3AAAC

Crystal structure of actin capping protein in complex with v-1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
117
structure length
117
Chain Sequence
CDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
total genus 43
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3aaaC00
4N5QA 5EIDA 2NYJA 1TR4A 3TWRA 2DZNA 5JA4D 3KEAA 4U8VD 1SW6A 3F6QA 5ENTD 5BXUA 3W9FA 3Q9NC 5EYPF 4DX7D 2XZTG 4OAVB 2F37A 3EHQA 2B0OE 2ETCA 1N0RA 1K1BA 2AJAA 3JXIA 4U95D 3TWSA 4F1PA 2J8SD 3DEOA 3B95A 4TUMA 5EN5D 5KWDA 3T9KA 4HRNA 5KNHD 5HRYA 4HB5A 1N0QA 1N11A 4BEPA 1BLXB 5HKPA 3NOCD 5ENQD 2F8XK 2JABA 5ENPD 1AP7A 4J7WA 1SVXA 1MYOA 5FIOA 3V31A 5CECB 2BKKB 4F6RD 1MX2A 4U96D 4A63B 4ZHBA 5KBAA 1A5EA 2V5QC 4BERA 4U8YD 2KBXA 3C5RA 3SO8A 2XEHA 2A5EA 1D9SA 4K5AB 1G3NB 4HBDA 1DC2A 2Y1LE 3D9HA 2ETAA 3Q9UC 3TWXA 4G8LA 1BU9A 3UTMA 4NIKA 2F8YA 1NFIE 1DCQA 2XENA 4QFVA 5AQ7A 5CEDB 2VGEA 2QC9A 2P2CP 3EHRA 3V2XA 1YCSB 4CZ2D 5EYLA 2PNNA 3AAAC 1BI7B 4K5BA 5CBNA 2BKGA 3NOGD 2KXPC 4YDYA 2DWZA 1S70B 3AJIA 3V2OA 4CYMD 5ITZF 5AQ9A 1WDYA 2RFMA 4LG6A 4YDWA 2MYOA 1K3ZD 4B93B 3EU9A 1MJ0A 2HE0A 5CEAA 1K1AA 4RLYA 3ZNGA 3ZU7B 2XEEA 3B7BA 4DX2A 4HLLA 4DX1A 5EIBE 4DX6D 4HI9A 4DUIA 1IKND 3HRAA 3V30A 4HRMB 1YMPA 3T8KA 3J5QB 3NBNB 3TWTA 3TWWA 1BI8B 1AWCB 2Y0BG 4HI8A 5EILA 5FINA 4QQIA 3V79K 4GMRA 2ETBA 2XZDG 1YYHA 3JXJA 3LJNA 4ZFHA 5AARA 3W9GA 2L6BA 5BXOA 1UOHA 3TWVA 5JMND 1MX4A 4LSZE 5ENSD 4DX5D 4GPMA 2FO1E 4DRXE 3IXEA 4HNAD 4JB8P 5KNGA 4UUCA 1OY3D 1BD8A 1WG0A 3J5PA 4J8YA 5AAOA 5AN8A 5D66A 4HRLA 4O1OA 3HG0D 2DVWA 3ZKJA 4O1PA 1MX6A 4K5CA 3TWQA 1IXVA 1OT8A 4Z68A 5AQBA 4BSZB 5CBOA 2RFAA 4C48B 5ENRD 2QYJA 3JUEA 4OAUC 4O60A 5ENOD 2ZGGA 2ZGDA 1QYMA 1IHBA 4LNUD 3UI2A 3DEPA 3UXGA 5CERB 2DZOA 5AQAA 3ZUVB 4ATZD 4HQDA 4BESA 3TWUA 2V4HC 4G8KA 4BETA 5HS0A
chains in the Genus database with same CATH superfamily
2IO3C 2NYJA 1E8ZA 1SW6A 5M72A 3SQVA 2EIJE 2LAIA 3B95A 1N4QA 2IOSA 1FPPA 3FTYA 1IQUA 2NC9A 3UX4A 3SNXA 3FTVA 4K5AB 4MKTA 4HOSA 4WUYA 5CCMA 3MZLB 3S7DA 3AS5A 4JA9A 1O5MA 2X6FA 2FEZA 2P9PG 5EYLA 3DSTA 4C0MA 3ZEFA 5BV1A 2RG8A 4DK5A 2IFUA 2QY7A 3EU9A 4XIFA 3FU3A 4KVMA 4EECA 3FEXA 3SHFA 1LTXA 1H19A 4TV3A 3EU5A 4UQYA 5EX0A 2CFUA 5D0QD 2Y0BG 1EF1C 2KM4A 1HG2A 3DSVA 2ZU6B 4GZ3A 2CG2A 2J49A 1N4SA 4BY6A 3IXEA 4UUCA 3CVVA 1OCZE 3RO2A 3TGOA 1ZBPA 3FUNA 2HR2A 3FU6A 4HVBA 1U3DA 3ASOE 3EUVA 3LDZA 1N4PA 4BSXA 2V4HC 2AVPA 4J8SA 3ESLA 2ZISA 3FUHA 4E85A 4BTBA 3Q7AA 1E7VA 3AG2E 1K1BA 3L17A 4F1PA 2J8SD 2QZAA 3UKUG 4AJWA 5FQ8A 4U0ZA 2F8XK 1WY6A 3PZ3A 4AOFA 4KYOB 5KBAA 1NP7A 3ABME 3PS6A 4XKCA 2WXGA 4PS8A 3U66A 1D9SA 2VYIA 3FUEA 3ZXSA 3UM2A 1N94A 3UTMA 2FI7A 3N71A 4NIKA 1OXJA 4D10C 4PH4B 4U8HA 3D9KA 2EINE 2RKKA 2IU1A 2L0IA 3D9OA 4DPRA 1Q2ZA 2I1KA 4LRZA 2WXRA 3L13A 5FZSA 5ANLA 1VDYA 4HI9A 4G1TA 4MBGA 3C3QA 2XEVA 2M63A 3JXJA 3OAWA 5BXOA 4DJAA 2WQ7A 4GTQA 4I2WA 1QZ2A 4OVUA 1MZCA 3AG3E 4TXQA 5CBOA 2R03A 3UINC 4M7CA 1OWLA 4Y6WA 4ANVA 3ENEA 1QQEA 2OEWA 3L54A 4HQDA 2WMNA 2P9LG 4CDRA 5KJLA 4TRQA 4A1GA 3JQ1A 2CHZA 3KEAA 1K8KG 2F37A 4U95D 3UPVA 3FTSA 2BTDA 1S64A 3LJ3A 4EZJA 4BT8A 3CKCA 4C0EA 1YA0A 3C3RA 3RO3A 2CFZA 5ENPD 3QNKA 1SVXA 1IHGA 4L2LA 2BKKB 3C3OA 2V5QC 3K9IA 1JCQA 3SGHA 4BTAA 3SO8A 4UWFA 1D8DA 3FY4A 1BU9A 3PNLB 3CVPA 2WXMA 1HU3A 2Y4TA 4QFVA 4OVVA 2KCKA 4N3BA 3AAAC 1S70B 3QKYA 3BEEA 3PUJA 3ZNGA 2PM6A 1KLXA 2R59A 3PE3A 1OWMA 2J08A 3FTWA 3LVQE 3HRAA 5A6CA 4WAFA 1BI8B 1AWCB 1Z3YA 2IEJA 3DBSA 2XZDG 2YQ8A 1YYHA 1FT2A 3NQPA 3GYZA 5ENSD 3Q75A 3CK9A 4LSZE 4UQZA 4KXKB 4N5CA 5KNGA 4J8YA 1QNFA 1L5JA 3ZIMA 4EZLA 4A3VA 5AQBA 4ACLA 4XKBA 4XX5A 3GZ2A 4PDXA 3Q5MA 1X81A 1JPLA 1QYMA 3FUMA 3I5PA 3UT8A 3E33A 4FU3A 3UQ3A 1U3CA 2H6FA 3FUIA 2LNIA 5JJ7A 5CRVA 2JABA 3LY8A 2IQCA 4AY5A 1OCOE 1MX2A 1LF8A 4U96D 4CT0A 4Q96A 4U8YD 3QARA 3I4RB 2A5EA 2XRZA 2OCCE 2XGMA 4GCNA 3EHRA 4CGWA 5CBNA 1WDYA 2HE0A 4H7XA 3ASHA 4CT4A 1LD8A 2MOWA 3I3NA 4GZ5A 5ANRA 3VLEA 3CK7A 2LAHA 2L6BA 1ELRA 3TWVA 4U0SA 2AXZA 1HZ4A 5AN8A 3PNTB 4HRLA 3HHMA 2P9NG 3ZYKA 4GYOA 2IJGX 3IEGA 2GRLA 5BUZA 5AJLA 3QC1A 3FTUA 3FH8A 1NA3A 3KSLA 2YINA 4FHKA 4AP2A 4G11A 4E6HA 4GTRA 1EDUA 4U8VD 4C9BB 5DBKA 2CG3A 4YDOA 1N0RA 2AJAA 2X6IA 1E96B 4TXRA 3FUFA 5JJ6A 3X2QE 4L7TA 1PAQA 4L9PA 2YHEA 3HXFA 4A63B 1XNFA 4BERA 3NAWA 3RKVA 4JEUA 2LSVA 4U0UA 4F3VA 4HOTA 1G3NB 3TG4A 3D9HA 4AM9A 3L16A 3MA5A 3P2BA 4KVOA 4FA6A 4M3OA 1E8YA 1FVFA 1NFIE 2XENA 3FWVA 5AQ7A 3FTZA 3E30A 4DLOA 4GB9A 2BKGA 2KXPC 3SFXA 4YDWA 4F1SA 3ULEG 1RW2A 3I4GA 1K1AA 3KSQA 3QJZA 4I1AA 4G24A 5JHAA 3HXDA 4DX6D 4KBQA 3B13A 1GW6A 1O1RA 3KD7A 3LJNA 1UOHA 3ZVVA 2HO1A 1OCRE 3ESKA 1TNYA 4JB8P 3J5PA 1E90A 3OXFA 4GTPA 2DVWA 4YVQC 4I1OB 4GTOA 1RZ4A 1O1SA 3CVUA 3APCA 5FTPA 3B7SA 2ZGGA 3ONLA 1LD7A 3S2AA 3G2WA 2AW6A 4GYWA 1OCCE 2R05A 2DZNA 3W9FA 5BT1A 4DX7D 2FBNA 4RG6A 1WM5A 4HRNA 4RSYA 5A23A 1MYOA 4F6RD 1EYHA 4U04A 3LS8A 1N54A 2ILRA 3ISMC 1FCHA 4PUCA 4ANWA 3MEKA 5B1AE 2ETAA 5BV0A 5KJKA 2GRRB 2F8YA 4IRUA 2XQ0A 1HH8A 3Q47B 4RVBA 4KZ0A 1X5BA 2XPYA 3LEWA 3MV3B 4B93B 3WXXA 2X3MA 3L22A 2WM9A 3APDA 4FJYA 4HLLA 5EKQD 3PZ4A 3ULYA 4ABNA 3MKRA 4JA7A 1INZA 3RJVA 3CSFA 1TEZA 4ANUA 3U4TA 3C98A 4L1BA 5CRUA 5KJMA 2Q7FA 3SBTB 1EPUA 4I6EA 4N3AA 1B89A 4B8AA 1D8EA 2RFAA 3ZFWA 3IKOB 3OXGA 2J9QA 3TWUA 2V0PA 4G8KA 1Z5SC 4J8FA 4AY6A 4EHMA 3F6QA 4NQ0A 4OAVB 2VQ2A 4U07A 3DXMG 4AIFA 3KAEA 4B94A 1DNPA 4APOA 5FZQA 4WNEA 4L2YA 2UY1A 4G26A 3DRAA 5CECB 2WXFA 3SY2A 3ZGQA 3PE4A 2PM7A 3C5RA 1H6OA 4JHKA 1JWFA 3CHPA 1HF8A 2VSNA 4BT9A 5AYWD 2JLBA 2Y4UA 4I43A 1E8WA 1Z3XA 4ACKA 3UKRG 5AIJA 3QWVA 5A7DB 4UI9C 2VTBB 4GU5A 3Q73A 3TXNA 2AWIA 4HFGA 3T8KA 2R02A 3TWWA 4N2SA 5JHBA 2DBAA 2AXUA 2HYZA 3CVNA 3CV0A 3VTYA 1IYGA 2NXPA 2Y3AA 3UIPC 2V5FA 5C2YA 3LCAA 3SI5A 2OEVA 4G2VA 4MS6A 1IHBA 2OVBA 3UXGA 2IO2C 2I9CA 5CMYA 1S0PA 2XPIA 3PZDA 1NZNA 4FHJA 3ZYMA 2UY1B 2KATA 4GA0A 4JHJA 4TUMA 1JUQA 1HE8A 3CVLA 5KWDA 3T9KA 4FLBA 2WXOA 3T5XA 1AP7A 3EIJA 3FU5A 5EDSA 2XHEA 2R2LA 1TJFA 4B0ZA 4CDNA 1H6KA 4KMOA 4LERA 2EILE 3E37A 3Q9UC 2EIKE 4F7AA 5D0OD 3LVRE 2IF4A 4CZ2D 3UT4A 2GRQB 3DSUA 2DYRE 3CHSA 2RD0A 5LP0A 2WXIA 3ASFA 5B1BE 4GTVA 3L82A 2DYSE 3NBNB 3TWTA 4HI8A 3RAUA 3DXKG 4GTTA 4RG9A 3IV0A 4DX5D 2NSZA 1OY3D 4FLHA 2VGXA 4N39A 2PL2A 5FJYA 3TWQA 1OT8A 3Q78A 4XEIG 1H6PA 2WPVA 2QYJA 4OAUC 5CMWA 1TNOA 1E8XA 3B7RL 1H0AA 1KT1A 3AS8A 2FULA 3Q9NC 3KS2A 3ABLE 2YNQA 3JXIA 1ELWA 5EN5D 3CEQA 2XCCA 2LXLA 3AU5A 2XGSA 4I1MA 5G55A 3SBSA 5HKPA 4J7WA 3DSWA 3PH0C 4MRUA 4ZHBA 4WNFA 1A5EA 4UI9J 4ME2A 3ML8A 3Q49B 3QOUA 3FTXA 3C72A 4N3CA 2I2OA 1OWNA 3HXEA 2OV8A 4GAAA 1BI7B 1TNBA 4F53A 3CVYA 1N9AA 3BQOA 2AXVA 2VJ8A 1XGWA 3CQGB 3ZRHA 1NL4A 2OVFA 4I6GA 3CLJA 4CCAA 2VGXB 3NZUA 5JMND 4LEUA 4B89A 1KT0A 4GA2A 5ENNA 4O1PA 3RRMB 1KZOA 4J0UA 3D9NA 2XS1A 3PZ2A 2C0LA 2BEDA 2GRPB 2CHXA 3UI2A 4RQIA 3CSTA 4BETA 1SQMA 5JA4D 3FP3A 3RRUA 1Y8MA 4A1SA 4EPZA 2GROB 4JL0A 2J4DA 2B0OE 2ETCA 2WXNA 4K03A 2I6HA 4B8CB 3DEOA 1TN8A 3CHQA 3UMVA 3L08A 1A17A 5ARGA 3NB2A 4WNGA 4BEPA 1BLXB 3PEVB 4GPKA 4HXIA 4V3IA 3ZN3A 2QFCA 1UN8A 4EZKA 3FHEA 2WVIA 1DCEA 4GTMA 3OXLA 4G25A 2XGOA 4WWPA 2PNNA 3LKUA 4NURA 2UWJG 3GW4A 3HXBA 1OWOA 4JW1A 3MV2B 3QWPA 4PS7A 2WXLA 4H7YA 4JZYA 4QQIA 1ZU2A 4GMRA 4ZFHA 4NACA 3D3MA 2E0IA 3RU0A 4YVOA 4ATGA 3T5VA 4HNAD 3B7TA 1WG0A 5AAOA 3HG0D 4Z68A 4XI0A 4UI9K 2I1JA 3Q4AB 1KPSB 4XZ4A 3P1UA 2B6CA 4IULA 2DZOA 4I2ZA 3PZ1A 1UJJA 3FUJA 1IQRA 2E2EA 4FJZA 4ILIA 3G2VA 2A5UA 1ELKA 1U2VG 4HB5A 2KCVA 4U63A 3R7QA 5LX8A 3SF4A 3JYSA 4DI3A 4O6FA 3UM1A 3D9JA 2KBXA 4AVXA 1N52A 5HQ8A 2XS8A 3ZYLA 2BUGA 3PUKA 4DLQA 4JXTA 3CHMA 2QYUA 4BX8A 4XI9A 2VGEA 2P2CP 2V4LA 5T8IA 1YCSB 3QWWA 3PDNA 4LNGA 2DWZA 5ITZF 2FO7A 4GCOA 3U3WA 4GZCA 2A4ZA 1K3ZD 5G04C 4JEHA 5CEAA 3EJNA 2LSUA 4DX1A 4MLPA 4JPSA 1FVHA 2L6JA 1YMPA 3LXUX 2WXHA 2JEKA 3QB2A 5AENA 3FEYA 3MKQB 4KZCA 1HO8A 2ETBA 3OTNA 2EIME 3MCXA 4J8EA 4GPMA 4I9EA 4U7EB 2H6HA 4UWHA 3ASGA 3ZKJA 4L23A 4C48B 3VTXA 5FQ6A 1HFAA 3HDXA 3RIBA 4O60A 2VTBA 3S7FA 2R17C 4W9RA 2OOEA 5HS0A 2GGFA 4K0RA 4JD2G 5EYPF 1H2TC 3L6AA 4CGVA 4XE0A 4GTSA 5LCWC 4WNDA 3LY7A 1TN6A 1N0QA 3NOCD 3Q15A 3U64A 3V31A 1TN7A 4Q69A 1HG5A 3Q7FA 5FQ7A 2XEHA 3CGHA 4FULA 3LPZA 4WWNA 3EHNA 4UWGA 3SZ7A 2YHCA 3EHMA 4GYYA 5J90A 3V2XA 2ZIRA 3E32A 1HXIA 4K5BA 1TNZA 2PQRA 5AQ9A 2MYOA 4BX9A 5KJNA 3FUKA 4RLYA 4HS2A 3B7BA 3TXMA 3IHYA 3FFLA 3V30A 3S7BA 2WQ6A 3U9WA 4FADA 1WAO1 5KCMA 5AARA 2IONA 5IY5E 3SFZA 3CHRA 2PZIA 3UT7A 1Z6TA 2IOLA 2FO1E 2X6KA 3PRZA 1MX6A 4TXPA 2GRMA 3DSSA 2FF4A 2L0TB 5ENRD 3JUEA 2F0YA 3DEPA 3MX3A 3FU0A 2GRNB 4ATZD 4A55A 1TR4A 5H7PA 3TWRA 1QBQA 3QK0A 5EX3A 4IN3B 1H2VC 4AXHA 3TWSA 1MQSA 2P9IG 2LXMA 3CKBA 2IY0C 3EIQC 5AJDA 2MHKA 3ZPJA 3GZ1A 2R5SA 4AV7A 2C2LA 3HYMB 5FQ4A 4UWKA 3AS4A 5LOZA 4N2QA 5G04J 1JWGA 4JVSA 3ZHEA 3D9MA 2H6IA 1JCSA 4GZ6A 5BW8C 4G8LA 3UUXA 2MRIA 3ABKE 5BNWA 5BPPA 5E75A 1V54E 5J08A 4GMLA 3FH5A 2LO6A 3NOGD 3AJIA 2RFMA 2X6HA 2WXJA 5B3SE 2L9BA 2DIWA 3HIZA 3GZSA 3B7UX 1JCRA 2WQHA 4BFRA 1UW4B 3QDNA 3W9GA 1Y6IA 3IHVA 1HX8A 3JUIA 1P5QA 2WXPA 3VLDA 2KZTA 2VGYA 5D66A 1O1TA 4O1OA 3HXCA 2XPZA 3JCKC 5DIZA 3O48A 1UN9A 1NA0A 4URKA 1TNUA 5LCWJ 5ENOD 5CERB 2CHWA 3TL5A 3FDHA 3D9PA 5G05C 2LUHA 2H6GA 4I17A 2WMOA 5BXUA 5C1DA 1HS6A 3CVWA 2KC7A 2XZTG 3PVLA 4LCTA 4EBAA 4UWLA 4EBAG 3Q79A 1OWPA 1SZAA 1V55E 3KEZA 4P29A 1N95A 3E4BA 4FP7A 2ONDA 3SFYA 3ZHEB 4JC8A 3RK6A 5ARFA 3G2SA 3HVEA 4CEMA 3DSXA 3FUDA 4TUUA 3TWXA 1W3BA 2EQXA 1DCQA 3EDTB 4PS3A 5CEDB 3ZXPA 5G2NA 3V2OA 3AG4E 3G2TA 4DI4A 2WXQA 3L9TA 1UJKA 3ZU7B 3FH7A 4Y6CA 2XCBA 4HRMB 4I6JA 3J5QB 3APFA 3V79K 2KZTB 4NRHB 4A3TA 3BUAA 3G2UA 4APFA 1PY1A 1BD8A 5FT9A 2GW1A 3TAXA 3DPYA 4WWOA 5LFAA 3IBEA 3MJWA 3ASNE 1S63A 4AEZC 3FULA 5AQAA 3E34A 3ZUVB 4BESA 1N4RA 4N5QA 3CIAA 5EIDA 4I9CA 3PREA 5ENTD 3URZA 3EHQA 2VSXE 3CQCB 2J09A 4ANXA 4GMJA 3HVEB 3QAQA 3O4ZA 1N11A 3ULQA 4X8QA 3BG0B 5ENQD 1KZPA 5CCLA 1SA4A 4JHRA 3BG1B 1DVPA 1DC2A 3ZYQA 3CHOA 2QC9A 3ZW3A 4GZDA 4YDYA 4CYMD 2Y69E 3MGBA 5HI7A 4ILHB 4DX2A 3ASDA 5EIBE 3D9IA 4CDMA 2ZXWE 2P58C 3MYVA 5EILA 3AU4A 3WG7E 3AG1E 2C0MA 5FWQA 2VSYA 5G05J 2P9KG 4G23A 4DRXE 1H2UA 3JQ0A 3R7RA 4YDEA 4CRWA 4K5CA 3UIOC 4UQXA 2J4BA 3DPDA 3LY9A 5FZRA 2ZGDA 3CR3A 2P9UG 3RSEG 3S7JA 3CVXA 5CHEE 3CVQA 4EQFA 3BU8A 3SD5A 3MKQA 2WB2A 4HORA 1E7UA 1SA5A 1ZB1A 2BF0X 3ONKA 2HM8A 3PEUB 5KNHD 2J07A 5HRYA 3TJPA 4BWRA 3LYAA 5FIOA 2XRYA 1UG3A 3UM0A 3VLFA 3R9MA 3T8MA 4LNBA 4HBDA 2Y1LE 4R7LA 2KCLA 5JJTA 3DWLG 5T4YA 2P9SG 4J6IA 3CK8A 2V8SE 3R9AB 1OUVA 2X6JA 3NZSA 3UM3A 4LG6A 1SZ9A 1MJ0A 5E76A 2DCPA 4FC8A 4ILGA 2XEEA 2WXKA 3ML9A 4HOUA 1FT1A 2PQNA 2VSOE 4DUIA 1IKND 5FINA 3RRNB 3TG5A 1PC2A 1NI1A 3NF1A 5T3RA 1MX4A 4KT6B 4J8DA 1TYQG 4HOQA 4HLEA 1IXVA 4BSZB 1TJCA 4IYPA 4LUNU 5D2MC 4YNDA 1MHQA 3D9LA 4GA1A 4Q94A 4LNUD 2X38A 4OYSA 1BPOA
chains in the Genus database with same CATH topology
4N5QA 5EIDA 2NYJA 1TR4A 3TWRA 2DZNA 5JA4D 3KEAA 4U8VD 1SW6A 3F6QA 5ENTD 5BXUA 3W9FA 3Q9NC 5EYPF 4DX7D 2XZTG 4OAVB 2F37A 3EHQA 2B0OE 2ETCA 1N0RA 1K1BA 2AJAA 3JXIA 4U95D 3TWSA 4F1PA 2J8SD 3DEOA 3B95A 4TUMA 5EN5D 5KWDA 3T9KA 4HRNA 5KNHD 5HRYA 4HB5A 1N0QA 1N11A 4BEPA 1BLXB 5HKPA 3NOCD 5ENQD 2F8XK 2JABA 5ENPD 1AP7A 4J7WA 1SVXA 1MYOA 5FIOA 3V31A 5CECB 2BKKB 4F6RD 1MX2A 4U96D 4A63B 4ZHBA 5KBAA 1A5EA 2V5QC 4BERA 4U8YD 2KBXA 3C5RA 3SO8A 2XEHA 2A5EA 1D9SA 4K5AB 1G3NB 4HBDA 1DC2A 2Y1LE 3D9HA 2ETAA 3Q9UC 3TWXA 4G8LA 1BU9A 3UTMA 4NIKA 2F8YA 1NFIE 1DCQA 2XENA 4QFVA 5AQ7A 5CEDB 2VGEA 2QC9A 2P2CP 3EHRA 3V2XA 1YCSB 4CZ2D 5EYLA 2PNNA 3AAAC 1BI7B 4K5BA 5CBNA 2BKGA 3NOGD 2KXPC 4YDYA 2DWZA 1S70B 3AJIA 3V2OA 4CYMD 5ITZF 5AQ9A 1WDYA 2RFMA 4LG6A 4YDWA 2MYOA 1K3ZD 4B93B 3EU9A 1MJ0A 2HE0A 5CEAA 1K1AA 4RLYA 3ZNGA 3ZU7B 2XEEA 3B7BA 4DX2A 4HLLA 4DX1A 5EIBE 4DX6D 4HI9A 4DUIA 1IKND 3HRAA 3V30A 4HRMB 1YMPA 3T8KA 3J5QB 3NBNB 3TWTA 3TWWA 1BI8B 1AWCB 2Y0BG 4HI8A 5EILA 5FINA 4QQIA 3V79K 4GMRA 2ETBA 2XZDG 1YYHA 3JXJA 3LJNA 4ZFHA 5AARA 3W9GA 2L6BA 5BXOA 1UOHA 3TWVA 5JMND 1MX4A 4LSZE 5ENSD 4DX5D 4GPMA 2FO1E 4DRXE 3IXEA 4HNAD 4JB8P 5KNGA 4UUCA 1OY3D 1BD8A 1WG0A 3J5PA 4J8YA 5AAOA 5AN8A 5D66A 4HRLA 4O1OA 3HG0D 2DVWA 3ZKJA 4O1PA 1MX6A 4K5CA 3TWQA 1IXVA 1OT8A 4Z68A 5AQBA 4BSZB 5CBOA 2RFAA 4C48B 5ENRD 2QYJA 3JUEA 4OAUC 4O60A 5ENOD 2ZGGA 2ZGDA 1QYMA 1IHBA 4LNUD 3UI2A 3DEPA 3UXGA 5CERB 2DZOA 5AQAA 3ZUVB 4ATZD 4HQDA 4BESA 3TWUA 2V4HC 4G8KA 4BETA 5HS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N5Q A;  5EID A;  2NYJ A;  1TR4 A;  3TWR A;  2DZN A;  5JA4 D;  3KEA A;  4U8V D;  1SW6 A;  3F6Q A;  5ENT D;  5BXU A;  3W9F A;  3Q9N C;  5EYP F;  4DX7 D;  2XZT G;  4OAV B;  2F37 A;  3EHQ A;  2B0O E;  2ETC A;  1N0R A;  1K1B A;  2AJA A;  3JXI A;  4U95 D;  3TWS A;  4F1P A;  2J8S D;  3DEO A;  3B95 A;  4TUM A;  5EN5 D;  5KWD A;  3T9K A;  4HRN A;  5KNH D;  5HRY A;  4HB5 A;  1N0Q A;  1N11 A;  4BEP A;  1BLX B;  5HKP A;  3NOC D;  5ENQ D;  2F8X K;  2JAB A;  5ENP D;  1AP7 A;  4J7W A;  1SVX A;  1MYO A;  5FIO A;  3V31 A;  5CEC B;  2BKK B;  4F6R D;  1MX2 A;  4U96 D;  4A63 B;  4ZHB A;  5KBA A;  1A5E A;  2V5Q C;  4BER A;  4U8Y D;  2KBX A;  3C5R A;  3SO8 A;  2XEH A;  2A5E A;  1D9S A;  4K5A B;  1G3N B;  4HBD A;  1DC2 A;  2Y1L E;  3D9H A;  2ETA A;  3Q9U C;  3TWX A;  4G8L A;  1BU9 A;  3UTM A;  4NIK A;  2F8Y A;  1NFI E;  1DCQ A;  2XEN A;  4QFV A;  5AQ7 A;  5CED B;  2VGE A;  2QC9 A;  2P2C P;  3EHR A;  3V2X A;  1YCS B;  4CZ2 D;  5EYL A;  2PNN A;  3AAA C;  1BI7 B;  4K5B A;  5CBN A;  2BKG A;  3NOG D;  2KXP C;  4YDY A;  2DWZ A;  1S70 B;  3AJI A;  3V2O A;  4CYM D;  5ITZ F;  5AQ9 A;  1WDY A;  2RFM A;  4LG6 A;  4YDW A;  2MYO A;  1K3Z D;  4B93 B;  3EU9 A;  1MJ0 A;  2HE0 A;  5CEA A;  1K1A A;  4RLY A;  3ZNG A;  3ZU7 B;  2XEE A;  3B7B A;  4DX2 A;  4HLL A;  4DX1 A;  5EIB E;  4DX6 D;  4HI9 A;  4DUI A;  1IKN D;  3HRA A;  3V30 A;  4HRM B;  1YMP A;  3T8K A;  3J5Q B;  3NBN B;  3TWT A;  3TWW A;  1BI8 B;  1AWC B;  2Y0B G;  4HI8 A;  5EIL A;  5FIN A;  4QQI A;  3V79 K;  4GMR A;  2ETB A;  2XZD G;  1YYH A;  3JXJ A;  3LJN A;  4ZFH A;  5AAR A;  3W9G A;  2L6B A;  5BXO A;  1UOH A;  3TWV A;  5JMN D;  1MX4 A;  4LSZ E;  5ENS D;  4DX5 D;  4GPM A;  2FO1 E;  4DRX E;  3IXE A;  4HNA D;  4JB8 P;  5KNG A;  4UUC A;  1OY3 D;  1BD8 A;  1WG0 A;  3J5P A;  4J8Y A;  5AAO A;  5AN8 A;  5D66 A;  4HRL A;  4O1O A;  3HG0 D;  2DVW A;  3ZKJ A;  4O1P A;  1MX6 A;  4K5C A;  3TWQ A;  1IXV A;  1OT8 A;  4Z68 A;  5AQB A;  4BSZ B;  5CBO A;  2RFA A;  4C48 B;  5ENR D;  2QYJ A;  3JUE A;  4OAU C;  4O60 A;  5ENO D;  2ZGG A;  2ZGD A;  1QYM A;  1IHB A;  4LNU D;  3UI2 A;  3DEP A;  3UXG A;  5CER B;  2DZO A;  5AQA A;  3ZUV B;  4ATZ D;  4HQD A;  4BES A;  3TWU A;  2V4H C;  4G8K A;  4BET A;  5HS0 A; 
#chains in the Genus database with same CATH topology
 2IO3 C;  2NYJ A;  1E8Z A;  1SW6 A;  5M72 A;  3SQV A;  2EIJ E;  2LAI A;  3B95 A;  1N4Q A;  2IOS A;  1FPP A;  3FTY A;  1IQU A;  2NC9 A;  3UX4 A;  3SNX A;  3FTV A;  4K5A B;  4MKT A;  4HOS A;  4WUY A;  5CCM A;  3MZL B;  3S7D A;  3AS5 A;  4JA9 A;  1O5M A;  2X6F A;  2FEZ A;  2P9P G;  5EYL A;  3DST A;  4C0M A;  3ZEF A;  5BV1 A;  2RG8 A;  4DK5 A;  2IFU A;  2QY7 A;  3EU9 A;  4XIF A;  3FU3 A;  4KVM A;  4EEC A;  3FEX A;  3SHF A;  1LTX A;  1H19 A;  4TV3 A;  3EU5 A;  4UQY A;  5EX0 A;  2CFU A;  5D0Q D;  2Y0B G;  1EF1 C;  2KM4 A;  1HG2 A;  3DSV A;  2ZU6 B;  4GZ3 A;  2CG2 A;  2J49 A;  1N4S A;  4BY6 A;  3IXE A;  4UUC A;  3CVV A;  1OCZ E;  3RO2 A;  3TGO A;  1ZBP A;  3FUN A;  2HR2 A;  3FU6 A;  4HVB A;  1U3D A;  3ASO E;  3EUV A;  3LDZ A;  1N4P A;  4BSX A;  2V4H C;  2AVP A;  4J8S A;  3ESL A;  2ZIS A;  3FUH A;  4E85 A;  4BTB A;  3Q7A A;  1E7V A;  3AG2 E;  1K1B A;  3L17 A;  4F1P A;  2J8S D;  2QZA A;  3UKU G;  4AJW A;  5FQ8 A;  4U0Z A;  2F8X K;  1WY6 A;  3PZ3 A;  4AOF A;  4KYO B;  5KBA A;  1NP7 A;  3ABM E;  3PS6 A;  4XKC A;  2WXG A;  4PS8 A;  3U66 A;  1D9S A;  2VYI A;  3FUE A;  3ZXS A;  3UM2 A;  1N94 A;  3UTM A;  2FI7 A;  3N71 A;  4NIK A;  1OXJ A;  4D10 C;  4PH4 B;  4U8H A;  3D9K A;  2EIN E;  2RKK A;  2IU1 A;  2L0I A;  3D9O A;  4DPR A;  1Q2Z A;  2I1K A;  4LRZ A;  2WXR A;  3L13 A;  5FZS A;  5ANL A;  1VDY A;  4HI9 A;  4G1T A;  4MBG A;  3C3Q A;  2XEV A;  2M63 A;  3JXJ A;  3OAW A;  5BXO A;  4DJA A;  2WQ7 A;  4GTQ A;  4I2W A;  1QZ2 A;  4OVU A;  1MZC A;  3AG3 E;  4TXQ A;  5CBO A;  2R03 A;  3UIN C;  4M7C A;  1OWL A;  4Y6W A;  4ANV A;  3ENE A;  1QQE A;  2OEW A;  3L54 A;  4HQD A;  2WMN A;  2P9L G;  4CDR A;  5KJL A;  4TRQ A;  4A1G A;  3JQ1 A;  2CHZ A;  3KEA A;  1K8K G;  2F37 A;  4U95 D;  3UPV A;  3FTS A;  2BTD A;  1S64 A;  3LJ3 A;  4EZJ A;  4BT8 A;  3CKC A;  4C0E A;  1YA0 A;  3C3R A;  3RO3 A;  2CFZ A;  5ENP D;  3QNK A;  1SVX A;  1IHG A;  4L2L A;  2BKK B;  3C3O A;  2V5Q C;  3K9I A;  1JCQ A;  3SGH A;  4BTA A;  3SO8 A;  4UWF A;  1D8D A;  3FY4 A;  1BU9 A;  3PNL B;  3CVP A;  2WXM A;  1HU3 A;  2Y4T A;  4QFV A;  4OVV A;  2KCK A;  4N3B A;  3AAA C;  1S70 B;  3QKY A;  3BEE A;  3PUJ A;  3ZNG A;  2PM6 A;  1KLX A;  2R59 A;  3PE3 A;  1OWM A;  2J08 A;  3FTW A;  3LVQ E;  3HRA A;  5A6C A;  4WAF A;  1BI8 B;  1AWC B;  1Z3Y A;  2IEJ A;  3DBS A;  2XZD G;  2YQ8 A;  1YYH A;  1FT2 A;  3NQP A;  3GYZ A;  5ENS D;  3Q75 A;  3CK9 A;  4LSZ E;  4UQZ A;  4KXK B;  4N5C A;  5KNG A;  4J8Y A;  1QNF A;  1L5J A;  3ZIM A;  4EZL A;  4A3V A;  5AQB A;  4ACL A;  4XKB A;  4XX5 A;  3GZ2 A;  4PDX A;  3Q5M A;  1X81 A;  1JPL A;  1QYM A;  3FUM A;  3I5P A;  3UT8 A;  3E33 A;  4FU3 A;  3UQ3 A;  1U3C A;  2H6F A;  3FUI A;  2LNI A;  5JJ7 A;  5CRV A;  2JAB A;  3LY8 A;  2IQC A;  4AY5 A;  1OCO E;  1MX2 A;  1LF8 A;  4U96 D;  4CT0 A;  4Q96 A;  4U8Y D;  3QAR A;  3I4R B;  2A5E A;  2XRZ A;  2OCC E;  2XGM A;  4GCN A;  3EHR A;  4CGW A;  5CBN A;  1WDY A;  2HE0 A;  4H7X A;  3ASH A;  4CT4 A;  1LD8 A;  2MOW A;  3I3N A;  4GZ5 A;  5ANR A;  3VLE A;  3CK7 A;  2LAH A;  2L6B A;  1ELR A;  3TWV A;  4U0S A;  2AXZ A;  1HZ4 A;  5AN8 A;  3PNT B;  4HRL A;  3HHM A;  2P9N G;  3ZYK A;  4GYO A;  2IJG X;  3IEG A;  2GRL A;  5BUZ A;  5AJL A;  3QC1 A;  3FTU A;  3FH8 A;  1NA3 A;  3KSL A;  2YIN A;  4FHK A;  4AP2 A;  4G11 A;  4E6H A;  4GTR A;  1EDU A;  4U8V D;  4C9B B;  5DBK A;  2CG3 A;  4YDO A;  1N0R A;  2AJA A;  2X6I A;  1E96 B;  4TXR A;  3FUF A;  5JJ6 A;  3X2Q E;  4L7T A;  1PAQ A;  4L9P A;  2YHE A;  3HXF A;  4A63 B;  1XNF A;  4BER A;  3NAW A;  3RKV A;  4JEU A;  2LSV A;  4U0U A;  4F3V A;  4HOT A;  1G3N B;  3TG4 A;  3D9H A;  4AM9 A;  3L16 A;  3MA5 A;  3P2B A;  4KVO A;  4FA6 A;  4M3O A;  1E8Y A;  1FVF A;  1NFI E;  2XEN A;  3FWV A;  5AQ7 A;  3FTZ A;  3E30 A;  4DLO A;  4GB9 A;  2BKG A;  2KXP C;  3SFX A;  4YDW A;  4F1S A;  3ULE G;  1RW2 A;  3I4G A;  1K1A A;  3KSQ A;  3QJZ A;  4I1A A;  4G24 A;  5JHA A;  3HXD A;  4DX6 D;  4KBQ A;  3B13 A;  1GW6 A;  1O1R A;  3KD7 A;  3LJN A;  1UOH A;  3ZVV A;  2HO1 A;  1OCR E;  3ESK A;  1TNY A;  4JB8 P;  3J5P A;  1E90 A;  3OXF A;  4GTP A;  2DVW A;  4YVQ C;  4I1O B;  4GTO A;  1RZ4 A;  1O1S A;  3CVU A;  3APC A;  5FTP A;  3B7S A;  2ZGG A;  3ONL A;  1LD7 A;  3S2A A;  3G2W A;  2AW6 A;  4GYW A;  1OCC E;  2R05 A;  2DZN A;  3W9F A;  5BT1 A;  4DX7 D;  2FBN A;  4RG6 A;  1WM5 A;  4HRN A;  4RSY A;  5A23 A;  1MYO A;  4F6R D;  1EYH A;  4U04 A;  3LS8 A;  1N54 A;  2ILR A;  3ISM C;  1FCH A;  4PUC A;  4ANW A;  3MEK A;  5B1A E;  2ETA A;  5BV0 A;  5KJK A;  2GRR B;  2F8Y A;  4IRU A;  2XQ0 A;  1HH8 A;  3Q47 B;  4RVB A;  4KZ0 A;  1X5B A;  2XPY A;  3LEW A;  3MV3 B;  4B93 B;  3WXX A;  2X3M A;  3L22 A;  2WM9 A;  3APD A;  4FJY A;  4HLL A;  5EKQ D;  3PZ4 A;  3ULY A;  4ABN A;  3MKR A;  4JA7 A;  1INZ A;  3RJV A;  3CSF A;  1TEZ A;  4ANU A;  3U4T A;  3C98 A;  4L1B A;  5CRU A;  5KJM A;  2Q7F A;  3SBT B;  1EPU A;  4I6E A;  4N3A A;  1B89 A;  4B8A A;  1D8E A;  2RFA A;  3ZFW A;  3IKO B;  3OXG A;  2J9Q A;  3TWU A;  2V0P A;  4G8K A;  1Z5S C;  4J8F A;  4AY6 A;  4EHM A;  3F6Q A;  4NQ0 A;  4OAV B;  2VQ2 A;  4U07 A;  3DXM G;  4AIF A;  3KAE A;  4B94 A;  1DNP A;  4APO A;  5FZQ A;  4WNE A;  4L2Y A;  2UY1 A;  4G26 A;  3DRA A;  5CEC B;  2WXF A;  3SY2 A;  3ZGQ A;  3PE4 A;  2PM7 A;  3C5R A;  1H6O A;  4JHK A;  1JWF A;  3CHP A;  1HF8 A;  2VSN A;  4BT9 A;  5AYW D;  2JLB A;  2Y4U A;  4I43 A;  1E8W A;  1Z3X A;  4ACK A;  3UKR G;  5AIJ A;  3QWV A;  5A7D B;  4UI9 C;  2VTB B;  4GU5 A;  3Q73 A;  3TXN A;  2AWI A;  4HFG A;  3T8K A;  2R02 A;  3TWW A;  4N2S A;  5JHB A;  2DBA A;  2AXU A;  2HYZ A;  3CVN A;  3CV0 A;  3VTY A;  1IYG A;  2NXP A;  2Y3A A;  3UIP C;  2V5F A;  5C2Y A;  3LCA A;  3SI5 A;  2OEV A;  4G2V A;  4MS6 A;  1IHB A;  2OVB A;  3UXG A;  2IO2 C;  2I9C A;  5CMY A;  1S0P A;  2XPI A;  3PZD A;  1NZN A;  4FHJ A;  3ZYM A;  2UY1 B;  2KAT A;  4GA0 A;  4JHJ A;  4TUM A;  1JUQ A;  1HE8 A;  3CVL A;  5KWD A;  3T9K A;  4FLB A;  2WXO A;  3T5X A;  1AP7 A;  3EIJ A;  3FU5 A;  5EDS A;  2XHE A;  2R2L A;  1TJF A;  4B0Z A;  4CDN A;  1H6K A;  4KMO A;  4LER A;  2EIL E;  3E37 A;  3Q9U C;  2EIK E;  4F7A A;  5D0O D;  3LVR E;  2IF4 A;  4CZ2 D;  3UT4 A;  2GRQ B;  3DSU A;  2DYR E;  3CHS A;  2RD0 A;  5LP0 A;  2WXI A;  3ASF A;  5B1B E;  4GTV A;  3L82 A;  2DYS E;  3NBN B;  3TWT A;  4HI8 A;  3RAU A;  3DXK G;  4GTT A;  4RG9 A;  3IV0 A;  4DX5 D;  2NSZ A;  1OY3 D;  4FLH A;  2VGX A;  4N39 A;  2PL2 A;  5FJY A;  3TWQ A;  1OT8 A;  3Q78 A;  4XEI G;  1H6P A;  2WPV A;  2QYJ A;  4OAU C;  5CMW A;  1TNO A;  1E8X A;  3B7R L;  1H0A A;  1KT1 A;  3AS8 A;  2FUL A;  3Q9N C;  3KS2 A;  3ABL E;  2YNQ A;  3JXI A;  1ELW A;  5EN5 D;  3CEQ A;  2XCC A;  2LXL A;  3AU5 A;  2XGS A;  4I1M A;  5G55 A;  3SBS A;  5HKP A;  4J7W A;  3DSW A;  3PH0 C;  4MRU A;  4ZHB A;  4WNF A;  1A5E A;  4UI9 J;  4ME2 A;  3ML8 A;  3Q49 B;  3QOU A;  3FTX A;  3C72 A;  4N3C A;  2I2O A;  1OWN A;  3HXE A;  2OV8 A;  4GAA A;  1BI7 B;  1TNB A;  4F53 A;  3CVY A;  1N9A A;  3BQO A;  2AXV A;  2VJ8 A;  1XGW A;  3CQG B;  3ZRH A;  1NL4 A;  2OVF A;  4I6G A;  3CLJ A;  4CCA A;  2VGX B;  3NZU A;  5JMN D;  4LEU A;  4B89 A;  1KT0 A;  4GA2 A;  5ENN A;  4O1P A;  3RRM B;  1KZO A;  4J0U A;  3D9N A;  2XS1 A;  3PZ2 A;  2C0L A;  2BED A;  2GRP B;  2CHX A;  3UI2 A;  4RQI A;  3CST A;  4BET A;  1SQM A;  5JA4 D;  3FP3 A;  3RRU A;  1Y8M A;  4A1S A;  4EPZ A;  2GRO B;  4JL0 A;  2J4D A;  2B0O E;  2ETC A;  2WXN A;  4K03 A;  2I6H A;  4B8C B;  3DEO A;  1TN8 A;  3CHQ A;  3UMV A;  3L08 A;  1A17 A;  5ARG A;  3NB2 A;  4WNG A;  4BEP A;  1BLX B;  3PEV B;  4GPK A;  4HXI A;  4V3I A;  3ZN3 A;  2QFC A;  1UN8 A;  4EZK A;  3FHE A;  2WVI A;  1DCE A;  4GTM A;  3OXL A;  4G25 A;  2XGO A;  4WWP A;  2PNN A;  3LKU A;  4NUR A;  2UWJ G;  3GW4 A;  3HXB A;  1OWO A;  4JW1 A;  3MV2 B;  3QWP A;  4PS7 A;  2WXL A;  4H7Y A;  4JZY A;  4QQI A;  1ZU2 A;  4GMR A;  4ZFH A;  4NAC A;  3D3M A;  2E0I A;  3RU0 A;  4YVO A;  4ATG A;  3T5V A;  4HNA D;  3B7T A;  1WG0 A;  5AAO A;  3HG0 D;  4Z68 A;  4XI0 A;  4UI9 K;  2I1J A;  3Q4A B;  1KPS B;  4XZ4 A;  3P1U A;  2B6C A;  4IUL A;  2DZO A;  4I2Z A;  3PZ1 A;  1UJJ A;  3FUJ A;  1IQR A;  2E2E A;  4FJZ A;  4ILI A;  3G2V A;  2A5U A;  1ELK A;  1U2V G;  4HB5 A;  2KCV A;  4U63 A;  3R7Q A;  5LX8 A;  3SF4 A;  3JYS A;  4DI3 A;  4O6F A;  3UM1 A;  3D9J A;  2KBX A;  4AVX A;  1N52 A;  5HQ8 A;  2XS8 A;  3ZYL A;  2BUG A;  3PUK A;  4DLQ A;  4JXT A;  3CHM A;  2QYU A;  4BX8 A;  4XI9 A;  2VGE A;  2P2C P;  2V4L A;  5T8I A;  1YCS B;  3QWW A;  3PDN A;  4LNG A;  2DWZ A;  5ITZ F;  2FO7 A;  4GCO A;  3U3W A;  4GZC A;  2A4Z A;  1K3Z D;  5G04 C;  4JEH A;  5CEA A;  3EJN A;  2LSU A;  4DX1 A;  4MLP A;  4JPS A;  1FVH A;  2L6J A;  1YMP A;  3LXU X;  2WXH A;  2JEK A;  3QB2 A;  5AEN A;  3FEY A;  3MKQ B;  4KZC A;  1HO8 A;  2ETB A;  3OTN A;  2EIM E;  3MCX A;  4J8E A;  4GPM A;  4I9E A;  4U7E B;  2H6H A;  4UWH A;  3ASG A;  3ZKJ A;  4L23 A;  4C48 B;  3VTX A;  5FQ6 A;  1HFA A;  3HDX A;  3RIB A;  4O60 A;  2VTB A;  3S7F A;  2R17 C;  4W9R A;  2OOE A;  5HS0 A;  2GGF A;  4K0R A;  4JD2 G;  5EYP F;  1H2T C;  3L6A A;  4CGV A;  4XE0 A;  4GTS A;  5LCW C;  4WND A;  3LY7 A;  1TN6 A;  1N0Q A;  3NOC D;  3Q15 A;  3U64 A;  3V31 A;  1TN7 A;  4Q69 A;  1HG5 A;  3Q7F A;  5FQ7 A;  2XEH A;  3CGH A;  4FUL A;  3LPZ A;  4WWN A;  3EHN A;  4UWG A;  3SZ7 A;  2YHC A;  3EHM A;  4GYY A;  5J90 A;  3V2X A;  2ZIR A;  3E32 A;  1HXI A;  4K5B A;  1TNZ A;  2PQR A;  5AQ9 A;  2MYO A;  4BX9 A;  5KJN A;  3FUK A;  4RLY A;  4HS2 A;  3B7B A;  3TXM A;  3IHY A;  3FFL A;  3V30 A;  3S7B A;  2WQ6 A;  3U9W A;  4FAD A;  1WAO 1;  5KCM A;  5AAR A;  2ION A;  5IY5 E;  3SFZ A;  3CHR A;  2PZI A;  3UT7 A;  1Z6T A;  2IOL A;  2FO1 E;  2X6K A;  3PRZ A;  1MX6 A;  4TXP A;  2GRM A;  3DSS A;  2FF4 A;  2L0T B;  5ENR D;  3JUE A;  2F0Y A;  3DEP A;  3MX3 A;  3FU0 A;  2GRN B;  4ATZ D;  4A55 A;  1TR4 A;  5H7P A;  3TWR A;  1QBQ A;  3QK0 A;  5EX3 A;  4IN3 B;  1H2V C;  4AXH A;  3TWS A;  1MQS A;  2P9I G;  2LXM A;  3CKB A;  2IY0 C;  3EIQ C;  5AJD A;  2MHK A;  3ZPJ A;  3GZ1 A;  2R5S A;  4AV7 A;  2C2L A;  3HYM B;  5FQ4 A;  4UWK A;  3AS4 A;  5LOZ A;  4N2Q A;  5G04 J;  1JWG A;  4JVS A;  3ZHE A;  3D9M A;  2H6I A;  1JCS A;  4GZ6 A;  5BW8 C;  4G8L A;  3UUX A;  2MRI A;  3ABK E;  5BNW A;  5BPP A;  5E75 A;  1V54 E;  5J08 A;  4GML A;  3FH5 A;  2LO6 A;  3NOG D;  3AJI A;  2RFM A;  2X6H A;  2WXJ A;  5B3S E;  2L9B A;  2DIW A;  3HIZ A;  3GZS A;  3B7U X;  1JCR A;  2WQH A;  4BFR A;  1UW4 B;  3QDN A;  3W9G A;  1Y6I A;  3IHV A;  1HX8 A;  3JUI A;  1P5Q A;  2WXP A;  3VLD A;  2KZT A;  2VGY A;  5D66 A;  1O1T A;  4O1O A;  3HXC A;  2XPZ A;  3JCK C;  5DIZ A;  3O48 A;  1UN9 A;  1NA0 A;  4URK A;  1TNU A;  5LCW J;  5ENO D;  5CER B;  2CHW A;  3TL5 A;  3FDH A;  3D9P A;  5G05 C;  2LUH A;  2H6G A;  4I17 A;  2WMO A;  5BXU A;  5C1D A;  1HS6 A;  3CVW A;  2KC7 A;  2XZT G;  3PVL A;  4LCT A;  4EBA A;  4UWL A;  4EBA G;  3Q79 A;  1OWP A;  1SZA A;  1V55 E;  3KEZ A;  4P29 A;  1N95 A;  3E4B A;  4FP7 A;  2OND A;  3SFY A;  3ZHE B;  4JC8 A;  3RK6 A;  5ARF A;  3G2S A;  3HVE A;  4CEM A;  3DSX A;  3FUD A;  4TUU A;  3TWX A;  1W3B A;  2EQX A;  1DCQ A;  3EDT B;  4PS3 A;  5CED B;  3ZXP A;  5G2N A;  3V2O A;  3AG4 E;  3G2T A;  4DI4 A;  2WXQ A;  3L9T A;  1UJK A;  3ZU7 B;  3FH7 A;  4Y6C A;  2XCB A;  4HRM B;  4I6J A;  3J5Q B;  3APF A;  3V79 K;  2KZT B;  4NRH B;  4A3T A;  3BUA A;  3G2U A;  4APF A;  1PY1 A;  1BD8 A;  5FT9 A;  2GW1 A;  3TAX A;  3DPY A;  4WWO A;  5LFA A;  3IBE A;  3MJW A;  3ASN E;  1S63 A;  4AEZ C;  3FUL A;  5AQA A;  3E34 A;  3ZUV B;  4BES A;  1N4R A;  4N5Q A;  3CIA A;  5EID A;  4I9C A;  3PRE A;  5ENT D;  3URZ A;  3EHQ A;  2VSX E;  3CQC B;  2J09 A;  4ANX A;  4GMJ A;  3HVE B;  3QAQ A;  3O4Z A;  1N11 A;  3ULQ A;  4X8Q A;  3BG0 B;  5ENQ D;  1KZP A;  5CCL A;  1SA4 A;  4JHR A;  3BG1 B;  1DVP A;  1DC2 A;  3ZYQ A;  3CHO A;  2QC9 A;  3ZW3 A;  4GZD A;  4YDY A;  4CYM D;  2Y69 E;  3MGB A;  5HI7 A;  4ILH B;  4DX2 A;  3ASD A;  5EIB E;  3D9I A;  4CDM A;  2ZXW E;  2P58 C;  3MYV A;  5EIL A;  3AU4 A;  3WG7 E;  3AG1 E;  2C0M A;  5FWQ A;  2VSY A;  5G05 J;  2P9K G;  4G23 A;  4DRX E;  1H2U A;  3JQ0 A;  3R7R A;  4YDE A;  4CRW A;  4K5C A;  3UIO C;  4UQX A;  2J4B A;  3DPD A;  3LY9 A;  5FZR A;  2ZGD A;  3CR3 A;  2P9U G;  3RSE G;  3S7J A;  3CVX A;  5CHE E;  3CVQ A;  4EQF A;  3BU8 A;  3SD5 A;  3MKQ A;  2WB2 A;  4HOR A;  1E7U A;  1SA5 A;  1ZB1 A;  2BF0 X;  3ONK A;  2HM8 A;  3PEU B;  5KNH D;  2J07 A;  5HRY A;  3TJP A;  4BWR A;  3LYA A;  5FIO A;  2XRY A;  1UG3 A;  3UM0 A;  3VLF A;  3R9M A;  3T8M A;  4LNB A;  4HBD A;  2Y1L E;  4R7L A;  2KCL A;  5JJT A;  3DWL G;  5T4Y A;  2P9S G;  4J6I A;  3CK8 A;  2V8S E;  3R9A B;  1OUV A;  2X6J A;  3NZS A;  3UM3 A;  4LG6 A;  1SZ9 A;  1MJ0 A;  5E76 A;  2DCP A;  4FC8 A;  4ILG A;  2XEE A;  2WXK A;  3ML9 A;  4HOU A;  1FT1 A;  2PQN A;  2VSO E;  4DUI A;  1IKN D;  5FIN A;  3RRN B;  3TG5 A;  1PC2 A;  1NI1 A;  3NF1 A;  5T3R A;  1MX4 A;  4KT6 B;  4J8D A;  1TYQ G;  4HOQ A;  4HLE A;  1IXV A;  4BSZ B;  1TJC A;  4IYP A;  4LUN U;  5D2M C;  4YND A;  1MHQ A;  3D9L A;  4GA1 A;  4Q94 A;  4LNU D;  2X38 A;  4OYS A;  1BPO A; 
#chains in the Genus database with same CATH homology
 4N5Q A;  5EID A;  2NYJ A;  1TR4 A;  3TWR A;  2DZN A;  5JA4 D;  3KEA A;  4U8V D;  1SW6 A;  3F6Q A;  5ENT D;  5BXU A;  3W9F A;  3Q9N C;  5EYP F;  4DX7 D;  2XZT G;  4OAV B;  2F37 A;  3EHQ A;  2B0O E;  2ETC A;  1N0R A;  1K1B A;  2AJA A;  3JXI A;  4U95 D;  3TWS A;  4F1P A;  2J8S D;  3DEO A;  3B95 A;  4TUM A;  5EN5 D;  5KWD A;  3T9K A;  4HRN A;  5KNH D;  5HRY A;  4HB5 A;  1N0Q A;  1N11 A;  4BEP A;  1BLX B;  5HKP A;  3NOC D;  5ENQ D;  2F8X K;  2JAB A;  5ENP D;  1AP7 A;  4J7W A;  1SVX A;  1MYO A;  5FIO A;  3V31 A;  5CEC B;  2BKK B;  4F6R D;  1MX2 A;  4U96 D;  4A63 B;  4ZHB A;  5KBA A;  1A5E A;  2V5Q C;  4BER A;  4U8Y D;  2KBX A;  3C5R A;  3SO8 A;  2XEH A;  2A5E A;  1D9S A;  4K5A B;  1G3N B;  4HBD A;  1DC2 A;  2Y1L E;  3D9H A;  2ETA A;  3Q9U C;  3TWX A;  4G8L A;  1BU9 A;  3UTM A;  4NIK A;  2F8Y A;  1NFI E;  1DCQ A;  2XEN A;  4QFV A;  5AQ7 A;  5CED B;  2VGE A;  2QC9 A;  2P2C P;  3EHR A;  3V2X A;  1YCS B;  4CZ2 D;  5EYL A;  2PNN A;  3AAA C;  1BI7 B;  4K5B A;  5CBN A;  2BKG A;  3NOG D;  2KXP C;  4YDY A;  2DWZ A;  1S70 B;  3AJI A;  3V2O A;  4CYM D;  5ITZ F;  5AQ9 A;  1WDY A;  2RFM A;  4LG6 A;  4YDW A;  2MYO A;  1K3Z D;  4B93 B;  3EU9 A;  1MJ0 A;  2HE0 A;  5CEA A;  1K1A A;  4RLY A;  3ZNG A;  3ZU7 B;  2XEE A;  3B7B A;  4DX2 A;  4HLL A;  4DX1 A;  5EIB E;  4DX6 D;  4HI9 A;  4DUI A;  1IKN D;  3HRA A;  3V30 A;  4HRM B;  1YMP A;  3T8K A;  3J5Q B;  3NBN B;  3TWT A;  3TWW A;  1BI8 B;  1AWC B;  2Y0B G;  4HI8 A;  5EIL A;  5FIN A;  4QQI A;  3V79 K;  4GMR A;  2ETB A;  2XZD G;  1YYH A;  3JXJ A;  3LJN A;  4ZFH A;  5AAR A;  3W9G A;  2L6B A;  5BXO A;  1UOH A;  3TWV A;  5JMN D;  1MX4 A;  4LSZ E;  5ENS D;  4DX5 D;  4GPM A;  2FO1 E;  4DRX E;  3IXE A;  4HNA D;  4JB8 P;  5KNG A;  4UUC A;  1OY3 D;  1BD8 A;  1WG0 A;  3J5P A;  4J8Y A;  5AAO A;  5AN8 A;  5D66 A;  4HRL A;  4O1O A;  3HG0 D;  2DVW A;  3ZKJ A;  4O1P A;  1MX6 A;  4K5C A;  3TWQ A;  1IXV A;  1OT8 A;  4Z68 A;  5AQB A;  4BSZ B;  5CBO A;  2RFA A;  4C48 B;  5ENR D;  2QYJ A;  3JUE A;  4OAU C;  4O60 A;  5ENO D;  2ZGG A;  2ZGD A;  1QYM A;  1IHB A;  4LNU D;  3UI2 A;  3DEP A;  3UXG A;  5CER B;  2DZO A;  5AQA A;  3ZUV B;  4ATZ D;  4HQD A;  4BES A;  3TWU A;  2V4H C;  4G8K A;  4BET A;  5HS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...