3AAAC

Crystal structure of actin capping protein in complex with v-1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
117
structure length
117
Chain Sequence
b'CDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 43
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3aaaC00
1BI7B 5EILA 5HRYA 2KXPC 4UUCA 4YDWA 4F6RD 4BESA 3V31A 3V2XA 5D66A 5ENRD 2B0OE 5CERB 5CEAA 4U95D 5KBAA 2L6BA 5ENQD 2DZNA 2J8SD 3J5QB 3TWVA 2XENA 1G3NB 2HE0A 5AQ7A 2XEEA 4JB8P 4BEPA 5EN5D 1A5EA 1WDYA 2A5EA 2QYJA 4J7WA 4HNAD 2JABA 4CYMD 4O60A 3NBNB 4O1OA 3F6QA 5KNHD 3TWQA 3Q9NC 2F8YA 1OY3D 5ENPD 3C5RA 4HRMB 4HI9A 4F1PA 4K5AB 4CZ2D 2V5QC 1WG0A 4OAUC 1IKND 1N0RA 3AJIA 2DZOA 3J5PA 1YMPA 5ENOD 3V2OA 1YYHA 2XZTG 4QFVA 2FO1E 5EYLA 3TWRA 3KEAA 4ATZD 3EU9A 3LJNA 3IXEA 2AJAA 4BSZB 2KBXA 5FIOA 5JA4D 4OAVB 4O1PA 3UXGA 3V30A 5HS0A 3TWWA 5CBNA 2ETBA 5JMND 1MX6A 1QYMA 2RFAA 1BLXB 5EIDA 5AARA 4Z68A 3ZNGA 2Y0BG 2ETCA 4HLLA 2VGEA 1MJ0A 4DX6D 1NFIE 2F37A 1BI8B 2RFMA 3TWSA 4DX5D 1DC2A 3TWXA 4BETA 4NIKA 3HG0D 4G8KA 4LSZE 5BXOA 5KWDA 2ETAA 4HRLA 1SVXA 4RLYA 5HKPA 4ZFHA 4G8LA 4J8YA 4DX2A 1SW6A 2PNNA 4HRNA 1IXVA 3UI2A 3ZUVB 4YDYA 5AQ9A 3B7BA 4B93B 2F8XK 1MYOA 3UTMA 3W9FA 4A63B 2P2CP 5AAOA 5BXUA 4HI8A 2DVWA 1AWCB 2BKKB 5ENSD 4K5BA 2XZDG 5KNGA 1S70B 5FINA 3T9KA 3ZU7B 4GPMA 5ITZF 2XEHA 3ZKJA 1K1BA 4U8YD 1TR4A 4DRXE 4QQIA 3B95A 5AN8A 3W9GA 4ZHBA 1UOHA 3DEPA 4C48B 5AQAA 1N11A 1MX4A 3D9HA 1OT8A 1YCSB 2V4HC 1K1AA 3SO8A 1MX2A 3Q9UC 1BU9A 3JXIA 5EYPF 1K3ZD 1DCQA 1N0QA 2NYJA 4DX7D 3DEOA 3HRAA 4U96D 2Y1LE 3T8KA 3JUEA 3V79K 4GMRA 3AAAC 3EHQA 3TWTA 2ZGGA 4K5CA 4HBDA 3NOGD 4LNUD 4N5QA 5CBOA 4LG6A 3TWUA 4HQDA 5CECB 2QC9A 1AP7A 4HB5A 4DUIA 5CEDB 1IHBA 3NOCD 2ZGDA 5AQBA 1BD8A 4U8VD 5EIBE 2DWZA 4DX1A 3JXJA 4TUMA 5ENTD 2MYOA 4BERA 2BKGA 3EHRA 1D9SA
chains in the Genus database with same CATH superfamily
3D9JA 3L82A 1WM5A 4HOSA 3TWVA 5AQ7A 1UN8A 3B13A 3CVPA 3G2WA 1HF8A 2OVBA 3B7TA 1FCHA 4CDMA 3CVLA 1RW2A 3DSTA 3LEWA 3QNKA 4K5AB 3V2OA 3OTNA 2VSXE 2GROB 2DIWA 2FO1E 3G2TA 2WMOA 4CGVA 2RFAA 3QKYA 5CCMA 4Z68A 3ZNGA 1S63A 2ETCA 5FQ6A 2F37A 3FDHA 5FQ4A 4MS6A 2YHEA 3KAEA 3S7FA 5LFAA 1TN7A 1OXJA 4ZFHA 4LCTA 4G8LA 4DX2A 4W9RA 1Z3YA 3E33A 1E8ZA 3X2QE 3ABLE 3HXEA 2ZU6B 5ENSD 1U3DA 2PM6A 2HM8A 1O1TA 4ME2A 3UQ3A 2J4BA 2XRZA 2CG3A 3SNXA 5BV0A 1K3ZD 2FO7A 1V55E 2P9LG 1JPLA 3D9LA 4ANUA 2VJ8A 3LS8A 4N5QA 5CBOA 3CGHA 3AG4E 3IKOB 2WPVA 1E7VA 4ILGA 4ACKA 5BNWA 3EIJA 3MGBA 3NQPA 4ATGA 2FULA 4JHKA 2J8SD 2LO6A 4XE0A 3FEYA 5C1DA 2MRIA 4EHMA 2A5EA 2KC7A 4GZDA 5KNHD 4BT8A 1OY3D 3OXFA 3PZDA 3UINC 3LY8A 3SY2A 2XGSA 1YMPA 3ZXPA 2MHKA 3AU5A 4FJYA 3U4TA 3AG3E 1BLXB 3RRNB 2ONDA 3HYMB 2WXHA 4JC8A 4DX6D 3FH8A 3CSFA 4TXQA 1OWLA 3C72A 4J8YA 4GZCA 4YDOA 4MLPA 1SQMA 4BT9A 1TJFA 4B93B 2J07A 3CHPA 5AAOA 3JQ1A 5AENA 1S70B 3ZU7B 4JHJA 3JQ0A 1H19A 4X8QA 3D9NA 1TR4A 4JHRA 3PE3A 4I1MA 4I1OB 4BWRA 4CDNA 1K1AA 1HU3A 4WNFA 3WXXA 1HG5A 3I4RB 3MX3A 4KZ0A 5EX0A 3AS4A 1DNPA 4GMJA 4N3AA 2KATA 3TWTA 5BPPA 2VGXB 2XCCA 2ZGDA 3ZVVA 4N3CA 2VSOE 1B89A 1XGWA 4JL0A 3JYSA 4L1BA 3QOUA 1INZA 3PNTB 2WXFA 2WQHA 3V31A 3VTXA 3L6AA 5KJMA 4BX8A 2WB2A 2V4LA 4R7LA 3CVWA 2WXJA 4U07A 5EKQD 3SFZA 2PL2A 4FLHA 3MKQB 4XEIG 4UWLA 2KCKA 2AXVA 3SHFA 4NACA 5EYLA 3FTUA 4OYSA 1D8DA 1MX6A 4FHKA 3EUVA 1FVHA 3ISMC 3U64A 4UWGA 3SF4A 1OCRE 4HRNA 1E90A 2ILRA 2R5SA 4TRQA 3CKBA 4KBQA 3FU5A 3QAQA 3AS5A 1HZ4A 3D9IA 3ZYLA 5E75A 4XI9A 4HVBA 1P5QA 1EYHA 3C98A 2NSZA 3EJNA 4G23A 3Q7AA 5D0QD 3UM3A 4J8SA 3LCAA 2J4DA 3EHNA 1HFAA 3MEKA 1IHBA 1WY6A 3R7RA 2IF4A 3L13A 2OOEA 2EIKE 3PZ4A 2Y4TA 1OCCE 1OCOE 3EU5A 2XEEA 5DBKA 3SI5A 4DPRA 3F6QA 2UY1B 1LTXA 5ENPD 4JXTA 3HVEB 4UI9J 4C0MA 4GA0A 2J09A 1WG0A 2KZTA 3FTWA 1H0AA 3P1UA 2MOWA 2XZTG 4QFVA 4ATZD 3U9WA 3UMVA 3UT4A 1TJCA 2ETBA 3FY4A 1A17A 1IYGA 4UWFA 4I6JA 1TNBA 4BETA 4LSZE 3QK0A 5HKPA 5G04C 5ENNA 3QDNA 4MKTA 2XPIA 4HORA 2LSVA 3B7BA 2WQ6A 4HI8A 4HLEA 3FU0A 2WMNA 3E30A 1H2VC 3CQGB 4M7CA 1VDYA 3EIQC 4AV7A 4L2YA 2EILE 3DEPA 3L54A 1JUQA 3E32A 4GTVA 2BEDA 1ZBPA 4KXKB 5M72A 4UQYA 3QJZA 3EDTB 4I6EA 1UG3A 4NQ0A 2XHEA 1N4QA 3SD5A 2DWZA 4TUMA 4DI4A 4WNGA 3TXNA 3FHEA 5KBAA 4KMOA 1SZAA 3J5QB 3ZXSA 2WXIA 2KCVA 1MZCA 1A5EA 2GW1A 4J7WA 4CYMD 4O60A 3NBNB 2WXQA 5FZSA 2F8YA 3QB2A 2IOLA 2IFUA 2GRNB 3FUFA 4KVOA 4CEMA 3UT8A 1JCQA 4H7YA 4CDRA 3B7UX 3IXEA 3LVQE 4YNDA 2FEZA 5AJDA 5EIDA 3APCA 1O5MA 3FUMA 4MRUA 5ARFA 1S0PA 3FUKA 1U2VG 3UUXA 1JWFA 2PM7A 1IQRA 3SZ7A 4CRWA 1KT1A 2XQ0A 3UM0A 4BY6A 3LXUX 1MYOA 1OCZE 1DCEA 3PS6A 3T9KA 3RKVA 2RG8A 3CK9A 3SFYA 2Q7FA 1YA0A 3KD7A 5EDSA 4FADA 2P9PG 4B94A 3BU8A 4K0RA 2GGFA 5EYPF 4U96D 3ZRHA 4F53A 1IQUA 4F1SA 4UWKA 2QFCA 4GYOA 4HB5A 5CEDB 2E2EA 4V3IA 4Y6CA 1QQEA 5ENTD 3PZ3A 4BERA 1JCRA 4LERA 4KT6B 1N95A 2KCLA 2PZIA 2JABA 4JA7A 3ZYKA 3Q9NC 2J08A 5FZQA 3CEQA 4GTMA 3BUAA 4AXHA 2J49A 4JEHA 1N9AA 4JA9A 3AG2E 4B0ZA 1KZPA 4A55A 5BUZA 3FWVA 3TWWA 4APOA 3SFXA 2XPZA 5G2NA 3DPYA 3CQCB 3ASOE 2XS1A 2IQCA 4CCAA 3TWXA 1SVXA 4BSXA 3CLJA 4XKBA 3CVQA 4TXPA 2ZXWE 2XZDG 3CK7A 3IV0A 3UKUG 2I9CA 3LKUA 3FTVA 1K1BA 5B1AE 4DRXE 3B95A 5AN8A 4G1TA 1N11A 3SO8A 4I6GA 2IU1A 4IULA 3B7RL 5AYWD 3ML9A 3TXMA 4Q69A 2M63A 1BPOA 3Q73A 4FJZA 5JHBA 3MV2B 1AP7A 1E8WA 3R9AB 3TGOA 2IY0C 4DX1A 2F0YA 1D9SA 5LOZA 3URZA 4I2ZA 4YDWA 3CVVA 2C0LA 2AXZA 1N4SA 4LRZA 2XENA 3S2AA 3ABKE 1H2TC 4AP2A 2Y4UA 1PAQA 4HNAD 3TWQA 4YVOA 3LY9A 4EBAA 1H6PA 4F1PA 2JLBA 2V5QC 3T8MA 1O1RA 5DIZA 1YYHA 4WUYA 3DPDA 2HYZA 4RG6A 2HO1A 3V30A 3S7DA 3ZHEB 4URKA 3ML8A 2RD0A 4ABNA 2Y69E 1UW4B 4GTPA 4ACLA 2WXOA 3FUDA 4HRLA 4RLYA 4J0UA 3HHMA 2PNNA 1IXVA 3PZ2A 4GZ6A 4U8HA 1Q2ZA 2XEHA 1E96B 1Y8MA 4E85A 2H6HA 4ZHBA 1UOHA 3ZW3A 1H6OA 3D9HA 1N4PA 4C0EA 2LAIA 3MJWA 3FTZA 3EHMA 2X38A 3UX4A 1HO8A 4AY6A 3VLDA 3CHRA 3MKQA 3CV0A 2HR2A 5G04J 3NZUA 5FZRA 2GRRB 4ILHB 2XGMA 2H6IA 3IBEA 5HRYA 3DWLG 4F6RD 2X3MA 4L23A 4B89A 3V2XA 3ASNE 5ENQD 1K8KG 1NP7A 4RG9A 1TNYA 3DXMG 2P58C 5BT1A 2KM4A 3PNLB 3PUKA 3ASFA 5EN5D 3ONLA 4J8FA 1H2UA 2QY7A 4BX9A 3J5PA 1N0RA 4K03A 4APFA 3C3RA 1FT2A 1EPUA 3ENEA 5CRVA 3NAWA 3KEZA 1GW6A 3L17A 5KJLA 2VGEA 3NZSA 4U7EB 4JVSA 4CGWA 4GZ3A 2WXRA 3T5VA 1QNFA 1QBQA 2P9KG 5T8IA 3E37A 3UPVA 3L9TA 2R17C 3GZ1A 3UTMA 3W9FA 3HXFA 3I4GA 2EIME 2LSUA 4N39A 4AIFA 4L9PA 4I9CA 5LCWJ 4N3BA 1TNOA 3Q49B 5AQAA 5LP0A 4AOFA 3GYZA 4I1AA 1Y6IA 4PS3A 4ANVA 1EDUA 5B3SE 3Q7FA 4GTTA 2Y1LE 3UIOC 4GA1A 3NOGD 3CVUA 4HQDA 3HVEA 2ZIRA 4F3VA 3FUIA 1WAO1 2IO2C 3QARA 2YHCA 5EIBE 4G24A 4DLQA 1BI7B 3DBSA 2WM9A 1ELWA 5A7DB 3R7QA 1N54A 2XRYA 2L9BA 3FH7A 3UIPC 2WXLA 4HI9A 1PC2A 2WXNA 4NRHB 2I6HA 4YDEA 5J08A 3TJPA 4D10C 5JA4D 3Q79A 5FIOA 4RQIA 4BSZB 3UXGA 3LJ3A 3LYAA 3FTYA 4BTBA 5BXOA 1HX8A 4UI9K 2J9QA 3VLEA 2VTBA 1D8EA 5ITZF 2EIJE 2WQ7A 2VSNA 1S64A 2LUHA 1V54E 4HXIA 3PH0C 3DSVA 3RU0A 4GZ5A 3FTSA 3GZSA 2WXGA 5FT9A 4HOTA 2R2LA 4LNUD 3JUIA 3LDZA 4ANXA 3NOCD 4UQXA 5G05C 2R59A 3D3MA 5AQBA 3L22A 3MKRA 4DLOA 4H7XA 3L16A 2BKGA 5T3RA 2KXPC 1HE8A 5CERB 5CEAA 4GA2A 1U3CA 3ULEG 4BEPA 3IHYA 3C5RA 3AJIA 3MV3B 5FQ7A 5E76A 2KZTB 1UJKA 4EBAG 4ANWA 3Q78A 3HXBA 2CFUA 3JCKC 2EQXA 3T5XA 1MJ0A 5FWQA 1BI8B 1FVFA 4G25A 4U04A 4A3TA 2JEKA 2X6KA 3CK8A 2GRPB 2L0TB 5CHEE 2OEVA 3CKCA 3MCXA 4PUCA 3UI2A 3D9PA 2XS8A 4KZCA 5CMYA 2GRQB 2R03A 5BXUA 2BKKB 2CHXA 4GPMA 3I3NA 2QYUA 4I2WA 4QQIA 3W9GA 1Z3XA 3CHMA 1X5BA 2XCBA 1N52A 2NC9A 2B6CA 3S7JA 4GTQA 3Q9UC 3ABME 2P9NG 2OV8A 1UJJA 3AAAC 3EHQA 1SA5A 1MHQA 3TG5A 4HBDA 5CECB 2QC9A 2OCCE 1E7UA 3ESKA 2CG2A 4GTSA 3UT7A 4U8VD 3C3QA 2P9UG 1OWOA 4BESA 2BF0X 2XGOA 4B8CB 4DI3A 2HE0A 4I17A 4G26A 2DYSE 2DYRE 4U0UA 1ZB1A 1PY1A 4HRMB 3VTYA 5AIJA 3DXKG 4CZ2D 3PREA 4UWHA 1IKND 2DZOA 1UN9A 4GTOA 3HXCA 3RRUA 4G2VA 4DK5A 4BFRA 4OAVB 4IYPA 2A5UA 2Y0BG 4CT0A 3RSEG 2BUGA 4I43A 4EPZA 4HLLA 3SQVA 5A6CA 3Q5MA 4WAFA 4NIKA 4FULA 4U0ZA 3CHQA 4Q94A 2LAHA 2NXPA 3L08A 2IEJA 3ZEFA 5FINA 3ZKJA 3CSTA 2L0IA 4G11A 3APDA 4U0SA 1OT8A 3QC1A 3D9OA 1DCQA 3V79K 2PQRA 3HIZA 3C3OA 4K5CA 3U66A 4XX5A 5FQ8A 2CHZA 3DRAA 4AVXA 1TNZA 3I5PA 3IHVA 3E34A 5HI7A 4UUCA 3ZHEA 5JHAA 1JWGA 4FU3A 3FUJA 3RJVA 5T4YA 2H6FA 3RAUA 3SBTB 4OAUC 2AVPA 2C2LA 2R05A 4LNGA 3LY7A 1Z5SC 4UQZA 1ELKA 3LJNA 4GYYA 4WWPA 4O1PA 2CHWA 3BG1B 5JMND 2VGYA 4GAAA 4OVVA 1W3BA 2P9SG 4TXRA 1TN6A 3HXDA 4TUUA 1KZOA 4YDYA 2F8XK 4A63B 2P2CP 2V8SE 5JJTA 1ELRA 3NF1A 4JD2G 4Q96A 2FF4A 2I1JA 3DSUA 4AEZC 1TNUA 3FH5A 4BTAA 1TYQG 3G2SA 3AG1E 4PDXA 4C48B 2LXLA 5KCMA 3O48A 2AW6A 3KSLA 2I2OA 2E0IA 2VGXA 3OAWA 4IRUA 3ZIMA 4LG6A 4P29A 4DUIA 4EZLA 5BV1A 3JXJA 1OWMA 3U3WA 4KYOB 3ULYA 2LNIA 4FLBA 3ESLA 3ZFWA 2L6BA 1NL4A 1G3NB 2YNQA 4FP7A 2RKKA 4WNDA 4O1OA 2YQ8A 3CHSA 1XNFA 4GCNA 3SBSA 5KJKA 4A1GA 3PEVB 5CBNA 4XKCA 3UM2A 3TG4A 5G05J 5AJLA 4AY5A 2RFMA 3HG0D 5G55A 4GCOA 2ETAA 3G2VA 3FUEA 1OUVA 2VSYA 4EECA 1RZ4A 1FT1A 3ASDA 5BW8C 5A23A 4U8YD 4FHJA 3HDXA 4AJWA 2WXPA 3JXIA 4RVBA 3B7SA 2A4ZA 4O6FA 3OXLA 4GMRA 5C2YA 5FTPA 3LPZA 4GU5A 5FJYA 1KLXA 2WXMA 3BEEA 3TWUA 1H6KA 4J6IA 2IONA 5KJNA 3TL5A 3O4ZA 4Y6WA 3AS8A 3EHRA 5EILA 4M3OA 5ENRD 4GB9A 2DZNA 4U63A 5ANRA 3CIAA 2XPYA 3CR3A 4JB8P 2Y3AA 2UY1A 2QYJA 3FUNA 3D9KA 4WNEA 3ONKA 3Q75A 2X6FA 3QWWA 3R9MA 3Q47B 4HS2A 4PS8A 3CVNA 1QYMA 2XEVA 1HG2A 1QZ2A 3UM1A 1E8XA 1KT0A 3TWSA 4DX5D 1DC2A 4YVQC 4EQFA 5CCLA 1FPPA 4A3VA 3WG7E 3FUHA 4J8DA 1SW6A 5EX3A 5ANLA 3ZPJA 3VLFA 4XZ4A 1O1SA 3PUJA 4K5BA 4JPSA 1N94A 4EZKA 2IJGX 5CRUA 3GZ2A 3MZLB 4HOQA 4AM9A 5D0OD 1SZ9A 3K9IA 3RO2A 1TN8A 3KSQA 3RRMB 4JEUA 1NZNA 1LD7A 2GRLA 2YINA 1NI1A 1NA0A 2OEWA 1JCSA 1BD8A 5ARGA 4ILIA 2WXKA 4JW1A 3S7BA 4E6HA 2GRMA 3FU3A 2FI7A 5D66A 2B0OE 4U95D 4F7AA 4N2QA 4B8AA 3ZYQA 1LF8A 3FU6A 4IN3B 4NURA 4CT4A 3UKRG 3PEUB 1HXIA 3P2BA 3FFLA 5ENOD 2CFZA 2PQNA 2VQ2A 3KEAA 4LNBA 3PE4A 2X6HA 2KBXA 2ZISA 5HS0A 4GPKA 2P9IG 3QWPA 3QWVA 4XIFA 5AARA 5LX8A 3G2UA 4WWOA 4PS7A 1NFIE 3RK6A 3RO3A 4G8KA 4GMLA 3ZUVB 1HH8A 1NA3A 5AQ9A 3CVXA 3PDNA 1AWCB 4KVMA 3PVLA 3MA5A 3D9MA 2VTBB 3BG0B 4HFGA 1TEZA 3CVYA 4N2SA 3MYVA 2IOSA 1Z6TA 3PZ1A 3BQOA 1MX4A 3OXGA 1YCSB 2V4HC 2AWIA 4L7TA 1ZU2A 3Q4AB 3ZGQA 4FA6A 1E8YA 3RIBA 4I9EA 3HRAA 2ZGGA 4L2LA 2X6IA 1OWNA 2IO3C 3IEGA 3E4BA 1KPSB 5H7PA 1EF1C 4XI0A 5LCWC 2H6GA 4GYWA 3DSWA 3Q15A 4A1SA 5JJ7A 3CHOA 4RSYA 4TV3A 4EZJA 3SGHA 2V5FA 1N4RA 3KS2A 5JJ6A 2R02A 2I1KA 1LD8A 3GW4A 2WVIA 5IY5E 2AXUA 3ASGA 3ASHA 1WDYA 1L5JA 3TAXA 2V0PA 3LVRE 4HOUA 4LUNU 3TWRA 3EU9A 3DSXA 2AJAA 4DJAA 2OVFA 3FP3A 5KWDA 2C0MA 1HS6A 5CMWA 4JZYA 3AU4A 3NB2A 3ZYMA 1SA4A 3APFA 3DSSA 2DCPA 5HQ8A 2DVWA 2L6JA 3FEXA 5KNGA 1MQSA 2X6JA 5D2MC 2EINE 2BTDA 3ULQA 1OWPA 2QZAA 2UWJG 4FC8A 3FULA 4UI9C 2DBAA 2VYIA 2LXMA 4N5CA 4C9BB 1X81A 1DVPA 1MX2A 1BU9A 3FTXA 1N0QA 2NYJA 4OVUA 4DX7D 3DEOA 1IHGA 5J90A 3T8KA 3JUEA 4WWNA 4GTRA 4PH4B 4J8EA 3PRZA 5B1BE 3ZN3A 4LEUA 2FBNA 4MBGA 2MYOA 3N71A
chains in the Genus database with same CATH topology
1BI7B 5EILA 5HRYA 2KXPC 4UUCA 4YDWA 4F6RD 4BESA 3V31A 3V2XA 5D66A 5ENRD 2B0OE 5CERB 5CEAA 4U95D 5KBAA 2L6BA 5ENQD 2DZNA 2J8SD 3J5QB 3TWVA 2XENA 1G3NB 2HE0A 5AQ7A 2XEEA 4JB8P 4BEPA 5EN5D 1A5EA 1WDYA 2A5EA 2QYJA 4J7WA 4HNAD 2JABA 4CYMD 4O60A 3NBNB 4O1OA 3F6QA 5KNHD 3TWQA 3Q9NC 2F8YA 1OY3D 5ENPD 3C5RA 4HRMB 4HI9A 4F1PA 4K5AB 4CZ2D 2V5QC 1WG0A 4OAUC 1IKND 1N0RA 3AJIA 2DZOA 3J5PA 1YMPA 5ENOD 3V2OA 1YYHA 2XZTG 4QFVA 2FO1E 5EYLA 3TWRA 3KEAA 4ATZD 3EU9A 3LJNA 3IXEA 2AJAA 4BSZB 2KBXA 5FIOA 5JA4D 4OAVB 4O1PA 3UXGA 3V30A 5HS0A 3TWWA 5CBNA 2ETBA 5JMND 1MX6A 1QYMA 2RFAA 1BLXB 5EIDA 5AARA 4Z68A 3ZNGA 2Y0BG 2ETCA 4HLLA 2VGEA 1MJ0A 4DX6D 1NFIE 2F37A 1BI8B 2RFMA 3TWSA 4DX5D 1DC2A 3TWXA 4BETA 4NIKA 3HG0D 4G8KA 4LSZE 5BXOA 5KWDA 2ETAA 4HRLA 1SVXA 4RLYA 5HKPA 4ZFHA 4G8LA 4J8YA 4DX2A 1SW6A 2PNNA 4HRNA 1IXVA 3UI2A 3ZUVB 4YDYA 5AQ9A 3B7BA 4B93B 2F8XK 1MYOA 3UTMA 3W9FA 4A63B 2P2CP 5AAOA 5BXUA 4HI8A 2DVWA 1AWCB 2BKKB 5ENSD 4K5BA 2XZDG 5KNGA 1S70B 5FINA 3T9KA 3ZU7B 4GPMA 5ITZF 2XEHA 3ZKJA 1K1BA 4U8YD 1TR4A 4DRXE 4QQIA 3B95A 5AN8A 3W9GA 4ZHBA 1UOHA 3DEPA 4C48B 5AQAA 1N11A 1MX4A 3D9HA 1OT8A 1YCSB 2V4HC 1K1AA 3SO8A 1MX2A 3Q9UC 1BU9A 3JXIA 5EYPF 1K3ZD 1DCQA 1N0QA 2NYJA 4DX7D 3DEOA 3HRAA 4U96D 2Y1LE 3T8KA 3JUEA 3V79K 4GMRA 3AAAC 3EHQA 3TWTA 2ZGGA 4K5CA 4HBDA 3NOGD 4LNUD 4N5QA 5CBOA 4LG6A 3TWUA 4HQDA 5CECB 2QC9A 1AP7A 4HB5A 4DUIA 5CEDB 1IHBA 3NOCD 2ZGDA 5AQBA 1BD8A 4U8VD 5EIBE 2DWZA 4DX1A 3JXJA 4TUMA 5ENTD 2MYOA 4BERA 2BKGA 3EHRA 1D9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI7 B;  5EIL A;  5HRY A;  2KXP C;  4UUC A;  4YDW A;  4F6R D;  4BES A;  3V31 A;  3V2X A;  5D66 A;  5ENR D;  2B0O E;  5CER B;  5CEA A;  4U95 D;  5KBA A;  2L6B A;  5ENQ D;  2DZN A;  2J8S D;  3J5Q B;  3TWV A;  2XEN A;  1G3N B;  2HE0 A;  5AQ7 A;  2XEE A;  4JB8 P;  4BEP A;  5EN5 D;  1A5E A;  1WDY A;  2A5E A;  2QYJ A;  4J7W A;  4HNA D;  2JAB A;  4CYM D;  4O60 A;  3NBN B;  4O1O A;  3F6Q A;  5KNH D;  3TWQ A;  3Q9N C;  2F8Y A;  1OY3 D;  5ENP D;  3C5R A;  4HRM B;  4HI9 A;  4F1P A;  4K5A B;  4CZ2 D;  2V5Q C;  1WG0 A;  4OAU C;  1IKN D;  1N0R A;  3AJI A;  2DZO A;  3J5P A;  1YMP A;  5ENO D;  3V2O A;  1YYH A;  2XZT G;  4QFV A;  2FO1 E;  5EYL A;  3TWR A;  3KEA A;  4ATZ D;  3EU9 A;  3LJN A;  3IXE A;  2AJA A;  4BSZ B;  2KBX A;  5FIO A;  5JA4 D;  4OAV B;  4O1P A;  3UXG A;  3V30 A;  5HS0 A;  3TWW A;  5CBN A;  2ETB A;  5JMN D;  1MX6 A;  1QYM A;  2RFA A;  1BLX B;  5EID A;  5AAR A;  4Z68 A;  3ZNG A;  2Y0B G;  2ETC A;  4HLL A;  2VGE A;  1MJ0 A;  4DX6 D;  1NFI E;  2F37 A;  1BI8 B;  2RFM A;  3TWS A;  4DX5 D;  1DC2 A;  3TWX A;  4BET A;  4NIK A;  3HG0 D;  4G8K A;  4LSZ E;  5BXO A;  5KWD A;  2ETA A;  4HRL A;  1SVX A;  4RLY A;  5HKP A;  4ZFH A;  4G8L A;  4J8Y A;  4DX2 A;  1SW6 A;  2PNN A;  4HRN A;  1IXV A;  3UI2 A;  3ZUV B;  4YDY A;  5AQ9 A;  3B7B A;  4B93 B;  2F8X K;  1MYO A;  3UTM A;  3W9F A;  4A63 B;  2P2C P;  5AAO A;  5BXU A;  4HI8 A;  2DVW A;  1AWC B;  2BKK B;  5ENS D;  4K5B A;  2XZD G;  5KNG A;  1S70 B;  5FIN A;  3T9K A;  3ZU7 B;  4GPM A;  5ITZ F;  2XEH A;  3ZKJ A;  1K1B A;  4U8Y D;  1TR4 A;  4DRX E;  4QQI A;  3B95 A;  5AN8 A;  3W9G A;  4ZHB A;  1UOH A;  3DEP A;  4C48 B;  5AQA A;  1N11 A;  1MX4 A;  3D9H A;  1OT8 A;  1YCS B;  2V4H C;  1K1A A;  3SO8 A;  1MX2 A;  3Q9U C;  1BU9 A;  3JXI A;  5EYP F;  1K3Z D;  1DCQ A;  1N0Q A;  2NYJ A;  4DX7 D;  3DEO A;  3HRA A;  4U96 D;  2Y1L E;  3T8K A;  3JUE A;  3V79 K;  4GMR A;  3AAA C;  3EHQ A;  3TWT A;  2ZGG A;  4K5C A;  4HBD A;  3NOG D;  4LNU D;  4N5Q A;  5CBO A;  4LG6 A;  3TWU A;  4HQD A;  5CEC B;  2QC9 A;  1AP7 A;  4HB5 A;  4DUI A;  5CED B;  1IHB A;  3NOC D;  2ZGD A;  5AQB A;  1BD8 A;  4U8V D;  5EIB E;  2DWZ A;  4DX1 A;  3JXJ A;  4TUM A;  5ENT D;  2MYO A;  4BER A;  2BKG A;  3EHR A;  1D9S A; 
#chains in the Genus database with same CATH topology
 3D9J A;  3L82 A;  1WM5 A;  4HOS A;  3TWV A;  5AQ7 A;  1UN8 A;  3B13 A;  3CVP A;  3G2W A;  1HF8 A;  2OVB A;  3B7T A;  1FCH A;  4CDM A;  3CVL A;  1RW2 A;  3DST A;  3LEW A;  3QNK A;  4K5A B;  3V2O A;  3OTN A;  2VSX E;  2GRO B;  2DIW A;  2FO1 E;  3G2T A;  2WMO A;  4CGV A;  2RFA A;  3QKY A;  5CCM A;  4Z68 A;  3ZNG A;  1S63 A;  2ETC A;  5FQ6 A;  2F37 A;  3FDH A;  5FQ4 A;  4MS6 A;  2YHE A;  3KAE A;  3S7F A;  5LFA A;  1TN7 A;  1OXJ A;  4ZFH A;  4LCT A;  4G8L A;  4DX2 A;  4W9R A;  1Z3Y A;  3E33 A;  1E8Z A;  3X2Q E;  3ABL E;  3HXE A;  2ZU6 B;  5ENS D;  1U3D A;  2PM6 A;  2HM8 A;  1O1T A;  4ME2 A;  3UQ3 A;  2J4B A;  2XRZ A;  2CG3 A;  3SNX A;  5BV0 A;  1K3Z D;  2FO7 A;  1V55 E;  2P9L G;  1JPL A;  3D9L A;  4ANU A;  2VJ8 A;  3LS8 A;  4N5Q A;  5CBO A;  3CGH A;  3AG4 E;  3IKO B;  2WPV A;  1E7V A;  4ILG A;  4ACK A;  5BNW A;  3EIJ A;  3MGB A;  3NQP A;  4ATG A;  2FUL A;  4JHK A;  2J8S D;  2LO6 A;  4XE0 A;  3FEY A;  5C1D A;  2MRI A;  4EHM A;  2A5E A;  2KC7 A;  4GZD A;  5KNH D;  4BT8 A;  1OY3 D;  3OXF A;  3PZD A;  3UIN C;  3LY8 A;  3SY2 A;  2XGS A;  1YMP A;  3ZXP A;  2MHK A;  3AU5 A;  4FJY A;  3U4T A;  3AG3 E;  1BLX B;  3RRN B;  2OND A;  3HYM B;  2WXH A;  4JC8 A;  4DX6 D;  3FH8 A;  3CSF A;  4TXQ A;  1OWL A;  3C72 A;  4J8Y A;  4GZC A;  4YDO A;  4MLP A;  1SQM A;  4BT9 A;  1TJF A;  4B93 B;  2J07 A;  3CHP A;  5AAO A;  3JQ1 A;  5AEN A;  1S70 B;  3ZU7 B;  4JHJ A;  3JQ0 A;  1H19 A;  4X8Q A;  3D9N A;  1TR4 A;  4JHR A;  3PE3 A;  4I1M A;  4I1O B;  4BWR A;  4CDN A;  1K1A A;  1HU3 A;  4WNF A;  3WXX A;  1HG5 A;  3I4R B;  3MX3 A;  4KZ0 A;  5EX0 A;  3AS4 A;  1DNP A;  4GMJ A;  4N3A A;  2KAT A;  3TWT A;  5BPP A;  2VGX B;  2XCC A;  2ZGD A;  3ZVV A;  4N3C A;  2VSO E;  1B89 A;  1XGW A;  4JL0 A;  3JYS A;  4L1B A;  3QOU A;  1INZ A;  3PNT B;  2WXF A;  2WQH A;  3V31 A;  3VTX A;  3L6A A;  5KJM A;  4BX8 A;  2WB2 A;  2V4L A;  4R7L A;  3CVW A;  2WXJ A;  4U07 A;  5EKQ D;  3SFZ A;  2PL2 A;  4FLH A;  3MKQ B;  4XEI G;  4UWL A;  2KCK A;  2AXV A;  3SHF A;  4NAC A;  5EYL A;  3FTU A;  4OYS A;  1D8D A;  1MX6 A;  4FHK A;  3EUV A;  1FVH A;  3ISM C;  3U64 A;  4UWG A;  3SF4 A;  1OCR E;  4HRN A;  1E90 A;  2ILR A;  2R5S A;  4TRQ A;  3CKB A;  4KBQ A;  3FU5 A;  3QAQ A;  3AS5 A;  1HZ4 A;  3D9I A;  3ZYL A;  5E75 A;  4XI9 A;  4HVB A;  1P5Q A;  1EYH A;  3C98 A;  2NSZ A;  3EJN A;  4G23 A;  3Q7A A;  5D0Q D;  3UM3 A;  4J8S A;  3LCA A;  2J4D A;  3EHN A;  1HFA A;  3MEK A;  1IHB A;  1WY6 A;  3R7R A;  2IF4 A;  3L13 A;  2OOE A;  2EIK E;  3PZ4 A;  2Y4T A;  1OCC E;  1OCO E;  3EU5 A;  2XEE A;  5DBK A;  3SI5 A;  4DPR A;  3F6Q A;  2UY1 B;  1LTX A;  5ENP D;  4JXT A;  3HVE B;  4UI9 J;  4C0M A;  4GA0 A;  2J09 A;  1WG0 A;  2KZT A;  3FTW A;  1H0A A;  3P1U A;  2MOW A;  2XZT G;  4QFV A;  4ATZ D;  3U9W A;  3UMV A;  3UT4 A;  1TJC A;  2ETB A;  3FY4 A;  1A17 A;  1IYG A;  4UWF A;  4I6J A;  1TNB A;  4BET A;  4LSZ E;  3QK0 A;  5HKP A;  5G04 C;  5ENN A;  3QDN A;  4MKT A;  2XPI A;  4HOR A;  2LSV A;  3B7B A;  2WQ6 A;  4HI8 A;  4HLE A;  3FU0 A;  2WMN A;  3E30 A;  1H2V C;  3CQG B;  4M7C A;  1VDY A;  3EIQ C;  4AV7 A;  4L2Y A;  2EIL E;  3DEP A;  3L54 A;  1JUQ A;  3E32 A;  4GTV A;  2BED A;  1ZBP A;  4KXK B;  5M72 A;  4UQY A;  3QJZ A;  3EDT B;  4I6E A;  1UG3 A;  4NQ0 A;  2XHE A;  1N4Q A;  3SD5 A;  2DWZ A;  4TUM A;  4DI4 A;  4WNG A;  3TXN A;  3FHE A;  5KBA A;  4KMO A;  1SZA A;  3J5Q B;  3ZXS A;  2WXI A;  2KCV A;  1MZC A;  1A5E A;  2GW1 A;  4J7W A;  4CYM D;  4O60 A;  3NBN B;  2WXQ A;  5FZS A;  2F8Y A;  3QB2 A;  2IOL A;  2IFU A;  2GRN B;  3FUF A;  4KVO A;  4CEM A;  3UT8 A;  1JCQ A;  4H7Y A;  4CDR A;  3B7U X;  3IXE A;  3LVQ E;  4YND A;  2FEZ A;  5AJD A;  5EID A;  3APC A;  1O5M A;  3FUM A;  4MRU A;  5ARF A;  1S0P A;  3FUK A;  1U2V G;  3UUX A;  1JWF A;  2PM7 A;  1IQR A;  3SZ7 A;  4CRW A;  1KT1 A;  2XQ0 A;  3UM0 A;  4BY6 A;  3LXU X;  1MYO A;  1OCZ E;  1DCE A;  3PS6 A;  3T9K A;  3RKV A;  2RG8 A;  3CK9 A;  3SFY A;  2Q7F A;  1YA0 A;  3KD7 A;  5EDS A;  4FAD A;  2P9P G;  4B94 A;  3BU8 A;  4K0R A;  2GGF A;  5EYP F;  4U96 D;  3ZRH A;  4F53 A;  1IQU A;  4F1S A;  4UWK A;  2QFC A;  4GYO A;  4HB5 A;  5CED B;  2E2E A;  4V3I A;  4Y6C A;  1QQE A;  5ENT D;  3PZ3 A;  4BER A;  1JCR A;  4LER A;  4KT6 B;  1N95 A;  2KCL A;  2PZI A;  2JAB A;  4JA7 A;  3ZYK A;  3Q9N C;  2J08 A;  5FZQ A;  3CEQ A;  4GTM A;  3BUA A;  4AXH A;  2J49 A;  4JEH A;  1N9A A;  4JA9 A;  3AG2 E;  4B0Z A;  1KZP A;  4A55 A;  5BUZ A;  3FWV A;  3TWW A;  4APO A;  3SFX A;  2XPZ A;  5G2N A;  3DPY A;  3CQC B;  3ASO E;  2XS1 A;  2IQC A;  4CCA A;  3TWX A;  1SVX A;  4BSX A;  3CLJ A;  4XKB A;  3CVQ A;  4TXP A;  2ZXW E;  2XZD G;  3CK7 A;  3IV0 A;  3UKU G;  2I9C A;  3LKU A;  3FTV A;  1K1B A;  5B1A E;  4DRX E;  3B95 A;  5AN8 A;  4G1T A;  1N11 A;  3SO8 A;  4I6G A;  2IU1 A;  4IUL A;  3B7R L;  5AYW D;  3ML9 A;  3TXM A;  4Q69 A;  2M63 A;  1BPO A;  3Q73 A;  4FJZ A;  5JHB A;  3MV2 B;  1AP7 A;  1E8W A;  3R9A B;  3TGO A;  2IY0 C;  4DX1 A;  2F0Y A;  1D9S A;  5LOZ A;  3URZ A;  4I2Z A;  4YDW A;  3CVV A;  2C0L A;  2AXZ A;  1N4S A;  4LRZ A;  2XEN A;  3S2A A;  3ABK E;  1H2T C;  4AP2 A;  2Y4U A;  1PAQ A;  4HNA D;  3TWQ A;  4YVO A;  3LY9 A;  4EBA A;  1H6P A;  4F1P A;  2JLB A;  2V5Q C;  3T8M A;  1O1R A;  5DIZ A;  1YYH A;  4WUY A;  3DPD A;  2HYZ A;  4RG6 A;  2HO1 A;  3V30 A;  3S7D A;  3ZHE B;  4URK A;  3ML8 A;  2RD0 A;  4ABN A;  2Y69 E;  1UW4 B;  4GTP A;  4ACL A;  2WXO A;  3FUD A;  4HRL A;  4RLY A;  4J0U A;  3HHM A;  2PNN A;  1IXV A;  3PZ2 A;  4GZ6 A;  4U8H A;  1Q2Z A;  2XEH A;  1E96 B;  1Y8M A;  4E85 A;  2H6H A;  4ZHB A;  1UOH A;  3ZW3 A;  1H6O A;  3D9H A;  1N4P A;  4C0E A;  2LAI A;  3MJW A;  3FTZ A;  3EHM A;  2X38 A;  3UX4 A;  1HO8 A;  4AY6 A;  3VLD A;  3CHR A;  3MKQ A;  3CV0 A;  2HR2 A;  5G04 J;  3NZU A;  5FZR A;  2GRR B;  4ILH B;  2XGM A;  2H6I A;  3IBE A;  5HRY A;  3DWL G;  4F6R D;  2X3M A;  4L23 A;  4B89 A;  3V2X A;  3ASN E;  5ENQ D;  1K8K G;  1NP7 A;  4RG9 A;  1TNY A;  3DXM G;  2P58 C;  5BT1 A;  2KM4 A;  3PNL B;  3PUK A;  3ASF A;  5EN5 D;  3ONL A;  4J8F A;  1H2U A;  2QY7 A;  4BX9 A;  3J5P A;  1N0R A;  4K03 A;  4APF A;  3C3R A;  1FT2 A;  1EPU A;  3ENE A;  5CRV A;  3NAW A;  3KEZ A;  1GW6 A;  3L17 A;  5KJL A;  2VGE A;  3NZS A;  4U7E B;  4JVS A;  4CGW A;  4GZ3 A;  2WXR A;  3T5V A;  1QNF A;  1QBQ A;  2P9K G;  5T8I A;  3E37 A;  3UPV A;  3L9T A;  2R17 C;  3GZ1 A;  3UTM A;  3W9F A;  3HXF A;  3I4G A;  2EIM E;  2LSU A;  4N39 A;  4AIF A;  4L9P A;  4I9C A;  5LCW J;  4N3B A;  1TNO A;  3Q49 B;  5AQA A;  5LP0 A;  4AOF A;  3GYZ A;  4I1A A;  1Y6I A;  4PS3 A;  4ANV A;  1EDU A;  5B3S E;  3Q7F A;  4GTT A;  2Y1L E;  3UIO C;  4GA1 A;  3NOG D;  3CVU A;  4HQD A;  3HVE A;  2ZIR A;  4F3V A;  3FUI A;  1WAO 1;  2IO2 C;  3QAR A;  2YHC A;  5EIB E;  4G24 A;  4DLQ A;  1BI7 B;  3DBS A;  2WM9 A;  1ELW A;  5A7D B;  3R7Q A;  1N54 A;  2XRY A;  2L9B A;  3FH7 A;  3UIP C;  2WXL A;  4HI9 A;  1PC2 A;  2WXN A;  4NRH B;  2I6H A;  4YDE A;  5J08 A;  3TJP A;  4D10 C;  5JA4 D;  3Q79 A;  5FIO A;  4RQI A;  4BSZ B;  3UXG A;  3LJ3 A;  3LYA A;  3FTY A;  4BTB A;  5BXO A;  1HX8 A;  4UI9 K;  2J9Q A;  3VLE A;  2VTB A;  1D8E A;  5ITZ F;  2EIJ E;  2WQ7 A;  2VSN A;  1S64 A;  2LUH A;  1V54 E;  4HXI A;  3PH0 C;  3DSV A;  3RU0 A;  4GZ5 A;  3FTS A;  3GZS A;  2WXG A;  5FT9 A;  4HOT A;  2R2L A;  4LNU D;  3JUI A;  3LDZ A;  4ANX A;  3NOC D;  4UQX A;  5G05 C;  2R59 A;  3D3M A;  5AQB A;  3L22 A;  3MKR A;  4DLO A;  4H7X A;  3L16 A;  2BKG A;  5T3R A;  2KXP C;  1HE8 A;  5CER B;  5CEA A;  4GA2 A;  1U3C A;  3ULE G;  4BEP A;  3IHY A;  3C5R A;  3AJI A;  3MV3 B;  5FQ7 A;  5E76 A;  2KZT B;  1UJK A;  4EBA G;  4ANW A;  3Q78 A;  3HXB A;  2CFU A;  3JCK C;  2EQX A;  3T5X A;  1MJ0 A;  5FWQ A;  1BI8 B;  1FVF A;  4G25 A;  4U04 A;  4A3T A;  2JEK A;  2X6K A;  3CK8 A;  2GRP B;  2L0T B;  5CHE E;  2OEV A;  3CKC A;  3MCX A;  4PUC A;  3UI2 A;  3D9P A;  2XS8 A;  4KZC A;  5CMY A;  2GRQ B;  2R03 A;  5BXU A;  2BKK B;  2CHX A;  4GPM A;  3I3N A;  2QYU A;  4I2W A;  4QQI A;  3W9G A;  1Z3X A;  3CHM A;  1X5B A;  2XCB A;  1N52 A;  2NC9 A;  2B6C A;  3S7J A;  4GTQ A;  3Q9U C;  3ABM E;  2P9N G;  2OV8 A;  1UJJ A;  3AAA C;  3EHQ A;  1SA5 A;  1MHQ A;  3TG5 A;  4HBD A;  5CEC B;  2QC9 A;  2OCC E;  1E7U A;  3ESK A;  2CG2 A;  4GTS A;  3UT7 A;  4U8V D;  3C3Q A;  2P9U G;  1OWO A;  4BES A;  2BF0 X;  2XGO A;  4B8C B;  4DI3 A;  2HE0 A;  4I17 A;  4G26 A;  2DYS E;  2DYR E;  4U0U A;  1ZB1 A;  1PY1 A;  4HRM B;  3VTY A;  5AIJ A;  3DXK G;  4CZ2 D;  3PRE A;  4UWH A;  1IKN D;  2DZO A;  1UN9 A;  4GTO A;  3HXC A;  3RRU A;  4G2V A;  4DK5 A;  4BFR A;  4OAV B;  4IYP A;  2A5U A;  2Y0B G;  4CT0 A;  3RSE G;  2BUG A;  4I43 A;  4EPZ A;  4HLL A;  3SQV A;  5A6C A;  3Q5M A;  4WAF A;  4NIK A;  4FUL A;  4U0Z A;  3CHQ A;  4Q94 A;  2LAH A;  2NXP A;  3L08 A;  2IEJ A;  3ZEF A;  5FIN A;  3ZKJ A;  3CST A;  2L0I A;  4G11 A;  3APD A;  4U0S A;  1OT8 A;  3QC1 A;  3D9O A;  1DCQ A;  3V79 K;  2PQR A;  3HIZ A;  3C3O A;  4K5C A;  3U66 A;  4XX5 A;  5FQ8 A;  2CHZ A;  3DRA A;  4AVX A;  1TNZ A;  3I5P A;  3IHV A;  3E34 A;  5HI7 A;  4UUC A;  3ZHE A;  5JHA A;  1JWG A;  4FU3 A;  3FUJ A;  3RJV A;  5T4Y A;  2H6F A;  3RAU A;  3SBT B;  4OAU C;  2AVP A;  2C2L A;  2R05 A;  4LNG A;  3LY7 A;  1Z5S C;  4UQZ A;  1ELK A;  3LJN A;  4GYY A;  4WWP A;  4O1P A;  2CHW A;  3BG1 B;  5JMN D;  2VGY A;  4GAA A;  4OVV A;  1W3B A;  2P9S G;  4TXR A;  1TN6 A;  3HXD A;  4TUU A;  1KZO A;  4YDY A;  2F8X K;  4A63 B;  2P2C P;  2V8S E;  5JJT A;  1ELR A;  3NF1 A;  4JD2 G;  4Q96 A;  2FF4 A;  2I1J A;  3DSU A;  4AEZ C;  1TNU A;  3FH5 A;  4BTA A;  1TYQ G;  3G2S A;  3AG1 E;  4PDX A;  4C48 B;  2LXL A;  5KCM A;  3O48 A;  2AW6 A;  3KSL A;  2I2O A;  2E0I A;  2VGX A;  3OAW A;  4IRU A;  3ZIM A;  4LG6 A;  4P29 A;  4DUI A;  4EZL A;  5BV1 A;  3JXJ A;  1OWM A;  3U3W A;  4KYO B;  3ULY A;  2LNI A;  4FLB A;  3ESL A;  3ZFW A;  2L6B A;  1NL4 A;  1G3N B;  2YNQ A;  4FP7 A;  2RKK A;  4WND A;  4O1O A;  2YQ8 A;  3CHS A;  1XNF A;  4GCN A;  3SBS A;  5KJK A;  4A1G A;  3PEV B;  5CBN A;  4XKC A;  3UM2 A;  3TG4 A;  5G05 J;  5AJL A;  4AY5 A;  2RFM A;  3HG0 D;  5G55 A;  4GCO A;  2ETA A;  3G2V A;  3FUE A;  1OUV A;  2VSY A;  4EEC A;  1RZ4 A;  1FT1 A;  3ASD A;  5BW8 C;  5A23 A;  4U8Y D;  4FHJ A;  3HDX A;  4AJW A;  2WXP A;  3JXI A;  4RVB A;  3B7S A;  2A4Z A;  4O6F A;  3OXL A;  4GMR A;  5C2Y A;  5FTP A;  3LPZ A;  4GU5 A;  5FJY A;  1KLX A;  2WXM A;  3BEE A;  3TWU A;  1H6K A;  4J6I A;  2ION A;  5KJN A;  3TL5 A;  3O4Z A;  4Y6W A;  3AS8 A;  3EHR A;  5EIL A;  4M3O A;  5ENR D;  4GB9 A;  2DZN A;  4U63 A;  5ANR A;  3CIA A;  2XPY A;  3CR3 A;  4JB8 P;  2Y3A A;  2UY1 A;  2QYJ A;  3FUN A;  3D9K A;  4WNE A;  3ONK A;  3Q75 A;  2X6F A;  3QWW A;  3R9M A;  3Q47 B;  4HS2 A;  4PS8 A;  3CVN A;  1QYM A;  2XEV A;  1HG2 A;  1QZ2 A;  3UM1 A;  1E8X A;  1KT0 A;  3TWS A;  4DX5 D;  1DC2 A;  4YVQ C;  4EQF A;  5CCL A;  1FPP A;  4A3V A;  3WG7 E;  3FUH A;  4J8D A;  1SW6 A;  5EX3 A;  5ANL A;  3ZPJ A;  3VLF A;  4XZ4 A;  1O1S A;  3PUJ A;  4K5B A;  4JPS A;  1N94 A;  4EZK A;  2IJG X;  5CRU A;  3GZ2 A;  3MZL B;  4HOQ A;  4AM9 A;  5D0O D;  1SZ9 A;  3K9I A;  3RO2 A;  1TN8 A;  3KSQ A;  3RRM B;  4JEU A;  1NZN A;  1LD7 A;  2GRL A;  2YIN A;  1NI1 A;  1NA0 A;  2OEW A;  1JCS A;  1BD8 A;  5ARG A;  4ILI A;  2WXK A;  4JW1 A;  3S7B A;  4E6H A;  2GRM A;  3FU3 A;  2FI7 A;  5D66 A;  2B0O E;  4U95 D;  4F7A A;  4N2Q A;  4B8A A;  3ZYQ A;  1LF8 A;  3FU6 A;  4IN3 B;  4NUR A;  4CT4 A;  3UKR G;  3PEU B;  1HXI A;  3P2B A;  3FFL A;  5ENO D;  2CFZ A;  2PQN A;  2VQ2 A;  3KEA A;  4LNB A;  3PE4 A;  2X6H A;  2KBX A;  2ZIS A;  5HS0 A;  4GPK A;  2P9I G;  3QWP A;  3QWV A;  4XIF A;  5AAR A;  5LX8 A;  3G2U A;  4WWO A;  4PS7 A;  1NFI E;  3RK6 A;  3RO3 A;  4G8K A;  4GML A;  3ZUV B;  1HH8 A;  1NA3 A;  5AQ9 A;  3CVX A;  3PDN A;  1AWC B;  4KVM A;  3PVL A;  3MA5 A;  3D9M A;  2VTB B;  3BG0 B;  4HFG A;  1TEZ A;  3CVY A;  4N2S A;  3MYV A;  2IOS A;  1Z6T A;  3PZ1 A;  3BQO A;  1MX4 A;  3OXG A;  1YCS B;  2V4H C;  2AWI A;  4L7T A;  1ZU2 A;  3Q4A B;  3ZGQ A;  4FA6 A;  1E8Y A;  3RIB A;  4I9E A;  3HRA A;  2ZGG A;  4L2L A;  2X6I A;  1OWN A;  2IO3 C;  3IEG A;  3E4B A;  1KPS B;  5H7P A;  1EF1 C;  4XI0 A;  5LCW C;  2H6G A;  4GYW A;  3DSW A;  3Q15 A;  4A1S A;  5JJ7 A;  3CHO A;  4RSY A;  4TV3 A;  4EZJ A;  3SGH A;  2V5F A;  1N4R A;  3KS2 A;  5JJ6 A;  2R02 A;  2I1K A;  1LD8 A;  3GW4 A;  2WVI A;  5IY5 E;  2AXU A;  3ASG A;  3ASH A;  1WDY A;  1L5J A;  3TAX A;  2V0P A;  3LVR E;  4HOU A;  4LUN U;  3TWR A;  3EU9 A;  3DSX A;  2AJA A;  4DJA A;  2OVF A;  3FP3 A;  5KWD A;  2C0M A;  1HS6 A;  5CMW A;  4JZY A;  3AU4 A;  3NB2 A;  3ZYM A;  1SA4 A;  3APF A;  3DSS A;  2DCP A;  5HQ8 A;  2DVW A;  2L6J A;  3FEX A;  5KNG A;  1MQS A;  2X6J A;  5D2M C;  2EIN E;  2BTD A;  3ULQ A;  1OWP A;  2QZA A;  2UWJ G;  4FC8 A;  3FUL A;  4UI9 C;  2DBA A;  2VYI A;  2LXM A;  4N5C A;  4C9B B;  1X81 A;  1DVP A;  1MX2 A;  1BU9 A;  3FTX A;  1N0Q A;  2NYJ A;  4OVU A;  4DX7 D;  3DEO A;  1IHG A;  5J90 A;  3T8K A;  3JUE A;  4WWN A;  4GTR A;  4PH4 B;  4J8E A;  3PRZ A;  5B1B E;  3ZN3 A;  4LEU A;  2FBN A;  4MBG A;  2MYO A;  3N71 A; 
#chains in the Genus database with same CATH homology
 1BI7 B;  5EIL A;  5HRY A;  2KXP C;  4UUC A;  4YDW A;  4F6R D;  4BES A;  3V31 A;  3V2X A;  5D66 A;  5ENR D;  2B0O E;  5CER B;  5CEA A;  4U95 D;  5KBA A;  2L6B A;  5ENQ D;  2DZN A;  2J8S D;  3J5Q B;  3TWV A;  2XEN A;  1G3N B;  2HE0 A;  5AQ7 A;  2XEE A;  4JB8 P;  4BEP A;  5EN5 D;  1A5E A;  1WDY A;  2A5E A;  2QYJ A;  4J7W A;  4HNA D;  2JAB A;  4CYM D;  4O60 A;  3NBN B;  4O1O A;  3F6Q A;  5KNH D;  3TWQ A;  3Q9N C;  2F8Y A;  1OY3 D;  5ENP D;  3C5R A;  4HRM B;  4HI9 A;  4F1P A;  4K5A B;  4CZ2 D;  2V5Q C;  1WG0 A;  4OAU C;  1IKN D;  1N0R A;  3AJI A;  2DZO A;  3J5P A;  1YMP A;  5ENO D;  3V2O A;  1YYH A;  2XZT G;  4QFV A;  2FO1 E;  5EYL A;  3TWR A;  3KEA A;  4ATZ D;  3EU9 A;  3LJN A;  3IXE A;  2AJA A;  4BSZ B;  2KBX A;  5FIO A;  5JA4 D;  4OAV B;  4O1P A;  3UXG A;  3V30 A;  5HS0 A;  3TWW A;  5CBN A;  2ETB A;  5JMN D;  1MX6 A;  1QYM A;  2RFA A;  1BLX B;  5EID A;  5AAR A;  4Z68 A;  3ZNG A;  2Y0B G;  2ETC A;  4HLL A;  2VGE A;  1MJ0 A;  4DX6 D;  1NFI E;  2F37 A;  1BI8 B;  2RFM A;  3TWS A;  4DX5 D;  1DC2 A;  3TWX A;  4BET A;  4NIK A;  3HG0 D;  4G8K A;  4LSZ E;  5BXO A;  5KWD A;  2ETA A;  4HRL A;  1SVX A;  4RLY A;  5HKP A;  4ZFH A;  4G8L A;  4J8Y A;  4DX2 A;  1SW6 A;  2PNN A;  4HRN A;  1IXV A;  3UI2 A;  3ZUV B;  4YDY A;  5AQ9 A;  3B7B A;  4B93 B;  2F8X K;  1MYO A;  3UTM A;  3W9F A;  4A63 B;  2P2C P;  5AAO A;  5BXU A;  4HI8 A;  2DVW A;  1AWC B;  2BKK B;  5ENS D;  4K5B A;  2XZD G;  5KNG A;  1S70 B;  5FIN A;  3T9K A;  3ZU7 B;  4GPM A;  5ITZ F;  2XEH A;  3ZKJ A;  1K1B A;  4U8Y D;  1TR4 A;  4DRX E;  4QQI A;  3B95 A;  5AN8 A;  3W9G A;  4ZHB A;  1UOH A;  3DEP A;  4C48 B;  5AQA A;  1N11 A;  1MX4 A;  3D9H A;  1OT8 A;  1YCS B;  2V4H C;  1K1A A;  3SO8 A;  1MX2 A;  3Q9U C;  1BU9 A;  3JXI A;  5EYP F;  1K3Z D;  1DCQ A;  1N0Q A;  2NYJ A;  4DX7 D;  3DEO A;  3HRA A;  4U96 D;  2Y1L E;  3T8K A;  3JUE A;  3V79 K;  4GMR A;  3AAA C;  3EHQ A;  3TWT A;  2ZGG A;  4K5C A;  4HBD A;  3NOG D;  4LNU D;  4N5Q A;  5CBO A;  4LG6 A;  3TWU A;  4HQD A;  5CEC B;  2QC9 A;  1AP7 A;  4HB5 A;  4DUI A;  5CED B;  1IHB A;  3NOC D;  2ZGD A;  5AQB A;  1BD8 A;  4U8V D;  5EIB E;  2DWZ A;  4DX1 A;  3JXJ A;  4TUM A;  5ENT D;  2MYO A;  4BER A;  2BKG A;  3EHR A;  1D9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...