4CT0A

Crystal structure of mouse cryptochrome1 in complex with period2
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
494
structure length
486
Chain Sequence
VNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVAANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Circadian clock protein
molecule keywords CRYPTOCHROME-1
publication title Interaction of Circadian Clock Proteins Cry1 and Per2 is Modulated by Zinc Binding and Disulfide Bond Formation.
pubmed doi rcsb
source organism Mus musculus
total genus 173
structure length 486
sequence length 494
ec nomenclature
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4ct0A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ct0A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ct0A01
3IDFA 1NURA 2O5RA 1NUTA 1M83A 5DB4A 5IHXA 2WSIA 1G8GA 2E21A 3ND6A 4KPUA 2GM3A 4H3SA 1WKBA 1KAQA 1T6ZA 3CA8A 3ELBA 1F4LA 2CYBA 1F9AA 2D13A 2EJCA 2A86A 3A04A 2XRZA 1I2DA 4HPWA 2CV1A 2A1UA 3IMGA 1P7PA 4QREA 3HFJA 3A4IA 4ZT2A 3PNYA 1QTQA 5TGTA 2YWCA 1R6TA 4J75A 3Q10A 3E27A 3Q12A 5F23A 1Q15A 2AG6A 1N2OA 2AKEA 1VLHA 1G59A 4R2LA 3TZLA 1EJ2A 1T6XA 2DEUA 2E18A 1TYBE 2ZP1A 1Y42X 5H16A 1I6LA 2PZBA 1M8FA 2HGZA 3H05A 3QE4A 4MULA 1EFVA 2X1LA 1J1UA 4NATA 2X0KA 4X0EA 1N2BA 1FFYA 1O96A 1KQNA 1V47A 2HMAA 4I6GA 2A4MA 3IUBA 1JEDA 5LLTA 4MUNA 4L2IA 2A88A 3FETA 4MW2A 3IMEA 2QUJA 2VXOA 1JEEA 1TYAE 1YUMA 2Z3VA 4R0NA 4ARCA 2JANA 3P0IA 2XRYA 4MWCA 4KR7A 1OBHA 1N3LA 3H99A 3CVVA 4EGAA 1WXIA 3SZGA 1QRTA 2VTBA 3SP1A 1GTSA 1U7DA 2CFOA 4ZCSA 4A91A 2NSYA 1KH2A 3IH5A 5FO1A 4ZT6A 1MJHA 3N2YA 3HGMA 2NZ2A 2V0CA 5HUJA 4XFDA 4MVCA 3AL0C 3IOBA 5J5AA 1EXDA 4G5FA 4PBRA 2CV2A 3S3TA 2DETA 3X1KA 4QBTA 4YP5A 4FZJA 4Q93A 2QJFA 1I6MA 2WQ6A 2IJGX 4XSVA 4EG3A 3GMIA 2A1TS 1OWPA 1QU2A 3UY4A 2PFSA 1X8XA 3OP1A 4Q16A 3VRHA 2ZUFA 3CVWA 3KT3A 2AZXA 4MWDA 1KAMA 3MLBA 4BWVA 2J07A 3CVYA 5FO0A 3N9IA 3N05A 4MW9A 2RD2A 1NZJA 3I05A 1N2HA 4PBSA 1B6TA 3GLVA 5TS2A 3AKZA 4F3RA 2I1LA 2CV0A 3JXEA 3SYTA 1JIIA 3M5WA 2CYAA 1GTRA 1JHDA 3D6VA 1U0BB 4MW7A 1O94D 5J59A 2A7XA 4MUJA 3H9BA 3L93A 2O8VA 1NYLA 1WXFA 4GRIA 1R6XA 2OQ2A 1J20A 4AQ7A 4JFAA 4DJAA 3CVUA 1H3FA 3IOCA 2R5WA 1FYDA 1ULHA 1M8GA 1JIKA 3DPIA 1N75A 1NUQA 3CLUD 4MLPA 5KCMA 1JZQA 4JZYA 1MB9A 2YXNA 1XJQA 3FHJA 1KP2A 2H29A 3IUEA 3PNVA 4NAHA 4KR9A 4ZCTA 3CLUC 4ZCQA 3P0HA 4MWBA 4ND7A 1O0CA 1Q11A 5LFAA 1TYCA 3K9WA 3RK0A 4MUEA 2G36A 3ND5A 4EF6A 2QTRA 3PRHA 4NX2A 4CDMA 1WOYA 4U8HA 1N77A 2OV4A 1IVSA 1EFVB 1IQ0A 1QQTA 4WNYA 3RBAA 4HK4A 3HMQA 2CT8A 2X1MA 1XNHA 1LI7A 4HJRA 4KKVA 1Q19A 4NZPA 2IELA 1VBKA 3TS1A 3FIUA 2A1TR 4L2IB 4YP7A 3L92A 4ZT4A 5K0TA 1VBMA 3IVCA 3HZRA 2QUHA 1J21A 4OJMX 2CYCA 4P2BA 3OTWA 3H97A 3ZXSA 2C5SA 3QTTA 2B7LA 3MLAA 1IQUA 5AHWA 4OUDB 2CSXA 4NDAA 2QTNA 2D54A 3KT8A 1N78A 2ZUEA 2VTBB 1PFUA 3FI0A 1ZJWA 1NI5A 4DDHA 3NBAA 4JYZA 1DNPA 1RQGA 1N2IA 3ND7A 1KORA 3N8HA 5IJXA 1MRZA 1O5TA 1TFUA 3QTBA 4F4HA 1KH3A 1ZH6A 4PY2A 1IQRA 4CDNA 2WB2A 3SEZA 1R6UA 1F7VA 4MUFA 3FOCA 3TQOA 4S1OA 4ZCRA 3P0JA 1PG2A 1EUYA 2IP1A 1N2JA 1PFWA 1MAUA 3KT0A 1G8FA 4MVXA 3TQIA 2PIDA 4EFKA 3D6UA 5DEOA 1N2GA 2D5BA 3KFLA 3A2KA 4I6EA 1IRXA 1NSYA 1I6KA 4I6JA 3A05A 3ZJUA 5JBNA 5FNZA 3AIIA 2J5BA 5KWVA 3FH0A 1NUPA 1EFPA 2GOYA 3MMXA 4MVYA 1QRSA 1PFYA 3AG5A 5LM3A 3IMCA 1M8JA 4U7JA 4YP6A 3X1MA 3SDBA 1WY5A 4DDMA 2DPLA 1MB2A 4G6ZA 4U63A 1GPMA 1QRUA 1JMVA 1COZA 1T6YA 2DR2A 1SURA 5DK4A 3ILVA 2J09A 4KPUB 1JILA 4MVWA 1TEZA 3HV0A 1IFXA 3CLTD 2QTMA 2HZ7A 1GN8A 1PFVA 3CLTC 1O94C 3K32A 3UC5A 1MAWA 4EG4A 2DUMA 4EG5A 2V0GA 3FY4A 2EL7A 1J09A 1J1ZA 3PXUA 2Z08A 2JAXA 2QUKA 4E1AA 3MUEA 4YMIA 3RJZA 3G6KA 2A1UB 1H3EA 2BYTA 3RFFA 4MUKA 3CLRD 3IVXA 4JXXA 3VGJA 1XNJA 1U3CA 1OD6A 3CLRC 4RPIA 2PXHA 2Z09A 4MQ6A 3TZEA 4EG7A 4CQNA 4K03A 4MW0A 1ZH0A 5KHAA 1JGTA 1OBCA 1D2RA 1YULA 1LW7A 3H9CA 1O95D 2QJOA 4MUIA 3CVXA 3LOQA 1O95C 1GLNA 2PZ8A 1NUUA 2J08A 3COZA 3GUZA 3IVGA 4EG1A 4GU5A 2YY5A 1VL2A 1HYBA 1OWLA 4DE5A 2RE8A 2QUIA 4CT0A 1ILEA 3DLAA 1K97A 1U3DA 2DERA 4ZT5A 2PZAA 1O96B 1KQOA 2E89A 1NUSA 1K4KA 1MC1A 3UK2A 3HL4A 2BTEA 3SZ3A 4MUHA 2E0IA 1Q77A 1A8HA 1EE1A 5HG0A 1EUQA 3FDXA 3U1VA 4UZFA 1MBZA 4XFJA 4MUGA 1ZUNA 4MW1A 1O97D 5H7XA 4AS1A 4EG8A 1GAXA 3RHSA 5BNZA 1O97C 4YBRA 1T9GS 3VU8A 3UMVA 3IODA 1OWOA 1PG0A 3Q4GA 1G8HA 1K92A 4NAUA 3UOWA 4J76A 3AFHA 1IHOA 4TS1A 1KR2A 1NP7A 1M1ZA 2A84A 4EG6A 1J70A 3FG9A 2WQ7A 2DLCX 1UFVA 1YIDA 5HUHA 2PG3A 1F7UA 1YI8A 4JXZA 1XNGA 1IH8A 3BL5A 1MOPA 3AG6A 1YIAA 5J58A 5K0SA 3ZJVA 3LE8A 3KT6A 1BS2A 1JZSA 1KQPA 1WZ2A 3ZGZA 2QJTA 3FWKA 4HJXA 1JIJA 3PNBA 1LI5A 4MW6A 1CT9A 4DLPA 1EFPB 2JA2A 4OUDA 3INNA 1KP3A 1KH1A 4G5YA 4RUKA 1U7XA 1WJGA 3RK1A 4QRDA 1H1TA 4R2MA 3LCJA 5TEVA 1WQ3A 1V8FA 1N2EA 3P52A 3G59A 4ND6A 5DASA 3C8ZA 4MAFA 3TNJA 3X1JA 4ARIA 3DO8A 3F3MA 3NV7A 4PBTA 1O0BA 1JECA 1N1DA 1WQ4A 1WXEA 3CLSD 2H2AA 2GKSA 4MW5A 1QU3A 3ZUGA 1S4MA 1WXHA 3CLSC 4KR6A 1TQ8A 4DNXA 3ZJTA 4DDKA 4MWEA 1YUNA 1H3NA 1QJCA 2TS1A 3CR8A 4ZCPA 4MW4A 1OWMA 1GZUA 1O6BA 2DXIA 3DV2A 1WXGA 3IOEA 1QNFA 5EKDA 3ZIUA 3COYA 2X3FA 3COVA 1X6VA 3FNRA 1M8PA 3ZXIA 4ZT7A 1TYDE 3COWA 4UZEA 5TEWA 1M8KA 4WSOA 1OWNA 3NBKA 1T9GR 1K4MA 3SEQA 4ZT3A 3G5AA 2YWBA 3ISJA 2CUZA 3MXTA 1KKUA 2J4DA 4K0RA 1VBNA
chains in the Genus database with same CATH superfamily
2RONA 1G5FA 3P5BA 1DJOA 2J5KA 5ALIA 4HYQA 4XGRA 1ZCJA 1VRVA 1RZVA 1X1RA 2R8YA 4R1SA 3E2PA 2X2EA 1SOMA 2RI1A 5LQRA 2DY1A 5ENNA 3B3AA 2X8WA 1UDXA 1PZEA 4HGOA 4IVRA 3ML8A 2NUPA 3C8HA 2XEEA 4HZUA 1GYQA 4X20A 1KXJA 1Q92A 2XUOA 2A14A 4FYWA 1JWLA 3KJQA 2W2TA 5B36A 4OP3A 1YKFA 3CZ9A 5DBFA 4GTMA 1WCXA 2F8XK 4OY3A 3NNDA 5DYGA 3QU4A 1DKQA 1LD8A 4AO8A 2O0MA 4NCJA 1IOZA 3KZOA 2DKOA 2CUTA 2PSJA 1X7ZB 1SKAA 4GECA 2CHZA 3PLAE 3AB8A 4BETA 4R1UA 3BZBA 3BUAA 3G0BA 2ADMA 3OWHA 5GIPE 5FX2A 3KAKA 4XKBA 3AWDA 2VO1A 4LOJA 2JAOA 1HT3A 5A0FA 4MAMA 5K8UA 2CUKA 1ZR4A 1KVQA 1PC2A 4L9RA 4O4LA 1U3TA 4IZOA 2HREA 2HU5A 2J9GA 4EWLA 2H1VA 4DCGA 3SZOA 4JX8A 1P2SA 4Q4DA 3EEFA 2ZSEA 4FGLA 2H29A 3I1FA 4QUEA 4UHEA 3N8NA 1J8VA 4XPIA 3FGZA 1KJZA 4Y6OA 3CKMA 3ND5A 2IDZA 3IBTA 2K4MA 1CF9A 4MEJA 2FOLA 1Q14A 3C72A 4ZXPA 1X5BA 4C3UA 2VSNA 1W5BA 4I1YA 4NZPA 1RFLA 1L5NA 1MH9A 1U2DC 2G0AA 5IJ9B 4DRXB 3QH4A 2W6IA 2ZEJA 1M72A 2NV2B 4A8JB 4JI2B 1Z7GA 2GXUA 4ITUA 4U7WA 3I2IA 1A5AB 2RHCA 1ESCA 5AKZA 1NM5A 5EUBA 3KEQA 2CDCA 5KMGB 1KGSA 4OL0A 1M73E 2QVGA 3E37A 1SC6A 2BEKA 4IUDS 3VR0A 3IT2A 3NETA 2AG0A 1H42A 3LT1A 5LP6A 5G02A 2DCUA 4MVXA 3VDNB 2APJA 4A8TA 5T4YA 3AM1A 3EYAA 4AUMA 1HWYA 4EX7A 3PCRB 1AKMA 1ISHA 2HXSA 1R4ZA 2KZTB 1N2ZA 4QXMA 2QX6A 2A5GA 5JLAA 4KK4A 4N5LA 4YCBA 2BUCA 4I9FA 4IX9A 1KFJB 3IV9A 3F7MA 5KX5F 3ITKA 4MMZB 5KTNA 2ZJZA 3C39A 5EPEA 3WYBA 1T24A 2VJCA 1GA4A 3NDBB 1T9BA 4PUCA 2HBQA 5ARCA 1LLCA 2FEOA 1U28A 2H1WA 5CYPA 3RFFA 4G0QA 4BNHA 1ZI6A 5JNUA 1RHMA 5HRUA 3PFKA 3C15C 1KEPA 3FUWA 3BK1A 5JSHA 1VPLA 1YULA 3EFHA 1RC0A 1JAYA 2ZJ4A 1D7AA 3U3KA 2QR3A 2FR1A 2XCBA 2NZUG 4CZ2D 2HGSA 5CFNA 5JARA 1SQ0A 2X1VA 2FOXA 2XW6A 2MDTA 1EE1A 4UZFA 4XFJA 4KNWA 5FDFA 4CODB 1D0SA 4M0DA 5DT9A 1SVKA 2ZK7A 2GFHA 2KATA 4MQUA 3AQIA 1SB9A 3NATA 1V9LA 3BL5A 3MJWA 4TUMA 4C48B 1Y4AE 2I2DA 2YWRA 1H69A 3FYSA 2V9CA 4GMKA 2I1KA 2OBYA 2QR5A 1GTG1 1ZIYA 1E64A 1H5UA 5K45A 2BL4A 4R2HA 3NB0A 1S9HA 2L69A 2DUJA 2WNIA 3A9SA 3C6BA 3U3JA 4DN6A 1V1RB 4CLOA 4B4WA 2OD9A 4YDEA 3DOCA 4MWEA 1U0GA 3FPCA 4P3XA 3OHMA 4RDXA 2V0NA 3NHRA 4MV7A 3N7AA 4AVXA 1EDOA 3AUJB 3KE9A 1XDUA 4XWYA 4GZCA 2O2SA 2F1IA 3BH0A 5ALKA 4HLNA 3DMRA 5F51A 2OL4A 1M3SA 1M6VA 1X2EA 3MN1A 4ETWA 2ILTA 3FYDA 3KU1A 4TMVA 4JYAB 5DPMA 7AT1A 3CHYA 1DZ3A 3HBLA 5B7NA 3OLZA 4UQZA 4XPZA 4BASA 3E27A 4H18A 5KOYA 2AKEA 2PZJA 1A8PA 2XXAA 3MRTA 3BXZA 1NKSA 2R4TA 4U1RA 2FDCA 2EJUA 1BYIA 4GB9A 1OI2A 3EBOA 3QWBA 3DEFA 1UT6A 3LQKA 3CW8X 4MS4A 1GILA 4XUEA 2WLSA 2I2AA 3LH5A 4L2IA 5F3WB 2C4WA 4L2YA 2WJPA 3IUYA 1O5IA 1E2DA 2A9VA 3SZGA 3JQAA 4F5EA 4ZQCB 1AHIA 2CFOA 2H57A 2Z1DA 3KL2A 1ECFA 2KSQA 3DVLA 1H85A 1OPRA 2B21A 3R6LA 1QAOA 2VUHB 1DAIA 1QB8A 3PDIA 1Y89A 1J8DA 4I1VA 3GLQA 4FHKA 1U4SA 1Z7YA 4LRYA 1T0HB 4CKZA 1XPOA 2J9XB 1P8JA 5DI3A 1AURA 3DZFA 3I2KA 1LX7A 3MRVA 3OFSA 5CLIA 4OQZA 3N05A 1E6KA 2L0IA 2Y0BG 2P5TB 3CG4A 5E2BA 4FOSA 1ZOPA 4QQKA 5DM2A 3HY6A 1FJ2A 4JB8A 4MUJA 9MHTA 2OCCE 3FTSA 3D1VA 2R86A 3CZRA 2OO5A 5TB5A 3ZVRA 4UARA 3TRHA 4XX0B 3WE7A 5LB4A 1OTHA 4G5QA 5EX3A 1QR6A 4V0NA 2E4UA 4OU5A 2H63A 5IFKA 2Q27A 4S1PA 1WP4A 4LHXA 3FLEA 2EJVA 1P8AA 1F1BA 2QU8A 3E9ZA 5GONB 4PGMA 5HQJA 5I9SA 1D0VA 1RQLA 5IKEA 1M2GA 2XF2A 3TFWA 3GZ1A 1EFAA 5C2JB 5CXUA 1IZ8A 1CWUA 3C3AA 3VR1A 4F2PA 1FNSA 2X3UA 5IZCA 1J7KA 5HKLA 3I3SR 3HA5A 1H8ED 3FOZA 3G17A 3ZEFA 5ISMA 2IEAA 1RMTA 1FDUA 1NUPA 4MVYA 5KIAA 3THYA 4DV6B 1GUYA 2Z8ZA 4PPQA 4RTNA 1F0YA 3GJ3A 3O90A 4UWHA 2H5IA 3OEHD 3VDRA 2F8SA 4FYKA 3DXYA 4OU4A 1R4MA 4G1BA 1CF2O 4BMXA 3HYSA 1GN8A 3GC6A 3SXUA 2VJQA 2GYWA 1MAWA 2EL7A 1LTHR 4JB8P 4HATA 2HJHA 4RWEA 5K2OA 1L4EA 1CCWA 3A6DA 3RAEC 4FBMA 4JAVC 2ZTSA 3ORFA 1JWBB 5LJIA 1AIPA 3PLRA 1HE4A 3A10A 2ATXA 3GCDA 1LVGA 1JDNA 1YFZA 4UJ3A 1CR0A 5LNK6 4FDUA 4KN6A 4UUCA 2HUNA 2PLWA 4WCVA 1QPGA 3CQ9A 2EFEB 4WK6A 3KSLA 3LHSA 3O4RA 3LLSA 5HIMA 4IXWA 1UBOS 3DUWA 3APFA 5ECWA 2HSGA 3MB5A 4FIZA 4IUBS 3VH4A 1SQ6A 4IDPA 1NVXQ 5EP1A 1N6NA 3DDOA 5EIAA 1CQJA 3UK1A 4B3JA 1LF8A 3S8EA 1ZM9A 1YIAA 4N6OA 2RGYA 1D1QA 4C0BA 3CF2A 1T0BA 4PR3A 3PKIA 3OFND 4RQBA 5ITWA 4YJGA 1N4QA 2FMIA 1RYEA 3RU9A 4M98A 5BXOA 5KJEA 3AFOA 5FINA 4DIMA 2YS6A 4HXYA 1S4MA 2BZSA 4CM8B 5FQ7A 4DDKA 4KXUA 4YJ3F 3U7QB 4FTWA 1MJNA 1JJ7A 3FCOA 3M4XA 1I9GA 4RO0A 1Q0LA 4PLHA 3B7UX 3M4NA 2H51A 5FRDA 1GA6A 3AF1A 3K1TA 4C03A 2OEPA 3TVTA 3AB3A 2VUTA 2EJTA 3COPA 4IV0A 4J6IA 2CMFA 4CMHA 2WJ3A 4AY5A 4JJ4A 1EXNA 3TD2A 2W48A 1A8UA 2IYEA 3VVBA 1OX4B 4QJIA 1IHGA 5T6BA 2JFHA 1TU4A 2WDPA 3QE4A 5BW8C 1HDCA 1ID1A 4IQGA 3EXFA 3H0KA 1ZQ9A 1SQSA 3TMAA 1SVIA 2NO0A 3JWHA 4LHZA 3N7UA 3WK6A 3W8EA 1YJBA 4C0AC 3OT1A 4CETA 1SUEA 2WM3A 5LBIA 1IWPB 5DHRA 1PAQA 2FWJA 2UZ1A 1QH1A 3NO4A 2HBZA 1SU7A 2EQBA 3IO5A 4QBTA 2HMTA 2PCLA 4U2KA 4MAAA 3LWNA 3LZ6A 3GMIA 2A1TS 1TEVA 2Z58A 4YCNA 3ASVA 3DEJA 4RESA 3FNFA 2E6KA 3WHPA 2CG3A 1A5SB 3SJZA 4UDNA 3DOOA 4D5EA 2VR1A 2X19A 2IYNA 3EASA 4IEIA 1OFGA 1Q0SA 1ISRA 5HZHA 4DMMA 1ZHFA 2WT9A 1MG5A 3DMTC 4QDUA 1Y9DA 2BTOA 3FDHA 4QTUB 3Q1KA 2XMDA 4F4FA 2VXCA 4C29A 3OHPA 4E13A 5AHXA 3ZLUA 5CXQA 4N7RA 1K89A 4DS3A 3C3PA 2XVXA 4YAGA 4LRUA 4TXLA 4FOOA 2X3YA 4OAUC 1P5FA 5C81A 3ECAA 1PHRA 2P2NA 4BXOA 5EINA 1YFJA 2NU6A 1Q2ZA 3REQA 3HUTA 1YB7A 2V5QC 1C9NA 4NDZA 4YJ3B 4BUZA 2IONA 5AKHA 5JZVA 3E34A 4AY2A 2D2FA 4LS3A 3W8FA 4AXHA 3S7DA 4UHKA 1H66A 1N3YA 5K4AA 3HB5X 1NMZA 4UD2A 2BSAA 4Q5IA 4OREX 3VNUA 5KJMA 2V58A 2IYLD 4KVOA 2J0UA 4UAGA 4Y6GB 5G2OA 3MA5A 3DMHA 1QZTA 3NIWA 2REQB 2RCNA 6REQA 1VRCA 5AVQA 4F21A 4NDNE 1DG1G 2EARA 1KZ9A 5JBNA 1K4YA 1YS1X 1H22A 3WLNA 2TMYA 1U7PA 3B70A 4CKEB 2X9VA 1LDBA 1U8EA 1AY0A 3W7VA 5L6LB 2FLVA 4I4TF 3VI3B 3H9EO 4OCZA 3UMSA 2ZS9A 2P3QA 1PFVA 1P1CA 3V1NA 3ZQJA 3S81A 4FJ1A 1ZD4A 2QFCA 2GPBA 4D3ZA 1HX8A 5B1DA 3DBLB 3T1TA 1AKVA 4ZIRB 4YMTA 5CD1A 4G11A 4EW3A 3HVEA 3U4DA 4Z0HO 3CUKA 1YRAA 3ZNOA 2IEDA 1D09A 5JD3A 4M8NE 4I50F 4IS3A 1HE2A 3NTVA 3ZCTA 2PT7A 2O2XA 4PQYA 3GLIB 1KGDA 2C5HA 2N42A 4B45A 4IDOA 5L3QB 4QA9A 2D8AA 5AOVA 1E8NA 1VCHA 4CI9A 3E58A 3A4NA 4K9OA 4YGYA 5K0SA 3B12A 3QWHA 3PFNA 2G6BA 1LJ8A 2HAEA 2NUBA 2X5KO 1JDTA 1DXYA 2ZIVB 3FTFA 4LISA 4FZRA 4DLWA 3QWIA 1YMUA 4IIVA 5LWHA 5AJTA 3E35A 1XE3A 2FPLA 3I1IA 2HC9A 4WGFA 4D9CA 2R5NA 3TIXB 3AS5A 4R05A 1C9EA 3UFBA 3L7AA 2G63A 3VPBA 1Q1AA 3KLMX 3IPLA 3COVA 3M6IA 3JWIA 4LAFA 1RP1A 5I9IA 1UMCA 4G5RA 1FUEA 2OBMA 4W5WA 3CVLA 2BEUA 3DSVA 3QELB 2HHJA 2C5AA 4NYMQ 2DVWA 4BVFA 2WTXA 2H65A 4QPDA 4UMFA 1PBNA 4MWOA 3SYKA 1HK7A 1UBCA 3ABQB 4I4TB 5BO5A 2WMDA 4EL0A 3ENZA 3BQNB 4TWRA 2HGZA 5JH7A 3HCNA 4RA9A 4KODA 1BS1A 5HS4A 3K4HA 4AIRA 3GVHA 4Y2RA 3SJAA 4HXEB 4G8LA 2ZT7A 2EKBA 2A88A 1YVDA 4TVKA 3GRPA 3KYIB 3VSEA 2VGEA 3DJYA 4C07A 2ID8A 4Q03A 1BYUA 4WBSA 4J0EA 1XLVA 2LP4Y 5LOVF 5L4LA 2BJWA 4I50B 5AARA 1QOQB 4C2AA 3N0WA 4JLKA 1IBMB 1T2CA 4K8RB 4K6CA 1CUXA 3BBLA 3EWNA 1G7TA 4G41A 1G3IA 3K1JA 2JBAB 2GM9A 3R44A 3DB2A 3EZNA 1MF7A 5K8IA 4JHJA 2H85A 3NU1A 1SK9A 1CUYA 2CYAA 2BFFA 5B3JC 2YXBA 4AX4A 1O08A 1U6KA 4M9SA 4PZCA 3UMCA 4LRSB 2AXUA 1AQIA 4QASA 4QBGB 2OC4A 1QKIA 2X14A 1BA3A 2M98A 2GN9A 3MNFA 3JQCA 5HMLA 3P9YA 2C03A 1O94A 4YDQA 2CT8A 1Q17A 3HB1A 5FWXB 2ZSDA 3EGDA 4DNFA 2EHJA 1M2NA 3LBIA 2IWHA 1U9CA 1PJBA 4MRSA 1QO0A 1GLVA 4V38A 2RGRA 2X58A 3PPWA 1EDZA 1HTWA 4UZSA 4R7LA 3CHPA 5LPNA 1NTOA 1O5OA 1IG3A 2EEPA 1VFNA 4I3FA 4AJHA 3WGUA 4EHAA 2HFKA 4FA6A 2W0MA 2X4DA 3ESAA 4YAIA 2XYGA 4YROA 4L2LA 4WFQA 2J9FB 3THXB 5KOHB 2NSLA 4I5GA 4KH0A 1NA5A 3MWEA 3DHNA 3O4VA 3DA8A 2X5JO 1DPFA 2C3MA 2P27A 4ZZIA 2NV6A 4GS5A 3LP6A 3RYHA 4BB6A 5AI6A 4RHUA 4LDJA 5ARFA 1VYUA 1JG3A 4WAUA 3CH7A 4DMRA 3FYUC 5K05A 2R9VA 3T9KA 4P34A 5HJ2A 4IRXA 5AD1A 5EJ4A 2W6MA 2Z98A 4DYDA 3G49A 3L01A 4WKPA 5JCJD 1W94A 2COUA 2R8PA 1E7RA 1BZYA 4D97A 1SHZA 4KDCA 5IN5A 2YZ2A 4OHPA 2G1JA 1E6UA 2GCIA 3KZCA 4QTXA 3FTUA 4QTZA 3OG9A 4YRLA 4O2RA 2A3NA 4YMVA 2CK3A 3DSTA 3V97A 4EPTA 1MQAA 1AN0A 2NU8A 1S3IA 4G2NA 1W9HA 1O95A 1ZXLA 3ETCA 3FG9A 4PSVA 3MA0A 3LIIA 2DFKB 1NPYA 3HRAA 3U19A 4K88A 3UWOA 2V65A 1P5HA 3QV2A 1CNFA 3U3WA 1GUFA 2TYSB 4C0XA 1OPXA 5JQWA 1KH1A 4CT4B 4ND3A 1T2NA 4UQXA 3G5TA 1K5GA 1C1YA 3S40A 3C70A 4OJNA 5LZ8A 4L3VA 3KQQA 3WAJA 4MVJD 2AJDA 5HI7A 4ITVA 4PX9A 4Y0NA 2WU3A 1ENZA 5JPCA 2XEHA 1XCMA 4KXWA 2OBXA 3CC8A 4S04A 2L82A 4BFXA 1VP9A 1D8EA 5DEIA 3PGMA 2RKOA 3LSTA 1EIZA 2VI5A 3ZHOA 2ZR0A 4I1RA 2WUFA 1KPGA 2C2OA 3GMDA 4NIKA 3TBHA 5D7NA 3D7RA 4O08A 2FOIA 3P0FA 1XKQA 1AWCB 3JCKC 2BWJA 2IU4A 1DT5A 4A5SA 4HDRA 4KR0A 3M4ZA 1LVHA 2YYYA 3PNSA 4I1SA 2C9DA 3NRJA 3LUBA 2LKCA 4DIEA 1Q3KA 4ACKA 4MYTA 1GSHA 1QG4A 2NVUB 1SXJD 3U4QA 4JHXA 1KDOA 4X8OA 4MIOA 2BKUA 5BWNA 1UKZA 1O96A 1R6BX 4EHFA 4HL6A 4ZA2A 3OEED 2LXMA 4UVIA 1GKYA 3UH1A 2EZ9A 3V00A 2H6IA 3VVLA 1ECPA 1IJBA 1SKYE 1B26A 1J6UA 1KYYA 2AS0A 3VR2A 4FHZA 2HLNA 4BAUA 1NXPA 4G4GA 3FVRA 1DQZA 1RIIA 3K9CA 1HM5A 4U8YD 4CR8A 3A4VA 1EM8B 5CTAA 1JWAB 1RZ3A 4K6GA 4JXJA 4Q00A 1AXGA 2IO3C 4OYSA 2ATVA 1OBFO 4DAOA 3EHQA 5CDTA 4HS4A 2W4IA 2PEYA 5ESDA 2PS9A 5BSEA 3OCJA 5DSZA 4YS6A 4LERA 4BNWA 3QA9A 3HNPA 2WKWA 2G8LA 2DFDA 1OXKB 3TIFA 1NYLA 2JLWA 1BD3A 4AQ7A 1FYFA 3N70A 1M9NA 4FMBB 2ARKA 3LHIA 3W5JA 1QX4A 5C4IA 4C4ZA 4HAUA 2BFPA 1ZJ6A 3ZLTA 1KT0A 4Z0TA 3VDXA 4YB8A 2OAGA 1N77A 1LRLA 1YMVA 4XDGA 3EBPA 3F8WA 3T34A 2R66A 5JECA 4RVCA 1CJTC 2VNIA 4YP7A 3RRJA 1D5WA 3E3AA 4HLQB 4FR5A 2CL6X 5K9ZA 1O87A 3UT8A 2ZXEA 4KLCA 5FWYA 1VGRA 2VAVA 3QLUC 2CLOB 4OKSA 3N76A 5JSFA 4G5SA 2MCFA 1XZEA 2OORC 1WS6A 1XRQA 2CFSA 5CD9A 5HTOA 3UKOA 1NUHA 2VJPA 4U02A 3V6MA 4AS2A 3SNKA 3T0IA 4XVHA 2PZIA 3JATB 1ADBA 1FX1A 4IILA 1W88B 1JPJA 5C34B 5CVDA 4B3XA 1VIYA 3O8OB 3EHRA 3SIWA 1H5NA 3W4KA 4URVR 3R9XA 4RFLA 3SZMA 4ACBA 3PUVA 2GDJA 2VPTA 2YVKA 3P96A 1USGA 4LYFA 5B1IA 3Q15C 4G0XA 1H9CA 4U0SA 3GQVA 2OBFA 3IC5A 3MIIA 2J9ZB 3UB2A 3M6MD 4LSWA 1WTAA 3UT7A 4Q9DA 1HH8A 3ZVLA 4R8LA 5AXBA 4LF4B 4EZIA 1CUJA 3RSGA 1S02A 2RJ3A 2UZ4A 2HV9A 1U2ZA 2RHLA 3L08A 1RRCA 2VZEA 5CDHA 1MHPA 5CXXA 4IIXA 2CCGA 3EOZA 2JFFA 5CIQA 2PH5A 1TUIA 2CJXA 4LBYA 3EXEA 4N7JA 2IYZA 5BN5A 1PFQA 4X8HA 3WWOA 4NE9A 1KHHA 3F8SA 4RLFA 1JIJA 1T3HA 4LY3A 1T9CA 4MSUA 1JPUA 1GIAA 2QRMA 1WJGA 4TPKA 3RK1A 3CIOA 4UBMA 3KSQA 4FK8A 1QQAA 4HI9A 2B1GA 3X1JA 3PK0A 5LD2C 1UL1X 5IAEA 4WNAB 3UKJA 2VSYA 3IFSA 2BEWA 5B7QA 4NENB 1RR6A 1T1SA 3HBAA 2NO7A 5INTA 1ZH4A 2ZCVA 5EP2A 1SG9A 2NNWB 2J4DA 3GGPA 4K0RA 1VPTA 5JE8A 2X6FA 4GX5A 1P39A 4N48A 5ARBA 3TQHA 4JUCA 4AF7A 5JSUA 2FSIA 4KN5A 1BGVA 1ZOOA 2A1UA 2FRVA 4CQMB 1JCQA 1KPHA 1L5LA 2VRWA 4PZYA 4GRDA 2IC5A 1F60A 5F98A 2QG6A 4V39A 3D31A 5DFAA 3WGHA 1I1NA 4G4IA 2D6FA 4HDSA 4K9LA 5A9RA 3A2NA 3W2HA 2OCXA 4ER7A 4NZYA 3DQPA 1G60A 4RF4A 4JI7B 2MSKA 3VUEA 3LFHA 2JLYA 1YZHA 2AFIA 2LNIA 1PN3A 3MZLB 3UGJA 1JEEA 1ADGA 2D1QA 2GETA 4APFA 1C0LA 3R20A 1B7GO 3I8OA 2A5EA 4IIHA 3GJSA 1ZIXA 3ZHEA 2VXBA 2P91A 4JYMA 3H3XA 1X19A 2QGFA 3PC8C 4MS1A 3W6PA 1RJEA 2ASVA 2XH8A 1ZZEA 1H5QA 4RLYA 4FCWA 2O3QA 3GYGA 4JVSB 1IZZA 3JZIA 5DLQC 2A67A 2NACA 4PBSA 4CRWB 4X1IB 1U80A 1GTRA 3DEPA 4H6VA 2PUWA 3DVRX 3D9NA 4DGQA 1JFSA 3VNAA 3DSXA 4BVEA 4LOKA 2PNNA 1ZMRA 1GTMA 1T36B 4Q82A 2NO6A 4I2ZA 1QHGA 3IEGA 4CEIA 4OJYA 2VHVA 4UU8A 2V7EA 4K9MA 1MQSA 2OHGA 2C1EA 1VKOA 2V4UA 1YZFA 5T6MA 1PFUA 2F7SA 3JU3A 5EJ5A 1HYGA 2XVZA 3IBGA 5LZ4A 2RARA 4MQBA 2A5JA 1F7VA 4EJFA 1ZOLA 5DOZA 2QPOA 4AKEA 3I39X 3LVRE 4J1NA 2F90A 1H19A 1QGUB 1VMKA 4OQYA 1ULSA 1P45A 5CBNA 3LTEA 3C16C 4XIFA 2EYQA 3BC1A 3BD8A 4NMWA 4KG7A 3SSAA 3CNQS 4UU1A 3JRNA 3QWFA 3K0FA 1E3IA 3BICA 3DP7A 3ESCA 4IZIA 5DYNA 4CCYB 5IK2A 1NDQA 4M88A 3FUEA 5DCLA 3RYCA 1PHPA 5D1HA 1P9RA 4DXHA 2JBHA 2R6CA 2PVSA 1BEEA 3T12A 4OGFA 4L4UA 2QXTA 1F9EA 4B84A 4EMBA 3KJFA 3KVVA 1GLNA 2A33A 5KSWB 4L57A 4BT9A 2Z4SA 3R6WA 2I67A 1TO6A 1OWLA 1CZLA 4U2EA 4OFXA 3FCYA 1IVYA 2BMAA 2QRKA 3EH2A 4ZVNA 5H7XA 4F71A 1GAXA 3BQOA 3H13A 2ZBEA 3FUUA 1FE8A 3OJ0A 5CEDB 2Q8PA 3GCZA 5JJLA 4YVQC 1M1ZA 3CSUA 4GTVA 1XAJA 4TSFD 2PD4A 2C9MA 1GXSB 5EL0A 4LKOA 1NMEA 3IBFA 4L9WA 4NV1A 1G55A 3UK0A 4Q7QA 5C4GB 2GBIA 4EY4A 1HTTA 3FCXA 4UTPA 3VZDA 4QT0A 5DGIA 3AJEA 1NMXA 1QZ2A 3PXDA 3F4BA 4YR9A 2GD0A 5AW0A 3EFOA 4EUFA 4IJKA 4ZJZA 4KU4A 1DWPA 4M0EA 4IXTA 1NKTA 2HU8A 2VWQA 1JHQA 3UUXA 3H11A 1JFVA 2P6PA 4AN4A 4FSHA 4HGNA 1VG0B 3DVAB 4TXQA 3K70C 1XTZA 2GM4A 1XMSA 1RPTA 2Q1XA 1DCQA 2AE2A 3RBZA 1XNQB 2BEJA 1OC2A 2OGWA 4YCLA 1OAKA 3K09C 5DISB 3LLUA 1CEYA 3R3WA 2UAGA 1VMEA 1CUIA 5HRAA 4D81A 4NCHA 2AG1A 1DU4A 5AW4A 3LF1A 2E5LB 4MO9A 3JYLA 4RWZA 4HKTA 2OYSA 3LQFA 1FXWF 3QVSA 3RRNA 4XLLA 1DCMA 2NQ8A 1NC3A 1G21A 3F73A 1REQA 2PXXA 1PCXA 4M86A 1PT8A 4CLEA 1NN3A 5JVDF 1NBMD 2H5JA 2Q2QA 5COQA 1UDBA 2VA9A 3WB2A 3SF8B 5EIEA 3RO3A 2XLBA 5ADUS 3H99A 2CXSA 1HQYE 3OLQA 1JIQA 2QRQA 4N2SA 4RTMA 5DTJA 2V0CA 5HUJA 4K26A 1X1EA 4MV1A 1F2UA 3D9HA 4QT4A 1SZDA 3JD3A 3NFYA 2AOTA 1D3AA 3HG7A 3ZKWB 4KIGA 3C3EA 2WYOA 5TNXA 4LEUA 3BILA 1Y5MA 4C5AA 4DCOA 4L6AA 5LB2A 5CHEE 2VUIB 1TECE 2I7DA 1Z29A 2FULA 2MTBA 2WFAA 4AZ0A 3R6TA 1FFGA 1R9JA 1R6XA 2WV7A 1VG8A 1FUYB 1ZM2A 2JI9A 3ANNA 1Y7PA 3GW4A 1TCCA 1JQKA 1YQDA 3QVJA 3TTYA 4QYMA 3WDKA 1U7ZA 1RYZA 4GAAA 3ONFA 3G89A 2P9UG 3AG4E 4CV0A 3RQIA 4PCVA 4FULA 4ZI5A 2DIWA 1VDMA 3U31A 2GK3A 3NOVA 1EFKA 4GVXA 1YA4A 1KFEB 1PG5A 3RJMA 4L8WB 4OJMX 4WPGA 5LU8A 4GTOA 1U4OA 1G7RA 4YP1A 1EA5A 3TO5A 3NVDA 3AUXA 3KEMA 1A72A 2FETA 3TAXA 4JNCA 1ZRSA 1N52A 3ACBA 2AE1A 3F7NA 4FW9A 1MAUA 1Z28A 4JB2A 5DN9A 3RLFA 4GOLD 3DWIA 3PVCA 1JKJA 3KYBA 5CVCA 3W06A 5JNSA 3D9MA 5EUCA 1EB9A 2GOYA 1LLUA 4E30A 2CNWA 1CQWA 3EZ6A 2V6JA 1Q84A 5CA0A 2JPDA 4EX6A 2VDUE 5JVDB 1XFAA 3I42A 1PP4A 2VZ0A 2FSFA 4HAOA 1QPZA 3Q72A 4INZA 4FYPA 4NPCA 2J0QA 4R1TA 3CY6A 1P5JA 3PITA 5DP2A 4F53A 3CLRD 4BLPA 1POXA 1XTUA 3LYUA 5COBA 3NMUF 5ERGB 3PIRA 4OP2A 1IIRA 2Q46A 5DM1A 4Y98A 3QEMB 3L7LA 1K8XB 1YRHA 4XVCA 2M1XA 4FKBA 5FQOA 1AGRA 4HDOB 2ZRQA 3B1KA 1S2NA 4YH1A 1QYVA 5AIBA 1JRLA 2GVDC 2M2IA 3OLXA 4RCZA 3WP0A 3RRXA 3UC9A 1S3GA 2VCYA 1H8HA 2PL1A 3G2HA 5CEFA 1Z5UA 3ST7A 2BI4A 4QC2A 2HR1A 2PKWA 3PQ5A 2XZDG 1Z0DA 2R7KA 3LPLA 1IUKA 2TSYB 2VNAA 1UK9A 3U1BA 1HV8A 3TW8B 2CHUA 5CM8B 2DH5A 1E9RA 4YYEA 4XSHA 3DWFA 3HMKA 3ANYB 4HNQA 1SQGA 1D2CA 4BCDA 2QN8A 4V1CB 1JE0A 2JK0A 3TL2A 1GNPA 4P83A 2YDXA 3UT5B 1OZ0A 2UVQA 4EFDA 3P9QA 2YWBA 1YQTA 2VK4A 4UU0A 4FGZA 4TLEA 2YRWA 1MAAA 1SKYB 1G8GA 4RMHA 5EJFA 1WHTA 1KAQA 1ARZA 1QOPB 3JYSA 1AT1A 2WJJA 1MEOA 1FFWA 2JIZA 1IEXA 3OXLA 3HFJA 3PXGA 3NPAA 2JLVA 4R8MA 2CLHB 3DB1A 1JIXA 1YBHA 2CDNA 3VZBA 4AZWA 1PNTA 3QF7A 3L8ZA 5F1OA 3GH3A 2V8OA 3SQLA 4BRWA 2G1PA 4PLVA 3SK0A 3DBSA 2YJNA 1DAGA 2PUEA 4QUDA 2QE7D 2VT2A 4QUIA 5H3HA 1U63A 4N4AA 2OA0A 4LWZA 4C4XA 4EMUA 4EUEA 1B23P 4M7RA 4EJSC 4GZ5A 5DYYA 5F1PA 4ENUA 3R74A 1N7HA 4EO7A 1LK7A 1GTSA 4QYSA 5A0TA 2Z2ZA 2IYQA 1MUUA 5BW8A 5JR3A 3UTDA 3HDHA 4BNJA 1ENPA 2REOA 3UW1A 2O2CA 1YB4A 1RVDA 1H4VB 4Y9UA 2YWGA 1HR0B 4C4YA 1BWSA 2Y67A 3FHCB 5FI3A 2NPIA 3O2QB 2IYOA 4HN2A 1ILWA 2P9FA 3PEVB 4KZCA 1BGXT 4FBLA 3WLMA 1ZCAA 3UAZA 3JQPA 1H94A 2QI9F 2ZXUA 3TW4A 3PNMA 3HP7A 2A9QA 3BGIA 4QRHA 2G76A 4CIDA 3AI3A 1NQ5A 4BP9A 1P1KA 1CQPA 2ODBA 3NB2A 1W0KD 4RIIA 5KYTA 4U0UA 3FWHA 3UJDA 4D6XA 3NWBA 2WM9B 3DMTA 3U4TA 5GM1A 5BV1A 2K87A 3AJDA 1JDSA 4IIEA 5CLLA 2QQ5A 2V5UA 1Z6QA 1KEWA 4F96A 2RHOA 2H6HA 3H97A 5IH7A 3Q7EA 3DZHA 3KKKA 1PS9A 1U0EA 1VL5A 2VDWB 2D5LA 1TFUA 2JD1A 1N0UA 2WFLB 3MJDA 4MQEA 3FOCA 4L0QA 3WRXC 1SVSA 2X0RA 4ENRA 4HNVA 3WGTA 5HPYB 5C5EA 4RELA 1HDGO 1QYMA 3JSAA 5J2TF 4KRYA 4JL6A 4DCCA 3HLYA 1BSVA 3T7EA 2P58C 2V8SE 1XTVA 1GT91 1P9LA 1N1GA 1YS9A 4FCCA 4AF8A 4MQ5A 3GAFA 2D0IA 1HOXA 4UI9J 4IJMA 2D7DA 2YZ7A 3Q5EA 4Q3LA 2YHBA 2I55A 1LS1A 4J1TC 3S44A 4K28A 2X23A 4DQDA 1NP6A 2ENWA 2BUGA 3TLGB 1TX4B 3HYCA 3KXKA 1JW9B 3C5CA 3ZS9A 3MZ0A 2JHCA 5D6OA 5CT8A 3PDHA 2VP9A 5D00A 2O7VA 1HZZC 1YF3A 1LW7A 2HJWA 3L8EA 4Q48A 4FILA 5K51A 1CRWG 5IW8A 1EM6A 2HA2A 4LI0A 4HDNA 3KOMA 1CY6A 5KX5B 2SCUB 1QV9A 3BORA 1J0DA 4PZZA 2HYDA 4LQDA 4QOGA 3A1WA 4IW3B 5E6RA 3LEWA 4OHWA 1KR2A 4F2HA 2BJVA 1PJ2A 1FRQA 3JW8A 4V2UA 5AW2A 3UG6A 1QC5B 3DFZA 5EZQA 2CHWA 1XUOA 2VHCA 1SCUB 1MAHA 4QU5A 3PEEA 3TWQA 3KPYA 4C76A 1WMBA 2BGTA 3RVBA 5EUQB 5KJ1A 4I1MA 1X87A 2NPOA 3TUJC 3CNBA 1Y98A 4ITRC 3BWCA 4KAJA 3FTDA 1Y3FE 5J4KA 4RK4A 2IKQA 4OHOA 3MCAA 4A3TA 4NFSA 5A02A 1PDWA 4RZQA 5FNVA 4GHWA 1G5HA 5FUMA 1NBOA 1T5IA 1XPUA 2ZIXB 4DT1A 4E3ZA 4PLFA 4ZYTA 3F6YA 4F8JA 2IU0A 4HZIA 4BVHA 3TM4A 3PA6A 2H2GA 3RH0A 1PUJA 4QPNA 5TE9A 2X0EA 4OQMA 2CYBA 5J2TB 5HMMA 3VDQA 4IL5A 3DCIA 3AJAA 3DUFB 3L6CA 3RSZA 3QYAA 2DWCA 1LKZA 2QWXA 1KI6B 3IX7A 3Q10A 4M3OA 2Q9UA 5K8TA 4F1JA 5DSXA 4R7ZA 2Q4OA 1J8FA 4DPMA 2HJVA 2OMKA 4OKIA 1SY7A 3EDCA 1LD3A 3ER8A 4MGEA 1T5TA 1NAHA 4IHJF 2PT6A 2GZMA 1UN9A 3WAGA 1P0QA 5AESA 4LFCB 4EPVA 1DC7A 1JLHA 2ATIA 4F4CA 2NXEA 3LY7A 3C7AA 1NJGA 4KTTE 5I9BA 3IPAA 4K05A 4E1VA 1TMKA 2YYZA 3GBPA 3A0RB 2VNHA 3UNXA 2HEGA 2IF0A 3B9PA 4KBQA 2EG5A 5G0TA 5DIZA 4DCSA 3RSOA 5FTLA 4LTMA 4CTOA 2MT9A 7REQB 1CB0A 2ZDHA 3MK31 4YA6A 3DMFA 1XXHE 3KDPA 1OXSC 3A26A 3DTNA 3KQUA 3PHCA 1R64A 1YVUA 1V45E 3MLBA 5AR1A 2JAUA 2PE5A 5IT5A 4YJ2A 2Q28A 3JXEA 1V7QA 3MW8A 3D6VA 1W1UA 2WWXA 3IJEB 2R87A 1QO9A 1E58A 3ULQA 2PX4A 2IZ0A 5A3VA 4C30A 3OAAA 2H54A 3NJ4A 3IOCA 4QAQA 1B8OA 2BISA 3QK7A 2GPJA 1CFJA 4KE7A 4C9BA 2SHKA 4DLBA 4CEHB 4TQGA 5A7FA 2NSDA 2NW6A 2RBGA 5AIJA 1ZD2P 2ACKA 5ENRD 1V1MB 2PK3A 3ENNA 3KXLA 4DARA 1G6KA 4XIGS 1G8AA 1KY2A 4UEWA 1E4EA 1J21A 1GPH1 4FW8A 5JSZB 1OXTA 4O1PA 3QTTA 2EFYA 3AILA 3ULYA 5FWDA 3O8LA 3LZDA 2JRCA 1RQGA 3QYFA 3JXJA 1ZKMA 1OCOE 2I3AA 1J0EA 2JGEA 4ETNA 4DZZA 2IYUA 5KBAA 1WQ1R 2W6ZA 4I1AA 2PXAA 2XRFA 1EEXB 1XVTA 3SX2A 1ULBA 5HQ3B 4DXAA 3A2KA 5BSKA 3RRMA 3ESLA 3ELWA 3QKYA 4HAYA 2GFQA 5LM3A 1CVIA 4EITA 3QKWA 3IAFA 2WPDA 4NMXB 1MB2A 2BT4A 4D80A 3PTAA 1LA2A 3NEYA 4KGXA 2WFZA 1KARA 4IHJB 3IHVA 1NYTA 4HMQA 1XP8A 2GBPA 1Z4LA 2C5LA 3UC5A 4BKOA 4ABTA 3PXUA 3BGSA 2BYTA 2BDTA 2GBGA 1Z6ZA 1JLLA 3WOHA 4P98A 5JWOA 3RV4A 3FHTA 1KI8A 4U7TB 3R5TA 4LJ9A 2GN0A 1Z8DA 4QDOA 2QVCA 5D6NA 4ENWA 2JFVA 1UPCA 2O0HA 2OKCA 3F9IA 2A2ZA 4ZYXA 4YONB 4XTCS 1T43A 1O97D 4B46A 4F8YA 1TMGE 3TNLA 4CLRB 1G42A 1YCGA 3MYVA 3O38A 4IZ6A 3E48A 5JBIA 3LUAA 2VIIA 1BU9A 1HUQA 1SVXA 5AYWD 4TS1A 3ZK9A 4TZ6A 4O4JA 2I80A 2B82A 4BESA 2PZFA 4YDRA 4AB1A 1W4BA 1GQFA 1V54E 5CB0A 1SG0A 2PQMA 5DGHA 4C0MA 5A4DA 3BULA 4KJZA 4OMCA 3MBOA 4OO3A 5LBTA 2OQVA 3BE4A 2FWAA 1RRPA 2FUEA 3R7RA 3ZPXA 3QOWA 3I4LA 4HDKB 2DXIA 4LZJA 1EGAA 1AQYA 1RPJA 2XQFA 1M8KA 1EFUA 1C2TA 4KN9S 5BMVA 2QY7A 1TJNA 4ESEA 3GLFE 4RV4A 2KE5A 5IBRA 2P68A 3WBKA 1ZMTA 2VEDA 4QSHA 1JNXX 4DG9A 2ET6A 3G5UA 1VHDA 1NF9A 1O89A 5IEJA 4LGCA 2EP5A 3T35A 4FB4A 3JQBA 5KKCA 3OF5A 3OQ1A 2VQDA 3SVZA 2WA2A 3QXGA 4ZV4A 3PXBA 3ZWPA 1OCZE 2OZLB 3T8KA 4HX5A 4PPNA 1WY7A 3DW3X 5L53A 3WA7A 2FMHA 2G7MC 1J0XO 1X1CA 5J40A 4D9BA 1SCAA 1UUFA 1Z3CA 5EE0A 3OPMA 1OXBB 1KZ4A 1X70A 3O21A 1LBSA 1QNLA 3N6XA 3PF8A 3KKEA 2XRYA 5BXYA 4RJIA 3BB3A 1FU4A 2P11A 3S7ZA 4WXRA 1Y7HA 2NSYA 1QVVA 4YPVA 2C2LA 3FUKA 5BV0A 1PJCA 3IA7A 6ADHA 4YDHB 2H4JA 3V4FA 5IMBA 4B73A 4KPYA 4Y2SA 4I5IA 3SHVA 3MILA 4B8CB 1GHTA 4PAWA 3U5ZB 4L8YA 1N2HA 1YDMA 4C6TA 3QDNA 4G1VA 4F3NA 2DHRA 2JHFA 1OGJA 5MHTA 2YQZA 4B3IA 2JIDA 3NWPA 1BEZA 3L93A 4CL3A 2JDIA 4MVJH 1FYDA 3CGGA 4QUAA 3FU3A 1WVGA 1XAHA 4EATA 4RNDB 1WETA 3AEQA 2LUOA 4TTJA 2C4NA 5EJAA 4JIMA 3DPYA 5HW0A 5JRDS 2Z83A 3WWPA 1XTSA 1SZJG 1QQ5A 4HZGA 1GITA 3O93A 4QVGA 1L5RA 1MIOB 1U94A 4PC6A 5BWCA 1E94E 3AOEC 1OA0A 2IV2X 2MYOA 1M2EA 4ZXFA 3RRBA 1GCIA 1D1TA 2VF2A 1MRZA 5JS2A 3AHCA 1QH8A 3G2OA 5CYGA 4F46A 3ESDA 2J4CA 3FYTA 3I64A 3S5UA 4CTMA 2EERA 3FFTA 4EFKA 4AIIA 1LSOA 1S2MA 1NSYA 1Q2UA 1F12A 4FHGA 2XQVA 3JZAA 2FI7A 4ZU3A 1VSQA 1EBFA 2P62A 521PA 3PUHA 3L6BA 3HDGA 1W59A 2OORA 1L5FA 3BERA 1X7DA 5F7JA 2PNJA 4EKIA 1IFXA 3GUVA 3L4SO 4MHSA 3G8YA 1QWOA 1M0SA 5FLYA 2B0JA 4PIVA 4N6GA 2F62A 3PJFA 1Z25A 4JQYA 1H1DA 3TLZA 4BKUA 3QLTA 3C3QA 2IGBA 3BG0B 5TQ2A 4FFDA 2WF5A 1CJKC 1KPIA 5ECDA 2Z4RA 1VDZA 4QO7A 4MW1A 5FULA 4GOMD 3RSSA 2R0QC 3QWWA 3UV7A 5JD5A 3K16A 2ZJ6A 2GRNB 1G9TA 1UFVA 2BEVB 3SG0A 1T8SA 2HPVA 3HB4X 4UHHA 1NQXA 1N0HA 2OK8A 2KBFA 4HJXA 1VPDA 2EATA 4C4PA 1OZGA 1JAIA 3NHJA 4OQLA 5KYWB 2JJQA 2MSEB 3UIPC 3GT7A 3Q5GA 3K9BA 3EFEA 1XZAA 5E8RA 3C8ZA 5TQJA 2ZRKA 1JECA 3G2QA 4M1ZA 2BV3A 2HPHA 2NP7A 4OSOA 3WSWA 3DDUA 3DF7A 3KXDA 1Q0TA 4R8KA 4YECA 4NBUA 3FWVA 1Z5OA 2ZITA 3EUAA 3GAAA 2GXQA 5HIIA 2E1RA 3DTVB 3E18A 1CY1A 4C7XA 4TKVA 2QQEA 1HF8A 4QYWA 4GZLA 1TF2A 3UJAA 1NJ6A 4NPAA 3L6EA 1XWIA 2XBUA 1IDN1 3G7UA 4CN9A 4GMRA 3QE9Y 1NZFA 1V96A 4WWNA 2R6AA 2VSXA 4DXDA 2KI5A 5LXTF 2QVXX 4OMUA 1VHWA 1ZEMA 4LC9A 1NYQA 2HA7A 4S24A 5MF6A 2C59A 3B5JA 5JPIA 2ZWAA 2XT9A 3AU8A 3A6ZA 2I9PA 3CUEF 5C5IA 2JLBA 4CCAA 2NV0A 3U44B 3JQ8B 1Y42X 2WR8A 2II6A 2O2GA 2RC6A 2CFIA 5ITZA 3FOWA 3L41A 2B2CA 5AJDA 1N9ZA 2A4MA 3V3TA 1AG9A 4EYQA 2P6OA 3AB7A 3D4IA 3R1IA 1E9FA 4EPYA 3HO1A 4A55A 2JS7A 1CK4A 2ZTLA 4CKXA 1UC5B 3WFJA 1SZPA 3CO0S 2VHTA 3FPSA 3AP1A 3AUTA 2V6MA 1R0YA 3SXPA 2ZJAA 4Z5XA 1LDEA 4HFMA 1A88A 4IH9A 2AV6A 2FLWA 3QOXA 3MBIA 3NI2A 4G0MA 4UWFA 2C4KA 2JGAA 3GR6A 3OJCA 4MDYA 1JG7A 2G28A 2XOXA 3TQSA 3ILSA 1E8MA 3R09A 2IPXA 2GVNA 3CJRA 3ZCXA 2AEEA 3ONKA 2YHCA 1X1TA 4KMSA 4XQ0A 3CLUD 3HEAA 5LOVB 4RG9A 4YCSA 3H5WA 3WIBA 3RM3A 1W2GA 4PO3X 1HYHA 4GPAA 3BH7A 4Q1EA 2OAP1 2ZAMA 5A9TA 3WYCA 3LQYA 2I6XA 3ZE8A 4G8JA 4HQFA 2O3SA 1RLJA 2AJ8A 2Y9MB 4YRNA 4D0LB 3K6SB 1CRPA 2FK7A 1WA5A 3P4XA 2IZ5A 1S7GA 1DNPA 3M8KA 4Z51A 1W87A 2I0FA 4JODA 2B1RA 2FUKA 4UASA 1FDWA 2OFXA 2PWBA 1G16A 4C4TA 5LXTB 2QMOA 5KJCA 2OZEA 1JFLA 4X95A 2B69A 5IVKA 1NVBA 1BPOA 3CUSA 3IBEA 1M6HA 2QJWA 1ZN8A 2JIMA 3A4LA 2FSGA 3JRWA 1RW2A 4CM5A 5ESRA 1NOIA 4ZRNA 4V0QA 3U61B 3LQ2A 1J07A 3BGDA 1YOBA 2BGIA 2ZUCA 1LBTA 3RJZA 5JV5A 3AJIA 4ARAA 5CUQA 2Y92A 3PIIA 4GOOD 5K8CA 4D26A 1A8IA 1WEHA 4DX1A 2VPIA 1RXYA 1NOJA 4OMDA 4RULA 2Q07A 1IHUA 1ILEA 4HYYA 4Y6WA 5IM5A 3C6MA 2JFBA 2NYAA 3MWDB 2QBYB 3VTAA 5JTTA 1F4VA 3NM6B 5DF1A 2W90A 3VC1A 4HAVA 3EUEA 3OQOA 4BMPB 1YNSA 1F7UA 2XECA 4K9NA 3OSZA 3AZOA 5M2QA 1HE5A 2EAUA 4URUR 3R3UA 1SU8A 4QSMA 3UCFA 1PL0A 1A9QA 1ND5A 3M9LA 1VL8A 3JAWA 4AG6A 3BM5A 3I28A 1EHYA 1QHXA 3C3XA 1OF1A 2MWMA 3TEJA 1TZCA 3QBTA 1FL9A 3D54D 4F1PA 1JX6A 5EJ8A 3FEXA 1K86A 3MUFA 4OQFA 5EZYF 1XAIA 2NG1A 4ZVRA 4GGOA 3I3NA 5FYDA 1QFZA 1GTVA 3ZTTA 5CVJA 1JT2A 3TM5A 3Q3GE 2O5RA 5ALGA 4OV6B 2GM3A 1ZVJA 1R12A 1L7MA 5IF3A 4EUNA 2QTTA 4EL5A 2WXQA 2ZREA 4TLAA 4ZARA 1HZ4A 5KYKA 4KYVA 4ES6A 4RKEA 1N8KA 1N5MA 2ZJ8A 4QGHA 3WRYA 1L3IA 3K09A 4BNXA 3PZ2A 2F9FA 3O1IC 4DILA 2VPWA 1Q0PA 3HCWA 1DEKA 3VJMA 2G67A 2X0JA 4QGFA 1WSAA 4FINA 4D74A 1KS9A 5E1DA 2ACEA 2WY2D 3NDIA 1E61A 4FCTA 5B55A 1Q2XA 1ODIA 4EGJA 1QO7A 2ZYTX 1Y4DE 4O8ZA 1E7UA 2LDXA 3N3BC 5DM0A 4R8RA 1P2FA 4FZVA 2OUKA 3ZDRA 5ESWA 5CMWA 1YQ9A 4H7HA 3UT4A 1K6MA 3QFCA 3IERA 1HDYA 4PXYA 3PUKA 2J07A 2H8GA 1D2NA 1X38A 4P4TA 2OXIA 5FA6A 4E7PA 2QC9A 4LK2A 1BI8B 1K9VF 2PRIA 3SYTA 5ANRB 4L5YA 4WECA 4CCWA 3ENQA 1SBTA 1LTKA 2CGEA 2YVAA 1BCRB 5I8PA 3EF1A 2F6RA 3I52A 2Z57A 4YRZA 2GZRA 4ZEMA 5CFPA 3O1HB 2R6R1 4GMXA 3I9OA 1NY6A 3FE2A 1JXOA 5DJ5A 4UCFA 1G8JA 5EZYB 3HVIA 2I2CA 2PFKA 3U2QA 2A1TR 4ZT4A 1SCKA 3AK4A 2YFYA 3LV8A 1UBGA 2CSXA 3THWA 1JHXA 3C98A 4W7SA 4H60A 3NYQA 1YQEA 1XWFA 2QRZA 2J9YB 1LJUA 4HDCA 4RPCA 3TQOA 4DF3A 1JWGA 4ZHSA 4KVAA 4TS4A 3P1JA 3WGMA 2AXEA 3GEEA 3OQMA 2WG0A 2JGKA 3N5KA 3HSKA 3WQHA 3FXAA 5J47A 2R1TB 2AEFA 4Z4FA 2ORED 3IPRA 1D4FA 1D7OA 1VOTA 2YFKA 3GEHA 4YUYA 4EMSA 4DR1B 1RQPA 3K0AA 3WIEA 4JKIA 5B4VA 4HS9A 16PKA 1UOHA 1BOFA 1GAJA 4CMKA 4KQ6A 4ON9A 3E7PA 2AI3A 3EXHB 4YMSA 4DIOA 1E1YA 3UIEA 1XB2A 3QX8A 3E22B 1MJGA 3HYRA 3BX1A 4QYIB 4TVBA 4B3RB 1Z38A 4V02A 3W4IA 4FZ3A 4KIJA 2PMEA 1TGVA 1IZ7A 3K5WA 3WLQA 5C1IA 3M6LA 3GDGA 2XB9A 1FYWA 1J23A 4DLKA 1D9SA 4UM9B 4BVLA 2CMHA 1UPAA 2WD8A 1JCSA 3CQGB 1C0IA 1JF8A 3OM1A 2OOSA 3IKMB 2A5UA 1CIPA 2B4QA 1OGYA 3OCYA 1P2TA 4D7AA 4MUHA 1I51A 4F1SA 1C3LA 3EU5A 1D6SA 3OVMA 1FZTA 5REQA 3OPYA 2OOKA 1TQ6A 1QZUA 4ANXA 1MC4A 4L73A 2WU4A 4IEEA 2V6BA 1KVUA 3WXXA 1NI4B 2HSJA 4HPJB 1UFKA 2HNKA 3W5BA 1AA9A 3GLFB 4DSUA 4ROTA 1GW6A 5A1JA 3FZEA 4IDEA 4DLPA 5JAOA 2PWAA 3AHDA 1U7XA 3OTQA 3VPHA 1HT2E 3FTYA 1WLSA 4MNTA 4A2PA 3WRVA 3DOEA 3RAGA 2QVBA 1CS0A 1Z6AA 1Q0HA 1YZVA 4M37A 5JYBA 2ZR7A 3OZAA 4O02B 1JG1A 4XJSA 2PDAA 2XBMA 2EZTA 3QFRA 2R8ZA 3GEGA 1QZZA 4EI2A 5K0GA 4JC8A 3I2GA 1RYMA 5AW7A 4KAXA 4ZKDA 1K1AA 4HOQA 5TGDA 4E07A 2GCNA 2UVDA 1B0ZA 3ZV3A 3IUEA 1SD2A 1TNYA 4ZQIA 3OJEA 4NNPA 1N6LA 2PVCA 2WVIA 1RKVA 2QUBA 2O6LA 2QNBA 3JQQA 1QPBA 2CZQA 1TYQG 2DFVA 1NVFA 4UTNA 1T3GA 1XMPA 4M1WA 1DAMA 4V3IA 5IKOA 3WYAA 1WMSA 1GKIA 4JX9A 4X94A 4NBVA 4CG0A 1KVRA 2NXCA 3F3KA 4URYR 2DOKA 1SXJC 1JR6A 1A9XA 4JT2A 3OPYI 1I7DA 4D0SA 3DHWC 5CLHA 2R79A 2K5UA 4OF4A 4P7BA 3CWZA 2IX3A 2FP3A 1DRUA 2Q6VA 1M2KA 5CVUA 2CJPA 3Q4AB 2GS9A 5DTRA 1CUAA 2NZ2A 3IOBA 1U2DA 4UM5A 4O4HA 5G0UA 4PLGA 4YJFA 3DQQA 1Q50A 1P1RA 2F1KA 2B2XA 3VRHA 3M6FA 1W0JD 4EJSA 1FNCA 3HDXA 1CHDA 3FA2A 2AX4A 4D42A 4EF4A 3VHLB 1JDUA 5ILOA 3E7WA 1C3EA 1N5DA 4K5CA 1TU0A 2VDLB 4ZVUA 4MW7A 5C1DA 3V1TC 1XDDA 4JA2A 1N6KA 2O8VA 4IH1A 2OQ2A 3PVLA 5F2OA 1Z2AA 4Z0NA 3RPEA 1RM5A 2AMYA 4ND7A 1WM1A 2H2WA 4GD3Q 8LDHA 1OLXB 3OE5A 5L3SB 4NZZA 3EZ9A 2AF4C 3NWOA 3UXEA 1QQTA 6LDHA 1HLGA 3EA5A 1ZSVA 1PW7A 1YB5A 2B1IA 1FEZA 2ZCJA 5K3AA 3NEPX 1VBMA 1SH7A 1FBNA 1SQMA 2PWYA 3SQMA 4LDRA 1DO8A 5AJXA 4GXTA 2GZSA 3WYGA 5EE1A 3V4ZA 3TW0A 4NBTA 1CR6A 3LXRA 3JZDA 3U6KA 2C8JA 4F91B 2JFPA 5L51A 1MJ0A 1G20A 4CGZA 5KWIA 3WWCA 5JTUA 4FNAA 1P18A 4KLNA 2FFBA 2RBEA 2V96A 4EBAA 3QKRB 2I4TA 4F7DA 4GUDA 2VAXA 3H2SA 3U4CA 4JOQA 5H7PA 2AQKA 4WN9B 2XVYA 3V42A 2E4WA 3WRXA 2Q0XA 3HDVA 2DRIA 1E89A 5BV7A 2PZGA 1Y81A 3K5PA 1Z07A 4DDVA 1NE2A 2FSUA 1GFSA 4ZRMA 1L5KA 4TKUB 1OD6A 4IBOA 2VJ8A 3EOBI 1H2YA 1I94B 3C6KA 1XTRA 2XOKA 4D96A 2A4KA 2GN2A 2WXGA 3KPJA 3OEYA 4HVTA 3U7GA 3L18A 5E9QA 4RY0A 1DSSG 2DBVO 1QGZA 4J1TA 5KQLA 1ZP6A 3GZNB 5KNLA 4U07A 3C7TA 1DDIA 2Z2YA 3TR6A 3N2KB 2IYYA 2C4UA 4EEXA 3TB4A 3MFYA 2IY8A 5IBQA 4WLFA 2HFJA 2DUNA 3VYSB 2E49A 3ROEA 1EK1A 1MO5A 4RVBA 4N0MA 2CE2X 4PICA 1KDPA 2VBCA 3I5UA 4J2TA 1YHNA 4RPGA 4GDMA 3F9CA 4JA7A 3ZHBA 5LP1A 4YFVA 2G0TA 3JPYA 5GIOE 3ELYA 2C5EA 1ORHA 3DR3A 4KR6A 4Q96A 2O2EA 2PFGA 2ZRGA 4K9DA 3O91A 2XR1A 1L4LA 1V2HE 2R44A 5JO9A 4KVZA 2BGNA 4Q01A 1GUZA 4GW3A 5FA8A 5IN4A 3L2OB 5TEWA 2SKEA 3WLOA 4UULA 1XT6A 5KWSA 4EZJA 4F2GA 3P0RA 1DGQA 2ZAIA 2N47A 2ISQA 2NZXA 1E1CA 4JHRA 5E6UA 3ZGNA 4ALJA 4BMVA 2QYUA 3SFXA 5F73A 4G8KA 2HL6A 4X1KB 5EXXA 1QFXA 1UJ2A 2FQ1A 3GU3A 3TK1A 3RKVA 5CNIA 1BH6A 2VP2A 2AWNA 3LYHA 4EHIA 1I32A 4D5GA 3D9OA 4MUBA 2GSWA 1V47A 5EKUA 4G07A 3PV0A 1L4MA 1G19A 4I9CA 1FOEB 3IAAA 3QOYA 3MTAA 4PTLA 2WC1A 3ACCA 1BW9A 1SWVA 3EMKA 5GVRA 5D51S 1FLAA 3K35A 3ZWMA 2VHZA 4EG3A 2ZBUA 3DW1X 4AJPA 2H52A 1T8YA 3B9BA 1BH2A 4HGRA 3EZ7A 4NF2A 1SWWA 3WWDA 3W7AA 4QDZA 8GPBA 1X8JA 2W9XA 3CVPA 3QVOA 4IDHA 4EUSA 1WMDA 3CKKA 2D3WA 3IP5A 1KOLA 1Z6XA 3PXAA 1HDRA 4KWHA 3L79A 2YIVX 1CE8B 4QFBA 1PZFA 3KYDA 3OZXA 3TZCA 1WOMA 3MMSA 3GI1A 3JVDA 4TUYA 3PNVA 3P2EA 4WXPA 2QGNA 4CKWB 4NCIA 3RRUA 2YZGA 1EJ0A 4C7BA 4E1BA 1L7XA 3U5TA 1JR3D 3OIFA 4IIGA 1AGPA 4LJRA 1M6NA 4KZKA 3OD1A 1YL5A 2W2VA 3OU7A 3HVJA 1AUXA 1YFLA 1Q57A 4BQIA 3W2TA 4FHFA 3P4UA 2GGSA 3H0CA 4FXOA 1TYZA 3P20A 2CC2A 5KEIA 3MC1A 2J3DA 1PWZA 3GXBA 3KT8A 4PC1A 2O20A 4DM7A 2XPYA 2NOAA 3BMNA 4FFVA 2O8FB 2OZKA 1RQ7A 2VHWA 2F3QA 4D4KA 4TWBA 3GPIA 1Z9BA 3RF6A 5JZSA 1LX6A 5BORA 3W2FA 4XWTA 4R5MA 1DAFA 3IHKA 4B75A 3RSLA 1V11A 3GJ7A 4GPBA 4EYOA 2GNAA 2D0PB 4H7JA 4U7JA 1II8A 4K87A 2BSXA 4MDHA 3B9RA 1I36A 4U63A 3CKLA 4TRRA 3GRCA 1JFTA 1V8PA 2Y0PA 4D8UA 121PA 1OH5A 4JLMA 2A30A 1B8PA 4M76B 1PNVA 3EZYA 1I6WA 1WD7A 1K88A 1JHVA 2XGGA 2YOHA 1OU4A 1C7QA 1P5QA 1XTBA 1Z26A 4EQZA 3LK6A 3R7SA 1S8NA 3AHIA 3UVEA 3IEUA 2LXNA 3S2GA 2D1RA 1FP2A 1P62B 2HHLA 2NYJA 1WKVA 5I9TA 4HNGA 4LJKA 2R2GA 3EVNA 2GO1A 2GHRA 1IN6A 4RHCA 4C0KA 1VECA 1W8DA 5BUSA 3DHEA 4X91A 2K7FA 5CFZA 2AH5A 4KNYA 1K5HA 1VKJA 4XB2A 4ZI7F 3SN6A 2XUKA 5E95A 3T52A 3NQPA 4CZ2A 5KNDD 1HA3A 4DSAA 4X1YA 2QVYX 5JQGF 1NVVQ 4FMPA 3SYLA 3QFHA 3R9MA 2RGWA 5ER9A 1QRRA 2YINC 2OLKA 2FH5B 3PJRA 1Y33E 3IDAA 3GXOA 2Q1YA 4XM0A 4I8XA 4P82A 3O47A 2IF2A 1W4AA 3OZEA 1TAHA 1FK8A 5HILA 2XJ4A 4ZCPA 2IXDA 3RBXA 5I7AA 1BE1A 5A04A 2GERA 2C5BA 1JQLB 2UY1A 3N2LA 1NUAA 4NJOA 2O57A 4B93B 2VT3A 3QJ5A 4X44A 3ZY2A 1TAUA 4NK5A 5IXYA 3TCKA 3GYZA 1JTFA 3OUTA 5G0SA 1XTIA 1V6CA 3AVWA 4LDNA 4ZVSA 1ZD1A 4JBLA 1JKFA 1NR7A 1FNBA 5EYPF 2A86A 5B2ZA 5AICA 4ZQBA 3GZJA 1WW2A 5JI2E 4RVSA 2JG3A 4HT3B 5LUBA 4Q4HA 1RWXA 5E6SB 2J31A 4BB5A 3OE7A 3CQCB 8ABPA 3KJIA 4QTTB 4YR7A 5CCXA 1M2JA 4ER6A 1ZBQA 1E0JA 1KEEB 4OTZA 3CSSA 1HE8A 4MRRA 6ABPA 3EX7C 1BTOA 4BTLA 4F2WA 1TYAE 2PGNA 3F9RA 3PBKA 4MB0A 4KR7A 3UENA 3JASB 2O59A 2PR7A 4KN8A 2EDCA 3GLSA 2WAYA 3NR2A 3KAEA 1RCFA 1A8SA 1NSTA 3QIAA 1C80A 2VRNA 2YJ6A 5E4TA 1SA0B 2RKKA 2EP8A 3EGVA 1A4XA 3TXAA 1NAIA 1PF7E 1MEJA 5JHGB 3BU8A 3ZBQA 1BHO1 4Q4LA 4MW9A 2ZAYA 1P80A 5EMJA 3EUFA 4K6FA 1WPQA 4OHRA 5AVRA 1D9ZA 5B6JA 3WKBA 3W9BA 2JLZA 4ZP1A 3ZG6A 1VHLA 1OH7A 4M0PA 2F3UA 5JQGB 1GGJA 1O77A 2E85A 2WW8A 2PZEA 2PA0A 4HRMB 5TC4A 4KR9A 3TJZA 4L08A 3P0HA 4A2QA 5GADl 3D3MA 4F11A 2OEWA 3UM2A 1OQAA 1JG4A 5ALFA 2B36A 3WIDA 1AMOA 4ZMRA 2P67A 2IY7A 3KLNA 1UOOA 3A3OA 2D5IA 1UM8A 1KK3A 4PYQA 1P1IA 1OT8A 1OYWA 2LDBA 4DTCA 3OTWA 3MV2B 1DC2A 2D7CA 1L4NA 1LPBB 5A7GA 4QM7A 1JQ5A 2VTBB 3HUEA 4P3OA 2H1SA 1E90A 4BWRA 1E7MA 2F3PA 4J8YA 2BFBA 3V4SA 3OIWA 3R7WB 3HJAA 5EYPB 3T9FA 3S2SA 3T1QA 1OYOA 3F71A 3AOEA 4YI3A 4CI0B 4BO5A 1H6BA 1GCGA 1WVIA 1JR4A 3OTOB 2C2MA 2XTZA 5CDFE 4JBIA 4WASA 2GGFA 1DIOB 2VTDA 4GRAA 3QPDA 1CERA 1TM3E 2J09A 2JCBA 3VPGA 5JEEA 4AM8A 5A4AA 4CVNA 1H8EA 4D0GA 3K1ZA 2A1IA 1H3EA 2VYQA 1X1AA 1RDFA 1U6IA 3CLRC 2BFCB 5EWJA 3B8HA 4OHBA 5KHOC 4UUAA 3PPXA 4LHWA 4EM6A 3DWLG 2QGZA 2VHXA 2D3TA 1MTZA 5B6PA 2VHEA 1KJNA 4KVFA 4UBLA 4B7XA 1RNLA 3MCUA 2UUCB 3RK4A 1U3DA 3PHJA 2C4MA 4DJ5X 1T5OA 3A11A 3UB3A 1E1DA 3UOAB 3OUUA 4ZAYA 4QNNA 1NT2A 10MHA 4GPTA 1VPVA 3L4EA 2O1XA 5LA6A 4Q37A 3AI1A 1PY1A 2PZMA 1Y4SA 4TL9A 3ISTA 4Q9JA 4TRJA 2KYRA 3S7BA 2NUAA 3EY4A 3H84A 3RYFB 2P6UA 5FPPA 4K1XA 5JT1A 4APOA 5IABA 4MPRA 3BWEA 3RSHA 3BDAA 3UFXB 3KVNA 2UYQA 2DHCA 2JHGA 3AVOA 3EPPA 1PR2A 3VXKA 3ZE1B 4JEUA 1N1DA 1WQ4A 3GNTA 5GVSA 2GKSA 5HRYA 5AQBA 4TXRA 1FCJA 3Q85A 4JR1A 1XQYA 1UP4A 3OFNA 1X6VA 4YT2A 1WMEA 1KZGB 4HH4A 4QVIA 1BWQA 2ZDGA 3H4TA 1JHAA 2WK1A 2A7QA 3V4LA 3DVQX 2XUJA 1PUIA 3RSEG 4BB0A 4XDYA 1PT7A 2C2XA 5IRCD 1N95A 4BEWA 2YZKA 1GSIA 3ICCA 3Q7SA 2PU5A 3JQGB 5ALNA 5I51A 4QREA 3DBIA 1V3TA 2LBPA 3V4VB 5TGTA 4PZUA 4J75A 1M1YE 1TJYA 4UBKA 1BMDA 1PTJC 3CYFA 3ND9A 3E03A 1J5EB 1Z4IA 2BE7A 3GPLA 5B3JA 4KXMA 2WD7A 1SUSA 4W7IA 4MINA 1FLNA 5AM2A 3OY2A 5F2EA 3H83A 4DG5A 4PZ9A 3ONNA 2BM9A 3E15A 4TV9F 3EIEA 1PS0A 1UPFA 4H1VA 3TNFA 2P9CA 1UCFA 4PO9A 4DB4A 1YVPA 2I8LA 2PGOA 5DDIP 4D8XA 3BIFA 2E82A 3KM0A 1B15A 2C57A 2IJGX 1M5UA 3PVZA 3NALA 2QAGC 1OWPA 1KC1A 2WBLC 4YPFA 4BC1A 5EFZA 2FMKA 2Y4TA 1OREA 3GRVA 5CBPA 4ATZD 2BI7A 1U5BB 4N40A 1IHYA 3KEFA 3O7MA 5FPKA 1RI3A 1R6DA 1E7VA 2NP6A 1TVEA 4EO4A 1EEHA 4Z9XA 4V0SA 8MHTA 5AVKA 2YJ5A 5HBRA 3TG5A 1XP5A 1P1FA 3LPZA 1ZXBA 2Q3HA 4P53A 4DB2A 1MB9A 2V4HC 3QFFA 3F6BX 1G4UR 1H2UA 1DV2A 2IY0C 4R1MA 4KFCA 1E5TA 2AYZA 4ZAWA 4WERA 5F5LA 3ZLJA 3HJTA 3CNNA 3PCTA 5L3RA 4BLOA 2GJ8A 5K2MA 4RTQA 4BC0A 3FYUA 1R5OA 3FVWA 3S55A 4J0HA 1BE8A 2GAFA 3ZHXA 3LT5A 5SYMA 4M0KA 4OM7A 4P3KA 1SBZA 5GV7A 4RQUA 5FQ4A 1KMMA 4FDLA 1I2BA 1B89A 4NCNA 3RVOA 1KYXA 4II3A 4D9MA 4S1OA 3BQMB 1HXHA 5TF0A 2GKOA 1EMDA 2PZKA 1OW3B 2Q7XA 4X3CA 1CY0A 1OY3D 5T8IA 2PN1A 5F1KA 1I7PA 2NM0A 4TL6A 4HGYA 1R74A 4GH5A 4NBSA 2PJUA 1X94A 1K2VN 1E8XA 2LAHA 4CG3A 3IXMA 2OGSA 1TT7A 2VEOA 3TEMA 2QLFA 2J9RA 4KPUB 1WBBA 4M6WB 5M3BA 5LX8A 2V1XA 2FFHA 4TV9B 2EZ4A 5AKYA 1V1JA 5TXGA 1ODFA 3UWDA 3JVIA 3ETJA 1UN8A 2BONA 3M83A 3EVAA 3JAMA 1Y9JA 2FX2A 3UM0A 4TTQA 3ER6A 3Q8LA 2RGCA 5FBLB 2QTGA 2K7ZA 4AKIA 1TNDA 3ELDA 3VYVA 4B3DA 1XL1A 1ZICA 5LN1A 2E0IA 4ENSA 3KS2A 3WGGA 1FRNA 1U0FA 2H2DA 1FT1A 1YSCA 3COSA 4CQJA 1YR8A 3QC1A 1FU7A 2QW1A 3O1JC 1IYGA 5HKKA 2D5AA 1SQ5A 1K27A 5FLKA 3H2HA 3A1UA 5K4HA 3UTCA 3FNIA 2FZKA 1S96A 1ULUA 3DBHB 2WOOA 1EFPB 4RE6A 1DX9A 4ZQHA 3LCJA 4FP9A 2GB4A 3P52A 3FPEA 3HSSA 5DZSA 3SICE 3STWA 1GQOA 1N3BA 4LNUB 1Y5NA 1PKXA 3D4LA 3GLHA 2C84A 3RTCA 1GZ6A 2BGUA 4YRDA 3SX0A 1WIWA 3DAPA 1E60A 4J4HA 4M46A 4ZALA 4P7FA 1N2CA 3MS2A 4YRQA 2RG8A 3M70A 1R8YA 3SLRA 4AXBA 4C6SA 1P1BA 3CCBA 3V8NA 1MJGM 3FF4A 3WA6A 4XWWA 3JZMA 5FZQA 2XADA 1EP3B 3EDYA 4G1FA 1OFTA 3MS4A 2PSEA 1Q7BA 4YK7A 2WEKA 1ZBPA 1I2AA 3EVCA 3QG1A 3UJCA 5GZ3A 4BUCA 4ODIA 4REQB 2V7VA 2QLMA 2HU7A 2V7GA 3MBKA 5K8VA 3I76A 2JBWA 2CVOA 3VU9A 3EGXA 3DV0B 2IDKA 3RIYA 4QXQA 4EQ6A 2DLNA 3IE2A 5KYGA 4IQFA 3ZKAA 1KMHB 3BFXA 1Z2DA 2GARA 5I8WA 1U3FA 3BIXA 4UUQA 1HG5A 3Q40A 2M32A 1Z74A 3ZGLA 1QQEA 1GPAA 1CUGA 1ZK3A 3D8SA 4M1OA 1EXDA 2FB9A 1MT3A 1TJPB 3UO8B 1HTBA 2P2SA 2WYVA 3QLUA 3SS8A 4WNCA 4YV0A 4BWVA 1QDLB 3CFYA 2CNKA 5CJJA 2VN8A 2IP4A 9GPBA 1F2TB 1XSEA 4W1RA 5EJEA 3N58A 2B6CA 2FPRA 2C7QA 1P0CA 1Z0UA 2PT5A 5CECB 5B58T 1DWUA 2WE8A 4YEDA 4A73A 3EGEA 2IHYA 1DTWA 2HHHB 3GOHA 2IEBA 1ZUNB 4P1ZA 2ZQYA 4RSYA 3EG9B 5BR1A 1NV9A 1ENYA 2BY4A 4MUEA 1IAQA 2O2JA 2YVQA 3AEUB 1N8NA 3ER9A 4RKFA 2BMVA 3Q15A 4R2WA 2IH2A 5C7YA 3NGLA 3PWZA 4PIPA 3IPCA 3SNHA 1K8KG 1TGYA 2XE7A 2LPMA 4MI6A 4C7KA 4RIFA 3L5OA 3H1BA 3CZPA 4DDHA 1XMIA 3GEPA 2GN4A 3PRYA 1ZGJA 3PTZA 4B6OA 1QFSA 5FFNA 1UWVA 4H31A 3ZZTA 4ROSA 4S2EA 3EPRA 3UICA 4ND1A 4FBGA 3IAHA 1WPXA 1P9OA 4F4IA 1U1IA 1VSTA 5AI5A 4XH9B 4D82A 5ETJA 5SICE 4RTKA 4LVNA 1I0LA 4FFBB 3L7IA 1BXRB 1TEZA 2BELA 3V32A 4YY3B 4PC2A 1NRJB 3H2ZA 3R0JA 2EHDA 2QUKA 5BSTA 1XKLA 2IEZA 3QUQA 1W4ZA 3VR3D 3ZDFA 5EJ7A 2CLCX 2C04A 4LF9B 4WDRA 3IESA 3T41A 3DV9A 5CDGA 4EDFA 1W73A 1GTL1 4BNFA 4BFSA 2GASA 4HBZA 2CD9A 4AQYB 3URZA 1Q77A 3B6JA 1VXRA 4XXHA 2ZRBA 1O97C 2VUUA 4R68A 4N65A 3F3YA 2Y0CA 4PONA 2WUEA 5JCJA 4NAUA 1XTTA 1C7EA 2HSEA 3EIXA 4DK5A 1E9EA 1IBSA 4DAEA 3KP1A 2PLRA 3CNOA 3DNMA 4CV1A 1DBWA 5KNBD 2FWIA 4FR2A 4IINA 3E3NA 3FDIA 3K31A 1IN4A 4J94A 1XTJA 4AG3A 3FBTA 1MCZA 1C0EA 3EIQC 2ZBFA 4QRDA 1NN5A 3GNQA 5D3MB 5JNTA 3RIHA 1FP1D 1Q0RA 3FJ1A 3UA4A 2Y3AA 2G77B 5JASA 2P9NG 4M9QA 4WGGA 3ZUGA 4P58A 1EVKA 3DOFA 5L7YA 3RFUA 4BO9A 4XWKA 4B83A 3ZTYA 2IHKA 1YB2A 1IULA 3HKBA 4F3TA 1WY6A 1W581 1OZAA 5ERYA 3WFIA 3RT7A 2L2QA 4CGYA 4INPA 3V2OA 1KBOA 3WADA 3PC8A 1A2BA 4MVJA 2PKQO 2E21A 2YC2C 1RYDA 4CGWA 4B0OA 1QFJA 4YMLA 3OLWA 4F8EA 4BO2A 2D13A 4YJKA 1L7VC 1KEUA 2JGNA 5K6RA 3AETB 1QHHB 4ERNA 2YN0A 2B4TO 3EISA 3H5NA 2YOGA 3KQNA 5BN4A 5FL7D 4HNAB 2IYTA 2AWIA 1PWEA 4OAQA 1U0NA 2BGLA 2HOQA 1BXGA 3BRQA 2WYHA 5B4UA 3EAQA 1YHZA 4AURA 4LOLA 3THRA 1IUNA 3CSDA 1CZUA 2RHBA 3RU2A 1S8FA 2JANA 4TMKA 3C8UA 3WFZA 4A91A 1SXJA 3BXHA 4KMMA 1FVOA 1NR5A 1S1MA 1CEXA 4ZCLA 2F3SA 1VA5A 4JI5B 3W9SA 2OHFA 1ZONA 3H1TA 3OEEA 1E79D 1Q83A 4B4DA 2A8YA 4JI4B 2D4AA 2P9ZA 5IDXA 3HU1A 5C37A 5FI0B 3QE0A 3KSBC 4JLAA 1EVEA 4Q3NA 1T9DA 3HQ4O 4P3NA 5GY7A 1E20A 2XCRB 4KXFB 2EIXA 2I22A 4MVJP 3DBRA 2J33A 4B87A 2P79A 4MVJI 3T5PA 3BB1A 3QKUA 3PFBA 3F6PA 4Z3KA 4BZZA 1Q11A 4OHCA 5J9FA 4DKXA 3KYCB 4AK9A 1KYZA 4KFRA 3HNOA 4MUYA 2Q3LA 4NCKA 3JQ7A 1Y4UA 1ZUD1 2R8XA 2JGFA 1NNSA 2ZTVA 4M8IA 3CLHA 2OXTA 3L8CA 2IELA 3EWAA 1QIDA 1KMQA 1OV4A 3LPDA 4G8BA 2GAOA 2ZWVA 4ZGBA 4UWLA 4RHTA 1RAIA 4IGKA 1D9XA 1TM1E 1YJ5A 2C1XA 3FCEA 3PNOA 3G68A 4H7IA 1K66A 2WZBA 2CD7A 1M7HA 4HAXA 4B3BA 3JVUA 1QCDA 2ADFA 1GEGA 1XFDA 1TJ5A 3WLEA 4O2BF 1L7NA 4FGSA 4HRVA 3MJCA 1OAOC 4DUPA 2WTMA 3S8YA 4OSPA 2R6DA 1WM5A 4LK3A 4WXMA 3PVSA 3BREA 2P2GA 1QRUA 1T6YA 3HCAA 4P33A 1KMCA 3SBTB 3LFTA 2Q5QA 1PYGA 5AVWA 1MNAA 3TWOA 4KPFC 2GI4A 4BGUA 1J0AA 3A06A 1IJFA 4EG7A 3S2AA 2EBHX 4NZMA 4BO7A 2F43B 5DTIA 4NV3A 4EIWA 3HPQA 2MSWA 4F0JA 1HO8A 4UVGA 1F48A 2C2KA 1A97A 5GAJA 2OFFA 4YRKA 3M7IA 1KAOA 3T5VA 5HG0A 3RARA 2RIRA 3IBSA 1XXHB 2J3QA 2AOUA 4DG8A 4RDCA