1N4SA

Protein geranylgeranyltransferase type-i complexed with ggpp and a geranylgeranylated kkksktkcvil peptide product
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Structure of mammalian protein geranylgeranyltransferase type-I
pubmed doi rcsb
source organism Rattus norvegicus
total genus 126
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n4sA00
1TN7A 1DCEA 3DPYA 3Q73A 1S64A 1TNZA 4YDEA 1TNUA 3Q79A 1N94A 2F0YA 3KSQA 1SA5A 1O5MA 3HXEA 1TN6A 3HXFA 3DSTA 1JCQA 3PZ2A 1TNYA 1S63A 1N9AA 3SFXA 3E37A 4EHMA 1O1TA 1TN8A 2H6HA 1D8DA 1X81A 3HXDA 1NL4A 4LNGA 3PZ3A 1KZOA 4GTPA 4GTSA 1TNOA 2BEDA 3DRAA 3E30A 1LD8A 1JCSA 3EUVA 1O1SA 1FPPA 2H6GA 4GTMA 3KSLA 3DSVA 1LD7A 2R2LA 1O1RA 1MZCA 4GTRA 1SA4A 1LTXA 3DSUA 3DSXA 1JCRA 3E33A 4GTQA 1FT1A 4YDOA 2H6IA 3PZ4A 2ZIRA 4LNBA 2ZISA 4GTTA 1N4PA 1QBQA 3Q7FA 3Q7AA 1N4QA 1N4SA 3SFYA 1KZPA 3E32A 2IEJA 3Q75A 3HXBA 1TNBA 3DSSA 4GTVA 1N4RA 3Q78A 3HXCA 2H6FA 3DSWA 1D8EA 4GTOA 3E34A 4MBGA 3C72A 3EU5A 1NI1A 3PZ1A 4L9PA 1N95A 1FT2A
chains in the Genus database with same CATH superfamily
1K1BA 4DX7D 1IHBA 3SGHA 3UKRG 5T8IA 2RFMA 4GZCA 1DVPA 3UTMA 3CV0A 3P1UA 5EX0A 2WXIA 2F0YA 4KXKB 4BY6A 4EQFA 4I43A 3ULQA 2DIWA 2ETBA 3D9NA 3D9LA 3PNLB 5AAOA 2ZGDA 3Q5MA 2NSZA 3AS5A 2J4DA 4PS7A 3LCAA 2P9UG 1O1RA 4DX2A 3J5PA 5BT1A 2Y4TA 3FHEA 3ULEG 4BSZB 4O6FA 4FJZA 4J8FA 4GYOA 3G2TA 3V2XA 5KNHD 2LNIA 3AU5A 4A55A 3B13A 1QBQA 3ESLA 3Q7AA 4H7XA 1N4SA 3ZPJA 3T9KA 4GYWA 4AEZC 2CFUA 3C3QA 3VTXA 3MJWA 2WXFA 3JQ0A 4XZ4A 4UWGA 3JQ1A 3CHPA 4L9PA 2AVPA 3GZ2A 5CMYA 3UT7A 4N39A 5CCLA 4GYYA 2KATA 1HO8A 3MZLB 4JZYA 3Q4AB 2GRNB 3DPYA 2GW1A 5JJ6A 2E0IA 3OAWA 4HI8A 1N94A 3ENEA 3O48A 3X2QE 4U0UA 4WWOA 3DSTA 2XEHA 2XGMA 4W9RA 3SFXA 3SI5A 3D9KA 1D8DA 2IU1A 4TXPA 5D0QD 4KZCA 5KNGA 2IJGX 4GTPA 4ILIA 2P9SG 2EIKE 2X6JA 4BX8A 4AOFA 2MHKA 3TGOA 2PZIA 3ML9A 4U95D 2MYOA 3WXXA 1XGWA 3NB2A 4JC8A 3TXNA 5B1BE 4L2LA 3RSEG 3DSXA 2YHEA 3I4RB 5EIDA 5EYLA 2KZTB 1AWCB 4DPRA 3ZKJA 3ONKA 4G11A 3D9OA 3RU0A 3UPVA 4V3IA 3L22A 4HRNA 3HVEA 3G2WA 3IV0A 3ONLA 4BETA 2OVBA 5CHEE 1OWNA 2VSXE 2WQ6A 1GW6A 1U3DA 4HVBA 4RVBA 4WNDA 4KBQA 4ANWA 4YDWA 4EPZA 2I9CA 5AYWD 3ZRHA 2WXKA 4NACA 3PS6A 3L08A 1BD8A 3EHQA 5BNWA 3VTYA 3OXFA 3BG0B 3TWWA 2HE0A 4LNUD 3B7UX 3FEYA 3UQ3A 4AY5A 5ENTD 1TN6A 4L1BA 4HLEA 4I9EA 3D9HA 1N9AA 3L82A 2B6CA 5LP0A 4GZDA 4MRUA 3LKUA 4GCOA 3ASNE 2HO1A 3UXGA 3EJNA 4DI3A 2P9NG 1PY1A 4UQYA 2WB2A 5M72A 2Y4UA 1KPSB 3UI2A 4FA6A 2C0LA 4G1TA 3TL5A 1JCRA 3DXKG 3JUEA 4BFRA 5FZQA 3ZHEB 2WXJA 4UQXA 5KJNA 5FZSA 1N4QA 4XKCA 1D9SA 2GRLA 5IY5E 3GW4A 3GZSA 4JL0A 3FP3A 3ABLE 3FUNA 5ARGA 2V4LA 5AQBA 2X6FA 4TXRA 5ENQD 4MBGA 2DWZA 2XPYA 4AXHA 4MS6A 1OCCE 4GAAA 4N3AA 3MKQB 3UMVA 1ZB1A 3ZN3A 4JPSA 1WAO1 1H2TC 3ABKE 1E8XA 2R17C 3LJNA 3NZSA 1E7UA 2I2OA 3NOGD 4ILHB 1TNUA 2KCLA 2PM6A 3CKBA 1H19A 4HRLA 4LERA 2C0MA 4LEUA 4L2YA 4URKA 2X38A 5CECB 4HRMB 4A1SA 4NRHB 3PZ2A 1Y6IA 3E37A 1IHGA 4EHMA 3CVWA 3Q15A 3L16A 3HXDA 1H6PA 4LNGA 3NOCD 3FUMA 3LY9A 1JPLA 3LXUX 2BEDA 1LD8A 3UT4A 3IHYA 2CHZA 3PUJA 3R7QA 1LTXA 3LVRE 5AQ9A 1QYMA 2AW6A 4U0SA 4FJYA 3U66A 3CHQA 1KLXA 1HS6A 1FT1A 2PNNA 4ZFHA 4GZ6A 3PE4A 3IHVA 2EIJE 1Y8MA 2J07A 4OVUA 3W9GA 5AJDA 4UI9K 5CERB 4Q69A 4DJAA 3MEKA 4HFGA 4F53A 2UY1B 1SZAA 3LY7A 3CVUA 2BUGA 3TAXA 1D8EA 3ZIMA 3E4BA 3D9PA 3EU5A 4DX5D 1OWOA 3SZ7A 4CDNA 2Q7FA 4J8YA 4EECA 2C2LA 3WG7E 4TRQA 5AQAA 5JMND 2YHCA 4M7CA 3D9JA 4Z68A 3CVYA 2ILRA 2X6HA 1TJFA 4GMLA 5G04J 4OVVA 4QFVA 4A3TA 1JUQA 3R9MA 4Y6CA 4GA2A 5ANLA 1O5MA 3HXFA 2GRQB 2WXQA 5CBOA 4J8DA 2P9KG 3D9MA 1DC2A 2QYUA 2RD0A 4I17A 2ETAA 2XGSA 2J08A 4ACLA 1QQEA 4ANXA 5ENSD 3R7RA 1FCHA 5T4YA 3CEQA 5JJ7A 4P29A 5E75A 2FO1E 3P2BA 1JWGA 2FULA 3JUIA 3TWVA 5LOZA 5FQ8A 2IO3C 3FH7A 4DI4A 1HG5A 3CVXA 1E7VA 3LYAA 3RRMB 4U04A 4BESA 4APFA 4ANUA 2RKKA 2LAIA 3SD5A 5ENOD 4U8HA 2X3MA 1H2UA 4WNEA 3V2OA 4AY6A 1EPUA 4HI9A 3FTZA 3HXCA 1N0RA 3AAAC 2WXGA 1QZ2A 3AS8A 2LSVA 2A5EA 3QWPA 3CVNA 3ASDA 1TEZA 3S7JA 4K5CA 4DK5A 1ZBPA 4HOQA 4JEHA 4RLYA 4HXIA 4FHJA 3Q73A 4D10C 5AENA 1HXIA 5J90A 4I2WA 2EILE 1OCRE 5JJTA 2J09A 4JA9A 3PEVB 2WXRA 1TN8A 2XS8A 1OT8A 1X81A 1SQMA 4CGVA 4I6GA 4AM9A 2Y3AA 3CVVA 5DBKA 2LUHA 3HDXA 4GTMA 1HX8A 3ASFA 5EYPF 1ELRA 4GTRA 5LFAA 2HR2A 2AWIA 4CZ2D 4GTQA 3C3RA 4PS3A 4LG6A 4BWRA 2I6HA 2BKKB 3FDHA 5DIZA 4HLLA 1NA3A 5LCWC 3SFYA 3CSTA 2KCVA 5EKQD 1E8YA 1N4RA 2I1JA 4K5BA 4N3BA 3CHOA 3C72A 3Q9UC 4A1GA 4AP2A 2R02A 2J4BA 4B8CB 4WNGA 1N95A 2KC7A 2QFCA 5KCMA 3V79K 3LEWA 1DCEA 4H7YA 3IEGA 4ABNA 4BTAA 3DWLG 5AQ7A 1OCOE 2QY7A 4K03A 3MX3A 3ZU7B 3AS4A 4JW1A 3HXEA 3CHSA 4EZLA 1PC2A 4B8AA 5FINA 1MJ0A 4RG6A 3FH8A 1IXVA 4J6IA 2QC9A 5AARA 4HS2A 1Z5SC 3SY2A 1EF1C 3JXIA 5B3SE 4IN3B 4UWHA 3T8KA 1VDYA 3DSVA 5FWQA 4PS8A 3UM1A 2QYJA 3Q49B 2XPZA 4WNFA 3DSUA 3NAWA 4FC8A 4M3OA 3LDZA 3APFA 4UI9J 3B7SA 1NA0A 3KAEA 4PH4B 2KBXA 4DUIA 4NURA 2AJAA 3W9FA 2IF4A 1EDUA 2AXVA 4U0ZA 1HZ4A 3PZDA 3NQPA 3SHFA 3Q78A 4DLQA 3CQGB 4TUUA 4Q96A 3G2SA 2EQXA 3UX4A 4JVSA 2OCCE 3O4ZA 1QNFA 5EIBE 4BEPA 5G05J 3FU5A 3QDNA 5FQ6A 3URZA 3ULYA 4FLBA 1SW6A 1S64A 2P9IG 3ZXSA 3NF1A 4HB5A 3UIPC 3L9TA 5KJKA 5FTPA 2AXZA 5EDSA 2H6HA 5ENNA 4GZ5A 2IQCA 4F1PA 1H2VC 3CSFA 4C48B 3DEOA 4JD2G 4APOA 2J8SD 1MX4A 4HNAD 1ELKA 1OY3D 1MHQA 3SFZA 1SA4A 3QAQA 4HQDA 4XE0A 2DCPA 4LSZE 3RK6A 4R7LA 4OAUC 1WDYA 4DLOA 1TJCA 3EU9A 5D0OD 2DYRE 1N4PA 2JLBA 3OXGA 5T3RA 3KD7A 1N52A 4OAVB 2WXLA 2AXUA 3CIAA 3ZEFA 3GYZA 1W3BA 1RZ4A 3EHRA 2WMOA 3QKYA 3V31A 4LUNU 2XZTG 3L13A 1V55E 4CT4A 5G04C 2F37A 3CLJA 4GMJA 3FWVA 2XQ0A 2BF0X 3RRNB 5CEAA 1MX2A 3F6QA 3RKVA 4JHKA 1TNZA 2ETCA 2GRRB 3VLEA 3TJPA 1TR4A 4B0ZA 3B7RL 3FUEA 4WWPA 2M63A 3QK0A 4ACKA 4E85A 2VGYA 2DVWA 4BERA 1O1TA 1DNPA 3LPZA 3DPDA 3DRAA 2OV8A 1UOHA 3FU6A 3QOUA 3EIQC 1UJKA 4YVQC 4FULA 2WVIA 3U64A 5HQ8A 1BLXB 3CQCB 4EZKA 5E76A 4FP7A 3PDNA 3RAUA 2DBAA 5BW8C 1UG3A 2OEVA 4I6EA 5ITZF 3BQOA 5D66A 3QJZA 3L6AA 4XIFA 2YQ8A 2JABA 1KT1A 3TWQA 1KZPA 4HORA 1RW2A 4MKTA 4J0UA 3S7DA 2VGXA 1YCSB 3UIOC 2XENA 4G8KA 4U07A 4CGWA 2HYZA 4NIKA 3CHRA 4I6JA 1FT2A 2A5UA 3JXJA 4F7AA 4FU3A 3ZYQA 2LXMA 2P9LG 3T8MA 4CT0A 4A3VA 2R59A 4BT9A 2VGEA 2J49A 4LCTA 3ZUVB 3G2VA 2R5SA 4XEIG 5BV0A 5CCMA 2X6KA 1HFAA 4WAFA 1S63A 4IYPA 4KVMA 4U8YD 3KEZA 2V4HC 3EHNA 3HYMB 2VTBA 4GPKA 2PQNA 3PZ3A 1KZOA 5JA4D 4YNDA 3MKQA 3FUIA 3NBNB 3ESKA 4JHRA 2L0TB 1NFIE 4G23A 1U2VG 1FPPA 3BUAA 3APDA 3PE3A 5HS0A 5AJLA 3AG2E 2FBNA 5A7DB 1K1AA 4K0RA 5ENRD 2R2LA 2IY0C 2DYSE 2YINA 3QARA 4FHKA 2WXMA 3MGBA 2IONA 3LY8A 2YNQA 2H6IA 3ML8A 3KEAA 5BV1A 2KXPC 3Q7FA 5FQ7A 2UWJG 2NXPA 4RSYA 1UN8A 3E32A 3DSSA 4GTVA 1H6OA 2IOLA 2XZDG 2XRZA 4GTOA 3FULA 4L23A 5G2NA 3Q47B 1IYGA 3SBSA 4KYOB 5C1DA 3GZ1A 3HG0D 3CVQA 2L6JA 1BU9A 2XEVA 3UM2A 3TWRA 3FU3A 5FZRA 2VSYA 4FLHA 3IBEA 2L9BA 5D2MC 3FFLA 4I1AA 1E8WA 4N2SA 4BT8A 3HRAA 2KM4A 3ASGA 4A63B 3ZYKA 2XS1A 4G26A 3KS2A 4HBDA 1Z3XA 1O1SA 2P58C 2X6IA 5CRVA 2FEZA 3FTWA 4GPMA 4GU5A 1NP7A 1OXJA 3C3OA 1A5EA 2E2EA 5BXUA 1WM5A 2KCKA 2NYJA 3PVLA 2WMNA 3UT8A 3AG4E 4AIFA 4GA1A 1E96B 5FQ4A 1YYHA 2FI7A 5AN8A 2ZISA 1BI7B 2F8XK 3ZW3A 3ZNGA 1MX6A 2L0IA 3DBSA 3TWSA 3RO2A 1TNBA 5CRUA 5G05C 2GRPB 4JEUA 1NI1A 1E8ZA 3PZ1A 3VLDA 5FIOA 3L54A 2LSUA 4RG9A 1IQUA 2XEEA 3S7FA 2ONDA 5J08A 4CEMA 4GMRA 2V5QC 3ASHA 1L5JA 1N54A 3QWWA 3ABME 2L6BA 2I1KA 4ILGA 4O1OA 4F1SA 4EZJA 4G2VA 3I5PA 1NL4A 3C98A 4ME2A 4CCAA 3LVQE 4J8SA 3QWVA 3HVEB 4F3VA 4QQIA 3AG1E 4X8QA 4DRXE 3DXMG 1Q2ZA 4AV7A 2ZU6B 3PRZA 5ENPD 3ZXPA 1Z3YA 3EIJA 2XGOA 3PUKA 1DCQA 1UN9A 5CEDB 2A4ZA 4YDOA 1H6KA 1ELWA 4LNBA 2P9PG 3IXEA 1Z6TA 4GZ3A 2CHXA 4U96D 5JHAA 3RIBA 1AP7A 4G24A 4IRUA 3B7TA 3DSWA 2XCCA 1SVXA 4Q94A 3V30A 4DX6D 2CG3A 4N5QA 4TUMA 3SO8A 2V0PA 4BX9A 5KJLA 2XPIA 3AU4A 3FEXA 2WXOA 4KT6B 3ISMC 3K9IA 3RJVA 3Q79A 3FTVA 3FTSA 1MQSA 5FJYA 2VSNA 3CHMA 1HG2A 3JYSA 3BEEA 4JB8P 3J5QB 1S0PA 3MKRA 4CRWA 3PEUB 1PAQA 4JA7A 3EUVA 2H6GA 3PH0C 1EYHA 4G8LA 3TWTA 2JEKA 1FVHA 2VSOE 2XHEA 4N5CA 4I2ZA 1YA0A 3HHMA 5FT9A 3MA5A 4HOSA 3TXMA 2IO2C 2MRIA 2RG8A 4OYSA 3E33A 3MYVA 4PDXA 5LCWJ 3PZ4A 2ZIRA 5A6CA 4MLPA 1N0QA 2MOWA 4GTTA 4GCNA 2IFUA 3CR3A 3CK7A 5KBAA 4UWLA 3D9IA 3EHMA 3HXBA 2FO7A 3D3MA 4FADA 3QC1A 5C2YA 4EBAG 2H6FA 4EBAA 1HU3A 1A17A 3E34A 1K3ZD 4LRZA 3TWUA 4L7TA 2PL2A 4O1PA 3RO3A 3JCKC 3FTXA 4BSXA 5A23A 5G55A 3S2AA 2FF4A 1K8KG 1TN7A 2Y0BG 4N3CA 3U4TA 4WUYA 3DEPA 2LO6A 2VGXB 4I1OB 2QZAA 2PQRA 3FUHA 1UW4B 4U7EB 3C5RA 5H7PA 2V5FA 3G2UA 4DX1A 1JCQA 3FUDA 3OTNA 4XI9A 4C9BB 4KVOA 4IULA 2CHWA 4YVOA 1JWFA 2KZTA 2B0OE 3UM3A 3BU8A 4BTBA 4GTSA 2VJ8A 1OCZE 2BKGA 1U3CA 3TG4A 4C0MA 4CDMA 4WWNA 2DZNA 3MV2B 2GRMA 3MCXA 5EN5D 3I3NA 3AJIA 3CGHA 3I4GA 4UUCA 3ZFWA 3FUJA 1INZA 3PNTB 3QNKA 4UQZA 2R03A 2VTBB 3SQVA 3IKOB 2DZOA 2NC9A 3N71A 3ZGQA 3T5VA 3BG1B 1OUVA 4CYMD 2P2CP 1ZU2A 5BPPA 3VLFA 2IEJA 3Q75A 3CKCA 1FVFA 2VYIA 2WPVA 4ATGA 2EINE 2IOSA 1HH8A 4HOTA 4N2QA 3SNXA 3PREA 1IQRA 4KZ0A 1HF8A 3FY4A 3U3WA 5ARFA 4XKBA 4AJWA 4UWKA 1KT0A 3EDTB 1LF8A 5LX8A 1H0AA 4O60A 4NQ0A 4TXQA 4B93B 3FUFA 3T5XA 1IKND 3R9AB 2EIME 4B89A 1SA5A 4C0EA 2V8SE 4GB9A 1TNYA 5CMWA 3CK8A 1P5QA 2Y69E 4G25A 2WXPA 4KMOA 3ZHEA 3UM0A 4I1MA 1TNOA 3B95A 1YMPA 5EX3A 2WXHA 1JCSA 3ZVVA 4J7WA 1BPOA 5BXOA 4YDYA 5KWDA 3SBTB 3KSLA 5HRYA 4B94A 3Q9NC 1TYQG 1G3NB 3S7BA 2XCBA 3LS8A 4F6RD 4JXTA 2OOEA 3L17A 3FUKA 3HIZA 4XI0A 1E90A 3MV3B 4Y6WA 2VQ2A 5B1AE 3TG5A 4HOUA 1B89A 3UUXA 4XX5A 2HM8A 2LAHA 3UKUG 1MYOA 3OXLA 5BUZA 1V54E 2J9QA 2WQ7A 5KJMA 3UINC 2Y1LE 1BI8B 3SF4A 1S70B 1NZNA 4K5AB 1WG0A 4GA0A 4J8EA 2PM7A 5AIJA 4YDEA 2F8YA 3KSQA 3CVLA 3CK9A 2WXNA 4U63A 5CBNA 2ZXWE 3FTYA 2GGFA 4ANVA 4ATZD 2GROB 2OEWA 1OWMA 3CVPA 2OVFA 3E30A 2WQHA 4RQIA 3TWXA 3LJ3A 4I9CA 4U8VD 1HE8A 3FTUA 2UY1A 1UJJA 1LD7A 3AG3E 5HKPA 3FH5A 1MZCA 1OWLA 2XRYA 4CDRA 2ZGGA 3ASOE 5HI7A 1SZ9A 1XNFA 1OWPA 2CG2A 3FU0A 1X5BA 4E6HA 4ZHBA 3ZYLA 3RRUA 5JHBA 2LXLA 4UI9C 4UWFA 5EILA 5ANRA 3NZUA 2CFZA 4PUCA 4AVXA 2WM9A 4JHJA 4TV3A 3B7BA 1WY6A 3U9WA 3ZYMA 3QB2A 2R05A 2RFAA 1N11A 2BTDA 3APCA
chains in the Genus database with same CATH topology
1TN7A 1DCEA 3DPYA 3Q73A 1S64A 1TNZA 4YDEA 1TNUA 3Q79A 1N94A 2F0YA 3KSQA 1SA5A 1O5MA 3HXEA 1TN6A 3HXFA 3DSTA 1JCQA 3PZ2A 1TNYA 1S63A 1N9AA 3SFXA 3E37A 4EHMA 1O1TA 1TN8A 2H6HA 1D8DA 1X81A 3HXDA 1NL4A 4LNGA 3PZ3A 1KZOA 4GTPA 4GTSA 1TNOA 2BEDA 3DRAA 3E30A 1LD8A 1JCSA 3EUVA 1O1SA 1FPPA 2H6GA 4GTMA 3KSLA 3DSVA 1LD7A 2R2LA 1O1RA 1MZCA 4GTRA 1SA4A 1LTXA 3DSUA 3DSXA 1JCRA 3E33A 4GTQA 1FT1A 4YDOA 2H6IA 3PZ4A 2ZIRA 4LNBA 2ZISA 4GTTA 1N4PA 1QBQA 3Q7FA 3Q7AA 1N4QA 1N4SA 3SFYA 1KZPA 3E32A 2IEJA 3Q75A 3HXBA 1TNBA 3DSSA 4GTVA 1N4RA 3Q78A 3HXCA 2H6FA 3DSWA 1D8EA 4GTOA 3E34A 4MBGA 3C72A 3EU5A 1NI1A 3PZ1A 4L9PA 1N95A 1FT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN7 A;  1DCE A;  3DPY A;  3Q73 A;  1S64 A;  1TNZ A;  4YDE A;  1TNU A;  3Q79 A;  1N94 A;  2F0Y A;  3KSQ A;  1SA5 A;  1O5M A;  3HXE A;  1TN6 A;  3HXF A;  3DST A;  1JCQ A;  3PZ2 A;  1TNY A;  1S63 A;  1N9A A;  3SFX A;  3E37 A;  4EHM A;  1O1T A;  1TN8 A;  2H6H A;  1D8D A;  1X81 A;  3HXD A;  1NL4 A;  4LNG A;  3PZ3 A;  1KZO A;  4GTP A;  4GTS A;  1TNO A;  2BED A;  3DRA A;  3E30 A;  1LD8 A;  1JCS A;  3EUV A;  1O1S A;  1FPP A;  2H6G A;  4GTM A;  3KSL A;  3DSV A;  1LD7 A;  2R2L A;  1O1R A;  1MZC A;  4GTR A;  1SA4 A;  1LTX A;  3DSU A;  3DSX A;  1JCR A;  3E33 A;  4GTQ A;  1FT1 A;  4YDO A;  2H6I A;  3PZ4 A;  2ZIR A;  4LNB A;  2ZIS A;  4GTT A;  1N4P A;  1QBQ A;  3Q7F A;  3Q7A A;  1N4Q A;  1N4S A;  3SFY A;  1KZP A;  3E32 A;  2IEJ A;  3Q75 A;  3HXB A;  1TNB A;  3DSS A;  4GTV A;  1N4R A;  3Q78 A;  3HXC A;  2H6F A;  3DSW A;  1D8E A;  4GTO A;  3E34 A;  4MBG A;  3C72 A;  3EU5 A;  1NI1 A;  3PZ1 A;  4L9P A;  1N95 A;  1FT2 A; 
#chains in the Genus database with same CATH topology
 1K1B A;  4DX7 D;  1IHB A;  3SGH A;  3UKR G;  5T8I A;  2RFM A;  4GZC A;  1DVP A;  3UTM A;  3CV0 A;  3P1U A;  5EX0 A;  2WXI A;  2F0Y A;  4KXK B;  4BY6 A;  4EQF A;  4I43 A;  3ULQ A;  2DIW A;  2ETB A;  3D9N A;  3D9L A;  3PNL B;  5AAO A;  2ZGD A;  3Q5M A;  2NSZ A;  3AS5 A;  2J4D A;  4PS7 A;  3LCA A;  2P9U G;  1O1R A;  4DX2 A;  3J5P A;  5BT1 A;  2Y4T A;  3FHE A;  3ULE G;  4BSZ B;  4O6F A;  4FJZ A;  4J8F A;  4GYO A;  3G2T A;  3V2X A;  5KNH D;  2LNI A;  3AU5 A;  4A55 A;  3B13 A;  1QBQ A;  3ESL A;  3Q7A A;  4H7X A;  1N4S A;  3ZPJ A;  3T9K A;  4GYW A;  4AEZ C;  2CFU A;  3C3Q A;  3VTX A;  3MJW A;  2WXF A;  3JQ0 A;  4XZ4 A;  4UWG A;  3JQ1 A;  3CHP A;  4L9P A;  2AVP A;  3GZ2 A;  5CMY A;  3UT7 A;  4N39 A;  5CCL A;  4GYY A;  2KAT A;  1HO8 A;  3MZL B;  4JZY A;  3Q4A B;  2GRN B;  3DPY A;  2GW1 A;  5JJ6 A;  2E0I A;  3OAW A;  4HI8 A;  1N94 A;  3ENE A;  3O48 A;  3X2Q E;  4U0U A;  4WWO A;  3DST A;  2XEH A;  2XGM A;  4W9R A;  3SFX A;  3SI5 A;  3D9K A;  1D8D A;  2IU1 A;  4TXP A;  5D0Q D;  4KZC A;  5KNG A;  2IJG X;  4GTP A;  4ILI A;  2P9S G;  2EIK E;  2X6J A;  4BX8 A;  4AOF A;  2MHK A;  3TGO A;  2PZI A;  3ML9 A;  4U95 D;  2MYO A;  3WXX A;  1XGW A;  3NB2 A;  4JC8 A;  3TXN A;  5B1B E;  4L2L A;  3RSE G;  3DSX A;  2YHE A;  3I4R B;  5EID A;  5EYL A;  2KZT B;  1AWC B;  4DPR A;  3ZKJ A;  3ONK A;  4G11 A;  3D9O A;  3RU0 A;  3UPV A;  4V3I A;  3L22 A;  4HRN A;  3HVE A;  3G2W A;  3IV0 A;  3ONL A;  4BET A;  2OVB A;  5CHE E;  1OWN A;  2VSX E;  2WQ6 A;  1GW6 A;  1U3D A;  4HVB A;  4RVB A;  4WND A;  4KBQ A;  4ANW A;  4YDW A;  4EPZ A;  2I9C A;  5AYW D;  3ZRH A;  2WXK A;  4NAC A;  3PS6 A;  3L08 A;  1BD8 A;  3EHQ A;  5BNW A;  3VTY A;  3OXF A;  3BG0 B;  3TWW A;  2HE0 A;  4LNU D;  3B7U X;  3FEY A;  3UQ3 A;  4AY5 A;  5ENT D;  1TN6 A;  4L1B A;  4HLE A;  4I9E A;  3D9H A;  1N9A A;  3L82 A;  2B6C A;  5LP0 A;  4GZD A;  4MRU A;  3LKU A;  4GCO A;  3ASN E;  2HO1 A;  3UXG A;  3EJN A;  4DI3 A;  2P9N G;  1PY1 A;  4UQY A;  2WB2 A;  5M72 A;  2Y4U A;  1KPS B;  3UI2 A;  4FA6 A;  2C0L A;  4G1T A;  3TL5 A;  1JCR A;  3DXK G;  3JUE A;  4BFR A;  5FZQ A;  3ZHE B;  2WXJ A;  4UQX A;  5KJN A;  5FZS A;  1N4Q A;  4XKC A;  1D9S A;  2GRL A;  5IY5 E;  3GW4 A;  3GZS A;  4JL0 A;  3FP3 A;  3ABL E;  3FUN A;  5ARG A;  2V4L A;  5AQB A;  2X6F A;  4TXR A;  5ENQ D;  4MBG A;  2DWZ A;  2XPY A;  4AXH A;  4MS6 A;  1OCC E;  4GAA A;  4N3A A;  3MKQ B;  3UMV A;  1ZB1 A;  3ZN3 A;  4JPS A;  1WAO 1;  1H2T C;  3ABK E;  1E8X A;  2R17 C;  3LJN A;  3NZS A;  1E7U A;  2I2O A;  3NOG D;  4ILH B;  1TNU A;  2KCL A;  2PM6 A;  3CKB A;  1H19 A;  4HRL A;  4LER A;  2C0M A;  4LEU A;  4L2Y A;  4URK A;  2X38 A;  5CEC B;  4HRM B;  4A1S A;  4NRH B;  3PZ2 A;  1Y6I A;  3E37 A;  1IHG A;  4EHM A;  3CVW A;  3Q15 A;  3L16 A;  3HXD A;  1H6P A;  4LNG A;  3NOC D;  3FUM A;  3LY9 A;  1JPL A;  3LXU X;  2BED A;  1LD8 A;  3UT4 A;  3IHY A;  2CHZ A;  3PUJ A;  3R7Q A;  1LTX A;  3LVR E;  5AQ9 A;  1QYM A;  2AW6 A;  4U0S A;  4FJY A;  3U66 A;  3CHQ A;  1KLX A;  1HS6 A;  1FT1 A;  2PNN A;  4ZFH A;  4GZ6 A;  3PE4 A;  3IHV A;  2EIJ E;  1Y8M A;  2J07 A;  4OVU A;  3W9G A;  5AJD A;  4UI9 K;  5CER B;  4Q69 A;  4DJA A;  3MEK A;  4HFG A;  4F53 A;  2UY1 B;  1SZA A;  3LY7 A;  3CVU A;  2BUG A;  3TAX A;  1D8E A;  3ZIM A;  3E4B A;  3D9P A;  3EU5 A;  4DX5 D;  1OWO A;  3SZ7 A;  4CDN A;  2Q7F A;  4J8Y A;  4EEC A;  2C2L A;  3WG7 E;  4TRQ A;  5AQA A;  5JMN D;  2YHC A;  4M7C A;  3D9J A;  4Z68 A;  3CVY A;  2ILR A;  2X6H A;  1TJF A;  4GML A;  5G04 J;  4OVV A;  4QFV A;  4A3T A;  1JUQ A;  3R9M A;  4Y6C A;  4GA2 A;  5ANL A;  1O5M A;  3HXF A;  2GRQ B;  2WXQ A;  5CBO A;  4J8D A;  2P9K G;  3D9M A;  1DC2 A;  2QYU A;  2RD0 A;  4I17 A;  2ETA A;  2XGS A;  2J08 A;  4ACL A;  1QQE A;  4ANX A;  5ENS D;  3R7R A;  1FCH A;  5T4Y A;  3CEQ A;  5JJ7 A;  4P29 A;  5E75 A;  2FO1 E;  3P2B A;  1JWG A;  2FUL A;  3JUI A;  3TWV A;  5LOZ A;  5FQ8 A;  2IO3 C;  3FH7 A;  4DI4 A;  1HG5 A;  3CVX A;  1E7V A;  3LYA A;  3RRM B;  4U04 A;  4BES A;  4APF A;  4ANU A;  2RKK A;  2LAI A;  3SD5 A;  5ENO D;  4U8H A;  2X3M A;  1H2U A;  4WNE A;  3V2O A;  4AY6 A;  1EPU A;  4HI9 A;  3FTZ A;  3HXC A;  1N0R A;  3AAA C;  2WXG A;  1QZ2 A;  3AS8 A;  2LSV A;  2A5E A;  3QWP A;  3CVN A;  3ASD A;  1TEZ A;  3S7J A;  4K5C A;  4DK5 A;  1ZBP A;  4HOQ A;  4JEH A;  4RLY A;  4HXI A;  4FHJ A;  3Q73 A;  4D10 C;  5AEN A;  1HXI A;  5J90 A;  4I2W A;  2EIL E;  1OCR E;  5JJT A;  2J09 A;  4JA9 A;  3PEV B;  2WXR A;  1TN8 A;  2XS8 A;  1OT8 A;  1X81 A;  1SQM A;  4CGV A;  4I6G A;  4AM9 A;  2Y3A A;  3CVV A;  5DBK A;  2LUH A;  3HDX A;  4GTM A;  1HX8 A;  3ASF A;  5EYP F;  1ELR A;  4GTR A;  5LFA A;  2HR2 A;  2AWI A;  4CZ2 D;  4GTQ A;  3C3R A;  4PS3 A;  4LG6 A;  4BWR A;  2I6H A;  2BKK B;  3FDH A;  5DIZ A;  4HLL A;  1NA3 A;  5LCW C;  3SFY A;  3CST A;  2KCV A;  5EKQ D;  1E8Y A;  1N4R A;  2I1J A;  4K5B A;  4N3B A;  3CHO A;  3C72 A;  3Q9U C;  4A1G A;  4AP2 A;  2R02 A;  2J4B A;  4B8C B;  4WNG A;  1N95 A;  2KC7 A;  2QFC A;  5KCM A;  3V79 K;  3LEW A;  1DCE A;  4H7Y A;  3IEG A;  4ABN A;  4BTA A;  3DWL G;  5AQ7 A;  1OCO E;  2QY7 A;  4K03 A;  3MX3 A;  3ZU7 B;  3AS4 A;  4JW1 A;  3HXE A;  3CHS A;  4EZL A;  1PC2 A;  4B8A A;  5FIN A;  1MJ0 A;  4RG6 A;  3FH8 A;  1IXV A;  4J6I A;  2QC9 A;  5AAR A;  4HS2 A;  1Z5S C;  3SY2 A;  1EF1 C;  3JXI A;  5B3S E;  4IN3 B;  4UWH A;  3T8K A;  1VDY A;  3DSV A;  5FWQ A;  4PS8 A;  3UM1 A;  2QYJ A;  3Q49 B;  2XPZ A;  4WNF A;  3DSU A;  3NAW A;  4FC8 A;  4M3O A;  3LDZ A;  3APF A;  4UI9 J;  3B7S A;  1NA0 A;  3KAE A;  4PH4 B;  2KBX A;  4DUI A;  4NUR A;  2AJA A;  3W9F A;  2IF4 A;  1EDU A;  2AXV A;  4U0Z A;  1HZ4 A;  3PZD A;  3NQP A;  3SHF A;  3Q78 A;  4DLQ A;  3CQG B;  4TUU A;  4Q96 A;  3G2S A;  2EQX A;  3UX4 A;  4JVS A;  2OCC E;  3O4Z A;  1QNF A;  5EIB E;  4BEP A;  5G05 J;  3FU5 A;  3QDN A;  5FQ6 A;  3URZ A;  3ULY A;  4FLB A;  1SW6 A;  1S64 A;  2P9I G;  3ZXS A;  3NF1 A;  4HB5 A;  3UIP C;  3L9T A;  5KJK A;  5FTP A;  2AXZ A;  5EDS A;  2H6H A;  5ENN A;  4GZ5 A;  2IQC A;  4F1P A;  1H2V C;  3CSF A;  4C48 B;  3DEO A;  4JD2 G;  4APO A;  2J8S D;  1MX4 A;  4HNA D;  1ELK A;  1OY3 D;  1MHQ A;  3SFZ A;  1SA4 A;  3QAQ A;  4HQD A;  4XE0 A;  2DCP A;  4LSZ E;  3RK6 A;  4R7L A;  4OAU C;  1WDY A;  4DLO A;  1TJC A;  3EU9 A;  5D0O D;  2DYR E;  1N4P A;  2JLB A;  3OXG A;  5T3R A;  3KD7 A;  1N52 A;  4OAV B;  2WXL A;  2AXU A;  3CIA A;  3ZEF A;  3GYZ A;  1W3B A;  1RZ4 A;  3EHR A;  2WMO A;  3QKY A;  3V31 A;  4LUN U;  2XZT G;  3L13 A;  1V55 E;  4CT4 A;  5G04 C;  2F37 A;  3CLJ A;  4GMJ A;  3FWV A;  2XQ0 A;  2BF0 X;  3RRN B;  5CEA A;  1MX2 A;  3F6Q A;  3RKV A;  4JHK A;  1TNZ A;  2ETC A;  2GRR B;  3VLE A;  3TJP A;  1TR4 A;  4B0Z A;  3B7R L;  3FUE A;  4WWP A;  2M63 A;  3QK0 A;  4ACK A;  4E85 A;  2VGY A;  2DVW A;  4BER A;  1O1T A;  1DNP A;  3LPZ A;  3DPD A;  3DRA A;  2OV8 A;  1UOH A;  3FU6 A;  3QOU A;  3EIQ C;  1UJK A;  4YVQ C;  4FUL A;  2WVI A;  3U64 A;  5HQ8 A;  1BLX B;  3CQC B;  4EZK A;  5E76 A;  4FP7 A;  3PDN A;  3RAU A;  2DBA A;  5BW8 C;  1UG3 A;  2OEV A;  4I6E A;  5ITZ F;  3BQO A;  5D66 A;  3QJZ A;  3L6A A;  4XIF A;  2YQ8 A;  2JAB A;  1KT1 A;  3TWQ A;  1KZP A;  4HOR A;  1RW2 A;  4MKT A;  4J0U A;  3S7D A;  2VGX A;  1YCS B;  3UIO C;  2XEN A;  4G8K A;  4U07 A;  4CGW A;  2HYZ A;  4NIK A;  3CHR A;  4I6J A;  1FT2 A;  2A5U A;  3JXJ A;  4F7A A;  4FU3 A;  3ZYQ A;  2LXM A;  2P9L G;  3T8M A;  4CT0 A;  4A3V A;  2R59 A;  4BT9 A;  2VGE A;  2J49 A;  4LCT A;  3ZUV B;  3G2V A;  2R5S A;  4XEI G;  5BV0 A;  5CCM A;  2X6K A;  1HFA A;  4WAF A;  1S63 A;  4IYP A;  4KVM A;  4U8Y D;  3KEZ A;  2V4H C;  3EHN A;  3HYM B;  2VTB A;  4GPK A;  2PQN A;  3PZ3 A;  1KZO A;  5JA4 D;  4YND A;  3MKQ A;  3FUI A;  3NBN B;  3ESK A;  4JHR A;  2L0T B;  1NFI E;  4G23 A;  1U2V G;  1FPP A;  3BUA A;  3APD A;  3PE3 A;  5HS0 A;  5AJL A;  3AG2 E;  2FBN A;  5A7D B;  1K1A A;  4K0R A;  5ENR D;  2R2L A;  2IY0 C;  2DYS E;  2YIN A;  3QAR A;  4FHK A;  2WXM A;  3MGB A;  2ION A;  3LY8 A;  2YNQ A;  2H6I A;  3ML8 A;  3KEA A;  5BV1 A;  2KXP C;  3Q7F A;  5FQ7 A;  2UWJ G;  2NXP A;  4RSY A;  1UN8 A;  3E32 A;  3DSS A;  4GTV A;  1H6O A;  2IOL A;  2XZD G;  2XRZ A;  4GTO A;  3FUL A;  4L23 A;  5G2N A;  3Q47 B;  1IYG A;  3SBS A;  4KYO B;  5C1D A;  3GZ1 A;  3HG0 D;  3CVQ A;  2L6J A;  1BU9 A;  2XEV A;  3UM2 A;  3TWR A;  3FU3 A;  5FZR A;  2VSY A;  4FLH A;  3IBE A;  2L9B A;  5D2M C;  3FFL A;  4I1A A;  1E8W A;  4N2S A;  4BT8 A;  3HRA A;  2KM4 A;  3ASG A;  4A63 B;  3ZYK A;  2XS1 A;  4G26 A;  3KS2 A;  4HBD A;  1Z3X A;  1O1S A;  2P58 C;  2X6I A;  5CRV A;  2FEZ A;  3FTW A;  4GPM A;  4GU5 A;  1NP7 A;  1OXJ A;  3C3O A;  1A5E A;  2E2E A;  5BXU A;  1WM5 A;  2KCK A;  2NYJ A;  3PVL A;  2WMN A;  3UT8 A;  3AG4 E;  4AIF A;  4GA1 A;  1E96 B;  5FQ4 A;  1YYH A;  2FI7 A;  5AN8 A;  2ZIS A;  1BI7 B;  2F8X K;  3ZW3 A;  3ZNG A;  1MX6 A;  2L0I A;  3DBS A;  3TWS A;  3RO2 A;  1TNB A;  5CRU A;  5G05 C;  2GRP B;  4JEU A;  1NI1 A;  1E8Z A;  3PZ1 A;  3VLD A;  5FIO A;  3L54 A;  2LSU A;  4RG9 A;  1IQU A;  2XEE A;  3S7F A;  2OND A;  5J08 A;  4CEM A;  4GMR A;  2V5Q C;  3ASH A;  1L5J A;  1N54 A;  3QWW A;  3ABM E;  2L6B A;  2I1K A;  4ILG A;  4O1O A;  4F1S A;  4EZJ A;  4G2V A;  3I5P A;  1NL4 A;  3C98 A;  4ME2 A;  4CCA A;  3LVQ E;  4J8S A;  3QWV A;  3HVE B;  4F3V A;  4QQI A;  3AG1 E;  4X8Q A;  4DRX E;  3DXM G;  1Q2Z A;  4AV7 A;  2ZU6 B;  3PRZ A;  5ENP D;  3ZXP A;  1Z3Y A;  3EIJ A;  2XGO A;  3PUK A;  1DCQ A;  1UN9 A;  5CED B;  2A4Z A;  4YDO A;  1H6K A;  1ELW A;  4LNB A;  2P9P G;  3IXE A;  1Z6T A;  4GZ3 A;  2CHX A;  4U96 D;  5JHA A;  3RIB A;  1AP7 A;  4G24 A;  4IRU A;  3B7T A;  3DSW A;  2XCC A;  1SVX A;  4Q94 A;  3V30 A;  4DX6 D;  2CG3 A;  4N5Q A;  4TUM A;  3SO8 A;  2V0P A;  4BX9 A;  5KJL A;  2XPI A;  3AU4 A;  3FEX A;  2WXO A;  4KT6 B;  3ISM C;  3K9I A;  3RJV A;  3Q79 A;  3FTV A;  3FTS A;  1MQS A;  5FJY A;  2VSN A;  3CHM A;  1HG2 A;  3JYS A;  3BEE A;  4JB8 P;  3J5Q B;  1S0P A;  3MKR A;  4CRW A;  3PEU B;  1PAQ A;  4JA7 A;  3EUV A;  2H6G A;  3PH0 C;  1EYH A;  4G8L A;  3TWT A;  2JEK A;  1FVH A;  2VSO E;  2XHE A;  4N5C A;  4I2Z A;  1YA0 A;  3HHM A;  5FT9 A;  3MA5 A;  4HOS A;  3TXM A;  2IO2 C;  2MRI A;  2RG8 A;  4OYS A;  3E33 A;  3MYV A;  4PDX A;  5LCW J;  3PZ4 A;  2ZIR A;  5A6C A;  4MLP A;  1N0Q A;  2MOW A;  4GTT A;  4GCN A;  2IFU A;  3CR3 A;  3CK7 A;  5KBA A;  4UWL A;  3D9I A;  3EHM A;  3HXB A;  2FO7 A;  3D3M A;  4FAD A;  3QC1 A;  5C2Y A;  4EBA G;  2H6F A;  4EBA A;  1HU3 A;  1A17 A;  3E34 A;  1K3Z D;  4LRZ A;  3TWU A;  4L7T A;  2PL2 A;  4O1P A;  3RO3 A;  3JCK C;  3FTX A;  4BSX A;  5A23 A;  5G55 A;  3S2A A;  2FF4 A;  1K8K G;  1TN7 A;  2Y0B G;  4N3C A;  3U4T A;  4WUY A;  3DEP A;  2LO6 A;  2VGX B;  4I1O B;  2QZA A;  2PQR A;  3FUH A;  1UW4 B;  4U7E B;  3C5R A;  5H7P A;  2V5F A;  3G2U A;  4DX1 A;  1JCQ A;  3FUD A;  3OTN A;  4XI9 A;  4C9B B;  4KVO A;  4IUL A;  2CHW A;  4YVO A;  1JWF A;  2KZT A;  2B0O E;  3UM3 A;  3BU8 A;  4BTB A;  4GTS A;  2VJ8 A;  1OCZ E;  2BKG A;  1U3C A;  3TG4 A;  4C0M A;  4CDM A;  4WWN A;  2DZN A;  3MV2 B;  2GRM A;  3MCX A;  5EN5 D;  3I3N A;  3AJI A;  3CGH A;  3I4G A;  4UUC A;  3ZFW A;  3FUJ A;  1INZ A;  3PNT B;  3QNK A;  4UQZ A;  2R03 A;  2VTB B;  3SQV A;  3IKO B;  2DZO A;  2NC9 A;  3N71 A;  3ZGQ A;  3T5V A;  3BG1 B;  1OUV A;  4CYM D;  2P2C P;  1ZU2 A;  5BPP A;  3VLF A;  2IEJ A;  3Q75 A;  3CKC A;  1FVF A;  2VYI A;  2WPV A;  4ATG A;  2EIN E;  2IOS A;  1HH8 A;  4HOT A;  4N2Q A;  3SNX A;  3PRE A;  1IQR A;  4KZ0 A;  1HF8 A;  3FY4 A;  3U3W A;  5ARF A;  4XKB A;  4AJW A;  4UWK A;  1KT0 A;  3EDT B;  1LF8 A;  5LX8 A;  1H0A A;  4O60 A;  4NQ0 A;  4TXQ A;  4B93 B;  3FUF A;  3T5X A;  1IKN D;  3R9A B;  2EIM E;  4B89 A;  1SA5 A;  4C0E A;  2V8S E;  4GB9 A;  1TNY A;  5CMW A;  3CK8 A;  1P5Q A;  2Y69 E;  4G25 A;  2WXP A;  4KMO A;  3ZHE A;  3UM0 A;  4I1M A;  1TNO A;  3B95 A;  1YMP A;  5EX3 A;  2WXH A;  1JCS A;  3ZVV A;  4J7W A;  1BPO A;  5BXO A;  4YDY A;  5KWD A;  3SBT B;  3KSL A;  5HRY A;  4B94 A;  3Q9N C;  1TYQ G;  1G3N B;  3S7B A;  2XCB A;  3LS8 A;  4F6R D;  4JXT A;  2OOE A;  3L17 A;  3FUK A;  3HIZ A;  4XI0 A;  1E90 A;  3MV3 B;  4Y6W A;  2VQ2 A;  5B1A E;  3TG5 A;  4HOU A;  1B89 A;  3UUX A;  4XX5 A;  2HM8 A;  2LAH A;  3UKU G;  1MYO A;  3OXL A;  5BUZ A;  1V54 E;  2J9Q A;  2WQ7 A;  5KJM A;  3UIN C;  2Y1L E;  1BI8 B;  3SF4 A;  1S70 B;  1NZN A;  4K5A B;  1WG0 A;  4GA0 A;  4J8E A;  2PM7 A;  5AIJ A;  4YDE A;  2F8Y A;  3KSQ A;  3CVL A;  3CK9 A;  2WXN A;  4U63 A;  5CBN A;  2ZXW E;  3FTY A;  2GGF A;  4ANV A;  4ATZ D;  2GRO B;  2OEW A;  1OWM A;  3CVP A;  2OVF A;  3E30 A;  2WQH A;  4RQI A;  3TWX A;  3LJ3 A;  4I9C A;  4U8V D;  1HE8 A;  3FTU A;  2UY1 A;  1UJJ A;  1LD7 A;  3AG3 E;  5HKP A;  3FH5 A;  1MZC A;  1OWL A;  2XRY A;  4CDR A;  2ZGG A;  3ASO E;  5HI7 A;  1SZ9 A;  1XNF A;  1OWP A;  2CG2 A;  3FU0 A;  1X5B A;  4E6H A;  4ZHB A;  3ZYL A;  3RRU A;  5JHB A;  2LXL A;  4UI9 C;  4UWF A;  5EIL A;  5ANR A;  3NZU A;  2CFZ A;  4PUC A;  4AVX A;  2WM9 A;  4JHJ A;  4TV3 A;  3B7B A;  1WY6 A;  3U9W A;  3ZYM A;  3QB2 A;  2R05 A;  2RFA A;  1N11 A;  2BTD A;  3APC A; 
#chains in the Genus database with same CATH homology
 1TN7 A;  1DCE A;  3DPY A;  3Q73 A;  1S64 A;  1TNZ A;  4YDE A;  1TNU A;  3Q79 A;  1N94 A;  2F0Y A;  3KSQ A;  1SA5 A;  1O5M A;  3HXE A;  1TN6 A;  3HXF A;  3DST A;  1JCQ A;  3PZ2 A;  1TNY A;  1S63 A;  1N9A A;  3SFX A;  3E37 A;  4EHM A;  1O1T A;  1TN8 A;  2H6H A;  1D8D A;  1X81 A;  3HXD A;  1NL4 A;  4LNG A;  3PZ3 A;  1KZO A;  4GTP A;  4GTS A;  1TNO A;  2BED A;  3DRA A;  3E30 A;  1LD8 A;  1JCS A;  3EUV A;  1O1S A;  1FPP A;  2H6G A;  4GTM A;  3KSL A;  3DSV A;  1LD7 A;  2R2L A;  1O1R A;  1MZC A;  4GTR A;  1SA4 A;  1LTX A;  3DSU A;  3DSX A;  1JCR A;  3E33 A;  4GTQ A;  1FT1 A;  4YDO A;  2H6I A;  3PZ4 A;  2ZIR A;  4LNB A;  2ZIS A;  4GTT A;  1N4P A;  1QBQ A;  3Q7F A;  3Q7A A;  1N4Q A;  1N4S A;  3SFY A;  1KZP A;  3E32 A;  2IEJ A;  3Q75 A;  3HXB A;  1TNB A;  3DSS A;  4GTV A;  1N4R A;  3Q78 A;  3HXC A;  2H6F A;  3DSW A;  1D8E A;  4GTO A;  3E34 A;  4MBG A;  3C72 A;  3EU5 A;  1NI1 A;  3PZ1 A;  4L9P A;  1N95 A;  1FT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...