3CVPA

Structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to pts1 peptide (10-skl)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
313
structure length
279
Chain Sequence
TDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVTRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peroxisome targeting signal 1 receptor PEX5
publication title Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transport protein
total genus 111
structure length 279
sequence length 313
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cvpA00
4N2QA 5EX0A 4APOA 4AY5A 4Y6CA 1IYGA 4XI0A 4GYYA 2Y4TA 3MA5A 4WNFA 4U04A 3ASFA 3ZHEB 3CK8A 4JL0A 4WUYA 4GA1A 4HOSA 3LY9A 4YNDA 2VGYA 4JA7A 4NRHB 2V5FA 4KBQA 4UQZA 3MEKA 4AIFA 4GPKA 4GYWA 1E96B 3RO2A 4GZ5A 2OOEA 2KATA 4J8EA 2R5SA 4UQYA 2XEVA 4H7XA 5FZQA 3FFLA 3NF1A 3MV3B 4BTBA 1NA3A 4BTAA 3LCAA 4U07A 2BUGA 3LY8A 3KAEA 4N3CA 4HOTA 4ABNA 3S7FA 5CCMA 4WNGA 3R9AB 2XCBA 2YQ8A 3FWVA 3FP3A 2I6HA 5A7DB 3RKVA 3QOUA 3TG5A 5FTPA 5BT1A 5CCLA 3GZ1A 3U4TA 4RG9A 4N3AA 5BNWA 4U0UA 4G1TA 5C1DA 4U0ZA 3PDNA 4CGWA 4BWRA 5G05C 2VGXA 3VTYA 3UUXA 3CEQA 2UY1A 4JHRA 2VGXB 3QDNA 5FJYA 2PL2A 2UY1B 3PE4A 1WAO1 1ZBPA 1Y8MA 5G04C 3RJVA 1ELWA 4IN3B 4UQXA 2PQNA 4GZ3A 4Y6WA 1B89A 5LCWJ 5JJ6A 3LY7A 3RU0A 4G23A 3PE3A 2FEZA 4I2ZA 3Q15A 2C0MA 3ZHEA 2FI7A 4EQFA 4UI9K 2MHKA 4YVOA 2FBNA 4I9EA 3SZ7A 4UI9J 2AVPA 4ME2A 4NQ0A 3U3WA 2PQRA 1PC2A 3ZN3A 4O6FA 4GCOA 3BEEA 1QZ2A 3QWWA 4N5CA 3HYMB 1WM5A 2KCVA 1QQEA 5M72A 4A1SA 4HOUA 4GZ6A 3TAXA 2XGOA 4GYOA 2FF4A 4HOQA 5DIZA 2L6JA 1KLXA 3JYSA 2XCCA 5CHEE 1FCHA 1OUVA 4GA0A 3GW4A 3O48A 1W3BA 4BT9A 3ESKA 3KS2A 3K9IA 3CKCA 4GCNA 3LKUA 3CK7A 2VQ2A 4KXKB 1KT1A 2VYIA 5ARFA 1XNFA 3CK9A 2Q7FA 1TJCA 2IF4A 2LSUA 2JLBA 4XI9A 4G24A 1YA0A 3E4BA 3ZFWA 3ULQA 2KC7A 5JJTA 3CVQA 2LSVA 3ASHA 3CKBA 3UQ3A 1NZNA 5KJNA 4CGVA 4HORA 2XGMA 3TG4A 2WQHA 4UI9C 2IFUA 2E2EA 3QKYA 2C0LA 3OXFA 2KCLA 3GYZA 3OXGA 3Q49B 5ARGA 5EKQD 2J9QA 2FO7A 4I9CA 2P58C 3CVPA 3AS8A 2XGSA 5FT9A 4AM9A 5G05J 2YHCA 3KD7A 5FZRA 1ELRA 4N39A 2VSNA 3LYAA 3Q5MA 3CVLA 1HXIA 2ONDA 3QWVA 4F3VA 3Q47B 4LEUA 2XPIA 5G04J 3IEGA 4CDRA 3ASGA 2LNIA 2HO1A 4KYOB 4G25A 4W9RA 4RG6A 4G26A 5DBKA 3ZGQA 1IHGA 4J0UA 5D0OD 4N2SA 3ZPJA 2PZIA 3TGOA 3MV2B 3WXXA 5BW8C 4WNEA 2VSYA 1KT0A 4YVQC 1HZ4A 3MKRA 4U0SA 5KJKA 2C2LA 5KJLA 3OXLA 1HH8A 1NA0A 5AYWD 4AY6A 5A6CA 4WNDA 4J8DA 3EDTB 4XIFA 5LCWC 4I2WA 5HI7A 2HR2A 4J8FA 4I17A 4JA9A 1P5QA 4GA2A 3UPVA 2UWJG 2GW1A 3GZ2A 4I1AA 5FZSA 5EX3A 5JJ7A 2Y4UA 2DBAA 3Q4AB 5KJMA 5HQ8A 3URZA 2KCKA 3CVNA 2QFCA 3ASDA 3AS5A 1ZU2A 3S7DA 3CV0A 3S7BA 4G2VA 2WPVA 3S7JA 3LPZA 4H7YA 2NC9A 2HYZA 3QWPA 5D0QD 3RO3A 4N3BA 3N71A 3VTXA 1A17A 3RIBA 4BT8A 3AS4A 4B94A 3SF4A
chains in the Genus database with same CATH superfamily
4KMOA 3TXNA 4Y6CA 1IYGA 2EINE 2DWZA 1JUQA 4ILGA 2DZOA 4JL0A 4QQIA 4WUYA 4LNBA 4HOSA 4Q69A 2VGYA 1DNPA 1VDYA 3APCA 5IY5E 1OWNA 4A1GA 4DI4A 4FULA 2R2LA 2XEVA 3KSQA 3IKOB 4LUNU 3Q79A 1IHBA 3ZKJA 1E7VA 1SVXA 2Y0BG 2BUGA 3KAEA 4HOTA 4ABNA 2I1KA 3S7FA 5CCMA 1E8ZA 4WAFA 3R9MA 2H6GA 4GTMA 5ANLA 4B0ZA 3ZYLA 5C2YA 2GRLA 3V79K 1O1SA 4NACA 2RG8A 4X8QA 2XRYA 4F6RD 5A7DB 4L2LA 2QYUA 3CVWA 3GZ1A 3U4TA 4RG9A 3IXEA 4U0UA 2Y1LE 3HVEA 1V55E 4OYSA 4U0ZA 3ZYKA 3PDNA 3E34A 3HVEB 2H6HA 3HDXA 4CGWA 4BWRA 3PZ4A 4GTOA 4XEIG 5D66A 4UWHA 3FTUA 4M3OA 3VTYA 3CEQA 2UY1A 3CHPA 3UIPC 2PL2A 3FUNA 2UY1B 4UWGA 3FUKA 3RJVA 3ZXPA 5CRVA 4AXHA 4J6IA 2WXNA 3SHFA 2GRRB 2OCCE 4L1BA 1B89A 5JJ6A 2OV8A 3L9TA 2YHEA 3FUEA 3L13A 3DSSA 3Q9UC 1OCCE 4JHJA 4ILIA 5B1AE 2FBNA 1NL4A 3PZ1A 3LVRE 1HE8A 1SZAA 3ASOE 4GCOA 3DEPA 1QZ2A 3L08A 2LXMA 3HYMB 1E8YA 1S64A 1A5EA 1H0AA 1JCSA 5KCMA 4UUCA 2XGOA 2CHWA 4GYOA 1FT1A 5BV1A 2FF4A 4Q94A 4GZDA 3MYVA 3CR3A 1KLXA 3CVXA 3D9KA 4GAAA 2AXZA 2ETCA 1RZ4A 4HQDA 3AG4E 1W3BA 1BI8B 2QZAA 3ESKA 1RW2A 4JD2G 5G2NA 1UN9A 3LKUA 2V4HC 1MX6A 5CERB 3CK7A 2XQ0A 3FTVA 3NOCD 4KXKB 4GMJA 3TWUA 1XNFA 3ML8A 4L9PA 3SD5A 3CK9A 3PZ2A 4ZFHA 2JLBA 3T5VA 1YA0A 3E4BA 4Z68A 5JHBA 3TWWA 4FU3A 3CVQA 1U2VG 3NZSA 5AQ9A 1H6PA 2OEVA 3D9PA 3EHRA 4ATZD 2DYSE 4XZ4A 3AG3E 2XGMA 4GTQA 2JABA 3QKYA 3OXFA 3SFYA 3GYZA 4V3IA 2VSXE 2LUHA 3NZUA 2FO7A 2LAIA 2P58C 3CVPA 3DSUA 4JEUA 3L82A 5CMYA 4EZKA 1FPPA 1DVPA 5G05J 3FTSA 1Z3YA 3KD7A 4B93B 5KNHD 3FH7A 4DJAA 1KZOA 3CVLA 1BU9A 5EYLA 3QWVA 4ACLA 4G11A 2F8XK 1KZPA 2B0OE 3Q47B 1BD8A 5CBOA 5G04J 3B95A 3TJPA 4G25A 3ZW3A 1IXVA 5EYPF 3ENEA 4ILHB 3EHQA 2R17C 3ONKA 3FHEA 4KVMA 3ZPJA 2WXLA 3TGOA 4C48B 3MV2B 1S70B 4A55A 5ENNA 5BW8C 4WNEA 2VSYA 2X6FA 4J8SA 3KEAA 2MRIA 5T4YA 3ZUVB 3CQCB 4O60A 3NOGD 1WDYA 5T3RA 3PZDA 4B8CB 4U0SA 5BPPA 2BEDA 5KJKA 2C2LA 3FU6A 2X6HA 4E6HA 3FEXA 4A3TA 4UWFA 3L6AA 1IQRA 4IRUA 3EIQC 4AY6A 2ZXWE 4ANUA 4J8DA 2PNNA 4I2WA 4I17A 2R05A 1EF1C 2GW1A 2CFZA 2DBAA 4DLOA 3Q4AB 4FHKA 4L23A 4FA6A 2WXPA 5HQ8A 1H2TC 3CVNA 2NSZA 3ESLA 3CHMA 5AIJA 4MLPA 3DEOA 5HRYA 3QWPA 4I43A 1UOHA 1MX2A 1DCQA 5D0QD 3RK6A 3ZRHA 2GRMA 1EPUA 2CG3A 4AVXA 3FH5A 3LXUX 4PS8A 1SA4A 4TUMA 1OCZE 1U3CA 3JCKC 2YNQA 2H6IA 1K1AA 5AN8A 4XI0A 4GYYA 3B7SA 4HS2A 3B7RL 1UJJA 4BX9A 4EZJA 1SQMA 4WNFA 3DXKG 3CK8A 4GA1A 4KVOA 3LY9A 5JMND 4GTSA 4KZ0A 4UQZA 3MEKA 3D9JA 1O1TA 1E96B 4I6JA 3AG2E 2DCPA 4OVUA 4I1OB 3D9MA 4UQYA 2MOWA 3VLEA 2GRPB 2WXMA 1DCEA 3LCAA 3LY8A 4NURA 3DPDA 1S63A 4WNGA 2EIJE 3MCXA 1JWGA 3CHRA 2J4BA 3FWVA 3L16A 2VGEA 1OCOE 4F53A 4B89A 4MBGA 4TXQA 1V54E 1AWCB 4UWKA 5ENSD 1LF8A 2DIWA 5BT1A 3HHMA 3Q7AA 5HKPA 3PEVB 4YDYA 4N3AA 3JUIA 4G1TA 3SNXA 1G3NB 3FU3A 4P29A 2IOLA 3MKQB 1BPOA 4DX5D 5FINA 3OTNA 5G05C 3FUJA 5D2MC 5ANRA 4F1SA 3SFZA 4JHRA 3U66A 1TN7A 5JA4D 4BY6A 4MRUA 1WAO1 1UW4B 4GMRA 5G04C 4EHMA 2WXFA 3UX4A 3DSVA 4UQXA 2PQNA 2RKKA 4GZ3A 3FUFA 4Y6WA 2PM6A 4RQIA 4CYMD 3QB2A 3LY7A 4RVBA 3CQGB 4G23A 3RAUA 3PE3A 5BXUA 5KWDA 1N0RA 3ZEFA 2FO1E 3FUDA 2C0MA 4JC8A 3EUVA 3QC1A 2P9NG 1N4PA 1NP7A 3G2SA 3ONLA 5ITZF 1PAQA 4YVOA 3QARA 5AQBA 4I9EA 4KZCA 4ME2A 4L2YA 4NQ0A 3ZIMA 2PQRA 3ZN3A 3QWWA 1IQUA 3SBTB 1QQEA 1EYHA 5M72A 1MX4A 4GZ6A 3HXFA 3IV0A 1JCRA 4APFA 2ZU6B 3U9WA 4JHKA 2WXIA 2L6JA 4ATGA 4EECA 4M7CA 2AWIA 1MYOA 3V2XA 1TNYA 5ENTD 4GU5A 1K3ZD 3K9IA 4B8AA 2M63A 4GCNA 4TV3A 1WG0A 2WXOA 5B3SE 1LD7A 1BLXB 4BX8A 2L6BA 4PS7A 2WMNA 4DX7D 5EN5D 1YMPA 4G24A 3UKUG 1DC2A 2F8YA 3QAQA 3FUMA 3APDA 2IY0C 4LCTA 4GPMA 3ULQA 3C3OA 3G2VA 3CKBA 3PS6A 1TNUA 4OAUC 1L5JA 2CHXA 2X6IA 3AJIA 5ENQD 4CGVA 3HIZA 3TG4A 4UI9C 2A5EA 2IFUA 5AJLA 2KCLA 1MJ0A 3PUJA 3Q49B 5ARGA 5B1BE 2KM4A 2J9QA 4G8LA 3ZVVA 2X38A 3C72A 5FT9A 4YDWA 4BEPA 3EIJA 4JW1A 2IJGX 3TL5A 4EBAA 2R03A 1ELRA 2VSNA 3UM2A 3Q5MA 1ELKA 4R7LA 1HXIA 4FJYA 5FWQA 5ENPD 2XPIA 2BKGA 1Q2ZA 4KYOB 3LJNA 1N95A 2AXVA 3F6QA 3IBEA 4I1MA 1Y6IA 2XZDG 1FT2A 5J90A 4E85A 4G26A 4EPZA 5E76A 4GZCA 4FLBA 3FUHA 1N9AA 3ZGQA 5EIDA 1IHGA 4N2SA 3FY4A 2DYRE 1GW6A 5KNGA 1UG3A 4CEMA 1H6KA 1KT0A 2WQ7A 4FADA 2P9LG 4U7EB 1K1BA 3APFA 2P9KG 3MKRA 2EQXA 3CSFA 3FTYA 4N5QA 4U8VD 4U8HA 3CGHA 4XX5A 3MX3A 1TNZA 4JXTA 3PNLB 4HLLA 3D3MA 3FTXA 2LO6A 3EU9A 2WXJA 4WNDA 3EDTB 1N4SA 4XIFA 5AQ7A 5HI7A 2IOSA 2EILE 4J8FA 3GZ2A 3UMVA 4I1AA 5JJ7A 2AJAA 1OY3D 5KJMA 5E75A 4ANXA 1HFAA 3ASDA 1HO8A 3AS5A 1ZU2A 4HNAD 3S7BA 4FHJA 2XS8A 1OWMA 3E32A 1N52A 5BUZA 2LAHA 4BERA 4URKA 2HYZA 3UIOC 2ZGGA 4RLYA 4GTPA 3D9OA 1TJFA 3L17A 2XS1A 3RO3A 5EILA 4G8KA 4BSZB 1EDUA 1A17A 1HF8A 2V0PA 3AS4A 4B94A 4LERA 2P9UG 4N2QA 2OEWA 1LD8A 3UI2A 4HB5A 2JEKA 4YDOA 2Y4TA 4CT4A 3DXMG 5AJDA 3CSTA 3JQ0A 3ZHEB 3DRAA 2X6JA 2XZTG 4KBQA 4TRQA 4GPKA 4GZ5A 2OOEA 4J8EA 3CHOA 2R5SA 1HS6A 4H7XA 5FZQA 5FQ7A 3FFLA 2IEJA 3MV3B 4BTBA 3C5RA 2WQ6A 4KT6B 5H7PA 1NA3A 5FQ8A 2P9SG 4BTAA 1IKND 1JPLA 2A5UA 5BXOA 3R9AB 2VTBA 3D9HA 2J8SD 4DX1A 5FQ6A 2VTBB 2XPYA 2BF0X 3IHVA 2P9PG 3ULEG 3FP3A 4OVVA 1MZCA 3RKVA 1NI1A 1N54A 3FU0A 3T8MA 2IONA 2DZNA 1JCQA 4TXPA 5CCLA 3Q73A 4K0RA 3ZYQA 5C1DA 3CVYA 2KZTA 3HRAA 3P1UA 2KZTB 2NYJA 5KBAA 3OAWA 2VGXA 4CRWA 1OWLA 3LEWA 5AENA 2VGXB 3QDNA 4BESA 3B7TA 5FJYA 1E8XA 1ZBPA 1X5BA 1Y8MA 3BG1B 3HXDA 4LNGA 2CHZA 3MJWA 4AV7A 4DLQA 5CMWA 4WWNA 1UJKA 3RSEG 2OVBA 1MHQA 3TWQA 5LCWJ 3HXEA 3HXBA 2FEZA 3BUAA 3FULA 4I2ZA 2I9CA 3Q15A 4RSYA 2FI7A 4UWLA 4EQFA 4O1OA 2ETAA 1HU3A 3VLDA 2GRQB 3SZ7A 4UI9J 3UT7A 2AVPA 3U3WA 3NB2A 1PC2A 4O6FA 1HG2A 3BEEA 4U8YD 2PM7A 3E37A 2Y3AA 2ZIRA 2RFMA 4A1SA 4HOUA 2J09A 5EIBE 3SI5A 4HOQA 3CVVA 3T9KA 3LJ3A 2WMOA 4K5BA 3CHSA 2B6CA 4PH4B 2XCCA 2QC9A 2V4LA 3AU5A 2BKKB 4XKBA 4O1PA 3UINC 1OWPA 3KS2A 3G2TA 5BV0A 3O4ZA 4C0MA 1KT1A 2VYIA 2XPZA 3MKQA 3TWVA 4JVSA 4JPSA 5AQAA 2WXQA 2IF4A 2LSUA 4MS6A 5CBNA 1N0QA 4MKTA 4TXRA 2KC7A 3NAWA 4F1PA 2LSVA 3ASHA 1SW6A 3UXGA 2L0IA 4FC8A 3ISMC 3CVUA 2XEHA 4CCAA 3PH0C 2AW6A 2R02A 4HORA 3FU5A 3DPYA 1OWOA 1S0PA 3LVQE 3IHYA 4WWPA 3OXGA 3Q78A 5EKQD 3UM0A 1OCRE 1AP7A 2GROB 3AS8A 1H2UA 2XGSA 3V31A 2YHCA 3FTZA 2LXLA 5FZRA 3W9GA 4HVBA 1QNFA 3LYAA 3R7RA 4F3VA 3C3RA 1D8DA 1OT8A 4C0EA 3JQ1A 4CDRA 4DPRA 4L7TA 3ASGA 4I6GA 1FVFA 2HO1A 2WXRA 4J7WA 3UM3A 3ULYA 2KBXA 4ANVA 4RG6A 3C3QA 3DSTA 1E7UA 3QNKA 3T8KA 3SY2A 2J08A 4HLEA 2GRNB 4J0UA 5D0OD 4DX6D 5A23A 2ZISA 4CDMA 2L9BA 3RRNB 3JXIA 1HZ4A 1Z3XA 5LFAA 3AAAC 3OXLA 1HH8A 2P2CP 3B7BA 2J49A 1NA0A 5AAOA 2VJ8A 4NIKA 5A6CA 3UT8A 3ZYMA 3LS8A 5LCWC 2HR2A 4K5CA 4FP7A 4JA9A 3UPVA 2CG2A 2IO3C 3PREA 4LRZA 5AARA 3PUKA 2F0YA 2XENA 5FZSA 5EX3A 1N94A 1E90A 4J8YA 4GTVA 3EJNA 2RFAA 2QFCA 3S7DA 4F7AA 4G2VA 2WPVA 4H7YA 3C98A 4CT0A 3G2UA 2BTDA 4AOFA 4N3BA 3N71A 4FLHA 3NBNB 3VTXA 4A3VA 2WM9A 3ABLE 3EHNA 4IYPA 5ENOD 3SF4A 1E8WA 3CHQA 5EX0A 4APOA 3D9NA 1YCSB 4A63B 4AY5A 1MQSA 3MA5A 3TWRA 1TR4A 4U04A 3ASFA 1TN8A 3I4RB 3J5PA 2I1JA 4XKCA 4ACKA 4BETA 4YNDA 4NRHB 4JA7A 2V5FA 4AIFA 2V8SE 4GYWA 3RO2A 3E33A 3P2BA 1YYHA 4DUIA 2KATA 2XHEA 4EZLA 1UN8A 4GTRA 5ENRD 1O5MA 4LNUD 3NF1A 2IO2C 3I3NA 2V5QC 4U07A 3JXJA 3ZXSA 2WXGA 1XGWA 3VLFA 4N3CA 5LX8A 3ZNGA 4XE0A 2XCBA 2EIKE 3L22A 2YQ8A 3D9LA 1PY1A 3WG7E 2I6HA 2KXPC 5FIOA 3QOUA 4JEHA 3TG5A 5FTPA 3TWTA 1D8EA 1TNOA 3SFXA 4BSXA 5BNWA 4QFVA 4CDNA 4I6EA 4D10C 1TYQG 3JUEA 3Q7FA 3L54A 2RD0A 3HXCA 4DK5A 3UUXA 2NXPA 4Q96A 5JHAA 3CLJA 5LOZA 3PE4A 3SO8A 3SBSA 1N11A 1ELWA 1O1RA 4BFRA 4IN3B 2H6FA 3MGBA 2OVFA 4PS3A 3I5PA 3SQVA 1H2VC 1OXJA 3NQPA 4LG6A 2QY7A 4GMLA 4WWOA 3RU0A 2IU1A 3MZLB 3AU4A 5LP0A 5HS0A 3PNTB 2XRZA 2E0IA 3ZHEA 3FDHA 4UI9K 4HRMB 2MHKA 3TWXA 2CFUA 2A4ZA 3UT4A 2AXUA 3RRUA 3HG0D 3UM1A 4HI8A 2WB2A 3AG1E 4ZHBA 3ML9A 4N5CA 5G55A 1WM5A 2KCVA 4PUCA 2Y69E 3FH8A 1D9SA 3Q75A 4U95D 4HXIA 3TAXA 4OAVB 4GTTA 2WXKA 5DIZA 2DVWA 4C9BB 3PZ3A 3UKRG 1HG5A 4ANWA 1QYMA 3T5XA 1HX8A 3E30A 3JYSA 2QYJA 3PRZA 5CHEE 1FCHA 1N4QA 1OUVA 2WXHA 4GA0A 3B13A 3GW4A 3O48A 4BT9A 1BI7B 2J07A 3TWSA 3CKCA 2VQ2A 4HI9A 3Q9NC 5ARFA 2X3MA 5CEAA 2Q7FA 1TJCA 1Z6TA 1K8KG 4XI9A 1INZA 3S2AA 3ABME 3KEZA 3ASNE 3PEUB 3DWLG 3ZFWA 5JJTA 3QK0A 3V2OA 2L0TB 3DBSA 3TXMA 3UQ3A 3EU5A 1NZNA 1QBQA 2YINA 3FTWA 3RRMB 3BG0B 5KJNA 2WQHA 2ILRA 2E2EA 2C0LA 3W9FA 1N4RA 2X6KA 3R7QA 4HFGA 1H19A 4I9CA 3UTMA 4AP2A 2GGFA 4K03A 4U63A 4AM9A 4FJZA 3PVLA 4JZYA 1TNBA 1H6OA 4N39A 1ZB1A 1U3DA 5CECB 2I2OA 2ONDA 5EDSA 4TUUA 2EIME 1KPSB 1FVHA 1NFIE 3FUIA 4LEUA 3GZSA 3ZU7B 3IEGA 2R59A 4GB9A 2LNIA 2WVIA 4AEZC 1Z5SC 3CIAA 3G2WA 4W9RA 5J08A 1SA5A 5CEDB 1JWFA 5DBKA 3DSXA 1X81A 4JB8P 4EBAG 4HRLA 2HE0A 4K5AB 2IQCA 2PZIA 2ETBA 4LSZE 3WXXA 4DI3A 3FEYA 2P9IG 3BQOA 3KSLA 2FULA 4DRXE 4YVQC 4DX2A 3I4GA 3SGHA 4HBDA 3B7UX 5KJLA 1SZ9A 1TN6A 3V30A 4PDXA 5CRUA 2ZGDA 5AYWD 5T8IA 2F37A 1P5QA 4GA2A 4YDEA 2UWJG 3J5QB 3QJZA 1LTXA 2Y4UA 2VSOE 3EHMA 2J4DA 2XEEA 4U96D 3URZA 2KCKA 3CV0A 4AJWA 1WY6A 3LDZA 3S7JA 3LPZA 4HRNA 3U64A 5FQ4A 3ABKE 3BU8A 2NC9A 2MYOA 4IULA 1TEZA 4CZ2D 3DSWA 3X2QE 2HM8A 3RIBA 4BT8A 3D9IA
chains in the Genus database with same CATH topology
4LERA 4N2QA 1U3CA 1E8WA 3JCKC 4KMOA 3CHQA 5EX0A 3TXNA 2YNQA 4APOA 3D9NA 4AY5A 4Y6CA 1IYGA 1MQSA 2JEKA 4XI0A 4GYYA 3B7SA 4HS2A 2Y4TA 3B7RL 1UJJA 3MA5A 4CT4A 4BX9A 4EZJA 1SQMA 4WNFA 1JUQA 4U04A 3ASFA 3CSTA 4ILGA 5AJDA 3JQ0A 3I4RB 3ZHEB 3CK8A 4JL0A 4WUYA 4GA1A 2I1JA 4KVOA 4XKCA 4Q69A 4HOSA 3LY9A 4ACKA 4YNDA 2X6JA 2VGYA 4JA7A 4KZ0A 2V5FA 4NRHB 4KBQA 4UQZA 3MEKA 1DNPA 3D9JA 4TRQA 4AIFA 2V8SE 1VDYA 3APCA 4GYWA 1E96B 4GPKA 3RO2A 4I6JA 4GZ5A 1OWNA 4A1GA 3P2BA 2OOEA 4DI4A 2DCPA 4OVUA 2KATA 2XHEA 4J8EA 4EZLA 1UN8A 2R5SA 3CHOA 3D9MA 4FULA 4I1OB 4UQYA 2MOWA 1HS6A 3VLEA 2XEVA 4H7XA 3IKOB 5FZQA 5FQ7A 4LUNU 3FFLA 3NF1A 3MV3B 4BTBA 2WQ6A 4KT6B 1E7VA 1NA3A 5FQ8A 3I3NA 2WXMA 3LCAA 4U07A 3ZXSA 2BUGA 3LY8A 4BTAA 2WXGA 4NURA 1JPLA 1XGWA 3KAEA 4N3CA 3DPDA 3VLFA 2I1KA 2A5UA 3S7FA 4ABNA 5CCMA 5LX8A 1E8ZA 4WNGA 4WAFA 4XE0A 3R9AB 2VTBA 2XCBA 5ANLA 3MCXA 3L22A 4B0ZA 3ZYLA 1JWGA 2YQ8A 5FQ6A 2VTBB 3D9LA 2XPYA 5C2YA 2BF0X 3CHRA 3IHVA 2GRLA 2J4BA 3FWVA 4NACA 2RG8A 3FP3A 1PY1A 3L16A 2XRYA 2I6HA 4OVVA 4F53A 4B89A 5A7DB 3RKVA 4L2LA 3QOUA 4UWKA 4JEHA 3TG5A 5FTPA 1N54A 1LF8A 2DIWA 5BT1A 3FU0A 3HHMA 2IONA 3T8MA 5CCLA 3CVWA 3GZ1A 3U4TA 3PEVB 4RG9A 4BSXA 4N3AA 3JUIA 4K0RA 4U0UA 4G1TA 5BNWA 3ZYQA 5C1DA 3CVYA 3HVEA 4OYSA 4U0ZA 2KZTA 4QFVA 3SNXA 4I6EA 4CDNA 3FU3A 4P29A 3ZYKA 4D10C 3PDNA 3HVEB 3P1UA 2IOLA 2KZTB 3HDXA 4CGWA 3MKQB 1BPOA 4BWRA 3L54A 2RD0A 4UWHA 3FTUA 3OTNA 3OAWA 4M3OA 5G05C 2VGXA 3FUJA 4CRWA 5ANRA 4DK5A 3VTYA 3CEQA 3UUXA 2NXPA 2UY1A 4F1SA 3CHPA 1OWLA 3LEWA 4Q96A 5JHAA 3SFZA 3CLJA 4JHRA 5AENA 2VGXB 3QDNA 3B7TA 5FJYA 2PL2A 3FUNA 3U66A 2UY1B 5LOZA 3PE4A 4BY6A 4MRUA 1WAO1 1E8XA 4UWGA 1ZBPA 3FUKA 1X5BA 1UW4B 1Y8MA 3BG1B 3SBSA 5G04C 3RJVA 1ELWA 4BFRA 4IN3B 2WXFA 4AXHA 3UX4A 2CHZA 3MJWA 3MGBA 4J6IA 2OVFA 2WXNA 4PS3A 3SHFA 3I5PA 4UQXA 2PQNA 4GZ3A 1H2VC 3FUFA 3NQPA 4AV7A 4DLQA 4L1BA 4Y6WA 5CMWA 2QY7A 1B89A 4GMLA 2PM6A 4WWNA 1UJKA 2OVBA 1MHQA 5LCWJ 3QB2A 3LY7A 4RVBA 2IU1A 4WWOA 5JJ6A 3RU0A 3MZLB 2OV8A 3CQGB 4G23A 3PE3A 3AU4A 2FEZA 2YHEA 3ZEFA 5LP0A 3FULA 3FUEA 2I9CA 4I2ZA 3FUDA 3L13A 3PNTB 2XRZA 2E0IA 3Q15A 2C0MA 4RSYA 4JC8A 3ZHEA 3QC1A 3FDHA 2FI7A 4JHJA 1NP7A 3G2SA 4UWLA 4HOTA 4ILIA 3ONLA 4EQFA 4UI9K 2MHKA 1PAQA 4YVOA 2CFUA 2A4ZA 2FBNA 2AXUA 3QARA 3UT4A 3RRUA 1HU3A 4I9EA 3VLDA 3SZ7A 4KZCA 3LVRE 4UI9J 3UT7A 1HE8A 2AVPA 4ME2A 4L2YA 4NQ0A 3U3WA 1SZAA 2PQRA 3ZIMA 1PC2A 3ZN3A 2WB2A 4O6FA 1HG2A 4GCOA 3BEEA 1QZ2A 3QWWA 3ML9A 3L08A 4N5CA 3HYMB 1WM5A 2KCVA 2PM7A 1IQUA 2Y3AA 4PUCA 5G55A 3FH8A 1E8YA 3SBTB 1QQEA 1EYHA 1H0AA 5M72A 5KCMA 4HOUA 4GZ6A 4HXIA 3TAXA 2XGOA 4A1SA 2CHWA 2J09A 3IV0A 4GYOA 4APFA 5BV1A 2FF4A 3SI5A 2WXKA 4HOQA 2ZU6B 5DIZA 3U9WA 4JHKA 3CVVA 4Q94A 4GZDA 3MYVA 2WXIA 4C9BB 3LJ3A 3CR3A 1HG5A 4ANWA 2L6JA 2WMOA 1KLXA 4ATGA 3T5XA 1HX8A 3CHSA 3JYSA 3CVXA 4PH4B 2XCCA 3PRZA 5CHEE 3D9KA 4GAAA 2V4LA 1FCHA 4EECA 2AXZA 1OUVA 2WXHA 3AU5A 2AWIA 4GA0A 3B13A 4XKBA 3GW4A 3O48A 1W3BA 4BT9A 3ESKA 1OWPA 3KS2A 4GU5A 2J07A 5G2NA 3G2TA 1UN9A 3K9IA 4B8AA 2M63A 3CKCA 5BV0A 4GCNA 3LKUA 4TV3A 3O4ZA 4C0MA 2WXOA 3CK7A 2XQ0A 2VQ2A 3FTVA 4KXKB 1KT1A 4BX8A 2VYIA 5ARFA 2XPZA 1XNFA 3MKQA 3ML8A 4GMJA 4PS7A 3SD5A 2WMNA 3CK9A 2X3MA 4JVSA 2Q7FA 1TJCA 4JPSA 1Z6TA 2WXQA 2IF4A 2LSUA 2JLBA 4XI9A 4G24A 3QAQA 3FUMA 1INZA 3T5VA 3S2AA 4MS6A 3APDA 4LCTA 1YA0A 3KEZA 3PEUB 4MKTA 3E4BA 3ZFWA 5JHBA 3ULQA 2KC7A 5JJTA 3QK0A 4FU3A 3CVQA 2LSVA 3G2VA 3ASHA 3NZSA 3CKBA 2L0IA 3PS6A 2L0TB 3DBSA 4FC8A 3TXMA 3UQ3A 1NZNA 1L5JA 2CHXA 2X6IA 2YINA 3D9PA 3FTWA 3CVUA 3RRMB 4CCAA 3BG0B 3PH0C 2AW6A 5KJNA 4CGVA 4HORA 3HIZA 4XZ4A 2XGMA 3FU5A 1OWOA 3TG4A 1S0PA 2WQHA 3LVQE 4UI9C 2ILRA 2IFUA 2E2EA 3IHYA 4WWPA 3QKYA 2C0LA 3OXFA 5AJLA 2KCLA 3GYZA 3OXGA 2X6KA 4V3IA 2VSXE 3R7QA 3PUJA 3Q49B 5ARGA 2KM4A 5EKQD 3NZUA 2J9QA 2FO7A 4HFGA 1H19A 4I9CA 2LAIA 2P58C 3CVPA 4AP2A 2GGFA 3ZVVA 4JEUA 2X38A 3AS8A 4K03A 1H2UA 2XGSA 4U63A 4FJZA 5FT9A 5CMYA 4AM9A 4EZKA 3EIJA 4JW1A 2IJGX 3TL5A 1DVPA 3PVLA 4JZYA 5G05J 3FTSA 1Z3YA 2YHCA 4EBAA 3KD7A 3FTZA 5FZRA 1ELRA 4N39A 4HVBA 2VSNA 3FH7A 4DJAA 1QNFA 3LYAA 3Q5MA 1ELKA 4R7LA 1U3DA 3CVLA 3R7RA 1HXIA 2I2OA 2ONDA 5EDSA 3QWVA 4FJYA 4G11A 4ACLA 4TUUA 4F3VA 5FWQA 1FVHA 4C0EA 3Q47B 4LEUA 3FUIA 3GZSA 2XPIA 5G04J 3JQ1A 3IEGA 4CDRA 3TJPA 4DPRA 4L7TA 2R59A 3ASGA 2LNIA 1FVFA 2HO1A 4G25A 2WXRA 4GB9A 4I6GA 4KYOB 2AXVA 2WVIA 4AEZC 3ZW3A 3CIAA 3IBEA 3G2WA 4W9RA 4I1MA 1Y6IA 5J90A 5J08A 4E85A 3ENEA 4ILHB 4G26A 4RG6A 4ANVA 1E7UA 3QNKA 4EPZA 1JWFA 2R17C 5DBKA 3ONKA 5E76A 4GZCA 4FLBA 3FUHA 3ZGQA 3FHEA 2J08A 1IHGA 4HLEA 4J0UA 5D0OD 4EBAG 4N2SA 3FY4A 4KVMA 3ZPJA 2WXLA 1GW6A 2IQCA 2PZIA 3TGOA 3MV2B 4A55A 5ENNA 3WXXA 4DI3A 5BW8C 3FEYA 1UG3A 4WNEA 4CEMA 5A23A 2VSYA 4CDMA 2X6FA 4J8SA 2MRIA 5T4YA 2FULA 1H6KA 1KT0A 3CQCB 2WQ7A 4FADA 2L9BA 4YVQC 3I4GA 3RRNB 5T3RA 3SGHA 4B8CB 3PZDA 3APFA 1HZ4A 1Z3XA 3MKRA 4U0SA 3B7UX 5LFAA 5BPPA 2EQXA 3CSFA 3FTYA 5KJKA 4U8HA 3CGHA 4XX5A 2C2LA 3FU6A 3MX3A 2X6HA 4E6HA 3FEXA 3OXLA 4JXTA 5KJLA 1HH8A 4A3TA 2J49A 1SZ9A 3PNLB 4UWFA 3D3MA 3FTXA 3L6AA 1IQRA 2LO6A 4IRUA 4PDXA 1NA0A 5AYWD 5T8IA 3EIQC 2VJ8A 4AY6A 4ANUA 5A6CA 2WXJA 3UT8A 4WNDA 4J8DA 3ZYMA 3EDTB 3LS8A 4XIFA 5LCWC 4I2WA 5HI7A 2HR2A 2IOSA 4J8FA 4I17A 4FP7A 1P5QA 4JA9A 4GA2A 3UPVA 2CG2A 3PREA 1EF1C 2UWJG 4LRZA 3PUKA 2GW1A 3GZ2A 3UMVA 4I1AA 3QJZA 5FZSA 5EX3A 5JJ7A 2CFZA 2Y4UA 1E90A 2VSOE 2DBAA 4DLOA 3Q4AB 5KJMA 4FHKA 3EHMA 4L23A 2J4DA 2WXPA 5E75A 4ANXA 4FA6A 5HQ8A 1HFAA 3URZA 1H2TC 3EJNA 2KCKA 3CVNA 2QFCA 3ASDA 1HO8A 3AS5A 1ZU2A 3S7DA 2NSZA 4F7AA 3CV0A 3S7BA 3ESLA 4G2VA 2WPVA 4FHJA 4AJWA 3CHMA 1WY6A 3LDZA 3S7JA 3LPZA 5AIJA 1OWMA 1N52A 5FQ4A 4H7YA 3U64A 2LAHA 4MLPA 5BUZA 3C98A 2NC9A 4URKA 2HYZA 4IULA 4CT0A 3QWPA 4I43A 1TEZA 3D9OA 1TJFA 3G2UA 5D0QD 3L17A 3RK6A 2BTDA 3ZRHA 2GRMA 4AOFA 3RO3A 1EPUA 2CG3A 4N3BA 3N71A 4FLHA 3VTXA 2HM8A 4AVXA 3FH5A 4A3VA 3LXUX 4PS8A 1EDUA 1A17A 1HF8A 2WM9A 3EHNA 4IYPA 2V0PA 3RIBA 4BT8A 3D9IA 3AS4A 4B94A 3SF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N2Q A;  5EX0 A;  4APO A;  4AY5 A;  4Y6C A;  1IYG A;  4XI0 A;  4GYY A;  2Y4T A;  3MA5 A;  4WNF A;  4U04 A;  3ASF A;  3ZHE B;  3CK8 A;  4JL0 A;  4WUY A;  4GA1 A;  4HOS A;  3LY9 A;  4YND A;  2VGY A;  4JA7 A;  4NRH B;  2V5F A;  4KBQ A;  4UQZ A;  3MEK A;  4AIF A;  4GPK A;  4GYW A;  1E96 B;  3RO2 A;  4GZ5 A;  2OOE A;  2KAT A;  4J8E A;  2R5S A;  4UQY A;  2XEV A;  4H7X A;  5FZQ A;  3FFL A;  3NF1 A;  3MV3 B;  4BTB A;  1NA3 A;  4BTA A;  3LCA A;  4U07 A;  2BUG A;  3LY8 A;  3KAE A;  4N3C A;  4HOT A;  4ABN A;  3S7F A;  5CCM A;  4WNG A;  3R9A B;  2XCB A;  2YQ8 A;  3FWV A;  3FP3 A;  2I6H A;  5A7D B;  3RKV A;  3QOU A;  3TG5 A;  5FTP A;  5BT1 A;  5CCL A;  3GZ1 A;  3U4T A;  4RG9 A;  4N3A A;  5BNW A;  4U0U A;  4G1T A;  5C1D A;  4U0Z A;  3PDN A;  4CGW A;  4BWR A;  5G05 C;  2VGX A;  3VTY A;  3UUX A;  3CEQ A;  2UY1 A;  4JHR A;  2VGX B;  3QDN A;  5FJY A;  2PL2 A;  2UY1 B;  3PE4 A;  1WAO 1;  1ZBP A;  1Y8M A;  5G04 C;  3RJV A;  1ELW A;  4IN3 B;  4UQX A;  2PQN A;  4GZ3 A;  4Y6W A;  1B89 A;  5LCW J;  5JJ6 A;  3LY7 A;  3RU0 A;  4G23 A;  3PE3 A;  2FEZ A;  4I2Z A;  3Q15 A;  2C0M A;  3ZHE A;  2FI7 A;  4EQF A;  4UI9 K;  2MHK A;  4YVO A;  2FBN A;  4I9E A;  3SZ7 A;  4UI9 J;  2AVP A;  4ME2 A;  4NQ0 A;  3U3W A;  2PQR A;  1PC2 A;  3ZN3 A;  4O6F A;  4GCO A;  3BEE A;  1QZ2 A;  3QWW A;  4N5C A;  3HYM B;  1WM5 A;  2KCV A;  1QQE A;  5M72 A;  4A1S A;  4HOU A;  4GZ6 A;  3TAX A;  2XGO A;  4GYO A;  2FF4 A;  4HOQ A;  5DIZ A;  2L6J A;  1KLX A;  3JYS A;  2XCC A;  5CHE E;  1FCH A;  1OUV A;  4GA0 A;  3GW4 A;  3O48 A;  1W3B A;  4BT9 A;  3ESK A;  3KS2 A;  3K9I A;  3CKC A;  4GCN A;  3LKU A;  3CK7 A;  2VQ2 A;  4KXK B;  1KT1 A;  2VYI A;  5ARF A;  1XNF A;  3CK9 A;  2Q7F A;  1TJC A;  2IF4 A;  2LSU A;  2JLB A;  4XI9 A;  4G24 A;  1YA0 A;  3E4B A;  3ZFW A;  3ULQ A;  2KC7 A;  5JJT A;  3CVQ A;  2LSV A;  3ASH A;  3CKB A;  3UQ3 A;  1NZN A;  5KJN A;  4CGV A;  4HOR A;  2XGM A;  3TG4 A;  2WQH A;  4UI9 C;  2IFU A;  2E2E A;  3QKY A;  2C0L A;  3OXF A;  2KCL A;  3GYZ A;  3OXG A;  3Q49 B;  5ARG A;  5EKQ D;  2J9Q A;  2FO7 A;  4I9C A;  2P58 C;  3CVP A;  3AS8 A;  2XGS A;  5FT9 A;  4AM9 A;  5G05 J;  2YHC A;  3KD7 A;  5FZR A;  1ELR A;  4N39 A;  2VSN A;  3LYA A;  3Q5M A;  3CVL A;  1HXI A;  2OND A;  3QWV A;  4F3V A;  3Q47 B;  4LEU A;  2XPI A;  5G04 J;  3IEG A;  4CDR A;  3ASG A;  2LNI A;  2HO1 A;  4KYO B;  4G25 A;  4W9R A;  4RG6 A;  4G26 A;  5DBK A;  3ZGQ A;  1IHG A;  4J0U A;  5D0O D;  4N2S A;  3ZPJ A;  2PZI A;  3TGO A;  3MV2 B;  3WXX A;  5BW8 C;  4WNE A;  2VSY A;  1KT0 A;  4YVQ C;  1HZ4 A;  3MKR A;  4U0S A;  5KJK A;  2C2L A;  5KJL A;  3OXL A;  1HH8 A;  1NA0 A;  5AYW D;  4AY6 A;  5A6C A;  4WND A;  4J8D A;  3EDT B;  4XIF A;  5LCW C;  4I2W A;  5HI7 A;  2HR2 A;  4J8F A;  4I17 A;  4JA9 A;  1P5Q A;  4GA2 A;  3UPV A;  2UWJ G;  2GW1 A;  3GZ2 A;  4I1A A;  5FZS A;  5EX3 A;  5JJ7 A;  2Y4U A;  2DBA A;  3Q4A B;  5KJM A;  5HQ8 A;  3URZ A;  2KCK A;  3CVN A;  2QFC A;  3ASD A;  3AS5 A;  1ZU2 A;  3S7D A;  3CV0 A;  3S7B A;  4G2V A;  2WPV A;  3S7J A;  3LPZ A;  4H7Y A;  2NC9 A;  2HYZ A;  3QWP A;  5D0Q D;  3RO3 A;  4N3B A;  3N71 A;  3VTX A;  1A17 A;  3RIB A;  4BT8 A;  3AS4 A;  4B94 A;  3SF4 A; 
#chains in the Genus database with same CATH topology
 4KMO A;  3TXN A;  4Y6C A;  1IYG A;  2EIN E;  2DWZ A;  1JUQ A;  4ILG A;  2DZO A;  4JL0 A;  4QQI A;  4WUY A;  4LNB A;  4HOS A;  4Q69 A;  2VGY A;  1DNP A;  1VDY A;  3APC A;  5IY5 E;  1OWN A;  4A1G A;  4DI4 A;  4FUL A;  2R2L A;  2XEV A;  3KSQ A;  3IKO B;  4LUN U;  3Q79 A;  1IHB A;  3ZKJ A;  1E7V A;  1SVX A;  2Y0B G;  2BUG A;  3KAE A;  4HOT A;  4ABN A;  2I1K A;  3S7F A;  5CCM A;  1E8Z A;  4WAF A;  3R9M A;  2H6G A;  4GTM A;  5ANL A;  4B0Z A;  3ZYL A;  5C2Y A;  2GRL A;  3V79 K;  1O1S A;  4NAC A;  2RG8 A;  4X8Q A;  2XRY A;  4F6R D;  5A7D B;  4L2L A;  2QYU A;  3CVW A;  3GZ1 A;  3U4T A;  4RG9 A;  3IXE A;  4U0U A;  2Y1L E;  3HVE A;  1V55 E;  4OYS A;  4U0Z A;  3ZYK A;  3PDN A;  3E34 A;  3HVE B;  2H6H A;  3HDX A;  4CGW A;  4BWR A;  3PZ4 A;  4GTO A;  4XEI G;  5D66 A;  4UWH A;  3FTU A;  4M3O A;  3VTY A;  3CEQ A;  2UY1 A;  3CHP A;  3UIP C;  2PL2 A;  3FUN A;  2UY1 B;  4UWG A;  3FUK A;  3RJV A;  3ZXP A;  5CRV A;  4AXH A;  4J6I A;  2WXN A;  3SHF A;  2GRR B;  2OCC E;  4L1B A;  1B89 A;  5JJ6 A;  2OV8 A;  3L9T A;  2YHE A;  3FUE A;  3L13 A;  3DSS A;  3Q9U C;  1OCC E;  4JHJ A;  4ILI A;  5B1A E;  2FBN A;  1NL4 A;  3PZ1 A;  3LVR E;  1HE8 A;  1SZA A;  3ASO E;  4GCO A;  3DEP A;  1QZ2 A;  3L08 A;  2LXM A;  3HYM B;  1E8Y A;  1S64 A;  1A5E A;  1H0A A;  1JCS A;  5KCM A;  4UUC A;  2XGO A;  2CHW A;  4GYO A;  1FT1 A;  5BV1 A;  2FF4 A;  4Q94 A;  4GZD A;  3MYV A;  3CR3 A;  1KLX A;  3CVX A;  3D9K A;  4GAA A;  2AXZ A;  2ETC A;  1RZ4 A;  4HQD A;  3AG4 E;  1W3B A;  1BI8 B;  2QZA A;  3ESK A;  1RW2 A;  4JD2 G;  5G2N A;  1UN9 A;  3LKU A;  2V4H C;  1MX6 A;  5CER B;  3CK7 A;  2XQ0 A;  3FTV A;  3NOC D;  4KXK B;  4GMJ A;  3TWU A;  1XNF A;  3ML8 A;  4L9P A;  3SD5 A;  3CK9 A;  3PZ2 A;  4ZFH A;  2JLB A;  3T5V A;  1YA0 A;  3E4B A;  4Z68 A;  5JHB A;  3TWW A;  4FU3 A;  3CVQ A;  1U2V G;  3NZS A;  5AQ9 A;  1H6P A;  2OEV A;  3D9P A;  3EHR A;  4ATZ D;  2DYS E;  4XZ4 A;  3AG3 E;  2XGM A;  4GTQ A;  2JAB A;  3QKY A;  3OXF A;  3SFY A;  3GYZ A;  4V3I A;  2VSX E;  2LUH A;  3NZU A;  2FO7 A;  2LAI A;  2P58 C;  3CVP A;  3DSU A;  4JEU A;  3L82 A;  5CMY A;  4EZK A;  1FPP A;  1DVP A;  5G05 J;  3FTS A;  1Z3Y A;  3KD7 A;  4B93 B;  5KNH D;  3FH7 A;  4DJA A;  1KZO A;  3CVL A;  1BU9 A;  5EYL A;  3QWV A;  4ACL A;  4G11 A;  2F8X K;  1KZP A;  2B0O E;  3Q47 B;  1BD8 A;  5CBO A;  5G04 J;  3B95 A;  3TJP A;  4G25 A;  3ZW3 A;  1IXV A;  5EYP F;  3ENE A;  4ILH B;  3EHQ A;  2R17 C;  3ONK A;  3FHE A;  4KVM A;  3ZPJ A;  2WXL A;  3TGO A;  4C48 B;  3MV2 B;  1S70 B;  4A55 A;  5ENN A;  5BW8 C;  4WNE A;  2VSY A;  2X6F A;  4J8S A;  3KEA A;  2MRI A;  5T4Y A;  3ZUV B;  3CQC B;  4O60 A;  3NOG D;  1WDY A;  5T3R A;  3PZD A;  4B8C B;  4U0S A;  5BPP A;  2BED A;  5KJK A;  2C2L A;  3FU6 A;  2X6H A;  4E6H A;  3FEX A;  4A3T A;  4UWF A;  3L6A A;  1IQR A;  4IRU A;  3EIQ C;  4AY6 A;  2ZXW E;  4ANU A;  4J8D A;  2PNN A;  4I2W A;  4I17 A;  2R05 A;  1EF1 C;  2GW1 A;  2CFZ A;  2DBA A;  4DLO A;  3Q4A B;  4FHK A;  4L23 A;  4FA6 A;  2WXP A;  5HQ8 A;  1H2T C;  3CVN A;  2NSZ A;  3ESL A;  3CHM A;  5AIJ A;  4MLP A;  3DEO A;  5HRY A;  3QWP A;  4I43 A;  1UOH A;  1MX2 A;  1DCQ A;  5D0Q D;  3RK6 A;  3ZRH A;  2GRM A;  1EPU A;  2CG3 A;  4AVX A;  3FH5 A;  3LXU X;  4PS8 A;  1SA4 A;  4TUM A;  1OCZ E;  1U3C A;  3JCK C;  2YNQ A;  2H6I A;  1K1A A;  5AN8 A;  4XI0 A;  4GYY A;  3B7S A;  4HS2 A;  3B7R L;  1UJJ A;  4BX9 A;  4EZJ A;  1SQM A;  4WNF A;  3DXK G;  3CK8 A;  4GA1 A;  4KVO A;  3LY9 A;  5JMN D;  4GTS A;  4KZ0 A;  4UQZ A;  3MEK A;  3D9J A;  1O1T A;  1E96 B;  4I6J A;  3AG2 E;  2DCP A;  4OVU A;  4I1O B;  3D9M A;  4UQY A;  2MOW A;  3VLE A;  2GRP B;  2WXM A;  1DCE A;  3LCA A;  3LY8 A;  4NUR A;  3DPD A;  1S63 A;  4WNG A;  2EIJ E;  3MCX A;  1JWG A;  3CHR A;  2J4B A;  3FWV A;  3L16 A;  2VGE A;  1OCO E;  4F53 A;  4B89 A;  4MBG A;  4TXQ A;  1V54 E;  1AWC B;  4UWK A;  5ENS D;  1LF8 A;  2DIW A;  5BT1 A;  3HHM A;  3Q7A A;  5HKP A;  3PEV B;  4YDY A;  4N3A A;  3JUI A;  4G1T A;  3SNX A;  1G3N B;  3FU3 A;  4P29 A;  2IOL A;  3MKQ B;  1BPO A;  4DX5 D;  5FIN A;  3OTN A;  5G05 C;  3FUJ A;  5D2M C;  5ANR A;  4F1S A;  3SFZ A;  4JHR A;  3U66 A;  1TN7 A;  5JA4 D;  4BY6 A;  4MRU A;  1WAO 1;  1UW4 B;  4GMR A;  5G04 C;  4EHM A;  2WXF A;  3UX4 A;  3DSV A;  4UQX A;  2PQN A;  2RKK A;  4GZ3 A;  3FUF A;  4Y6W A;  2PM6 A;  4RQI A;  4CYM D;  3QB2 A;  3LY7 A;  4RVB A;  3CQG B;  4G23 A;  3RAU A;  3PE3 A;  5BXU A;  5KWD A;  1N0R A;  3ZEF A;  2FO1 E;  3FUD A;  2C0M A;  4JC8 A;  3EUV A;  3QC1 A;  2P9N G;  1N4P A;  1NP7 A;  3G2S A;  3ONL A;  5ITZ F;  1PAQ A;  4YVO A;  3QAR A;  5AQB A;  4I9E A;  4KZC A;  4ME2 A;  4L2Y A;  4NQ0 A;  3ZIM A;  2PQR A;  3ZN3 A;  3QWW A;  1IQU A;  3SBT B;  1QQE A;  1EYH A;  5M72 A;  1MX4 A;  4GZ6 A;  3HXF A;  3IV0 A;  1JCR A;  4APF A;  2ZU6 B;  3U9W A;  4JHK A;  2WXI A;  2L6J A;  4ATG A;  4EEC A;  4M7C A;  2AWI A;  1MYO A;  3V2X A;  1TNY A;  5ENT D;  4GU5 A;  1K3Z D;  3K9I A;  4B8A A;  2M63 A;  4GCN A;  4TV3 A;  1WG0 A;  2WXO A;  5B3S E;  1LD7 A;  1BLX B;  4BX8 A;  2L6B A;  4PS7 A;  2WMN A;  4DX7 D;  5EN5 D;  1YMP A;  4G24 A;  3UKU G;  1DC2 A;  2F8Y A;  3QAQ A;  3FUM A;  3APD A;  2IY0 C;  4LCT A;  4GPM A;  3ULQ A;  3C3O A;  3G2V A;  3CKB A;  3PS6 A;  1TNU A;  4OAU C;  1L5J A;  2CHX A;  2X6I A;  3AJI A;  5ENQ D;  4CGV A;  3HIZ A;  3TG4 A;  4UI9 C;  2A5E A;  2IFU A;  5AJL A;  2KCL A;  1MJ0 A;  3PUJ A;  3Q49 B;  5ARG A;  5B1B E;  2KM4 A;  2J9Q A;  4G8L A;  3ZVV A;  2X38 A;  3C72 A;  5FT9 A;  4YDW A;  4BEP A;  3EIJ A;  4JW1 A;  2IJG X;  3TL5 A;  4EBA A;  2R03 A;  1ELR A;  2VSN A;  3UM2 A;  3Q5M A;  1ELK A;  4R7L A;  1HXI A;  4FJY A;  5FWQ A;  5ENP D;  2XPI A;  2BKG A;  1Q2Z A;  4KYO B;  3LJN A;  1N95 A;  2AXV A;  3F6Q A;  3IBE A;  4I1M A;  1Y6I A;  2XZD G;  1FT2 A;  5J90 A;  4E85 A;  4G26 A;  4EPZ A;  5E76 A;  4GZC A;  4FLB A;  3FUH A;  1N9A A;  3ZGQ A;  5EID A;  1IHG A;  4N2S A;  3FY4 A;  2DYR E;  1GW6 A;  5KNG A;  1UG3 A;  4CEM A;  1H6K A;  1KT0 A;  2WQ7 A;  4FAD A;  2P9L G;  4U7E B;  1K1B A;  3APF A;  2P9K G;  3MKR A;  2EQX A;  3CSF A;  3FTY A;  4N5Q A;  4U8V D;  4U8H A;  3CGH A;  4XX5 A;  3MX3 A;  1TNZ A;  4JXT A;  3PNL B;  4HLL A;  3D3M A;  3FTX A;  2LO6 A;  3EU9 A;  2WXJ A;  4WND A;  3EDT B;  1N4S A;  4XIF A;  5AQ7 A;  5HI7 A;  2IOS A;  2EIL E;  4J8F A;  3GZ2 A;  3UMV A;  4I1A A;  5JJ7 A;  2AJA A;  1OY3 D;  5KJM A;  5E75 A;  4ANX A;  1HFA A;  3ASD A;  1HO8 A;  3AS5 A;  1ZU2 A;  4HNA D;  3S7B A;  4FHJ A;  2XS8 A;  1OWM A;  3E32 A;  1N52 A;  5BUZ A;  2LAH A;  4BER A;  4URK A;  2HYZ A;  3UIO C;  2ZGG A;  4RLY A;  4GTP A;  3D9O A;  1TJF A;  3L17 A;  2XS1 A;  3RO3 A;  5EIL A;  4G8K A;  4BSZ B;  1EDU A;  1A17 A;  1HF8 A;  2V0P A;  3AS4 A;  4B94 A;  4LER A;  2P9U G;  4N2Q A;  2OEW A;  1LD8 A;  3UI2 A;  4HB5 A;  2JEK A;  4YDO A;  2Y4T A;  4CT4 A;  3DXM G;  5AJD A;  3CST A;  3JQ0 A;  3ZHE B;  3DRA A;  2X6J A;  2XZT G;  4KBQ A;  4TRQ A;  4GPK A;  4GZ5 A;  2OOE A;  4J8E A;  3CHO A;  2R5S A;  1HS6 A;  4H7X A;  5FZQ A;  5FQ7 A;  3FFL A;  2IEJ A;  3MV3 B;  4BTB A;  3C5R A;  2WQ6 A;  4KT6 B;  5H7P A;  1NA3 A;  5FQ8 A;  2P9S G;  4BTA A;  1IKN D;  1JPL A;  2A5U A;  5BXO A;  3R9A B;  2VTB A;  3D9H A;  2J8S D;  4DX1 A;  5FQ6 A;  2VTB B;  2XPY A;  2BF0 X;  3IHV A;  2P9P G;  3ULE G;  3FP3 A;  4OVV A;  1MZC A;  3RKV A;  1NI1 A;  1N54 A;  3FU0 A;  3T8M A;  2ION A;  2DZN A;  1JCQ A;  4TXP A;  5CCL A;  3Q73 A;  4K0R A;  3ZYQ A;  5C1D A;  3CVY A;  2KZT A;  3HRA A;  3P1U A;  2KZT B;  2NYJ A;  5KBA A;  3OAW A;  2VGX A;  4CRW A;  1OWL A;  3LEW A;  5AEN A;  2VGX B;  3QDN A;  4BES A;  3B7T A;  5FJY A;  1E8X A;  1ZBP A;  1X5B A;  1Y8M A;  3BG1 B;  3HXD A;  4LNG A;  2CHZ A;  3MJW A;  4AV7 A;  4DLQ A;  5CMW A;  4WWN A;  1UJK A;  3RSE G;  2OVB A;  1MHQ A;  3TWQ A;  5LCW J;  3HXE A;  3HXB A;  2FEZ A;  3BUA A;  3FUL A;  4I2Z A;  2I9C A;  3Q15 A;  4RSY A;  2FI7 A;  4UWL A;  4EQF A;  4O1O A;  2ETA A;  1HU3 A;  3VLD A;  2GRQ B;  3SZ7 A;  4UI9 J;  3UT7 A;  2AVP A;  3U3W A;  3NB2 A;  1PC2 A;  4O6F A;  1HG2 A;  3BEE A;  4U8Y D;  2PM7 A;  3E37 A;  2Y3A A;  2ZIR A;  2RFM A;  4A1S A;  4HOU A;  2J09 A;  5EIB E;  3SI5 A;  4HOQ A;  3CVV A;  3T9K A;  3LJ3 A;  2WMO A;  4K5B A;  3CHS A;  2B6C A;  4PH4 B;  2XCC A;  2QC9 A;  2V4L A;  3AU5 A;  2BKK B;  4XKB A;  4O1P A;  3UIN C;  1OWP A;  3KS2 A;  3G2T A;  5BV0 A;  3O4Z A;  4C0M A;  1KT1 A;  2VYI A;  2XPZ A;  3MKQ A;  3TWV A;  4JVS A;  4JPS A;  5AQA A;  2WXQ A;  2IF4 A;  2LSU A;  4MS6 A;  5CBN A;  1N0Q A;  4MKT A;  4TXR A;  2KC7 A;  3NAW A;  4F1P A;  2LSV A;  3ASH A;  1SW6 A;  3UXG A;  2L0I A;  4FC8 A;  3ISM C;  3CVU A;  2XEH A;  4CCA A;  3PH0 C;  2AW6 A;  2R02 A;  4HOR A;  3FU5 A;  3DPY A;  1OWO A;  1S0P A;  3LVQ E;  3IHY A;  4WWP A;  3OXG A;  3Q78 A;  5EKQ D;  3UM0 A;  1OCR E;  1AP7 A;  2GRO B;  3AS8 A;  1H2U A;  2XGS A;  3V31 A;  2YHC A;  3FTZ A;  2LXL A;  5FZR A;  3W9G A;  4HVB A;  1QNF A;  3LYA A;  3R7R A;  4F3V A;  3C3R A;  1D8D A;  1OT8 A;  4C0E A;  3JQ1 A;  4CDR A;  4DPR A;  4L7T A;  3ASG A;  4I6G A;  1FVF A;  2HO1 A;  2WXR A;  4J7W A;  3UM3 A;  3ULY A;  2KBX A;  4ANV A;  4RG6 A;  3C3Q A;  3DST A;  1E7U A;  3QNK A;  3T8K A;  3SY2 A;  2J08 A;  4HLE A;  2GRN B;  4J0U A;  5D0O D;  4DX6 D;  5A23 A;  2ZIS A;  4CDM A;  2L9B A;  3RRN B;  3JXI A;  1HZ4 A;  1Z3X A;  5LFA A;  3AAA C;  3OXL A;  1HH8 A;  2P2C P;  3B7B A;  2J49 A;  1NA0 A;  5AAO A;  2VJ8 A;  4NIK A;  5A6C A;  3UT8 A;  3ZYM A;  3LS8 A;  5LCW C;  2HR2 A;  4K5C A;  4FP7 A;  4JA9 A;  3UPV A;  2CG2 A;  2IO3 C;  3PRE A;  4LRZ A;  5AAR A;  3PUK A;  2F0Y A;  2XEN A;  5FZS A;  5EX3 A;  1N94 A;  1E90 A;  4J8Y A;  4GTV A;  3EJN A;  2RFA A;  2QFC A;  3S7D A;  4F7A A;  4G2V A;  2WPV A;  4H7Y A;  3C98 A;  4CT0 A;  3G2U A;  2BTD A;  4AOF A;  4N3B A;  3N71 A;  4FLH A;  3NBN B;  3VTX A;  4A3V A;  2WM9 A;  3ABL E;  3EHN A;  4IYP A;  5ENO D;  3SF4 A;  1E8W A;  3CHQ A;  5EX0 A;  4APO A;  3D9N A;  1YCS B;  4A63 B;  4AY5 A;  1MQS A;  3MA5 A;  3TWR A;  1TR4 A;  4U04 A;  3ASF A;  1TN8 A;  3I4R B;  3J5P A;  2I1J A;  4XKC A;  4ACK A;  4BET A;  4YND A;  4NRH B;  4JA7 A;  2V5F A;  4AIF A;  2V8S E;  4GYW A;  3RO2 A;  3E33 A;  3P2B A;  1YYH A;  4DUI A;  2KAT A;  2XHE A;  4EZL A;  1UN8 A;  4GTR A;  5ENR D;  1O5M A;  4LNU D;  3NF1 A;  2IO2 C;  3I3N A;  2V5Q C;  4U07 A;  3JXJ A;  3ZXS A;  2WXG A;  1XGW A;  3VLF A;  4N3C A;  5LX8 A;  3ZNG A;  4XE0 A;  2XCB A;  2EIK E;  3L22 A;  2YQ8 A;  3D9L A;  1PY1 A;  3WG7 E;  2I6H A;  2KXP C;  5FIO A;  3QOU A;  4JEH A;  3TG5 A;  5FTP A;  3TWT A;  1D8E A;  1TNO A;  3SFX A;  4BSX A;  5BNW A;  4QFV A;  4CDN A;  4I6E A;  4D10 C;  1TYQ G;  3JUE A;  3Q7F A;  3L54 A;  2RD0 A;  3HXC A;  4DK5 A;  3UUX A;  2NXP A;  4Q96 A;  5JHA A;  3CLJ A;  5LOZ A;  3PE4 A;  3SO8 A;  3SBS A;  1N11 A;  1ELW A;  1O1R A;  4BFR A;  4IN3 B;  2H6F A;  3MGB A;  2OVF A;  4PS3 A;  3I5P A;  3SQV A;  1H2V C;  1OXJ A;  3NQP A;  4LG6 A;  2QY7 A;  4GML A;  4WWO A;  3RU0 A;  2IU1 A;  3MZL B;  3AU4 A;  5LP0 A;  5HS0 A;  3PNT B;  2XRZ A;  2E0I A;  3ZHE A;  3FDH A;  4UI9 K;  4HRM B;  2MHK A;  3TWX A;  2CFU A;  2A4Z A;  3UT4 A;  2AXU A;  3RRU A;  3HG0 D;  3UM1 A;  4HI8 A;  2WB2 A;  3AG1 E;  4ZHB A;  3ML9 A;  4N5C A;  5G55 A;  1WM5 A;  2KCV A;  4PUC A;  2Y69 E;  3FH8 A;  1D9S A;  3Q75 A;  4U95 D;  4HXI A;  3TAX A;  4OAV B;  4GTT A;  2WXK A;  5DIZ A;  2DVW A;  4C9B B;  3PZ3 A;  3UKR G;  1HG5 A;  4ANW A;  1QYM A;  3T5X A;  1HX8 A;  3E30 A;  3JYS A;  2QYJ A;  3PRZ A;  5CHE E;  1FCH A;  1N4Q A;  1OUV A;  2WXH A;  4GA0 A;  3B13 A;  3GW4 A;  3O48 A;  4BT9 A;  1BI7 B;  2J07 A;  3TWS A;  3CKC A;  2VQ2 A;  4HI9 A;  3Q9N C;  5ARF A;  2X3M A;  5CEA A;  2Q7F A;  1TJC A;  1Z6T A;  1K8K G;  4XI9 A;  1INZ A;  3S2A A;  3ABM E;  3KEZ A;  3ASN E;  3PEU B;  3DWL G;  3ZFW A;  5JJT A;  3QK0 A;  3V2O A;  2L0T B;  3DBS A;  3TXM A;  3UQ3 A;  3EU5 A;  1NZN A;  1QBQ A;  2YIN A;  3FTW A;  3RRM B;  3BG0 B;  5KJN A;  2WQH A;  2ILR A;  2E2E A;  2C0L A;  3W9F A;  1N4R A;  2X6K A;  3R7Q A;  4HFG A;  1H19 A;  4I9C A;  3UTM A;  4AP2 A;  2GGF A;  4K03 A;  4U63 A;  4AM9 A;  4FJZ A;  3PVL A;  4JZY A;  1TNB A;  1H6O A;  4N39 A;  1ZB1 A;  1U3D A;  5CEC B;  2I2O A;  2OND A;  5EDS A;  4TUU A;  2EIM E;  1KPS B;  1FVH A;  1NFI E;  3FUI A;  4LEU A;  3GZS A;  3ZU7 B;  3IEG A;  2R59 A;  4GB9 A;  2LNI A;  2WVI A;  4AEZ C;  1Z5S C;  3CIA A;  3G2W A;  4W9R A;  5J08 A;  1SA5 A;  5CED B;  1JWF A;  5DBK A;  3DSX A;  1X81 A;  4JB8 P;  4EBA G;  4HRL A;  2HE0 A;  4K5A B;  2IQC A;  2PZI A;  2ETB A;  4LSZ E;  3WXX A;  4DI3 A;  3FEY A;  2P9I G;  3BQO A;  3KSL A;  2FUL A;  4DRX E;  4YVQ C;  4DX2 A;  3I4G A;  3SGH A;  4HBD A;  3B7U X;  5KJL A;  1SZ9 A;  1TN6 A;  3V30 A;  4PDX A;  5CRU A;  2ZGD A;  5AYW D;  5T8I A;  2F37 A;  1P5Q A;  4GA2 A;  4YDE A;  2UWJ G;  3J5Q B;  3QJZ A;  1LTX A;  2Y4U A;  2VSO E;  3EHM A;  2J4D A;  2XEE A;  4U96 D;  3URZ A;  2KCK A;  3CV0 A;  4AJW A;  1WY6 A;  3LDZ A;  3S7J A;  3LPZ A;  4HRN A;  3U64 A;  5FQ4 A;  3ABK E;  3BU8 A;  2NC9 A;  2MYO A;  4IUL A;  1TEZ A;  4CZ2 D;  3DSW A;  3X2Q E;  2HM8 A;  3RIB A;  4BT8 A;  3D9I A; 
#chains in the Genus database with same CATH homology
 4LER A;  4N2Q A;  1U3C A;  1E8W A;  3JCK C;  4KMO A;  3CHQ A;  5EX0 A;  3TXN A;  2YNQ A;  4APO A;  3D9N A;  4AY5 A;  4Y6C A;  1IYG A;  1MQS A;  2JEK A;  4XI0 A;  4GYY A;  3B7S A;  4HS2 A;  2Y4T A;  3B7R L;  1UJJ A;  3MA5 A;  4CT4 A;  4BX9 A;  4EZJ A;  1SQM A;  4WNF A;  1JUQ A;  4U04 A;  3ASF A;  3CST A;  4ILG A;  5AJD A;  3JQ0 A;  3I4R B;  3ZHE B;  3CK8 A;  4JL0 A;  4WUY A;  4GA1 A;  2I1J A;  4KVO A;  4XKC A;  4Q69 A;  4HOS A;  3LY9 A;  4ACK A;  4YND A;  2X6J A;  2VGY A;  4JA7 A;  4KZ0 A;  2V5F A;  4NRH B;  4KBQ A;  4UQZ A;  3MEK A;  1DNP A;  3D9J A;  4TRQ A;  4AIF A;  2V8S E;  1VDY A;  3APC A;  4GYW A;  1E96 B;  4GPK A;  3RO2 A;  4I6J A;  4GZ5 A;  1OWN A;  4A1G A;  3P2B A;  2OOE A;  4DI4 A;  2DCP A;  4OVU A;  2KAT A;  2XHE A;  4J8E A;  4EZL A;  1UN8 A;  2R5S A;  3CHO A;  3D9M A;  4FUL A;  4I1O B;  4UQY A;  2MOW A;  1HS6 A;  3VLE A;  2XEV A;  4H7X A;  3IKO B;  5FZQ A;  5FQ7 A;  4LUN U;  3FFL A;  3NF1 A;  3MV3 B;  4BTB A;  2WQ6 A;  4KT6 B;  1E7V A;  1NA3 A;  5FQ8 A;  3I3N A;  2WXM A;  3LCA A;  4U07 A;  3ZXS A;  2BUG A;  3LY8 A;  4BTA A;  2WXG A;  4NUR A;  1JPL A;  1XGW A;  3KAE A;  4N3C A;  3DPD A;  3VLF A;  2I1K A;  2A5U A;  3S7F A;  4ABN A;  5CCM A;  5LX8 A;  1E8Z A;  4WNG A;  4WAF A;  4XE0 A;  3R9A B;  2VTB A;  2XCB A;  5ANL A;  3MCX A;  3L22 A;  4B0Z A;  3ZYL A;  1JWG A;  2YQ8 A;  5FQ6 A;  2VTB B;  3D9L A;  2XPY A;  5C2Y A;  2BF0 X;  3CHR A;  3IHV A;  2GRL A;  2J4B A;  3FWV A;  4NAC A;  2RG8 A;  3FP3 A;  1PY1 A;  3L16 A;  2XRY A;  2I6H A;  4OVV A;  4F53 A;  4B89 A;  5A7D B;  3RKV A;  4L2L A;  3QOU A;  4UWK A;  4JEH A;  3TG5 A;  5FTP A;  1N54 A;  1LF8 A;  2DIW A;  5BT1 A;  3FU0 A;  3HHM A;  2ION A;  3T8M A;  5CCL A;  3CVW A;  3GZ1 A;  3U4T A;  3PEV B;  4RG9 A;  4BSX A;  4N3A A;  3JUI A;  4K0R A;  4U0U A;  4G1T A;  5BNW A;  3ZYQ A;  5C1D A;  3CVY A;  3HVE A;  4OYS A;  4U0Z A;  2KZT A;  4QFV A;  3SNX A;  4I6E A;  4CDN A;  3FU3 A;  4P29 A;  3ZYK A;  4D10 C;  3PDN A;  3HVE B;  3P1U A;  2IOL A;  2KZT B;  3HDX A;  4CGW A;  3MKQ B;  1BPO A;  4BWR A;  3L54 A;  2RD0 A;  4UWH A;  3FTU A;  3OTN A;  3OAW A;  4M3O A;  5G05 C;  2VGX A;  3FUJ A;  4CRW A;  5ANR A;  4DK5 A;  3VTY A;  3CEQ A;  3UUX A;  2NXP A;  2UY1 A;  4F1S A;  3CHP A;  1OWL A;  3LEW A;  4Q96 A;  5JHA A;  3SFZ A;  3CLJ A;  4JHR A;  5AEN A;  2VGX B;  3QDN A;  3B7T A;  5FJY A;  2PL2 A;  3FUN A;  3U66 A;  2UY1 B;  5LOZ A;  3PE4 A;  4BY6 A;  4MRU A;  1WAO 1;  1E8X A;  4UWG A;  1ZBP A;  3FUK A;  1X5B A;  1UW4 B;  1Y8M A;  3BG1 B;  3SBS A;  5G04 C;  3RJV A;  1ELW A;  4BFR A;  4IN3 B;  2WXF A;  4AXH A;  3UX4 A;  2CHZ A;  3MJW A;  3MGB A;  4J6I A;  2OVF A;  2WXN A;  4PS3 A;  3SHF A;  3I5P A;  4UQX A;  2PQN A;  4GZ3 A;  1H2V C;  3FUF A;  3NQP A;  4AV7 A;  4DLQ A;  4L1B A;  4Y6W A;  5CMW A;  2QY7 A;  1B89 A;  4GML A;  2PM6 A;  4WWN A;  1UJK A;  2OVB A;  1MHQ A;  5LCW J;  3QB2 A;  3LY7 A;  4RVB A;  2IU1 A;  4WWO A;  5JJ6 A;  3RU0 A;  3MZL B;  2OV8 A;  3CQG B;  4G23 A;  3PE3 A;  3AU4 A;  2FEZ A;  2YHE A;  3ZEF A;  5LP0 A;  3FUL A;  3FUE A;  2I9C A;  4I2Z A;  3FUD A;  3L13 A;  3PNT B;  2XRZ A;  2E0I A;  3Q15 A;  2C0M A;  4RSY A;  4JC8 A;  3ZHE A;  3QC1 A;  3FDH A;  2FI7 A;  4JHJ A;  1NP7 A;  3G2S A;  4UWL A;  4HOT A;  4ILI A;  3ONL A;  4EQF A;  4UI9 K;  2MHK A;  1PAQ A;  4YVO A;  2CFU A;  2A4Z A;  2FBN A;  2AXU A;  3QAR A;  3UT4 A;  3RRU A;  1HU3 A;  4I9E A;  3VLD A;  3SZ7 A;  4KZC A;  3LVR E;  4UI9 J;  3UT7 A;  1HE8 A;  2AVP A;  4ME2 A;  4L2Y A;  4NQ0 A;  3U3W A;  1SZA A;  2PQR A;  3ZIM A;  1PC2 A;  3ZN3 A;  2WB2 A;  4O6F A;  1HG2 A;  4GCO A;  3BEE A;  1QZ2 A;  3QWW A;  3ML9 A;  3L08 A;  4N5C A;  3HYM B;  1WM5 A;  2KCV A;  2PM7 A;  1IQU A;  2Y3A A;  4PUC A;  5G55 A;  3FH8 A;  1E8Y A;  3SBT B;  1QQE A;  1EYH A;  1H0A A;  5M72 A;  5KCM A;  4HOU A;  4GZ6 A;  4HXI A;  3TAX A;  2XGO A;  4A1S A;  2CHW A;  2J09 A;  3IV0 A;  4GYO A;  4APF A;  5BV1 A;  2FF4 A;  3SI5 A;  2WXK A;  4HOQ A;  2ZU6 B;  5DIZ A;  3U9W A;  4JHK A;  3CVV A;  4Q94 A;  4GZD A;  3MYV A;  2WXI A;  4C9B B;  3LJ3 A;  3CR3 A;  1HG5 A;  4ANW A;  2L6J A;  2WMO A;  1KLX A;  4ATG A;  3T5X A;  1HX8 A;  3CHS A;  3JYS A;  3CVX A;  4PH4 B;  2XCC A;  3PRZ A;  5CHE E;  3D9K A;  4GAA A;  2V4L A;  1FCH A;  4EEC A;  2AXZ A;  1OUV A;  2WXH A;  3AU5 A;  2AWI A;  4GA0 A;  3B13 A;  4XKB A;  3GW4 A;  3O48 A;  1W3B A;  4BT9 A;  3ESK A;  1OWP A;  3KS2 A;  4GU5 A;  2J07 A;  5G2N A;  3G2T A;  1UN9 A;  3K9I A;  4B8A A;  2M63 A;  3CKC A;  5BV0 A;  4GCN A;  3LKU A;  4TV3 A;  3O4Z A;  4C0M A;  2WXO A;  3CK7 A;  2XQ0 A;  2VQ2 A;  3FTV A;  4KXK B;  1KT1 A;  4BX8 A;  2VYI A;  5ARF A;  2XPZ A;  1XNF A;  3MKQ A;  3ML8 A;  4GMJ A;  4PS7 A;  3SD5 A;  2WMN A;  3CK9 A;  2X3M A;  4JVS A;  2Q7F A;  1TJC A;  4JPS A;  1Z6T A;  2WXQ A;  2IF4 A;  2LSU A;  2JLB A;  4XI9 A;  4G24 A;  3QAQ A;  3FUM A;  1INZ A;  3T5V A;  3S2A A;  4MS6 A;  3APD A;  4LCT A;  1YA0 A;  3KEZ A;  3PEU B;  4MKT A;  3E4B A;  3ZFW A;  5JHB A;  3ULQ A;  2KC7 A;  5JJT A;  3QK0 A;  4FU3 A;  3CVQ A;  2LSV A;  3G2V A;  3ASH A;  3NZS A;  3CKB A;  2L0I A;  3PS6 A;  2L0T B;  3DBS A;  4FC8 A;  3TXM A;  3UQ3 A;  1NZN A;  1L5J A;  2CHX A;  2X6I A;  2YIN A;  3D9P A;  3FTW A;  3CVU A;  3RRM B;  4CCA A;  3BG0 B;  3PH0 C;  2AW6 A;  5KJN A;  4CGV A;  4HOR A;  3HIZ A;  4XZ4 A;  2XGM A;  3FU5 A;  1OWO A;  3TG4 A;  1S0P A;  2WQH A;  3LVQ E;  4UI9 C;  2ILR A;  2IFU A;  2E2E A;  3IHY A;  4WWP A;  3QKY A;  2C0L A;  3OXF A;  5AJL A;  2KCL A;  3GYZ A;  3OXG A;  2X6K A;  4V3I A;  2VSX E;  3R7Q A;  3PUJ A;  3Q49 B;  5ARG A;  2KM4 A;  5EKQ D;  3NZU A;  2J9Q A;  2FO7 A;  4HFG A;  1H19 A;  4I9C A;  2LAI A;  2P58 C;  3CVP A;  4AP2 A;  2GGF A;  3ZVV A;  4JEU A;  2X38 A;  3AS8 A;  4K03 A;  1H2U A;  2XGS A;  4U63 A;  4FJZ A;  5FT9 A;  5CMY A;  4AM9 A;  4EZK A;  3EIJ A;  4JW1 A;  2IJG X;  3TL5 A;  1DVP A;  3PVL A;  4JZY A;  5G05 J;  3FTS A;  1Z3Y A;  2YHC A;  4EBA A;  3KD7 A;  3FTZ A;  5FZR A;  1ELR A;  4N39 A;  4HVB A;  2VSN A;  3FH7 A;  4DJA A;  1QNF A;  3LYA A;  3Q5M A;  1ELK A;  4R7L A;  1U3D A;  3CVL A;  3R7R A;  1HXI A;  2I2O A;  2OND A;  5EDS A;  3QWV A;  4FJY A;  4G11 A;  4ACL A;  4TUU A;  4F3V A;  5FWQ A;  1FVH A;  4C0E A;  3Q47 B;  4LEU A;  3FUI A;  3GZS A;  2XPI A;  5G04 J;  3JQ1 A;  3IEG A;  4CDR A;  3TJP A;  4DPR A;  4L7T A;  2R59 A;  3ASG A;  2LNI A;  1FVF A;  2HO1 A;  4G25 A;  2WXR A;  4GB9 A;  4I6G A;  4KYO B;  2AXV A;  2WVI A;  4AEZ C;  3ZW3 A;  3CIA A;  3IBE A;  3G2W A;  4W9R A;  4I1M A;  1Y6I A;  5J90 A;  5J08 A;  4E85 A;  3ENE A;  4ILH B;  4G26 A;  4RG6 A;  4ANV A;  1E7U A;  3QNK A;  4EPZ A;  1JWF A;  2R17 C;  5DBK A;  3ONK A;  5E76 A;  4GZC A;  4FLB A;  3FUH A;  3ZGQ A;  3FHE A;  2J08 A;  1IHG A;  4HLE A;  4J0U A;  5D0O D;  4EBA G;  4N2S A;  3FY4 A;  4KVM A;  3ZPJ A;  2WXL A;  1GW6 A;  2IQC A;  2PZI A;  3TGO A;  3MV2 B;  4A55 A;  5ENN A;  3WXX A;  4DI3 A;  5BW8 C;  3FEY A;  1UG3 A;  4WNE A;  4CEM A;  5A23 A;  2VSY A;  4CDM A;  2X6F A;  4J8S A;  2MRI A;  5T4Y A;  2FUL A;  1H6K A;  1KT0 A;  3CQC B;  2WQ7 A;  4FAD A;  2L9B A;  4YVQ C;  3I4G A;  3RRN B;  5T3R A;  3SGH A;  4B8C B;  3PZD A;  3APF A;  1HZ4 A;  1Z3X A;  3MKR A;  4U0S A;  3B7U X;  5LFA A;  5BPP A;  2EQX A;  3CSF A;  3FTY A;  5KJK A;  4U8H A;  3CGH A;  4XX5 A;  2C2L A;  3FU6 A;  3MX3 A;  2X6H A;  4E6H A;  3FEX A;  3OXL A;  4JXT A;  5KJL A;  1HH8 A;  4A3T A;  2J49 A;  1SZ9 A;  3PNL B;  4UWF A;  3D3M A;  3FTX A;  3L6A A;  1IQR A;  2LO6 A;  4IRU A;  4PDX A;  1NA0 A;  5AYW D;  5T8I A;  3EIQ C;  2VJ8 A;  4AY6 A;  4ANU A;  5A6C A;  2WXJ A;  3UT8 A;  4WND A;  4J8D A;  3ZYM A;  3EDT B;  3LS8 A;  4XIF A;  5LCW C;  4I2W A;  5HI7 A;  2HR2 A;  2IOS A;  4J8F A;  4I17 A;  4FP7 A;  1P5Q A;  4JA9 A;  4GA2 A;  3UPV A;  2CG2 A;  3PRE A;  1EF1 C;  2UWJ G;  4LRZ A;  3PUK A;  2GW1 A;  3GZ2 A;  3UMV A;  4I1A A;  3QJZ A;  5FZS A;  5EX3 A;  5JJ7 A;  2CFZ A;  2Y4U A;  1E90 A;  2VSO E;  2DBA A;  4DLO A;  3Q4A B;  5KJM A;  4FHK A;  3EHM A;  4L23 A;  2J4D A;  2WXP A;  5E75 A;  4ANX A;  4FA6 A;  5HQ8 A;  1HFA A;  3URZ A;  1H2T C;  3EJN A;  2KCK A;  3CVN A;  2QFC A;  3ASD A;  1HO8 A;  3AS5 A;  1ZU2 A;  3S7D A;  2NSZ A;  4F7A A;  3CV0 A;  3S7B A;  3ESL A;  4G2V A;  2WPV A;  4FHJ A;  4AJW A;  3CHM A;  1WY6 A;  3LDZ A;  3S7J A;  3LPZ A;  5AIJ A;  1OWM A;  1N52 A;  5FQ4 A;  4H7Y A;  3U64 A;  2LAH A;  4MLP A;  5BUZ A;  3C98 A;  2NC9 A;  4URK A;  2HYZ A;  4IUL A;  4CT0 A;  3QWP A;  4I43 A;  1TEZ A;  3D9O A;  1TJF A;  3G2U A;  5D0Q D;  3L17 A;  3RK6 A;  2BTD A;  3ZRH A;  2GRM A;  4AOF A;  3RO3 A;  1EPU A;  2CG3 A;  4N3B A;  3N71 A;  4FLH A;  3VTX A;  2HM8 A;  4AVX A;  3FH5 A;  4A3V A;  3LXU X;  4PS8 A;  1EDU A;  1A17 A;  1HF8 A;  2WM9 A;  3EHN A;  4IYP A;  2V0P A;  3RIB A;  4BT8 A;  3D9I A;  3AS4 A;  4B94 A;  3SF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...