3CVPA

Structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to pts1 peptide (10-skl)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
313
structure length
279
Chain Sequence
TDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVTRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Peroxisome targeting signal 1 receptor PEX5
publication title Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 111
structure length 279
sequence length 313
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cvpA00
4GA0A 4G23A 4B94A 4JHRA 4JA7A 1IHGA 5FZSA 4GA2A 3CK7A 5LCWC 4U04A 5CCMA 5KJMA 2VYIA 4NQ0A 3EDTB 3Q15A 4YNDA 3MKRA 2WPVA 1KT1A 1QZ2A 4UQZA 2HO1A 3K9IA 2KCLA 5LCWJ 3OXGA 3S7BA 3UUXA 4LEUA 4KBQA 5A6CA 3CVPA 3CK9A 2VQ2A 5KJNA 2KCKA 3GZ2A 5JJ7A 3QKYA 2UWJG 3Q5MA 1ELRA 4U0UA 3RO2A 2HR2A 3BEEA 2FO7A 3QOUA 5HQ8A 3URZA 1HXIA 1NZNA 5FZRA 2JLBA 5CHEE 2XGOA 4HOUA 3CVQA 3VTXA 4GCOA 4H7XA 4CDRA 1A17A 1NA0A 2FBNA 2VSNA 4RG9A 4N3CA 4BT9A 1ELWA 2LSUA 2UY1B 2YHCA 3MA5A 3CKBA 4AY6A 4G1TA 3PDNA 4EQFA 4G26A 4GZ5A 3Q47B 4KYOB 3KD7A 5ARGA 5M72A 3RJVA 4HORA 5D0OD 5A7DB 4N2SA 4I2ZA 2PQNA 4U0SA 1P5QA 3RKVA 3R9AB 5EKQD 4RG6A 3ASHA 5CCLA 1TJCA 3ASGA 3ESKA 2FI7A 2XGSA 2NC9A 4HOQA 3SF4A 3ZHEB 3KS2A 5BNWA 1QQEA 4AM9A 5G04C 3NF1A 3CEQA 3TAXA 4J8FA 2IFUA 2PL2A 2XPIA 2AVPA 4J8EA 2P58C 2C2LA 2I6HA 5G04J 3AS4A 4UI9K 3KAEA 1WAO1 4GPKA 4N3BA 3TGOA 4UQXA 4NRHB 5KJKA 2FEZA 3QDNA 3UQ3A 4CGWA 1OUVA 2PQRA 4XIFA 3S7JA 4U07A 3TG4A 4Y6WA 2XCBA 3LKUA 4GA1A 3RU0A 4H7YA 2V5FA 4I1AA 3Q4AB 1B89A 2LSVA 4HOTA 3ZPJA 5JJTA 4UI9C 4ABNA 2GW1A 4BTBA 3UPVA 4WNDA 3CVLA 2Q7FA 4O6FA 4WNGA 4JL0A 4UQYA 4I9EA 4KXKB 3VTYA 3ULQA 2DBAA 3QWVA 4GCNA 4BWRA 3FFLA 1WM5A 4UI9J 4WNEA 3IEGA 5BT1A 3GYZA 4WNFA 4WUYA 2UY1A 2XCCA 4GYOA 4APOA 2VGXA 2ONDA 2C0MA 3SZ7A 2R5SA 1KLXA 5HI7A 3E4BA 5C1DA 4BTAA 5AYWD 2OOEA 2XEVA 3ZGQA 5JJ6A 1E96B 3OXLA 4W9RA 5FT9A 3MV2B 5FZQA 3N71A 5BW8C 4XI0A 1ZBPA 3ZHEA 3LYAA 3CVNA 4GZ3A 1PC2A 4GYWA 3LY7A 3QWWA 4I17A 2KATA 3ZN3A 4G25A 5DBKA 3GW4A 3S7DA 3ASDA 3RO3A 3JYSA 4JA9A 3LY9A 4I2WA 4YVOA 4J0UA 4ME2A 2Y4TA 3O48A 3S7FA 5FTPA 3ZFWA 1HH8A 2VGYA 2KC7A 3LCAA 2J9QA 1KT0A 2HYZA 2KCVA 3PE3A 3FP3A 1HZ4A 2LNIA 1IYGA 3Q49B 4XI9A 2VSYA 5FJYA 4I9CA 4N2QA 4N5CA 4HOSA 2IF4A 4N39A 2MHKA 3CK8A 3PE4A 4N3AA 5ARFA 4G24A 2E2EA 3MV3B 1NA3A 3HYMB 5G05C 4GYYA 4A1SA 2L6JA 5KJLA 2YQ8A 1XNFA 4AIFA 3MEKA 4F3VA 3GZ1A 2FF4A 3FWVA 1W3BA 1YA0A 5G05J 5D0QD 1FCHA 2QFCA 4GZ6A 3OXFA 1Y8MA 4AY5A 2C0LA 3CV0A 3LPZA 3TG5A 3WXXA 4BT8A 4YVQC 3U4TA 3AS5A 2VGXB 2Y4UA 5EX0A 3RIBA 4U0ZA 5EX3A 4IN3B 4Y6CA 3AS8A 3LY8A 2WQHA 3CKCA 4CGVA 2BUGA 2PZIA 4G2VA 3ASFA 3U3WA 3QWPA 4J8DA 5DIZA 2XGMA 1ZU2A
chains in the Genus database with same CATH superfamily
4U8YD 4JA7A 1IHGA 1WDYA 4GA2A 3QJZA 1N4SA 5AJDA 5CCMA 5KJMA 3Q75A 3EDTB 4YNDA 2QZAA 3ZRHA 4PH4B 4HLEA 3EHRA 3FEYA 2LXMA 2KCLA 3PNLB 1IHBA 2RFAA 1DVPA 3W9GA 4KBQA 3CK9A 2VTBB 4Q69A 4EZKA 4RSYA 3PZ1A 3T5VA 3FU3A 3B7TA 3FHEA 3SBTB 1DNPA 3SO8A 3GZ2A 4F1PA 4Z68A 1E8ZA 1OWOA 2XZDG 3QKYA 4O1PA 1ELRA 3EHQA 4U0UA 3L16A 3BEEA 4LCTA 1FT1A 5JA4D 1D9SA 2IEJA 1HXIA 1HG2A 2WXRA 4AP2A 4HOUA 3D9IA 3UMVA 3VTXA 4GCOA 4H7XA 4O60A 3G2SA 1NP7A 4HI8A 1A17A 2FBNA 4RG9A 3UTMA 4GMRA 1OCOE 2CG3A 1TR4A 1MX4A 4AY6A 4G1TA 3PDNA 2RFMA 4FP7A 2EIME 3KD7A 4ANUA 4DX6D 2WXIA 2J09A 3L13A 3MZLB 4YDEA 4GTRA 5D0OD 1N4RA 1Z3YA 4XE0A 3IXEA 1PY1A 5ENRD 4I1OB 2J4BA 3ASHA 3R9MA 1DCQA 3ASGA 3ESKA 2XGSA 5AQAA 4HOQA 1UJKA 4A3TA 3ISMC 4AM9A 3QARA 4J8YA 2XRYA 5CMYA 3PS6A 2XPIA 4U63A 4AV7A 2DWZA 4FHJA 5G04J 1EYHA 5A23A 4GPKA 3TGOA 3OTNA 5ITZF 2L0IA 1NI1A 5KJKA 3UQ3A 2VTBA 4DX2A 3DXMG 4HQDA 3PREA 3TXMA 2X6HA 3AJIA 2V5FA 5KWDA 2LSVA 1QYMA 3ZYQA 3APDA 2OEWA 3ESLA 4UI9C 4L9PA 4O6FA 4JL0A 2OVBA 1SZ9A 5D66A 3VTYA 4BETA 3CHRA 2DBAA 3EIJA 4WNEA 4HNAD 4ANXA 5IY5E 3I3NA 2KZTB 3KSLA 2M63A 3NBNB 3PRZA 3RAUA 2VGXA 1MX2A 2C0MA 2DZNA 2R5SA 1KLXA 1D8EA 3RRMB 1QNFA 5HI7A 3E4BA 3L17A 4QFVA 3Q73A 4BTAA 5LOZA 2DZOA 2XEVA 5LP0A 3ZGQA 1S63A 4DK5A 4HRLA 2X6IA 3FH7A 3L82A 1K1AA 2GRLA 3MV2B 5FZQA 3N71A 3JCKC 3BUAA 1H2VC 4XI0A 1WY6A 4TUUA 3QWWA 3B7BA 1TNYA 2DIWA 3BQOA 3IHVA 4X8QA 2IU1A 4LRZA 4JEUA 4WWPA 3ZUVB 4I2WA 4OVVA 1H6PA 3B95A 3F6QA 4XEIG 3ZIMA 4TUMA 2J08A 4EECA 4KMOA 1KT0A 4GU5A 2KCVA 3FP3A 3CQCB 1HZ4A 2P9NG 3DSUA 3FTSA 5EYPF 4N5QA 3SNXA 2IF4A 4A3VA 3HG0D 4N39A 3G2VA 4B0ZA 2IO2C 5CEDB 2IOLA 3Q9UC 3FUNA 4FLBA 3X2QE 3Q9NC 3D9JA 2MRIA 3ZYMA 2GRNB 4LSZE 2XRZA 1XNFA 4L1BA 3CVWA 4F3VA 2EINE 1YA0A 2KZTA 2PNNA 3FUDA 2R03A 5B1AE 3OXFA 4DJAA 1Y8MA 1HG5A 2C0LA 3LPZA 3TG5A 1YCSB 4DRXE 3AS5A 4C9BB 2XS1A 2Y4UA 4UWKA 3TWSA 3P1UA 4FJZA 3D9HA 5ANLA 3D9LA 3G2UA 5EX3A 2X6FA 3UKUG 3QB2A 2YHEA 5T4YA 2QC9A 4G2VA 3ASFA 5E75A 2YNQA 1V55E 1HX8A 2P9PG 4UUCA 3UT4A 1LF8A 3UM0A 3D9PA 4WWOA 2XGMA 3NZUA 1ZU2A 3ULEG 5FZSA 4CZ2D 5B3SE 3I4RB 4J6IA 2R2LA 4AVXA 1H19A 2R59A 2VYIA 2CHWA 5J08A 3J5QB 2V5QC 3Q15A 2GRPB 4IYPA 3ULYA 3VLDA 3MKRA 4OAUC 3ML8A 3CHOA 1OCRE 2R17C 4K5AB 1SW6A 4UQZA 2GRMA 2R02A 5LCWJ 2IJGX 2ZIRA 3CHPA 2CFUA 3D9NA 3CHMA 3ABME 3UUXA 3DWLG 4GTMA 2FULA 4YDOA 3L6AA 5KJNA 1EDUA 3PZ4A 2KCKA 1EPUA 3BG0B 5JJ7A 3Q7FA 4HBDA 2H6IA 1N11A 2UWJG 1AWCB 2HR2A 4ILIA 1OWLA 4LNGA 4JZYA 4K5BA 3URZA 1H6KA 1UOHA 1NZNA 3VLEA 3B13A 5FZRA 3UKRG 3CVQA 3IV0A 4YDYA 1TNBA 5ENOD 3LS8A 2KBXA 4BT9A 2A5UA 1ELWA 4L23A 3MCXA 5ENPD 2GRRB 3CKBA 4XZ4A 4UWHA 4K5CA 4G26A 4AXHA 3Q47B 4KYOB 4EBAG 5ARGA 4JC8A 4HORA 4GZCA 2X6KA 4I2ZA 3JQ0A 4ZFHA 2PM7A 3RKVA 1BU9A 5EIBE 2J4DA 4A1GA 3HXCA 4V3IA 1SA5A 2L6BA 2LUHA 3AG1E 4DI3A 3FTWA 4GTQA 3CSTA 2OV8A 5AARA 1QBQA 3JUEA 3KS2A 2GRQB 5BNWA 4LERA 3EU5A 1QQEA 2P9SG 5G04C 4J8FA 2XEHA 2IFUA 1U3CA 2EIKE 3FH5A 3CR3A 3L08A 1N52A 2AVPA 3KEZA 4J8EA 2Y1LE 3NOGD 3CVVA 2ZGGA 3IKOB 3CHQA 4AJWA 1HE8A 4GTPA 1N0QA 2WVIA 2EIJE 4NRHB 3E33A 1HO8A 3PNTB 2AXVA 2VGEA 4DLOA 3E30A 4XIFA 3C5RA 2OVFA 2ZISA 3S7JA 3SFXA 4JHKA 5ENTD 3TG4A 2MOWA 3TXNA 2XCBA 3TWVA 4H7YA 4YDWA 4APFA 1K3ZD 4BEPA 3RRNB 2QYJA 4FA6A 3ZYKA 1G3NB 2J8SD 3AG2E 4WNGA 5KNHD 4I9EA 4KXKB 3TL5A 2CHXA 1JUQA 3DBSA 4BWRA 1WM5A 2RG8A 4A63B 5BT1A 1TNOA 2BF0X 2RKKA 5FWQA 4RLYA 3FY4A 3AU4A 3L22A 5E76A 4APOA 3ZEFA 3TWQA 3PZ2A 3SZ7A 4FHKA 1BD8A 4UWGA 3PZ3A 1ELKA 5ENQD 1K1BA 2AXUA 4LG6A 4R7LA 5AJLA 1BLXB 3ABLE 5FT9A 4TV3A 3D9OA 1LTXA 5BW8C 4CDNA 1JWGA 3TWWA 4O1OA 1UJJA 2AJAA 3T9KA 2AW6A 3CVNA 1UN9A 3QAQA 3ZN3A 4XX5A 4DI4A 4E6HA 3WG7E 3ASDA 2WXKA 3FTYA 2F37A 3JYSA 2H6FA 4YVOA 4G11A 4ME2A 3O48A 3S7FA 2H6GA 1MYOA 3CVXA 3NQPA 1RZ4A 1HH8A 2L9BA 2J9QA 1H2TC 3DSXA 3FU5A 4B8AA 3ZKJA 2LNIA 3FU0A 2WXQA 3Q49B 2NYJA 3R7RA 1X5BA 4XI9A 5FJYA 3FTVA 4PS7A 4N5CA 4URKA 5AENA 3B7UX 3PE4A 4N3AA 3U9WA 3HYMB 4PDXA 4J7WA 4GYYA 2WQ7A 2XPZA 4I6JA 1E8XA 3B7RL 4HVBA 2E0IA 4FC8A 3C3OA 4XKCA 3GZ1A 3SY2A 2FF4A 3FWVA 2XQ0A 1W3BA 3E37A 5G05J 3CLJA 5D0QD 3L54A 2QFCA 4GZ6A 5ENSD 3LEWA 2P9KG 2DVWA 3WXXA 3DPDA 4BT8A 5CBNA 3O4ZA 3Q78A 1UG3A 2J49A 3PH0C 1XGWA 3R7QA 4FJYA 1NL4A 4CEMA 3AS8A 4U8VD 3LY8A 5B1BE 4CGVA 4KT6B 4OVUA 3JUIA 2BUGA 4G8LA 4TRQA 3DSVA 4J8DA 5DIZA 1LD8A 3J5PA 1Z3XA 3PVLA 1H2UA 4PS3A 1OCZE 4ANVA 4G23A 3UX4A 4B94A 3CK7A 1YMPA 5LCWC 2ZGDA 3AAAC 3FUIA 1JPLA 4U04A 3UT7A 2A5EA 4HRMB 3LXUX 4RVBA 4NQ0A 3LJNA 4MS6A 3HRAA 5FQ4A 1KT1A 4TXPA 4NACA 1JCRA 1QZ2A 2HO1A 5KNGA 2J07A 3OXGA 1IXVA 1FT2A 4AOFA 2XHEA 1X81A 2WXLA 1IKND 2ETAA 3FTUA 4Q96A 5A6CA 1TJFA 3CVPA 1NFIE 3KSQA 3RRUA 1IQRA 2A4ZA 4UWLA 2V8SE 3ENEA 2H6HA 4KVMA 5JHAA 2KM4A 3Q5MA 3RO2A 2OCCE 4HRNA 1OWNA 4BFRA 2CG2A 1OY3D 1E90A 2QYUA 4ANWA 3E32A 5CERB 5CHEE 1O1RA 3FULA 4Q94A 4CDRA 3MX3A 4F6RD 1NA0A 1FPPA 2VSNA 5KCMA 2LSUA 2CFZA 5T8IA 1OCCE 1GW6A 2EQXA 4E85A 3TWXA 3LVQE 4GZ5A 1SVXA 1L5JA 5M72A 2BKGA 1SZAA 1O1SA 3RJVA 3V2OA 2OEVA 1LD7A 5A7DB 3ZYLA 2EILE 2LXLA 3NB2A 2WXFA 1HF8A 4U0SA 1P5QA 3FUFA 1OXJA 1VDYA 2WXNA 5EKQD 4RG6A 3EUVA 3FUMA 5CCLA 2KXPC 2FI7A 2NC9A 2LAIA 1E7VA 3ZHEB 1S70B 4NURA 4I1MA 2P9LG 3NF1A 3CEQA 4KZCA 3TAXA 2IQCA 2PL2A 5LX8A 1HU3A 5CRUA 3ZVVA 3EHNA 3AU5A 2C2LA 4BSZB 5G2NA 4LNUD 4UI9K 3T5XA 1BI8B 2ZXWE 4N3BA 3UI2A 2FEZA 1JCQA 1OUVA 2PQRA 4ILHB 3NZSA 5AN8A 3SHFA 5FQ6A 4C0MA 4U96D 3ZW3A 4GA1A 3RU0A 4I1AA 3TJPA 3Q4AB 1N54A 1B89A 3U66A 3T8MA 1H0AA 4JB8P 1V54E 4ABNA 3CVLA 3DEOA 4HFGA 4CRWA 4UQYA 3KEAA 4MRUA 1HS6A 5HKPA 3IHYA 1D8DA 4WAFA 5FINA 4GCNA 3FFLA 2AWIA 4BX9A 1S0PA 4WNFA 1DCEA 4G8KA 3ASNE 4DX7D 3ZU7B 3GZSA 4UWFA 2P2CP 1U3DA 5CBOA 3CSFA 5C1DA 3CQGB 5AYWD 1EF1C 2OOEA 2I2OA 2NSZA 1Q2ZA 5JJ6A 1S64A 3PEVB 3UM3A 1TEZA 3OXLA 5AQ9A 3Q79A 2WXMA 2IO3C 1PAQA 2X6JA 1ZBPA 3ZHEA 3FUHA 2DYRE 3LYAA 4GAAA 3E34A 5EDSA 3MGBA 4GZ3A 1PC2A 2I9CA 2KATA 3SD5A 4OAVB 3TWUA 1FVHA 5DBKA 4LUNU 4L7TA 3TWRA 4EZJA 3S7DA 2ETBA 4DX5D 5H7PA 3ASOE 4IULA 1A5EA 3D9MA 2IOSA 3V79K 3FUEA 1O5MA 2Y3AA 3CVUA 2IONA 2VGYA 2KC7A 3LCAA 4I6EA 4PS8A 2BEDA 2HYZA 5FIOA 2X38A 2ILRA 3U64A 1IYGA 4CCAA 2VSYA 4I9CA 4N2QA 1Z6TA 5FQ8A 2GGFA 4HOSA 3ONKA 4GMJA 4F1SA 4DX1A 1SA4A 3ONLA 5BV1A 3CK8A 3D3MA 1KZOA 5ARFA 4G24A 3SQVA 3AG3E 3MV3B 5G05C 3ABKE 1WG0A 4TXQA 1U2VG 4A1SA 5J90A 5CECB 2YQ8A 4TXRA 3MEKA 4HLLA 3DPYA 4J8SA 5C2YA 1UN8A 2WMNA 2XPYA 3ZXPA 1AP7A 3DXKG 4FU3A 3CIAA 3HXBA 4U8HA 3V2XA 4ATGA 2LAHA 3SFYA 3FTXA 4YVQC 2VGXB 4C48B 4LNBA 2Y0BG 3UT8A 5EX0A 2F8XK 5HS0A 3DSWA 3LDZA 1Y6IA 4AEZC 4IN3B 4Y6CA 3CKCA 1TNZA 3UIPC 2LO6A 3MJWA 2PZIA 2F0YA 2YINA 2WXGA 4GA0A 4EHMA 4JHRA 2XZTG 2QY7A 3G2TA 1E8WA 4ATZD 1MZCA 2AXZA 1N9AA 2WPVA 1N94A 2WXJA 4RQIA 3K9IA 5EN5D 3RK6A 4GB9A 3S7BA 1KPSB 3HVEB 3UIOC 4LEUA 3ZNGA 1BI7B 1MHQA 4ACLA 3QK0A 1HFAA 2I1JA 2VQ2A 3TWTA 3HDXA 4FULA 2P9UG 4GZDA 3G2WA 3I5PA 5BXUA 4A55A 4HXIA 5ENNA 4I43A 1JCSA 3APFA 4GTOA 3EU9A 4U7EB 3PZDA 2HM8A 2FO7A 3QOUA 4C0EA 3Q7AA 3S2AA 5HQ8A 3HXDA 3NOCD 2ETCA 2JLBA 2XGOA 2HE0A 3PUKA 3HIZA 4BERA 4JW1A 4ZHBA 5JMND 1SQMA 3OAWA 4N3CA 3BG1B 3UXGA 2UY1B 3FH8A 2YHCA 3MA5A 2FO1E 1E8YA 2L0TB 3IBEA 4NIKA 4EQFA 3V30A 4F53A 2XEEA 4M7CA 5HRYA 2IY0C 1MQSA 5D2MC 3BU8A 1BPOA 5FQ7A 4N2SA 2PQNA 2WXHA 4B93B 1INZA 4WWNA 5T3RA 3FU6A 3T8KA 2PM6A 3R9AB 5AIJA 2VJ8A 2ZU6B 3ML9A 1TJCA 1E7UA 3CVYA 1TNUA 3SF4A 2WXPA 4M3OA 4CT0A 1ZB1A 2MYOA 3CGHA 3QNKA 2VSOE 4D10C 2WQ6A 1N4PA 2DYSE 4JPSA 3QC1A 1OT8A 2P58C 5JHBA 2R05A 2I6HA 5CEAA 4B89A 3AS4A 2WB2A 4BY6A 2I1KA 3KAEA 1WAO1 1RW2A 3HVEA 3C3RA 3SBSA 4UQXA 4KVOA 4I6GA 4MKTA 3QDNA 4GMLA 3CHSA 4CGWA 4KZ0A 5AAOA 2XENA 5EIDA 3DSTA 1N95A 3MKQB 4U07A 3UM2A 1N4QA 1OWMA 4Y6WA 1H6OA 2DCPA 3LKUA 4HOTA 3ZPJA 3APCA 4EBAA 3MYVA 2BKKB 3UINC 5JJTA 3EIQC 1KZPA 4PUCA 2WXOA 2GW1A 4BTBA 3UPVA 4WNDA 5KBAA 2Q7FA 1JWFA 4GTVA 3ULQA 2Y69E 4K0RA 4DLQA 3QWVA 3EJNA 2V4LA 3PUJA 4UI9J 3IEGA 1OWPA 3GYZA 1YYHA 4WUYA 2UY1A 1TN7A 2GROB 2XCCA 4GYOA 4JEHA 2XS8A 2ONDA 3JXJA 1TN6A 2WMOA 4GTSA 4HB5A 2V0PA 3DSSA 3JXIA 4MLPA 3D9KA 4EZLA 1MJ0A 2JEKA 1E96B 4GPMA 1FVFA 5AQ7A 2B0OE 4W9RA 3PEUB 1Z5SC 4JHJA 3RSEG 2RD0A 4CYMD 3ZXSA 3FEXA 3B7SA 4GYWA 3LY7A 4K03A 4I17A 2JABA 4FLHA 4G25A 3FDHA 4JVSA 3SI5A 1K8KG 5AQBA 4OYSA 3GW4A 5ANRA 5EILA 3RO3A 4JA9A 3LY9A 4B8CB 5BV0A 4J0UA 2Y4TA 4HS2A 5FTPA 1MX6A 3ZFWA 3HXFA 4CT4A 2VSXE 4IRUA 4JD2G 5BXOA 3NAWA 2P9IG 3VLFA 3PE3A 4F7AA 5G55A 3DRAA 4FADA 3AG4E 3MKQA 3C98A 5EYLA 3V31A 3LVRE 4L2YA 3HHMA 3LJ3A 2MHKA 3EHMA 5LFAA 4DUIA 3C72A 2E2EA 1NA3A 3W9FA 4JXTA 5BUZA 3P2BA 4U95D 3L9TA 2X3MA 2F8YA 2L6JA 5KJLA 4ILGA 4AIFA 3FTZA 4CDMA 2CHZA 2BTDA 3SFZA 5CMWA 1DC2A 1TN8A 1FCHA 1O1TA 1UW4B 2NXPA 4AY5A 3CV0A 3I4GA 3U4TA 4BSXA 3C3QA 5BPPA 3RIBA 3DEPA 4U0ZA 3FUKA 4QQIA 4XKBA 2V4HC 4EPZA 4DPRA 4GTTA 2WQHA 1TYQG 3JQ1A 5CRVA 4BESA 3UM1A 4P29A 3HXEA 3SGHA 4BX8A 3U3WA 3QWPA 2WM9A 4L2LA 1N0RA 3FUJA 2B6CA 4ACKA 1IQUA 4HI9A 4MBGA
chains in the Genus database with same CATH topology
4GA0A 4G23A 3UX4A 4B94A 4JHRA 4JA7A 1IHGA 5FZSA 4GA2A 3QJZA 3CK7A 5LCWC 2QY7A 3I4RB 3G2TA 3FUIA 4J6IA 1H19A 1E8WA 1JPLA 4U04A 5AJDA 3UT7A 2R59A 4AVXA 5CCMA 5KJMA 2VYIA 4RVBA 3LXUX 2AXZA 2CHWA 3EDTB 4NQ0A 5J08A 3Q15A 4YNDA 4IYPA 3VLDA 3MKRA 2WPVA 4MS6A 5FQ4A 3ZRHA 3ML8A 3CHOA 4PH4B 2R17C 4HLEA 1KT1A 4NACA 1QZ2A 3FEYA 4UQZA 2WXJA 2GRMA 2HO1A 3K9IA 2KCLA 5LCWJ 2IJGX 3CHPA 3PNLB 2CFUA 2J07A 3OXGA 3RK6A 4GB9A 3D9NA 3S7BA 3CHMA 3UUXA 4AOFA 3HVEB 4LEUA 2XHEA 2WXLA 1DVPA 3FTUA 4Q96A 1MHQA 4KBQA 1TJFA 5A6CA 3CVPA 3CK9A 4ACLA 3QK0A 2VTBB 4Q69A 2FULA 4EZKA 4RSYA 3T5VA 1HFAA 2I1JA 2VQ2A 3B7TA 3FU3A 3L6AA 5KJNA 1EDUA 3RRUA 1IQRA 3HDXA 4FULA 3FHEA 2A4ZA 3SBTB 2KCKA 1DNPA 4UWLA 1EPUA 2V8SE 3GZ2A 3ENEA 3BG0B 5JJ7A 4GZDA 1E8ZA 3G2WA 1OWOA 4KVMA 3I5PA 4A55A 4HXIA 3QKYA 2UWJG 4I43A 2KM4A 3Q5MA 5ENNA 5JHAA 1ELRA 4U0UA 3RO2A 3APFA 2HR2A 3L16A 4ILIA 3BEEA 4LCTA 3PZDA 1OWNA 2HM8A 2FO7A 3QOUA 4C0EA 1OWLA 4BFRA 2CG2A 3S2AA 4JZYA 5HQ8A 1E90A 3URZA 1HXIA 1H6KA 1HG2A 1NZNA 3VLEA 4ANWA 3B13A 5FZRA 2JLBA 2WXRA 5CHEE 4AP2A 2XGOA 3D9IA 4HOUA 3UMVA 3CVQA 3IV0A 3VTXA 4GCOA 4H7XA 3G2SA 3FULA 3PUKA 4Q94A 3HIZA 1NP7A 4JW1A 4CDRA 3MX3A 1A17A 1SQMA 1NA0A 2FBNA 3LS8A 3OAWA 2VSNA 4RG9A 4N3CA 3BG1B 4BT9A 2A5UA 1ELWA 5KCMA 4L23A 2LSUA 2UY1B 3FH8A 2YHCA 3MCXA 3MA5A 1E8YA 2CFZA 5T8IA 2CG3A 3CKBA 1GW6A 2EQXA 4E85A 4AY6A 4G1TA 4XZ4A 2L0TB 3IBEA 3PDNA 4UWHA 4EQFA 4G26A 3LVQE 4GZ5A 4AXHA 3Q47B 4F53A 4FP7A 4KYOB 4EBAG 1L5JA 3KD7A 5ARGA 4ANUA 2WXIA 1MQSA 2J09A 3L13A 5M72A 1SZAA 3MZLB 3RJVA 4JC8A 4HORA 4GZCA 2X6KA 5D0OD 1BPOA 5FQ7A 5A7DB 4N2SA 4I2ZA 3JQ0A 3ZYLA 1Z3YA 2PQNA 2WXFA 2WXHA 4XE0A 1INZA 1HF8A 4WWNA 4U0SA 5T3RA 1P5QA 1PY1A 2PM7A 3FU6A 2PM6A 1VDYA 2WXNA 3FUFA 2J4DA 5EKQD 3R9AB 4I1OB 2VJ8A 3RKVA 4A1GA 5AIJA 4RG6A 2ZU6B 3FUMA 2J4BA 3ASHA 3ML9A 4V3IA 5CCLA 1TJCA 4DI3A 3ASGA 3ESKA 1E7UA 3FTWA 3CVYA 2FI7A 2XGSA 2NC9A 2LAIA 4HOQA 1E7VA 3SF4A 3CSTA 2OV8A 3ZHEB 1UJKA 2WXPA 4M3OA 4A3TA 4CT0A 3KS2A 4NURA 5BNWA 4LERA 4I1MA 1QQEA 3CGHA 4AM9A 5G04C 3QNKA 3NF1A 2VSOE 3CEQA 4D10C 2WQ6A 4KZCA 3TAXA 2IQCA 3QARA 4J8FA 2IFUA 2PL2A 2XRYA 1U3CA 3FH5A 5CMYA 5LX8A 1HU3A 3PS6A 3CR3A 3L08A 2XPIA 1N52A 2AVPA 3KEZA 4U63A 4J8EA 3ZVVA 4JPSA 3QC1A 3EHNA 4AV7A 2P58C 3AU5A 5JHBA 3CVVA 4FHJA 2C2LA 2I6HA 3IKOB 3CHQA 5G04J 5G2NA 4B89A 3AS4A 4AJWA 4BY6A 1EYHA 2WB2A 4UI9K 3T5XA 5A23A 1HE8A 2I1KA 3KAEA 2WVIA 1WAO1 4GPKA 3HVEA 4N3BA 3TGOA 3SBSA 4UQXA 3OTNA 4KVOA 4I6GA 2L0IA 4MKTA 4NRHB 5KJKA 1HO8A 2FEZA 3QDNA 3PNTB 2AXVA 4GMLA 3CHSA 3UQ3A 4CGWA 4KZ0A 1OUVA 2VTBA 2PQRA 4DLOA 4XIFA 4ILHB 3MKQB 2OVFA 3S7JA 4U07A 3NZSA 3SHFA 4JHKA 3TG4A 1OWMA 2MOWA 4Y6WA 5FQ6A 4C0MA 3PREA 3TXNA 3TXMA 3ZW3A 2XCBA 2DCPA 2X6HA 3LKUA 4GA1A 4H7YA 3RU0A 2V5FA 4I1AA 4APFA 3TJPA 3Q4AB 1N54A 1B89A 2LSVA 3U66A 3T8MA 4HOTA 3ZYQA 1H0AA 3ZPJA 3APCA 3APDA 3MYVA 4EBAA 5JJTA 3EIQC 3ESLA 4UI9C 4PUCA 2WXOA 4ABNA 2GW1A 4BTBA 3RRNB 4FA6A 3ZYKA 3UPVA 4WNDA 3CVLA 2Q7FA 4O6FA 1JWFA 4HFGA 4WNGA 4JL0A 4CRWA 4UQYA 4I9EA 4MRUA 2OVBA 1SZ9A 4KXKB 3VTYA 3TL5A 3ULQA 1HS6A 3IHYA 2CHXA 3CHRA 4WAFA 4K0RA 4DLQA 2DBAA 3EIJA 3QWVA 1JUQA 2V4LA 3DBSA 3EJNA 1WM5A 3FFLA 3PUJA 4GCNA 4UI9J 4BWRA 2AWIA 4BX9A 2RG8A 4WNEA 4ANXA 3IEGA 5BT1A 1S0PA 2BF0X 2KZTB 1OWPA 3GYZA 3I3NA 5FWQA 4WNFA 3FY4A 2M63A 4WUYA 2UY1A 3AU4A 3L22A 3PRZA 5E76A 2XCCA 4GYOA 4APOA 3GZSA 3ZEFA 2VGXA 4JEHA 2ONDA 4UWFA 2C0MA 3SZ7A 4FHKA 1U3DA 1KLXA 1QNFA 2R5SA 2WMOA 4UWGA 3RRMB 5HI7A 3CSFA 3E4BA 3L17A 1ELKA 4QFVA 2V0PA 5C1DA 4BTAA 3CQGB 5AYWD 1EF1C 2OOEA 2AXUA 2XEVA 5LOZA 2I2OA 4MLPA 5LP0A 2NSZA 3D9KA 3ZGQA 4EZLA 4DK5A 4F3VA 2X6IA 5JJ6A 2JEKA 3FH7A 1E96B 3PEVB 4R7LA 1TEZA 3OXLA 1FVFA 5AJLA 4W9RA 2GRLA 5FT9A 4TV3A 3PEUB 4JHJA 3MV2B 2WXMA 5FZQA 3D9OA 3N71A 2RD0A 3JCKC 5BW8C 1PAQA 2X6JA 3ZXSA 4CDNA 3FEXA 1H2VC 4XI0A 1JWGA 1ZBPA 3ZHEA 1WY6A 3FUHA 4TUUA 3LYAA 4GAAA 1UJJA 3B7SA 5EDSA 3MGBA 2AW6A 3CVNA 4GZ3A 1PC2A 4GYWA 3LY7A 1UN9A 3QWWA 3QAQA 4K03A 2I9CA 4I17A 2KATA 3SD5A 3ZN3A 1FVHA 4G25A 2DIWA 3FDHA 4FLHA 4JVSA 4XX5A 3IHVA 4DI4A 5DBKA 2IU1A 3SI5A 4LUNU 4E6HA 4L7TA 4OYSA 3GW4A 4LRZA 4EZJA 3S7DA 5ANRA 3ASDA 4JEUA 2WXKA 4CDMA 3FTYA 4WWPA 3RO3A 3JYSA 4JA9A 3LY9A 4I2WA 4YVOA 4OVVA 4B8CB 5BV0A 4IULA 4J0UA 4G11A 4ME2A 2Y4TA 3D9MA 3O48A 2IOSA 3S7FA 3FUEA 4HS2A 2Y3AA 3ZIMA 3CVXA 3CVUA 3NQPA 5FTPA 2IONA 3ZFWA 1HH8A 2VGYA 2KC7A 3LCAA 4I6EA 4CT4A 2J08A 4EECA 2L9BA 4PS8A 2J9QA 4KMOA 1KT0A 2VSXE 1H2TC 2HYZA 4IRUA 4GU5A 2KCVA 3VLFA 2X38A 3FU5A 3FP3A 3PE3A 2ILRA 3U64A 3CQCB 1HZ4A 4B8AA 2LNIA 1IYGA 4F7AA 3FU0A 3FTSA 2WXQA 3Q49B 5G55A 1X5BA 4XI9A 3R7RA 4CCAA 2VSYA 5FJYA 4FADA 4I9CA 3FTVA 4PS7A 4N2QA 1Z6TA 3MKQA 2GGFA 4N5CA 5FQ8A 4HOSA 3ONKA 4GMJA 4F1SA 3C98A 4URKA 3LVRE 3ONLA 4L2YA 3SNXA 3HHMA 2IF4A 4A3VA 3LJ3A 4N39A 5AENA 3G2VA 5BV1A 2MHKA 3EHMA 3B7UX 3CK8A 3D3MA 3PE4A 4N3AA 4B0ZA 5LFAA 5ARFA 3U9WA 4G24A 2IOLA 2E2EA 3FUNA 4FLBA 3MV3B 1NA3A 3HYMB 4PDXA 5G05C 3D9JA 4GYYA 2WQ7A 2XPZA 4JXTA 2MRIA 4I6JA 3ZYMA 3P2BA 1E8XA 5BUZA 3B7RL 4HVBA 2X3MA 2E0IA 4FC8A 2XRZA 4A1SA 4XKCA 5J90A 2L6JA 5KJLA 2YQ8A 1XNFA 4ILGA 4L1BA 4AIFA 3CVWA 3MEKA 3FTZA 3GZ1A 2CHZA 4J8SA 1UN8A 2FF4A 2WMNA 2BTDA 2XPYA 3FWVA 5C2YA 2XQ0A 1W3BA 1YA0A 3SFZA 5CMWA 2KZTA 5G05J 3CLJA 5D0QD 4FU3A 1FCHA 3L54A 2QFCA 3FUDA 4GZ6A 3CIAA 4U8HA 3OXFA 4DJAA 1Y8MA 2NXPA 1UW4B 1HG5A 3LEWA 4ATGA 4AY5A 2C0LA 3CV0A 3LPZA 3TG5A 2LAHA 3WXXA 3DPDA 4BT8A 3FTXA 4YVQC 3I4GA 3AS5A 2VGXB 3O4ZA 1UG3A 2J49A 3U4TA 4BSXA 4C9BB 3PH0C 1XGWA 5BPPA 2Y4UA 4UWKA 3UT8A 3P1UA 5EX0A 3RIBA 3R7QA 4FJZA 4U0ZA 4FJYA 3D9LA 3G2UA 3FUKA 5ANLA 5EX3A 2X6FA 3LDZA 4XKBA 1Y6IA 4AEZC 4EPZA 4IN3B 4Y6CA 4CEMA 3AS8A 4DPRA 3LY8A 2WQHA 3CKCA 3JQ1A 4CGVA 3QB2A 2YHEA 2LO6A 4KT6B 3MJWA 4OVUA 3JUIA 2BUGA 2PZIA 4P29A 5T4YA 3SGHA 4TRQA 4G2VA 3ASFA 4BX8A 3U3WA 3QWPA 5E75A 2YNQA 2WM9A 4J8DA 5DIZA 2YINA 4L2LA 1HX8A 3FUJA 1Z3XA 3PVLA 4ACKA 1IQUA 1H2UA 3UT4A 1LF8A 2WXGA 4PS3A 3D9PA 4WWOA 2XGMA 4ANVA 3NZUA 1ZU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GA0 A;  4G23 A;  4B94 A;  4JHR A;  4JA7 A;  1IHG A;  5FZS A;  4GA2 A;  3CK7 A;  5LCW C;  4U04 A;  5CCM A;  5KJM A;  2VYI A;  4NQ0 A;  3EDT B;  3Q15 A;  4YND A;  3MKR A;  2WPV A;  1KT1 A;  1QZ2 A;  4UQZ A;  2HO1 A;  3K9I A;  2KCL A;  5LCW J;  3OXG A;  3S7B A;  3UUX A;  4LEU A;  4KBQ A;  5A6C A;  3CVP A;  3CK9 A;  2VQ2 A;  5KJN A;  2KCK A;  3GZ2 A;  5JJ7 A;  3QKY A;  2UWJ G;  3Q5M A;  1ELR A;  4U0U A;  3RO2 A;  2HR2 A;  3BEE A;  2FO7 A;  3QOU A;  5HQ8 A;  3URZ A;  1HXI A;  1NZN A;  5FZR A;  2JLB A;  5CHE E;  2XGO A;  4HOU A;  3CVQ A;  3VTX A;  4GCO A;  4H7X A;  4CDR A;  1A17 A;  1NA0 A;  2FBN A;  2VSN A;  4RG9 A;  4N3C A;  4BT9 A;  1ELW A;  2LSU A;  2UY1 B;  2YHC A;  3MA5 A;  3CKB A;  4AY6 A;  4G1T A;  3PDN A;  4EQF A;  4G26 A;  4GZ5 A;  3Q47 B;  4KYO B;  3KD7 A;  5ARG A;  5M72 A;  3RJV A;  4HOR A;  5D0O D;  5A7D B;  4N2S A;  4I2Z A;  2PQN A;  4U0S A;  1P5Q A;  3RKV A;  3R9A B;  5EKQ D;  4RG6 A;  3ASH A;  5CCL A;  1TJC A;  3ASG A;  3ESK A;  2FI7 A;  2XGS A;  2NC9 A;  4HOQ A;  3SF4 A;  3ZHE B;  3KS2 A;  5BNW A;  1QQE A;  4AM9 A;  5G04 C;  3NF1 A;  3CEQ A;  3TAX A;  4J8F A;  2IFU A;  2PL2 A;  2XPI A;  2AVP A;  4J8E A;  2P58 C;  2C2L A;  2I6H A;  5G04 J;  3AS4 A;  4UI9 K;  3KAE A;  1WAO 1;  4GPK A;  4N3B A;  3TGO A;  4UQX A;  4NRH B;  5KJK A;  2FEZ A;  3QDN A;  3UQ3 A;  4CGW A;  1OUV A;  2PQR A;  4XIF A;  3S7J A;  4U07 A;  3TG4 A;  4Y6W A;  2XCB A;  3LKU A;  4GA1 A;  3RU0 A;  4H7Y A;  2V5F A;  4I1A A;  3Q4A B;  1B89 A;  2LSV A;  4HOT A;  3ZPJ A;  5JJT A;  4UI9 C;  4ABN A;  2GW1 A;  4BTB A;  3UPV A;  4WND A;  3CVL A;  2Q7F A;  4O6F A;  4WNG A;  4JL0 A;  4UQY A;  4I9E A;  4KXK B;  3VTY A;  3ULQ A;  2DBA A;  3QWV A;  4GCN A;  4BWR A;  3FFL A;  1WM5 A;  4UI9 J;  4WNE A;  3IEG A;  5BT1 A;  3GYZ A;  4WNF A;  4WUY A;  2UY1 A;  2XCC A;  4GYO A;  4APO A;  2VGX A;  2OND A;  2C0M A;  3SZ7 A;  2R5S A;  1KLX A;  5HI7 A;  3E4B A;  5C1D A;  4BTA A;  5AYW D;  2OOE A;  2XEV A;  3ZGQ A;  5JJ6 A;  1E96 B;  3OXL A;  4W9R A;  5FT9 A;  3MV2 B;  5FZQ A;  3N71 A;  5BW8 C;  4XI0 A;  1ZBP A;  3ZHE A;  3LYA A;  3CVN A;  4GZ3 A;  1PC2 A;  4GYW A;  3LY7 A;  3QWW A;  4I17 A;  2KAT A;  3ZN3 A;  4G25 A;  5DBK A;  3GW4 A;  3S7D A;  3ASD A;  3RO3 A;  3JYS A;  4JA9 A;  3LY9 A;  4I2W A;  4YVO A;  4J0U A;  4ME2 A;  2Y4T A;  3O48 A;  3S7F A;  5FTP A;  3ZFW A;  1HH8 A;  2VGY A;  2KC7 A;  3LCA A;  2J9Q A;  1KT0 A;  2HYZ A;  2KCV A;  3PE3 A;  3FP3 A;  1HZ4 A;  2LNI A;  1IYG A;  3Q49 B;  4XI9 A;  2VSY A;  5FJY A;  4I9C A;  4N2Q A;  4N5C A;  4HOS A;  2IF4 A;  4N39 A;  2MHK A;  3CK8 A;  3PE4 A;  4N3A A;  5ARF A;  4G24 A;  2E2E A;  3MV3 B;  1NA3 A;  3HYM B;  5G05 C;  4GYY A;  4A1S A;  2L6J A;  5KJL A;  2YQ8 A;  1XNF A;  4AIF A;  3MEK A;  4F3V A;  3GZ1 A;  2FF4 A;  3FWV A;  1W3B A;  1YA0 A;  5G05 J;  5D0Q D;  1FCH A;  2QFC A;  4GZ6 A;  3OXF A;  1Y8M A;  4AY5 A;  2C0L A;  3CV0 A;  3LPZ A;  3TG5 A;  3WXX A;  4BT8 A;  4YVQ C;  3U4T A;  3AS5 A;  2VGX B;  2Y4U A;  5EX0 A;  3RIB A;  4U0Z A;  5EX3 A;  4IN3 B;  4Y6C A;  3AS8 A;  3LY8 A;  2WQH A;  3CKC A;  4CGV A;  2BUG A;  2PZI A;  4G2V A;  3ASF A;  3U3W A;  3QWP A;  4J8D A;  5DIZ A;  2XGM A;  1ZU2 A; 
#chains in the Genus database with same CATH topology
 4U8Y D;  4JA7 A;  1IHG A;  1WDY A;  4GA2 A;  3QJZ A;  1N4S A;  5AJD A;  5CCM A;  5KJM A;  3Q75 A;  3EDT B;  4YND A;  2QZA A;  3ZRH A;  4PH4 B;  4HLE A;  3EHR A;  3FEY A;  2LXM A;  2KCL A;  3PNL B;  1IHB A;  2RFA A;  1DVP A;  3W9G A;  4KBQ A;  3CK9 A;  2VTB B;  4Q69 A;  4EZK A;  4RSY A;  3PZ1 A;  3T5V A;  3FU3 A;  3B7T A;  3FHE A;  3SBT B;  1DNP A;  3SO8 A;  3GZ2 A;  4F1P A;  4Z68 A;  1E8Z A;  1OWO A;  2XZD G;  3QKY A;  4O1P A;  1ELR A;  3EHQ A;  4U0U A;  3L16 A;  3BEE A;  4LCT A;  1FT1 A;  5JA4 D;  1D9S A;  2IEJ A;  1HXI A;  1HG2 A;  2WXR A;  4AP2 A;  4HOU A;  3D9I A;  3UMV A;  3VTX A;  4GCO A;  4H7X A;  4O60 A;  3G2S A;  1NP7 A;  4HI8 A;  1A17 A;  2FBN A;  4RG9 A;  3UTM A;  4GMR A;  1OCO E;  2CG3 A;  1TR4 A;  1MX4 A;  4AY6 A;  4G1T A;  3PDN A;  2RFM A;  4FP7 A;  2EIM E;  3KD7 A;  4ANU A;  4DX6 D;  2WXI A;  2J09 A;  3L13 A;  3MZL B;  4YDE A;  4GTR A;  5D0O D;  1N4R A;  1Z3Y A;  4XE0 A;  3IXE A;  1PY1 A;  5ENR D;  4I1O B;  2J4B A;  3ASH A;  3R9M A;  1DCQ A;  3ASG A;  3ESK A;  2XGS A;  5AQA A;  4HOQ A;  1UJK A;  4A3T A;  3ISM C;  4AM9 A;  3QAR A;  4J8Y A;  2XRY A;  5CMY A;  3PS6 A;  2XPI A;  4U63 A;  4AV7 A;  2DWZ A;  4FHJ A;  5G04 J;  1EYH A;  5A23 A;  4GPK A;  3TGO A;  3OTN A;  5ITZ F;  2L0I A;  1NI1 A;  5KJK A;  3UQ3 A;  2VTB A;  4DX2 A;  3DXM G;  4HQD A;  3PRE A;  3TXM A;  2X6H A;  3AJI A;  2V5F A;  5KWD A;  2LSV A;  1QYM A;  3ZYQ A;  3APD A;  2OEW A;  3ESL A;  4UI9 C;  4L9P A;  4O6F A;  4JL0 A;  2OVB A;  1SZ9 A;  5D66 A;  3VTY A;  4BET A;  3CHR A;  2DBA A;  3EIJ A;  4WNE A;  4HNA D;  4ANX A;  5IY5 E;  3I3N A;  2KZT B;  3KSL A;  2M63 A;  3NBN B;  3PRZ A;  3RAU A;  2VGX A;  1MX2 A;  2C0M A;  2DZN A;  2R5S A;  1KLX A;  1D8E A;  3RRM B;  1QNF A;  5HI7 A;  3E4B A;  3L17 A;  4QFV A;  3Q73 A;  4BTA A;  5LOZ A;  2DZO A;  2XEV A;  5LP0 A;  3ZGQ A;  1S63 A;  4DK5 A;  4HRL A;  2X6I A;  3FH7 A;  3L82 A;  1K1A A;  2GRL A;  3MV2 B;  5FZQ A;  3N71 A;  3JCK C;  3BUA A;  1H2V C;  4XI0 A;  1WY6 A;  4TUU A;  3QWW A;  3B7B A;  1TNY A;  2DIW A;  3BQO A;  3IHV A;  4X8Q A;  2IU1 A;  4LRZ A;  4JEU A;  4WWP A;  3ZUV B;  4I2W A;  4OVV A;  1H6P A;  3B95 A;  3F6Q A;  4XEI G;  3ZIM A;  4TUM A;  2J08 A;  4EEC A;  4KMO A;  1KT0 A;  4GU5 A;  2KCV A;  3FP3 A;  3CQC B;  1HZ4 A;  2P9N G;  3DSU A;  3FTS A;  5EYP F;  4N5Q A;  3SNX A;  2IF4 A;  4A3V A;  3HG0 D;  4N39 A;  3G2V A;  4B0Z A;  2IO2 C;  5CED B;  2IOL A;  3Q9U C;  3FUN A;  4FLB A;  3X2Q E;  3Q9N C;  3D9J A;  2MRI A;  3ZYM A;  2GRN B;  4LSZ E;  2XRZ A;  1XNF A;  4L1B A;  3CVW A;  4F3V A;  2EIN E;  1YA0 A;  2KZT A;  2PNN A;  3FUD A;  2R03 A;  5B1A E;  3OXF A;  4DJA A;  1Y8M A;  1HG5 A;  2C0L A;  3LPZ A;  3TG5 A;  1YCS B;  4DRX E;  3AS5 A;  4C9B B;  2XS1 A;  2Y4U A;  4UWK A;  3TWS A;  3P1U A;  4FJZ A;  3D9H A;  5ANL A;  3D9L A;  3G2U A;  5EX3 A;  2X6F A;  3UKU G;  3QB2 A;  2YHE A;  5T4Y A;  2QC9 A;  4G2V A;  3ASF A;  5E75 A;  2YNQ A;  1V55 E;  1HX8 A;  2P9P G;  4UUC A;  3UT4 A;  1LF8 A;  3UM0 A;  3D9P A;  4WWO A;  2XGM A;  3NZU A;  1ZU2 A;  3ULE G;  5FZS A;  4CZ2 D;  5B3S E;  3I4R B;  4J6I A;  2R2L A;  4AVX A;  1H19 A;  2R59 A;  2VYI A;  2CHW A;  5J08 A;  3J5Q B;  2V5Q C;  3Q15 A;  2GRP B;  4IYP A;  3ULY A;  3VLD A;  3MKR A;  4OAU C;  3ML8 A;  3CHO A;  1OCR E;  2R17 C;  4K5A B;  1SW6 A;  4UQZ A;  2GRM A;  2R02 A;  5LCW J;  2IJG X;  2ZIR A;  3CHP A;  2CFU A;  3D9N A;  3CHM A;  3ABM E;  3UUX A;  3DWL G;  4GTM A;  2FUL A;  4YDO A;  3L6A A;  5KJN A;  1EDU A;  3PZ4 A;  2KCK A;  1EPU A;  3BG0 B;  5JJ7 A;  3Q7F A;  4HBD A;  2H6I A;  1N11 A;  2UWJ G;  1AWC B;  2HR2 A;  4ILI A;  1OWL A;  4LNG A;  4JZY A;  4K5B A;  3URZ A;  1H6K A;  1UOH A;  1NZN A;  3VLE A;  3B13 A;  5FZR A;  3UKR G;  3CVQ A;  3IV0 A;  4YDY A;  1TNB A;  5ENO D;  3LS8 A;  2KBX A;  4BT9 A;  2A5U A;  1ELW A;  4L23 A;  3MCX A;  5ENP D;  2GRR B;  3CKB A;  4XZ4 A;  4UWH A;  4K5C A;  4G26 A;  4AXH A;  3Q47 B;  4KYO B;  4EBA G;  5ARG A;  4JC8 A;  4HOR A;  4GZC A;  2X6K A;  4I2Z A;  3JQ0 A;  4ZFH A;  2PM7 A;  3RKV A;  1BU9 A;  5EIB E;  2J4D A;  4A1G A;  3HXC A;  4V3I A;  1SA5 A;  2L6B A;  2LUH A;  3AG1 E;  4DI3 A;  3FTW A;  4GTQ A;  3CST A;  2OV8 A;  5AAR A;  1QBQ A;  3JUE A;  3KS2 A;  2GRQ B;  5BNW A;  4LER A;  3EU5 A;  1QQE A;  2P9S G;  5G04 C;  4J8F A;  2XEH A;  2IFU A;  1U3C A;  2EIK E;  3FH5 A;  3CR3 A;  3L08 A;  1N52 A;  2AVP A;  3KEZ A;  4J8E A;  2Y1L E;  3NOG D;  3CVV A;  2ZGG A;  3IKO B;  3CHQ A;  4AJW A;  1HE8 A;  4GTP A;  1N0Q A;  2WVI A;  2EIJ E;  4NRH B;  3E33 A;  1HO8 A;  3PNT B;  2AXV A;  2VGE A;  4DLO A;  3E30 A;  4XIF A;  3C5R A;  2OVF A;  2ZIS A;  3S7J A;  3SFX A;  4JHK A;  5ENT D;  3TG4 A;  2MOW A;  3TXN A;  2XCB A;  3TWV A;  4H7Y A;  4YDW A;  4APF A;  1K3Z D;  4BEP A;  3RRN B;  2QYJ A;  4FA6 A;  3ZYK A;  1G3N B;  2J8S D;  3AG2 E;  4WNG A;  5KNH D;  4I9E A;  4KXK B;  3TL5 A;  2CHX A;  1JUQ A;  3DBS A;  4BWR A;  1WM5 A;  2RG8 A;  4A63 B;  5BT1 A;  1TNO A;  2BF0 X;  2RKK A;  5FWQ A;  4RLY A;  3FY4 A;  3AU4 A;  3L22 A;  5E76 A;  4APO A;  3ZEF A;  3TWQ A;  3PZ2 A;  3SZ7 A;  4FHK A;  1BD8 A;  4UWG A;  3PZ3 A;  1ELK A;  5ENQ D;  1K1B A;  2AXU A;  4LG6 A;  4R7L A;  5AJL A;  1BLX B;  3ABL E;  5FT9 A;  4TV3 A;  3D9O A;  1LTX A;  5BW8 C;  4CDN A;  1JWG A;  3TWW A;  4O1O A;  1UJJ A;  2AJA A;  3T9K A;  2AW6 A;  3CVN A;  1UN9 A;  3QAQ A;  3ZN3 A;  4XX5 A;  4DI4 A;  4E6H A;  3WG7 E;  3ASD A;  2WXK A;  3FTY A;  2F37 A;  3JYS A;  2H6F A;  4YVO A;  4G11 A;  4ME2 A;  3O48 A;  3S7F A;  2H6G A;  1MYO A;  3CVX A;  3NQP A;  1RZ4 A;  1HH8 A;  2L9B A;  2J9Q A;  1H2T C;  3DSX A;  3FU5 A;  4B8A A;  3ZKJ A;  2LNI A;  3FU0 A;  2WXQ A;  3Q49 B;  2NYJ A;  3R7R A;  1X5B A;  4XI9 A;  5FJY A;  3FTV A;  4PS7 A;  4N5C A;  4URK A;  5AEN A;  3B7U X;  3PE4 A;  4N3A A;  3U9W A;  3HYM B;  4PDX A;  4J7W A;  4GYY A;  2WQ7 A;  2XPZ A;  4I6J A;  1E8X A;  3B7R L;  4HVB A;  2E0I A;  4FC8 A;  3C3O A;  4XKC A;  3GZ1 A;  3SY2 A;  2FF4 A;  3FWV A;  2XQ0 A;  1W3B A;  3E37 A;  5G05 J;  3CLJ A;  5D0Q D;  3L54 A;  2QFC A;  4GZ6 A;  5ENS D;  3LEW A;  2P9K G;  2DVW A;  3WXX A;  3DPD A;  4BT8 A;  5CBN A;  3O4Z A;  3Q78 A;  1UG3 A;  2J49 A;  3PH0 C;  1XGW A;  3R7Q A;  4FJY A;  1NL4 A;  4CEM A;  3AS8 A;  4U8V D;  3LY8 A;  5B1B E;  4CGV A;  4KT6 B;  4OVU A;  3JUI A;  2BUG A;  4G8L A;  4TRQ A;  3DSV A;  4J8D A;  5DIZ A;  1LD8 A;  3J5P A;  1Z3X A;  3PVL A;  1H2U A;  4PS3 A;  1OCZ E;  4ANV A;  4G23 A;  3UX4 A;  4B94 A;  3CK7 A;  1YMP A;  5LCW C;  2ZGD A;  3AAA C;  3FUI A;  1JPL A;  4U04 A;  3UT7 A;  2A5E A;  4HRM B;  3LXU X;  4RVB A;  4NQ0 A;  3LJN A;  4MS6 A;  3HRA A;  5FQ4 A;  1KT1 A;  4TXP A;  4NAC A;  1JCR A;  1QZ2 A;  2HO1 A;  5KNG A;  2J07 A;  3OXG A;  1IXV A;  1FT2 A;  4AOF A;  2XHE A;  1X81 A;  2WXL A;  1IKN D;  2ETA A;  3FTU A;  4Q96 A;  5A6C A;  1TJF A;  3CVP A;  1NFI E;  3KSQ A;  3RRU A;  1IQR A;  2A4Z A;  4UWL A;  2V8S E;  3ENE A;  2H6H A;  4KVM A;  5JHA A;  2KM4 A;  3Q5M A;  3RO2 A;  2OCC E;  4HRN A;  1OWN A;  4BFR A;  2CG2 A;  1OY3 D;  1E90 A;  2QYU A;  4ANW A;  3E32 A;  5CER B;  5CHE E;  1O1R A;  3FUL A;  4Q94 A;  4CDR A;  3MX3 A;  4F6R D;  1NA0 A;  1FPP A;  2VSN A;  5KCM A;  2LSU A;  2CFZ A;  5T8I A;  1OCC E;  1GW6 A;  2EQX A;  4E85 A;  3TWX A;  3LVQ E;  4GZ5 A;  1SVX A;  1L5J A;  5M72 A;  2BKG A;  1SZA A;  1O1S A;  3RJV A;  3V2O A;  2OEV A;  1LD7 A;  5A7D B;  3ZYL A;  2EIL E;  2LXL A;  3NB2 A;  2WXF A;  1HF8 A;  4U0S A;  1P5Q A;  3FUF A;  1OXJ A;  1VDY A;  2WXN A;  5EKQ D;  4RG6 A;  3EUV A;  3FUM A;  5CCL A;  2KXP C;  2FI7 A;  2NC9 A;  2LAI A;  1E7V A;  3ZHE B;  1S70 B;  4NUR A;  4I1M A;  2P9L G;  3NF1 A;  3CEQ A;  4KZC A;  3TAX A;  2IQC A;  2PL2 A;  5LX8 A;  1HU3 A;  5CRU A;  3ZVV A;  3EHN A;  3AU5 A;  2C2L A;  4BSZ B;  5G2N A;  4LNU D;  4UI9 K;  3T5X A;  1BI8 B;  2ZXW E;  4N3B A;  3UI2 A;  2FEZ A;  1JCQ A;  1OUV A;  2PQR A;  4ILH B;  3NZS A;  5AN8 A;  3SHF A;  5FQ6 A;  4C0M A;  4U96 D;  3ZW3 A;  4GA1 A;  3RU0 A;  4I1A A;  3TJP A;  3Q4A B;  1N54 A;  1B89 A;  3U66 A;  3T8M A;  1H0A A;  4JB8 P;  1V54 E;  4ABN A;  3CVL A;  3DEO A;  4HFG A;  4CRW A;  4UQY A;  3KEA A;  4MRU A;  1HS6 A;  5HKP A;  3IHY A;  1D8D A;  4WAF A;  5FIN A;  4GCN A;  3FFL A;  2AWI A;  4BX9 A;  1S0P A;  4WNF A;  1DCE A;  4G8K A;  3ASN E;  4DX7 D;  3ZU7 B;  3GZS A;  4UWF A;  2P2C P;  1U3D A;  5CBO A;  3CSF A;  5C1D A;  3CQG B;  5AYW D;  1EF1 C;  2OOE A;  2I2O A;  2NSZ A;  1Q2Z A;  5JJ6 A;  1S64 A;  3PEV B;  3UM3 A;  1TEZ A;  3OXL A;  5AQ9 A;  3Q79 A;  2WXM A;  2IO3 C;  1PAQ A;  2X6J A;  1ZBP A;  3ZHE A;  3FUH A;  2DYR E;  3LYA A;  4GAA A;  3E34 A;  5EDS A;  3MGB A;  4GZ3 A;  1PC2 A;  2I9C A;  2KAT A;  3SD5 A;  4OAV B;  3TWU A;  1FVH A;  5DBK A;  4LUN U;  4L7T A;  3TWR A;  4EZJ A;  3S7D A;  2ETB A;  4DX5 D;  5H7P A;  3ASO E;  4IUL A;  1A5E A;  3D9M A;  2IOS A;  3V79 K;  3FUE A;  1O5M A;  2Y3A A;  3CVU A;  2ION A;  2VGY A;  2KC7 A;  3LCA A;  4I6E A;  4PS8 A;  2BED A;  2HYZ A;  5FIO A;  2X38 A;  2ILR A;  3U64 A;  1IYG A;  4CCA A;  2VSY A;  4I9C A;  4N2Q A;  1Z6T A;  5FQ8 A;  2GGF A;  4HOS A;  3ONK A;  4GMJ A;  4F1S A;  4DX1 A;  1SA4 A;  3ONL A;  5BV1 A;  3CK8 A;  3D3M A;  1KZO A;  5ARF A;  4G24 A;  3SQV A;  3AG3 E;  3MV3 B;  5G05 C;  3ABK E;  1WG0 A;  4TXQ A;  1U2V G;  4A1S A;  5J90 A;  5CEC B;  2YQ8 A;  4TXR A;  3MEK A;  4HLL A;  3DPY A;  4J8S A;  5C2Y A;  1UN8 A;  2WMN A;  2XPY A;  3ZXP A;  1AP7 A;  3DXK G;  4FU3 A;  3CIA A;  3HXB A;  4U8H A;  3V2X A;  4ATG A;  2LAH A;  3SFY A;  3FTX A;  4YVQ C;  2VGX B;  4C48 B;  4LNB A;  2Y0B G;  3UT8 A;  5EX0 A;  2F8X K;  5HS0 A;  3DSW A;  3LDZ A;  1Y6I A;  4AEZ C;  4IN3 B;  4Y6C A;  3CKC A;  1TNZ A;  3UIP C;  2LO6 A;  3MJW A;  2PZI A;  2F0Y A;  2YIN A;  2WXG A;  4GA0 A;  4EHM A;  4JHR A;  2XZT G;  2QY7 A;  3G2T A;  1E8W A;  4ATZ D;  1MZC A;  2AXZ A;  1N9A A;  2WPV A;  1N94 A;  2WXJ A;  4RQI A;  3K9I A;  5EN5 D;  3RK6 A;  4GB9 A;  3S7B A;  1KPS B;  3HVE B;  3UIO C;  4LEU A;  3ZNG A;  1BI7 B;  1MHQ A;  4ACL A;  3QK0 A;  1HFA A;  2I1J A;  2VQ2 A;  3TWT A;  3HDX A;  4FUL A;  2P9U G;  4GZD A;  3G2W A;  3I5P A;  5BXU A;  4A55 A;  4HXI A;  5ENN A;  4I43 A;  1JCS A;  3APF A;  4GTO A;  3EU9 A;  4U7E B;  3PZD A;  2HM8 A;  2FO7 A;  3QOU A;  4C0E A;  3Q7A A;  3S2A A;  5HQ8 A;  3HXD A;  3NOC D;  2ETC A;  2JLB A;  2XGO A;  2HE0 A;  3PUK A;  3HIZ A;  4BER A;  4JW1 A;  4ZHB A;  5JMN D;  1SQM A;  3OAW A;  4N3C A;  3BG1 B;  3UXG A;  2UY1 B;  3FH8 A;  2YHC A;  3MA5 A;  2FO1 E;  1E8Y A;  2L0T B;  3IBE A;  4NIK A;  4EQF A;  3V30 A;  4F53 A;  2XEE A;  4M7C A;  5HRY A;  2IY0 C;  1MQS A;  5D2M C;  3BU8 A;  1BPO A;  5FQ7 A;  4N2S A;  2PQN A;  2WXH A;  4B93 B;  1INZ A;  4WWN A;  5T3R A;  3FU6 A;  3T8K A;  2PM6 A;  3R9A B;  5AIJ A;  2VJ8 A;  2ZU6 B;  3ML9 A;  1TJC A;  1E7U A;  3CVY A;  1TNU A;  3SF4 A;  2WXP A;  4M3O A;  4CT0 A;  1ZB1 A;  2MYO A;  3CGH A;  3QNK A;  2VSO E;  4D10 C;  2WQ6 A;  1N4P A;  2DYS E;  4JPS A;  3QC1 A;  1OT8 A;  2P58 C;  5JHB A;  2R05 A;  2I6H A;  5CEA A;  4B89 A;  3AS4 A;  2WB2 A;  4BY6 A;  2I1K A;  3KAE A;  1WAO 1;  1RW2 A;  3HVE A;  3C3R A;  3SBS A;  4UQX A;  4KVO A;  4I6G A;  4MKT A;  3QDN A;  4GML A;  3CHS A;  4CGW A;  4KZ0 A;  5AAO A;  2XEN A;  5EID A;  3DST A;  1N95 A;  3MKQ B;  4U07 A;  3UM2 A;  1N4Q A;  1OWM A;  4Y6W A;  1H6O A;  2DCP A;  3LKU A;  4HOT A;  3ZPJ A;  3APC A;  4EBA A;  3MYV A;  2BKK B;  3UIN C;  5JJT A;  3EIQ C;  1KZP A;  4PUC A;  2WXO A;  2GW1 A;  4BTB A;  3UPV A;  4WND A;  5KBA A;  2Q7F A;  1JWF A;  4GTV A;  3ULQ A;  2Y69 E;  4K0R A;  4DLQ A;  3QWV A;  3EJN A;  2V4L A;  3PUJ A;  4UI9 J;  3IEG A;  1OWP A;  3GYZ A;  1YYH A;  4WUY A;  2UY1 A;  1TN7 A;  2GRO B;  2XCC A;  4GYO A;  4JEH A;  2XS8 A;  2OND A;  3JXJ A;  1TN6 A;  2WMO A;  4GTS A;  4HB5 A;  2V0P A;  3DSS A;  3JXI A;  4MLP A;  3D9K A;  4EZL A;  1MJ0 A;  2JEK A;  1E96 B;  4GPM A;  1FVF A;  5AQ7 A;  2B0O E;  4W9R A;  3PEU B;  1Z5S C;  4JHJ A;  3RSE G;  2RD0 A;  4CYM D;  3ZXS A;  3FEX A;  3B7S A;  4GYW A;  3LY7 A;  4K03 A;  4I17 A;  2JAB A;  4FLH A;  4G25 A;  3FDH A;  4JVS A;  3SI5 A;  1K8K G;  5AQB A;  4OYS A;  3GW4 A;  5ANR A;  5EIL A;  3RO3 A;  4JA9 A;  3LY9 A;  4B8C B;  5BV0 A;  4J0U A;  2Y4T A;  4HS2 A;  5FTP A;  1MX6 A;  3ZFW A;  3HXF A;  4CT4 A;  2VSX E;  4IRU A;  4JD2 G;  5BXO A;  3NAW A;  2P9I G;  3VLF A;  3PE3 A;  4F7A A;  5G55 A;  3DRA A;  4FAD A;  3AG4 E;  3MKQ A;  3C98 A;  5EYL A;  3V31 A;  3LVR E;  4L2Y A;  3HHM A;  3LJ3 A;  2MHK A;  3EHM A;  5LFA A;  4DUI A;  3C72 A;  2E2E A;  1NA3 A;  3W9F A;  4JXT A;  5BUZ A;  3P2B A;  4U95 D;  3L9T A;  2X3M A;  2F8Y A;  2L6J A;  5KJL A;  4ILG A;  4AIF A;  3FTZ A;  4CDM A;  2CHZ A;  2BTD A;  3SFZ A;  5CMW A;  1DC2 A;  1TN8 A;  1FCH A;  1O1T A;  1UW4 B;  2NXP A;  4AY5 A;  3CV0 A;  3I4G A;  3U4T A;  4BSX A;  3C3Q A;  5BPP A;  3RIB A;  3DEP A;  4U0Z A;  3FUK A;  4QQI A;  4XKB A;  2V4H C;  4EPZ A;  4DPR A;  4GTT A;  2WQH A;  1TYQ G;  3JQ1 A;  5CRV A;  4BES A;  3UM1 A;  4P29 A;  3HXE A;  3SGH A;  4BX8 A;  3U3W A;  3QWP A;  2WM9 A;  4L2L A;  1N0R A;  3FUJ A;  2B6C A;  4ACK A;  1IQU A;  4HI9 A;  4MBG A; 
#chains in the Genus database with same CATH homology
 4GA0 A;  4G23 A;  3UX4 A;  4B94 A;  4JHR A;  4JA7 A;  1IHG A;  5FZS A;  4GA2 A;  3QJZ A;  3CK7 A;  5LCW C;  2QY7 A;  3I4R B;  3G2T A;  3FUI A;  4J6I A;  1H19 A;  1E8W A;  1JPL A;  4U04 A;  5AJD A;  3UT7 A;  2R59 A;  4AVX A;  5CCM A;  5KJM A;  2VYI A;  4RVB A;  3LXU X;  2AXZ A;  2CHW A;  3EDT B;  4NQ0 A;  5J08 A;  3Q15 A;  4YND A;  4IYP A;  3VLD A;  3MKR A;  2WPV A;  4MS6 A;  5FQ4 A;  3ZRH A;  3ML8 A;  3CHO A;  4PH4 B;  2R17 C;  4HLE A;  1KT1 A;  4NAC A;  1QZ2 A;  3FEY A;  4UQZ A;  2WXJ A;  2GRM A;  2HO1 A;  3K9I A;  2KCL A;  5LCW J;  2IJG X;  3CHP A;  3PNL B;  2CFU A;  2J07 A;  3OXG A;  3RK6 A;  4GB9 A;  3D9N A;  3S7B A;  3CHM A;  3UUX A;  4AOF A;  3HVE B;  4LEU A;  2XHE A;  2WXL A;  1DVP A;  3FTU A;  4Q96 A;  1MHQ A;  4KBQ A;  1TJF A;  5A6C A;  3CVP A;  3CK9 A;  4ACL A;  3QK0 A;  2VTB B;  4Q69 A;  2FUL A;  4EZK A;  4RSY A;  3T5V A;  1HFA A;  2I1J A;  2VQ2 A;  3B7T A;  3FU3 A;  3L6A A;  5KJN A;  1EDU A;  3RRU A;  1IQR A;  3HDX A;  4FUL A;  3FHE A;  2A4Z A;  3SBT B;  2KCK A;  1DNP A;  4UWL A;  1EPU A;  2V8S E;  3GZ2 A;  3ENE A;  3BG0 B;  5JJ7 A;  4GZD A;  1E8Z A;  3G2W A;  1OWO A;  4KVM A;  3I5P A;  4A55 A;  4HXI A;  3QKY A;  2UWJ G;  4I43 A;  2KM4 A;  3Q5M A;  5ENN A;  5JHA A;  1ELR A;  4U0U A;  3RO2 A;  3APF A;  2HR2 A;  3L16 A;  4ILI A;  3BEE A;  4LCT A;  3PZD A;  1OWN A;  2HM8 A;  2FO7 A;  3QOU A;  4C0E A;  1OWL A;  4BFR A;  2CG2 A;  3S2A A;  4JZY A;  5HQ8 A;  1E90 A;  3URZ A;  1HXI A;  1H6K A;  1HG2 A;  1NZN A;  3VLE A;  4ANW A;  3B13 A;  5FZR A;  2JLB A;  2WXR A;  5CHE E;  4AP2 A;  2XGO A;  3D9I A;  4HOU A;  3UMV A;  3CVQ A;  3IV0 A;  3VTX A;  4GCO A;  4H7X A;  3G2S A;  3FUL A;  3PUK A;  4Q94 A;  3HIZ A;  1NP7 A;  4JW1 A;  4CDR A;  3MX3 A;  1A17 A;  1SQM A;  1NA0 A;  2FBN A;  3LS8 A;  3OAW A;  2VSN A;  4RG9 A;  4N3C A;  3BG1 B;  4BT9 A;  2A5U A;  1ELW A;  5KCM A;  4L23 A;  2LSU A;  2UY1 B;  3FH8 A;  2YHC A;  3MCX A;  3MA5 A;  1E8Y A;  2CFZ A;  5T8I A;  2CG3 A;  3CKB A;  1GW6 A;  2EQX A;  4E85 A;  4AY6 A;  4G1T A;  4XZ4 A;  2L0T B;  3IBE A;  3PDN A;  4UWH A;  4EQF A;  4G26 A;  3LVQ E;  4GZ5 A;  4AXH A;  3Q47 B;  4F53 A;  4FP7 A;  4KYO B;  4EBA G;  1L5J A;  3KD7 A;  5ARG A;  4ANU A;  2WXI A;  1MQS A;  2J09 A;  3L13 A;  5M72 A;  1SZA A;  3MZL B;  3RJV A;  4JC8 A;  4HOR A;  4GZC A;  2X6K A;  5D0O D;  1BPO A;  5FQ7 A;  5A7D B;  4N2S A;  4I2Z A;  3JQ0 A;  3ZYL A;  1Z3Y A;  2PQN A;  2WXF A;  2WXH A;  4XE0 A;  1INZ A;  1HF8 A;  4WWN A;  4U0S A;  5T3R A;  1P5Q A;  1PY1 A;  2PM7 A;  3FU6 A;  2PM6 A;  1VDY A;  2WXN A;  3FUF A;  2J4D A;  5EKQ D;  3R9A B;  4I1O B;  2VJ8 A;  3RKV A;  4A1G A;  5AIJ A;  4RG6 A;  2ZU6 B;  3FUM A;  2J4B A;  3ASH A;  3ML9 A;  4V3I A;  5CCL A;  1TJC A;  4DI3 A;  3ASG A;  3ESK A;  1E7U A;  3FTW A;  3CVY A;  2FI7 A;  2XGS A;  2NC9 A;  2LAI A;  4HOQ A;  1E7V A;  3SF4 A;  3CST A;  2OV8 A;  3ZHE B;  1UJK A;  2WXP A;  4M3O A;  4A3T A;  4CT0 A;  3KS2 A;  4NUR A;  5BNW A;  4LER A;  4I1M A;  1QQE A;  3CGH A;  4AM9 A;  5G04 C;  3QNK A;  3NF1 A;  2VSO E;  3CEQ A;  4D10 C;  2WQ6 A;  4KZC A;  3TAX A;  2IQC A;  3QAR A;  4J8F A;  2IFU A;  2PL2 A;  2XRY A;  1U3C A;  3FH5 A;  5CMY A;  5LX8 A;  1HU3 A;  3PS6 A;  3CR3 A;  3L08 A;  2XPI A;  1N52 A;  2AVP A;  3KEZ A;  4U63 A;  4J8E A;  3ZVV A;  4JPS A;  3QC1 A;  3EHN A;  4AV7 A;  2P58 C;  3AU5 A;  5JHB A;  3CVV A;  4FHJ A;  2C2L A;  2I6H A;  3IKO B;  3CHQ A;  5G04 J;  5G2N A;  4B89 A;  3AS4 A;  4AJW A;  4BY6 A;  1EYH A;  2WB2 A;  4UI9 K;  3T5X A;  5A23 A;  1HE8 A;  2I1K A;  3KAE A;  2WVI A;  1WAO 1;  4GPK A;  3HVE A;  4N3B A;  3TGO A;  3SBS A;  4UQX A;  3OTN A;  4KVO A;  4I6G A;  2L0I A;  4MKT A;  4NRH B;  5KJK A;  1HO8 A;  2FEZ A;  3QDN A;  3PNT B;  2AXV A;  4GML A;  3CHS A;  3UQ3 A;  4CGW A;  4KZ0 A;  1OUV A;  2VTB A;  2PQR A;  4DLO A;  4XIF A;  4ILH B;  3MKQ B;  2OVF A;  3S7J A;  4U07 A;  3NZS A;  3SHF A;  4JHK A;  3TG4 A;  1OWM A;  2MOW A;  4Y6W A;  5FQ6 A;  4C0M A;  3PRE A;  3TXN A;  3TXM A;  3ZW3 A;  2XCB A;  2DCP A;  2X6H A;  3LKU A;  4GA1 A;  4H7Y A;  3RU0 A;  2V5F A;  4I1A A;  4APF A;  3TJP A;  3Q4A B;  1N54 A;  1B89 A;  2LSV A;  3U66 A;  3T8M A;  4HOT A;  3ZYQ A;  1H0A A;  3ZPJ A;  3APC A;  3APD A;  3MYV A;  4EBA A;  5JJT A;  3EIQ C;  3ESL A;  4UI9 C;  4PUC A;  2WXO A;  4ABN A;  2GW1 A;  4BTB A;  3RRN B;  4FA6 A;  3ZYK A;  3UPV A;  4WND A;  3CVL A;  2Q7F A;  4O6F A;  1JWF A;  4HFG A;  4WNG A;  4JL0 A;  4CRW A;  4UQY A;  4I9E A;  4MRU A;  2OVB A;  1SZ9 A;  4KXK B;  3VTY A;  3TL5 A;  3ULQ A;  1HS6 A;  3IHY A;  2CHX A;  3CHR A;  4WAF A;  4K0R A;  4DLQ A;  2DBA A;  3EIJ A;  3QWV A;  1JUQ A;  2V4L A;  3DBS A;  3EJN A;  1WM5 A;  3FFL A;  3PUJ A;  4GCN A;  4UI9 J;  4BWR A;  2AWI A;  4BX9 A;  2RG8 A;  4WNE A;  4ANX A;  3IEG A;  5BT1 A;  1S0P A;  2BF0 X;  2KZT B;  1OWP A;  3GYZ A;  3I3N A;  5FWQ A;  4WNF A;  3FY4 A;  2M63 A;  4WUY A;  2UY1 A;  3AU4 A;  3L22 A;  3PRZ A;  5E76 A;  2XCC A;  4GYO A;  4APO A;  3GZS A;  3ZEF A;  2VGX A;  4JEH A;  2OND A;  4UWF A;  2C0M A;  3SZ7 A;  4FHK A;  1U3D A;  1KLX A;  1QNF A;  2R5S A;  2WMO A;  4UWG A;  3RRM B;  5HI7 A;  3CSF A;  3E4B A;  3L17 A;  1ELK A;  4QFV A;  2V0P A;  5C1D A;  4BTA A;  3CQG B;  5AYW D;  1EF1 C;  2OOE A;  2AXU A;  2XEV A;  5LOZ A;  2I2O A;  4MLP A;  5LP0 A;  2NSZ A;  3D9K A;  3ZGQ A;  4EZL A;  4DK5 A;  4F3V A;  2X6I A;  5JJ6 A;  2JEK A;  3FH7 A;  1E96 B;  3PEV B;  4R7L A;  1TEZ A;  3OXL A;  1FVF A;  5AJL A;  4W9R A;  2GRL A;  5FT9 A;  4TV3 A;  3PEU B;  4JHJ A;  3MV2 B;  2WXM A;  5FZQ A;  3D9O A;  3N71 A;  2RD0 A;  3JCK C;  5BW8 C;  1PAQ A;  2X6J A;  3ZXS A;  4CDN A;  3FEX A;  1H2V C;  4XI0 A;  1JWG A;  1ZBP A;  3ZHE A;  1WY6 A;  3FUH A;  4TUU A;  3LYA A;  4GAA A;  1UJJ A;  3B7S A;  5EDS A;  3MGB A;  2AW6 A;  3CVN A;  4GZ3 A;  1PC2 A;  4GYW A;  3LY7 A;  1UN9 A;  3QWW A;  3QAQ A;  4K03 A;  2I9C A;  4I17 A;  2KAT A;  3SD5 A;  3ZN3 A;  1FVH A;  4G25 A;  2DIW A;  3FDH A;  4FLH A;  4JVS A;  4XX5 A;  3IHV A;  4DI4 A;  5DBK A;  2IU1 A;  3SI5 A;  4LUN U;  4E6H A;  4L7T A;  4OYS A;  3GW4 A;  4LRZ A;  4EZJ A;  3S7D A;  5ANR A;  3ASD A;  4JEU A;  2WXK A;  4CDM A;  3FTY A;  4WWP A;  3RO3 A;  3JYS A;  4JA9 A;  3LY9 A;  4I2W A;  4YVO A;  4OVV A;  4B8C B;  5BV0 A;  4IUL A;  4J0U A;  4G11 A;  4ME2 A;  2Y4T A;  3D9M A;  3O48 A;  2IOS A;  3S7F A;  3FUE A;  4HS2 A;  2Y3A A;  3ZIM A;  3CVX A;  3CVU A;  3NQP A;  5FTP A;  2ION A;  3ZFW A;  1HH8 A;  2VGY A;  2KC7 A;  3LCA A;  4I6E A;  4CT4 A;  2J08 A;  4EEC A;  2L9B A;  4PS8 A;  2J9Q A;  4KMO A;  1KT0 A;  2VSX E;  1H2T C;  2HYZ A;  4IRU A;  4GU5 A;  2KCV A;  3VLF A;  2X38 A;  3FU5 A;  3FP3 A;  3PE3 A;  2ILR A;  3U64 A;  3CQC B;  1HZ4 A;  4B8A A;  2LNI A;  1IYG A;  4F7A A;  3FU0 A;  3FTS A;  2WXQ A;  3Q49 B;  5G55 A;  1X5B A;  4XI9 A;  3R7R A;  4CCA A;  2VSY A;  5FJY A;  4FAD A;  4I9C A;  3FTV A;  4PS7 A;  4N2Q A;  1Z6T A;  3MKQ A;  2GGF A;  4N5C A;  5FQ8 A;  4HOS A;  3ONK A;  4GMJ A;  4F1S A;  3C98 A;  4URK A;  3LVR E;  3ONL A;  4L2Y A;  3SNX A;  3HHM A;  2IF4 A;  4A3V A;  3LJ3 A;  4N39 A;  5AEN A;  3G2V A;  5BV1 A;  2MHK A;  3EHM A;  3B7U X;  3CK8 A;  3D3M A;  3PE4 A;  4N3A A;  4B0Z A;  5LFA A;  5ARF A;  3U9W A;  4G24 A;  2IOL A;  2E2E A;  3FUN A;  4FLB A;  3MV3 B;  1NA3 A;  3HYM B;  4PDX A;  5G05 C;  3D9J A;  4GYY A;  2WQ7 A;  2XPZ A;  4JXT A;  2MRI A;  4I6J A;  3ZYM A;  3P2B A;  1E8X A;  5BUZ A;  3B7R L;  4HVB A;  2X3M A;  2E0I A;  4FC8 A;  2XRZ A;  4A1S A;  4XKC A;  5J90 A;  2L6J A;  5KJL A;  2YQ8 A;  1XNF A;  4ILG A;  4L1B A;  4AIF A;  3CVW A;  3MEK A;  3FTZ A;  3GZ1 A;  2CHZ A;  4J8S A;  1UN8 A;  2FF4 A;  2WMN A;  2BTD A;  2XPY A;  3FWV A;  5C2Y A;  2XQ0 A;  1W3B A;  1YA0 A;  3SFZ A;  5CMW A;  2KZT A;  5G05 J;  3CLJ A;  5D0Q D;  4FU3 A;  1FCH A;  3L54 A;  2QFC A;  3FUD A;  4GZ6 A;  3CIA A;  4U8H A;  3OXF A;  4DJA A;  1Y8M A;  2NXP A;  1UW4 B;  1HG5 A;  3LEW A;  4ATG A;  4AY5 A;  2C0L A;  3CV0 A;  3LPZ A;  3TG5 A;  2LAH A;  3WXX A;  3DPD A;  4BT8 A;  3FTX A;  4YVQ C;  3I4G A;  3AS5 A;  2VGX B;  3O4Z A;  1UG3 A;  2J49 A;  3U4T A;  4BSX A;  4C9B B;  3PH0 C;  1XGW A;  5BPP A;  2Y4U A;  4UWK A;  3UT8 A;  3P1U A;  5EX0 A;  3RIB A;  3R7Q A;  4FJZ A;  4U0Z A;  4FJY A;  3D9L A;  3G2U A;  3FUK A;  5ANL A;  5EX3 A;  2X6F A;  3LDZ A;  4XKB A;  1Y6I A;  4AEZ C;  4EPZ A;  4IN3 B;  4Y6C A;  4CEM A;  3AS8 A;  4DPR A;  3LY8 A;  2WQH A;  3CKC A;  3JQ1 A;  4CGV A;  3QB2 A;  2YHE A;  2LO6 A;  4KT6 B;  3MJW A;  4OVU A;  3JUI A;  2BUG A;  2PZI A;  4P29 A;  5T4Y A;  3SGH A;  4TRQ A;  4G2V A;  3ASF A;  4BX8 A;  3U3W A;  3QWP A;  5E75 A;  2YNQ A;  2WM9 A;  4J8D A;  5DIZ A;  2YIN A;  4L2L A;  1HX8 A;  3FUJ A;  1Z3X A;  3PVL A;  4ACK A;  1IQU A;  1H2U A;  3UT4 A;  1LF8 A;  2WXG A;  4PS3 A;  3D9P A;  4WWO A;  2XGM A;  4ANV A;  3NZU A;  1ZU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...