1N4SA

Protein geranylgeranyltransferase type-i complexed with ggpp and a geranylgeranylated kkksktkcvil peptide product
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of mammalian protein geranylgeranyltransferase type-I
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
total genus 126
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n4sA00
1N94A 1N4PA 3HXBA 3EUVA 2ZIRA 3DSSA 1O5MA 4L9PA 1TNBA 4MBGA 1FT1A 3HXEA 2H6GA 1NI1A 1N4SA 2H6HA 2H6IA 1TNYA 3E34A 3Q73A 4LNGA 3EU5A 3SFXA 4GTQA 1O1TA 4GTMA 1D8DA 3DRAA 3E32A 1SA5A 1SA4A 3E30A 1TNOA 3DSVA 4EHMA 1TN7A 1JCQA 1TN8A 1TN6A 2R2LA 2H6FA 1JCRA 3HXFA 1N9AA 1MZCA 4YDEA 3Q75A 4GTSA 1FT2A 1LD8A 1FPPA 1O1RA 3PZ1A 1LD7A 3Q7AA 3KSLA 1JCSA 3Q78A 1KZOA 3DSTA 2ZISA 4GTPA 4GTVA 3Q79A 4YDOA 3PZ2A 3Q7FA 1TNZA 4GTRA 2F0YA 3KSQA 1N95A 3SFYA 3C72A 1N4RA 1DCEA 1NL4A 4GTOA 3DPYA 1D8EA 2BEDA 1LTXA 3HXDA 1KZPA 1X81A 3DSWA 1S64A 1QBQA 3HXCA 1S63A 4GTTA 3E33A 3E37A 3PZ3A 1O1SA 4LNBA 3DSXA 1TNUA 3PZ4A 3DSUA 1N4QA 2IEJA
chains in the Genus database with same CATH superfamily
1H2UA 1N4PA 4FU3A 4J8SA 4LCTA 1VDYA 1EYHA 2J09A 1FT1A 4GMRA 2CG2A 4YDWA 2Y4TA 2FF4A 3SD5A 3AG3E 4GPMA 4GYOA 4XZ4A 4MLPA 4YVOA 2EILE 3UI2A 1YMPA 3KD7A 4CDNA 3LEWA 4DX1A 2X3MA 4BERA 4TXRA 2XEVA 3CQGB 2H6FA 3PH0C 3FU3A 2MOWA 3ZXSA 2J49A 4URKA 1OCOE 4G1TA 3Q75A 4KT6B 3O4ZA 4J8FA 5CECB 2GW1A 5EX3A 2C0MA 1LD7A 2Y3AA 5E76A 3QB2A 3S7BA 3BU8A 2V8SE 2WXHA 2VSXE 1HH8A 3PE3A 4JEHA 1IQUA 2LXLA 1JWFA 5ENRD 4I1OB 4A3VA 5AQAA 4F53A 3FH8A 3B95A 2J9QA 5KNHD 1Y8MA 4DX2A 2BEDA 2WXGA 5B3SE 2RFMA 1WY6A 3SI5A 1AP7A 5T3RA 5T4YA 1HG2A 3PZ3A 3PNLB 3CK9A 4EZJA 1WG0A 2DZOA 2J4BA 1HXIA 4N5QA 2P58C 3UXGA 4JHJA 3UIPC 3VLFA 3VTXA 3ESLA 2M63A 5D2MC 3P1UA 1OCCE 2DVWA 4MBGA 3FU6A 1UN9A 4K5CA 3CVUA 4AXHA 3T8KA 3FU5A 4FA6A 5CHEE 2H6HA 4HORA 4K5BA 1TNYA 3N71A 3OXGA 1IHGA 3SFXA 3TXNA 2WB2A 2L9BA 1H0AA 1OWMA 5JHAA 3JQ1A 2WPVA 4X8QA 1INZA 4V3IA 4B8AA 3LPZA 1ZBPA 1K1AA 1EDUA 5AQ7A 5FQ6A 4HLEA 1U2VG 4GTSA 1UG3A 1MQSA 1D9SA 3D9HA 1O1RA 4BSZB 3D9OA 1E8ZA 3G2UA 3I4GA 5C2YA 1SW6A 3S7JA 4KZ0A 1H6PA 3I5PA 4YDOA 5KJKA 2KATA 1SZ9A 3ML8A 3OXFA 4RQIA 4HBDA 2LXMA 5BXUA 5KJLA 1N11A 5ENQD 1OCZE 2C2LA 5LX8A 3SBTB 3QNKA 3SFYA 2GRQB 2E2EA 2A5UA 2VTBA 5FJYA 4U8YD 4BESA 4UWFA 4YNDA 3OAWA 2IU1A 3G2SA 4N3BA 4JVSA 2VTBB 4F6RD 1RZ4A 3RK6A 4F1PA 2J8SD 3VLEA 4HOSA 2GRMA 3L22A 3IHVA 3Q5MA 5LCWC 1E8XA 4JL0A 4ANUA 5BV0A 2KZTB 2ZGDA 5G2NA 4GTQA 2XS1A 4GTMA 1D8DA 3IBEA 1SA4A 3F6QA 1AWCB 4U0ZA 1FVFA 2LSUA 4LNUD 4GYWA 4Y6WA 5HKPA 4KBQA 4ANVA 3U9WA 2IONA 2WXLA 3TWVA 1JCSA 1KZOA 4Q96A 2XRYA 3ZIMA 3FH7A 3NZSA 4ILIA 2XGSA 2DBAA 3VTYA 5JMND 3FUIA 1BU9A 3CVYA 2IO3C 5EIDA 3UT7A 3J5PA 5CBNA 4C0EA 2P9PG 4JA7A 3G2VA 3UX4A 1QBQA 3SFZA 1TEZA 4TRQA 2DZNA 2XENA 3LYAA 5LOZA 2IJGX 4UWGA 3DSXA 5KCMA 5AQ9A 1H19A 3HYMB 5FIOA 2A5EA 2VQ2A 4G11A 4DJAA 3C3OA 3U64A 3X2QE 2QYJA 4EPZA 1SQMA 5DBKA 1NP7A 2P9LG 2WXNA 3RAUA 3S7DA 3UM0A 3L08A 2YQ8A 3EU5A 3FTYA 3TAXA 1DNPA 3AS8A 3FTUA 4I9EA 2LSVA 4OAVB 4OAUC 5KJMA 2X6IA 3E32A 4GA2A 4K5AB 2I9CA 3FHEA 4U04A 1JCQA 4AM9A 3LVQE 4ZHBA 3JQ0A 4ANXA 2GRLA 3FUDA 3JYSA 4HFGA 4CGVA 3SBSA 2EINE 1FT2A 2F8YA 3KSLA 3Q78A 5EX0A 4BSXA 2CFUA 2X6HA 4JA9A 2I2OA 4WUYA 2IQCA 5AARA 1MX2A 1ELWA 3FUEA 4G23A 1TNZA 2I6HA 3MA5A 3QDNA 4LEUA 3ABKE 2LNIA 2NXPA 4EBAA 4UQZA 3ZYLA 3WG7E 1NL4A 4WNGA 3HXDA 4MS6A 4DI3A 2XS8A 1OY3D 3LVRE 3LJ3A 2YHEA 3BG1B 4UWLA 3V31A 3CHPA 4WNDA 1MX4A 2VSOE 5AJLA 1TNUA 4TUMA 3UKRG 4AP2A 4JHRA 2NSZA 4F3VA 2XGOA 3V79K 3J5QB 4KXKB 3ABME 4FP7A 2EIJE 4CDRA 5J90A 3PUKA 3QJZA 4G2VA 2PL2A 4EZKA 2XEEA 1A17A 5D0OD 1WAO1 1KLXA 4N3AA 4AVXA 5FWQA 4O1OA 5CEDB 4C48B 4RVBA 1N9AA 5A23A 4BT8A 3ZN3A 5JA4D 4U8VD 2WQHA 2RFAA 2PQRA 5A6CA 4EQFA 2BKKB 2GGFA 1QZ2A 2IFUA 3DPDA 2IO2C 4XX5A 4TV3A 4EBAG 2RG8A 1PC2A 5ENSD 4OVUA 2X38A 4PS7A 1S70B 1N4RA 4MRUA 1KT1A 4BX9A 5ARGA 2P2CP 4N5CA 4HRNA 3WXXA 2XZDG 5AQBA 4LNBA 3I4RB 4DPRA 3DSUA 4IN3B 4IULA 2KCKA 1EF1C 3ASHA 5AYWD 4J6IA 2P9NG 3KAEA 1N94A 1Z3YA 4Q69A 3RU0A 2VJ8A 1UJKA 4PS3A 2WXQA 4AY6A 3C3RA 3HXEA 2B6CA 2HM8A 4IYPA 3G2WA 4C0MA 2DIWA 1E7VA 4QQIA 3PNTB 2DCPA 4ILGA 2B0OE 2FI7A 3OXLA 1HG5A 5ARFA 1BI7B 4JXTA 2R2LA 1YA0A 3MZLB 2WQ7A 3CHRA 2OVFA 1MZCA 3OTNA 4UUCA 4XKBA 3AG1E 3JUEA 4J8YA 1FPPA 3PZ1A 1UOHA 3LJNA 3TXMA 4GTVA 5G05C 4GZCA 3Q79A 3HG0D 1KPSB 4XI9A 1HFAA 4N2SA 4G8KA 4I17A 4WAFA 3CR3A 2Q7FA 3NBNB 4NQ0A 2PM7A 3DPYA 3K9IA 3FUJA 4J8EA 5HQ8A 1E90A 2OV8A 4WNEA 2OVBA 4GZ6A 2WQ6A 4L23A 3DEPA 4OVVA 3ZUVB 1N4QA 2UY1B 4I1AA 4XE0A 5BT1A 3T9KA 4HRLA 3L54A 3AS4A 4NRHB 4CCAA 5BW8C 1RW2A 2L6JA 3LS8A 2AXUA 2P9SG 2VGXB 1UW4B 4APFA 4DX6D 5CERB 1JUQA 2LAHA 5G55A 4LG6A 4BFRA 4ATZD 2LUHA 3TWSA 3UINC 4JHKA 3IV0A 5EYLA 4U07A 3BQOA 2FULA 2J07A 2X6KA 2UWJG 2CHXA 3SNXA 3CHOA 3QKYA 3CGHA 2Y0BG 3ULYA 3PUJA 2E0IA 2NC9A 1H6OA 3EDTB 4E6HA 2L0IA 4LERA 3BG0B 2CG3A 2JABA 3LY9A 1HZ4A 3NZUA 4CT4A 4HOQA 5FTPA 3B7SA 2R05A 4U0UA 4BT9A 4FADA 2WXPA 3SY2A 2HO1A 3ZYQA 3UM1A 4LRZA 4GTTA 4ATGA 3GZ1A 4GB9A 3ZXPA 3EIJA 4GCOA 2YINA 3AU5A 3PZ4A 4OYSA 3EUVA 3UKUG 4L9PA 2VSYA 3C5RA 5AJDA 1MJ0A 3ASDA 3FDHA 3V2OA 3NF1A 4I1MA 3AJIA 4PDXA 1ZU2A 3O48A 1DVPA 1IKND 3MKQB 3KS2A 1IQRA 2P9KG 3CVXA 3R7QA 1DC2A 3TWRA 2OEVA 2EQXA 4YVQC 2WMNA 4ABNA 4U8HA 5CBOA 2R03A 1IXVA 3JCKC 4IRUA 4I6GA 1TR4A 3DSVA 4EHMA 4KVOA 4DK5A 2CFZA 4UI9J 1LD8A 4B93B 2ZISA 5D0QD 4CT0A 3TG5A 4NURA 4HS2A 4FHKA 4H7YA 1N54A 2HYZA 2CHWA 5C1DA 2A4ZA 1OWLA 3KSQA 3R7RA 3URZA 4QFVA 3EHRA 1X5BA 1BD8A 2PM6A 3RRMB 5BV1A 3CHMA 4BEPA 2P9UG 2V0PA 2QY7A 2NYJA 3ZU7B 4XEIG 4DUIA 3HVEB 2XZTG 2AXVA 2KC7A 4J8DA 1HU3A 3CLJA 3MV3B 5KNGA 3UT8A 4LUNU 3CHQA 2IEJA 4KZCA 2ZXWE 2ZGGA 4DI4A 4B94A 3FTWA 3DEOA 5ANLA 3QWWA 2LAIA 4KYOB 3MX3A 4GAAA 2YNQA 1FCHA 3CEQA 3FUMA 5LCWJ 2WMOA 4HI8A 3FUFA 3NQPA 5EN5D 4JD2G 1SA5A 2AWIA 3SO8A 5M72A 5ANRA 1KT0A 2FEZA 3MGBA 4I6EA 3D9PA 4K0RA 4WWNA 1NZNA 3FP3A 3RKVA 4ILHB 5FZSA 3AG4E 1MHQA 4JEUA 3Q7AA 3TWWA 3APCA 1E96B 2KCLA 2IOLA 3ZNGA 1G3NB 3ULEG 5KBAA 1BI8B 4JC8A 4GTRA 4AOFA 1E8YA 3L82A 4MKTA 2PQNA 3MJWA 3C72A 2VYIA 3HVEA 3D9NA 3CK7A 3ONLA 1S0PA 3LDZA 3QC1A 3IHYA 3PS6A 3HXCA 1S63A 1Y6IA 3UQ3A 1W3BA 4TXPA 1O1SA 4R7LA 4CZ2D 4WNFA 2YHCA 4ACLA 5BXOA 3FFLA 3PDNA 5BPPA 1XNFA 3LKUA 4B8CB 4Z68A 3ZHEA 3APDA 3ZKJA 4RG6A 2FO1E 3IXEA 2H6GA 1NI1A 3CHSA 5B1AE 4HRMB 3CIAA 4GA0A 2RKKA 2HR2A 1QQEA 2GRNB 2GRRB 3TJPA 2MHKA 3FUHA 4D10C 4U63A 3TWUA 4CGWA 1JPLA 3EU9A 2QZAA 3Q9UC 2EIKE 2VGEA 2IOSA 4RG9A 3HXFA 4FULA 3MKQA 3FTSA 3MCXA 5G05J 3T5XA 3V2XA 1BLXB 3TWQA 3ABLE 5DIZA 4L2LA 4AJWA 3PZ2A 4I9CA 2F0YA 4UI9C 3SQVA 2WXIA 5EDSA 3RRNB 1ZB1A 1H2TC 3JUIA 2WXRA 4UQXA 1U3DA 2XEHA 3B7TA 4GTOA 1IHBA 4UQYA 2I1JA 4U7EB 2ETCA 1N52A 2OOEA 3FTZA 3E33A 4BY6A 2KXPC 3ZPJA 2ILRA 3UUXA 4AEZC 4U96D 3CVVA 5CEAA 3CVLA 3EHNA 1TJFA 1O5MA 3FTXA 2R17C 5EYPF 5EKQD 5CCLA 2H6IA 2R59A 5JHBA 2X6FA 4N39A 1PY1A 4A1GA 4DX7D 3TWTA 3VLDA 1NFIE 5FZQA 1N0RA 3FEYA 3D9MA 1TN7A 3FTVA 2WXFA 3ASGA 4G25A 2BF0X 1B89A 1TN8A 4O60A 5JJTA 3DBSA 4L7TA 2AJAA 5H7PA 3QWPA 4JZYA 5ITZF 3UM2A 2GROB 3ASNE 1XGWA 3AG2E 1PAQA 5HRYA 3SGHA 4UWKA 4GPKA 2ETAA 4NACA 5FT9A 5CMWA 4H7XA 2XCBA 4FJYA 3L17A 2HE0A 2IY0C 5J08A 5BNWA 3IEGA 4E85A 5CCMA 5FQ4A 2L6BA 4P29A 2FO7A 3C98A 3C3QA 5AN8A 1E8WA 3FWVA 3P2BA 3DWLG 5EIBE 2X6JA 2XQ0A 1NA0A 3EHQA 4BTAA 3PE4A 3QAQA 3TG4A 4GMJA 2KZTA 3ZRHA 3QOUA 4HXIA 1N4SA 4A1SA 2JLBA 2QC9A 2P9IG 2VSNA 3ENEA 3Q4AB 4LNGA 3PRZA 1K8KG 3IKOB 4GU5A 2IF4A 2V4HC 4BWRA 3JXJA 2WXMA 1UN8A 2QYUA 3FEXA 4AV7A 5HS0A 3U3WA 3V30A 1QYMA 3ZGQA 1K1BA 1Z5SC 4K03A 2J08A 4GA1A 4U0SA 1DCQA 3D9IA 4U95D 4DLQA 2C0LA 3ZFWA 2XPIA 2AVPA 4DX5D 2JEKA 4BETA 2OEWA 2ONDA 5KWDA 3FUNA 1DCEA 4J7WA 5FQ7A 5E75A 2XPYA 1LTXA 3FULA 1S64A 3GYZA 2AXZA 2XCCA 3E37A 3GZSA 2WM9A 1U3CA 3QWVA 1TJCA 2BKGA 2PNNA 2OCCE 3ZW3A 3ZHEB 4I2WA 3SF4A 1V54E 2BUGA 3AS5A 5FQ8A 3ZYKA 3APFA 5KJNA 4GCNA 3UM3A 4PUCA 4ACKA 3Q73A 4XI0A 1UJJA 1H2VC 2V5QC 2KM4A 1QNFA 4F1SA 1WM5A 2Y4UA 5HI7A 4PH4B 1O1TA 1OT8A 2V5FA 3UT4A 3E30A 4UI9K 3KEAA 1OXJA 4F7AA 3NOCD 5CRUA 3EIQC 4FLHA 1JCRA 4FHJA 1TYQG 2WXKA 4FJZA 5CRVA 3QARA 5BUZA 2WXJA 4Q94A 1OWOA 1LF8A 3DSTA 4YDYA 4ANWA 3RJVA 5A7DB 3NAWA 2MRIA 3PVLA 4M3OA 4G8LA 2XPZA 2Y69E 1N95A 3W9FA 5G04J 5FINA 3L9TA 4FLBA 2VGYA 3U4TA 4ZFHA 4UWHA 4KVMA 1MX6A 1YYHA 3PEVB 3T5VA 4CEMA 4GZ5A 4CDMA 4RSYA 3R9AB 4HLLA 3HXBA 2ZIRA 4M7CA 3FU0A 3NOGD 1SVXA 2KBXA 4APOA 1L5JA 3Q49B 2RD0A 5D66A 3NB2A 4B89A 3I3NA 4XKCA 4GZ3A 5ENOD 4XIFA 1EPUA 3ASOE 1GW6A 3CVWA 4WWOA 3PREA 2XGMA 3ULQA 3MKRA 3TL5A 4C9BB 2WXOA 2V4LA 4CYMD 3E4BA 1SZAA 1YCSB 5LFAA 4W9RA 3FY4A 4GMLA 4I43A 4YDEA 5T8IA 3L6AA 4HB5A 3TWXA 1NA3A 3LXUX 2FBNA 4N3CA 4CRWA 2ETBA 4G26A 1OWNA 4I2ZA 3SHFA 3Q7FA 3CVNA 5G04C 3B7BA 3D3MA 3ZYMA 4I6JA 4BTBA 2R02A 3Q15A 4GZDA 3HRAA 2R5SA 5AIJA 1D8EA 5AENA 3TGOA 3G2TA 3BUAA 3FH5A 1OWPA 4ME2A 1N0QA 2MYOA 3PZDA 2Y1LE 1Z6TA 3SZ7A 3Q47B 1HS6A 4RLYA 3LY8A 2LO6A 1TNBA 4GYYA 4DRXE 3CKCA 3U66A 2PZIA 5AAOA 3E34A 3Q9NC 4Y6CA 1BPOA 5B1BE 3HIZA 2ZU6B 1OCRE 3L13A 3S7FA 1Q2ZA 1WDYA 3QK0A 3DRAA 1HE8A 5LP0A 4O6FA 1TNOA 3D9LA 4WWPA 3MV2B 5ENPD 3ESKA 3D9JA 4JW1A 3AU4A 4JB8P 3UIOC 2BTDA 3JXIA 4AIFA 4FC8A 3UTMA 3RRUA 1Z3XA 3MEKA 3B7UX 4N2QA 3PEUB 2AW6A 1ELKA 3HHMA 2XRZA 3GZ2A 4L1BA 3B7RL 1V55E 4G24A 2UY1A 1IYGA 3ZVVA 3ISMC 3MYVA 2VGXA 1KZPA 1X81A 3CVPA 3KEZA 4TUUA 4JPSA 3S2AA 4LSZE 3EJNA 1HF8A 3CV0A 3EHMA 3R9MA 5JJ7A 4HVBA 4AY5A 5CMYA 1ELRA 2KCVA 3L16A 4L2YA 3DXKG 1P5QA 4J0UA 2EIME 3DSSA 2F8XK 3RO2A 1JWGA 2DYSE 1MYOA 5FZRA 5EILA 3CK8A 4BX8A 1OUVA 3CQCB 2DYRE 4A55A 2I1KA 3CSFA 5ENNA 4O1PA 1FVHA 4DLOA 4KMOA 4A63B 2J4DA 3ZEFA 2F37A 3GW4A 1A5EA 5ENTD 3ONKA 1TN6A 5IY5E 2CHZA 3UMVA 2WVIA 4EZLA 3DXMG 3BEEA 3LCAA 3ASFA 3UPVA 3CKBA 4GTPA 4HQDA 4HOUA 4TXQA 4HI9A 2L0TB 5JJ6A 4EECA 3T8MA 1HX8A 3W9GA 3LY7A 3B13A 3ML9A 4A3TA 3RSEG 4HOTA 2DWZA 3CSTA 3CVQA 3HDXA 2XHEA 1K3ZD 3RO3A 1HO8A 2GRPB 3DSWA 1H6KA 2QFCA 3D9KA 1E7UA 4B0ZA 3RIBA 4NIKA 4HNAD 3AAAC 4PS8A 3FUKA
chains in the Genus database with same CATH topology
1N94A 1N4PA 3HXBA 3EUVA 2ZIRA 3DSSA 1O5MA 4L9PA 1TNBA 4MBGA 1FT1A 3HXEA 2H6GA 1NI1A 1N4SA 2H6HA 2H6IA 1TNYA 3E34A 3Q73A 4LNGA 3EU5A 3SFXA 4GTQA 1O1TA 4GTMA 1D8DA 3DRAA 3E32A 1SA5A 1SA4A 3E30A 1TNOA 3DSVA 4EHMA 1TN7A 1JCQA 1TN8A 1TN6A 2R2LA 2H6FA 1JCRA 3HXFA 1N9AA 1MZCA 4YDEA 3Q75A 4GTSA 1FT2A 1LD8A 1FPPA 1O1RA 3PZ1A 1LD7A 3Q7AA 3KSLA 1JCSA 3Q78A 1KZOA 3DSTA 2ZISA 4GTPA 4GTVA 3Q79A 4YDOA 3PZ2A 3Q7FA 1TNZA 4GTRA 2F0YA 3KSQA 1N95A 3SFYA 3C72A 1N4RA 1DCEA 1NL4A 4GTOA 3DPYA 1D8EA 2BEDA 1LTXA 3HXDA 1KZPA 1X81A 3DSWA 1S64A 1QBQA 3HXCA 1S63A 4GTTA 3E33A 3E37A 3PZ3A 1O1SA 4LNBA 3DSXA 1TNUA 3PZ4A 3DSUA 1N4QA 2IEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N94 A;  1N4P A;  3HXB A;  3EUV A;  2ZIR A;  3DSS A;  1O5M A;  4L9P A;  1TNB A;  4MBG A;  1FT1 A;  3HXE A;  2H6G A;  1NI1 A;  1N4S A;  2H6H A;  2H6I A;  1TNY A;  3E34 A;  3Q73 A;  4LNG A;  3EU5 A;  3SFX A;  4GTQ A;  1O1T A;  4GTM A;  1D8D A;  3DRA A;  3E32 A;  1SA5 A;  1SA4 A;  3E30 A;  1TNO A;  3DSV A;  4EHM A;  1TN7 A;  1JCQ A;  1TN8 A;  1TN6 A;  2R2L A;  2H6F A;  1JCR A;  3HXF A;  1N9A A;  1MZC A;  4YDE A;  3Q75 A;  4GTS A;  1FT2 A;  1LD8 A;  1FPP A;  1O1R A;  3PZ1 A;  1LD7 A;  3Q7A A;  3KSL A;  1JCS A;  3Q78 A;  1KZO A;  3DST A;  2ZIS A;  4GTP A;  4GTV A;  3Q79 A;  4YDO A;  3PZ2 A;  3Q7F A;  1TNZ A;  4GTR A;  2F0Y A;  3KSQ A;  1N95 A;  3SFY A;  3C72 A;  1N4R A;  1DCE A;  1NL4 A;  4GTO A;  3DPY A;  1D8E A;  2BED A;  1LTX A;  3HXD A;  1KZP A;  1X81 A;  3DSW A;  1S64 A;  1QBQ A;  3HXC A;  1S63 A;  4GTT A;  3E33 A;  3E37 A;  3PZ3 A;  1O1S A;  4LNB A;  3DSX A;  1TNU A;  3PZ4 A;  3DSU A;  1N4Q A;  2IEJ A; 
#chains in the Genus database with same CATH topology
 1H2U A;  1N4P A;  4FU3 A;  4J8S A;  4LCT A;  1VDY A;  1EYH A;  2J09 A;  1FT1 A;  4GMR A;  2CG2 A;  4YDW A;  2Y4T A;  2FF4 A;  3SD5 A;  3AG3 E;  4GPM A;  4GYO A;  4XZ4 A;  4MLP A;  4YVO A;  2EIL E;  3UI2 A;  1YMP A;  3KD7 A;  4CDN A;  3LEW A;  4DX1 A;  2X3M A;  4BER A;  4TXR A;  2XEV A;  3CQG B;  2H6F A;  3PH0 C;  3FU3 A;  2MOW A;  3ZXS A;  2J49 A;  4URK A;  1OCO E;  4G1T A;  3Q75 A;  4KT6 B;  3O4Z A;  4J8F A;  5CEC B;  2GW1 A;  5EX3 A;  2C0M A;  1LD7 A;  2Y3A A;  5E76 A;  3QB2 A;  3S7B A;  3BU8 A;  2V8S E;  2WXH A;  2VSX E;  1HH8 A;  3PE3 A;  4JEH A;  1IQU A;  2LXL A;  1JWF A;  5ENR D;  4I1O B;  4A3V A;  5AQA A;  4F53 A;  3FH8 A;  3B95 A;  2J9Q A;  5KNH D;  1Y8M A;  4DX2 A;  2BED A;  2WXG A;  5B3S E;  2RFM A;  1WY6 A;  3SI5 A;  1AP7 A;  5T3R A;  5T4Y A;  1HG2 A;  3PZ3 A;  3PNL B;  3CK9 A;  4EZJ A;  1WG0 A;  2DZO A;  2J4B A;  1HXI A;  4N5Q A;  2P58 C;  3UXG A;  4JHJ A;  3UIP C;  3VLF A;  3VTX A;  3ESL A;  2M63 A;  5D2M C;  3P1U A;  1OCC E;  2DVW A;  4MBG A;  3FU6 A;  1UN9 A;  4K5C A;  3CVU A;  4AXH A;  3T8K A;  3FU5 A;  4FA6 A;  5CHE E;  2H6H A;  4HOR A;  4K5B A;  1TNY A;  3N71 A;  3OXG A;  1IHG A;  3SFX A;  3TXN A;  2WB2 A;  2L9B A;  1H0A A;  1OWM A;  5JHA A;  3JQ1 A;  2WPV A;  4X8Q A;  1INZ A;  4V3I A;  4B8A A;  3LPZ A;  1ZBP A;  1K1A A;  1EDU A;  5AQ7 A;  5FQ6 A;  4HLE A;  1U2V G;  4GTS A;  1UG3 A;  1MQS A;  1D9S A;  3D9H A;  1O1R A;  4BSZ B;  3D9O A;  1E8Z A;  3G2U A;  3I4G A;  5C2Y A;  1SW6 A;  3S7J A;  4KZ0 A;  1H6P A;  3I5P A;  4YDO A;  5KJK A;  2KAT A;  1SZ9 A;  3ML8 A;  3OXF A;  4RQI A;  4HBD A;  2LXM A;  5BXU A;  5KJL A;  1N11 A;  5ENQ D;  1OCZ E;  2C2L A;  5LX8 A;  3SBT B;  3QNK A;  3SFY A;  2GRQ B;  2E2E A;  2A5U A;  2VTB A;  5FJY A;  4U8Y D;  4BES A;  4UWF A;  4YND A;  3OAW A;  2IU1 A;  3G2S A;  4N3B A;  4JVS A;  2VTB B;  4F6R D;  1RZ4 A;  3RK6 A;  4F1P A;  2J8S D;  3VLE A;  4HOS A;  2GRM A;  3L22 A;  3IHV A;  3Q5M A;  5LCW C;  1E8X A;  4JL0 A;  4ANU A;  5BV0 A;  2KZT B;  2ZGD A;  5G2N A;  4GTQ A;  2XS1 A;  4GTM A;  1D8D A;  3IBE A;  1SA4 A;  3F6Q A;  1AWC B;  4U0Z A;  1FVF A;  2LSU A;  4LNU D;  4GYW A;  4Y6W A;  5HKP A;  4KBQ A;  4ANV A;  3U9W A;  2ION A;  2WXL A;  3TWV A;  1JCS A;  1KZO A;  4Q96 A;  2XRY A;  3ZIM A;  3FH7 A;  3NZS A;  4ILI A;  2XGS A;  2DBA A;  3VTY A;  5JMN D;  3FUI A;  1BU9 A;  3CVY A;  2IO3 C;  5EID A;  3UT7 A;  3J5P A;  5CBN A;  4C0E A;  2P9P G;  4JA7 A;  3G2V A;  3UX4 A;  1QBQ A;  3SFZ A;  1TEZ A;  4TRQ A;  2DZN A;  2XEN A;  3LYA A;  5LOZ A;  2IJG X;  4UWG A;  3DSX A;  5KCM A;  5AQ9 A;  1H19 A;  3HYM B;  5FIO A;  2A5E A;  2VQ2 A;  4G11 A;  4DJA A;  3C3O A;  3U64 A;  3X2Q E;  2QYJ A;  4EPZ A;  1SQM A;  5DBK A;  1NP7 A;  2P9L G;  2WXN A;  3RAU A;  3S7D A;  3UM0 A;  3L08 A;  2YQ8 A;  3EU5 A;  3FTY A;  3TAX A;  1DNP A;  3AS8 A;  3FTU A;  4I9E A;  2LSV A;  4OAV B;  4OAU C;  5KJM A;  2X6I A;  3E32 A;  4GA2 A;  4K5A B;  2I9C A;  3FHE A;  4U04 A;  1JCQ A;  4AM9 A;  3LVQ E;  4ZHB A;  3JQ0 A;  4ANX A;  2GRL A;  3FUD A;  3JYS A;  4HFG A;  4CGV A;  3SBS A;  2EIN E;  1FT2 A;  2F8Y A;  3KSL A;  3Q78 A;  5EX0 A;  4BSX A;  2CFU A;  2X6H A;  4JA9 A;  2I2O A;  4WUY A;  2IQC A;  5AAR A;  1MX2 A;  1ELW A;  3FUE A;  4G23 A;  1TNZ A;  2I6H A;  3MA5 A;  3QDN A;  4LEU A;  3ABK E;  2LNI A;  2NXP A;  4EBA A;  4UQZ A;  3ZYL A;  3WG7 E;  1NL4 A;  4WNG A;  3HXD A;  4MS6 A;  4DI3 A;  2XS8 A;  1OY3 D;  3LVR E;  3LJ3 A;  2YHE A;  3BG1 B;  4UWL A;  3V31 A;  3CHP A;  4WND A;  1MX4 A;  2VSO E;  5AJL A;  1TNU A;  4TUM A;  3UKR G;  4AP2 A;  4JHR A;  2NSZ A;  4F3V A;  2XGO A;  3V79 K;  3J5Q B;  4KXK B;  3ABM E;  4FP7 A;  2EIJ E;  4CDR A;  5J90 A;  3PUK A;  3QJZ A;  4G2V A;  2PL2 A;  4EZK A;  2XEE A;  1A17 A;  5D0O D;  1WAO 1;  1KLX A;  4N3A A;  4AVX A;  5FWQ A;  4O1O A;  5CED B;  4C48 B;  4RVB A;  1N9A A;  5A23 A;  4BT8 A;  3ZN3 A;  5JA4 D;  4U8V D;  2WQH A;  2RFA A;  2PQR A;  5A6C A;  4EQF A;  2BKK B;  2GGF A;  1QZ2 A;  2IFU A;  3DPD A;  2IO2 C;  4XX5 A;  4TV3 A;  4EBA G;  2RG8 A;  1PC2 A;  5ENS D;  4OVU A;  2X38 A;  4PS7 A;  1S70 B;  1N4R A;  4MRU A;  1KT1 A;  4BX9 A;  5ARG A;  2P2C P;  4N5C A;  4HRN A;  3WXX A;  2XZD G;  5AQB A;  4LNB A;  3I4R B;  4DPR A;  3DSU A;  4IN3 B;  4IUL A;  2KCK A;  1EF1 C;  3ASH A;  5AYW D;  4J6I A;  2P9N G;  3KAE A;  1N94 A;  1Z3Y A;  4Q69 A;  3RU0 A;  2VJ8 A;  1UJK A;  4PS3 A;  2WXQ A;  4AY6 A;  3C3R A;  3HXE A;  2B6C A;  2HM8 A;  4IYP A;  3G2W A;  4C0M A;  2DIW A;  1E7V A;  4QQI A;  3PNT B;  2DCP A;  4ILG A;  2B0O E;  2FI7 A;  3OXL A;  1HG5 A;  5ARF A;  1BI7 B;  4JXT A;  2R2L A;  1YA0 A;  3MZL B;  2WQ7 A;  3CHR A;  2OVF A;  1MZC A;  3OTN A;  4UUC A;  4XKB A;  3AG1 E;  3JUE A;  4J8Y A;  1FPP A;  3PZ1 A;  1UOH A;  3LJN A;  3TXM A;  4GTV A;  5G05 C;  4GZC A;  3Q79 A;  3HG0 D;  1KPS B;  4XI9 A;  1HFA A;  4N2S A;  4G8K A;  4I17 A;  4WAF A;  3CR3 A;  2Q7F A;  3NBN B;  4NQ0 A;  2PM7 A;  3DPY A;  3K9I A;  3FUJ A;  4J8E A;  5HQ8 A;  1E90 A;  2OV8 A;  4WNE A;  2OVB A;  4GZ6 A;  2WQ6 A;  4L23 A;  3DEP A;  4OVV A;  3ZUV B;  1N4Q A;  2UY1 B;  4I1A A;  4XE0 A;  5BT1 A;  3T9K A;  4HRL A;  3L54 A;  3AS4 A;  4NRH B;  4CCA A;  5BW8 C;  1RW2 A;  2L6J A;  3LS8 A;  2AXU A;  2P9S G;  2VGX B;  1UW4 B;  4APF A;  4DX6 D;  5CER B;  1JUQ A;  2LAH A;  5G55 A;  4LG6 A;  4BFR A;  4ATZ D;  2LUH A;  3TWS A;  3UIN C;  4JHK A;  3IV0 A;  5EYL A;  4U07 A;  3BQO A;  2FUL A;  2J07 A;  2X6K A;  2UWJ G;  2CHX A;  3SNX A;  3CHO A;  3QKY A;  3CGH A;  2Y0B G;  3ULY A;  3PUJ A;  2E0I A;  2NC9 A;  1H6O A;  3EDT B;  4E6H A;  2L0I A;  4LER A;  3BG0 B;  2CG3 A;  2JAB A;  3LY9 A;  1HZ4 A;  3NZU A;  4CT4 A;  4HOQ A;  5FTP A;  3B7S A;  2R05 A;  4U0U A;  4BT9 A;  4FAD A;  2WXP A;  3SY2 A;  2HO1 A;  3ZYQ A;  3UM1 A;  4LRZ A;  4GTT A;  4ATG A;  3GZ1 A;  4GB9 A;  3ZXP A;  3EIJ A;  4GCO A;  2YIN A;  3AU5 A;  3PZ4 A;  4OYS A;  3EUV A;  3UKU G;  4L9P A;  2VSY A;  3C5R A;  5AJD A;  1MJ0 A;  3ASD A;  3FDH A;  3V2O A;  3NF1 A;  4I1M A;  3AJI A;  4PDX A;  1ZU2 A;  3O48 A;  1DVP A;  1IKN D;  3MKQ B;  3KS2 A;  1IQR A;  2P9K G;  3CVX A;  3R7Q A;  1DC2 A;  3TWR A;  2OEV A;  2EQX A;  4YVQ C;  2WMN A;  4ABN A;  4U8H A;  5CBO A;  2R03 A;  1IXV A;  3JCK C;  4IRU A;  4I6G A;  1TR4 A;  3DSV A;  4EHM A;  4KVO A;  4DK5 A;  2CFZ A;  4UI9 J;  1LD8 A;  4B93 B;  2ZIS A;  5D0Q D;  4CT0 A;  3TG5 A;  4NUR A;  4HS2 A;  4FHK A;  4H7Y A;  1N54 A;  2HYZ A;  2CHW A;  5C1D A;  2A4Z A;  1OWL A;  3KSQ A;  3R7R A;  3URZ A;  4QFV A;  3EHR A;  1X5B A;  1BD8 A;  2PM6 A;  3RRM B;  5BV1 A;  3CHM A;  4BEP A;  2P9U G;  2V0P A;  2QY7 A;  2NYJ A;  3ZU7 B;  4XEI G;  4DUI A;  3HVE B;  2XZT G;  2AXV A;  2KC7 A;  4J8D A;  1HU3 A;  3CLJ A;  3MV3 B;  5KNG A;  3UT8 A;  4LUN U;  3CHQ A;  2IEJ A;  4KZC A;  2ZXW E;  2ZGG A;  4DI4 A;  4B94 A;  3FTW A;  3DEO A;  5ANL A;  3QWW A;  2LAI A;  4KYO B;  3MX3 A;  4GAA A;  2YNQ A;  1FCH A;  3CEQ A;  3FUM A;  5LCW J;  2WMO A;  4HI8 A;  3FUF A;  3NQP A;  5EN5 D;  4JD2 G;  1SA5 A;  2AWI A;  3SO8 A;  5M72 A;  5ANR A;  1KT0 A;  2FEZ A;  3MGB A;  4I6E A;  3D9P A;  4K0R A;  4WWN A;  1NZN A;  3FP3 A;  3RKV A;  4ILH B;  5FZS A;  3AG4 E;  1MHQ A;  4JEU A;  3Q7A A;  3TWW A;  3APC A;  1E96 B;  2KCL A;  2IOL A;  3ZNG A;  1G3N B;  3ULE G;  5KBA A;  1BI8 B;  4JC8 A;  4GTR A;  4AOF A;  1E8Y A;  3L82 A;  4MKT A;  2PQN A;  3MJW A;  3C72 A;  2VYI A;  3HVE A;  3D9N A;  3CK7 A;  3ONL A;  1S0P A;  3LDZ A;  3QC1 A;  3IHY A;  3PS6 A;  3HXC A;  1S63 A;  1Y6I A;  3UQ3 A;  1W3B A;  4TXP A;  1O1S A;  4R7L A;  4CZ2 D;  4WNF A;  2YHC A;  4ACL A;  5BXO A;  3FFL A;  3PDN A;  5BPP A;  1XNF A;  3LKU A;  4B8C B;  4Z68 A;  3ZHE A;  3APD A;  3ZKJ A;  4RG6 A;  2FO1 E;  3IXE A;  2H6G A;  1NI1 A;  3CHS A;  5B1A E;  4HRM B;  3CIA A;  4GA0 A;  2RKK A;  2HR2 A;  1QQE A;  2GRN B;  2GRR B;  3TJP A;  2MHK A;  3FUH A;  4D10 C;  4U63 A;  3TWU A;  4CGW A;  1JPL A;  3EU9 A;  2QZA A;  3Q9U C;  2EIK E;  2VGE A;  2IOS A;  4RG9 A;  3HXF A;  4FUL A;  3MKQ A;  3FTS A;  3MCX A;  5G05 J;  3T5X A;  3V2X A;  1BLX B;  3TWQ A;  3ABL E;  5DIZ A;  4L2L A;  4AJW A;  3PZ2 A;  4I9C A;  2F0Y A;  4UI9 C;  3SQV A;  2WXI A;  5EDS A;  3RRN B;  1ZB1 A;  1H2T C;  3JUI A;  2WXR A;  4UQX A;  1U3D A;  2XEH A;  3B7T A;  4GTO A;  1IHB A;  4UQY A;  2I1J A;  4U7E B;  2ETC A;  1N52 A;  2OOE A;  3FTZ A;  3E33 A;  4BY6 A;  2KXP C;  3ZPJ A;  2ILR A;  3UUX A;  4AEZ C;  4U96 D;  3CVV A;  5CEA A;  3CVL A;  3EHN A;  1TJF A;  1O5M A;  3FTX A;  2R17 C;  5EYP F;  5EKQ D;  5CCL A;  2H6I A;  2R59 A;  5JHB A;  2X6F A;  4N39 A;  1PY1 A;  4A1G A;  4DX7 D;  3TWT A;  3VLD A;  1NFI E;  5FZQ A;  1N0R A;  3FEY A;  3D9M A;  1TN7 A;  3FTV A;  2WXF A;  3ASG A;  4G25 A;  2BF0 X;  1B89 A;  1TN8 A;  4O60 A;  5JJT A;  3DBS A;  4L7T A;  2AJA A;  5H7P A;  3QWP A;  4JZY A;  5ITZ F;  3UM2 A;  2GRO B;  3ASN E;  1XGW A;  3AG2 E;  1PAQ A;  5HRY A;  3SGH A;  4UWK A;  4GPK A;  2ETA A;  4NAC A;  5FT9 A;  5CMW A;  4H7X A;  2XCB A;  4FJY A;  3L17 A;  2HE0 A;  2IY0 C;  5J08 A;  5BNW A;  3IEG A;  4E85 A;  5CCM A;  5FQ4 A;  2L6B A;  4P29 A;  2FO7 A;  3C98 A;  3C3Q A;  5AN8 A;  1E8W A;  3FWV A;  3P2B A;  3DWL G;  5EIB E;  2X6J A;  2XQ0 A;  1NA0 A;  3EHQ A;  4BTA A;  3PE4 A;  3QAQ A;  3TG4 A;  4GMJ A;  2KZT A;  3ZRH A;  3QOU A;  4HXI A;  1N4S A;  4A1S A;  2JLB A;  2QC9 A;  2P9I G;  2VSN A;  3ENE A;  3Q4A B;  4LNG A;  3PRZ A;  1K8K G;  3IKO B;  4GU5 A;  2IF4 A;  2V4H C;  4BWR A;  3JXJ A;  2WXM A;  1UN8 A;  2QYU A;  3FEX A;  4AV7 A;  5HS0 A;  3U3W A;  3V30 A;  1QYM A;  3ZGQ A;  1K1B A;  1Z5S C;  4K03 A;  2J08 A;  4GA1 A;  4U0S A;  1DCQ A;  3D9I A;  4U95 D;  4DLQ A;  2C0L A;  3ZFW A;  2XPI A;  2AVP A;  4DX5 D;  2JEK A;  4BET A;  2OEW A;  2OND A;  5KWD A;  3FUN A;  1DCE A;  4J7W A;  5FQ7 A;  5E75 A;  2XPY A;  1LTX A;  3FUL A;  1S64 A;  3GYZ A;  2AXZ A;  2XCC A;  3E37 A;  3GZS A;  2WM9 A;  1U3C A;  3QWV A;  1TJC A;  2BKG A;  2PNN A;  2OCC E;  3ZW3 A;  3ZHE B;  4I2W A;  3SF4 A;  1V54 E;  2BUG A;  3AS5 A;  5FQ8 A;  3ZYK A;  3APF A;  5KJN A;  4GCN A;  3UM3 A;  4PUC A;  4ACK A;  3Q73 A;  4XI0 A;  1UJJ A;  1H2V C;  2V5Q C;  2KM4 A;  1QNF A;  4F1S A;  1WM5 A;  2Y4U A;  5HI7 A;  4PH4 B;  1O1T A;  1OT8 A;  2V5F A;  3UT4 A;  3E30 A;  4UI9 K;  3KEA A;  1OXJ A;  4F7A A;  3NOC D;  5CRU A;  3EIQ C;  4FLH A;  1JCR A;  4FHJ A;  1TYQ G;  2WXK A;  4FJZ A;  5CRV A;  3QAR A;  5BUZ A;  2WXJ A;  4Q94 A;  1OWO A;  1LF8 A;  3DST A;  4YDY A;  4ANW A;  3RJV A;  5A7D B;  3NAW A;  2MRI A;  3PVL A;  4M3O A;  4G8L A;  2XPZ A;  2Y69 E;  1N95 A;  3W9F A;  5G04 J;  5FIN A;  3L9T A;  4FLB A;  2VGY A;  3U4T A;  4ZFH A;  4UWH A;  4KVM A;  1MX6 A;  1YYH A;  3PEV B;  3T5V A;  4CEM A;  4GZ5 A;  4CDM A;  4RSY A;  3R9A B;  4HLL A;  3HXB A;  2ZIR A;  4M7C A;  3FU0 A;  3NOG D;  1SVX A;  2KBX A;  4APO A;  1L5J A;  3Q49 B;  2RD0 A;  5D66 A;  3NB2 A;  4B89 A;  3I3N A;  4XKC A;  4GZ3 A;  5ENO D;  4XIF A;  1EPU A;  3ASO E;  1GW6 A;  3CVW A;  4WWO A;  3PRE A;  2XGM A;  3ULQ A;  3MKR A;  3TL5 A;  4C9B B;  2WXO A;  2V4L A;  4CYM D;  3E4B A;  1SZA A;  1YCS B;  5LFA A;  4W9R A;  3FY4 A;  4GML A;  4I43 A;  4YDE A;  5T8I A;  3L6A A;  4HB5 A;  3TWX A;  1NA3 A;  3LXU X;  2FBN A;  4N3C A;  4CRW A;  2ETB A;  4G26 A;  1OWN A;  4I2Z A;  3SHF A;  3Q7F A;  3CVN A;  5G04 C;  3B7B A;  3D3M A;  3ZYM A;  4I6J A;  4BTB A;  2R02 A;  3Q15 A;  4GZD A;  3HRA A;  2R5S A;  5AIJ A;  1D8E A;  5AEN A;  3TGO A;  3G2T A;  3BUA A;  3FH5 A;  1OWP A;  4ME2 A;  1N0Q A;  2MYO A;  3PZD A;  2Y1L E;  1Z6T A;  3SZ7 A;  3Q47 B;  1HS6 A;  4RLY A;  3LY8 A;  2LO6 A;  1TNB A;  4GYY A;  4DRX E;  3CKC A;  3U66 A;  2PZI A;  5AAO A;  3E34 A;  3Q9N C;  4Y6C A;  1BPO A;  5B1B E;  3HIZ A;  2ZU6 B;  1OCR E;  3L13 A;  3S7F A;  1Q2Z A;  1WDY A;  3QK0 A;  3DRA A;  1HE8 A;  5LP0 A;  4O6F A;  1TNO A;  3D9L A;  4WWP A;  3MV2 B;  5ENP D;  3ESK A;  3D9J A;  4JW1 A;  3AU4 A;  4JB8 P;  3UIO C;  2BTD A;  3JXI A;  4AIF A;  4FC8 A;  3UTM A;  3RRU A;  1Z3X A;  3MEK A;  3B7U X;  4N2Q A;  3PEU B;  2AW6 A;  1ELK A;  3HHM A;  2XRZ A;  3GZ2 A;  4L1B A;  3B7R L;  1V55 E;  4G24 A;  2UY1 A;  1IYG A;  3ZVV A;  3ISM C;  3MYV A;  2VGX A;  1KZP A;  1X81 A;  3CVP A;  3KEZ A;  4TUU A;  4JPS A;  3S2A A;  4LSZ E;  3EJN A;  1HF8 A;  3CV0 A;  3EHM A;  3R9M A;  5JJ7 A;  4HVB A;  4AY5 A;  5CMY A;  1ELR A;  2KCV A;  3L16 A;  4L2Y A;  3DXK G;  1P5Q A;  4J0U A;  2EIM E;  3DSS A;  2F8X K;  3RO2 A;  1JWG A;  2DYS E;  1MYO A;  5FZR A;  5EIL A;  3CK8 A;  4BX8 A;  1OUV A;  3CQC B;  2DYR E;  4A55 A;  2I1K A;  3CSF A;  5ENN A;  4O1P A;  1FVH A;  4DLO A;  4KMO A;  4A63 B;  2J4D A;  3ZEF A;  2F37 A;  3GW4 A;  1A5E A;  5ENT D;  3ONK A;  1TN6 A;  5IY5 E;  2CHZ A;  3UMV A;  2WVI A;  4EZL A;  3DXM G;  3BEE A;  3LCA A;  3ASF A;  3UPV A;  3CKB A;  4GTP A;  4HQD A;  4HOU A;  4TXQ A;  4HI9 A;  2L0T B;  5JJ6 A;  4EEC A;  3T8M A;  1HX8 A;  3W9G A;  3LY7 A;  3B13 A;  3ML9 A;  4A3T A;  3RSE G;  4HOT A;  2DWZ A;  3CST A;  3CVQ A;  3HDX A;  2XHE A;  1K3Z D;  3RO3 A;  1HO8 A;  2GRP B;  3DSW A;  1H6K A;  2QFC A;  3D9K A;  1E7U A;  4B0Z A;  3RIB A;  4NIK A;  4HNA D;  3AAA C;  4PS8 A;  3FUK A; 
#chains in the Genus database with same CATH homology
 1N94 A;  1N4P A;  3HXB A;  3EUV A;  2ZIR A;  3DSS A;  1O5M A;  4L9P A;  1TNB A;  4MBG A;  1FT1 A;  3HXE A;  2H6G A;  1NI1 A;  1N4S A;  2H6H A;  2H6I A;  1TNY A;  3E34 A;  3Q73 A;  4LNG A;  3EU5 A;  3SFX A;  4GTQ A;  1O1T A;  4GTM A;  1D8D A;  3DRA A;  3E32 A;  1SA5 A;  1SA4 A;  3E30 A;  1TNO A;  3DSV A;  4EHM A;  1TN7 A;  1JCQ A;  1TN8 A;  1TN6 A;  2R2L A;  2H6F A;  1JCR A;  3HXF A;  1N9A A;  1MZC A;  4YDE A;  3Q75 A;  4GTS A;  1FT2 A;  1LD8 A;  1FPP A;  1O1R A;  3PZ1 A;  1LD7 A;  3Q7A A;  3KSL A;  1JCS A;  3Q78 A;  1KZO A;  3DST A;  2ZIS A;  4GTP A;  4GTV A;  3Q79 A;  4YDO A;  3PZ2 A;  3Q7F A;  1TNZ A;  4GTR A;  2F0Y A;  3KSQ A;  1N95 A;  3SFY A;  3C72 A;  1N4R A;  1DCE A;  1NL4 A;  4GTO A;  3DPY A;  1D8E A;  2BED A;  1LTX A;  3HXD A;  1KZP A;  1X81 A;  3DSW A;  1S64 A;  1QBQ A;  3HXC A;  1S63 A;  4GTT A;  3E33 A;  3E37 A;  3PZ3 A;  1O1S A;  4LNB A;  3DSX A;  1TNU A;  3PZ4 A;  3DSU A;  1N4Q A;  2IEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...