3ZXXA 3CX4A 1YK1A 3ENZA 5IYZB 4GTTA 3KFXA 2X4GA 5CB4F 3VO2A 2ZRKA 1K7XB 4IHKA 2PUWA 3U4QA 1DC3A 4L73A 3OQBA 4Q3BA 1ND5A 1UH5A 4AJNA 1RPTA 3GD5A 4HNTA 1TYAE 2SICE 3PZDA 4MEAA 4ZRMA 4S12A 3CHMA 4J4BA 5AK3A 4NIMA 1GYPA 4Y2GA 5E6RB 4AM8A 5IZCA 4BMZA 2WAMA 3HP7A 1S9HA 1Q50A 4YRBA 1HYEA 2Z3VA 3ZNQA 2A9RA 3ZY2A 3TG5A 3I0ZA 1SCNE 3FZQA 4NYIR 5COBA 4C4ZA 5FBHA 3A27A 2SKDA 5EIDA 3EFHA 4D9IA 1GLNA 2JK0A 5KYWA 3U4HA 2IS1A 4CIDA 3TGPA 2J6CA 2HSGA 2QT0A 3MMXA 4YCDA 4URKA 1DCQA 1IEWA 5CCEA 2CMFA 1IVYA 4HEQA 1SPXA 4OD0A 1T4CA 1EUDA 1G5FA 3AXSA 2CSXA 2R2AA 3TUZC 3E6AA 5FA6A 2OSVA 5H80A 3DBRB 1HG2A 1DBVO 3SO8A 1HH4A 2HA4A 3Q40A 3Q3EA 3TTVA 3K0AA 5EKDA 3MJEA 3VVBA 1KEEB 2V0GA 4PFJA 3QU9A 1J6UA 2PR2A 3QLUA 4QJBA 4QBHA 2FMTA 3CJTA 3PYLA 4RPHA 3EHQA 3FCAA 1I13A 3K0CA 5TC4A 5A4DA 4YXWA 3N9IA 5TRTA 2P9HA 5ELXA 3OEYA 5DN6D 1I7DA 4EMSA 1ZGCA 2AH5A 4X1KB 1FU7A 1U90A 4HNGA 4ETIA 1EFPB 3ELYA 1DAFA 3UJ6A 1MDBA 3AAAC 2Q7XA 2FPGA 1IYZA 1DIAA 3HY6A 4HN9A 3KBBA 3KKZA 5D3KA 4BGEA 4DN6A 1GDDA 3BWDD 3CM0A 4LG1A 3WGUA 2GGSA 1V8FA 3C6XA 1HYBA 2XOKD 4DUPA 3B7RL 2R7KA 3ZZ0A 4CKWA 2Q5FA 1DO2A 3AVQA 3FYUC 2PZJA 4MB2A 1XDUA 1SZCA 2J9GA 4D3ZA 5FRDA 1LY1A 2EKDA 1M8GA 3Q9LA 2PUDA 2KX7A 3HO1A 3CR3A 4TXRA 2CLHB 5CDYA 2W0SA 3QVWA 4RWEA 1OXJA 1PR2A 1AGNA 1IUPA 5J40A 3G9QA 1GADO 1NW6A 2RHLA 2LAIA 2AI1A 4LDPA 4EVQA 2YBEA 1NUQA 3ELDA 2V65A 3KYIB 3EZXA 2PBRA 2DPYA 2WYUA 4ZO6A 3OTOB 4N1AA 2ZM5A 1NN1A 3H86A 1KDZA 2ZULA 4PVDA 1E3DA 1Z2DA 3NXSA 3RABA 3WYDA 1ECFA 1W0KD 2G17A 3EAGA 4M54A 5CW1A 1K6JA 1UL1X 2IEGA 4FIDA 1IJBA 3KUXA 5IBRA 1P4JA 1JQKA 2J32A 1RWBA 1ZLYA 3AHCA 4J16A 4PXYA 2RAPA 1K7CA 3CW2A 1OMOA 1BDBA 4KMRA 1QK3A 4JA7A 4ARZA 1GUDA 4MQBA 2NZXA 3EPJA 4BLSA 2C0LA 2WWXA 2QTMA 4MV5A 1I6MA 1T43A 5IKMA 4UTOA 4BO3A 3B5JA 1N5MA 4DPLA 4H7FA 4BNFA 2BY4A 1D4AA 1MEEA 2VDMB 3ACBA 4MVCA 4OXRA 1W9MA 3GRFA 3IX7A 3TSCA 3TLKA 1WAO1 4LNBA 2GJ4A 4BU1A 2RGRA 2GZ1A 5C5DA 3QFRA 1JPLA 1E8NA 3EFOB 3KVYA 3VOBA 3ZGVA 2PSEA 1I3LA 3ACDA 2Y3AA 2C96A 4PLYA 3N5KA 2G0AA 2NU8A 1KPGA 1V4VA 2EKLA 2LDBA 4NP6A 2X6QA 2ECOA 4PGFA 3WGLA 4LN1A 8LDHA 5JASA 2NWQA 4C22A 5IWAB 2PZEA 3FOFC 1XPUA 3HHEA 4Y2JA 2GUWA 2Q21A 4RF5A 5IK2A 4INPA 4BL5A 2FZVA 6NULA 3NYQA 1M2NA 4ZVUA 2KW5A 4P81A 4OI0A 4N5CA 3FFXA 2V7GA 3OIDA 4QHTA 5B53A 3MBIA 3V1KA 2GN9A 4C2BA 1FF9A 3AWDA 3N8KA 5CA0B 4B45A 5IEJA 2XCRB 4GIBA 5FI3A 1MH9A 2W6OA 4MS3B 1KH1A 1TGVA 1FDVA 2IGTA 3KB6A 1KI1A 1B0ZA 3Q75A 4M9SA 2V4UA 4ZICA 5FFFA 4Q3OA 2JCXA 1GGMA 3D5QA 4HKTA 3RWOA 1JLHA 3QEOA 1DKQA 3V8MA 1A9SA 4X8QA 3HI4A 1GRCA 3RVOA 2H7XA 4B3RB 1KK0A 2G9ZA 2Y4NA 1V8PA 2GRQB 3FFLA 2HB6A 2WIAA 3IQWA 5HE9A 3UV6A 5BRAA 1FYVA 2CGEA 1CJUC 3WNVA 2VDWB 1A2KC 2PNJA 1UXHA 2R5SA 4WKPA 1ZOPA 5F7XA 1MT0A 3V46A 4WOKA 5LBTA 4XYEA 5TMDA 3ULKA 4DBLC 2WM2A 2IY7A 1NXWA 1QQAA 3QNMA 4LNUD 4GVPA 3QVOA 3N0WA 1PL8A 2BJVA 2GM4A 1G2PA 2ZTHA 1WU7A 4JDPA 4RVHA 3VYVA 4E07A 1KY3A 1I6WA 2GPAA 1YI8A 3D2CA 3ESZA 4IWYA 4OKSA 1H0HA 1Y4ZA 2H0QA 3G1TA 4PBTA 3IAHA 1K7EB 5DHUA 4K6OA 3RVMA 3VXKA 4EFNA 1Q2XA 1FX1A 3BDVA 1F4LA 3CFYA 3Q49B 1BW9A 1Q7BA 1TEXA 1XD2A 2QUAA 3IP3A 2XPYA 4TWRA 3S5UA 3TI7A 1PG2A 3S7TA 1YRQA 3W5HA 2YJTD 1YA8A 1TU3A 3L06A 3NKLA 4PF1A 2R1TA 4YCBA 1YS2X 2EL9A 1QC5A 2AJAA 4JBGA 1RSZA 5G0UA 3S70A 5DE3A 3V4PB 3QF4B 4BJ5A 2Q1YA 4DYDA 1DV1A 4YRKA 4WGGA 4BP3A 4PO9A 2BFWA 2CFZA 1FLAA 1E1NA 2VSNA 2WC1A 1U1DA 3A6FA 2JFOA 1JYEA 1DCKA 1GGJA 4QQRA 3B1XA 1JU4A 2W8ZA 3REQB 2PIDA 2PTHA 3MWGA 4NBUA 1FNMA 5LXTF 4AFNA 1J1UA 4HOTA 2ZB3A 4FQ7A 3ZTWA 2PTGA 4RH3A 3ESQA 5A7GA 1IBLB 4RTRA 4F6RD 2GZAA 1RMTA 2A30A 3GAAA 2O14A 3K0FA 3JS5A 3JYNA 1JXQA 2RH4A 3PL5A 5EE0A 5JOQA 1HTTA 3SS9X 4N5LA 5LMCA 1YOVA 4F3KA 3TFOA 4WLVA 4G8JA 2GAFA 2R5FA 3A3OA 5HFJA 1IDN1 1RC8A 3U7IA 2EIKE 4TUYB 1H8HD 1QYCA 1ZD2P 2YMPA 4RKQA 1YZUA 3H1BA 5K0LA 3PCRB 4FJ0A 4JLUA 721PA 1R0WA 4KQWA 1ILEA 1UQTA 4BLOA 1DINA 1OWOA 3LIPA 4GQAA 1IZ0A 3Q2KA 4NKRA 4RETA 4A2PA 2VJCA 4K9PA 1W36B 3SHQA 2L0XA 4ZT3A 5HMMA 4CM1A 3VNAA 2YWBA 4JJGA 2QPOA 2XEXA 3MA5A 4LA4A 4JR0A 3RFCA 3DVAA 1DUVG 4B2IA 5ICGA 2D2FA 4QSHA 4BGDA 5H9WA 4IIDA 4D4IA 1U5BB 4ND6A 1X6VA 3DFIA 4G9GA 3SEZA 1YOVB 1TUEA 2KHZA 4RCVA 5FQ7A 4FEYA 2CFCA 2P4UA 4TTQA 3RGGA 3BKXA 3BSSA 3G8YA 3B6JA 3EDYA 3PV0A 2JA1A 3G13A 2C57A 4MIEA 4MUAA 4OI4A 4YAWA 3UA4A 1A96A 1M8FA 1AB6A 2ODEA 1DT5A 4HNAB 4XQEA 3LK7A 4F3CA 2EJWA 2G9UA 1CX9B 1Y8QB 1JFVA 1F60A 2G80A 3TPZA 1S01A 1H65A 2YXPX 4NFSA 4DA4A 1J09A 5DIFA 3SNXA 1K4KA 5ERGB 2BI7A 2HJRA 4HK4A 3ZCRA 5KEIA 3RYIA 1SBYA 4ZT6A 5K01A 4EA6A 4EW2A 2XNKA 4MPRA 3TE6A 4B2PA 5ITZF 2YDYA 3ZGNA 1I6LA 1SXJB 1IWOA 3PFIA 4HGZA 3V1YA 4CIXA 5ITVA 4YO8A 5ENVA 3ZQKA 1IZZA 2PQ6A 2RG1A 4MUJA 4CLHA 4BFWA 4HOUA 1DWQA 2Q07A 2AD5A 2ZI4A 5DW3A 1VDYA 1XL1A 4KXMA 3TW4A 3RJZA 3EJWA 1VYUA 3WAGA 4MW6A 5J47A 2WWFA 3KLMX 1KP9A 2ZUWA 2CNDA 3T7RA 3R9XB 5K4GA 3BRSA 5ENPD 1ISIA 1T4MA 2UY1A 3R74A 3H4MA 5FQOA 5B1IA 3HJCA 1RXIA 3NDJA 3S2SA 3TQQA 1LBIA 3LU1A 1X39A 3QELB 1HWYA 4Q4JB 1U8FO 3RARA 2UKDA 3THSA 3WLPA 2HMAA 3ZBPA 3UQZA 2B94A 2PVSA 4LJ7A 3HKDB 3EUFA 4POOA 1YFJA 4CM4A 5AM1A 1PUIA 4PGAA 2N75A 3A05A 2AGVA 3AFOA 5L3ZA 2IEZA 3PX7A 2IIPA 3MZ0A 4TPKA 4FILA 3FGZA 4ZN6A 3PZ4A 4F06A 2KLBA 1YR8A 3A1SA 3SQWA 1TLTA 4CTNA 1CEEA 1I0ZA 4I6JA 1E3TA 5JC1A 3IVMA 3KZCA 2PUGA 2EJUA 5D84A 2F8XK 2VWGA 5ALXA 3AR4A 5FNVF 1KVUA 4UXHA 5KVSA 1W73A 5EGSA 5JV5A 2V0PA 4OHPA 1ATIA 4FC6A 3SF0A 1OUMA 3E27A 4LOKA 1E77A 1VFNA 3GGPA 2RONA 3K1AA 3BXXA 3FWPA 3ZNNA 3A3NA 4HRMB 3HI6A 1VJTA 1XTJA 5HVNA 2G1PA 2XXJA 1RHUA 4DIOA 3ZCVA 5K05A 1A8SA 1DXYA 3TL2A 4DT1A 4HYEA 1E9RA 1KZ1A 4GPIB 4I9NA 1D5WA 2GZMA 4K8RB 3KB2A 2FV8A 4H31A 3X2FA 2A84A 4N0PA 4ARUA 1Z3YA 4IS3A 5CB0A 3CEJA 3LE8A 4PTYA 1MQ9A 1KQ3A 1JDPA 4KHZA 4YAIA 5G3ZA 5IMSA 3C4JA 4JU9A 1J99A 1JCSA 2A5EA 1PSDA 4IVNA 5JR3A 2PJZA 3P0EA 2OYRA 4ZI7F 2WWWA 1A7JA 2ZBUA 4ZAGA 1J25A 4IXDA 2FW8A 1FDSA 3GRYA 4EJ6A 1ISFA 3AETA 4L22A 1EVQA 2VC2B 4B0ZA 1GO2A 4J76A 1YZTA 3HCRA 5LA6F 1G60A 1FQJA 3EF0A 1E8XA 1C7EA 1Z4OA 4FZ3A 2ACKA 4B3MB 5SZJA 1QRAA 4BCCA 4JOCA 1LD3A 2OESA 4IKOA 5EWMB 1ML3A 2Y1CA 4W9RA 3E5RA 4NL4H 2GX6A 2V7UA 1N7HA 1X7WA 8GPBA 3TQOA 4CM6A 5HM8A 5GOZA 1FMJA 3TJRA 1JJAA 1LD8A 3B6ZA 4F5DA 5FUVA 2HUNA 3I52A 3QLVA 4FXOA 3RHZA 3UH0A 1LC0A 1VKRA 4D3XA 5C18A 3SNKA 1Q57A 4OCZA 4PNHA 4TV9F 5B37A 3WQRA 1YS4A 4EF4A 5EP2A 1J2TA 1N6OA 1NI4B 2JRLA 3CZ5A 4QQFA 1IM5A 1J2YA 3EASA 4B3XA 1E8YA 2Q6VA 2RGUA 5FV7A 4NENB 4A8HA 4GLFA 2OKGA 3SSOA 3AIIA 1QKIA 4ZHQF 2EFCB 2Q5IA 2XUKA 4XPZA 1YL7A 3QPCA 4Z9XA 2OZLB 4KQKA 3CRNA 4JS0A 4QNMA 2WLSA 1UBLS 1ZOLA 1U5BA 1ZSNA 4JQZA 1W0JA 3B78A 4DB4A 5B58C 1IDOA 2MSDB 1CHDA 3BICA 5TJHA 1RABA 3K31A 5IT9A 4IOMA 1BDMA 4RKYA 3CE9A 4IS2A 3O31A 4U3JB 2LCQA 4AECA 1M6NA 4BHTA 3JSXA 3C72A 2W58A 1XTPA 3SFTA 5BYKA 4FZJA 3EULA 4V1CI 2XSZD 3FNIA 5ERYA 2RGXA 2VOEA 3V4ZA 3A9RA 1ZM7A 1FS6A 4N41A 3K30A 2ZI9A 3K15A 4WNAB 4IIGA 3T1OA 2H3HA 4FFOA 3KEQA 4WWNA 2BIFA 4ZV9A 5JSUA 1J8QA 4K8OA 2JFZA 3BCRA 4K2AA 1V9CA 1NRIA 2FN9A 4URVR 3DUWA 4RTMA 1KMIY 2ZE7A 1OYYA 3QVTA 2QVBA 3U3RA 4GE0A 4UNQA 2XKKA 1O97D 5DWDA 1XDDA 4JUAA 4YMHA 2IYEA 1PJ8A 4JXZA 1A95A 2OBLA 3WWCA 4NBKA 3AS8A 1W5SA 3G2MA 3BQ9A 2LUHA 2J5RA 4KT6B 1V8ZA 3ZJ4A 1N6HA 4GL2A 4KBYA 4YDWA 4NCIA 1OYOA 5GGXA 3PRJA 4L8VA 3DYBA 4ND1A 3C3CA 2VK4A 1V8BA 4CQMD 4GVXA 4KQFA 3CVNA 2QP4A 1E3IA 5LA6B 1PGJA 5JFGA 2YY6A 3W6UA 4ZYTA 2XAUA 5HGXA 3EF3A 2HCBA 4A0QA 4DTCA 3LKZA 4M22A 3S44A 2PE5A 3THWB 1G7SA 3B6KA 2H48A 3TX6A 2RK4A 2GK4A 4N3NA 5E4YA 2HQ1A 3HXKA 3RB8A 1Z3XA 5B4UA 1DC4A 1E61A 2A3NA 1Q6YA 3P5SA 5I3CA 1QB7A 2K4MA 2VJMB 3LNCA 3QMVA 1AO0A 3SE0A 1MIOA 3SGHA 2HMSA 1E1QA 3LBFA 2O1WA 2IIQA 3I6YA 4IJ6A 5EGNA 2O5RA 4NK5A 5EJAA 2Y8EA 3T7TA 5I7FA 3SYKA 5EIBC 3P9RA 2AMYA 1ZH0A 4IIBA 2XY4A 2ZUTA 1GP2A 3LTEA 2F1JA 2FF5A 4PC7A 4OUKX 4ZAFA 3EVZA 1OOEA 2QMHA 3F71A 2D2EA 3VA7A 1GFWA 4DBLE 3HBMA 3QIAA 3KU1A 2RHMA 1IPEA 4EHMA 1I6KA 2EX1A 3DUFB 1PCXA 2XDQB 4U02A 4G4IA 4TKMA 2W2PA 3GDWA 4LJ6A 5BOSA 4HXIA 3GT4A 3N8NA 1F48A 2E55A 2VT7A 1JF8A 2BMFA 1WXHA 2ZBVA 3I4FA 4KXYA 3G2IA 2QL6A 3ANNA 4UI9J 1DX6A 2H9YA 4L2IA 4IJMA 4HAZA 4QC2A 4AJ1A 1YNSA 1WMBA 1Y81A 4X62B 4YGXB 5AO9A 2VUTA 1EFKA 4KQJA 5ESWA 2VBFA 2GYWA 5D0QD 1KBQA 2QM7A 4JFRA 1U8CB 1XQXA 2C94A 3TW6A 4JXKA 5IHXA 4ZAYA 1XI2A 4OL0A 3U0VA 1EESA 4GOOD 2I34A 4O08A 3V48A 1U80A 3WNQA 3WYAA 5C8YF 3VYRB 2HSZA 4HAWA 3DEPA 1HKHA 4UHDA 1QAMA 4FLBA 1T5HX 1MVLA 3CKMA 3ZTTA 1A9ZA 1LDNA 3I42A 4CL2A 1DO0A 3DAFA 4RVGA 4C4PA 4RKEA 1N25A 4C6HA 1NULA 2CV2A 2X23A 3E33A 1P2VA 5KQGA 3D6MA 2IY9A 2JH9A 4D3SA 3RRXA 3OXFA 2XWBF 2YQZA 1HEYA 3SC2B 1Z06A 2GVDC 1WDKA 3K2BA 1UWCA 2ZAOA 1IY9A 5EIHA 1GR0A 3BL8A 4GPTA 2BEJA 4J0GA 5ERXA 4R1QA 4X3CA 1KZ4A 4XB1A 3PHBE 4MYTA 4X0EA 5JJ6A 5EX3A 3INYA 5CBOA 4P3NA 5FWQA 4GTOA 2Q6KA 3OCYA 4JI8B 1S0PA 3O8CA 3CK9A 3TBKA 2JGNA 2DE0X 2AFHB 2X40A 2IHVA 3GJ3A 1BWPA 4U5QA 1LTHR 2GKGA 5EIXA 3C5WP 4AZ3A 4J0QA 1GL9B 3JQFC 4QT0A 2G67A 3K3PA 5AQ1A 5M2QA 4HNQA 1ZGAA 3DBSA 4NACA 3E3AA 4U0JA 1N4SA 1M6WA 2WUGA 4NOMA 3EWAA 4X1OA 3UW1A 3WNZA 3G0OA 2OXCA 2PSJA 3R7AA 3G2TA 4O4IA 4UPDA 5AQBA 1ISHA 1ZXBA 2QMZA 4IMRA 4JQSA 5I9LA 1ZO8A 1OLXA 1W46A 4NZZA 3ULQA 4OBWA 4WOPA 3SBOA 3F3SA 1Y1QA 2FWNA 3KQLA 1M1YB 5KCMA 3WL5A 2YL2A 3E1KA 4ZKDA 3I2YX 2HJSA 1DFHA 5GAJA 3FHTA 1FVFA 4KUGA 4TRNA 1S5PA 5BUCA 4JBLA 1ADYA 3T8KA 1ZIXA 3AYZB 1L5ZA 4OV6B 5ITSA 1ABFA 1UANA 3DXYA 3WLOA 3Q8LA 2V8BA 1N9ZA 3C5RA 4HNAD 4F0JA 2JAHA 2AG8A 2G6BA 1CB7A 1Y1TA 4Q03A 1ZCAA 3GCDA 2VDOB 4FOPA 3RFTA 4EPTA 2AKAB 3V2OA 3TWVA 2MINB 1K6MA 1J22A 1CBUA 1B16A 2WNIA 1G59A 2XZOA 4I4CA 4IDEA 2IDZA 2JG3A 4HWTA 4IO1A 4UVGA 2FP4B 1OFIA 2CNKA 2WJYA 4MRVA 1Z5WA 4KDRA 3OQNA 1DBIA 3G9UA 3CZMA 3H8VA 4G0XA 5JBIA 1Z8DA 1REQA 3D7RA 4NATA 1J0DA 3U44B 3V7UA 1Q0ZA 1BQ4A 5JXIA 3O4JA 2QB5A 5DNDA 1ULUA 1IN4A 2AQIA 3G8CA 3FWVA 4OSOA 5IAEA 1O0BA 4A82A 2XVZA 2HLDD 2WJVA 3E5NA 3AEUB 3ZW9A 4KO8A 4EFDA 4JEUA 5LP6C 4WZ6A 3T7DA 2CXHA 2GBCA 1XTSA 3D4LA 4QFVA 4EGQA 1H5QA 4KGZA 4LSWA 2VZ0A 4QM7A 2AXZA 5DB4A 3PEUA 2DF8A 3CMMA 1L5KA 3S81A 1TN6A 2WK1A 4PAMA 3IKOB 1E1MA 4FEGA 2AJBA 1SWVA 3QHQA 2WU8A 3HN6A 2H7YA 1IXSB 3E9NA 3LHFA 4EYEA 5JZOA 1ST3A 2NUAB 4UU8A 3V8EA 3HZRA 2A0YA 5ECWA 1KVQA 2PMKA 3ROEA 4G86A 3ZU4A 2GSDA 1VKOA 4HJRA 4MW4A 2I78A 2OCKA 5BV2P 3OSZA 3GV0A 1F6WA 3V7YA 2Y4TA 3ZKWA 4QUHA 4X1KA 3G2SA 1ZOOA 4ZEOA 1ZPDA 4D0LB 4CIWA 1PW7A 1VIDA 1R8QA 3PFFA 2QAIA 5EIOA 1YKSA 4ETNA 3WS7A 3FUHA 2GS9A 3I9MA 1IN5A 1CDDA 2B9VA 1USKA 3HQ4O 2IXAA 4A0FA 3JD2A 1PNVA 4JCCA 1SEVA 3OJXA 4Q9DA 4RQTA 4GL4A 4XJXA 1IEVA 3L4BC 1SVKA 3Q8WA 3HB0A 4FFNA 1F3OA 3R3JA 1M2VB 2DHRA 1PQ4A 2ZT7A 4LC9A 4MQLA 4Q16A 4PQFA 4LMPA 5CPFA 3UTMA 1NA5A 2OFWA 1KC1A 4H7HA 2UZ1B 3E7WA 3K5HA 4WLEA 5TQ0B 3S68A 4D4LA 3DT8A 3QX3A 1KZ7B 4CGVA 5ER9A 5IKXA 4N39A 4M8KA 4WZBA 1N7JA 1JBQA 2SKCA 3DD5A 1FFYA 4K1XA 1Z0DA 1Y33E 4EG1A 3RKSA 3EPKA 1V3TA 1W4ZA 1J8FA 1P6QA 2SBTA 3NDRA 1T2UA 1IRIA 3D81A 4O2BA 4X97A 4BO6A 2OXEA 1AUOA 1XRPA 3ZXIA 4E88A 1S3IA 1NQTA 5P8WA 5ALUA 5AUQA 4PINA 2PKRA 5B57C 2LKCA 4XB2A 4A5SA 4O1MA 3D3QA 4P5PA 3RTAA 1H66A 1QZXA 2FWJA 3T8MA 2VHYA 5BMVF 1O9HA 1B15A 5D3QA 4DNOA 1VPWA 4ZHBA 5DLDA 1RQGA 1BKYA 1FRQA 3BZUA 3TOVA 4DLVA 2A4MA 3UIPC 4EELA 2IQIA 2W7TA 3ABME 1VKZA 2ZKLA 4I7EA 4GYYA 5HRCA 4X20B 2I6SA 5TQJA 5ALNA 3SF4A 1EFLA 1Z7WA 2JBWA 2JLRA 4MS1A 1YZLA 5DSXA 2XBMA 3EQ6A 1ZLXA 4IXWA 5HKBA 3PR3A 1GUYA 1O95C 3LPDA 2A9VA 3EG5A 4O4JA 2HU2A 4G5GA 5TQVA 1Q20A 3LT5A 3THYB 5D2MC 3E9EA 2H1CA 4R8KA 3MCUA 2DBVO 2XGOA 4ND8A 4MYCA 3GHYA 3OJFA 1JDUA 4OP3A 2A3RA 3C3PA 4P54A 3WZ2A 4YV7A 2ZJ7A 3ZHYA 4ATZD 1TL7C 2RARA 3EIOA 4ESHA 4Z68A 2P0AA 2PZBA 3BS4A 2HXSA 3BCUA 1PHRA 4OU5A 3CUTA 4N65A 2E6KA 3QXSA 3RDPA 2LW7A 4C7KA 2Q5EA 2AK3A 1T5TA 3DV9A 1TFUA 4KBGA 2RKOA 4L74A 4BX0A 5HOQA 3PUIA 5JYCA 3CGWA 2O19A 3IMGA 2VDLB 4XEIG 1NDUA 4ZYWA 1UKZA 3WHPA 5IAOA 1FW6A 3AUSA 2H3EA 3BGSA 5I9BA 4ID3A 3D59A 1XA3A 2Y68A 3BRCA 2COEA 4S1VA 2FW1A 3QBJA 2Q99A 4QOIA 4RDXA 3UT7A 4CEIA 4MJ7A 2HOQA 3KJGA 3Q2OA 2AMJA 2LSUA 1E92A 3AI1A 5LYJF 3OX2A 4QEDA 1EFRA 1N0VC 1N5DA 2Y05A 4WNIA 4XRRA 2J3JA 4JJ4A 4BNWA 2AOUB 5C9ZA 2ECFA 4DEYA 1HU3A 5T5QA 4Y6LA 3CK7A 2TS1A 4A36A 4K5BA 2JFNA 3KTFA 3D9KA 1OSNA 1QV9A 4IDHA 4PWYA 2MCFA 3RQIA 5AJTA 3UUGA 4GKAA 3H18A 4FA6A 1HG5A 1PR5A 2E85A 3W90A 5BOVA 5FR2A 1U0NA 1P5HA 1N4RA 2EIME 1PTJC 1PYGA 1BX1A 2LXNA 3ECSA 2AN1A 1SCIA 2ERCA 2EFEB 1CXZA 4K6HA 3IVAA 3VVCA 1E3EA 4FB4A 3LQKA 1L5NA 3RS9A 1J21A 2V3VA 4KMSA 3JQ6A 1XJQA 2VNKA 4E85A 3CEAA 3HS3A 4FZ5A 3QJYA 2RG7A 1WMSA 4TGLA 4K9NA 2H54A 5I5GA 2XBLA 1M1YE 4I9CA 4RVCA 1ZAKA 2G71A 2F4NA 4IHJB 4DCGA 2Z2IA 2ACWA 1FSGA 3W8EA 4U0UA 1V1MA 5CR9A 1GZ6A 2W93A 1PFGA 3SICE 4EFKA 4M7OA 4PLTA 4F6RA 1CNMA 2VSYA 3FA2A 1AQIA 4YPOA 2C8LA 4NNJA 4CKCB 4KEAA 4W4TA 4R2KA 4A26A 5DIZA 2BLNA 4D8WA 1TLFA 4Y6GB 1XQYA 3QQPA 2G5PA 3A9VA 3PC2A 2J41A 2VGXA 3QJZA 1I0LA 3PH0C 2GCGA 2VF7A 2XNSA 1RJ9A 2AFHE 3LO8A 1E99A 4QGSA 4JT9A 3RT9A 1E79D 1G3IA 4AZWA 3OIFA 2O2YA 4G65A 1GU0A 3C0KA 2JCGA 2FN8A 4WFIA 4X24A 1JVBA 1DO8A 1XWFA 1UZUA 3OUZA 2ZW9A 2GW1A 1TAUA 1YRYE 1OPRA 3C2QA 1CW2B 2PZAA 4KVZA 5DLPA 4Z8YA 5LZ9A 1TLLA 1ACMA 4MCJA 4BX8A 2FUKA 2WD7B 3WRYA 4GPKA 4W5RA 4KDFA 3HO8A 3X2QE 4RQAA 4YAUA 4AJIA 1JT2A 3T15A 3NVDA 1ELKA 3BWEA 3T3HA 3LUHA 3U81A 4MVYA 5CM2Z 3GCXA 2JF0A 2YVLA 2FP4A 2JJ2A 4NU5A 4QPPA 4R8LA 1Z18A 3OJOA 1A1SA 1NP6A 4HEJA 3TBHA 4RXMA 3EPPA 3I5MA 2RSLA 1HRKA 1HEUA 4L27A 1FNDA 1MJNA 2BZ1A 2P67A 1IY8A 5B5SA 4H3VA 3GLUA 1WXWA 1V6AA 1X2EA 2YWEA 3UAOA 5JS7A 2O8FA 5A03A 2KBXA 4BFRA 1SUBA 3X1DA 2VVTA 5A4IS 3PLNA 4TTPA 4DXDA 1QHGA 1OFHA 3ZIMA 4ARIA 4GTRA 1XXHA 2UVPB 2HK9A 621PA 2JK1A 4RHCA 4HI8A 4YJ3F 4EO9A 1PZEA 3CSSA 2GF9A 2GTHA 4HLQB 3BGIA 1ZR2A 1N8KA 1RKUA 4WECA 4CEMA 2I2AA 3CH7A 3NETA 3VKWA 2WXHA 1DC5A 3FYTA 5G53C 3Q73A 3DVAB 5BWCA 2QWXA 3UGJA 1RYFA 4O02B 4AN4A 4ML3A 2Z83A 3GVCA 1SXIA 3GEMA 4ZOLF 4BP9A 2B7LA 1KDYA 3JQGB 1U8XX 4F4CA 5IF9A 2DP4E 3I58A 4KXKB 3QXHA 1VHWA 2V4MA 3SDBA 3WLAA 2DH5A 1F8UA 1V9SA 3NC1C 1R18A 3V4VB 3A4YA 3SJZA 1O6BA 1DI0A 4GNKA 4EA7A 1EGVB 3KJZA 4LYDA 3C4VA 4HDKA 4P4GA 1DU4A 3DDNA 1R0KA 1XTRA 3WWYA 4HB3A 2J7PA 3UAWA 1D7AA 3ICVA 4KDCA 4U7PB 1DCMA 4B4VA 1XEFA 2ZT6A 1K0FA 3LMKA 1IOWA 3W5UA 4OXXA 2NNLD 3T7CA 4LCJA 4CMKA 3T1HB 2VH2A 4RD1A 4XRGA 3TXMA 4TMVA 1E7RA 2CHFA 2GNPA 4FOSA 2RHCA 1V5GA 3R8FA 2FEZA 1R5NA 2QSYA 4R8RA 4WY2A 2SCUA 3ZDAA 1VCNA 5ENSD 1R8YA 3Q5GA 4QVGA 2FLKA 2YC4C 2XS1A 3LCAA 3PI6A 2A86A 1XMVA 5K3EA 2LKDA 1Y5IA 4F4HA 1H0AA 1Y0BA 2PIAA 1S2NA 4AF8A 1X9IA 5I45A 3QARA 4JKIA 3IMCA 1RM5A 4P98A 4XWTA 4DQUA 4PUCA 3TIXB 2AX3A 4UI9K 3PL1A 5FWNA 4LDQA 4B3JA 4MGEA 2J0UB 2OE2A 4KTTE 5DBEX 5CNMA 4RKRA 1PJSA 1RTKA 2CBXA 1R6VA 3IUBA 3KTAB 3LT2A 4UCQA 2QTWB 1ICEA 2QHXA 2DSNA 3ZD9A 1P6XA 3PI7A 3NAGA 5AH0A 2QF7A 2IF0A 3GY0A 3VR4H 3TQIA 1SKBA 4YAKA 3TG2A 3NHLA 1K9SA 3D7SA 2GN6A 1P31A 3WYGA 4TV3A 3ABQB 3CZ4A 3GQBB 1Q1BA 4BV2A 1YGYA 1ZONA 1I3NA 2CDRA 4ZVQA 4RE6A 4CKEA 1C0KA 5LC1A 2BDUA 2WDZA 1QR6A 3QVLA 4XIJA 5A7FA 1E94E 1ZG3A 1PWXA 4C7JA 2QSZA 5EUCA 3ASOE 4NI5A 3QU2A 3RT7A 3PT9A 4B9EA 4YP5A 3JZAA 1X7XA 2QVGA 3T52A 4BMPB 3K1AB 4Z6KA 3ZEFA 3FYUB 3L1VA 4H6XA 5EDSA 2YHIB 2PSHA 2Z8ZA 5DWVA 4AYTA 3ILXA 2P41A 3IFSA 3E3LA 4MGIR 2BSQA 4UOZA 3BERA 1H9AA 2BFFA 3JPYA 4Y1FA 5DISB 4HQ6A 4FLEA 1SQMA 1QGUA 4DG5A 2DPLA 1NR5A 4QUAA 3OHPA 2QTLA 2PL1A 2FZKA 3I2JA 3EEIA 1EM8B 2YWDA 4N5NA 3ET4A 4RK0A 4F5WA 5A3VA 2A33A 2IY8A 4JHLA 2FU5C 4BO9A 5D7NA 1O5MA 3U7GA 3DAPA 3WKDA 1GDHA 4FMBB 5AD1A 2IUEA 3GYGA 1UMBA 3Q6NA 4HAOA 2C2KA 4K3UA 3UG6A 2VDPB 3RYTC 4R71A 2FPLA 2G77B 2WT9A 3LV8A 1XJWA 3F78A 2P78A 4UBIA 1DELA 4IJKA 1ORIA 4LDRA 5CT9A 3HMQA 3B7SA 1TMKA 4KUEA 3K5IA 3PNQA 4JJ6A 5G4LA 2KWIA 2PMFA 4RHTA 4R2XA 4BVJA 2DQKA 4HOQA 4F21A 1DAIA 4X84A 1GJRA 3OOYA 5I9TA 5LOVF 4IDFA 4OHCA 4FHJA 1DAOA 1KJNA 3DO6A 3BMNB 2YIJA 2Y9PB 1ZN9A 3A2LA 3NHRA 3P9KA 4PFKA 4UREA 3RHSA 4FWTA 3UINC 3FLMA 2GPWA 2V8SE 3P2BA 3UPVA 3AXTA 3K1YA 3NORA 1EWTA 1QYDA 1VGRA 2BFDA 1PZHA 1XHEA 3TZQA 2X4LA 4E2YA 4K9KA 1W52X 3QG1A 4TV8F 4EJSA 4TVSA 1FVHA 4OHUA 2WWIA 1VJ0A 4FU0A 4CXMA 1QGED 4L15A 1ZAYA 3VSDA 5JSYA 5GV7A 2I2FA 1TJNA 2OQRA 4J07A 1N6NA 1CVLA 1GYQA 2G1KA 3VGPA 1XNQB 3RV3A 2Y1GA 2GN8A 1GTSA 3IDQA 1J5PA 2IYFA 3LZCA 1T8YA 2B30A 2CFIA 2X7HA 1ZXXA 2QNIA 2GJSA 3LHIA 4UCFA 3RO3A 3U48A 3WK8A 5JAHA 5CMYA 3N2GB 4I17A 5DN9A 1LDYA 1JV2B 3QVUA 1QDEA 1X80B 1I7NA 4D9JA 4LVCA 4YROA 2CL6X 1GQ2A 2FQYA 1JHPA 3ND7A 3MWJA 1E0DA 1KYZA 3B3JA 1QE3A 3DM9B 4DPMA 1X7HA 3SHWA 1XNFA 3JQ7A 4FGKA 2QRJA 4UTPA 3SHTA 3KUCA 5JWHA 1ZD1A 2J1LA 1SBIA 5IANA 3H3FA 1D2RA 3ELWA 4CM8B 4JHXA 3N0VA 1CFJA 3ZGXA 5B2FA 2GNOA 3FWKA 1GZ4A 2FG6C 1E4YA 2KYRA 4MJXA 3QKUA 2IYRA 3CR3C 4QGBA 3AVPA 1C50A 3MJVA 3PGMA 3GVPA 3BFVA 4B4UA 3E18A 3H1GA 5AN8A 4ZAZA 4YA6A 1QP4A 3MZLB 4ACKA 1TECE 3NI2A 2AXNA 1Q44A 1EM6A 1QX3A 4G2VA 3E9YA 3KLOA 4NABA 1FUYB 2B7BA 4JP8A 1RIIA 4LXQA 4DCSA 4UW9A 4BQQA 4JLJA 4UD2A 3MILA 2C20A 1U2QA 4RJJA 5A4MS 3WGYA 3ULYA 1LF0A 1MC8A 3UAYA 1ISSA 2GEVA 2B0OE 1MQAA 1AVTA 3DT6A 1YBMA 3D64A 2P62A 3JD0A 1GRQA 3FWZA 6REQB 2NO5A 4NU0A 2BCEA 2Q0QA 2V6GA 2C9OA 3U4AA 3VO9A 3DOEA 1PE0A 3U49A 1MV8A 3H05A 2Q3EA 4ZP1A 4ENPA 4O0LA 5CIQA 5IUKC 1WHSB 1SZDA 1YHNA 3B6IA 2J9YB 2FGKA 5EIWA 5CBNA 1NMQA 3R4VA 5B6IA 2HRQA 4DABA 5HRYA 4EYQA 2FMUA 2DOKA 4NPHA 4ZO8A 3O1HB 2PWZA 3DYIA 3NATA 1KK2A 2BMJA 1NVEA 2HCRA 5IRCD 1PVDA 5D8DA 1G7TA 1E1DA 4L0CA 3VR6A 4O3MA 2ODWA 1U4OA 3DFUA 2R7NA 3I9V6 1NI3A 3UNXA 2LUOA 1CQIB 1YI0A 3MCWA 4A0SA 5E6UB 3UWPA 5CDHA 4R9VA 2AZXA 1NASA 3QP9A 1ELRA 1RZUA 5EMMA 1I32A 4BY6A 1TM1E 3VZPA 2XGGA 1OFTA 4L75A 5JDCA 1EKXA 2MWMA 4EGJA 4F4FA 3WHKA 2JGIA 2IW1A 2VYCA 1AN9A 5D7BA 2ZYUX 3MTAA 3RIGA 3CB4A 2FFJA 4TT8A 3OCUA 4Q7JB 2WFLB 4GMXA 4R54A 4EY7A 3L8GA 1YJAA 2CXUA 1URPA 2J6HA 3O91A 3W9BA 2JNWA 3ZUGA 5A06A 1N34B 1PR9A 5AHKA 1Z6QA 3MMPA 4YMSA 3HVEB 5ARCA 4OATA 4CTJA 5CURA 3FDIA 4LY0A 4B3IA 3DD1A 2EWVA 1GGHA 5B64A 4GYKA 5NULA 5A0TA 1KP3A 4KPUB 1TT7A 5IS2A 3LD9A 4FZRA 4CM5A 4RA6B 5FLXA 1HT1E 4PYNA 1E1CB 2VTEA 4MVXA 1KMHA 4AF7A 1MX2A 4D57A 1G17A 1BC5A 2BL4A 2HLDA 3GGDA 3VU3A 2HCTA 4XUDA 5FAKA 1CUCA 4I5DA 4DR5B 3PEVA 2B8TA 4CKYA 3U3OA 2FPMA 3QOXA 1X86B 2A4KA 1R50A 3FWNA 3BQOA 4ZALA 1GNVA 4EZEA 2VQ2A 1I5EA 1SIOA 2J46A 2QX6A 4YP1A 2VL7A 4PHFA 1US8A 2BR4A 1EE1A 3I73A 4E4TA 2O1SA 5I8WA 2H8KA 3OETA 3WTBA 2ZRNA 4ALIA 5LZ8A 1U2VG 1GGVA 4ZFHA 1FP6A 3GELA 4TL9A 1M34A 1KH2A 3FWHA 2O9JA 3Q0IA 1Z4LA 5CVDA 2WY2D 4F8EA 4RTSA 2B21A 1MZPA 5HSGA 2YS7A 4E13A 1BVUA 4GNRA 4Z4GA 5FOTA 4JI2B 4LJ8A 2PKCA 5G0TA 3IBSA 1J20A 3V31A 3I5AA 2CJWA 3ORSA 5KSOA 2FZWA 4JA2A 1N5JA 1R74A 2YFYA 5B36A 2VTDA 3U6KA 3DL4A 4Y2YA 1C1YA 1V3VA 2FSUA 3H16A 2CE2X 3C6KA 4QYWA 5EZSA 1P0CA 4DQVA 1ZH4A 5BQOA 1X8LA 3MX3A 4YV1A 2HIAA 4GZDA 3JAKA 4PPGA 3KQNA 2NYUA 3G82C 4MUYA 4NJEB 4R1NA 1DQZA 4HATA 5REQA 1JTFA 2GARA 3FVRA 2RGNC 2VKTA 3K1TA 3LSTA 4D0SA 5HIKA 4MDFA 2ZYRA 4J03A 4BFSA 1MJ0A 1AK2A 1NATA 2JBHA 3K53A 4GM1A 2LGJA 5DF1A 5M5BA 4XX0B 1GY8A 2FLWA 3DOJA 4PO3X 4M0PA 4XJSA 4ALNA 4ZQGA 4F60A 3NHUA 4AY5A 4ESOA 5HDQA 5B6JA 4K9DA 4YJHA 4L4UA 4ZU3A 1P1KA 3FM9A 4BKRA 2QY6A 1Y8ZA 4Z49A 6LDHA 4CQLB 4DOMA 4D74A 1Z8FA 4OVVA 4PLFA 5BNZA 2E5FA 1HL3A 3PDCA 2HZBA 1Z25A 1ACJA 1E9DA 3PEFA 4RL4A 1XPOA 4GWGA 4JI6B 2O48X 2DQSA 3I9LA 1D8DA 4MEBA 5ALSA 3V4OA 1NBME 4B6FA 1OGJA 2MSWA 3MJTA 3N2GA 3K6KA 3TPFA 1GAJA 4ZOLA 5LQAA 4LF8B 3RRBA 4UVEA 3ISVA 4KE7A 2BDEA 1GNLA 4JIMA 3DGFC 4QSMA 1F4VA 5HKAA 4BRUA 3ZD6A 1PEKE 1RPNA 1EVIA 4HGOA 3HDQA 4GZMA 5KWIA 4CGYA 2QQ0A 1VMKA 3L7DA 4HXGA 4XQ9A 1RWVA 1NQUA 4RV5A 1OE0A 4YX9A 2X9GA 4WY5A 2B4AA 3MXOA 2MYTA 2CVFA 2FETA 1W5AA 1JQAA 2DHCA 2ID9A 2VHWA 2UV8A 3L0IB 4W1PA 2EQ5A 4DLTA 1GOTA 1EHCA 2QJWA 1L7OA 3C1UA 3S8MA 3U60B 3EWSA 3NHSA 2D2IA 3RUFA 3ZY6A 4MKHA 3G49A 3OXGA 1JMVA 1BOFA 2P6NA 3A3YA 1N0UA 2FOIA 2PRIA 1ZNZA 4JLMA 1OXVA 2HJVA 4I8DA 5TF4A 1NBWB 1BXGA 2ONKA 4OLJA 3ZWWA 1DG1G 4EYGA 2XUDA 3OA2A 1DT3A 4LHSA 4H7KA 3R5HA 4FI3C 1GCIA 4I9GA 3ZCSA 4MR8A 2G06A 3PUYA 5I4KA 1CYEA 1U0LA 2R8PA 4TWIA 4ZIRA 4L4RA 3Q3CA 1S2IA 3FTSA 3NB2A 1E2QA 1O6FA 4WTOA 5SZKB 4AN1A 4DIUA 5G02A 3CH6A 3EZ6A 1XRQA 3PUZA 3CH5A 1MZCA 4TUYA 3TDNA 2HWXA 4AG5A 4EG0A 4XWOA 4D5GA 2EYQA 5IVDA 3P9XA 4BTVA 4EB3A 3T34A 4D9NA 5JSZA 3VZRA 3KWJA 1RYZA 2P9NG 4BT9A 2ECQA 2EERA 2OG2A 4H08A 1TAHA 3EWIA 4CIVA 3RUCA 1Z5SC 3A6HA 5A5VA 4L8FA 4OAOA 5AKEA 3SY2A 4W9NC 1TO2E 5HJ2A 3TXAA 4AKEA 1RFGE 4Z2AA 4D4HA 3OTHA 3LQYA 4OMFG 4D4JA 3ITNA 5EJMA 3FR8A 3DDWA 3G2HA 5GV8A 3G7SA 5SY4A 5AVJA 3B53X 4D9HA 2I4OA 1JQ3A 5AKHA 1BDJA 9MHTA 3GG2A 1PAUA 1SXJC 1EFCA 1NTRA 1YQ9A 2JGFA 3UJ8A 1ZICA 4QZVA 2DB3A 2NZYA 3HXPA 1JEEA 3ZQ6A 3I9NA 1X15A 4P32A 3DQZA 2D74A 5LDGA 2XRYA 2NV0A 3K73O 3LBHA 4WNDA 4TV8A 3RAPR 3KEGA 2NV2B 2QN1A 3C3AA 3CZAA 3D3NA 4K3VA 4AIIA 4R2IA 1TM5E 5CVJA 1CF2O 1LBHA 5CFNA 6CHYA 2ZB7A 5AVYA 4A55A 5BYJA 5GVSA 1TQ8A 1RC1A 1FSSA 2AFIB 4RMIA 2IRWA 1T8PA 1E2HA 1RYDA 3C5VA 1TR4A 3DR5A 3IPLA 1ECGA 4B0PA 1LJLA 3L6RA 1VBNA 5E1OA 2CNBA 1QANA 1VIVA 2JGLA 1KFKB 1RP1A 4DQKA 1YVRA 3MHTA 3QX7A 2NU8B 1C3VA 2JFGA 3ODGA 3QE0A 5L4NA 3FD8A 3QBTA 4XQGA 3K9BA 1UC4B 4BDTA 5AQAA 2ZIWB 4OXYA 3MB5A 2I3DA 3L6UA 1P6UA 2PGDA 3AL2A 4ZVSA 5HF6A 2JJ1D 4PE5B 4W8HA 4CHGA 4YASA 1L1EA 6YASA 1J1IA 1QVAA 2VPWA 1A4IA 3I23A 4LZZA 5E2IA 3T5BA 1KRXA 4UHKA 3OCWA 1IEXA 4G85A 3HDGA 2V96A 4MB6A 5JAPA 1QDUA 1HG0A 1ISMA 3K8YA 4KO3S 1N6IA 1RW4A 5DXAA 3ZTYA 1AUXA 5IT4A 3KJEA 3P0IA 4U9HS 4BNIA 3Q5MA 3FJOA 1Y6IA 3PXXA 1THTA 4CCYA 3QF7A 1GQFA 4H1HA 3LPLA 2HFKA 2O2XA 4LI3X 4C0MA 1SVOA 2NYJA 2SKEA 2CNOA 3ME5A 4J3FA 4L9AA 3NBUA 4LWPA 5F52A 5NLLA 4OQNA 4EHIA 4B40A 1K9VF 1OC2A 3RS2A 3FJ1A 3KKKA 1KQPA 2C2ZA 5D3ZA 5A1JA 4NFLA 3OLZA 4GU5A 2LDXA 1HDZA 1EH5A 1SBTA 1B2RA 1VMEA 4KH1A 1JKMA 1O54A 1J0XO 3AFMA 1FTQA 4CG3A 5K6RA 3QHAA 2VDVE 4MINA 4YT4A 1Z4IA 2NUPA 3B7GA 2D0OB 1QHNA 2ID7A 4CM9A 5IDQA 4TMYA 1AUQA 1U8UA 2HO4A 2DWUA 1QF6A 2MSEB 2J8SD 1CQPA 1XTZA 1PQUA 2YIMA 2ZS9A 3RC2A 3PK0A 4HS2A 1AV6A 3ACCA 3M6UA 5EWJA 4AK9A 4A15A 5TPWA 3E35A 3IOCA 4CT4A 2FR1A 3RRNA 1ESCA 5I7OA 1UDAA 4Z4HA 4BV9A 3DKPA 1L4GA 1NVWQ 2QUKA 4C78A 2C61A 5KO2A 2AR7A 4ACLA 1JEOA 1CK4A 1KYIA 4M1YA 5FBZA 5CLFA 1NMZA 1W59A 2NZVG 1TA4A 4WBXC 5KYGA 4HHEA 5MN4A 2L42A 4D7AA 1AN0A 2I29A 5ELLA 4EGAA 2YJ3A 3K9WA 4OYSA 4BAZA 4RO0A 4YPVA 5DP2A 3UXGA 1E64A 1AXEA 1X7GA 2HPZA 1DQRA 1C3OA 2WFAA 3AINA 3H5IA 3Q41A 3AIMA 3VUFA 1PJ4A 3VYTB 4BGUA 5FO0A 1M2WA 1DWOA 4PSDA 2L0IA 5BN4B 5IULC 4W8GA 1OQAA 1QBKC 5G3YA 4WZAE 1EI9A 3C41J 3H5RA 1CIJA 4YJ2A 5AARA 3GLIA 4L07A 3RLIA 3WZLA 2XE6A 2IFUA 4XUCA 4KIWA 1T9BA 3AOEC 4DMLA 4ITUA 3DBRA 3ZHUA 2QX7A 1GM5A 2O2ZA 3QUCA 4XARA 3D9LA 1IQUA 3ENKA 3IS3A 1GZ3A 3N7UA 4LX0A 1DQPA 4JL8A 4LJSA 4ER3A 2JL1A 3KPVA 4EKIA 2I6FA 1H4TA 3E03A 1N0IA 3V4SA 1LD7A 2E18A 1D2EA 5CLLA 1RQXA 2PD6A 3C87A 4IV8A 4RPCA 4KZPA 1NX6A 3KJQA 4XR4A 2X1MA 4ENVA 4KPFC 2PXCA 4UBKA 5KMGA 1DAEA 1KEZA 4DDUA 1ECPA 4QOEA 1H5UA 5I48A 3LUFA 1XDBA 3DZIA 4DK5A 4DAOA 2B0JA 2RGNA 4EB6A 2MR5A 4TLAA 3FTYA 1PUJA 1UBOS 4YDOA 3PQCA 4PYKA 1RJ9B 2CNWD 1LPSA 4QNNA 4QULA 3SD5A 2DAPA 2GEBA 5BW5A 3EU5A 3VTYA 1SKQA 1VFPA 1EB9A 1NXTA 2AA3A 2BBSA 3PD0A 3U3DA 1NQWA 2WDPA 1ADCA 2WTUA 4OMUA 3UHAA 5BQPA 3WWZA 2CCGA 5AESA 1WNTA 3E9CA 2AV6A 4DV5B 4Z8XA 4JVOA 5ANRB 2C5FA 5K0ZA 2H18A 2HF8A 2OO5C 2PT9A 3IERA 3O5AA 4KXVA 3DMNA 1T25A 4MARA 3T9DA 2GBFA 2I6TA 3BMQA 4ZAVA 1NRWA 1Q3TA 2XUQA 3I4CA 4G07A 4RD4A 2CBZA 3IEXA 2Y9MB 2CEAA 2NU9A 3OQIB 4GX5A 4LWZA 4QX6A 2YMMA 3SQMA 2JFBA 3IQXA 3PT5A 2DVMA 1BE8A 4LWQA 1WMDA 2R65A 1GYRA 1VSUA 4BE4A 4ZT4A 4BP1A 4I19A 1PGQA 5DK6A 4BO7A 2OK8A 4Y98A 3R7DA 5L6MB 2VSOE 4DWOA 3T3EA 3DEOA 3ND8A 2C4UA 4WK6A 4OKNA 2PUFA 3VYWA 2IOSA 3L01A 1TZMA 2PT6A 2IYWA 1NLFA 3NASA 4FW8A 4V0RA 3WMRA 4HADA 4DDMA 5IEBA 2Y76A 3ML8A 4JL0A 4IDOA 1SB8A 5AI9A 3FWYA 5G0SA 4CNQA 3LX8A 1OBCA 3PEWA 4Q02A 4Q9IA 1EDUA 2RIRA 5KQLA 3L0BA 2B35A 2H2IA 1WVIA 5G0VA 2PV0A 1EJ2A 2YYAA 4R2LA 2EJTA 3JQAD 4TSKA 3WFIA 5TLSA 2HHCA 4OP1A 3RVBA 3KZVA 4H7DA 1COWD 3GEDA 2CL5A 2I6XA 3A4MA 2F3RA 4H3HB 2J7PD 2QTHA 3W6NA 4FUTA 1RYBA 2UVQA 2YJ5A 1XZIA 3PRYA 1EQAA 4PG4A 3HVRA 4N7BA 1KYQA 3B3AA 5H68A 4XVHA 2NXJA 5HBGA 4A8PA 5CB8A 2NGRA 1YZFA 2VDRB 4ID9A 1P0MA 2D8MA 1N0QA 1ODJA 2G3YA 2J8ZA 1JUDA 1JHMA 2O3TA 5LQNA 3RG2A 5C1DA 4EIWA 5K5EA 4TV8B 3V4RA 2O7SA 1V6SA 1JA9A 1JWBB 2QQ5A 1Y82A 1T4DA 2Z9CA 1CQIA 1U7HA 3AUXA 3GRPA 1DEOA 4FJ2A 2Q4BA 4CF5A 4J6EA 4GRDA 4LTMA 5LP6B 1C5KA 1K68A 5C1BA 3CEPB 4NYMR 3TZLA 4XFDA 1YRBA 1HURA 3RPEA 5KYXA 1A2OA 2BONA 1OCOE 2FGJA 2GFQA 2IXEA 2IDKA 2A0FA 2IYQA 4OL9A 4YRTA 5SZHB 2IGBA 3WADA 2HT6A 3R0VA 3ADCA 1LW6E 3APCA 1CS0B 1JLRA 2IVZA 3DMTA 1QO7A 1YMPA 3AF5A 1VG9B 4FQ8A 4GI3A 2Q45A 4I1PA 1E6UA 3KDSE 2C98A 3R41A 1IOVA 4LEUA 4DLXA 2R84A 2W6CX 2IU6A 3UK6A 3G23A 1JVNA 1ZHOA 3KHSA 1NJ1A 1VJRA 4C1NA 2VZEA 4N4AA 1II8A 3MOSA 1H4VB 3GUZA 2PZIA 1EWRA 1ZUWA 1MPTA 4KODA 2HZ7A 3DNPA 2K87A 3I39X 2RCYA 4JA0A 3THXB 1QCCA 5FO1A 2YZKA 2X9VA 4X61A 3AB8A 3KAJA 5K0TA 4TN5A 3U09A 3F47A 2VA8A 4QPNA 3U7EB 1KSJA 5BPFA 5T3YA 3LL7A 2D1SA 3LFTA 4B87A 1RHKA 1LI5A 4WFQA 2A5JA 2DXIA 2IS4A 3BEDA 1VLQA 3DVRX 4QTYA 2R8EA 3OI7A 5ENDA 2JIBA 3UHPA 2DVWA 2GN2A 3R5SA 4XD2A 3D6NB 1N4PA 1U6IA 1F2DA 1TCUA 3VJRA 4HR7A 2AZDA 4LDJA 2XCBA 1ZSVA 3QV1A 3ZGYA 4APOA 1MXFA 1Y4SA 1YKGA 4FYHA 4HDOB 3MYVA 1GN9A 2HIHA 4DDHA 5GY7A 5L53A 3EIWA 3F96A 1MC4A 1SBCA 3EBPA 3I83A 3ISJA 4OAVB 3NKFA 3R3WA 1FZQA 2BELA 1DL5A 2F9LA 4G5SA 1ZIDA 1JQ5A 2PX4A 1N9GB 4OGFA 1Y6ZA 3EEQA 2QE7D 3D6UA 3F6QA 4IRMA 1XZAA 4IF6A 2GYUA 4R05A 4R16A 4RY9A 4WX2B 4CMCA 3BRWA 4D6YA 4KO2S 1Y98A 3FU3A 1C2TA 3GRUA 4CEHB 1P8AA 2FWBA 3D2BA 3ICWA 4DRYA 3AUFA 3IAEA 5M34A 1K6IA 3ORHA 1ESDA 4U2FA 5ILGA 3TH5A 3MVEA 4GPD1 5LP1A 3KC2A 3DS8A 3SF8B 4YXWD 3BT7A 2VUSA 2ZAIA 2WQ7A 2CLFB 3H9GA 3Q9NA 3L7JA 3HXQA 5J2UF 2JD1A 2RK6A 3UMFA 5EUBA 1YASA 5L3VA 3ZWXA 4RMNA 2JLQA 2X0EA 1N7IA 1UAYA 2B8WA 1E7QA 2JFVA 2H1LA 2NG1A 2ZJ5A 4FQ5A 4GM0A 4ZD6A 1YC2A 2Z09A 2IU3A 3CLKA 2BFDB 1PHPA 2I22A 3P0FA 1TMGE 2Q4RA 2ZJ3A 4N8SA 2XZDG 3EWNA 2ET6A 4EKGA 5G0WA 1ELOA 1XEXB 1ZN7A 5DM2A 5KJMA 3TRHA 2V6FA 3KO8A 2WTAA 5JY6A 3DOIA 4AS2A 3E9RA 5B7QA 1M33A 1B8PA 1GDTA 4TKUA 1ZN2A 4S0ZA 4R8SA 1SR8A 1J8YF 2ZS8A 5EP4A 3OEHA 1TNZA 1CUEA 1K92A 2YOFA 4PCAA 1PR3A 2GI4A 2IITA 4WUVA 2Z4SA 3ZXSA 1X1DA 3PNPA 4A91A 2V1UA 3B48A 4C7VA 3KE8A 3OAAA 5CECB 2Q50A 4MMYB 1U2ZA 2WWVD 3KYCB 4OLBA 3AP3A 4IL5A 2I1VB 4BB0A 1O1RA 5J43A 2NO7A 2QA5A 1ENYA 1V0JA 1BCRA 1VE1A 2VPXA 4EYKA 3E23A 3KD7A 4LZOA 4QICA 4N47A 3U62A 1L1QA 3WZMA 1E6KA 3IDZA 1KY5A 2GILA 4H16A 3UJ7A 3ELUA 1V16A 1ARZA 1H05A 4QO7A 2VJYA 3AY3A 3H11B 3K0CC 4OTZA 5ES3A 4ZEVA 1TIKA 2Q4EA 2R6FA 5BN3A 2WB4A 3CVXA 1VLMA 1V5WA 4TUYF 2BT4A 7REQA 3DZHA 2BISA 3RSGA 2LRHA 4HY3A 4WPGA 4MYDA 1ST2A 2JATA 5K0CA 1TAGA 4YP6A 3IMFA 4IIEA 2GM5A 2WG2A 3CW8X 3EMVA 3EDTB 1SVUA 4QVKA 2O4UX 2E1RA 1M2VA 1NNLA 3PPYA 3WHLA 4WXHA 4CLOA 3UKRG 1N0WA 1VSBA 3KSMA 3SIWA 3MQ2A 4RPJA 4ZGGA 4CLRA 5JI2E 1BDIA 2PMBA 3TFQA 5HFAA 2J3KA 3EDQA 3O3OB 2WSSD 2VQFB 2FSSA 3D6TB 3NBXX 2KZTB 2VRWA 3H5LA 3HLYA 3KSRA 4AWBA 2EW8A 2VF8A 4EYOA 1E6EA 2D0IA 5BMVB 2D6FA 4PLGA 4G1VA 4D9EA 1GTL1 1Z36A 3L02A 4PZPA 1NXVA 1KMNA 4HXFB 4UDNA 2ZJ4A 3YASA 5KSWB 2AOWA 1U3VA 1K2VN 1OIVA 2HK6A 2G72A 2MRIA 1CU1A 4YN3A 6REQA 2C2WA 2X6RA 1NQAO 3GGJA 1WBDA 3QXXA 4Q19A 1I36A 3QUSA 1ZD3A 1HDRA 2Z56A 5EIEA 1UBGA 3WR5A 2IEIA 5CHEE 1RI2A 3D5EA 2G9QA 1AM4D 5HK8A 5LYYA 1JNYA 5FPPA 4II7A 4E6EA 4C3OB 3GJTA 4MYSA 1TKAA 5MGNA 4UVHA 1GGKA 4J9VA 1UIMA 1I51A 2HAEA 4IDBA 4XX1A 5IM5A 3E15A 1VP9A 4BO0A 3PDHA 1QHSA 4QG3A 5JS1A 3TE7A 2XA2A 2YXDA 5KHOC 4LPKA 3FKJA 4EPZA 4S0XA 3V55A 1NJ6A 5FTMA 3F5MA 4ZZ1A 3B9RA 3L7AA 4HPWA 3IXQA 4KQCA 3I5XA 4RG6A 1DKRA 2QSJA 3H6KA 3TBFA 2JC3A 5HQJA 1VOTA 2DPMA 2AMLA 3LC0A 1QIEA 1QAOA 2POQX 4QXOA 3B3GA 4Q4JA 1G6KA 3VR4A 4ZJYA 1KJJA 2YUTA 4KXLA 5M3BA 4F1SA 5K6AC 2OV6A 3DSXA 4ZOEA 5E6SA 1UJJA 4EI7A 4V24A 3K2QA 4BKUA 1M2GA 1G5QA 4H1VA 1QTQA 2QROA 5CJPA 3D7MA 3D6VA 3WP1B 3L5OA 5DHFA 4NBRA 3SZ7A 1JHDA 2QG4A 1MB2A 1WF3A 1CVIA 3WQBA 4EBFA 4JLKA 3STUA 1KQFA 2AUMA 5B4VA 3GJYA 2DFLA 3ITDA 1RRGA 4G1CA 1AUPA 1IBRA 3PITA 3U9LA 3GRVA 3OZAA 5HJ7A 5AUNB 4CGWA 1UJMA 2VJBA 4TS1A 4UEWA 2WMOB 3VR1A 3OX4A 4M9ZA 4YLYA 3LA8A 3V3KA 2DIWA 4OQPA 3N8DA 1EAYA 2Q5JA 1XNJA 3PC6A 5KHAA 3UTDA 4C2AA 2V97A 1JALA 3Q1KA 1G20A 4C3ZA 3IBYA 2GERA 5AVSA 4Z9FA 4FULA 1RMYA 3RVSA 3TGOA 5K20A 2GO7A 3M9LA 2XQ0A 4DTIA 4ZQFA 3HCEA 2W6JA 1XQ6A 2V6MA 4HWKA 1JILA 2ZI7A 5FOUA 2JARA 1D7OA 3W5IA 2PX3A 4FC7A 1O77A 4URFA 3M2TA 4EMTA 5KNCH 1E7YA 1T9ZA 4JASB 3V2GA 1CUFA 4QQIA 2FZGA 4GP6A 4KWTA 3SXUA 2AE2A 3TNYA 5H02A 4L8WB 3U6BA 4HP8A 3QFCA 4RULA 5LIRA 3ZHZA 2ZI3A 2OYCA 2Y1FA 1GCGA 4HWOA 5DTRA 2ZAGA 3RYHB 1FT1A 1NI5A 3DDOA 3ESYA 1E9SA 4PGGA 4LJLA 5DHRA 3VSBA 3WQQA 4JLWA 4YMWA 3RAGA 4X7RA 3CQ9A 2WWHA 3JPWA 2B1JA 4KLRA 5DBFA 3UXHA 3DAOA 3V97A 2I1LA 3W5SA 4LZLA 3WKAA 1EAMA 1SD5A 3SYTA 4MA5A 3ZWQA 4BUCA 4EKNB 1MQSA 4YJ2B 1I7PA 5AXCA 3ZK9A 3H13A 3HJGA 1JJFA 4RXTA 1ACLA 5B1BE 4BEPA 1SBZA 2PG3A 1BN6A 1HPLA 1T6XA 4M0UA 3SZ3A 3KAQA 3D02A 4NVRA 4R2WA 3MGGA 4ZZ0A 2FZEA 1YR3A 2PUAA 5REQB 3DTNA 3LFHA 4FEEA 3HSSA 4HDSA 3SJ7A 1LCIA 1LV7A 2WSMA 1T9CA 2BHSA 4AJEA 4MVJF 5LQMA 1GW6A 2NSJA 2OO7A 5KQPA 2IBSA 2WHQA 1ZCBA 2HDWA 5K3BA 1NVBA 1EP1B 1BMFD 4FMPA 4DV7B 1AXRA 1X1TA 1HYHA 4BKOA 4DNQA 2ETCA 3Q98A 3CVJA 1MHPA 3SIXA 1Q91A 2HD4A 1CE8A 2UYQA 1JHYA 4GRIA 4XCVA 4TSRA