1N4SA

Protein geranylgeranyltransferase type-i complexed with ggpp and a geranylgeranylated kkksktkcvil peptide product
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Structure of mammalian protein geranylgeranyltransferase type-I
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 126
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n4sA00
3DSXA 3EUVA 4L9PA 3E32A 4GTVA 3E37A 3EU5A 1X81A 3HXBA 4GTPA 1N4QA 1KZPA 3E33A 1DCEA 1KZOA 1N4PA 3E34A 2H6IA 1NL4A 1TNUA 1SA5A 1S64A 1N4SA 4MBGA 2ZISA 1FPPA 1O1RA 3HXEA 1NI1A 2ZIRA 1LTXA 2R2LA 1N94A 1O1SA 4LNGA 4GTOA 3KSLA 1TNYA 4GTRA 3SFYA 3Q79A 3DSVA 1O5MA 1TN8A 1N4RA 1O1TA 3PZ4A 3PZ2A 3Q7AA 2F0YA 3Q7FA 1MZCA 2IEJA 1TN7A 3Q78A 1QBQA 1TNZA 1FT2A 3DSUA 2H6HA 3HXDA 3DPYA 1N9AA 3HXFA 3KSQA 4EHMA 4YDEA 3PZ1A 1N95A 1JCRA 3Q73A 1SA4A 1JCSA 4GTTA 1D8EA 1TNBA 1JCQA 3PZ3A 2H6GA 3C72A 2BEDA 1TNOA 3SFXA 4GTQA 4LNBA 4GTSA 3Q75A 1D8DA 1FT1A 1LD8A 1TN6A 4YDOA 1S63A 3DSTA 4GTMA 3HXCA 3DSSA 3E30A 1LD7A 3DSWA 2H6FA 3DRAA
chains in the Genus database with same CATH superfamily
1H19A 4FLHA 4A63B 1BI7B 1OCCE 4ACKA 3S7FA 4JD2G 3PNLB 4GTPA 4WWPA 2C2LA 2XHEA 4ILIA 1E8ZA 2DZNA 1FPPA 2LXMA 4J8YA 3ZYLA 3PZDA 3U4TA 5CHEE 3ZNGA 2BF0X 2KZTB 2F8YA 5DIZA 4CDMA 3CHMA 2OVFA 1TN8A 1UN9A 3AAAC 4GYWA 3AG3E 4OAUC 5AJLA 1NZNA 2PNNA 2IEJA 1SZAA 2NYJA 1EPUA 5KBAA 1IHBA 4YNDA 4I6GA 3D9LA 4GMJA 3FU5A 4JB8P 3UPVA 3IBEA 4I6JA 2WXIA 3CK7A 2X6JA 4DPRA 2ONDA 4NRHB 4BY6A 3MV3B 2DYSE 4LSZE 2VGXB 3LPZA 4BETA 5BV1A 3CVLA 4JEHA 3I3NA 3RRMB 3TWSA 4CYMD 4HS2A 3C72A 3CSTA 5B1BE 3TJPA 4AM9A 5ARFA 1FVFA 2XEVA 3D9IA 4RG6A 2XZTG 4GTMA 4XZ4A 3PE3A 4Q96A 5IY5E 3JXIA 2CHXA 3FTWA 5FQ8A 3EU5A 3PUKA 3CR3A 2OCCE 3SFZA 4RG9A 3ZW3A 2PQNA 3MEKA 1ELWA 1INZA 1HX8A 2I1JA 2X38A 1G3NB 3VTXA 3HDXA 3PREA 3ZKJA 4I9CA 4ANWA 4I6EA 2VTBB 4UWHA 1N4RA 1X5BA 3ASHA 3FU0A 3EU9A 4B8CB 3Q78A 4MLPA 4BWRA 1B89A 3PVLA 2EIME 2WXMA 5JJ6A 4Q69A 5LP0A 5AJDA 1OWOA 1JPLA 3PUJA 3UM2A 4HVBA 4PH4B 4YDEA 1WM5A 3V2OA 4OAVB 2WQ6A 1OWPA 2E0IA 3QDNA 3ZHEA 4F1PA 3EHNA 2AXZA 2R17C 3BU8A 3SGHA 2JEKA 2GW1A 2PM7A 4GA2A 3SY2A 2VYIA 4OVVA 1MX4A 3BUAA 3KEAA 2CHZA 4A3TA 2R05A 3Q9NC 3FU6A 4GB9A 2YHEA 2L6BA 5CERB 4HRMB 3LVQE 2KZTA 3OXLA 5J90A 1SA5A 1MYOA 3QOUA 5LX8A 4CGWA 2GROB 4HI9A 5HS0A 4ILGA 2PQRA 3UQ3A 5EX0A 1TNYA 5KJKA 4GTRA 4URKA 1O5MA 2GRRB 2AVPA 4IRUA 3Q7AA 1N0QA 4YDYA 4XX5A 4DRXE 3FUEA 3ONKA 3FUKA 1IYGA 1H2VC 3HXFA 3D9KA 1E8WA 3L54A 2X3MA 4ABNA 4L2YA 1TJCA 5EIBE 1YCSB 2V5QC 3D9PA 3CVUA 3QWVA 4RSYA 2DCPA 4GTTA 4BT9A 1P5QA 5AENA 4H7XA 2B0OE 3SHFA 2X6IA 4BX8A 3AG4E 1H0AA 4AV7A 4O60A 2AW6A 3KEZA 3I5PA 4GU5A 2ZGGA 3HYMB 2KBXA 3Q4AB 3UMVA 3CV0A 3DSTA 4HNAD 2HM8A 2DVWA 3S7DA 2HO1A 3L22A 1HFAA 5AYWD 3VLFA 1K3ZD 3CSFA 2YHCA 4L9PA 3QWWA 3TWVA 5FJYA 1N4QA 2AXVA 4R7LA 1N4PA 4U7EB 3AU5A 1RZ4A 3ZU7B 2P9KG 1O1RA 4WWOA 2J07A 2B6CA 3FUIA 4GA1A 5ENTD 4U0ZA 1O1SA 4WNDA 2R5SA 4DK5A 4TUMA 5AQBA 4CRWA 3HIZA 5G55A 1EF1C 2C0MA 3DWLG 1OT8A 3RK6A 4WUYA 5KNGA 1IQUA 4N2QA 5AQAA 2ETCA 5JMND 2WXGA 4ATZD 4LNUD 3DPYA 3ZXSA 5G05J 4U8YD 3L17A 4C48B 2QC9A 2X6KA 3O48A 3B7BA 4GCOA 1L5JA 4EBAG 2XS8A 3UIPC 3UKRG 1IHGA 4AXHA 4EZJA 3V2XA 5B1AE 4GZ5A 2CG3A 3S7BA 3X2QE 5AARA 3J5PA 3LY8A 3ZN3A 3GYZA 1E96B 4GMLA 4FP7A 4I1AA 3APCA 3HXCA 3CVYA 3G2TA 3Q49B 1AWCB 3NAWA 1JWFA 1E7UA 4CT0A 3GZ2A 3IHYA 3LY7A 4HOQA 1DCEA 2FULA 3FEXA 3ZIMA 2F37A 4XIFA 4U95D 4NQ0A 4AY5A 1NI1A 1LF8A 4DX5D 3ABKE 2KCKA 2GGFA 4HQDA 3JYSA 1N54A 2XCCA 1HG2A 1O1TA 1YMPA 1A17A 4MS6A 3ZYMA 5CEAA 2HYZA 3HXDA 1GW6A 5EYPF 2PL2A 1HH8A 3DEOA 4TXQA 4B93B 4L2LA 1S70B 5BPPA 5JJ7A 3AG1E 3EHMA 2WXFA 1YA0A 4ATGA 1MHQA 3J5QB 3ASOE 4GMRA 2FF4A 2RG8A 3AS4A 1QZ2A 2RFAA 1WY6A 1TNBA 3UI2A 3UUXA 2DZOA 2WXHA 2BEDA 2WQ7A 3B7TA 1H2TC 4F7AA 1KLXA 5JA4D 3RO3A 2V4HC 3ULQA 4APOA 2Y4UA 4JEUA 1NA3A 3TL5A 2LUHA 3CGHA 4C0MA 1DVPA 5T4YA 3QK0A 3E33A 2UY1B 4AOFA 1FVHA 4ACLA 2XPYA 1WAO1 3FHEA 1S64A 4ANVA 2R02A 3FTZA 2X6FA 2XS1A 2P58C 3L9TA 4ANUA 4LNGA 2R59A 4JA7A 4UWLA 3GW4A 4F53A 2Q7FA 2GRMA 3B95A 4A1GA 5JHAA 2L0TB 5BUZA 1W3BA 3TWQA 4JHJA 5T8IA 1S0PA 3ABLE 4DI3A 3TWUA 3FFLA 2H6HA 4Z68A 2V8SE 3CKBA 3CHQA 4BX9A 1NFIE 3IV0A 1Z5SC 3AJIA 3DXKG 5B3SE 1HO8A 1TYQG 4KT6B 3ASFA 1H2UA 3T5XA 3JXJA 2NC9A 3K9IA 3RSEG 2H6GA 3SFXA 2V0PA 3CHSA 4ANXA 2A5UA 3B7SA 2VSXE 3UIOC 3E30A 2WXNA 3EHQA 3DRAA 3FH8A 3B13A 3LS8A 3Q47B 2IU1A 2CFUA 1WG0A 3T8KA 3QAQA 3Q5MA 3ASDA 2I9CA 4Y6WA 3R9MA 1N94A 4CGVA 5M72A 3ZRHA 2IJGX 2WQHA 1KT0A 1MX2A 4U8VD 5KJNA 3FP3A 2FO7A 3GZSA 5J08A 2VSNA 2C0LA 3FTYA 4JC8A 3TWTA 4DX7D 3AG2E 3TWRA 1TNZA 3MA5A 3LY9A 1ELKA 3FTVA 3NQPA 4K5AB 3CLJA 4JZYA 2WPVA 3QARA 1OCRE 1OCOE 3FUJA 3SZ7A 1H6OA 3PNTB 2CFZA 3UKUG 2BUGA 5BNWA 2XGSA 3ASGA 1UOHA 5EIDA 3RJVA 4KMOA 3L13A 1HXIA 3LYAA 3PZ3A 3VLEA 2J49A 1HF8A 4MKTA 1D8DA 1UJJA 2I6HA 4FC8A 3FU3A 2EINE 4LG6A 4N2SA 2P9NG 4AP2A 3PEVB 2AXUA 2UY1A 1XGWA 5LOZA 3SD5A 4DX2A 4XI9A 1VDYA 3MJWA 5KCMA 3MZLB 1DCQA 3R7QA 4BTBA 4XEIG 2KCVA 3ULYA 2Y69E 1KPSB 3E34A 2YNQA 1PY1A 3ONLA 2R2LA 3FUNA 2RKKA 2IONA 3ZYQA 2BKKB 3KSLA 3JUIA 3Q79A 4OVUA 4FULA 3DSVA 3HVEB 3PZ2A 2PZIA 4PS8A 4DUIA 3LKUA 3V79K 5FINA 4I2ZA 4LUNU 1QBQA 5C2YA 3FH7A 1FT2A 2IFUA 4HOSA 4HOTA 4B89A 3DXMG 5G2NA 4DX1A 4GPKA 3Q73A 2LSUA 4MRUA 4GZCA 4TXRA 3HHMA 2J09A 4HLEA 2LAHA 5CECB 2VGXA 1QQEA 3UM0A 5KJLA 1JCQA 2MRIA 4G11A 3ZFWA 3BEEA 3ZGQA 5H7PA 3EJNA 3C3OA 3D9HA 4N3BA 2WXKA 3GZ1A 5C1DA 2E2EA 4FJYA 2DBAA 3DSXA 5LCWC 3PH0C 1NP7A 3BG0B 4HI8A 3IKOB 2J8SD 3VTYA 3DPDA 5E75A 3U64A 2EQXA 3FWVA 3Q9UC 2FEZA 3NOCD 3ZXPA 5AN8A 4AVXA 2GRNB 5D0QD 1E8YA 4J8FA 1SQMA 4WNFA 4JHKA 4UQXA 4P29A 2VTBA 2F0YA 1BU9A 5CRVA 3PE4A 3L6AA 5LFAA 3JCKC 3OXGA 4BEPA 2WVIA 1QYMA 3SNXA 4UQZA 1BLXB 5HRYA 5FZRA 4DLOA 4U96D 4O1PA 2BKGA 2KCLA 3FUFA 3L82A 2IY0C 3I4GA 3R9AB 3APDA 4M7CA 1OWNA 3FY4A 4HB5A 1Z3XA 1S63A 4NACA 4J8SA 3RO2A 1LD7A 3ISMC 3T8MA 1DNPA 5ENQD 4G23A 1UW4B 4B0ZA 2A4ZA 4JHRA 2KXPC 3CQGB 5BT1A 3UT8A 4FLBA 3SBSA 1IQRA 2J08A 4GTVA 4ZFHA 2XEHA 2XCBA 3PS6A 1D9SA 1KZPA 1PC2A 1KZOA 5A23A 2ILRA 3RAUA 4BSZB 2ZISA 3HVEA 2EIJE 3MV2B 5D2MC 3U66A 5CMYA 2AJAA 4WNEA 1HS6A 3OTNA 4HLLA 4K0RA 4NIKA 4AEZC 2WXRA 2J4DA 3CHPA 4GYOA 2LAIA 2WXJA 3L08A 3G2SA 3PRZA 3DSUA 4J8EA 3BG1B 3C3RA 2WMNA 3TWXA 5ENRD 2I1KA 4BSXA 2IQCA 3IHVA 3TGOA 4K03A 4G8KA 4TV3A 4F6RD 1JCSA 3WXXA 4RLYA 3TXMA 5BXUA 5EYLA 4G25A 1EYHA 3CVVA 3EIQC 2XPZA 2QZAA 5ENPD 4GTQA 4EBAA 2KM4A 4G1TA 2P9SG 3PEUB 1FT1A 1LD8A 3LJ3A 1V55E 3DSSA 2FO1E 4I9EA 3QC1A 3CVWA 3U9WA 2P2CP 5FWQA 2IOLA 2MHKA 5DBKA 4CDRA 2WM9A 2Y3AA 1BI8B 4JPSA 4UI9K 4KVMA 3E37A 5CRUA 4DI4A 4BTAA 4JW1A 3RRNB 3CK9A 3SBTB 2Y4TA 2H6IA 3ESLA 4J8DA 2IF4A 3CKCA 4FHKA 2IOSA 1OY3D 4HBDA 1OUVA 5FQ7A 2MOWA 2XGMA 3CHRA 4JVSA 4BFRA 4NURA 4CZ2D 4FHJA 1U3CA 3NZUA 4GYYA 4FJZA 4KYOB 3DBSA 4KXKB 3V31A 4U0SA 1N11A 3FULA 3RU0A 2NXPA 5FZQA 3TG4A 2VSYA 3G2WA 3L16A 3ZHEB 3KS2A 4M3OA 4TXPA 2KC7A 1UG3A 2GRQB 3PZ1A 3W9GA 2OEWA 1JCRA 2WXPA 3HG0D 1ELRA 5FIOA 2LO6A 4B94A 4N3CA 4XE0A 1SVXA 5BXOA 4CCAA 2V4LA 2WXLA 3MX3A 2P9UG 3QJZA 4UI9J 4AIFA 1K1AA 4U04A 4G26A 4N3AA 4I43A 3CEQA 3B7UX 3FH5A 4U07A 3D9NA 4XKBA 3WG7E 3UM3A 4WWNA 5BV0A 4IN3B 3ML8A 2ZGDA 4GA0A 3SI5A 5CBNA 4U63A 4GZDA 4N5QA 1UN8A 4F3VA 4UI9C 4C9BB 1DC2A 5KWDA 4WNGA 1XNFA 1RW2A 4BERA 2ZIRA 2YQ8A 5HKPA 3NZSA 4Y6CA 3ABME 1EDUA 3TG5A 1UJKA 3C3QA 3SFYA 2QYJA 1OCZE 4HXIA 3PZ4A 5ARGA 1HZ4A 5ITZF 1MX6A 5EN5D 4UQYA 3ZEFA 4IYPA 3TWWA 1K1BA 4O1OA 4JL0A 1FCHA 1ZB1A 1OWLA 3W9FA 2P9IG 4WAFA 3O4ZA 4EECA 1N9AA 1WDYA 4G24A 2OEVA 3KD7A 4G2VA 3TAXA 3D9MA 4OYSA 4U8HA 1ZU2A 3CK8A 3D9OA 1JWGA 1TR4A 1SA4A 2CG2A 2DYRE 3QNKA 3KAEA 1KT1A 4QQIA 3RKVA 3FTXA 4N39A 1U2VG 3FDHA 4JA9A 2VGYA 4CT4A 4ME2A 4GTSA 2L6JA 4X8QA 1TN6A 3JQ1A 3B7RL 3T9KA 3DSWA 4E85A 2MYOA 2RFMA 5KJMA 5AQ9A 2WXOA 4JXTA 4J0UA 3RRUA 3EUVA 3SF4A 2DIWA 4IULA 4HOUA 3I4RB 5JHBA 5FT9A 3MGBA 3F6QA 1BD8A 3FTUA 4GPMA 3EIJA 4U0UA 4GZ3A 3D9JA 3V30A 4G8LA 3NB2A 2XQ0A 5A6CA 4GTOA 3ULEG 4I1MA 4UUCA 2F8XK 4PDXA 4C0EA 3RIBA 3UINC 4AJWA 3UT7A 2UWJG 2VSOE 4I1OB 5AIJA 5ANRA 3Q7FA 1U3DA 2HR2A 2M63A 5HI7A 4FU3A 2QY7A 2VJ8A 3KSQA 4H7YA 4D10C 1ZBPA 4GCNA 2V5FA 2KATA 1A5EA 2VGEA 1AP7A 5D0OD 2A5EA 5FQ4A 2NSZA 3AS8A 1N52A 1OWMA 2I2OA 3S2AA 5ENNA 4DLQA 3P2BA 2AWIA 2GRPB 1PAQA 4ILHB 4RQIA 3URZA 3Q75A 5BW8C 3IEGA 3NOGD 3PDNA 3MKRA 1TEZA 2DWZA 3FUMA 3CQCB 4LCTA 5CCMA 3QB2A 3S7JA 1SW6A 5CCLA 5LCWJ 2WMOA 1IXVA 4K5BA 3SQVA 2JLBA 3OXFA 2EIKE 3U3WA 1X81A 1YYHA 4K5CA 4TRQA 3G2UA 4L7TA 5FTPA 2XZDG 3LJNA 1QNFA 1TNUA 4YVOA 1N0RA 4MBGA 4Q94A 3ZYKA 3MYVA 3HXEA 3FUDA 2XPIA 4CDNA 4EPZA 3ZVVA 3ENEA 3BQOA 5D66A 2YINA 2ZU6B 2XGOA 3FTSA 3MKQB 5FZSA 4E6HA 4O6FA 1TJFA 3CVQA 3JQ0A 1JUQA 2OV8A 3CHOA 1OXJA 3DEPA 2WXQA 4I2WA 1V54E 4APFA 3SO8A 4EHMA 4EQFA 1N95A 4BESA 1HG5A 2VQ2A 4HORA 3LDZA 2GRLA 2FBNA 4CEMA 3E4BA 3HRAA 4GAAA 1TNOA 1Q2ZA 5AAOA 4LNBA 4HRLA 3ESKA 3UX4A 1MJ0A 3R7RA 3UXGA 5JJTA 4V3IA 4QFVA 4ZHBA 4UWFA 5CMWA 3C5RA 2ZXWE 3E32A 5ENOD 1HU3A 2XRZA 4EZKA 2X6HA 4RVBA 1NL4A 5CBOA 2XEEA 4FA6A 3EDTB 3LCAA 1N4SA 3LXUX 3VLDA 4LEUA 4B8AA 4YDWA 2IO2C 4GZ6A 3CVPA 2WB2A 2Y0BG 3T5VA 4BT8A 4A1SA 2QFCA 3LVRE 5T3RA 4KBQA 4N5CA 3CIAA 4W9RA 3ZUVB 1BPOA 3TXNA 4J6IA 1Y6IA 4DX6D 3P1UA 5G05C 3QKYA 3NF1A 4PUCA 2ETBA 4KVOA 2OVBA 4YVQC 4F1SA 3ASNE 4AY6A 4L1BA 3QWPA 1E8XA 3APFA 1MQSA 5EKQD 4LERA 1D8EA 4XKCA 4DJAA 5E76A 1IKND 1HE8A 5ANLA 2EILE 3C98A 1NA0A 3D3MA 2BTDA 2H6FA 3N71A 4KZCA 2R03A 2J9QA 4A3VA 3Q15A 3HXBA 4HRNA 3AU4A 3MCXA 2L9BA 4LRZA 2OOEA 2FI7A 2IO3C 5FQ6A 2J4BA 3FEYA 5ENSD 3G2VA 3MKQA 3ML9A 4UWGA 5G04J 1LTXA 2P9LG 2XENA 2LSVA 3IXEA 1Y8MA 2P9PG 3OAWA 5AQ7A 3CVNA 3ZPJA 1Z6TA 1H6PA 5EILA 1MZCA 3EHRA 2Y1LE 5KNHD 3FUHA 4A55A 3AS5A 4HFGA 2LXLA 2PM6A 4J7WA 5G04C 3CVXA 1SZ9A 5EDSA 2JABA 5HQ8A 2CHWA 2LNIA 4PS3A 1Z3YA 1K8KG 4I17A 3UTMA 4PS7A 3JUEA 5EX3A 5A7DB 4FADA 4XI0A 3UM1A 5CEDB 4EZLA 1E7VA 2QYUA 2ETAA 3LEWA 2L0IA 1E90A 2RD0A 3NBNB 4L23A 2HE0A 4YDOA 3UT4A 2XRYA 4KZ0A 1H6KA 4UWKA 1TN7A 4TUUA
chains in the Genus database with same CATH topology
3DSXA 3EUVA 4L9PA 3E32A 4GTVA 3E37A 3EU5A 1X81A 3HXBA 4GTPA 1N4QA 1KZPA 3E33A 1DCEA 1KZOA 1N4PA 3E34A 2H6IA 1NL4A 1TNUA 1SA5A 1S64A 1N4SA 4MBGA 2ZISA 1FPPA 1O1RA 3HXEA 1NI1A 2ZIRA 1LTXA 2R2LA 1N94A 1O1SA 4LNGA 4GTOA 3KSLA 1TNYA 4GTRA 3SFYA 3Q79A 3DSVA 1O5MA 1TN8A 1N4RA 1O1TA 3PZ4A 3PZ2A 3Q7AA 2F0YA 3Q7FA 1MZCA 2IEJA 1TN7A 3Q78A 1QBQA 1TNZA 1FT2A 3DSUA 2H6HA 3HXDA 3DPYA 1N9AA 3HXFA 3KSQA 4EHMA 4YDEA 3PZ1A 1N95A 1JCRA 3Q73A 1SA4A 1JCSA 4GTTA 1D8EA 1TNBA 1JCQA 3PZ3A 2H6GA 3C72A 2BEDA 1TNOA 3SFXA 4GTQA 4LNBA 4GTSA 3Q75A 1D8DA 1FT1A 1LD8A 1TN6A 4YDOA 1S63A 3DSTA 4GTMA 3HXCA 3DSSA 3E30A 1LD7A 3DSWA 2H6FA 3DRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSX A;  3EUV A;  4L9P A;  3E32 A;  4GTV A;  3E37 A;  3EU5 A;  1X81 A;  3HXB A;  4GTP A;  1N4Q A;  1KZP A;  3E33 A;  1DCE A;  1KZO A;  1N4P A;  3E34 A;  2H6I A;  1NL4 A;  1TNU A;  1SA5 A;  1S64 A;  1N4S A;  4MBG A;  2ZIS A;  1FPP A;  1O1R A;  3HXE A;  1NI1 A;  2ZIR A;  1LTX A;  2R2L A;  1N94 A;  1O1S A;  4LNG A;  4GTO A;  3KSL A;  1TNY A;  4GTR A;  3SFY A;  3Q79 A;  3DSV A;  1O5M A;  1TN8 A;  1N4R A;  1O1T A;  3PZ4 A;  3PZ2 A;  3Q7A A;  2F0Y A;  3Q7F A;  1MZC A;  2IEJ A;  1TN7 A;  3Q78 A;  1QBQ A;  1TNZ A;  1FT2 A;  3DSU A;  2H6H A;  3HXD A;  3DPY A;  1N9A A;  3HXF A;  3KSQ A;  4EHM A;  4YDE A;  3PZ1 A;  1N95 A;  1JCR A;  3Q73 A;  1SA4 A;  1JCS A;  4GTT A;  1D8E A;  1TNB A;  1JCQ A;  3PZ3 A;  2H6G A;  3C72 A;  2BED A;  1TNO A;  3SFX A;  4GTQ A;  4LNB A;  4GTS A;  3Q75 A;  1D8D A;  1FT1 A;  1LD8 A;  1TN6 A;  4YDO A;  1S63 A;  3DST A;  4GTM A;  3HXC A;  3DSS A;  3E30 A;  1LD7 A;  3DSW A;  2H6F A;  3DRA A; 
#chains in the Genus database with same CATH topology
 1H19 A;  4FLH A;  4A63 B;  1BI7 B;  1OCC E;  4ACK A;  3S7F A;  4JD2 G;  3PNL B;  4GTP A;  4WWP A;  2C2L A;  2XHE A;  4ILI A;  1E8Z A;  2DZN A;  1FPP A;  2LXM A;  4J8Y A;  3ZYL A;  3PZD A;  3U4T A;  5CHE E;  3ZNG A;  2BF0 X;  2KZT B;  2F8Y A;  5DIZ A;  4CDM A;  3CHM A;  2OVF A;  1TN8 A;  1UN9 A;  3AAA C;  4GYW A;  3AG3 E;  4OAU C;  5AJL A;  1NZN A;  2PNN A;  2IEJ A;  1SZA A;  2NYJ A;  1EPU A;  5KBA A;  1IHB A;  4YND A;  4I6G A;  3D9L A;  4GMJ A;  3FU5 A;  4JB8 P;  3UPV A;  3IBE A;  4I6J A;  2WXI A;  3CK7 A;  2X6J A;  4DPR A;  2OND A;  4NRH B;  4BY6 A;  3MV3 B;  2DYS E;  4LSZ E;  2VGX B;  3LPZ A;  4BET A;  5BV1 A;  3CVL A;  4JEH A;  3I3N A;  3RRM B;  3TWS A;  4CYM D;  4HS2 A;  3C72 A;  3CST A;  5B1B E;  3TJP A;  4AM9 A;  5ARF A;  1FVF A;  2XEV A;  3D9I A;  4RG6 A;  2XZT G;  4GTM A;  4XZ4 A;  3PE3 A;  4Q96 A;  5IY5 E;  3JXI A;  2CHX A;  3FTW A;  5FQ8 A;  3EU5 A;  3PUK A;  3CR3 A;  2OCC E;  3SFZ A;  4RG9 A;  3ZW3 A;  2PQN A;  3MEK A;  1ELW A;  1INZ A;  1HX8 A;  2I1J A;  2X38 A;  1G3N B;  3VTX A;  3HDX A;  3PRE A;  3ZKJ A;  4I9C A;  4ANW A;  4I6E A;  2VTB B;  4UWH A;  1N4R A;  1X5B A;  3ASH A;  3FU0 A;  3EU9 A;  4B8C B;  3Q78 A;  4MLP A;  4BWR A;  1B89 A;  3PVL A;  2EIM E;  2WXM A;  5JJ6 A;  4Q69 A;  5LP0 A;  5AJD A;  1OWO A;  1JPL A;  3PUJ A;  3UM2 A;  4HVB A;  4PH4 B;  4YDE A;  1WM5 A;  3V2O A;  4OAV B;  2WQ6 A;  1OWP A;  2E0I A;  3QDN A;  3ZHE A;  4F1P A;  3EHN A;  2AXZ A;  2R17 C;  3BU8 A;  3SGH A;  2JEK A;  2GW1 A;  2PM7 A;  4GA2 A;  3SY2 A;  2VYI A;  4OVV A;  1MX4 A;  3BUA A;  3KEA A;  2CHZ A;  4A3T A;  2R05 A;  3Q9N C;  3FU6 A;  4GB9 A;  2YHE A;  2L6B A;  5CER B;  4HRM B;  3LVQ E;  2KZT A;  3OXL A;  5J90 A;  1SA5 A;  1MYO A;  3QOU A;  5LX8 A;  4CGW A;  2GRO B;  4HI9 A;  5HS0 A;  4ILG A;  2PQR A;  3UQ3 A;  5EX0 A;  1TNY A;  5KJK A;  4GTR A;  4URK A;  1O5M A;  2GRR B;  2AVP A;  4IRU A;  3Q7A A;  1N0Q A;  4YDY A;  4XX5 A;  4DRX E;  3FUE A;  3ONK A;  3FUK A;  1IYG A;  1H2V C;  3HXF A;  3D9K A;  1E8W A;  3L54 A;  2X3M A;  4ABN A;  4L2Y A;  1TJC A;  5EIB E;  1YCS B;  2V5Q C;  3D9P A;  3CVU A;  3QWV A;  4RSY A;  2DCP A;  4GTT A;  4BT9 A;  1P5Q A;  5AEN A;  4H7X A;  2B0O E;  3SHF A;  2X6I A;  4BX8 A;  3AG4 E;  1H0A A;  4AV7 A;  4O60 A;  2AW6 A;  3KEZ A;  3I5P A;  4GU5 A;  2ZGG A;  3HYM B;  2KBX A;  3Q4A B;  3UMV A;  3CV0 A;  3DST A;  4HNA D;  2HM8 A;  2DVW A;  3S7D A;  2HO1 A;  3L22 A;  1HFA A;  5AYW D;  3VLF A;  1K3Z D;  3CSF A;  2YHC A;  4L9P A;  3QWW A;  3TWV A;  5FJY A;  1N4Q A;  2AXV A;  4R7L A;  1N4P A;  4U7E B;  3AU5 A;  1RZ4 A;  3ZU7 B;  2P9K G;  1O1R A;  4WWO A;  2J07 A;  2B6C A;  3FUI A;  4GA1 A;  5ENT D;  4U0Z A;  1O1S A;  4WND A;  2R5S A;  4DK5 A;  4TUM A;  5AQB A;  4CRW A;  3HIZ A;  5G55 A;  1EF1 C;  2C0M A;  3DWL G;  1OT8 A;  3RK6 A;  4WUY A;  5KNG A;  1IQU A;  4N2Q A;  5AQA A;  2ETC A;  5JMN D;  2WXG A;  4ATZ D;  4LNU D;  3DPY A;  3ZXS A;  5G05 J;  4U8Y D;  3L17 A;  4C48 B;  2QC9 A;  2X6K A;  3O48 A;  3B7B A;  4GCO A;  1L5J A;  4EBA G;  2XS8 A;  3UIP C;  3UKR G;  1IHG A;  4AXH A;  4EZJ A;  3V2X A;  5B1A E;  4GZ5 A;  2CG3 A;  3S7B A;  3X2Q E;  5AAR A;  3J5P A;  3LY8 A;  3ZN3 A;  3GYZ A;  1E96 B;  4GML A;  4FP7 A;  4I1A A;  3APC A;  3HXC A;  3CVY A;  3G2T A;  3Q49 B;  1AWC B;  3NAW A;  1JWF A;  1E7U A;  4CT0 A;  3GZ2 A;  3IHY A;  3LY7 A;  4HOQ A;  1DCE A;  2FUL A;  3FEX A;  3ZIM A;  2F37 A;  4XIF A;  4U95 D;  4NQ0 A;  4AY5 A;  1NI1 A;  1LF8 A;  4DX5 D;  3ABK E;  2KCK A;  2GGF A;  4HQD A;  3JYS A;  1N54 A;  2XCC A;  1HG2 A;  1O1T A;  1YMP A;  1A17 A;  4MS6 A;  3ZYM A;  5CEA A;  2HYZ A;  3HXD A;  1GW6 A;  5EYP F;  2PL2 A;  1HH8 A;  3DEO A;  4TXQ A;  4B93 B;  4L2L A;  1S70 B;  5BPP A;  5JJ7 A;  3AG1 E;  3EHM A;  2WXF A;  1YA0 A;  4ATG A;  1MHQ A;  3J5Q B;  3ASO E;  4GMR A;  2FF4 A;  2RG8 A;  3AS4 A;  1QZ2 A;  2RFA A;  1WY6 A;  1TNB A;  3UI2 A;  3UUX A;  2DZO A;  2WXH A;  2BED A;  2WQ7 A;  3B7T A;  1H2T C;  4F7A A;  1KLX A;  5JA4 D;  3RO3 A;  2V4H C;  3ULQ A;  4APO A;  2Y4U A;  4JEU A;  1NA3 A;  3TL5 A;  2LUH A;  3CGH A;  4C0M A;  1DVP A;  5T4Y A;  3QK0 A;  3E33 A;  2UY1 B;  4AOF A;  1FVH A;  4ACL A;  2XPY A;  1WAO 1;  3FHE A;  1S64 A;  4ANV A;  2R02 A;  3FTZ A;  2X6F A;  2XS1 A;  2P58 C;  3L9T A;  4ANU A;  4LNG A;  2R59 A;  4JA7 A;  4UWL A;  3GW4 A;  4F53 A;  2Q7F A;  2GRM A;  3B95 A;  4A1G A;  5JHA A;  2L0T B;  5BUZ A;  1W3B A;  3TWQ A;  4JHJ A;  5T8I A;  1S0P A;  3ABL E;  4DI3 A;  3TWU A;  3FFL A;  2H6H A;  4Z68 A;  2V8S E;  3CKB A;  3CHQ A;  4BX9 A;  1NFI E;  3IV0 A;  1Z5S C;  3AJI A;  3DXK G;  5B3S E;  1HO8 A;  1TYQ G;  4KT6 B;  3ASF A;  1H2U A;  3T5X A;  3JXJ A;  2NC9 A;  3K9I A;  3RSE G;  2H6G A;  3SFX A;  2V0P A;  3CHS A;  4ANX A;  2A5U A;  3B7S A;  2VSX E;  3UIO C;  3E30 A;  2WXN A;  3EHQ A;  3DRA A;  3FH8 A;  3B13 A;  3LS8 A;  3Q47 B;  2IU1 A;  2CFU A;  1WG0 A;  3T8K A;  3QAQ A;  3Q5M A;  3ASD A;  2I9C A;  4Y6W A;  3R9M A;  1N94 A;  4CGV A;  5M72 A;  3ZRH A;  2IJG X;  2WQH A;  1KT0 A;  1MX2 A;  4U8V D;  5KJN A;  3FP3 A;  2FO7 A;  3GZS A;  5J08 A;  2VSN A;  2C0L A;  3FTY A;  4JC8 A;  3TWT A;  4DX7 D;  3AG2 E;  3TWR A;  1TNZ A;  3MA5 A;  3LY9 A;  1ELK A;  3FTV A;  3NQP A;  4K5A B;  3CLJ A;  4JZY A;  2WPV A;  3QAR A;  1OCR E;  1OCO E;  3FUJ A;  3SZ7 A;  1H6O A;  3PNT B;  2CFZ A;  3UKU G;  2BUG A;  5BNW A;  2XGS A;  3ASG A;  1UOH A;  5EID A;  3RJV A;  4KMO A;  3L13 A;  1HXI A;  3LYA A;  3PZ3 A;  3VLE A;  2J49 A;  1HF8 A;  4MKT A;  1D8D A;  1UJJ A;  2I6H A;  4FC8 A;  3FU3 A;  2EIN E;  4LG6 A;  4N2S A;  2P9N G;  4AP2 A;  3PEV B;  2AXU A;  2UY1 A;  1XGW A;  5LOZ A;  3SD5 A;  4DX2 A;  4XI9 A;  1VDY A;  3MJW A;  5KCM A;  3MZL B;  1DCQ A;  3R7Q A;  4BTB A;  4XEI G;  2KCV A;  3ULY A;  2Y69 E;  1KPS B;  3E34 A;  2YNQ A;  1PY1 A;  3ONL A;  2R2L A;  3FUN A;  2RKK A;  2ION A;  3ZYQ A;  2BKK B;  3KSL A;  3JUI A;  3Q79 A;  4OVU A;  4FUL A;  3DSV A;  3HVE B;  3PZ2 A;  2PZI A;  4PS8 A;  4DUI A;  3LKU A;  3V79 K;  5FIN A;  4I2Z A;  4LUN U;  1QBQ A;  5C2Y A;  3FH7 A;  1FT2 A;  2IFU A;  4HOS A;  4HOT A;  4B89 A;  3DXM G;  5G2N A;  4DX1 A;  4GPK A;  3Q73 A;  2LSU A;  4MRU A;  4GZC A;  4TXR A;  3HHM A;  2J09 A;  4HLE A;  2LAH A;  5CEC B;  2VGX A;  1QQE A;  3UM0 A;  5KJL A;  1JCQ A;  2MRI A;  4G11 A;  3ZFW A;  3BEE A;  3ZGQ A;  5H7P A;  3EJN A;  3C3O A;  3D9H A;  4N3B A;  2WXK A;  3GZ1 A;  5C1D A;  2E2E A;  4FJY A;  2DBA A;  3DSX A;  5LCW C;  3PH0 C;  1NP7 A;  3BG0 B;  4HI8 A;  3IKO B;  2J8S D;  3VTY A;  3DPD A;  5E75 A;  3U64 A;  2EQX A;  3FWV A;  3Q9U C;  2FEZ A;  3NOC D;  3ZXP A;  5AN8 A;  4AVX A;  2GRN B;  5D0Q D;  1E8Y A;  4J8F A;  1SQM A;  4WNF A;  4JHK A;  4UQX A;  4P29 A;  2VTB A;  2F0Y A;  1BU9 A;  5CRV A;  3PE4 A;  3L6A A;  5LFA A;  3JCK C;  3OXG A;  4BEP A;  2WVI A;  1QYM A;  3SNX A;  4UQZ A;  1BLX B;  5HRY A;  5FZR A;  4DLO A;  4U96 D;  4O1P A;  2BKG A;  2KCL A;  3FUF A;  3L82 A;  2IY0 C;  3I4G A;  3R9A B;  3APD A;  4M7C A;  1OWN A;  3FY4 A;  4HB5 A;  1Z3X A;  1S63 A;  4NAC A;  4J8S A;  3RO2 A;  1LD7 A;  3ISM C;  3T8M A;  1DNP A;  5ENQ D;  4G23 A;  1UW4 B;  4B0Z A;  2A4Z A;  4JHR A;  2KXP C;  3CQG B;  5BT1 A;  3UT8 A;  4FLB A;  3SBS A;  1IQR A;  2J08 A;  4GTV A;  4ZFH A;  2XEH A;  2XCB A;  3PS6 A;  1D9S A;  1KZP A;  1PC2 A;  1KZO A;  5A23 A;  2ILR A;  3RAU A;  4BSZ B;  2ZIS A;  3HVE A;  2EIJ E;  3MV2 B;  5D2M C;  3U66 A;  5CMY A;  2AJA A;  4WNE A;  1HS6 A;  3OTN A;  4HLL A;  4K0R A;  4NIK A;  4AEZ C;  2WXR A;  2J4D A;  3CHP A;  4GYO A;  2LAI A;  2WXJ A;  3L08 A;  3G2S A;  3PRZ A;  3DSU A;  4J8E A;  3BG1 B;  3C3R A;  2WMN A;  3TWX A;  5ENR D;  2I1K A;  4BSX A;  2IQC A;  3IHV A;  3TGO A;  4K03 A;  4G8K A;  4TV3 A;  4F6R D;  1JCS A;  3WXX A;  4RLY A;  3TXM A;  5BXU A;  5EYL A;  4G25 A;  1EYH A;  3CVV A;  3EIQ C;  2XPZ A;  2QZA A;  5ENP D;  4GTQ A;  4EBA A;  2KM4 A;  4G1T A;  2P9S G;  3PEU B;  1FT1 A;  1LD8 A;  3LJ3 A;  1V55 E;  3DSS A;  2FO1 E;  4I9E A;  3QC1 A;  3CVW A;  3U9W A;  2P2C P;  5FWQ A;  2IOL A;  2MHK A;  5DBK A;  4CDR A;  2WM9 A;  2Y3A A;  1BI8 B;  4JPS A;  4UI9 K;  4KVM A;  3E37 A;  5CRU A;  4DI4 A;  4BTA A;  4JW1 A;  3RRN B;  3CK9 A;  3SBT B;  2Y4T A;  2H6I A;  3ESL A;  4J8D A;  2IF4 A;  3CKC A;  4FHK A;  2IOS A;  1OY3 D;  4HBD A;  1OUV A;  5FQ7 A;  2MOW A;  2XGM A;  3CHR A;  4JVS A;  4BFR A;  4NUR A;  4CZ2 D;  4FHJ A;  1U3C A;  3NZU A;  4GYY A;  4FJZ A;  4KYO B;  3DBS A;  4KXK B;  3V31 A;  4U0S A;  1N11 A;  3FUL A;  3RU0 A;  2NXP A;  5FZQ A;  3TG4 A;  2VSY A;  3G2W A;  3L16 A;  3ZHE B;  3KS2 A;  4M3O A;  4TXP A;  2KC7 A;  1UG3 A;  2GRQ B;  3PZ1 A;  3W9G A;  2OEW A;  1JCR A;  2WXP A;  3HG0 D;  1ELR A;  5FIO A;  2LO6 A;  4B94 A;  4N3C A;  4XE0 A;  1SVX A;  5BXO A;  4CCA A;  2V4L A;  2WXL A;  3MX3 A;  2P9U G;  3QJZ A;  4UI9 J;  4AIF A;  1K1A A;  4U04 A;  4G26 A;  4N3A A;  4I43 A;  3CEQ A;  3B7U X;  3FH5 A;  4U07 A;  3D9N A;  4XKB A;  3WG7 E;  3UM3 A;  4WWN A;  5BV0 A;  4IN3 B;  3ML8 A;  2ZGD A;  4GA0 A;  3SI5 A;  5CBN A;  4U63 A;  4GZD A;  4N5Q A;  1UN8 A;  4F3V A;  4UI9 C;  4C9B B;  1DC2 A;  5KWD A;  4WNG A;  1XNF A;  1RW2 A;  4BER A;  2ZIR A;  2YQ8 A;  5HKP A;  3NZS A;  4Y6C A;  3ABM E;  1EDU A;  3TG5 A;  1UJK A;  3C3Q A;  3SFY A;  2QYJ A;  1OCZ E;  4HXI A;  3PZ4 A;  5ARG A;  1HZ4 A;  5ITZ F;  1MX6 A;  5EN5 D;  4UQY A;  3ZEF A;  4IYP A;  3TWW A;  1K1B A;  4O1O A;  4JL0 A;  1FCH A;  1ZB1 A;  1OWL A;  3W9F A;  2P9I G;  4WAF A;  3O4Z A;  4EEC A;  1N9A A;  1WDY A;  4G24 A;  2OEV A;  3KD7 A;  4G2V A;  3TAX A;  3D9M A;  4OYS A;  4U8H A;  1ZU2 A;  3CK8 A;  3D9O A;  1JWG A;  1TR4 A;  1SA4 A;  2CG2 A;  2DYR E;  3QNK A;  3KAE A;  1KT1 A;  4QQI A;  3RKV A;  3FTX A;  4N39 A;  1U2V G;  3FDH A;  4JA9 A;  2VGY A;  4CT4 A;  4ME2 A;  4GTS A;  2L6J A;  4X8Q A;  1TN6 A;  3JQ1 A;  3B7R L;  3T9K A;  3DSW A;  4E85 A;  2MYO A;  2RFM A;  5KJM A;  5AQ9 A;  2WXO A;  4JXT A;  4J0U A;  3RRU A;  3EUV A;  3SF4 A;  2DIW A;  4IUL A;  4HOU A;  3I4R B;  5JHB A;  5FT9 A;  3MGB A;  3F6Q A;  1BD8 A;  3FTU A;  4GPM A;  3EIJ A;  4U0U A;  4GZ3 A;  3D9J A;  3V30 A;  4G8L A;  3NB2 A;  2XQ0 A;  5A6C A;  4GTO A;  3ULE G;  4I1M A;  4UUC A;  2F8X K;  4PDX A;  4C0E A;  3RIB A;  3UIN C;  4AJW A;  3UT7 A;  2UWJ G;  2VSO E;  4I1O B;  5AIJ A;  5ANR A;  3Q7F A;  1U3D A;  2HR2 A;  2M63 A;  5HI7 A;  4FU3 A;  2QY7 A;  2VJ8 A;  3KSQ A;  4H7Y A;  4D10 C;  1ZBP A;  4GCN A;  2V5F A;  2KAT A;  1A5E A;  2VGE A;  1AP7 A;  5D0O D;  2A5E A;  5FQ4 A;  2NSZ A;  3AS8 A;  1N52 A;  1OWM A;  2I2O A;  3S2A A;  5ENN A;  4DLQ A;  3P2B A;  2AWI A;  2GRP B;  1PAQ A;  4ILH B;  4RQI A;  3URZ A;  3Q75 A;  5BW8 C;  3IEG A;  3NOG D;  3PDN A;  3MKR A;  1TEZ A;  2DWZ A;  3FUM A;  3CQC B;  4LCT A;  5CCM A;  3QB2 A;  3S7J A;  1SW6 A;  5CCL A;  5LCW J;  2WMO A;  1IXV A;  4K5B A;  3SQV A;  2JLB A;  3OXF A;  2EIK E;  3U3W A;  1X81 A;  1YYH A;  4K5C A;  4TRQ A;  3G2U A;  4L7T A;  5FTP A;  2XZD G;  3LJN A;  1QNF A;  1TNU A;  4YVO A;  1N0R A;  4MBG A;  4Q94 A;  3ZYK A;  3MYV A;  3HXE A;  3FUD A;  2XPI A;  4CDN A;  4EPZ A;  3ZVV A;  3ENE A;  3BQO A;  5D66 A;  2YIN A;  2ZU6 B;  2XGO A;  3FTS A;  3MKQ B;  5FZS A;  4E6H A;  4O6F A;  1TJF A;  3CVQ A;  3JQ0 A;  1JUQ A;  2OV8 A;  3CHO A;  1OXJ A;  3DEP A;  2WXQ A;  4I2W A;  1V54 E;  4APF A;  3SO8 A;  4EHM A;  4EQF A;  1N95 A;  4BES A;  1HG5 A;  2VQ2 A;  4HOR A;  3LDZ A;  2GRL A;  2FBN A;  4CEM A;  3E4B A;  3HRA A;  4GAA A;  1TNO A;  1Q2Z A;  5AAO A;  4LNB A;  4HRL A;  3ESK A;  3UX4 A;  1MJ0 A;  3R7R A;  3UXG A;  5JJT A;  4V3I A;  4QFV A;  4ZHB A;  4UWF A;  5CMW A;  3C5R A;  2ZXW E;  3E32 A;  5ENO D;  1HU3 A;  2XRZ A;  4EZK A;  2X6H A;  4RVB A;  1NL4 A;  5CBO A;  2XEE A;  4FA6 A;  3EDT B;  3LCA A;  1N4S A;  3LXU X;  3VLD A;  4LEU A;  4B8A A;  4YDW A;  2IO2 C;  4GZ6 A;  3CVP A;  2WB2 A;  2Y0B G;  3T5V A;  4BT8 A;  4A1S A;  2QFC A;  3LVR E;  5T3R A;  4KBQ A;  4N5C A;  3CIA A;  4W9R A;  3ZUV B;  1BPO A;  3TXN A;  4J6I A;  1Y6I A;  4DX6 D;  3P1U A;  5G05 C;  3QKY A;  3NF1 A;  4PUC A;  2ETB A;  4KVO A;  2OVB A;  4YVQ C;  4F1S A;  3ASN E;  4AY6 A;  4L1B A;  3QWP A;  1E8X A;  3APF A;  1MQS A;  5EKQ D;  4LER A;  1D8E A;  4XKC A;  4DJA A;  5E76 A;  1IKN D;  1HE8 A;  5ANL A;  2EIL E;  3C98 A;  1NA0 A;  3D3M A;  2BTD A;  2H6F A;  3N71 A;  4KZC A;  2R03 A;  2J9Q A;  4A3V A;  3Q15 A;  3HXB A;  4HRN A;  3AU4 A;  3MCX A;  2L9B A;  4LRZ A;  2OOE A;  2FI7 A;  2IO3 C;  5FQ6 A;  2J4B A;  3FEY A;  5ENS D;  3G2V A;  3MKQ A;  3ML9 A;  4UWG A;  5G04 J;  1LTX A;  2P9L G;  2XEN A;  2LSV A;  3IXE A;  1Y8M A;  2P9P G;  3OAW A;  5AQ7 A;  3CVN A;  3ZPJ A;  1Z6T A;  1H6P A;  5EIL A;  1MZC A;  3EHR A;  2Y1L E;  5KNH D;  3FUH A;  4A55 A;  3AS5 A;  4HFG A;  2LXL A;  2PM6 A;  4J7W A;  5G04 C;  3CVX A;  1SZ9 A;  5EDS A;  2JAB A;  5HQ8 A;  2CHW A;  2LNI A;  4PS3 A;  1Z3Y A;  1K8K G;  4I17 A;  3UTM A;  4PS7 A;  3JUE A;  5EX3 A;  5A7D B;  4FAD A;  4XI0 A;  3UM1 A;  5CED B;  4EZL A;  1E7V A;  2QYU A;  2ETA A;  3LEW A;  2L0I A;  1E90 A;  2RD0 A;  3NBN B;  4L23 A;  2HE0 A;  4YDO A;  3UT4 A;  2XRY A;  4KZ0 A;  1H6K A;  4UWK A;  1TN7 A;  4TUU A; 
#chains in the Genus database with same CATH homology
 3DSX A;  3EUV A;  4L9P A;  3E32 A;  4GTV A;  3E37 A;  3EU5 A;  1X81 A;  3HXB A;  4GTP A;  1N4Q A;  1KZP A;  3E33 A;  1DCE A;  1KZO A;  1N4P A;  3E34 A;  2H6I A;  1NL4 A;  1TNU A;  1SA5 A;  1S64 A;  1N4S A;  4MBG A;  2ZIS A;  1FPP A;  1O1R A;  3HXE A;  1NI1 A;  2ZIR A;  1LTX A;  2R2L A;  1N94 A;  1O1S A;  4LNG A;  4GTO A;  3KSL A;  1TNY A;  4GTR A;  3SFY A;  3Q79 A;  3DSV A;  1O5M A;  1TN8 A;  1N4R A;  1O1T A;  3PZ4 A;  3PZ2 A;  3Q7A A;  2F0Y A;  3Q7F A;  1MZC A;  2IEJ A;  1TN7 A;  3Q78 A;  1QBQ A;  1TNZ A;  1FT2 A;  3DSU A;  2H6H A;  3HXD A;  3DPY A;  1N9A A;  3HXF A;  3KSQ A;  4EHM A;  4YDE A;  3PZ1 A;  1N95 A;  1JCR A;  3Q73 A;  1SA4 A;  1JCS A;  4GTT A;  1D8E A;  1TNB A;  1JCQ A;  3PZ3 A;  2H6G A;  3C72 A;  2BED A;  1TNO A;  3SFX A;  4GTQ A;  4LNB A;  4GTS A;  3Q75 A;  1D8D A;  1FT1 A;  1LD8 A;  1TN6 A;  4YDO A;  1S63 A;  3DST A;  4GTM A;  3HXC A;  3DSS A;  3E30 A;  1LD7 A;  3DSW A;  2H6F A;  3DRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...