3CVPA

Structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to pts1 peptide (10-skl)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
313
structure length
279
Chain Sequence
b'TDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVTRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peroxisome targeting signal 1 receptor PEX5
publication title Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transport protein
total genus 111
structure length 279
sequence length 313
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cvpA00
3ZHEA 2C0LA 4GZ6A 1QZ2A 4U0SA 3Q15A 3AS4A 4N3BA 4F3VA 4BTBA 3AS8A 3R9AB 2NC9A 4GZ5A 2PL2A 4RG9A 4U0ZA 4U07A 4N5CA 1P5QA 3MKRA 5JJTA 4JL0A 1ZBPA 2XCBA 3S7JA 3MA5A 2VYIA 2P58C 3WXXA 2XPIA 5KJKA 4NQ0A 1WM5A 3RJVA 2C2LA 2LSUA 2VGXB 3KAEA 3E4BA 5FZQA 3ULQA 3CV0A 4AY6A 3PE4A 4O6FA 2KCVA 5CCMA 2XGMA 3PDNA 4CGVA 1YA0A 4UQYA 4UQXA 5D0OD 1TJCA 3RIBA 5ARFA 1PC2A 1IYGA 2Y4TA 4U0UA 1W3BA 5JJ6A 4KBQA 4A1SA 2JLBA 5DBKA 2AVPA 3MEKA 3HYMB 4UI9K 5FJYA 1HXIA 3VTYA 4U04A 1OUVA 2Y4UA 5G05C 3ASHA 3ASDA 3NF1A 2C0MA 3CKBA 3Q4AB 3TAXA 4WUYA 4WNDA 1KLXA 2QFCA 5C1DA 4CGWA 5G04J 4J8DA 2PZIA 3MV2B 3S7DA 4G24A 4WNFA 3JYSA 3OXFA 3CK7A 3CKCA 3RO3A 5HQ8A 2KCKA 2MHKA 2LSVA 4GA1A 4J8FA 2FEZA 5CCLA 4BTAA 2R5SA 3RU0A 4G25A 2OOEA 3ESKA 2BUGA 4AM9A 2HO1A 2E2EA 5ARGA 4ABNA 4N2QA 3LYAA 1XNFA 5JJ7A 3KD7A 4J0UA 2XGSA 3URZA 1A17A 3GZ2A 2J9QA 4UQZA 1E96B 4G23A 3UPVA 3LY7A 4BT8A 2KC7A 5EX0A 5G04C 3K9IA 3CVNA 4IN3B 4G2VA 5FZSA 3QDNA 5A6CA 3MV3B 5AYWD 4GZ3A 4BT9A 2FBNA 3ZN3A 1ELRA 3ASFA 4GYOA 4I2WA 1KT0A 2HYZA 3QWVA 4G26A 3BEEA 5KJLA 4GPKA 4Y6WA 3S7FA 4N39A 1NA0A 2XCCA 5KJNA 3CK9A 3GW4A 3OXLA 3ZFWA 5EX3A 3VTXA 2UY1B 2VGYA 2IFUA 3FFLA 3LPZA 4APOA 2HR2A 2DBAA 2LNIA 2WQHA 5M72A 3SZ7A 1ELWA 3CVQA 3LCAA 1FCHA 2UWJG 4JA7A 4JA9A 4HORA 3U3WA 3TG5A 3LY9A 2GW1A 5FT9A 3SF4A 3UQ3A 2V5FA 3QOUA 3GZ1A 3Q49B 5A7DB 3QWWA 3FWVA 4UI9J 1HZ4A 4YVQC 2FO7A 4JHRA 1KT1A 4I17A 5LCWJ 4GYYA 3GYZA 4HOQA 2Q7FA 4N3CA 2VQ2A 4EQFA 3FP3A 1IHGA 4XIFA 5BT1A 5DIZA 3PE3A 2VGXA 4RG6A 3Q5MA 2YHCA 4I1AA 4GCOA 4N2SA 4WNEA 2VSNA 4AIFA 3UUXA 3N71A 4B94A 3TG4A 5D0QD 5FTPA 3RO2A 3ZHEB 3QWPA 5BW8C 5G05J 4XI0A 4NRHB 3IEGA 4BWRA 2KATA 4I2ZA 3KS2A 2PQNA 1QQEA 4GA0A 2UY1A 2YQ8A 4ME2A 4W9RA 4UI9C 4CDRA 3TGOA 3OXGA 3ZGQA 3AS5A 3RKVA 5BNWA 4GYWA 5LCWC 4KYOB 4HOTA 4Y6CA 1WAO1 2FI7A 1NA3A 4G1TA 2XEVA 2ONDA 3CVLA 1ZU2A 4LEUA 5FZRA 4J8EA 4AY5A 3O48A 2VSYA 3Q47B 4YNDA 3CK8A 3CEQA 2L6JA 1B89A 5EKQD 4HOUA 2KCLA 1HH8A 4I9CA 2FF4A 3ZPJA 5KJMA 4N3AA 3EDTB 4YVOA 4XI9A 2PQRA 4I9EA 1NZNA 2WPVA 3ASGA 1Y8MA 3U4TA 3CVPA 2IF4A 5CHEE 3QKYA 3LKUA 3LY8A 4H7XA 2I6HA 5HI7A 3S7BA 2XGOA 4GCNA 4WNGA 4HOSA 4GA2A 4H7YA 4KXKB
chains in the Genus database with same CATH superfamily
5EYLA 4FULA 3PREA 1ELKA 3ZW3A 2I1KA 3UM2A 2WXKA 4GZ5A 4A1GA 2X6IA 1UJJA 4G8KA 1N4SA 2F8YA 1P5QA 4EECA 3CHQA 4FA6A 1WG0A 1SW6A 1TN8A 1H6PA 1Z3YA 3CQCB 3SHFA 3UXGA 2XPIA 2ETCA 5KJKA 3LVRE 3EHRA 1WM5A 2LSUA 3KAEA 3ULQA 2IY0C 4AY6A 4JW1A 3FUJA 2XGMA 1INZA 1MX2A 1YA0A 4UQYA 3D9IA 5AQBA 2P9PG 5D0OD 2VTBA 1TJCA 4BESA 4N5QA 1IYGA 2Y4TA 4KZCA 2J09A 5JJ6A 3TWVA 4JEHA 5ENNA 4A1SA 3D9LA 3UM3A 3MEKA 3L16A 4RVBA 3VTYA 3CHOA 4U04A 1OUVA 3PNLB 2Y4UA 3FH7A 3SNXA 3ASHA 3KSQA 5HKPA 3NF1A 4BFRA 3CKBA 2M63A 3Q4AB 3W9GA 3TAXA 5BV1A 3L22A 3L54A 4ACLA 4WNDA 1DCQA 1KLXA 1OCCE 4PS7A 2J08A 3PNTB 1H2TC 2V5QC 3J5PA 3DPDA 4B8AA 3S7DA 1RZ4A 2BF0X 3CK7A 2LSVA 4J8FA 1V55E 5EILA 1H6KA 2FEZA 4TUUA 3ZXPA 4D10C 1JWFA 3SY2A 4IRUA 3FUKA 3JUEA 4ANXA 3RRUA 4J7WA 4G25A 5AQ7A 2HE0A 1TNYA 3ZYQA 2BUGA 5FQ8A 2IOLA 2R02A 1XNFA 5JJ7A 4OAUC 4I6JA 1TNBA 4J0UA 3URZA 1BI8B 4ILIA 2J9QA 2YHEA 1UN9A 3T8KA 4BT8A 4YDWA 4FU3A 4L9PA 3L17A 1KZOA 4BT9A 3ZN3A 1MYOA 4JXTA 4I2WA 2HYZA 4K0RA 2WXNA 3HG0D 5KJLA 4KT6B 1N4PA 2AXVA 3ZYLA 3LJ3A 4F7AA 2I9CA 2NXPA 3OXLA 4PH4B 1WY6A 3ZFWA 5EX3A 2UY1B 3FUIA 2VGYA 3LEWA 3TXNA 4APOA 5E76A 3C3OA 3FTXA 2WQHA 1WDYA 2GRPB 3SZ7A 3Q9NC 5AN8A 1N0QA 4LG6A 2FULA 2CG3A 3UTMA 3U9WA 3U3WA 3LY9A 2L0IA 2GW1A 3EJNA 4FJYA 5LX8A 2WMOA 2P9IG 4JD2G 3EU9A 3UINC 2L6BA 4FLHA 3ML8A 2WXPA 4NACA 3TJPA 3PZ2A 3UMVA 1LTXA 3B13A 3HXFA 5LCWJ 4J8SA 1X5BA 3FH8A 1O1RA 3KEZA 1OT8A 2VQ2A 2J8SD 2KZTA 3DSUA 3TWWA 4Q94A 1IHGA 4O1PA 2WXRA 2VGXA 2P2CP 2YHCA 2Y69E 3UI2A 4WNEA 4BSXA 1LF8A 5D0QD 3ZHEB 3QWPA 3HHMA 1GW6A 4HVBA 4JB8P 4MS6A 4LUNU 4I2ZA 1Q2ZA 3KS2A 1NL4A 4ANUA 4L1BA 2ZU6B 4Z68A 3SO8A 5AARA 2WB2A 2UY1A 3UKRG 4ME2A 4UI9C 3PVLA 2B0OE 3ZGQA 3RKVA 3PH0C 2WXGA 3FU0A 4GYWA 4AP2A 4KYOB 1WAO1 2WXOA 1N95A 3MYVA 3AG4E 4HFGA 3TWXA 4HS2A 2X6FA 4FADA 1S64A 4I1MA 1ZU2A 5FZRA 4AY5A 1E7VA 4TXPA 2VSYA 4YNDA 2A5UA 1KPSB 2YINA 2XPZA 5AAOA 2DCPA 1B89A 3UX4A 2AXZA 1N11A 4MLPA 3TL5A 4EBAG 2PQRA 4I9EA 4C0EA 5KBAA 4KVMA 4U96D 3FUEA 4AVXA 3ASGA 4XEIG 2WXFA 4PS3A 2WXJA 4CT4A 3FH5A 3ONLA 3ISMC 3W9FA 2F0YA 5CHEE 1DNPA 4H7XA 5T3RA 4L7TA 4WWPA 4K03A 3S7BA 3B95A 2XGOA 4GCNA 1IQRA 4HOSA 2YNQA 3ZHEA 2WQ6A 1N94A 2LXLA 4GZ6A 4EHMA 3Q7AA 4U0SA 5CBNA 1K3ZD 3R9AB 2PL2A 1BPOA 2V4LA 2GRQB 4J6IA 4RG9A 4U0ZA 4U07A 4XX5A 5B1AE 3SBTB 1PAQA 5JJTA 1D8EA 4EBAA 1S63A 3MA5A 4GPMA 2GROB 3HXCA 4URKA 1D8DA 4XZ4A 5AJDA 3WXXA 2C2LA 4M7CA 3E4BA 4XKBA 3CVUA 5EIBE 3PE4A 1H0AA 1JCQA 2KCVA 3ZYKA 5CCMA 3PDNA 4CGVA 4JHJA 1UN8A 4HI9A 1XGWA 2WMNA 2QZAA 3OAWA 3I5PA 5HS0A 1QNFA 2EILE 4Q69A 5B1BE 5AQ9A 3I3NA 2OCCE 5JA4D 5DBKA 2P9KG 3TXMA 3RRMB 5JHBA 5FWQA 2IOSA 2LUHA 4OVVA 2GGFA 5AIJA 1E7UA 2J4BA 3UM1A 1O1SA 1AWCB 4RQIA 2EIME 4CGWA 1LD7A 5JMND 5T8IA 2PZIA 4BEPA 4G8LA 4TXQA 3JYSA 3OXFA 4GMLA 1RW2A 2XRZA 4K5BA 4GA1A 5ENPD 3ASNE 3SFZA 3U66A 1HS6A 4DX7D 4ATZD 3CSTA 3HRAA 3AG1E 5CCLA 1EYHA 3RRNB 4BTAA 4RLYA 3RU0A 1L5JA 3LDZA 3S2AA 3ESKA 3MCXA 2JABA 5ARGA 2QYJA 3D9MA 4HB5A 2WXQA 4HRLA 1A17A 3GZ2A 4LERA 3FTZA 3JCKC 3UPVA 3LY7A 2MOWA 3G2UA 2KC7A 4MBGA 2Y0BG 5EX0A 5G04C 3CVNA 4IN3B 4G2VA 2WM9A 3DXKG 3ENEA 2AXUA 5FZSA 2GRLA 3MX3A 2IQCA 4DI4A 5EYPF 3ASFA 3DSSA 2FO1E 2DZOA 4GAAA 3QWVA 5KWDA 3D9OA 2HM8A 4GPKA 3DPYA 1V54E 4ATGA 3UT4A 2XCCA 5KJNA 3SI5A 3Q79A 2H6FA 5D2MC 3CK9A 3GW4A 3LPZA 4JC8A 2HR2A 5CEAA 2LNIA 3CHRA 1SA5A 4CT0A 3IXEA 3CVQA 5CMWA 2OEVA 3TWTA 4JA7A 3P2BA 4HORA 1TNUA 3TG5A 1TR4A 5BUZA 3U64A 3APDA 3ONKA 4O1OA 5FINA 3FU6A 3DXMG 3E30A 2A5EA 3Q49B 2WXHA 4UI9J 4HI8A 3EHNA 3IKOB 4YDEA 4JVSA 1AP7A 1DCEA 3FULA 4I17A 5HRYA 2RG8A 4TXRA 1HE8A 4HQDA 3FHEA 2R03A 4N3CA 3LS8A 4K5AB 4U63A 1MX6A 2CHXA 3ZVVA 3BG0B 5AENA 3QARA 5DIZA 2Y1LE 4RG6A 3Q5MA 3ZEFA 4BY6A 4I1AA 2PNNA 2DWZA 4FHKA 3N71A 3TG4A 4B94A 3O4ZA 4LNGA 5BW8C 3PEUB 4KZ0A 3MKQB 3D9KA 4BWRA 2KBXA 4ACKA 3ZUVB 2IO2C 2PQNA 4F6RD 2WXLA 2R05A 2XEHA 4GTTA 1UOHA 3TGOA 4OVUA 5CBOA 3AS5A 3PZDA 3C5RA 4CCAA 1MQSA 4HOTA 3MZLB 3D9HA 4FLBA 2ZISA 3VLEA 3QNKA 4B0ZA 3D3MA 4LEUA 5H7PA 2XZDG 1E8WA 2X38A 3BQOA 4DUIA 5LP0A 2WQ7A 4HRNA 3OTNA 5CECB 3WG7E 3DSVA 2ZXWE 2WVIA 2KCLA 2LAHA 1HH8A 1NFIE 4O60A 2XPYA 4JEUA 3EUVA 5KJMA 4I6EA 3PUKA 2RFAA 5J08A 4XI9A 4ZFHA 4K5CA 3CVXA 2WPVA 4LNUD 5AJLA 3ZU7B 4U7EB 4MRUA 2IF4A 2IJGX 2DVWA 3LKUA 3MJWA 3LY8A 2I1JA 1ZB1A 5AQAA 2EQXA 3EU5A 1OCZE 3I4GA 2C0LA 1JWGA 3MKQA 1QZ2A 3Q15A 4U8VD 4N3BA 4F3VA 4HRMB 4BTBA 3AS8A 3F6QA 4I43A 4UWHA 1S0PA 1FVHA 3QB2A 3D9JA 3SFYA 3IBEA 1ZBPA 2XCBA 3S7JA 2CFZA 1Z5SC 4GTPA 4UUCA 5BPPA 3AJIA 2P58C 4FP7A 4B89A 3ASOE 4NQ0A 2OVBA 4C0MA 5FZQA 3L13A 3B7BA 2LO6A 2XENA 3GZSA 4PDXA 1O1TA 5BV0A 2XZTG 4OYSA 4NIKA 4GTOA 3C3RA 2DIWA 3RIBA 3CHPA 5ARFA 1PC2A 4GMRA 3LJNA 1W3BA 4X8QA 3DBSA 4GTSA 5FIOA 1OWMA 3L6AA 4CDMA 1HU3A 1DVPA 1HXIA 4DX2A 3CVYA 2Y3AA 3NOGD 1FPPA 4L23A 5ENTD 2C0MA 3EIQC 3JXIA 2XS1A 4WUYA 3D9PA 1MHQA 2QFCA 3DSXA 1Z3XA 3CSFA 4F1PA 5G04J 4J8DA 2R2LA 4ILGA 1VDYA 2VSOE 3I4RB 4OAVB 1H6OA 4G24A 1SA4A 4R7LA 1TJFA 4TV3A 3RO3A 4B93B 2MHKA 3FTSA 3TWSA 3ZXSA 3TWUA 3UIPC 5LFAA 1OCRE 3ABME 1U2VG 1U3CA 3T8MA 1SQMA 2R5SA 4Q96A 2XS8A 3SGHA 2ZGGA 3DSWA 2IO3C 4XKCA 2OOEA 4AM9A 3VLDA 2MYOA 3LYAA 4I1OB 5ITZF 5CEDB 3KD7A 2XGSA 1HFAA 5BXOA 1OCOE 3HXDA 2J07A 3LVQE 3FDHA 1E96B 3CVVA 2XEEA 3K9IA 1MJ0A 4TRQA 2H6GA 4NURA 1Y6IA 4DX5D 2X6HA 5A6CA 3MV3B 4GZ3A 3CHMA 3FUMA 1FT1A 4G26A 3BEEA 3CR3A 4A55A 4AEZC 4DPRA 4DRXE 2XQ0A 4TUMA 3NZUA 4Y6WA 3S7FA 3NBNB 4N39A 1NA0A 3IV0A 4FHJA 5B3SE 3JQ0A 3JUIA 4RSYA 3Q73A 4EZLA 3DEPA 2IFUA 4MKTA 2F8XK 4UWGA 4WWOA 2P9NG 4YDYA 3QC1A 1ELWA 2QYUA 4DX6D 1PY1A 3LCAA 2BKGA 1FCHA 2V8SE 2UWJG 4JA9A 3PZ3A 3UQ3A 3VLFA 2V5FA 1BLXB 3FUFA 1K1AA 5CRUA 4GB9A 2PM6A 3R7RA 2GRRB 1E8ZA 1N0RA 3GZ1A 5A7DB 4WAFA 3DWLG 3QWWA 3FWVA 5FQ4A 1HZ4A 1BD8A 2R59A 4YVQC 4BX8A 3FUNA 3SD5A 3HXBA 1TN7A 2B6CA 2BKKB 4GYYA 3FTUA 4LRZA 4QFVA 2CFUA 2Q7FA 3SQVA 3QJZA 4F1SA 3EHMA 1EDUA 3FU5A 4GTRA 4EQFA 4XIFA 4HXIA 1H2VC 3APCA 3ULEG 3L82A 3UIOC 4GCOA 2XHEA 4HLEA 2VSNA 3UUXA 3E33A 5FTPA 2DZNA 4BX9A 4EZKA 1OWOA 1HG5A 3PRZA 5G05J 2J49A 4XI0A 2LAIA 4NRHB 3E34A 3IEGA 2CG2A 3BUAA 3BU8A 4APFA 3QAQA 3R9MA 2CHWA 3T5VA 5ENQD 2R17C 3R7QA 4IYPA 4DI3A 4GA0A 1OY3D 1TN6A 2YQ8A 4CDRA 2IU1A 1BI7B 3PEVB 4G11A 2BTDA 5BNWA 5CERB 1YYHA 3V2XA 3BG1B 5IY5E 2FI7A 4ANWA 4EPZA 3MGBA 3UT8A 1NA3A 4G1TA 2XEVA 3CVLA 5ENRD 4J8EA 4GTMA 1QYMA 3V31A 3FTWA 5LOZA 1YCSB 3CEQA 3ABKE 5CMYA 2GRNB 2OV8A 4GMJA 5EKQD 4HOUA 2FF4A 3ZPJA 1HF8A 4WWNA 3EDTB 4YVOA 1SZAA 1U3DA 2RFMA 4C9BB 1NZNA 2X6KA 1UJKA 5G2NA 1EF1C 1Y8MA 3U4TA 3DEOA 3IHVA 3ZYMA 1E8YA 3P1UA 4CEMA 2I6HA 5HI7A 2ZGDA 1IQUA 3QK0A 1K8KG 4WNGA 4GA2A 3CQGB 4H7YA 4HNAD 5JHAA 3G2TA 4JHKA 3AS4A 2DYRE 3EHQA 2NC9A 3UM0A 4LNBA 2NYJA 4U8YD 4N5CA 1KZPA 1N4RA 3MKRA 4U95D 1QBQA 3JXJA 1YMPA 4F53A 2PM7A 3AG3E 1SZ9A 4JL0A 5D66A 1OWLA 4AOFA 1LD8A 2VYIA 4V3IA 2KZTB 2WXIA 3RJVA 2VGXB 5T4YA 3ML9A 3CV0A 4C48B 2GRMA 3HXEA 1H2UA 4O6FA 3HDXA 2ETBA 2IEJA 3DSTA 4UQXA 2AW6A 3AG2E 2L0TB 3X2QE 1TNZA 2P9UG 5G55A 2RKKA 2I2OA 4U0UA 3UKUG 4KBQA 1MX4A 2JLBA 3E32A 2AVPA 3ULYA 3HYMB 4UI9K 5FJYA 1NI1A 2A4ZA 3ZRHA 5G05C 3FEXA 2EINE 3AAAC 4FC8A 3ASDA 3NZSA 4B8CB 4DJAA 4PUCA 5ENOD 4UWFA 4J8YA 4I6GA 1SVXA 3NAWA 5ENSD 3L9TA 1IKND 3V2OA 5C1DA 2DYSE 2J4DA 3G2SA 5KNGA 1MZCA 3MV2B 3IHYA 3Q75A 4WNFA 3L08A 2KXPC 2H6IA 2RD0A 3CKCA 2X6JA 5HQ8A 2KCKA 1IHBA 2XRYA 3RAUA 4AXHA 1TYQG 4CYMD 3C98A 4E85A 4EZJA 1JUQA 1Z6TA 3B7UX 4CZ2D 3D9NA 3Q78A 5EIDA 1G3NB 2EIJE 3Q7FA 2HO1A 2E2EA 4CRWA 4BERA 4ABNA 4N2QA 2AJAA 3PZ4A 2IONA 4GZCA 5ANRA 3NQPA 1UW4B 3G2VA 5A23A 4UQZA 4JZYA 3ESLA 5EN5D 1JCSA 4G23A 3EIJA 2QC9A 1EPUA 2EIKE 1OXJA 2AWIA 3QDNA 5AYWD 3V79K 2ILRA 3B7SA 2FBNA 1ELRA 4GYOA 3V30A 1KT0A 3ZNGA 2P9LG 3CVWA 4BETA 3C72A 3FTYA 3RSEG 1H19A 4HBDA 4GTQA 3ZKJA 3ABLE 3VTXA 3Q9UC 4DX1A 3FFLA 4IULA 3SFXA 3G2WA 1OWPA 5CRVA 2DBAA 1N52A 2V4HC 3NOCD 3AU4A 3TWQA 1E90A 5M72A 1HG2A 4L2YA 5C2YA 3FUHA 3T5XA 4GZDA 2WXMA 4BSZB 2VGEA 2ETAA 3FEYA 4GTVA 5FT9A 3SF4A 1JPLA 2OVFA 3FU3A 3APFA 2VJ8A 3RK6A 5FQ7A 1JCRA 4LCTA 3QOUA 1NP7A 4CDNA 2H6HA 1S70B 2NSZA 2BEDA 2V0PA 4LSZE 1DC2A 3FY4A 4ZHBA 1TEZA 2FO7A 2OEWA 1O5MA 4JHRA 2MRIA 1KT1A 1D9SA 4P29A 2JEKA 3GYZA 4HOQA 4A63B 3HIZA 2F37A 3PZ1A 2CHZA 4GU5A 3FP3A 4A3VA 3SBSA 2E0IA 5BT1A 3PE3A 1N54A 3HVEB 4N2SA 4AIFA 3B7RL 3KEAA 1HX8A 3RO2A 4M3OA 3TWRA 3LXUX 2P9SG 3T9KA 5J90A 4UWLA 4AV7A 4YDOA 1X81A 2KATA 5FQ6A 1QQEA 2VSXE 3FTVA 5ANLA 4XE0A 4W9RA 3NB2A 4AJWA 3OXGA 3DRAA 3CHSA 3CLJA 5LCWC 1UG3A 4KMOA 3CGHA 4UWKA 2KM4A 4Y6CA 3C3QA 4DLQA 3ZIMA 4HLLA 3J5QB 2ZIRA 4U8HA 2ONDA 5KNHD 1IXVA 4L2LA 4A3TA 4KVOA 3B7TA 3O48A 4ANVA 1N4QA 3Q47B 3CK8A 3KSLA 4DK5A 1FT2A 2VTBB 2L6JA 4FJZA 5BXUA 3PS6A 4I9CA 4DLOA 3UT7A 2X3MA 1HO8A 4N3AA 2L9BA 1OWNA 5EDSA 3FUDA 1BU9A 1A5EA 5E75A 5KCMA 1K1BA 3CVPA 1N9AA 3AU5A 2LXMA 3E37A 4JPSA 4E6HA 3QKYA 1E8XA 4ILHB 3PUJA 3HVEA 4QQIA 1FVFA 4PS8A 3JQ1A 1TNOA 4KXKB 2QY7A 3CIAA
chains in the Genus database with same CATH topology
5JHAA 3I4GA 3ZHEA 2C0LA 1JWGA 3G2TA 4JHKA 2WQ6A 3MKQA 1QZ2A 4FULA 3PREA 4GZ6A 1ELKA 4U0SA 3Q15A 3ZW3A 3AS4A 4N3BA 4F3VA 4BTBA 2I1KA 3AS8A 3R9AB 2NC9A 4I43A 4UWHA 2WXKA 2PL2A 1BPOA 2V4LA 4GZ5A 1S0PA 4J6IA 4RG9A 1FVHA 3QB2A 2X6IA 4A1GA 1UJJA 4U0ZA 3D9JA 4U07A 4XX5A 4N5CA 1P5QA 4EECA 3MKRA 3IBEA 3SBTB 1PAQA 3CHQA 5JJTA 4EBAA 4F53A 4FA6A 2PM7A 1SZ9A 4JL0A 1ZBPA 2XCBA 1OWLA 3S7JA 2CFZA 3MA5A 4AOFA 2VYIA 4V3IA 4URKA 2KZTB 5BPPA 1Z3YA 2P58C 4FP7A 3CQCB 3SHFA 2WXIA 4XZ4A 5AJDA 4B89A 3WXXA 2XPIA 5KJKA 3LVRE 4NQ0A 1WM5A 3RJVA 2C2LA 2OVBA 2LSUA 2VGXB 3KAEA 5T4YA 3E4BA 4XKBA 4C0MA 5FZQA 3ULQA 3ML9A 3CVUA 3CV0A 4AY6A 3PE4A 1H0AA 3L13A 4JW1A 2GRMA 2LO6A 1H2UA 3FUJA 4O6FA 2KCVA 3HDXA 2XGMA 3ZYKA 5CCMA 1INZA 3PDNA 4CGVA 3GZSA 4JHJA 1YA0A 4PDXA 1UN8A 4UQYA 1XGWA 5BV0A 4OYSA 3D9IA 2WMNA 4UQXA 2AW6A 5D0OD 2DIWA 2VTBA 2L0TB 1TJCA 3RIBA 3CHPA 5ARFA 1PC2A 5G55A 3OAWA 1IYGA 2Y4TA 2I2OA 3I5PA 4KZCA 4U0UA 1W3BA 1QNFA 2J09A 5JJ6A 4Q69A 3DBSA 1OWMA 4JEHA 4KBQA 5ENNA 4A1SA 3D9LA 3I3NA 3L6AA 4CDMA 1HU3A 2JLBA 5DBKA 2AVPA 3MEKA 3TXMA 1DVPA 3L16A 4RVBA 3HYMB 4UI9K 5FJYA 1HXIA 3RRMB 5JHBA 3CVYA 5FWQA 2IOSA 2Y3AA 2A4ZA 3VTYA 3CHOA 4L23A 4U04A 1OUVA 3ZRHA 3PNLB 2Y4UA 3FH7A 5G05C 3FEXA 4OVVA 2GGFA 3SNXA 3ASHA 4FC8A 3ASDA 3NF1A 4BFRA 2C0MA 3NZSA 3CKBA 2M63A 3EIQC 3Q4AB 4PUCA 5BW8C 3TAXA 4B8CB 4DJAA 5BV1A 4UWFA 3L22A 3L54A 4I6GA 4WUYA 5AIJA 4ACLA 3D9PA 4WNDA 1KLXA 1MHQA 1E7UA 2QFCA 2J4BA 4PS7A 1Z3XA 3CSFA 2J08A 5C1DA 3PNTB 4CGWA 1H2TC 2J4DA 5G04J 3G2SA 5T8IA 4J8DA 2PZIA 3DPDA 3MV2B 4ILGA 1VDYA 2VSOE 3I4RB 3IHYA 4B8AA 3S7DA 4G24A 4WNFA 4R7LA 3JYSA 3OXFA 4GMLA 3L08A 2BF0X 1TJFA 2RD0A 3CK7A 3CKCA 2XRZA 4TV3A 2X6JA 3RO3A 5HQ8A 2KCKA 2MHKA 2LSVA 3FTSA 4GA1A 4J8FA 3SFZA 2XRYA 3ZXSA 3U66A 5LFAA 1HS6A 1H6KA 2FEZA 4TUUA 4AXHA 3CSTA 3C98A 4D10C 4E85A 1U3CA 1JWFA 4EZJA 3T8MA 5CCLA 4IRUA 1EYHA 1SQMA 3FUKA 3RRNB 1JUQA 4ANXA 4BTAA 2R5SA 1Z6TA 3RU0A 1L5JA 3LDZA 3RRUA 3B7UX 4Q96A 3SGHA 4G25A 3D9NA 3S2AA 3ZYQA 4XKCA 2OOEA 3ESKA 2BUGA 4AM9A 3MCXA 2HO1A 2E2EA 5FQ8A 4CRWA 5ARGA 3VLDA 4ABNA 2IOLA 3D9MA 4N2QA 3LYAA 1XNFA 5JJ7A 4I1OB 4I6JA 3KD7A 4J0UA 2XGSA 3URZA 2WXQA 2IONA 4GZCA 1HFAA 5ANRA 1A17A 3NQPA 1UW4B 3GZ2A 2J07A 3LVQE 4LERA 4ILIA 2J9QA 3G2VA 3FTZA 4UQZA 5A23A 2YHEA 1UN9A 3FDHA 3JCKC 1E96B 3ESLA 4JZYA 4G23A 3EIJA 3UPVA 3LY7A 1EPUA 4BT8A 2MOWA 3CVVA 3G2UA 2KC7A 5EX0A 5G04C 3K9IA 4TRQA 2AWIA 3CVNA 4NURA 1Y6IA 4IN3B 4G2VA 2WM9A 2X6HA 3ENEA 2AXUA 4FU3A 5FZSA 2GRLA 3QDNA 5A6CA 3MV3B 5AYWD 3MX3A 4GZ3A 3CHMA 3L17A 4BT9A 2IQCA 4DI4A 2ILRA 3B7SA 2FBNA 3ZN3A 1ELRA 3ASFA 3FUMA 4GYOA 4JXTA 4I2WA 1KT0A 2HYZA 3QWVA 4GAAA 4K0RA 4G26A 3BEEA 3CR3A 4A55A 4AEZC 2WXNA 3D9OA 4DPRA 3CVWA 5KJLA 2HM8A 4KT6B 4GPKA 2XQ0A 2AXVA 3ZYLA 3LJ3A 3NZUA 4Y6WA 3S7FA 4F7AA 2I9CA 4N39A 1NA0A 3FTYA 4ATGA 3UT4A 2XCCA 3IV0A 4FHJA 5KJNA 3SI5A 3JQ0A 2NXPA 3JUIA 1H19A 4RSYA 3CK9A 3GW4A 3OXLA 4PH4B 1WY6A 3ZFWA 5EX3A 3VTXA 2UY1B 4EZLA 3FUIA 2VGYA 2IFUA 3FFLA 4MKTA 3LEWA 3LPZA 4UWGA 4IULA 3TXNA 3G2WA 4APOA 1OWPA 4JC8A 2HR2A 2DBAA 1N52A 4WWOA 2LNIA 5E76A 3AU4A 3CHRA 3FTXA 1E90A 2WQHA 5M72A 1HG2A 4L2YA 3SZ7A 5C2YA 4CT0A 3QC1A 1ELWA 3FUHA 3CVQA 1PY1A 3LCAA 3T5XA 2FULA 5CMWA 1FCHA 4GZDA 2WXMA 2V8SE 2UWJG 2CG3A 4JA7A 3U9WA 3P2BA 4JA9A 4HORA 3U3WA 3TG5A 5BUZA 3U64A 3APDA 3ONKA 3FEYA 3LY9A 2L0IA 2GW1A 3EJNA 4FJYA 5FT9A 3SF4A 1JPLA 2OVFA 3FU3A 5LX8A 3APFA 2WMOA 2VJ8A 3UQ3A 3VLFA 3RK6A 5FQ7A 2V5FA 3FU6A 3FUFA 4LCTA 3QOUA 4GB9A 2PM6A 1NP7A 3R7RA 4CDNA 1E8ZA 3GZ1A 2NSZA 3Q49B 2V0PA 5A7DB 4WAFA 3QWWA 3FWVA 5FQ4A 2WXHA 4UI9J 4FLHA 1HZ4A 2WXPA 2R59A 3ML8A 4NACA 3FY4A 3EHNA 1TEZA 3IKOB 4YVQC 4BX8A 2FO7A 3FUNA 3SD5A 4JHRA 3TJPA 4JVSA 2MRIA 3UMVA 1KT1A 3B13A 3FULA 4I17A 5LCWJ 2RG8A 4P29A 1HE8A 4GYYA 4J8SA 2JEKA 3FHEA 1X5BA 3FTUA 3GYZA 4HOQA 2CFUA 3HIZA 2Q7FA 4LRZA 4QFVA 2CHZA 4N3CA 3QJZA 3FH8A 3LS8A 4F1SA 3KEZA 3EHMA 1EDUA 4U63A 2VQ2A 2KZTA 2CHXA 4Q94A 3ZVVA 4GU5A 3FU5A 4EQFA 3BG0B 1IHGA 3FP3A 3SBSA 4A3VA 5AENA 4XIFA 2E0IA 4HXIA 5BT1A 1H2VC 2WXRA 3APCA 3QARA 5DIZA 3PE3A 1N54A 2VGXA 4RG6A 3Q5MA 3ZEFA 4BY6A 2YHCA 4I1AA 3HVEB 4FHKA 4GCOA 4N2SA 2XHEA 4HLEA 4WNEA 4BSXA 2VSNA 3N71A 3UUXA 4AIFA 3TG4A 1LF8A 5D0QD 4B94A 3B7RL 3O4ZA 5FTPA 4BX9A 4EZKA 1HX8A 4KXKB 1OWOA 3RO2A 4M3OA 3LXUX 3ZHEB 3QWPA 3HHMA 1HG5A 3PEUB 1GW6A 3PRZA 4KZ0A 3MKQB 5G05J 2J49A 4XI0A 2LAIA 4NRHB 4HVBA 3D9KA 4MS6A 3IEGA 4LUNU 4UWLA 5J90A 2CG2A 4AV7A 4BWRA 4ACKA 2KATA 4I2ZA 5FQ6A 4APFA 3KS2A 3QAQA 2CHWA 2PQNA 1QQEA 2VSXE 3T5VA 4ANUA 2R17C 4L1BA 3R7QA 2ZU6B 2WXLA 4IYPA 4DI3A 4GA0A 3FTVA 2WB2A 5ANLA 2UY1A 2YQ8A 4ME2A 4XE0A 4W9RA 4UI9C 3PVLA 4CDRA 2IU1A 4AJWA 3TGOA 3OXGA 3ZGQA 4OVUA 3PEVB 4G11A 2BTDA 3AS5A 3RKVA 3PH0C 3PZDA 2WXGA 3CHSA 5BNWA 3FU0A 3CLJA 4GYWA 4CCAA 5LCWC 1UG3A 4AP2A 1MQSA 4KYOB 4KMOA 3CGHA 4HOTA 3MZLB 4UWKA 3BG1B 2KM4A 4Y6CA 1WAO1 2FI7A 2WXOA 4FLBA 3ZIMA 4ANWA 4DLQA 3MYVA 3VLEA 4EPZA 4HFGA 3QNKA 3MGBA 3UT8A 1NA3A 4G1TA 4HS2A 2X6FA 2XEVA 4U8HA 2ONDA 4FADA 3CVLA 4I1MA 4B0ZA 1ZU2A 4L2LA 3D3MA 4LEUA 4KVOA 5FZRA 4A3TA 4J8EA 4AY5A 1E8WA 2X38A 1E7VA 3B7TA 3O48A 2VSYA 4ANVA 5LP0A 3Q47B 2WQ7A 4YNDA 3FTWA 3CK8A 2A5UA 4DK5A 3OTNA 3CEQA 5LOZA 2VTBB 5CMYA 2YINA 2XPZA 2L6JA 2DCPA 2OV8A 1B89A 4GMJA 2WVIA 4FJZA 5EKQD 3UX4A 3PS6A 2AXZA 4HOUA 2KCLA 2LAHA 1HH8A 4MLPA 4I9CA 2XPYA 2FF4A 3TL5A 3UT7A 4DLOA 4JEUA 3ZPJA 2X3MA 1HO8A 5KJMA 4I6EA 1HF8A 3PUKA 4N3AA 3EDTB 4WWNA 4YVOA 4EBAG 2L9BA 1OWNA 5J08A 4XI9A 2PQRA 4I9EA 5EDSA 3FUDA 1SZAA 4C0EA 3CVXA 1U3DA 4KVMA 4C9BB 3FUEA 4AVXA 1NZNA 2X6KA 2WPVA 5E75A 1UJKA 5G2NA 5AJLA 3ASGA 5KCMA 1EF1C 2WXFA 1Y8MA 3U4TA 4PS3A 2WXJA 3CVPA 4CT4A 4MRUA 3AU5A 3IHVA 3FH5A 3ONLA 3ZYMA 1E8YA 2IF4A 2IJGX 3P1UA 5CHEE 4JPSA 4E6HA 3QKYA 3LKUA 1DNPA 3LY8A 3MJWA 1E8XA 4H7XA 4ILHB 2I1JA 4L7TA 5T3RA 4CEMA 3PUJA 2I6HA 3HVEA 1FVFA 4WWPA 4K03A 2EQXA 5HI7A 1IQUA 3S7BA 3QK0A 4PS8A 2XGOA 4GCNA 4WNGA 1IQRA 4HOSA 4GA2A 3CQGB 3JQ1A 4H7YA 2YNQA 2QY7A 3CIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZHE A;  2C0L A;  4GZ6 A;  1QZ2 A;  4U0S A;  3Q15 A;  3AS4 A;  4N3B A;  4F3V A;  4BTB A;  3AS8 A;  3R9A B;  2NC9 A;  4GZ5 A;  2PL2 A;  4RG9 A;  4U0Z A;  4U07 A;  4N5C A;  1P5Q A;  3MKR A;  5JJT A;  4JL0 A;  1ZBP A;  2XCB A;  3S7J A;  3MA5 A;  2VYI A;  2P58 C;  3WXX A;  2XPI A;  5KJK A;  4NQ0 A;  1WM5 A;  3RJV A;  2C2L A;  2LSU A;  2VGX B;  3KAE A;  3E4B A;  5FZQ A;  3ULQ A;  3CV0 A;  4AY6 A;  3PE4 A;  4O6F A;  2KCV A;  5CCM A;  2XGM A;  3PDN A;  4CGV A;  1YA0 A;  4UQY A;  4UQX A;  5D0O D;  1TJC A;  3RIB A;  5ARF A;  1PC2 A;  1IYG A;  2Y4T A;  4U0U A;  1W3B A;  5JJ6 A;  4KBQ A;  4A1S A;  2JLB A;  5DBK A;  2AVP A;  3MEK A;  3HYM B;  4UI9 K;  5FJY A;  1HXI A;  3VTY A;  4U04 A;  1OUV A;  2Y4U A;  5G05 C;  3ASH A;  3ASD A;  3NF1 A;  2C0M A;  3CKB A;  3Q4A B;  3TAX A;  4WUY A;  4WND A;  1KLX A;  2QFC A;  5C1D A;  4CGW A;  5G04 J;  4J8D A;  2PZI A;  3MV2 B;  3S7D A;  4G24 A;  4WNF A;  3JYS A;  3OXF A;  3CK7 A;  3CKC A;  3RO3 A;  5HQ8 A;  2KCK A;  2MHK A;  2LSV A;  4GA1 A;  4J8F A;  2FEZ A;  5CCL A;  4BTA A;  2R5S A;  3RU0 A;  4G25 A;  2OOE A;  3ESK A;  2BUG A;  4AM9 A;  2HO1 A;  2E2E A;  5ARG A;  4ABN A;  4N2Q A;  3LYA A;  1XNF A;  5JJ7 A;  3KD7 A;  4J0U A;  2XGS A;  3URZ A;  1A17 A;  3GZ2 A;  2J9Q A;  4UQZ A;  1E96 B;  4G23 A;  3UPV A;  3LY7 A;  4BT8 A;  2KC7 A;  5EX0 A;  5G04 C;  3K9I A;  3CVN A;  4IN3 B;  4G2V A;  5FZS A;  3QDN A;  5A6C A;  3MV3 B;  5AYW D;  4GZ3 A;  4BT9 A;  2FBN A;  3ZN3 A;  1ELR A;  3ASF A;  4GYO A;  4I2W A;  1KT0 A;  2HYZ A;  3QWV A;  4G26 A;  3BEE A;  5KJL A;  4GPK A;  4Y6W A;  3S7F A;  4N39 A;  1NA0 A;  2XCC A;  5KJN A;  3CK9 A;  3GW4 A;  3OXL A;  3ZFW A;  5EX3 A;  3VTX A;  2UY1 B;  2VGY A;  2IFU A;  3FFL A;  3LPZ A;  4APO A;  2HR2 A;  2DBA A;  2LNI A;  2WQH A;  5M72 A;  3SZ7 A;  1ELW A;  3CVQ A;  3LCA A;  1FCH A;  2UWJ G;  4JA7 A;  4JA9 A;  4HOR A;  3U3W A;  3TG5 A;  3LY9 A;  2GW1 A;  5FT9 A;  3SF4 A;  3UQ3 A;  2V5F A;  3QOU A;  3GZ1 A;  3Q49 B;  5A7D B;  3QWW A;  3FWV A;  4UI9 J;  1HZ4 A;  4YVQ C;  2FO7 A;  4JHR A;  1KT1 A;  4I17 A;  5LCW J;  4GYY A;  3GYZ A;  4HOQ A;  2Q7F A;  4N3C A;  2VQ2 A;  4EQF A;  3FP3 A;  1IHG A;  4XIF A;  5BT1 A;  5DIZ A;  3PE3 A;  2VGX A;  4RG6 A;  3Q5M A;  2YHC A;  4I1A A;  4GCO A;  4N2S A;  4WNE A;  2VSN A;  4AIF A;  3UUX A;  3N71 A;  4B94 A;  3TG4 A;  5D0Q D;  5FTP A;  3RO2 A;  3ZHE B;  3QWP A;  5BW8 C;  5G05 J;  4XI0 A;  4NRH B;  3IEG A;  4BWR A;  2KAT A;  4I2Z A;  3KS2 A;  2PQN A;  1QQE A;  4GA0 A;  2UY1 A;  2YQ8 A;  4ME2 A;  4W9R A;  4UI9 C;  4CDR A;  3TGO A;  3OXG A;  3ZGQ A;  3AS5 A;  3RKV A;  5BNW A;  4GYW A;  5LCW C;  4KYO B;  4HOT A;  4Y6C A;  1WAO 1;  2FI7 A;  1NA3 A;  4G1T A;  2XEV A;  2OND A;  3CVL A;  1ZU2 A;  4LEU A;  5FZR A;  4J8E A;  4AY5 A;  3O48 A;  2VSY A;  3Q47 B;  4YND A;  3CK8 A;  3CEQ A;  2L6J A;  1B89 A;  5EKQ D;  4HOU A;  2KCL A;  1HH8 A;  4I9C A;  2FF4 A;  3ZPJ A;  5KJM A;  4N3A A;  3EDT B;  4YVO A;  4XI9 A;  2PQR A;  4I9E A;  1NZN A;  2WPV A;  3ASG A;  1Y8M A;  3U4T A;  3CVP A;  2IF4 A;  5CHE E;  3QKY A;  3LKU A;  3LY8 A;  4H7X A;  2I6H A;  5HI7 A;  3S7B A;  2XGO A;  4GCN A;  4WNG A;  4HOS A;  4GA2 A;  4H7Y A;  4KXK B; 
#chains in the Genus database with same CATH topology
 5EYL A;  4FUL A;  3PRE A;  1ELK A;  3ZW3 A;  2I1K A;  3UM2 A;  2WXK A;  4GZ5 A;  4A1G A;  2X6I A;  1UJJ A;  4G8K A;  1N4S A;  2F8Y A;  1P5Q A;  4EEC A;  3CHQ A;  4FA6 A;  1WG0 A;  1SW6 A;  1TN8 A;  1H6P A;  1Z3Y A;  3CQC B;  3SHF A;  3UXG A;  2XPI A;  2ETC A;  5KJK A;  3LVR E;  3EHR A;  1WM5 A;  2LSU A;  3KAE A;  3ULQ A;  2IY0 C;  4AY6 A;  4JW1 A;  3FUJ A;  2XGM A;  1INZ A;  1MX2 A;  1YA0 A;  4UQY A;  3D9I A;  5AQB A;  2P9P G;  5D0O D;  2VTB A;  1TJC A;  4BES A;  4N5Q A;  1IYG A;  2Y4T A;  4KZC A;  2J09 A;  5JJ6 A;  3TWV A;  4JEH A;  5ENN A;  4A1S A;  3D9L A;  3UM3 A;  3MEK A;  3L16 A;  4RVB A;  3VTY A;  3CHO A;  4U04 A;  1OUV A;  3PNL B;  2Y4U A;  3FH7 A;  3SNX A;  3ASH A;  3KSQ A;  5HKP A;  3NF1 A;  4BFR A;  3CKB A;  2M63 A;  3Q4A B;  3W9G A;  3TAX A;  5BV1 A;  3L22 A;  3L54 A;  4ACL A;  4WND A;  1DCQ A;  1KLX A;  1OCC E;  4PS7 A;  2J08 A;  3PNT B;  1H2T C;  2V5Q C;  3J5P A;  3DPD A;  4B8A A;  3S7D A;  1RZ4 A;  2BF0 X;  3CK7 A;  2LSV A;  4J8F A;  1V55 E;  5EIL A;  1H6K A;  2FEZ A;  4TUU A;  3ZXP A;  4D10 C;  1JWF A;  3SY2 A;  4IRU A;  3FUK A;  3JUE A;  4ANX A;  3RRU A;  4J7W A;  4G25 A;  5AQ7 A;  2HE0 A;  1TNY A;  3ZYQ A;  2BUG A;  5FQ8 A;  2IOL A;  2R02 A;  1XNF A;  5JJ7 A;  4OAU C;  4I6J A;  1TNB A;  4J0U A;  3URZ A;  1BI8 B;  4ILI A;  2J9Q A;  2YHE A;  1UN9 A;  3T8K A;  4BT8 A;  4YDW A;  4FU3 A;  4L9P A;  3L17 A;  1KZO A;  4BT9 A;  3ZN3 A;  1MYO A;  4JXT A;  4I2W A;  2HYZ A;  4K0R A;  2WXN A;  3HG0 D;  5KJL A;  4KT6 B;  1N4P A;  2AXV A;  3ZYL A;  3LJ3 A;  4F7A A;  2I9C A;  2NXP A;  3OXL A;  4PH4 B;  1WY6 A;  3ZFW A;  5EX3 A;  2UY1 B;  3FUI A;  2VGY A;  3LEW A;  3TXN A;  4APO A;  5E76 A;  3C3O A;  3FTX A;  2WQH A;  1WDY A;  2GRP B;  3SZ7 A;  3Q9N C;  5AN8 A;  1N0Q A;  4LG6 A;  2FUL A;  2CG3 A;  3UTM A;  3U9W A;  3U3W A;  3LY9 A;  2L0I A;  2GW1 A;  3EJN A;  4FJY A;  5LX8 A;  2WMO A;  2P9I G;  4JD2 G;  3EU9 A;  3UIN C;  2L6B A;  4FLH A;  3ML8 A;  2WXP A;  4NAC A;  3TJP A;  3PZ2 A;  3UMV A;  1LTX A;  3B13 A;  3HXF A;  5LCW J;  4J8S A;  1X5B A;  3FH8 A;  1O1R A;  3KEZ A;  1OT8 A;  2VQ2 A;  2J8S D;  2KZT A;  3DSU A;  3TWW A;  4Q94 A;  1IHG A;  4O1P A;  2WXR A;  2VGX A;  2P2C P;  2YHC A;  2Y69 E;  3UI2 A;  4WNE A;  4BSX A;  1LF8 A;  5D0Q D;  3ZHE B;  3QWP A;  3HHM A;  1GW6 A;  4HVB A;  4JB8 P;  4MS6 A;  4LUN U;  4I2Z A;  1Q2Z A;  3KS2 A;  1NL4 A;  4ANU A;  4L1B A;  2ZU6 B;  4Z68 A;  3SO8 A;  5AAR A;  2WB2 A;  2UY1 A;  3UKR G;  4ME2 A;  4UI9 C;  3PVL A;  2B0O E;  3ZGQ A;  3RKV A;  3PH0 C;  2WXG A;  3FU0 A;  4GYW A;  4AP2 A;  4KYO B;  1WAO 1;  2WXO A;  1N95 A;  3MYV A;  3AG4 E;  4HFG A;  3TWX A;  4HS2 A;  2X6F A;  4FAD A;  1S64 A;  4I1M A;  1ZU2 A;  5FZR A;  4AY5 A;  1E7V A;  4TXP A;  2VSY A;  4YND A;  2A5U A;  1KPS B;  2YIN A;  2XPZ A;  5AAO A;  2DCP A;  1B89 A;  3UX4 A;  2AXZ A;  1N11 A;  4MLP A;  3TL5 A;  4EBA G;  2PQR A;  4I9E A;  4C0E A;  5KBA A;  4KVM A;  4U96 D;  3FUE A;  4AVX A;  3ASG A;  4XEI G;  2WXF A;  4PS3 A;  2WXJ A;  4CT4 A;  3FH5 A;  3ONL A;  3ISM C;  3W9F A;  2F0Y A;  5CHE E;  1DNP A;  4H7X A;  5T3R A;  4L7T A;  4WWP A;  4K03 A;  3S7B A;  3B95 A;  2XGO A;  4GCN A;  1IQR A;  4HOS A;  2YNQ A;  3ZHE A;  2WQ6 A;  1N94 A;  2LXL A;  4GZ6 A;  4EHM A;  3Q7A A;  4U0S A;  5CBN A;  1K3Z D;  3R9A B;  2PL2 A;  1BPO A;  2V4L A;  2GRQ B;  4J6I A;  4RG9 A;  4U0Z A;  4U07 A;  4XX5 A;  5B1A E;  3SBT B;  1PAQ A;  5JJT A;  1D8E A;  4EBA A;  1S63 A;  3MA5 A;  4GPM A;  2GRO B;  3HXC A;  4URK A;  1D8D A;  4XZ4 A;  5AJD A;  3WXX A;  2C2L A;  4M7C A;  3E4B A;  4XKB A;  3CVU A;  5EIB E;  3PE4 A;  1H0A A;  1JCQ A;  2KCV A;  3ZYK A;  5CCM A;  3PDN A;  4CGV A;  4JHJ A;  1UN8 A;  4HI9 A;  1XGW A;  2WMN A;  2QZA A;  3OAW A;  3I5P A;  5HS0 A;  1QNF A;  2EIL E;  4Q69 A;  5B1B E;  5AQ9 A;  3I3N A;  2OCC E;  5JA4 D;  5DBK A;  2P9K G;  3TXM A;  3RRM B;  5JHB A;  5FWQ A;  2IOS A;  2LUH A;  4OVV A;  2GGF A;  5AIJ A;  1E7U A;  2J4B A;  3UM1 A;  1O1S A;  1AWC B;  4RQI A;  2EIM E;  4CGW A;  1LD7 A;  5JMN D;  5T8I A;  2PZI A;  4BEP A;  4G8L A;  4TXQ A;  3JYS A;  3OXF A;  4GML A;  1RW2 A;  2XRZ A;  4K5B A;  4GA1 A;  5ENP D;  3ASN E;  3SFZ A;  3U66 A;  1HS6 A;  4DX7 D;  4ATZ D;  3CST A;  3HRA A;  3AG1 E;  5CCL A;  1EYH A;  3RRN B;  4BTA A;  4RLY A;  3RU0 A;  1L5J A;  3LDZ A;  3S2A A;  3ESK A;  3MCX A;  2JAB A;  5ARG A;  2QYJ A;  3D9M A;  4HB5 A;  2WXQ A;  4HRL A;  1A17 A;  3GZ2 A;  4LER A;  3FTZ A;  3JCK C;  3UPV A;  3LY7 A;  2MOW A;  3G2U A;  2KC7 A;  4MBG A;  2Y0B G;  5EX0 A;  5G04 C;  3CVN A;  4IN3 B;  4G2V A;  2WM9 A;  3DXK G;  3ENE A;  2AXU A;  5FZS A;  2GRL A;  3MX3 A;  2IQC A;  4DI4 A;  5EYP F;  3ASF A;  3DSS A;  2FO1 E;  2DZO A;  4GAA A;  3QWV A;  5KWD A;  3D9O A;  2HM8 A;  4GPK A;  3DPY A;  1V54 E;  4ATG A;  3UT4 A;  2XCC A;  5KJN A;  3SI5 A;  3Q79 A;  2H6F A;  5D2M C;  3CK9 A;  3GW4 A;  3LPZ A;  4JC8 A;  2HR2 A;  5CEA A;  2LNI A;  3CHR A;  1SA5 A;  4CT0 A;  3IXE A;  3CVQ A;  5CMW A;  2OEV A;  3TWT A;  4JA7 A;  3P2B A;  4HOR A;  1TNU A;  3TG5 A;  1TR4 A;  5BUZ A;  3U64 A;  3APD A;  3ONK A;  4O1O A;  5FIN A;  3FU6 A;  3DXM G;  3E30 A;  2A5E A;  3Q49 B;  2WXH A;  4UI9 J;  4HI8 A;  3EHN A;  3IKO B;  4YDE A;  4JVS A;  1AP7 A;  1DCE A;  3FUL A;  4I17 A;  5HRY A;  2RG8 A;  4TXR A;  1HE8 A;  4HQD A;  3FHE A;  2R03 A;  4N3C A;  3LS8 A;  4K5A B;  4U63 A;  1MX6 A;  2CHX A;  3ZVV A;  3BG0 B;  5AEN A;  3QAR A;  5DIZ A;  2Y1L E;  4RG6 A;  3Q5M A;  3ZEF A;  4BY6 A;  4I1A A;  2PNN A;  2DWZ A;  4FHK A;  3N71 A;  3TG4 A;  4B94 A;  3O4Z A;  4LNG A;  5BW8 C;  3PEU B;  4KZ0 A;  3MKQ B;  3D9K A;  4BWR A;  2KBX A;  4ACK A;  3ZUV B;  2IO2 C;  2PQN A;  4F6R D;  2WXL A;  2R05 A;  2XEH A;  4GTT A;  1UOH A;  3TGO A;  4OVU A;  5CBO A;  3AS5 A;  3PZD A;  3C5R A;  4CCA A;  1MQS A;  4HOT A;  3MZL B;  3D9H A;  4FLB A;  2ZIS A;  3VLE A;  3QNK A;  4B0Z A;  3D3M A;  4LEU A;  5H7P A;  2XZD G;  1E8W A;  2X38 A;  3BQO A;  4DUI A;  5LP0 A;  2WQ7 A;  4HRN A;  3OTN A;  5CEC B;  3WG7 E;  3DSV A;  2ZXW E;  2WVI A;  2KCL A;  2LAH A;  1HH8 A;  1NFI E;  4O60 A;  2XPY A;  4JEU A;  3EUV A;  5KJM A;  4I6E A;  3PUK A;  2RFA A;  5J08 A;  4XI9 A;  4ZFH A;  4K5C A;  3CVX A;  2WPV A;  4LNU D;  5AJL A;  3ZU7 B;  4U7E B;  4MRU A;  2IF4 A;  2IJG X;  2DVW A;  3LKU A;  3MJW A;  3LY8 A;  2I1J A;  1ZB1 A;  5AQA A;  2EQX A;  3EU5 A;  1OCZ E;  3I4G A;  2C0L A;  1JWG A;  3MKQ A;  1QZ2 A;  3Q15 A;  4U8V D;  4N3B A;  4F3V A;  4HRM B;  4BTB A;  3AS8 A;  3F6Q A;  4I43 A;  4UWH A;  1S0P A;  1FVH A;  3QB2 A;  3D9J A;  3SFY A;  3IBE A;  1ZBP A;  2XCB A;  3S7J A;  2CFZ A;  1Z5S C;  4GTP A;  4UUC A;  5BPP A;  3AJI A;  2P58 C;  4FP7 A;  4B89 A;  3ASO E;  4NQ0 A;  2OVB A;  4C0M A;  5FZQ A;  3L13 A;  3B7B A;  2LO6 A;  2XEN A;  3GZS A;  4PDX A;  1O1T A;  5BV0 A;  2XZT G;  4OYS A;  4NIK A;  4GTO A;  3C3R A;  2DIW A;  3RIB A;  3CHP A;  5ARF A;  1PC2 A;  4GMR A;  3LJN A;  1W3B A;  4X8Q A;  3DBS A;  4GTS A;  5FIO A;  1OWM A;  3L6A A;  4CDM A;  1HU3 A;  1DVP A;  1HXI A;  4DX2 A;  3CVY A;  2Y3A A;  3NOG D;  1FPP A;  4L23 A;  5ENT D;  2C0M A;  3EIQ C;  3JXI A;  2XS1 A;  4WUY A;  3D9P A;  1MHQ A;  2QFC A;  3DSX A;  1Z3X A;  3CSF A;  4F1P A;  5G04 J;  4J8D A;  2R2L A;  4ILG A;  1VDY A;  2VSO E;  3I4R B;  4OAV B;  1H6O A;  4G24 A;  1SA4 A;  4R7L A;  1TJF A;  4TV3 A;  3RO3 A;  4B93 B;  2MHK A;  3FTS A;  3TWS A;  3ZXS A;  3TWU A;  3UIP C;  5LFA A;  1OCR E;  3ABM E;  1U2V G;  1U3C A;  3T8M A;  1SQM A;  2R5S A;  4Q96 A;  2XS8 A;  3SGH A;  2ZGG A;  3DSW A;  2IO3 C;  4XKC A;  2OOE A;  4AM9 A;  3VLD A;  2MYO A;  3LYA A;  4I1O B;  5ITZ F;  5CED B;  3KD7 A;  2XGS A;  1HFA A;  5BXO A;  1OCO E;  3HXD A;  2J07 A;  3LVQ E;  3FDH A;  1E96 B;  3CVV A;  2XEE A;  3K9I A;  1MJ0 A;  4TRQ A;  2H6G A;  4NUR A;  1Y6I A;  4DX5 D;  2X6H A;  5A6C A;  3MV3 B;  4GZ3 A;  3CHM A;  3FUM A;  1FT1 A;  4G26 A;  3BEE A;  3CR3 A;  4A55 A;  4AEZ C;  4DPR A;  4DRX E;  2XQ0 A;  4TUM A;  3NZU A;  4Y6W A;  3S7F A;  3NBN B;  4N39 A;  1NA0 A;  3IV0 A;  4FHJ A;  5B3S E;  3JQ0 A;  3JUI A;  4RSY A;  3Q73 A;  4EZL A;  3DEP A;  2IFU A;  4MKT A;  2F8X K;  4UWG A;  4WWO A;  2P9N G;  4YDY A;  3QC1 A;  1ELW A;  2QYU A;  4DX6 D;  1PY1 A;  3LCA A;  2BKG A;  1FCH A;  2V8S E;  2UWJ G;  4JA9 A;  3PZ3 A;  3UQ3 A;  3VLF A;  2V5F A;  1BLX B;  3FUF A;  1K1A A;  5CRU A;  4GB9 A;  2PM6 A;  3R7R A;  2GRR B;  1E8Z A;  1N0R A;  3GZ1 A;  5A7D B;  4WAF A;  3DWL G;  3QWW A;  3FWV A;  5FQ4 A;  1HZ4 A;  1BD8 A;  2R59 A;  4YVQ C;  4BX8 A;  3FUN A;  3SD5 A;  3HXB A;  1TN7 A;  2B6C A;  2BKK B;  4GYY A;  3FTU A;  4LRZ A;  4QFV A;  2CFU A;  2Q7F A;  3SQV A;  3QJZ A;  4F1S A;  3EHM A;  1EDU A;  3FU5 A;  4GTR A;  4EQF A;  4XIF A;  4HXI A;  1H2V C;  3APC A;  3ULE G;  3L82 A;  3UIO C;  4GCO A;  2XHE A;  4HLE A;  2VSN A;  3UUX A;  3E33 A;  5FTP A;  2DZN A;  4BX9 A;  4EZK A;  1OWO A;  1HG5 A;  3PRZ A;  5G05 J;  2J49 A;  4XI0 A;  2LAI A;  4NRH B;  3E34 A;  3IEG A;  2CG2 A;  3BUA A;  3BU8 A;  4APF A;  3QAQ A;  3R9M A;  2CHW A;  3T5V A;  5ENQ D;  2R17 C;  3R7Q A;  4IYP A;  4DI3 A;  4GA0 A;  1OY3 D;  1TN6 A;  2YQ8 A;  4CDR A;  2IU1 A;  1BI7 B;  3PEV B;  4G11 A;  2BTD A;  5BNW A;  5CER B;  1YYH A;  3V2X A;  3BG1 B;  5IY5 E;  2FI7 A;  4ANW A;  4EPZ A;  3MGB A;  3UT8 A;  1NA3 A;  4G1T A;  2XEV A;  3CVL A;  5ENR D;  4J8E A;  4GTM A;  1QYM A;  3V31 A;  3FTW A;  5LOZ A;  1YCS B;  3CEQ A;  3ABK E;  5CMY A;  2GRN B;  2OV8 A;  4GMJ A;  5EKQ D;  4HOU A;  2FF4 A;  3ZPJ A;  1HF8 A;  4WWN A;  3EDT B;  4YVO A;  1SZA A;  1U3D A;  2RFM A;  4C9B B;  1NZN A;  2X6K A;  1UJK A;  5G2N A;  1EF1 C;  1Y8M A;  3U4T A;  3DEO A;  3IHV A;  3ZYM A;  1E8Y A;  3P1U A;  4CEM A;  2I6H A;  5HI7 A;  2ZGD A;  1IQU A;  3QK0 A;  1K8K G;  4WNG A;  4GA2 A;  3CQG B;  4H7Y A;  4HNA D;  5JHA A;  3G2T A;  4JHK A;  3AS4 A;  2DYR E;  3EHQ A;  2NC9 A;  3UM0 A;  4LNB A;  2NYJ A;  4U8Y D;  4N5C A;  1KZP A;  1N4R A;  3MKR A;  4U95 D;  1QBQ A;  3JXJ A;  1YMP A;  4F53 A;  2PM7 A;  3AG3 E;  1SZ9 A;  4JL0 A;  5D66 A;  1OWL A;  4AOF A;  1LD8 A;  2VYI A;  4V3I A;  2KZT B;  2WXI A;  3RJV A;  2VGX B;  5T4Y A;  3ML9 A;  3CV0 A;  4C48 B;  2GRM A;  3HXE A;  1H2U A;  4O6F A;  3HDX A;  2ETB A;  2IEJ A;  3DST A;  4UQX A;  2AW6 A;  3AG2 E;  2L0T B;  3X2Q E;  1TNZ A;  2P9U G;  5G55 A;  2RKK A;  2I2O A;  4U0U A;  3UKU G;  4KBQ A;  1MX4 A;  2JLB A;  3E32 A;  2AVP A;  3ULY A;  3HYM B;  4UI9 K;  5FJY A;  1NI1 A;  2A4Z A;  3ZRH A;  5G05 C;  3FEX A;  2EIN E;  3AAA C;  4FC8 A;  3ASD A;  3NZS A;  4B8C B;  4DJA A;  4PUC A;  5ENO D;  4UWF A;  4J8Y A;  4I6G A;  1SVX A;  3NAW A;  5ENS D;  3L9T A;  1IKN D;  3V2O A;  5C1D A;  2DYS E;  2J4D A;  3G2S A;  5KNG A;  1MZC A;  3MV2 B;  3IHY A;  3Q75 A;  4WNF A;  3L08 A;  2KXP C;  2H6I A;  2RD0 A;  3CKC A;  2X6J A;  5HQ8 A;  2KCK A;  1IHB A;  2XRY A;  3RAU A;  4AXH A;  1TYQ G;  4CYM D;  3C98 A;  4E85 A;  4EZJ A;  1JUQ A;  1Z6T A;  3B7U X;  4CZ2 D;  3D9N A;  3Q78 A;  5EID A;  1G3N B;  2EIJ E;  3Q7F A;  2HO1 A;  2E2E A;  4CRW A;  4BER A;  4ABN A;  4N2Q A;  2AJA A;  3PZ4 A;  2ION A;  4GZC A;  5ANR A;  3NQP A;  1UW4 B;  3G2V A;  5A23 A;  4UQZ A;  4JZY A;  3ESL A;  5EN5 D;  1JCS A;  4G23 A;  3EIJ A;  2QC9 A;  1EPU A;  2EIK E;  1OXJ A;  2AWI A;  3QDN A;  5AYW D;  3V79 K;  2ILR A;  3B7S A;  2FBN A;  1ELR A;  4GYO A;  3V30 A;  1KT0 A;  3ZNG A;  2P9L G;  3CVW A;  4BET A;  3C72 A;  3FTY A;  3RSE G;  1H19 A;  4HBD A;  4GTQ A;  3ZKJ A;  3ABL E;  3VTX A;  3Q9U C;  4DX1 A;  3FFL A;  4IUL A;  3SFX A;  3G2W A;  1OWP A;  5CRV A;  2DBA A;  1N52 A;  2V4H C;  3NOC D;  3AU4 A;  3TWQ A;  1E90 A;  5M72 A;  1HG2 A;  4L2Y A;  5C2Y A;  3FUH A;  3T5X A;  4GZD A;  2WXM A;  4BSZ B;  2VGE A;  2ETA A;  3FEY A;  4GTV A;  5FT9 A;  3SF4 A;  1JPL A;  2OVF A;  3FU3 A;  3APF A;  2VJ8 A;  3RK6 A;  5FQ7 A;  1JCR A;  4LCT A;  3QOU A;  1NP7 A;  4CDN A;  2H6H A;  1S70 B;  2NSZ A;  2BED A;  2V0P A;  4LSZ E;  1DC2 A;  3FY4 A;  4ZHB A;  1TEZ A;  2FO7 A;  2OEW A;  1O5M A;  4JHR A;  2MRI A;  1KT1 A;  1D9S A;  4P29 A;  2JEK A;  3GYZ A;  4HOQ A;  4A63 B;  3HIZ A;  2F37 A;  3PZ1 A;  2CHZ A;  4GU5 A;  3FP3 A;  4A3V A;  3SBS A;  2E0I A;  5BT1 A;  3PE3 A;  1N54 A;  3HVE B;  4N2S A;  4AIF A;  3B7R L;  3KEA A;  1HX8 A;  3RO2 A;  4M3O A;  3TWR A;  3LXU X;  2P9S G;  3T9K A;  5J90 A;  4UWL A;  4AV7 A;  4YDO A;  1X81 A;  2KAT A;  5FQ6 A;  1QQE A;  2VSX E;  3FTV A;  5ANL A;  4XE0 A;  4W9R A;  3NB2 A;  4AJW A;  3OXG A;  3DRA A;  3CHS A;  3CLJ A;  5LCW C;  1UG3 A;  4KMO A;  3CGH A;  4UWK A;  2KM4 A;  4Y6C A;  3C3Q A;  4DLQ A;  3ZIM A;  4HLL A;  3J5Q B;  2ZIR A;  4U8H A;  2OND A;  5KNH D;  1IXV A;  4L2L A;  4A3T A;  4KVO A;  3B7T A;  3O48 A;  4ANV A;  1N4Q A;  3Q47 B;  3CK8 A;  3KSL A;  4DK5 A;  1FT2 A;  2VTB B;  2L6J A;  4FJZ A;  5BXU A;  3PS6 A;  4I9C A;  4DLO A;  3UT7 A;  2X3M A;  1HO8 A;  4N3A A;  2L9B A;  1OWN A;  5EDS A;  3FUD A;  1BU9 A;  1A5E A;  5E75 A;  5KCM A;  1K1B A;  3CVP A;  1N9A A;  3AU5 A;  2LXM A;  3E37 A;  4JPS A;  4E6H A;  3QKY A;  1E8X A;  4ILH B;  3PUJ A;  3HVE A;  4QQI A;  1FVF A;  4PS8 A;  3JQ1 A;  1TNO A;  4KXK B;  2QY7 A;  3CIA A; 
#chains in the Genus database with same CATH homology
 5JHA A;  3I4G A;  3ZHE A;  2C0L A;  1JWG A;  3G2T A;  4JHK A;  2WQ6 A;  3MKQ A;  1QZ2 A;  4FUL A;  3PRE A;  4GZ6 A;  1ELK A;  4U0S A;  3Q15 A;  3ZW3 A;  3AS4 A;  4N3B A;  4F3V A;  4BTB A;  2I1K A;  3AS8 A;  3R9A B;  2NC9 A;  4I43 A;  4UWH A;  2WXK A;  2PL2 A;  1BPO A;  2V4L A;  4GZ5 A;  1S0P A;  4J6I A;  4RG9 A;  1FVH A;  3QB2 A;  2X6I A;  4A1G A;  1UJJ A;  4U0Z A;  3D9J A;  4U07 A;  4XX5 A;  4N5C A;  1P5Q A;  4EEC A;  3MKR A;  3IBE A;  3SBT B;  1PAQ A;  3CHQ A;  5JJT A;  4EBA A;  4F53 A;  4FA6 A;  2PM7 A;  1SZ9 A;  4JL0 A;  1ZBP A;  2XCB A;  1OWL A;  3S7J A;  2CFZ A;  3MA5 A;  4AOF A;  2VYI A;  4V3I A;  4URK A;  2KZT B;  5BPP A;  1Z3Y A;  2P58 C;  4FP7 A;  3CQC B;  3SHF A;  2WXI A;  4XZ4 A;  5AJD A;  4B89 A;  3WXX A;  2XPI A;  5KJK A;  3LVR E;  4NQ0 A;  1WM5 A;  3RJV A;  2C2L A;  2OVB A;  2LSU A;  2VGX B;  3KAE A;  5T4Y A;  3E4B A;  4XKB A;  4C0M A;  5FZQ A;  3ULQ A;  3ML9 A;  3CVU A;  3CV0 A;  4AY6 A;  3PE4 A;  1H0A A;  3L13 A;  4JW1 A;  2GRM A;  2LO6 A;  1H2U A;  3FUJ A;  4O6F A;  2KCV A;  3HDX A;  2XGM A;  3ZYK A;  5CCM A;  1INZ A;  3PDN A;  4CGV A;  3GZS A;  4JHJ A;  1YA0 A;  4PDX A;  1UN8 A;  4UQY A;  1XGW A;  5BV0 A;  4OYS A;  3D9I A;  2WMN A;  4UQX A;  2AW6 A;  5D0O D;  2DIW A;  2VTB A;  2L0T B;  1TJC A;  3RIB A;  3CHP A;  5ARF A;  1PC2 A;  5G55 A;  3OAW A;  1IYG A;  2Y4T A;  2I2O A;  3I5P A;  4KZC A;  4U0U A;  1W3B A;  1QNF A;  2J09 A;  5JJ6 A;  4Q69 A;  3DBS A;  1OWM A;  4JEH A;  4KBQ A;  5ENN A;  4A1S A;  3D9L A;  3I3N A;  3L6A A;  4CDM A;  1HU3 A;  2JLB A;  5DBK A;  2AVP A;  3MEK A;  3TXM A;  1DVP A;  3L16 A;  4RVB A;  3HYM B;  4UI9 K;  5FJY A;  1HXI A;  3RRM B;  5JHB A;  3CVY A;  5FWQ A;  2IOS A;  2Y3A A;  2A4Z A;  3VTY A;  3CHO A;  4L23 A;  4U04 A;  1OUV A;  3ZRH A;  3PNL B;  2Y4U A;  3FH7 A;  5G05 C;  3FEX A;  4OVV A;  2GGF A;  3SNX A;  3ASH A;  4FC8 A;  3ASD A;  3NF1 A;  4BFR A;  2C0M A;  3NZS A;  3CKB A;  2M63 A;  3EIQ C;  3Q4A B;  4PUC A;  5BW8 C;  3TAX A;  4B8C B;  4DJA A;  5BV1 A;  4UWF A;  3L22 A;  3L54 A;  4I6G A;  4WUY A;  5AIJ A;  4ACL A;  3D9P A;  4WND A;  1KLX A;  1MHQ A;  1E7U A;  2QFC A;  2J4B A;  4PS7 A;  1Z3X A;  3CSF A;  2J08 A;  5C1D A;  3PNT B;  4CGW A;  1H2T C;  2J4D A;  5G04 J;  3G2S A;  5T8I A;  4J8D A;  2PZI A;  3DPD A;  3MV2 B;  4ILG A;  1VDY A;  2VSO E;  3I4R B;  3IHY A;  4B8A A;  3S7D A;  4G24 A;  4WNF A;  4R7L A;  3JYS A;  3OXF A;  4GML A;  3L08 A;  2BF0 X;  1TJF A;  2RD0 A;  3CK7 A;  3CKC A;  2XRZ A;  4TV3 A;  2X6J A;  3RO3 A;  5HQ8 A;  2KCK A;  2MHK A;  2LSV A;  3FTS A;  4GA1 A;  4J8F A;  3SFZ A;  2XRY A;  3ZXS A;  3U66 A;  5LFA A;  1HS6 A;  1H6K A;  2FEZ A;  4TUU A;  4AXH A;  3CST A;  3C98 A;  4D10 C;  4E85 A;  1U3C A;  1JWF A;  4EZJ A;  3T8M A;  5CCL A;  4IRU A;  1EYH A;  1SQM A;  3FUK A;  3RRN B;  1JUQ A;  4ANX A;  4BTA A;  2R5S A;  1Z6T A;  3RU0 A;  1L5J A;  3LDZ A;  3RRU A;  3B7U X;  4Q96 A;  3SGH A;  4G25 A;  3D9N A;  3S2A A;  3ZYQ A;  4XKC A;  2OOE A;  3ESK A;  2BUG A;  4AM9 A;  3MCX A;  2HO1 A;  2E2E A;  5FQ8 A;  4CRW A;  5ARG A;  3VLD A;  4ABN A;  2IOL A;  3D9M A;  4N2Q A;  3LYA A;  1XNF A;  5JJ7 A;  4I1O B;  4I6J A;  3KD7 A;  4J0U A;  2XGS A;  3URZ A;  2WXQ A;  2ION A;  4GZC A;  1HFA A;  5ANR A;  1A17 A;  3NQP A;  1UW4 B;  3GZ2 A;  2J07 A;  3LVQ E;  4LER A;  4ILI A;  2J9Q A;  3G2V A;  3FTZ A;  4UQZ A;  5A23 A;  2YHE A;  1UN9 A;  3FDH A;  3JCK C;  1E96 B;  3ESL A;  4JZY A;  4G23 A;  3EIJ A;  3UPV A;  3LY7 A;  1EPU A;  4BT8 A;  2MOW A;  3CVV A;  3G2U A;  2KC7 A;  5EX0 A;  5G04 C;  3K9I A;  4TRQ A;  2AWI A;  3CVN A;  4NUR A;  1Y6I A;  4IN3 B;  4G2V A;  2WM9 A;  2X6H A;  3ENE A;  2AXU A;  4FU3 A;  5FZS A;  2GRL A;  3QDN A;  5A6C A;  3MV3 B;  5AYW D;  3MX3 A;  4GZ3 A;  3CHM A;  3L17 A;  4BT9 A;  2IQC A;  4DI4 A;  2ILR A;  3B7S A;  2FBN A;  3ZN3 A;  1ELR A;  3ASF A;  3FUM A;  4GYO A;  4JXT A;  4I2W A;  1KT0 A;  2HYZ A;  3QWV A;  4GAA A;  4K0R A;  4G26 A;  3BEE A;  3CR3 A;  4A55 A;  4AEZ C;  2WXN A;  3D9O A;  4DPR A;  3CVW A;  5KJL A;  2HM8 A;  4KT6 B;  4GPK A;  2XQ0 A;  2AXV A;  3ZYL A;  3LJ3 A;  3NZU A;  4Y6W A;  3S7F A;  4F7A A;  2I9C A;  4N39 A;  1NA0 A;  3FTY A;  4ATG A;  3UT4 A;  2XCC A;  3IV0 A;  4FHJ A;  5KJN A;  3SI5 A;  3JQ0 A;  2NXP A;  3JUI A;  1H19 A;  4RSY A;  3CK9 A;  3GW4 A;  3OXL A;  4PH4 B;  1WY6 A;  3ZFW A;  5EX3 A;  3VTX A;  2UY1 B;  4EZL A;  3FUI A;  2VGY A;  2IFU A;  3FFL A;  4MKT A;  3LEW A;  3LPZ A;  4UWG A;  4IUL A;  3TXN A;  3G2W A;  4APO A;  1OWP A;  4JC8 A;  2HR2 A;  2DBA A;  1N52 A;  4WWO A;  2LNI A;  5E76 A;  3AU4 A;  3CHR A;  3FTX A;  1E90 A;  2WQH A;  5M72 A;  1HG2 A;  4L2Y A;  3SZ7 A;  5C2Y A;  4CT0 A;  3QC1 A;  1ELW A;  3FUH A;  3CVQ A;  1PY1 A;  3LCA A;  3T5X A;  2FUL A;  5CMW A;  1FCH A;  4GZD A;  2WXM A;  2V8S E;  2UWJ G;  2CG3 A;  4JA7 A;  3U9W A;  3P2B A;  4JA9 A;  4HOR A;  3U3W A;  3TG5 A;  5BUZ A;  3U64 A;  3APD A;  3ONK A;  3FEY A;  3LY9 A;  2L0I A;  2GW1 A;  3EJN A;  4FJY A;  5FT9 A;  3SF4 A;  1JPL A;  2OVF A;  3FU3 A;  5LX8 A;  3APF A;  2WMO A;  2VJ8 A;  3UQ3 A;  3VLF A;  3RK6 A;  5FQ7 A;  2V5F A;  3FU6 A;  3FUF A;  4LCT A;  3QOU A;  4GB9 A;  2PM6 A;  1NP7 A;  3R7R A;  4CDN A;  1E8Z A;  3GZ1 A;  2NSZ A;  3Q49 B;  2V0P A;  5A7D B;  4WAF A;  3QWW A;  3FWV A;  5FQ4 A;  2WXH A;  4UI9 J;  4FLH A;  1HZ4 A;  2WXP A;  2R59 A;  3ML8 A;  4NAC A;  3FY4 A;  3EHN A;  1TEZ A;  3IKO B;  4YVQ C;  4BX8 A;  2FO7 A;  3FUN A;  3SD5 A;  4JHR A;  3TJP A;  4JVS A;  2MRI A;  3UMV A;  1KT1 A;  3B13 A;  3FUL A;  4I17 A;  5LCW J;  2RG8 A;  4P29 A;  1HE8 A;  4GYY A;  4J8S A;  2JEK A;  3FHE A;  1X5B A;  3FTU A;  3GYZ A;  4HOQ A;  2CFU A;  3HIZ A;  2Q7F A;  4LRZ A;  4QFV A;  2CHZ A;  4N3C A;  3QJZ A;  3FH8 A;  3LS8 A;  4F1S A;  3KEZ A;  3EHM A;  1EDU A;  4U63 A;  2VQ2 A;  2KZT A;  2CHX A;  4Q94 A;  3ZVV A;  4GU5 A;  3FU5 A;  4EQF A;  3BG0 B;  1IHG A;  3FP3 A;  3SBS A;  4A3V A;  5AEN A;  4XIF A;  2E0I A;  4HXI A;  5BT1 A;  1H2V C;  2WXR A;  3APC A;  3QAR A;  5DIZ A;  3PE3 A;  1N54 A;  2VGX A;  4RG6 A;  3Q5M A;  3ZEF A;  4BY6 A;  2YHC A;  4I1A A;  3HVE B;  4FHK A;  4GCO A;  4N2S A;  2XHE A;  4HLE A;  4WNE A;  4BSX A;  2VSN A;  3N71 A;  3UUX A;  4AIF A;  3TG4 A;  1LF8 A;  5D0Q D;  4B94 A;  3B7R L;  3O4Z A;  5FTP A;  4BX9 A;  4EZK A;  1HX8 A;  4KXK B;  1OWO A;  3RO2 A;  4M3O A;  3LXU X;  3ZHE B;  3QWP A;  3HHM A;  1HG5 A;  3PEU B;  1GW6 A;  3PRZ A;  4KZ0 A;  3MKQ B;  5G05 J;  2J49 A;  4XI0 A;  2LAI A;  4NRH B;  4HVB A;  3D9K A;  4MS6 A;  3IEG A;  4LUN U;  4UWL A;  5J90 A;  2CG2 A;  4AV7 A;  4BWR A;  4ACK A;  2KAT A;  4I2Z A;  5FQ6 A;  4APF A;  3KS2 A;  3QAQ A;  2CHW A;  2PQN A;  1QQE A;  2VSX E;  3T5V A;  4ANU A;  2R17 C;  4L1B A;  3R7Q A;  2ZU6 B;  2WXL A;  4IYP A;  4DI3 A;  4GA0 A;  3FTV A;  2WB2 A;  5ANL A;  2UY1 A;  2YQ8 A;  4ME2 A;  4XE0 A;  4W9R A;  4UI9 C;  3PVL A;  4CDR A;  2IU1 A;  4AJW A;  3TGO A;  3OXG A;  3ZGQ A;  4OVU A;  3PEV B;  4G11 A;  2BTD A;  3AS5 A;  3RKV A;  3PH0 C;  3PZD A;  2WXG A;  3CHS A;  5BNW A;  3FU0 A;  3CLJ A;  4GYW A;  4CCA A;  5LCW C;  1UG3 A;  4AP2 A;  1MQS A;  4KYO B;  4KMO A;  3CGH A;  4HOT A;  3MZL B;  4UWK A;  3BG1 B;  2KM4 A;  4Y6C A;  1WAO 1;  2FI7 A;  2WXO A;  4FLB A;  3ZIM A;  4ANW A;  4DLQ A;  3MYV A;  3VLE A;  4EPZ A;  4HFG A;  3QNK A;  3MGB A;  3UT8 A;  1NA3 A;  4G1T A;  4HS2 A;  2X6F A;  2XEV A;  4U8H A;  2OND A;  4FAD A;  3CVL A;  4I1M A;  4B0Z A;  1ZU2 A;  4L2L A;  3D3M A;  4LEU A;  4KVO A;  5FZR A;  4A3T A;  4J8E A;  4AY5 A;  1E8W A;  2X38 A;  1E7V A;  3B7T A;  3O48 A;  2VSY A;  4ANV A;  5LP0 A;  3Q47 B;  2WQ7 A;  4YND A;  3FTW A;  3CK8 A;  2A5U A;  4DK5 A;  3OTN A;  3CEQ A;  5LOZ A;  2VTB B;  5CMY A;  2YIN A;  2XPZ A;  2L6J A;  2DCP A;  2OV8 A;  1B89 A;  4GMJ A;  2WVI A;  4FJZ A;  5EKQ D;  3UX4 A;  3PS6 A;  2AXZ A;  4HOU A;  2KCL A;  2LAH A;  1HH8 A;  4MLP A;  4I9C A;  2XPY A;  2FF4 A;  3TL5 A;  3UT7 A;  4DLO A;  4JEU A;  3ZPJ A;  2X3M A;  1HO8 A;  5KJM A;  4I6E A;  1HF8 A;  3PUK A;  4N3A A;  3EDT B;  4WWN A;  4YVO A;  4EBA G;  2L9B A;  1OWN A;  5J08 A;  4XI9 A;  2PQR A;  4I9E A;  5EDS A;  3FUD A;  1SZA A;  4C0E A;  3CVX A;  1U3D A;  4KVM A;  4C9B B;  3FUE A;  4AVX A;  1NZN A;  2X6K A;  2WPV A;  5E75 A;  1UJK A;  5G2N A;  5AJL A;  3ASG A;  5KCM A;  1EF1 C;  2WXF A;  1Y8M A;  3U4T A;  4PS3 A;  2WXJ A;  3CVP A;  4CT4 A;  4MRU A;  3AU5 A;  3IHV A;  3FH5 A;  3ONL A;  3ZYM A;  1E8Y A;  2IF4 A;  2IJG X;  3P1U A;  5CHE E;  4JPS A;  4E6H A;  3QKY A;  3LKU A;  1DNP A;  3LY8 A;  3MJW A;  1E8X A;  4H7X A;  4ILH B;  2I1J A;  4L7T A;  5T3R A;  4CEM A;  3PUJ A;  2I6H A;  3HVE A;  1FVF A;  4WWP A;  4K03 A;  2EQX A;  5HI7 A;  1IQU A;  3S7B A;  3QK0 A;  4PS8 A;  2XGO A;  4GCN A;  4WNG A;  1IQR A;  4HOS A;  4GA2 A;  3CQG B;  3JQ1 A;  4H7Y A;  2YNQ A;  2QY7 A;  3CIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...