3CVPA

Structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to pts1 peptide (10-skl)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
313
structure length
279
Chain Sequence
TDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVTRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transport protein
molecule keywords Peroxisome targeting signal 1 receptor PEX5
total genus 111
structure length 279
sequence length 313
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cvpA00
3UUXA 2C0MA 1HH8A 3ZFWA 5LCWC 5AYWD 4B94A 1KLXA 3ZHEA 1KT0A 3MV3B 4RG9A 3OXGA 3LKUA 4UQXA 3S7BA 2YQ8A 3ULQA 4HOTA 2J9QA 1IHGA 2XPIA 4U04A 5BT1A 1QZ2A 3TGOA 3JYSA 3K9IA 3CKCA 4WUYA 2IF4A 3RO2A 1XNFA 3QWPA 4KXKB 2V5FA 4I9EA 3QOUA 1NZNA 1P5QA 4JHRA 5CCLA 3CV0A 4GA0A 2VGYA 3LY9A 4I2ZA 2I6HA 5JJTA 3MA5A 3PE4A 3GYZA 4GYYA 3RIBA 3S7DA 2HO1A 3TG5A 2KCKA 4J8DA 2UWJG 3MKRA 4H7XA 3EDTB 5G05C 5KJNA 3LCAA 2PQNA 1W3BA 4LEUA 3KAEA 4GA2A 4GCOA 5EX0A 2OOEA 4RG6A 4YVQC 3VTXA 1FCHA 3E4BA 4JL0A 2KC7A 3QKYA 4N5CA 2XCBA 4BTAA 2C2LA 4UI9K 4GZ3A 4YVOA 3HYMB 3QWWA 4IN3B 3CEQA 2XCCA 5ARFA 2FEZA 3LPZA 3LYAA 5A6CA 2BUGA 4GPKA 2XGSA 3ASGA 3CK9A 5DIZA 2E2EA 1NA0A 1E96B 2FI7A 3ASHA 3OXFA 1KT1A 2C0LA 3QDNA 4U0ZA 4UQYA 5CHEE 4G2VA 5D0OD 4BT8A 3ASDA 3R9AB 3CK7A 4GZ5A 3SZ7A 3TAXA 2DBAA 4I1AA 3U4TA 4G26A 2FF4A 4N3AA 3NF1A 5BW8C 4EQFA 4WNGA 1A17A 1B89A 1ELRA 2VYIA 3RJVA 5JJ7A 4ABNA 3QWVA 2FO7A 2UY1A 3FP3A 4GCNA 3LY8A 4Y6WA 4XI0A 2HYZA 2LSVA 3KS2A 5HI7A 3RU0A 2LNIA 2MHKA 1OUVA 2VSYA 3ASFA 5CCMA 5LCWJ 1IYGA 1Y8MA 4I17A 3UPVA 2VGXA 2PQRA 3Q15A 3BEEA 4JA9A 3CVPA 4AY6A 2WPVA 4G23A 4BWRA 3CVNA 5DBKA 1PC2A 4GYOA 4H7YA 5EKQD 3RO3A 5FZSA 2Q7FA 3FFLA 3N71A 3ZHEB 3ESKA 4J8FA 1ZBPA 2JLBA 3CVQA 4GA1A 2XGOA 4U0UA 5FZQA 4BTBA 4CGWA 3OXLA 4AIFA 2GW1A 4WNFA 1HXIA 4Y6CA 3Q49B 4NQ0A 1QQEA 4G1TA 3PDNA 5JJ6A 2HR2A 4I9CA 3CK8A 2Y4TA 4G24A 2VQ2A 5HQ8A 3ZGQA 3Q5MA 2WQHA 5C1DA 2P58C 4G25A 2XEVA 3O48A 4UQZA 3Q4AB 3URZA 2LSUA 3Q47B 2NC9A 4JA7A 4N3BA 4WNDA 3S7JA 4NRHB 4BT9A 3S7FA 5A7DB 3RKVA 5KJLA 3UQ3A 4AM9A 5D0QD 4AY5A 4UI9J 2KCLA 1NA3A 4WNEA 2KCVA 2UY1B 2XGMA 3MV2B 5FZRA 1HZ4A 3PE3A 4UI9C 4XI9A 4APOA 4N2QA 3GZ1A 2PL2A 2VGXB 1WAO1 4GYWA 3AS8A 4N39A 5G05J 2KATA 3WXXA 4N2SA 4ME2A 5FT9A 4YNDA 3CKBA 2Y4UA 4HOUA 2ONDA 4I2WA 3GW4A 3LY7A 3VTYA 3U3WA 3ZN3A 2R5SA 3CVLA 4KBQA 5EX3A 3TG4A 4HOSA 5G04J 3AS5A 2L6JA 4J0UA 1ELWA 5M72A 4A1SA 1YA0A 3AS4A 5G04C 3ZPJA 3KD7A 3SF4A 5ARGA 4HOQA 4U0SA 2PZIA 4F3VA 3GZ2A 1ZU2A 5FTPA 2YHCA 3IEGA 1WM5A 4N3CA 4U07A 2QFCA 4CDRA 1TJCA 3MEKA 5BNWA 5KJMA 4HORA 2FBNA 2VSNA 5FJYA 5KJKA 4O6FA 4XIFA 3FWVA 2AVPA 4CGVA 4J8EA 4W9RA 4GZ6A 4KYOB 2IFUA
chains in the Genus database with same CATH superfamily
5C2YA 5HS0A 5AYWD 1LD7A 2Y0BG 2BKGA 3FUDA 2WXKA 3JYSA 4XX5A 2WXGA 2F0YA 2IF4A 3V79K 1XNFA 4KXKB 1KPSB 4IULA 3HHMA 3TJPA 4GTVA 3PREA 2ETBA 3FUEA 1DCQA 2IU1A 3G2TA 3B7SA 1E96B 3CK7A 5ENPD 4OAVB 3NF1A 4JEHA 2X6IA 1HE8A 2J49A 1OUVA 2H6HA 3HXDA 2WPVA 3PNLB 2Q7FA 4J8FA 4FADA 4CGWA 5AQBA 3FTVA 4J7WA 3UT7A 2I1KA 3URZA 2WQ6A 1NI1A 1E7VA 3AJIA 3P1UA 4WNEA 3MV2B 5FIOA 2R02A 2YNQA 1OCZE 3R9MA 2V8SE 4YNDA 1LF8A 5G55A 1BD8A 3DSTA 2FULA 1YA0A 1JWFA 5ARGA 3CSTA 2P2CP 3JCKC 4CZ2D 4F6RD 5EDSA 4RG9A 3CSFA 3ULQA 4CT4A 2XPIA 1QZ2A 3K9IA 3MKQA 3CKCA 1UW4B 4I2ZA 3LY9A 3AU5A 4B0ZA 5FQ7A 4LEUA 1SZAA 2KZTA 2CHXA 5EILA 3QWWA 4A55A 2WXOA 4DX5D 3QC1A 3OAWA 3ASHA 1JCSA 3SI5A 2DCPA 3FTXA 1B89A 1ELRA 3EHNA 4DJAA 4ABNA 3B7UX 3CHSA 3O4ZA 2MHKA 4X8QA 4AY6A 1H6KA 3ZYKA 3RO3A 5KBAA 4K0RA 3E30A 4B93B 2X3MA 5KNHD 3E37A 3FUFA 3Q49B 3FH7A 2ETAA 4O1OA 3EIQC 4I43A 2P58C 4A3TA 1UN8A 5KJLA 4AY5A 5D66A 5HRYA 3SFZA 3AS8A 2KATA 1K1BA 3SY2A 2XZDG 4GTTA 3FY4A 5BXUA 3L22A 2J4BA 2L6JA 1WG0A 4BETA 4HOQA 3HXBA 2WMOA 5FTPA 3BQOA 3BG0B 4DI4A 2FBNA 3FWVA 4BWRA 4OVUA 1ELKA 1OWNA 3CIAA 4LNGA 1RZ4A 1SA4A 3UM1A 2GRRB 3Q78A 3TWQA 2GRLA 1NZNA 1NL4A 2NYJA 1H19A 4GPMA 5AJDA 3NAWA 3ZIMA 4GCOA 3I3NA 4QQIA 3CEQA 1PAQA 2E2EA 5ENTD 5CHEE 1KT1A 4HNAD 4DRXE 4L2YA 2DBAA 2WXNA 4A3VA 3MKQB 4U8HA 3CVVA 2HYZA 1MZCA 2GGFA 1Y8MA 3PUJA 3TWVA 5FWQA 3U64A 3HG0D 4L1BA 3ZYQA 3IV0A 2LO6A 1QQEA 3D9PA 5T8IA 5C1DA 3FUHA 3S7FA 3L54A 3TWUA 2LXMA 3J5PA 4XI9A 4UI9C 4NACA 3GZ1A 4LG6A 4ME2A 2IQCA 4EZLA 3AAAC 5CEDB 4A1SA 5G04C 1ZU2A 5LX8A 3W9GA 1MJ0A 3FUNA 3T8KA 4GZ6A 3CVWA 4JXTA 3P2BA 3FTWA 3ZFWA 5JMND 3RAUA 3TL5A 4EBAG 3V2XA 1DNPA 1ZB1A 2MRIA 4BSXA 1H0AA 3MA5A 3C3QA 3B95A 3PE4A 5ENOD 5CERB 2X6FA 3TXMA 3SO8A 5AJLA 4APFA 1BI8B 2FEZA 5T3RA 2B0OE 3UM3A 3ASGA 2OCCE 3PS6A 2FF4A 4OAUC 1TNOA 3CHQA 1S63A 3UT8A 2A5UA 5LCWJ 3W9FA 3T5VA 5KCMA 4GYOA 3TWSA 4DX7D 3J5QB 1HXIA 1S0PA 1HF8A 1N11A 4CT0A 3O48A 2P9PG 2KCLA 4N2QA 1HU3A 4I2WA 4GZDA 4WWOA 4HS2A 2RFMA 4J8YA 4N3CA 4HLLA 4O6FA 3ZW3A 3UUXA 1H2VC 1N9AA 1DVPA 4FA6A 2I1JA 4ZFHA 3PH0C 5BT1A 1BLXB 2BTDA 3PRZA 4GZCA 5FQ6A 2DIWA 3JQ1A 3ZYLA 3ZUVB 2KCKA 3CHPA 2PM6A 1V55E 4N5CA 2XCBA 3AG1E 5ARFA 3LYAA 3X2QE 3V2OA 4LRZA 1DC2A 3QNKA 4F7AA 3DSXA 4RVBA 5CEAA 4BX8A 3RU0A 3IHVA 2WXMA 1IHBA 2ILRA 2H6FA 4GTMA 3ZHEB 2XPYA 5G2NA 1ZBPA 3SFXA 3L9TA 5B1AE 3OXLA 1UN9A 5JHBA 1S70B 2DYSE 1Q2ZA 2KCVA 4ANXA 2GRPB 4K5CA 2E0IA 1N0QA 2BKKB 2I9CA 2Y4UA 2WXHA 1U2VG 2R5SA 3E34A 4F3VA 4JVSA 4AJWA 2B6CA 2CFUA 4UWGA 3APDA 3WG7E 4EZKA 3CVUA 5LCWC 1FVFA 4B94A 2P9IG 1KT0A 3Q75A 3LKUA 5BXOA 4JW1A 3I5PA 3SQVA 4FHKA 1P5QA 2V4LA 5JJTA 4GYYA 4OVVA 3DPDA 5AENA 3EDTB 4HRMB 3E4BA 3UKRG 4ANWA 2P9SG 1WY6A 4GZ3A 1U3DA 4EHMA 2V0PA 2XGSA 3ABLE 2C0LA 4JHKA 4LUNU 4GTSA 2L0TB 2WXRA 3ASFA 4HB5A 3PUKA 3BEEA 4GB9A 4YDOA 3N71A 3UXGA 3QB2A 2JLBA 1X81A 3MX3A 4WNFA 2R17C 1TN8A 1NFIE 2WQHA 4Q94A 1N0RA 3PZ4A 2NC9A 4JA7A 3APFA 4KZCA 4N5QA 1WAO1 5G05J 4HRNA 3DSVA 3G2SA 3MGBA 3HVEB 4TXQA 4L9PA 3KEZA 2V4HC 4U0SA 4JZYA 2IO2C 2VSNA 1OWPA 2GRMA 4UWFA 2DYRE 3AG2E 3L16A 4L23A 2QYJA 3AG4E 1SW6A 3PEUB 2J9QA 3LJ3A 1OXJA 2R05A 2V5FA 3E32A 3ML8A 3EUVA 3C3OA 2VGEA 3GYZA 3L13A 4J8DA 2UWJG 2RKKA 2DWZA 2YINA 4RG6A 4YVQC 4FU3A 4JL0A 5CRUA 4XKCA 4Z68A 2MYOA 1TNYA 4GPKA 3FUJA 3CVXA 4AOFA 5T4YA 3ZXPA 5D0OD 4B8AA 4BERA 3QWVA 4C0MA 4ACLA 2L9BA 4KZ0A 5ITZF 3CHMA 3UPVA 4EBAA 3C5RA 1FT1A 3ESKA 5AN8A 4GA1A 1E8YA 3FTYA 3UKUG 2X6JA 1AP7A 2XRYA 3FTUA 2XZTG 4WNDA 5D2MC 5ENSD 3UMVA 4EPZA 5D0QD 5FZRA 3U66A 5KWDA 4G11A 3L17A 4GTQA 4F1SA 4ANVA 3LY7A 4RLYA 3PZDA 2WXPA 4PS7A 3AS5A 3DSSA 3KD7A 4EZJA 2OVFA 3FEYA 3GZ2A 2KM4A 1HG5A 4ZHBA 4A63B 5KJMA 4V3IA 5FJYA 4LERA 4XIFA 3HXFA 4NRHB 2VTBB 1HH8A 3HRAA 4FP7A 3SFYA 1KLXA 1UG3A 1YMPA 4G8LA 3PVLA 3LVRE 4B89A 3HXCA 3QWPA 3QOUA 3JUIA 4C48B 2I6HA 3ZKJA 3DRAA 5KJNA 3LCAA 1K8KG 4YDEA 2XS8A 4DUIA 5ANLA 3VTXA 2VTBA 3NBNB 1OCCE 3IBEA 2A5EA 1TJFA 2YHEA 4N3AA 1O1SA 3D9KA 3G2VA 2WXQA 2WXJA 2FO7A 3FP3A 1QNFA 4GTRA 5LP0A 3KS2A 5FQ4A 2LNIA 3FHEA 1INZA 1TEZA 2WXLA 3NZSA 4Q69A 4U96D 5HKPA 3EIJA 3ESLA 4U0UA 4NQ0A 3LXUX 2VQ2A 4PS3A 4TUMA 4PH4B 3JUEA 3TWXA 2P9NG 2XHEA 2IJGX 4BESA 2ETCA 3CHOA 4CCAA 3IXEA 4MRUA 2QYUA 2H6IA 1EPUA 5EIBE 5B3SE 4HOSA 5G04J 3UINC 1PY1A 2WXIA 3OTNA 4BX9A 2YHCA 3T8MA 3DXMG 4CGVA 4TXRA 3Q7FA 2XQ0A 3FEXA 3UI2A 5LOZA 3OXGA 1N94A 4L7TA 4ILIA 4IYPA 4I9EA 1L5JA 4RQIA 1N54A 4F53A 1TNZA 4XZ4A 4UI9K 1G3NB 3BG1B 2X38A 2XCCA 5A6CA 3S2AA 1AWCB 2KZTB 3CQCB 3SBTB 4DPRA 3RRNB 2WB2A 2VYIA 4ILHB 4RSYA 2AXZA 1A5EA 2VSYA 3QK0A 3D9MA 3FULA 3CLJA 5FZSA 4UWHA 2XRZA 3HVEA 4M7CA 3KEAA 3PDNA 4I1OB 4BY6A 3SBSA 3APCA 3FUMA 4XKBA 1OWOA 1U3CA 3UQ3A 4K5AB 4AM9A 3ULEG 3UIPC 1NA3A 2XGMA 4N39A 3ABKE 4JD2G 1JUQA 3CKBA 1SZ9A 1LD8A 3C3RA 5EX3A 3TG4A 4ILGA 2Y3AA 4AP2A 5BV1A 3BU8A 5B1BE 2IOSA 1TJCA 3ML9A 1V54E 2WVIA 3EJNA 3BUAA 3MV3B 3B7TA 4HOTA 2RD0A 4JEUA 3TGOA 3PNTB 1JPLA 4J8SA 1TN6A 1HX8A 1NP7A 2VGYA 2VJ8A 3FH5A 2GRQB 4K5BA 3B13A 3TG5A 4F1PA 2LXLA 4NURA 2F8XK 1QYMA 2EIME 1E8ZA 2NSZA 5H7PA 4JB8P 3RRMB 2C2LA 1TYQG 2BUGA 1JCRA 5CMYA 1IQUA 3DPYA 5HQ8A 3I4GA 3TAXA 2Y69E 4U95D 4WNGA 1A17A 3E33A 3CGHA 4I17A 3CVYA 2PQRA 4HFGA 4OYSA 1HS6A 3CVNA 1PC2A 4H7YA 5EKQD 4CDMA 4CEMA 3FFLA 2X6KA 4KVMA 1IQRA 3CVQA 5BUZA 4HLEA 1FPPA 2HR2A 4I9CA 2CG2A 2OV8A 5AQ9A 4PS8A 4I1MA 3Q4AB 4DLOA 4PUCA 5ENQD 4M3OA 2HM8A 5A7DB 3KSLA 3NZUA 4O60A 4DI3A 4APOA 2QY7A 5BV0A 1IXVA 5J90A 5AQAA 2XEEA 1ELWA 3AS4A 4DX6D 1X5BA 3ONLA 4FULA 1MX4A 1KZOA 2XS1A 4WWNA 2OEWA 3QJZA 3NOCD 1Z3YA 4PDXA 2X6HA 4JHRA 3RIBA 4H7XA 5EX0A 4DX2A 1HO8A 1N4QA 3ABME 3MYVA 2J09A 1NA0A 3QDNA 4UQYA 3JXJA 2F8YA 4LSZE 4BT8A 1N4PA 2R59A 2ZGDA 2EQXA 5JHAA 3RJVA 3LY8A 2M63A 3MCXA 3QARA 2CHZA 2ZXWE 5JA4D 3UM2A 2OEVA 2FO1E 4TXPA 1TNUA 1HG2A 2CHWA 3FU3A 4G1TA 2RFAA 4BFRA 3G2WA 2J08A 3Q7AA 3FU6A 1LTXA 4UWKA 4AXHA 4GTOA 3LDZA 4E85A 3PE3A 4GMJA 4J6IA 4U7EB 4FJZA 2LAIA 4J0UA 5BPPA 5M72A 2PZIA 2QZAA 3ENEA 2QFCA 2BF0X 4HORA 3V30A 3ZYMA 2BEDA 3UM0A 2AVPA 2F37A 2XENA 2C0MA 3FDHA 4JHJA 3ZHEA 2EILE 3S7BA 1K1AA 1TN7A 1EYHA 2KBXA 3UT4A 2MOWA 2XPZA 2EIJE 3MJWA 3Q9UC 3VLEA 2AWIA 3D9OA 3D9IA 3ISMC 1OCRE 2GRNB 3ZU7B 1UOHA 5LFAA 3TXNA 3JXIA 3FU5A 3QKYA 4QFVA 3L08A 3HXEA 3HYMB 5EYPF 4G2VA 2H6GA 3D9HA 3FH8A 4YDYA 3U4TA 5BW8C 4I6EA 1OCOE 4GCNA 2LSVA 3D9JA 5CCMA 2IOLA 4FLBA 3TWWA 3DBSA 5CBNA 4YDWA 2ZGGA 4E6HA 2IO3C 2IONA 5FZQA 2IEJA 5A23A 2GW1A 4Y6CA 5ENNA 3DSUA 5EYLA 4CDNA 3ULYA 2XEVA 4JPSA 4N3BA 3LEWA 4WWPA 2EINE 4FJYA 3IHYA 5ANRA 4GYWA 4KMOA 2ONDA 3DSWA 4HI9A 1D9SA 3ZN3A 3CVLA 1H6PA 4UWLA 2WMNA 1OWLA 2A4ZA 4HBDA 5CRVA 2J8SD 4GTPA 1WM5A 1D8DA 2AXVA 4D10C 4U63A 2DZOA 4NIKA 2KXPC 3R7RA 3C98A 1D8EA 1XGWA 1RW2A 3Q9NC 4ACKA 4KVOA 2XEHA 1O1TA 1E7UA 3CV0A 4GA0A 2J4DA 1E8XA 4ANUA 2JEKA 5G05C 3KAEA 4I6GA 4EECA 2KC7A 3QAQA 2ZIRA 1YYHA 3MZLB 3CK9A 4KT6B 3ZRHA 3OXFA 3CQGB 3ASDA 4LNUD 1N95A 1BU9A 2WQ7A 4K03A 2UY1A 4GAAA 1Z3XA 3JQ0A 5HI7A 1IYGA 5AARA 3Q15A 3B7RL 4JA9A 2VSOE 4U8YD 2VSXE 1FVHA 3AG3E 1TR4A 4BTBA 4DK5A 1H2UA 3FUIA 1SQMA 1K3ZD 4UQZA 4FC8A 1WDYA 4AEZC 1N4RA 5AAOA 3VLFA 2UY1B 2JABA 3C72A 5J08A 2VGXB 2J07A 3WXXA 4N2SA 3R7QA 1OT8A 5FT9A 1DCEA 1EDUA 2ZISA 1MYOA 5AQ7A 3L82A 4GU5A 4HI8A 3RK6A 4FHJA 2CFZA 4CDRA 4G8KA 5FINA 2IFUA 2P9LG 3F6QA 4ATGA 3EHRA 1MX6A 2AW6A 4XEIG 3ASNE 4U04A 3SHFA 4HRLA 4TUUA 4LCTA 1KZPA 1O5MA 3PZ2A 4JC8A 3RO2A 5CCLA 1E8WA 1QBQA 2PNNA 5CBOA 2OOEA 3VLDA 4URKA 2OVBA 4YVOA 4IN3B 3LPZA 2DVWA 5DIZA 1YCSB 4U0ZA 4U8VD 3SZ7A 3I4RB 4GZ5A 2P9KG 2L0IA 4R7LA 3EU9A 2P9UG 4A1GA 2LUHA 2CG3A 1S64A 4HVBA 4CYMD 3ASOE 4TV3A 3CVPA 1EF1C 3DEPA 5JJ6A 2ZU6B 3NOGD 3CK8A 3D9NA 3T5XA 4C0EA 3B7BA 4MKTA 4AV7A 2LSUA 3Q79A 3PZ3A 2WM9A 4UI9J 4TRQA 1BI7B 1VDYA 2I2OA 3IKOB 2PL2A 3EHMA 3SD5A 4HOUA 2RG8A 4KBQA 3DWLG 4GMRA 3UTMA 3UIOC 3SGHA 2QC9A 3G2UA 4MS6A 4XE0A 4J8EA 1OY3D 4B8CB 4DLQA 2GROB 3D9LA 3Q73A 3PEVB 4BEPA 1FT2A 4UQXA 1IHGA 4GMLA 4WUYA 5EN5D 3S7DA 2HO1A 3MKRA 2PQNA 1W3BA 4LNBA 2NXPA 1UJJA 2EIKE 5CMWA 4ATZD 2Y1LE 3LJNA 3SNXA 5KNGA 4I1AA 4G26A 4EQFA 3EU5A 1BPOA 3L6AA 5IY5E 4Y6WA 1Y6IA 2WXFA 3CR3A 2HE0A 3T9KA 3ZNGA 4G23A 5FQ8A 3UX4A 1N52A 4Q96A 1O1RA 4CRWA 3V31A 5AIJA 4C9BB 1N4SA 3ONKA 4MLPA 4G24A 3ZGQA 3Q5MA 1MX2A 4AVXA 3GZSA 3Q47B 3S7JA 1SA5A 1SVXA 1Z5SC 3AU4A 1JCQA 3PZ1A 4IRUA 3VTYA 5CECB 4HQDA 3NB2A 4UUCA 3HDXA 3ZPJA 2V5QC 2R2LA 1JWGA 3IEGA 1Z6TA 5BNWA 3TWRA 1H6OA 3ZVVA 5JJ7A 2IY0C 1TNBA 3RSEG 3FU0A 2YQ8A 4MBGA 3TWTA 3CHRA 3DEOA 2PM7A 4GA2A 4BSZB 1FCHA 4BTAA 4O1PA 4P29A 2AJAA 3EHQA 3LVQE 3D3MA 2FI7A 3LS8A 2LAHA 3R9AB 3DXKG 5EIDA 1UJKA 3FTSA 3FTZA 4XI0A 2L6BA 4FLHA 1H2TC 5E75A 2VGXA 1HFAA 2DZNA 5DBKA 1MHQA 1MQSA 4WAFA 3KSQA 2XGOA 4AIFA 3U9WA 3NQPA 2Y4TA 1OWMA 5ENRD 2R03A 4G25A 3FUKA 4BT9A 1IKND 3RKVA 1HZ4A 4HXIA 2AXUA 3GW4A 3U3WA 4L2LA 1GW6A 3SF4A 3ZXSA 5E76A 4U07A 4I6JA 3MEKA 3HIZA 3ZEFA 4DX1A 5KJKA 1E90A 3RRUA 4W9RA 4KYOB
chains in the Genus database with same CATH topology
3UUXA 1H2VC 5C2YA 1DVPA 2XQ0A 3FEXA 4FA6A 5AYWD 2I1JA 3R7RA 3C98A 5LOZA 3OXGA 1XGWA 4L7TA 3PH0C 3FUDA 5BT1A 4ACKA 2WXKA 3JYSA 4ILIA 4KVOA 4XX5A 2BTDA 3PRZA 2WXGA 4IYPA 2IF4A 1XNFA 4GZCA 1E7UA 4KXKB 5FQ6A 2DIWA 4I9EA 3CV0A 4GA0A 1L5JA 2J4DA 1E8XA 4ANUA 1N54A 3JQ1A 3ZYLA 2JEKA 4IULA 3HHMA 2KCKA 3CHPA 3TJPA 3PREA 5G05C 3KAEA 4I6GA 4F53A 2PM6A 4EECA 2KC7A 3QAQA 4N5CA 2XCBA 4XZ4A 4UI9K 3BG1B 3FUEA 5ARFA 2X38A 2XCCA 5A6CA 3LYAA 2IU1A 3MZLB 3G2TA 3CK9A 3B7SA 4KT6B 4LRZA 3ZRHA 1E96B 3OXFA 3S2AA 3CQGB 2KZTB 3CQCB 3ASDA 3QNKA 3CK7A 3SBTB 4F7AA 4DPRA 3RRNB 2WQ7A 3NF1A 2WB2A 4JEHA 2VYIA 4ILHB 4K03A 4RSYA 2UY1A 2X6IA 1Z3XA 4GAAA 4RVBA 3JQ0A 4BX8A 1HE8A 5LP0A 2AXZA 5HI7A 3RU0A 2VSYA 2J49A 1OUVA 3QK0A 1IYGA 3IHVA 2WXMA 3D9MA 3Q15A 3FULA 2ILRA 3B7RL 4JA9A 2VSOE 2WPVA 2VSXE 3CLJA 1FVHA 5FZSA 3PNLB 2Q7FA 4UWHA 2XRZA 3ZHEB 2XPYA 4J8FA 1ZBPA 5G2NA 4BTBA 4DK5A 3HVEA 4FADA 4CGWA 3OXLA 1H2UA 1UN9A 3PDNA 4I1OB 5JHBA 4BY6A 3FTVA 3FUIA 3SBSA 1SQMA 3UT7A 4UQZA 2I1KA 3APCA 3FUMA 4FC8A 4XKBA 1OWOA 3URZA 2WQ6A 1U3CA 1E7VA 3P1UA 4AEZC 3UQ3A 4AM9A 3VLFA 1NA3A 4WNEA 2KCVA 2UY1B 2XGMA 3MV2B 4ANXA 2YNQA 5J08A 2E0IA 2VGXB 2J07A 3WXXA 4N39A 4N2SA 3R7QA 2V8SE 2I9CA 1JUQA 5FT9A 4YNDA 3CKBA 2Y4UA 1LF8A 2WXHA 1SZ9A 1EDUA 2R5SA 5EX3A 5G55A 3TG4A 4ILGA 2Y3AA 2FULA 1YA0A 1JWFA 4GU5A 5ARGA 4AP2A 5BV1A 4F3VA 4JVSA 3RK6A 3CSTA 4FHJA 2IOSA 4AJWA 2CFZA 1TJCA 4CDRA 3ML9A 3JCKC 2CFUA 2IFUA 4UWGA 3APDA 5EDSA 4EZKA 3CVUA 5LCWC 1FVFA 2WVIA 3EJNA 4B94A 4ATGA 1KT0A 2AW6A 3MV3B 4RG9A 3CSFA 3LKUA 4JW1A 3ULQA 3B7TA 4HOTA 2RD0A 4CT4A 2XPIA 4U04A 3SHFA 1QZ2A 4JEUA 4LCTA 3K9IA 4TUUA 3TGOA 3I5PA 3MKQA 3CKCA 3PNTB 1JPLA 4JC8A 4J8SA 3RO2A 4FHKA 5CCLA 1E8WA 1P5QA 1UW4B 1HX8A 1NP7A 2VGYA 2V4LA 3LY9A 2VJ8A 3FH5A 4I2ZA 5JJTA 4GYYA 3B13A 4OVVA 3AU5A 3DPDA 4B0ZA 5FQ7A 3TG5A 5AENA 3EDTB 4NURA 4LEUA 1SZAA 1E8ZA 2KZTA 2OOEA 3VLDA 2CHXA 4URKA 2NSZA 3E4BA 4ANWA 1WY6A 3RRMB 2OVBA 2C2LA 4YVOA 4GZ3A 3QWWA 4IN3B 4A55A 1U3DA 2WXOA 3LPZA 2BUGA 3QC1A 2V0PA 2XGSA 3OAWA 5DIZA 3ASHA 1IQUA 5CMYA 5HQ8A 2C0LA 4U0ZA 3SI5A 3SZ7A 2DCPA 3I4RB 3I4GA 4GZ5A 2L0IA 3TAXA 3FTXA 4R7LA 4WNGA 1A17A 1B89A 1ELRA 4JHKA 3EHNA 4DJAA 4ABNA 4LUNU 4A1GA 3B7UX 3CGHA 2CG3A 3CHSA 2L0TB 2WXRA 2MHKA 3ASFA 3O4ZA 4HVBA 3PUKA 4I17A 3CVYA 4TV3A 2PQRA 4HFGA 3BEEA 4GB9A 4OYSA 3CVPA 4AY6A 1HS6A 1H6KA 3CVNA 1PC2A 4H7YA 5EKQD 3ZYKA 3RO3A 4K0RA 4CEMA 3FFLA 3N71A 4CDMA 3QB2A 2X6KA 4KVMA 1IQRA 3CVQA 1EF1C 2JLBA 2X3MA 5BUZA 3FUFA 3MX3A 4WNFA 4HLEA 3Q49B 3FH7A 5JJ6A 2R17C 2HR2A 2ZU6B 4I9CA 3CK8A 3D9NA 3T5XA 4C0EA 2CG2A 2OV8A 3EIQC 2WQHA 4Q94A 4I43A 2P58C 4I1MA 4MKTA 4PS8A 4A3TA 4AV7A 3Q4AB 4DLOA 4PUCA 2LSUA 2NC9A 4JA7A 4M3OA 2HM8A 1UN8A 2WM9A 5A7DB 5KJLA 3APFA 4AY5A 4UI9J 4TRQA 3NZUA 1VDYA 4DI3A 4KZCA 4APOA 2QY7A 5BV0A 2I2OA 3IKOB 2PL2A 3SFZA 1WAO1 3AS8A 5G05J 5J90A 2KATA 3EHMA 3SD5A 4HOUA 3G2SA 2RG8A 3MGBA 3FY4A 4KBQA 3L22A 3HVEB 2J4BA 2L6JA 1ELWA 3AS4A 3KEZA 4HOQA 4U0SA 4JZYA 2WMOA 5FTPA 1X5BA 3ONLA 4FULA 3SGHA 3BG0B 4DI4A 2FBNA 2VSNA 3G2UA 1OWPA 2GRMA 4MS6A 3FWVA 4XE0A 4J8EA 4BWRA 4UWFA 4B8CB 4DLQA 3L16A 4WWNA 3D9LA 4L23A 3PEVB 4OVUA 3QJZA 1ELKA 1OWNA 3PEUB 4UQXA 2J9QA 1IHGA 3CIAA 3LJ3A 4GMLA 4WUYA 1Z3YA 4PDXA 2X6HA 2V5FA 2GRLA 4JHRA 1NZNA 3ML8A 3GYZA 3RIBA 1H19A 3S7DA 2HO1A 3L13A 4J8DA 5AJDA 2UWJG 3MKRA 4H7XA 2PQNA 1W3BA 3ZIMA 2NXPA 4GCOA 5EX0A 1UJJA 2YINA 4RG6A 4YVQC 4FU3A 3I3NA 4JL0A 1HO8A 5CMWA 4XKCA 3CEQA 4GPKA 3MYVA 2J09A 3FUJA 1PAQA 2E2EA 1NA0A 5T4YA 4AOFA 5CHEE 3CVXA 5D0OD 1KT1A 3QDNA 4UQYA 3SNXA 4BT8A 4L2YA 2DBAA 2WXNA 4I1AA 2R59A 4G26A 2EQXA 4B8AA 4A3VA 4EQFA 5JHAA 3MKQB 1BPOA 3RJVA 3L6AA 4U8HA 3QWVA 4C0MA 3LY8A 4ACLA 4Y6WA 3CVVA 2HYZA 2M63A 2L9BA 3MCXA 1Y6IA 3QARA 2WXFA 2CHZA 4KZ0A 3CR3A 2GGFA 1Y8MA 3CHMA 3PUJA 3UPVA 5FWQA 3U64A 4G23A 4EBAA 5FQ8A 3UX4A 1N52A 1HG2A 4L1BA 4Q96A 3ZYQA 3IV0A 4CRWA 2CHWA 3ESKA 3FU3A 4GA1A 1E8YA 2LO6A 3FTYA 5AIJA 4C9BB 1QQEA 4G1TA 3ONKA 4BFRA 4MLPA 2X6JA 3D9PA 4G24A 3G2WA 2J08A 3ZGQA 3Q5MA 5T8IA 2XRYA 5C1DA 4AVXA 3FU6A 3FTUA 3GZSA 3FUHA 3Q47B 4WNDA 3S7JA 3S7FA 4UWKA 3UMVA 3L54A 4AXHA 3LDZA 4EPZA 5D0QD 5FZRA 3U66A 4XI9A 3PE3A 4UI9C 4E85A 4NACA 3GZ1A 3AU4A 4G11A 4GMJA 4ME2A 3L17A 4F1SA 4ANVA 2IQCA 4IRUA 4EZLA 3VTYA 3LY7A 3PZDA 2WXPA 4J6IA 4FJZA 4PS7A 2LAIA 3AS5A 4J0UA 3HDXA 5BPPA 4A1SA 5M72A 5G04C 3ZPJA 3KD7A 4EZJA 2OVFA 2PZIA 3FEYA 1ZU2A 2KM4A 1JWGA 1HG5A 3GZ2A 5LX8A 3IEGA 3ENEA 1Z6TA 2QFCA 5KJMA 2BF0X 5BNWA 4V3IA 4HORA 5FJYA 4LERA 3ZYMA 4XIFA 3ZVVA 2AVPA 3FUNA 5JJ7A 4GZ6A 3CVWA 4JXTA 4NRHB 3P2BA 2VTBB 3FTWA 2C0MA 1HH8A 3FDHA 3FU0A 4JHJA 3ZFWA 4FP7A 3TL5A 1KLXA 3ZHEA 4EBAG 1UG3A 1DNPA 3S7BA 2YQ8A 1EYHA 3UT4A 3PVLA 3LVRE 4B89A 2MRIA 3CHRA 2MOWA 3QWPA 2PM7A 3QOUA 3JUIA 4BSXA 2XPZA 1H0AA 2I6HA 3MA5A 3MJWA 3VLEA 3PE4A 2AWIA 2X6FA 3D9OA 3D9IA 3TXMA 5KJNA 3LCAA 4GA2A 5AJLA 5ANLA 3TXNA 5LFAA 3VTXA 1FCHA 3FU5A 4BTAA 3QKYA 4QFVA 3L08A 4APFA 4P29A 3HYMB 2VTBA 2FEZA 5T3RA 3IBEA 3LVQE 3D3MA 3ASGA 2FI7A 3LS8A 4G2VA 3FH8A 2LAHA 1TJFA 3R9AB 3U4TA 2YHEA 3PS6A 4N3AA 2FF4A 1UJKA 5BW8C 3D9KA 4I6EA 3G2VA 2WXQA 2WXJA 3FTSA 2FO7A 3CHQA 3FP3A 1QNFA 3FTZA 4GCNA 4XI0A 3KS2A 2A5UA 2LSVA 3D9JA 5FQ4A 2LNIA 3FHEA 3UT8A 5CCMA 2IOLA 5LCWJ 4FLHA 1TEZA 1INZA 2WXLA 1H2TC 5E75A 2VGXA 3NZSA 4FLBA 1HFAA 3DBSA 3T5VA 5KCMA 5DBKA 4GYOA 1MHQA 4Q69A 1MQSA 4WAFA 3EIJA 3ESLA 2XGOA 4U0UA 2IONA 5FZQA 4E6HA 5A23A 4AIFA 2GW1A 1HXIA 4Y6CA 5ENNA 4NQ0A 3NQPA 3LXUX 3U9WA 1S0PA 1HF8A 4CDNA 2Y4TA 1OWMA 2VQ2A 4PS3A 4PH4B 4CT0A 4G25A 2XEVA 3FUKA 3O48A 4JPSA 2XHEA 4N3BA 4BT9A 3LEWA 2IJGX 4WWPA 3CHOA 4CCAA 2KCLA 4FJYA 3RKVA 3IHYA 1HZ4A 4N2QA 5ANRA 1HU3A 4MRUA 4GYWA 4KMOA 4HXIA 2AXUA 1EPUA 4I2WA 2ONDA 3GW4A 3U3WA 3ZN3A 3CVLA 4L2LA 4HOSA 5G04J 4GZDA 4UWLA 2WMNA 1GW6A 1OWLA 1PY1A 2A4ZA 2WXIA 4HS2A 4WWOA 3SF4A 3OTNA 3ZXSA 4BX9A 5E76A 2YHCA 1WM5A 4N3CA 2AXVA 4U07A 4I6JA 3T8MA 3MEKA 3HIZA 4D10C 3ZEFA 5KJKA 4O6FA 1E90A 4U63A 3RRUA 3ZW3A 4CGVA 4W9RA 4KYOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UUX A;  2C0M A;  1HH8 A;  3ZFW A;  5LCW C;  5AYW D;  4B94 A;  1KLX A;  3ZHE A;  1KT0 A;  3MV3 B;  4RG9 A;  3OXG A;  3LKU A;  4UQX A;  3S7B A;  2YQ8 A;  3ULQ A;  4HOT A;  2J9Q A;  1IHG A;  2XPI A;  4U04 A;  5BT1 A;  1QZ2 A;  3TGO A;  3JYS A;  3K9I A;  3CKC A;  4WUY A;  2IF4 A;  3RO2 A;  1XNF A;  3QWP A;  4KXK B;  2V5F A;  4I9E A;  3QOU A;  1NZN A;  1P5Q A;  4JHR A;  5CCL A;  3CV0 A;  4GA0 A;  2VGY A;  3LY9 A;  4I2Z A;  2I6H A;  5JJT A;  3MA5 A;  3PE4 A;  3GYZ A;  4GYY A;  3RIB A;  3S7D A;  2HO1 A;  3TG5 A;  2KCK A;  4J8D A;  2UWJ G;  3MKR A;  4H7X A;  3EDT B;  5G05 C;  5KJN A;  3LCA A;  2PQN A;  1W3B A;  4LEU A;  3KAE A;  4GA2 A;  4GCO A;  5EX0 A;  2OOE A;  4RG6 A;  4YVQ C;  3VTX A;  1FCH A;  3E4B A;  4JL0 A;  2KC7 A;  3QKY A;  4N5C A;  2XCB A;  4BTA A;  2C2L A;  4UI9 K;  4GZ3 A;  4YVO A;  3HYM B;  3QWW A;  4IN3 B;  3CEQ A;  2XCC A;  5ARF A;  2FEZ A;  3LPZ A;  3LYA A;  5A6C A;  2BUG A;  4GPK A;  2XGS A;  3ASG A;  3CK9 A;  5DIZ A;  2E2E A;  1NA0 A;  1E96 B;  2FI7 A;  3ASH A;  3OXF A;  1KT1 A;  2C0L A;  3QDN A;  4U0Z A;  4UQY A;  5CHE E;  4G2V A;  5D0O D;  4BT8 A;  3ASD A;  3R9A B;  3CK7 A;  4GZ5 A;  3SZ7 A;  3TAX A;  2DBA A;  4I1A A;  3U4T A;  4G26 A;  2FF4 A;  4N3A A;  3NF1 A;  5BW8 C;  4EQF A;  4WNG A;  1A17 A;  1B89 A;  1ELR A;  2VYI A;  3RJV A;  5JJ7 A;  4ABN A;  3QWV A;  2FO7 A;  2UY1 A;  3FP3 A;  4GCN A;  3LY8 A;  4Y6W A;  4XI0 A;  2HYZ A;  2LSV A;  3KS2 A;  5HI7 A;  3RU0 A;  2LNI A;  2MHK A;  1OUV A;  2VSY A;  3ASF A;  5CCM A;  5LCW J;  1IYG A;  1Y8M A;  4I17 A;  3UPV A;  2VGX A;  2PQR A;  3Q15 A;  3BEE A;  4JA9 A;  3CVP A;  4AY6 A;  2WPV A;  4G23 A;  4BWR A;  3CVN A;  5DBK A;  1PC2 A;  4GYO A;  4H7Y A;  5EKQ D;  3RO3 A;  5FZS A;  2Q7F A;  3FFL A;  3N71 A;  3ZHE B;  3ESK A;  4J8F A;  1ZBP A;  2JLB A;  3CVQ A;  4GA1 A;  2XGO A;  4U0U A;  5FZQ A;  4BTB A;  4CGW A;  3OXL A;  4AIF A;  2GW1 A;  4WNF A;  1HXI A;  4Y6C A;  3Q49 B;  4NQ0 A;  1QQE A;  4G1T A;  3PDN A;  5JJ6 A;  2HR2 A;  4I9C A;  3CK8 A;  2Y4T A;  4G24 A;  2VQ2 A;  5HQ8 A;  3ZGQ A;  3Q5M A;  2WQH A;  5C1D A;  2P58 C;  4G25 A;  2XEV A;  3O48 A;  4UQZ A;  3Q4A B;  3URZ A;  2LSU A;  3Q47 B;  2NC9 A;  4JA7 A;  4N3B A;  4WND A;  3S7J A;  4NRH B;  4BT9 A;  3S7F A;  5A7D B;  3RKV A;  5KJL A;  3UQ3 A;  4AM9 A;  5D0Q D;  4AY5 A;  4UI9 J;  2KCL A;  1NA3 A;  4WNE A;  2KCV A;  2UY1 B;  2XGM A;  3MV2 B;  5FZR A;  1HZ4 A;  3PE3 A;  4UI9 C;  4XI9 A;  4APO A;  4N2Q A;  3GZ1 A;  2PL2 A;  2VGX B;  1WAO 1;  4GYW A;  3AS8 A;  4N39 A;  5G05 J;  2KAT A;  3WXX A;  4N2S A;  4ME2 A;  5FT9 A;  4YND A;  3CKB A;  2Y4U A;  4HOU A;  2OND A;  4I2W A;  3GW4 A;  3LY7 A;  3VTY A;  3U3W A;  3ZN3 A;  2R5S A;  3CVL A;  4KBQ A;  5EX3 A;  3TG4 A;  4HOS A;  5G04 J;  3AS5 A;  2L6J A;  4J0U A;  1ELW A;  5M72 A;  4A1S A;  1YA0 A;  3AS4 A;  5G04 C;  3ZPJ A;  3KD7 A;  3SF4 A;  5ARG A;  4HOQ A;  4U0S A;  2PZI A;  4F3V A;  3GZ2 A;  1ZU2 A;  5FTP A;  2YHC A;  3IEG A;  1WM5 A;  4N3C A;  4U07 A;  2QFC A;  4CDR A;  1TJC A;  3MEK A;  5BNW A;  5KJM A;  4HOR A;  2FBN A;  2VSN A;  5FJY A;  5KJK A;  4O6F A;  4XIF A;  3FWV A;  2AVP A;  4CGV A;  4J8E A;  4W9R A;  4GZ6 A;  4KYO B;  2IFU A; 
#chains in the Genus database with same CATH topology
 5C2Y A;  5HS0 A;  5AYW D;  1LD7 A;  2Y0B G;  2BKG A;  3FUD A;  2WXK A;  3JYS A;  4XX5 A;  2WXG A;  2F0Y A;  2IF4 A;  3V79 K;  1XNF A;  4KXK B;  1KPS B;  4IUL A;  3HHM A;  3TJP A;  4GTV A;  3PRE A;  2ETB A;  3FUE A;  1DCQ A;  2IU1 A;  3G2T A;  3B7S A;  1E96 B;  3CK7 A;  5ENP D;  4OAV B;  3NF1 A;  4JEH A;  2X6I A;  1HE8 A;  2J49 A;  1OUV A;  2H6H A;  3HXD A;  2WPV A;  3PNL B;  2Q7F A;  4J8F A;  4FAD A;  4CGW A;  5AQB A;  3FTV A;  4J7W A;  3UT7 A;  2I1K A;  3URZ A;  2WQ6 A;  1NI1 A;  1E7V A;  3AJI A;  3P1U A;  4WNE A;  3MV2 B;  5FIO A;  2R02 A;  2YNQ A;  1OCZ E;  3R9M A;  2V8S E;  4YND A;  1LF8 A;  5G55 A;  1BD8 A;  3DST A;  2FUL A;  1YA0 A;  1JWF A;  5ARG A;  3CST A;  2P2C P;  3JCK C;  4CZ2 D;  4F6R D;  5EDS A;  4RG9 A;  3CSF A;  3ULQ A;  4CT4 A;  2XPI A;  1QZ2 A;  3K9I A;  3MKQ A;  3CKC A;  1UW4 B;  4I2Z A;  3LY9 A;  3AU5 A;  4B0Z A;  5FQ7 A;  4LEU A;  1SZA A;  2KZT A;  2CHX A;  5EIL A;  3QWW A;  4A55 A;  2WXO A;  4DX5 D;  3QC1 A;  3OAW A;  3ASH A;  1JCS A;  3SI5 A;  2DCP A;  3FTX A;  1B89 A;  1ELR A;  3EHN A;  4DJA A;  4ABN A;  3B7U X;  3CHS A;  3O4Z A;  2MHK A;  4X8Q A;  4AY6 A;  1H6K A;  3ZYK A;  3RO3 A;  5KBA A;  4K0R A;  3E30 A;  4B93 B;  2X3M A;  5KNH D;  3E37 A;  3FUF A;  3Q49 B;  3FH7 A;  2ETA A;  4O1O A;  3EIQ C;  4I43 A;  2P58 C;  4A3T A;  1UN8 A;  5KJL A;  4AY5 A;  5D66 A;  5HRY A;  3SFZ A;  3AS8 A;  2KAT A;  1K1B A;  3SY2 A;  2XZD G;  4GTT A;  3FY4 A;  5BXU A;  3L22 A;  2J4B A;  2L6J A;  1WG0 A;  4BET A;  4HOQ A;  3HXB A;  2WMO A;  5FTP A;  3BQO A;  3BG0 B;  4DI4 A;  2FBN A;  3FWV A;  4BWR A;  4OVU A;  1ELK A;  1OWN A;  3CIA A;  4LNG A;  1RZ4 A;  1SA4 A;  3UM1 A;  2GRR B;  3Q78 A;  3TWQ A;  2GRL A;  1NZN A;  1NL4 A;  2NYJ A;  1H19 A;  4GPM A;  5AJD A;  3NAW A;  3ZIM A;  4GCO A;  3I3N A;  4QQI A;  3CEQ A;  1PAQ A;  2E2E A;  5ENT D;  5CHE E;  1KT1 A;  4HNA D;  4DRX E;  4L2Y A;  2DBA A;  2WXN A;  4A3V A;  3MKQ B;  4U8H A;  3CVV A;  2HYZ A;  1MZC A;  2GGF A;  1Y8M A;  3PUJ A;  3TWV A;  5FWQ A;  3U64 A;  3HG0 D;  4L1B A;  3ZYQ A;  3IV0 A;  2LO6 A;  1QQE A;  3D9P A;  5T8I A;  5C1D A;  3FUH A;  3S7F A;  3L54 A;  3TWU A;  2LXM A;  3J5P A;  4XI9 A;  4UI9 C;  4NAC A;  3GZ1 A;  4LG6 A;  4ME2 A;  2IQC A;  4EZL A;  3AAA C;  5CED B;  4A1S A;  5G04 C;  1ZU2 A;  5LX8 A;  3W9G A;  1MJ0 A;  3FUN A;  3T8K A;  4GZ6 A;  3CVW A;  4JXT A;  3P2B A;  3FTW A;  3ZFW A;  5JMN D;  3RAU A;  3TL5 A;  4EBA G;  3V2X A;  1DNP A;  1ZB1 A;  2MRI A;  4BSX A;  1H0A A;  3MA5 A;  3C3Q A;  3B95 A;  3PE4 A;  5ENO D;  5CER B;  2X6F A;  3TXM A;  3SO8 A;  5AJL A;  4APF A;  1BI8 B;  2FEZ A;  5T3R A;  2B0O E;  3UM3 A;  3ASG A;  2OCC E;  3PS6 A;  2FF4 A;  4OAU C;  1TNO A;  3CHQ A;  1S63 A;  3UT8 A;  2A5U A;  5LCW J;  3W9F A;  3T5V A;  5KCM A;  4GYO A;  3TWS A;  4DX7 D;  3J5Q B;  1HXI A;  1S0P A;  1HF8 A;  1N11 A;  4CT0 A;  3O48 A;  2P9P G;  2KCL A;  4N2Q A;  1HU3 A;  4I2W A;  4GZD A;  4WWO A;  4HS2 A;  2RFM A;  4J8Y A;  4N3C A;  4HLL A;  4O6F A;  3ZW3 A;  3UUX A;  1H2V C;  1N9A A;  1DVP A;  4FA6 A;  2I1J A;  4ZFH A;  3PH0 C;  5BT1 A;  1BLX B;  2BTD A;  3PRZ A;  4GZC A;  5FQ6 A;  2DIW A;  3JQ1 A;  3ZYL A;  3ZUV B;  2KCK A;  3CHP A;  2PM6 A;  1V55 E;  4N5C A;  2XCB A;  3AG1 E;  5ARF A;  3LYA A;  3X2Q E;  3V2O A;  4LRZ A;  1DC2 A;  3QNK A;  4F7A A;  3DSX A;  4RVB A;  5CEA A;  4BX8 A;  3RU0 A;  3IHV A;  2WXM A;  1IHB A;  2ILR A;  2H6F A;  4GTM A;  3ZHE B;  2XPY A;  5G2N A;  1ZBP A;  3SFX A;  3L9T A;  5B1A E;  3OXL A;  1UN9 A;  5JHB A;  1S70 B;  2DYS E;  1Q2Z A;  2KCV A;  4ANX A;  2GRP B;  4K5C A;  2E0I A;  1N0Q A;  2BKK B;  2I9C A;  2Y4U A;  2WXH A;  1U2V G;  2R5S A;  3E34 A;  4F3V A;  4JVS A;  4AJW A;  2B6C A;  2CFU A;  4UWG A;  3APD A;  3WG7 E;  4EZK A;  3CVU A;  5LCW C;  1FVF A;  4B94 A;  2P9I G;  1KT0 A;  3Q75 A;  3LKU A;  5BXO A;  4JW1 A;  3I5P A;  3SQV A;  4FHK A;  1P5Q A;  2V4L A;  5JJT A;  4GYY A;  4OVV A;  3DPD A;  5AEN A;  3EDT B;  4HRM B;  3E4B A;  3UKR G;  4ANW A;  2P9S G;  1WY6 A;  4GZ3 A;  1U3D A;  4EHM A;  2V0P A;  2XGS A;  3ABL E;  2C0L A;  4JHK A;  4LUN U;  4GTS A;  2L0T B;  2WXR A;  3ASF A;  4HB5 A;  3PUK A;  3BEE A;  4GB9 A;  4YDO A;  3N71 A;  3UXG A;  3QB2 A;  2JLB A;  1X81 A;  3MX3 A;  4WNF A;  2R17 C;  1TN8 A;  1NFI E;  2WQH A;  4Q94 A;  1N0R A;  3PZ4 A;  2NC9 A;  4JA7 A;  3APF A;  4KZC A;  4N5Q A;  1WAO 1;  5G05 J;  4HRN A;  3DSV A;  3G2S A;  3MGB A;  3HVE B;  4TXQ A;  4L9P A;  3KEZ A;  2V4H C;  4U0S A;  4JZY A;  2IO2 C;  2VSN A;  1OWP A;  2GRM A;  4UWF A;  2DYR E;  3AG2 E;  3L16 A;  4L23 A;  2QYJ A;  3AG4 E;  1SW6 A;  3PEU B;  2J9Q A;  3LJ3 A;  1OXJ A;  2R05 A;  2V5F A;  3E32 A;  3ML8 A;  3EUV A;  3C3O A;  2VGE A;  3GYZ A;  3L13 A;  4J8D A;  2UWJ G;  2RKK A;  2DWZ A;  2YIN A;  4RG6 A;  4YVQ C;  4FU3 A;  4JL0 A;  5CRU A;  4XKC A;  4Z68 A;  2MYO A;  1TNY A;  4GPK A;  3FUJ A;  3CVX A;  4AOF A;  5T4Y A;  3ZXP A;  5D0O D;  4B8A A;  4BER A;  3QWV A;  4C0M A;  4ACL A;  2L9B A;  4KZ0 A;  5ITZ F;  3CHM A;  3UPV A;  4EBA A;  3C5R A;  1FT1 A;  3ESK A;  5AN8 A;  4GA1 A;  1E8Y A;  3FTY A;  3UKU G;  2X6J A;  1AP7 A;  2XRY A;  3FTU A;  2XZT G;  4WND A;  5D2M C;  5ENS D;  3UMV A;  4EPZ A;  5D0Q D;  5FZR A;  3U66 A;  5KWD A;  4G11 A;  3L17 A;  4GTQ A;  4F1S A;  4ANV A;  3LY7 A;  4RLY A;  3PZD A;  2WXP A;  4PS7 A;  3AS5 A;  3DSS A;  3KD7 A;  4EZJ A;  2OVF A;  3FEY A;  3GZ2 A;  2KM4 A;  1HG5 A;  4ZHB A;  4A63 B;  5KJM A;  4V3I A;  5FJY A;  4LER A;  4XIF A;  3HXF A;  4NRH B;  2VTB B;  1HH8 A;  3HRA A;  4FP7 A;  3SFY A;  1KLX A;  1UG3 A;  1YMP A;  4G8L A;  3PVL A;  3LVR E;  4B89 A;  3HXC A;  3QWP A;  3QOU A;  3JUI A;  4C48 B;  2I6H A;  3ZKJ A;  3DRA A;  5KJN A;  3LCA A;  1K8K G;  4YDE A;  2XS8 A;  4DUI A;  5ANL A;  3VTX A;  2VTB A;  3NBN B;  1OCC E;  3IBE A;  2A5E A;  1TJF A;  2YHE A;  4N3A A;  1O1S A;  3D9K A;  3G2V A;  2WXQ A;  2WXJ A;  2FO7 A;  3FP3 A;  1QNF A;  4GTR A;  5LP0 A;  3KS2 A;  5FQ4 A;  2LNI A;  3FHE A;  1INZ A;  1TEZ A;  2WXL A;  3NZS A;  4Q69 A;  4U96 D;  5HKP A;  3EIJ A;  3ESL A;  4U0U A;  4NQ0 A;  3LXU X;  2VQ2 A;  4PS3 A;  4TUM A;  4PH4 B;  3JUE A;  3TWX A;  2P9N G;  2XHE A;  2IJG X;  4BES A;  2ETC A;  3CHO A;  4CCA A;  3IXE A;  4MRU A;  2QYU A;  2H6I A;  1EPU A;  5EIB E;  5B3S E;  4HOS A;  5G04 J;  3UIN C;  1PY1 A;  2WXI A;  3OTN A;  4BX9 A;  2YHC A;  3T8M A;  3DXM G;  4CGV A;  4TXR A;  3Q7F A;  2XQ0 A;  3FEX A;  3UI2 A;  5LOZ A;  3OXG A;  1N94 A;  4L7T A;  4ILI A;  4IYP A;  4I9E A;  1L5J A;  4RQI A;  1N54 A;  4F53 A;  1TNZ A;  4XZ4 A;  4UI9 K;  1G3N B;  3BG1 B;  2X38 A;  2XCC A;  5A6C A;  3S2A A;  1AWC B;  2KZT B;  3CQC B;  3SBT B;  4DPR A;  3RRN B;  2WB2 A;  2VYI A;  4ILH B;  4RSY A;  2AXZ A;  1A5E A;  2VSY A;  3QK0 A;  3D9M A;  3FUL A;  3CLJ A;  5FZS A;  4UWH A;  2XRZ A;  3HVE A;  4M7C A;  3KEA A;  3PDN A;  4I1O B;  4BY6 A;  3SBS A;  3APC A;  3FUM A;  4XKB A;  1OWO A;  1U3C A;  3UQ3 A;  4K5A B;  4AM9 A;  3ULE G;  3UIP C;  1NA3 A;  2XGM A;  4N39 A;  3ABK E;  4JD2 G;  1JUQ A;  3CKB A;  1SZ9 A;  1LD8 A;  3C3R A;  5EX3 A;  3TG4 A;  4ILG A;  2Y3A A;  4AP2 A;  5BV1 A;  3BU8 A;  5B1B E;  2IOS A;  1TJC A;  3ML9 A;  1V54 E;  2WVI A;  3EJN A;  3BUA A;  3MV3 B;  3B7T A;  4HOT A;  2RD0 A;  4JEU A;  3TGO A;  3PNT B;  1JPL A;  4J8S A;  1TN6 A;  1HX8 A;  1NP7 A;  2VGY A;  2VJ8 A;  3FH5 A;  2GRQ B;  4K5B A;  3B13 A;  3TG5 A;  4F1P A;  2LXL A;  4NUR A;  2F8X K;  1QYM A;  2EIM E;  1E8Z A;  2NSZ A;  5H7P A;  4JB8 P;  3RRM B;  2C2L A;  1TYQ G;  2BUG A;  1JCR A;  5CMY A;  1IQU A;  3DPY A;  5HQ8 A;  3I4G A;  3TAX A;  2Y69 E;  4U95 D;  4WNG A;  1A17 A;  3E33 A;  3CGH A;  4I17 A;  3CVY A;  2PQR A;  4HFG A;  4OYS A;  1HS6 A;  3CVN A;  1PC2 A;  4H7Y A;  5EKQ D;  4CDM A;  4CEM A;  3FFL A;  2X6K A;  4KVM A;  1IQR A;  3CVQ A;  5BUZ A;  4HLE A;  1FPP A;  2HR2 A;  4I9C A;  2CG2 A;  2OV8 A;  5AQ9 A;  4PS8 A;  4I1M A;  3Q4A B;  4DLO A;  4PUC A;  5ENQ D;  4M3O A;  2HM8 A;  5A7D B;  3KSL A;  3NZU A;  4O60 A;  4DI3 A;  4APO A;  2QY7 A;  5BV0 A;  1IXV A;  5J90 A;  5AQA A;  2XEE A;  1ELW A;  3AS4 A;  4DX6 D;  1X5B A;  3ONL A;  4FUL A;  1MX4 A;  1KZO A;  2XS1 A;  4WWN A;  2OEW A;  3QJZ A;  3NOC D;  1Z3Y A;  4PDX A;  2X6H A;  4JHR A;  3RIB A;  4H7X A;  5EX0 A;  4DX2 A;  1HO8 A;  1N4Q A;  3ABM E;  3MYV A;  2J09 A;  1NA0 A;  3QDN A;  4UQY A;  3JXJ A;  2F8Y A;  4LSZ E;  4BT8 A;  1N4P A;  2R59 A;  2ZGD A;  2EQX A;  5JHA A;  3RJV A;  3LY8 A;  2M63 A;  3MCX A;  3QAR A;  2CHZ A;  2ZXW E;  5JA4 D;  3UM2 A;  2OEV A;  2FO1 E;  4TXP A;  1TNU A;  1HG2 A;  2CHW A;  3FU3 A;  4G1T A;  2RFA A;  4BFR A;  3G2W A;  2J08 A;  3Q7A A;  3FU6 A;  1LTX A;  4UWK A;  4AXH A;  4GTO A;  3LDZ A;  4E85 A;  3PE3 A;  4GMJ A;  4J6I A;  4U7E B;  4FJZ A;  2LAI A;  4J0U A;  5BPP A;  5M72 A;  2PZI A;  2QZA A;  3ENE A;  2QFC A;  2BF0 X;  4HOR A;  3V30 A;  3ZYM A;  2BED A;  3UM0 A;  2AVP A;  2F37 A;  2XEN A;  2C0M A;  3FDH A;  4JHJ A;  3ZHE A;  2EIL E;  3S7B A;  1K1A A;  1TN7 A;  1EYH A;  2KBX A;  3UT4 A;  2MOW A;  2XPZ A;  2EIJ E;  3MJW A;  3Q9U C;  3VLE A;  2AWI A;  3D9O A;  3D9I A;  3ISM C;  1OCR E;  2GRN B;  3ZU7 B;  1UOH A;  5LFA A;  3TXN A;  3JXI A;  3FU5 A;  3QKY A;  4QFV A;  3L08 A;  3HXE A;  3HYM B;  5EYP F;  4G2V A;  2H6G A;  3D9H A;  3FH8 A;  4YDY A;  3U4T A;  5BW8 C;  4I6E A;  1OCO E;  4GCN A;  2LSV A;  3D9J A;  5CCM A;  2IOL A;  4FLB A;  3TWW A;  3DBS A;  5CBN A;  4YDW A;  2ZGG A;  4E6H A;  2IO3 C;  2ION A;  5FZQ A;  2IEJ A;  5A23 A;  2GW1 A;  4Y6C A;  5ENN A;  3DSU A;  5EYL A;  4CDN A;  3ULY A;  2XEV A;  4JPS A;  4N3B A;  3LEW A;  4WWP A;  2EIN E;  4FJY A;  3IHY A;  5ANR A;  4GYW A;  4KMO A;  2OND A;  3DSW A;  4HI9 A;  1D9S A;  3ZN3 A;  3CVL A;  1H6P A;  4UWL A;  2WMN A;  1OWL A;  2A4Z A;  4HBD A;  5CRV A;  2J8S D;  4GTP A;  1WM5 A;  1D8D A;  2AXV A;  4D10 C;  4U63 A;  2DZO A;  4NIK A;  2KXP C;  3R7R A;  3C98 A;  1D8E A;  1XGW A;  1RW2 A;  3Q9N C;  4ACK A;  4KVO A;  2XEH A;  1O1T A;  1E7U A;  3CV0 A;  4GA0 A;  2J4D A;  1E8X A;  4ANU A;  2JEK A;  5G05 C;  3KAE A;  4I6G A;  4EEC A;  2KC7 A;  3QAQ A;  2ZIR A;  1YYH A;  3MZL B;  3CK9 A;  4KT6 B;  3ZRH A;  3OXF A;  3CQG B;  3ASD A;  4LNU D;  1N95 A;  1BU9 A;  2WQ7 A;  4K03 A;  2UY1 A;  4GAA A;  1Z3X A;  3JQ0 A;  5HI7 A;  1IYG A;  5AAR A;  3Q15 A;  3B7R L;  4JA9 A;  2VSO E;  4U8Y D;  2VSX E;  1FVH A;  3AG3 E;  1TR4 A;  4BTB A;  4DK5 A;  1H2U A;  3FUI A;  1SQM A;  1K3Z D;  4UQZ A;  4FC8 A;  1WDY A;  4AEZ C;  1N4R A;  5AAO A;  3VLF A;  2UY1 B;  2JAB A;  3C72 A;  5J08 A;  2VGX B;  2J07 A;  3WXX A;  4N2S A;  3R7Q A;  1OT8 A;  5FT9 A;  1DCE A;  1EDU A;  2ZIS A;  1MYO A;  5AQ7 A;  3L82 A;  4GU5 A;  4HI8 A;  3RK6 A;  4FHJ A;  2CFZ A;  4CDR A;  4G8K A;  5FIN A;  2IFU A;  2P9L G;  3F6Q A;  4ATG A;  3EHR A;  1MX6 A;  2AW6 A;  4XEI G;  3ASN E;  4U04 A;  3SHF A;  4HRL A;  4TUU A;  4LCT A;  1KZP A;  1O5M A;  3PZ2 A;  4JC8 A;  3RO2 A;  5CCL A;  1E8W A;  1QBQ A;  2PNN A;  5CBO A;  2OOE A;  3VLD A;  4URK A;  2OVB A;  4YVO A;  4IN3 B;  3LPZ A;  2DVW A;  5DIZ A;  1YCS B;  4U0Z A;  4U8V D;  3SZ7 A;  3I4R B;  4GZ5 A;  2P9K G;  2L0I A;  4R7L A;  3EU9 A;  2P9U G;  4A1G A;  2LUH A;  2CG3 A;  1S64 A;  4HVB A;  4CYM D;  3ASO E;  4TV3 A;  3CVP A;  1EF1 C;  3DEP A;  5JJ6 A;  2ZU6 B;  3NOG D;  3CK8 A;  3D9N A;  3T5X A;  4C0E A;  3B7B A;  4MKT A;  4AV7 A;  2LSU A;  3Q79 A;  3PZ3 A;  2WM9 A;  4UI9 J;  4TRQ A;  1BI7 B;  1VDY A;  2I2O A;  3IKO B;  2PL2 A;  3EHM A;  3SD5 A;  4HOU A;  2RG8 A;  4KBQ A;  3DWL G;  4GMR A;  3UTM A;  3UIO C;  3SGH A;  2QC9 A;  3G2U A;  4MS6 A;  4XE0 A;  4J8E A;  1OY3 D;  4B8C B;  4DLQ A;  2GRO B;  3D9L A;  3Q73 A;  3PEV B;  4BEP A;  1FT2 A;  4UQX A;  1IHG A;  4GML A;  4WUY A;  5EN5 D;  3S7D A;  2HO1 A;  3MKR A;  2PQN A;  1W3B A;  4LNB A;  2NXP A;  1UJJ A;  2EIK E;  5CMW A;  4ATZ D;  2Y1L E;  3LJN A;  3SNX A;  5KNG A;  4I1A A;  4G26 A;  4EQF A;  3EU5 A;  1BPO A;  3L6A A;  5IY5 E;  4Y6W A;  1Y6I A;  2WXF A;  3CR3 A;  2HE0 A;  3T9K A;  3ZNG A;  4G23 A;  5FQ8 A;  3UX4 A;  1N52 A;  4Q96 A;  1O1R A;  4CRW A;  3V31 A;  5AIJ A;  4C9B B;  1N4S A;  3ONK A;  4MLP A;  4G24 A;  3ZGQ A;  3Q5M A;  1MX2 A;  4AVX A;  3GZS A;  3Q47 B;  3S7J A;  1SA5 A;  1SVX A;  1Z5S C;  3AU4 A;  1JCQ A;  3PZ1 A;  4IRU A;  3VTY A;  5CEC B;  4HQD A;  3NB2 A;  4UUC A;  3HDX A;  3ZPJ A;  2V5Q C;  2R2L A;  1JWG A;  3IEG A;  1Z6T A;  5BNW A;  3TWR A;  1H6O A;  3ZVV A;  5JJ7 A;  2IY0 C;  1TNB A;  3RSE G;  3FU0 A;  2YQ8 A;  4MBG A;  3TWT A;  3CHR A;  3DEO A;  2PM7 A;  4GA2 A;  4BSZ B;  1FCH A;  4BTA A;  4O1P A;  4P29 A;  2AJA A;  3EHQ A;  3LVQ E;  3D3M A;  2FI7 A;  3LS8 A;  2LAH A;  3R9A B;  3DXK G;  5EID A;  1UJK A;  3FTS A;  3FTZ A;  4XI0 A;  2L6B A;  4FLH A;  1H2T C;  5E75 A;  2VGX A;  1HFA A;  2DZN A;  5DBK A;  1MHQ A;  1MQS A;  4WAF A;  3KSQ A;  2XGO A;  4AIF A;  3U9W A;  3NQP A;  2Y4T A;  1OWM A;  5ENR D;  2R03 A;  4G25 A;  3FUK A;  4BT9 A;  1IKN D;  3RKV A;  1HZ4 A;  4HXI A;  2AXU A;  3GW4 A;  3U3W A;  4L2L A;  1GW6 A;  3SF4 A;  3ZXS A;  5E76 A;  4U07 A;  4I6J A;  3MEK A;  3HIZ A;  3ZEF A;  4DX1 A;  5KJK A;  1E90 A;  3RRU A;  4W9R A;  4KYO B; 
#chains in the Genus database with same CATH homology
 3UUX A;  1H2V C;  5C2Y A;  1DVP A;  2XQ0 A;  3FEX A;  4FA6 A;  5AYW D;  2I1J A;  3R7R A;  3C98 A;  5LOZ A;  3OXG A;  1XGW A;  4L7T A;  3PH0 C;  3FUD A;  5BT1 A;  4ACK A;  2WXK A;  3JYS A;  4ILI A;  4KVO A;  4XX5 A;  2BTD A;  3PRZ A;  2WXG A;  4IYP A;  2IF4 A;  1XNF A;  4GZC A;  1E7U A;  4KXK B;  5FQ6 A;  2DIW A;  4I9E A;  3CV0 A;  4GA0 A;  1L5J A;  2J4D A;  1E8X A;  4ANU A;  1N54 A;  3JQ1 A;  3ZYL A;  2JEK A;  4IUL A;  3HHM A;  2KCK A;  3CHP A;  3TJP A;  3PRE A;  5G05 C;  3KAE A;  4I6G A;  4F53 A;  2PM6 A;  4EEC A;  2KC7 A;  3QAQ A;  4N5C A;  2XCB A;  4XZ4 A;  4UI9 K;  3BG1 B;  3FUE A;  5ARF A;  2X38 A;  2XCC A;  5A6C A;  3LYA A;  2IU1 A;  3MZL B;  3G2T A;  3CK9 A;  3B7S A;  4KT6 B;  4LRZ A;  3ZRH A;  1E96 B;  3OXF A;  3S2A A;  3CQG B;  2KZT B;  3CQC B;  3ASD A;  3QNK A;  3CK7 A;  3SBT B;  4F7A A;  4DPR A;  3RRN B;  2WQ7 A;  3NF1 A;  2WB2 A;  4JEH A;  2VYI A;  4ILH B;  4K03 A;  4RSY A;  2UY1 A;  2X6I A;  1Z3X A;  4GAA A;  4RVB A;  3JQ0 A;  4BX8 A;  1HE8 A;  5LP0 A;  2AXZ A;  5HI7 A;  3RU0 A;  2VSY A;  2J49 A;  1OUV A;  3QK0 A;  1IYG A;  3IHV A;  2WXM A;  3D9M A;  3Q15 A;  3FUL A;  2ILR A;  3B7R L;  4JA9 A;  2VSO E;  2WPV A;  2VSX E;  3CLJ A;  1FVH A;  5FZS A;  3PNL B;  2Q7F A;  4UWH A;  2XRZ A;  3ZHE B;  2XPY A;  4J8F A;  1ZBP A;  5G2N A;  4BTB A;  4DK5 A;  3HVE A;  4FAD A;  4CGW A;  3OXL A;  1H2U A;  1UN9 A;  3PDN A;  4I1O B;  5JHB A;  4BY6 A;  3FTV A;  3FUI A;  3SBS A;  1SQM A;  3UT7 A;  4UQZ A;  2I1K A;  3APC A;  3FUM A;  4FC8 A;  4XKB A;  1OWO A;  3URZ A;  2WQ6 A;  1U3C A;  1E7V A;  3P1U A;  4AEZ C;  3UQ3 A;  4AM9 A;  3VLF A;  1NA3 A;  4WNE A;  2KCV A;  2UY1 B;  2XGM A;  3MV2 B;  4ANX A;  2YNQ A;  5J08 A;  2E0I A;  2VGX B;  2J07 A;  3WXX A;  4N39 A;  4N2S A;  3R7Q A;  2V8S E;  2I9C A;  1JUQ A;  5FT9 A;  4YND A;  3CKB A;  2Y4U A;  1LF8 A;  2WXH A;  1SZ9 A;  1EDU A;  2R5S A;  5EX3 A;  5G55 A;  3TG4 A;  4ILG A;  2Y3A A;  2FUL A;  1YA0 A;  1JWF A;  4GU5 A;  5ARG A;  4AP2 A;  5BV1 A;  4F3V A;  4JVS A;  3RK6 A;  3CST A;  4FHJ A;  2IOS A;  4AJW A;  2CFZ A;  1TJC A;  4CDR A;  3ML9 A;  3JCK C;  2CFU A;  2IFU A;  4UWG A;  3APD A;  5EDS A;  4EZK A;  3CVU A;  5LCW C;  1FVF A;  2WVI A;  3EJN A;  4B94 A;  4ATG A;  1KT0 A;  2AW6 A;  3MV3 B;  4RG9 A;  3CSF A;  3LKU A;  4JW1 A;  3ULQ A;  3B7T A;  4HOT A;  2RD0 A;  4CT4 A;  2XPI A;  4U04 A;  3SHF A;  1QZ2 A;  4JEU A;  4LCT A;  3K9I A;  4TUU A;  3TGO A;  3I5P A;  3MKQ A;  3CKC A;  3PNT B;  1JPL A;  4JC8 A;  4J8S A;  3RO2 A;  4FHK A;  5CCL A;  1E8W A;  1P5Q A;  1UW4 B;  1HX8 A;  1NP7 A;  2VGY A;  2V4L A;  3LY9 A;  2VJ8 A;  3FH5 A;  4I2Z A;  5JJT A;  4GYY A;  3B13 A;  4OVV A;  3AU5 A;  3DPD A;  4B0Z A;  5FQ7 A;  3TG5 A;  5AEN A;  3EDT B;  4NUR A;  4LEU A;  1SZA A;  1E8Z A;  2KZT A;  2OOE A;  3VLD A;  2CHX A;  4URK A;  2NSZ A;  3E4B A;  4ANW A;  1WY6 A;  3RRM B;  2OVB A;  2C2L A;  4YVO A;  4GZ3 A;  3QWW A;  4IN3 B;  4A55 A;  1U3D A;  2WXO A;  3LPZ A;  2BUG A;  3QC1 A;  2V0P A;  2XGS A;  3OAW A;  5DIZ A;  3ASH A;  1IQU A;  5CMY A;  5HQ8 A;  2C0L A;  4U0Z A;  3SI5 A;  3SZ7 A;  2DCP A;  3I4R B;  3I4G A;  4GZ5 A;  2L0I A;  3TAX A;  3FTX A;  4R7L A;  4WNG A;  1A17 A;  1B89 A;  1ELR A;  4JHK A;  3EHN A;  4DJA A;  4ABN A;  4LUN U;  4A1G A;  3B7U X;  3CGH A;  2CG3 A;  3CHS A;  2L0T B;  2WXR A;  2MHK A;  3ASF A;  3O4Z A;  4HVB A;  3PUK A;  4I17 A;  3CVY A;  4TV3 A;  2PQR A;  4HFG A;  3BEE A;  4GB9 A;  4OYS A;  3CVP A;  4AY6 A;  1HS6 A;  1H6K A;  3CVN A;  1PC2 A;  4H7Y A;  5EKQ D;  3ZYK A;  3RO3 A;  4K0R A;  4CEM A;  3FFL A;  3N71 A;  4CDM A;  3QB2 A;  2X6K A;  4KVM A;  1IQR A;  3CVQ A;  1EF1 C;  2JLB A;  2X3M A;  5BUZ A;  3FUF A;  3MX3 A;  4WNF A;  4HLE A;  3Q49 B;  3FH7 A;  5JJ6 A;  2R17 C;  2HR2 A;  2ZU6 B;  4I9C A;  3CK8 A;  3D9N A;  3T5X A;  4C0E A;  2CG2 A;  2OV8 A;  3EIQ C;  2WQH A;  4Q94 A;  4I43 A;  2P58 C;  4I1M A;  4MKT A;  4PS8 A;  4A3T A;  4AV7 A;  3Q4A B;  4DLO A;  4PUC A;  2LSU A;  2NC9 A;  4JA7 A;  4M3O A;  2HM8 A;  1UN8 A;  2WM9 A;  5A7D B;  5KJL A;  3APF A;  4AY5 A;  4UI9 J;  4TRQ A;  3NZU A;  1VDY A;  4DI3 A;  4KZC A;  4APO A;  2QY7 A;  5BV0 A;  2I2O A;  3IKO B;  2PL2 A;  3SFZ A;  1WAO 1;  3AS8 A;  5G05 J;  5J90 A;  2KAT A;  3EHM A;  3SD5 A;  4HOU A;  3G2S A;  2RG8 A;  3MGB A;  3FY4 A;  4KBQ A;  3L22 A;  3HVE B;  2J4B A;  2L6J A;  1ELW A;  3AS4 A;  3KEZ A;  4HOQ A;  4U0S A;  4JZY A;  2WMO A;  5FTP A;  1X5B A;  3ONL A;  4FUL A;  3SGH A;  3BG0 B;  4DI4 A;  2FBN A;  2VSN A;  3G2U A;  1OWP A;  2GRM A;  4MS6 A;  3FWV A;  4XE0 A;  4J8E A;  4BWR A;  4UWF A;  4B8C B;  4DLQ A;  3L16 A;  4WWN A;  3D9L A;  4L23 A;  3PEV B;  4OVU A;  3QJZ A;  1ELK A;  1OWN A;  3PEU B;  4UQX A;  2J9Q A;  1IHG A;  3CIA A;  3LJ3 A;  4GML A;  4WUY A;  1Z3Y A;  4PDX A;  2X6H A;  2V5F A;  2GRL A;  4JHR A;  1NZN A;  3ML8 A;  3GYZ A;  3RIB A;  1H19 A;  3S7D A;  2HO1 A;  3L13 A;  4J8D A;  5AJD A;  2UWJ G;  3MKR A;  4H7X A;  2PQN A;  1W3B A;  3ZIM A;  2NXP A;  4GCO A;  5EX0 A;  1UJJ A;  2YIN A;  4RG6 A;  4YVQ C;  4FU3 A;  3I3N A;  4JL0 A;  1HO8 A;  5CMW A;  4XKC A;  3CEQ A;  4GPK A;  3MYV A;  2J09 A;  3FUJ A;  1PAQ A;  2E2E A;  1NA0 A;  5T4Y A;  4AOF A;  5CHE E;  3CVX A;  5D0O D;  1KT1 A;  3QDN A;  4UQY A;  3SNX A;  4BT8 A;  4L2Y A;  2DBA A;  2WXN A;  4I1A A;  2R59 A;  4G26 A;  2EQX A;  4B8A A;  4A3V A;  4EQF A;  5JHA A;  3MKQ B;  1BPO A;  3RJV A;  3L6A A;  4U8H A;  3QWV A;  4C0M A;  3LY8 A;  4ACL A;  4Y6W A;  3CVV A;  2HYZ A;  2M63 A;  2L9B A;  3MCX A;  1Y6I A;  3QAR A;  2WXF A;  2CHZ A;  4KZ0 A;  3CR3 A;  2GGF A;  1Y8M A;  3CHM A;  3PUJ A;  3UPV A;  5FWQ A;  3U64 A;  4G23 A;  4EBA A;  5FQ8 A;  3UX4 A;  1N52 A;  1HG2 A;  4L1B A;  4Q96 A;  3ZYQ A;  3IV0 A;  4CRW A;  2CHW A;  3ESK A;  3FU3 A;  4GA1 A;  1E8Y A;  2LO6 A;  3FTY A;  5AIJ A;  4C9B B;  1QQE A;  4G1T A;  3ONK A;  4BFR A;  4MLP A;  2X6J A;  3D9P A;  4G24 A;  3G2W A;  2J08 A;  3ZGQ A;  3Q5M A;  5T8I A;  2XRY A;  5C1D A;  4AVX A;  3FU6 A;  3FTU A;  3GZS A;  3FUH A;  3Q47 B;  4WND A;  3S7J A;  3S7F A;  4UWK A;  3UMV A;  3L54 A;  4AXH A;  3LDZ A;  4EPZ A;  5D0Q D;  5FZR A;  3U66 A;  4XI9 A;  3PE3 A;  4UI9 C;  4E85 A;  4NAC A;  3GZ1 A;  3AU4 A;  4G11 A;  4GMJ A;  4ME2 A;  3L17 A;  4F1S A;  4ANV A;  2IQC A;  4IRU A;  4EZL A;  3VTY A;  3LY7 A;  3PZD A;  2WXP A;  4J6I A;  4FJZ A;  4PS7 A;  2LAI A;  3AS5 A;  4J0U A;  3HDX A;  5BPP A;  4A1S A;  5M72 A;  5G04 C;  3ZPJ A;  3KD7 A;  4EZJ A;  2OVF A;  2PZI A;  3FEY A;  1ZU2 A;  2KM4 A;  1JWG A;  1HG5 A;  3GZ2 A;  5LX8 A;  3IEG A;  3ENE A;  1Z6T A;  2QFC A;  5KJM A;  2BF0 X;  5BNW A;  4V3I A;  4HOR A;  5FJY A;  4LER A;  3ZYM A;  4XIF A;  3ZVV A;  2AVP A;  3FUN A;  5JJ7 A;  4GZ6 A;  3CVW A;  4JXT A;  4NRH B;  3P2B A;  2VTB B;  3FTW A;  2C0M A;  1HH8 A;  3FDH A;  3FU0 A;  4JHJ A;  3ZFW A;  4FP7 A;  3TL5 A;  1KLX A;  3ZHE A;  4EBA G;  1UG3 A;  1DNP A;  3S7B A;  2YQ8 A;  1EYH A;  3UT4 A;  3PVL A;  3LVR E;  4B89 A;  2MRI A;  3CHR A;  2MOW A;  3QWP A;  2PM7 A;  3QOU A;  3JUI A;  4BSX A;  2XPZ A;  1H0A A;  2I6H A;  3MA5 A;  3MJW A;  3VLE A;  3PE4 A;  2AWI A;  2X6F A;  3D9O A;  3D9I A;  3TXM A;  5KJN A;  3LCA A;  4GA2 A;  5AJL A;  5ANL A;  3TXN A;  5LFA A;  3VTX A;  1FCH A;  3FU5 A;  4BTA A;  3QKY A;  4QFV A;  3L08 A;  4APF A;  4P29 A;  3HYM B;  2VTB A;  2FEZ A;  5T3R A;  3IBE A;  3LVQ E;  3D3M A;  3ASG A;  2FI7 A;  3LS8 A;  4G2V A;  3FH8 A;  2LAH A;  1TJF A;  3R9A B;  3U4T A;  2YHE A;  3PS6 A;  4N3A A;  2FF4 A;  1UJK A;  5BW8 C;  3D9K A;  4I6E A;  3G2V A;  2WXQ A;  2WXJ A;  3FTS A;  2FO7 A;  3CHQ A;  3FP3 A;  1QNF A;  3FTZ A;  4GCN A;  4XI0 A;  3KS2 A;  2A5U A;  2LSV A;  3D9J A;  5FQ4 A;  2LNI A;  3FHE A;  3UT8 A;  5CCM A;  2IOL A;  5LCW J;  4FLH A;  1TEZ A;  1INZ A;  2WXL A;  1H2T C;  5E75 A;  2VGX A;  3NZS A;  4FLB A;  1HFA A;  3DBS A;  3T5V A;  5KCM A;  5DBK A;  4GYO A;  1MHQ A;  4Q69 A;  1MQS A;  4WAF A;  3EIJ A;  3ESL A;  2XGO A;  4U0U A;  2ION A;  5FZQ A;  4E6H A;  5A23 A;  4AIF A;  2GW1 A;  1HXI A;  4Y6C A;  5ENN A;  4NQ0 A;  3NQP A;  3LXU X;  3U9W A;  1S0P A;  1HF8 A;  4CDN A;  2Y4T A;  1OWM A;  2VQ2 A;  4PS3 A;  4PH4 B;  4CT0 A;  4G25 A;  2XEV A;  3FUK A;  3O48 A;  4JPS A;  2XHE A;  4N3B A;  4BT9 A;  3LEW A;  2IJG X;  4WWP A;  3CHO A;  4CCA A;  2KCL A;  4FJY A;  3RKV A;  3IHY A;  1HZ4 A;  4N2Q A;  5ANR A;  1HU3 A;  4MRU A;  4GYW A;  4KMO A;  4HXI A;  2AXU A;  1EPU A;  4I2W A;  2OND A;  3GW4 A;  3U3W A;  3ZN3 A;  3CVL A;  4L2L A;  4HOS A;  5G04 J;  4GZD A;  4UWL A;  2WMN A;  1GW6 A;  1OWL A;  1PY1 A;  2A4Z A;  2WXI A;  4HS2 A;  4WWO A;  3SF4 A;  3OTN A;  3ZXS A;  4BX9 A;  5E76 A;  2YHC A;  1WM5 A;  4N3C A;  2AXV A;  4U07 A;  4I6J A;  3T8M A;  3MEK A;  3HIZ A;  4D10 C;  3ZEF A;  5KJK A;  4O6F A;  1E90 A;  4U63 A;  3RRU A;  3ZW3 A;  4CGV A;  4W9R A;  4KYO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...