3I4RB

Nup107(aa658-925)/nup133(aa517-1156) complex, h.sapiens
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
639
structure length
528
Chain Sequence
KIKLLKAAFLQYCRKDLGHAQMVVDELFSSHSDLDSDSELDRAVTQISVDLMDDYPASIILHQLEDKMKAHSFLMDFIHQVGLFGRLGSFPVRLLLCEHAEKLSAAIVLKNHHSRLSDLVNTAILIALNKREYEIPSNLTPADVFFREVSQVDTICECLLEHEEQVLRDSIEWAEVVINVNNILKDMLQAASHYRQNRRTVIIRQHEIVLKVAYPQADSNLRNIVTEQLVALIDCFLDGYVSQLKSVDKSSNRERYDNLEMEYLQKRSDLLSPLLSLGQYLWAASLAEKYCDFDILVQMCEQTDNQSRLQRYMTQFADQNFSDFLFRWYLEQHGQLANFLQAHEHLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDININDLKLEILCKALQRDNWVSKDSIFVKILLPEVKDLLQADEFVLKANYEYYVQGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Nuclear pore complex protein Nup107
publication title Architectural nucleoporins Nup157/170 and Nup133 are structurally related and descend from a second ancestral element.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 528
sequence length 639
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03177 Nucleoporin_C Non-repetitive/WGA-negative nucleoporin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.700 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3i4rB00
3CQGB 3CQCB 3I4RB
chains in the Genus database with same CATH superfamily
2NYJA 3CVYA 4NQ0A 4CDRA 3HXBA 3LY9A 3WXXA 3ENEA 3MGBA 2B0OE 4U95D 3O48A 1K3ZD 4C0MA 2RFAA 2PQRA 4A1GA 3AU5A 2OVBA 2WXLA 3TGOA 3CVQA 2KCKA 4DJAA 2IFUA 3AS8A 2HYZA 1MHQA 2A4ZA 3FFLA 4GMJA 5A23A 3L82A 1IQRA 2F8YA 3ABLE 4TRQA 5BV1A 4FADA 4L2LA 2J09A 4U07A 4G8LA 4GMLA 2LSUA 2IOLA 5ENOD 2H6FA 3WG7E 4Q69A 3EDTB 4JZYA 1LD8A 2X6FA 2H6GA 2E2EA 4AY6A 4GYWA 4CRWA 3GZSA 1WAO1 3BU8A 1BLXB 3C5RA 4JD2G 3Q75A 3TAXA 4BX8A 3TG5A 2IONA 1SW6A 4O1PA 3DXMG 4KMOA 3OXLA 3SBTB 4FJYA 2L6JA 4L1BA 2WXMA 2A5EA 3V31A 2BUGA 2ETBA 4N3BA 2HM8A 1WG0A 3UM2A 4BEPA 1TR4A 5EIBE 2LXMA 5G2NA 3FP3A 4L23A 2IO2C 5BXOA 4ILHB 2QC9A 2MRIA 2UWJG 3B7RL 2X6IA 4O6FA 5ENTD 4IYPA 3RSEG 4JL0A 3CK9A 4XKCA 5ANRA 3UXGA 2P9SG 2WMOA 3BUAA 4UWFA 1O1TA 4U8HA 2R59A 2WXGA 2UY1B 4I1AA 4J7WA 5ENPD 3NBNB 3P2BA 4GTSA 3TWUA 4HOTA 3FUIA 5HS0A 1TN8A 1Z3YA 4LNUD 2L0IA 3MV2B 4U04A 4I2ZA 3CLJA 3D9MA 4GTOA 4AP2A 4CCAA 1E7VA 3QKYA 1X5BA 1A17A 2KATA 3ZHEB 3IHVA 2MOWA 4TUUA 4YDEA 4YVOA 3UIPC 1ZBPA 2FULA 4X8QA 3HYMB 5G05C 1KT0A 3ULQA 3W9FA 4TV3A 5JJ7A 5T4YA 2P9PG 3AG1E 2A5UA 4CGWA 3PZ2A 1EYHA 1OCCE 4OAVB 2KC7A 3R7QA 2FO7A 3QWWA 1MJ0A 2AXZA 2VSYA 1TJCA 3EUVA 1E8XA 3PZDA 3MKRA 4A3VA 3CSFA 4FHJA 5M72A 2Y3AA 4HNAD 1NL4A 2H6HA 4U8YD 5AYWD 1B89A 3UIOC 4J8FA 3DPDA 3R9MA 3PREA 3ZXPA 3OXGA 3MYVA 4EBAG 3ML9A 2CG2A 2XPIA 3LJ3A 2KCLA 2V4LA 3HIZA 3APDA 4EZJA 3FH8A 2WM9A 1E8YA 5EYLA 5BNWA 3CHQA 4DX6D 2X6JA 4RG6A 2V5QC 4G26A 4BT9A 1XGWA 5ENNA 5FINA 1OT8A 1FVFA 5FWQA 4DLQA 4UI9J 5AAOA 3U9WA 4EZKA 3ZRHA 4DI3A 4DUIA 3U4TA 3CVNA 5G55A 3Q47B 1OWOA 3FUJA 1QBQA 3ZYLA 4BY6A 3PRZA 4DI4A 5FZSA 5AARA 3ONKA 3KSLA 3ULEG 1TNZA 2GRMA 1UJJA 1PAQA 4BSZB 2J8SD 1NFIE 2NC9A 2J4DA 4E85A 5AJLA 3NB2A 4J8DA 1IQUA 2IJGX 1MYOA 2R5SA 3RIBA 2RD0A 2WXRA 3ZIMA 5LCWJ 4OAUC 4JC8A 3T8KA 4RLYA 3Q7AA 3D9JA 3V2OA 3KD7A 4GB9A 4B89A 4K5CA 4RVBA 5AENA 4UQXA 4RQIA 3QAQA 4HLLA 4AOFA 4BETA 3LKUA 2WXQA 1QNFA 3PDNA 2P9NG 3QK0A 4WWPA 2BKGA 3ZPJA 3NF1A 3ZFWA 2I6HA 3MJWA 3CKCA 5FJYA 1VDYA 3CVXA 3LJNA 5EILA 1V55E 3ZUVB 3L6AA 3FUNA 2FF4A 3OAWA 2L6BA 5A6CA 1Z6TA 4OYSA 3DSWA 4ILIA 3FUDA 3PZ3A 3HG0D 3NOGD 4EPZA 1WM5A 3D9IA 4FULA 3FY4A 3ONLA 2FI7A 3L22A 3O4ZA 1O1SA 1IKND 5CCLA 2BKKB 5EIDA 4PS7A 3I4GA 1FVHA 1WY6A 2BF0X 1S63A 2F37A 3APFA 3FUMA 1DNPA 1MX4A 1BI8B 2BTDA 3FEXA 2Y4UA 4CEMA 2Y0BG 1SA5A 3FUFA 2VGXB 1OY3D 2DYSE 2LAIA 3SHFA 5FIOA 2GRRB 3ESKA 4FU3A 2E0IA 1HG5A 4HI9A 3UT4A 5FZRA 3TXNA 2XRYA 5EKQD 1RZ4A 4HRNA 3PEUB 1N9AA 4AEZC 5JMND 2XZTG 2F8XK 5DIZA 5ITZF 2P9UG 3DSUA 3IBEA 2R17C 4GTPA 1K1BA 3PH0C 3FULA 3PNLB 1UN9A 3Q73A 2DCPA 5EN5D 2L9BA 3E34A 3EU5A 3AG2E 4UUCA 4GMRA 5AJDA 5AQBA 3ZW3A 4Y6CA 3DXKG 4J8SA 5D2MC 3C72A 4GYYA 5JJTA 4PDXA 3DWLG 1D8DA 4GTRA 3AS4A 2CG3A 2P9LG 3RRUA 3SF4A 4EBAA 3DSSA 1ELKA 4KZ0A 1Y6IA 1Y8MA 4HOSA 4TXPA 5FQ7A 1BU9A 3VLEA 4U0SA 2ONDA 3J5QB 4D10C 4G1TA 1OWLA 1N4QA 3Q5MA 1TN7A 3Q79A 1N54A 4JW1A 4CT4A 3MKQA 5AQAA 3UM0A 1IHGA 5BT1A 3KEZA 4YNDA 2H6IA 4UI9C 4C9BB 1LTXA 5KWDA 4JVSA 4GCOA 3HXCA 3QARA 3ZKJA 3VTXA 4I6EA 3ASOE 1AP7A 3ASGA 3PUKA 2OEVA 2VYIA 1S64A 4OVVA 4GPMA 2P2CP 3UM1A 4U63A 1N0RA 5CRUA 5CCMA 3B7UX 3PNTB 2WXKA 1A5EA 3UI2A 4KBQA 1N52A 3I4RB 3PVLA 1BPOA 4U0UA 3SQVA 2EINE 3CR3A 4AXHA 3TWRA 5C1DA 4PH4B 3ZU7B 2AXVA 4ANUA 2ZISA 3PE4A 4CGVA 1TJFA 3TXMA 3PZ1A 3FWVA 3I3NA 2HE0A 4I17A 2WMNA 4KZCA 4ANVA 2XS8A 2WQ7A 2KM4A 3V2XA 4BSXA 2XCBA 3S7BA 2DIWA 1FPPA 2EIKE 4FHKA 1OWNA 2XGSA 3CQGB 2MYOA 4YVQC 2XEEA 1MZCA 3C98A 2WVIA 3Q9UC 3JYSA 1SVXA 1K8KG 5DBKA 2Y4TA 1YCSB 2V4HC 4MS6A 4Q96A 1H6OA 1H2TC 2DZNA 4BWRA 2YINA 3SFXA 3NAWA 1GW6A 5FZQA 1OCOE 2OOEA 2RKKA 4ANWA 4TXQA 2VTBB 2ETAA 3ML8A 2HR2A 4IN3B 3MEKA 5D0QD 2LXLA 4HRLA 3APCA 2CHZA 1YYHA 2I9CA 2M63A 5G04J 5HRYA 1E8ZA 4APFA 4G25A 3HVEA 3EHRA 4I1MA 1OCZE 2ZXWE 3KS2A 2J07A 1JCSA 4H7XA 3CVVA 4I9EA 3CIAA 2L0TB 4I1OB 3C3OA 3CKBA 3IV0A 1N4SA 2FBNA 3QOUA 1H2VC 5JA4D 4EHMA 5LFAA 4MKTA 5CBNA 4BX9A 2GRPB 3Q4AB 2VSXE 3TWXA 4A3TA 4H7YA 3L08A 4GZ6A 1LF8A 3KSQA 1N11A 3P1UA 5KBAA 3QDNA 3RRNB 4JA9A 4GZDA 3LEWA 2V0PA 4HB5A 4FP7A 1JUQA 1E96B 4AIFA 2VGEA 2NSZA 3HRAA 2IEJA 2VJ8A 3T5VA 1JCQA 2MHKA 3AU4A 4GZCA 4GA0A 3RO3A 3ASFA 3ZVVA 4L7TA 2PZIA 5E75A 3QJZA 1LD7A 3G2TA 1OWMA 3FHEA 5T8IA 4NURA 2IQCA 4GZ3A 3HXFA 1ELWA 1TEZA 2GROB 2ILRA 5D66A 4UQYA 3FTZA 4WNDA 4F1PA 1HX8A 2WXJA 3AAAC 3URZA 1QYMA 1L5JA 1NA0A 4HQDA 4GYOA 3CSTA 1W3BA 2KZTB 1FCHA 3DSXA 1N0QA 4R7LA 4WAFA 1OCRE 4HBDA 5ENRD 1SA4A 1IXVA 3EIQC 3E33A 3LS8A 3TG4A 2XCCA 4Y6WA 3R9AB 2X3MA 4KYOB 2GRNB 1BI7B 3W9GA 1HS6A 4LRZA 3DEOA 3E30A 3CV0A 3RU0A 5LP0A 2RG8A 1OXJA 3IKOB 4BERA 2LUHA 4AV7A 2WXOA 2EIJE 1DCEA 1PY1A 4HOUA 1UW4B 4B93B 3IXEA 3DBSA 4HXIA 5J90A 4GCNA 4BTBA 2CFZA 2I1JA 5B1BE 2ZGDA 3B7TA 4AY5A 4B94A 4N5QA 1AWCB 3TWSA 3LY8A 3L9TA 2XGOA 4HS2A 4JHKA 5A7DB 3UT8A 3FUEA 1N94A 1K1AA 3SFYA 2UY1A 2KCVA 1HG2A 3SFZA 4CDMA 2P9IG 3GZ2A 4MLPA 3LCAA 4WNFA 2JABA 4N2QA 3PZ4A 2I1KA 4DX1A 3I5PA 3DRAA 1INZA 2GRQB 3FH7A 3CVWA 3AS5A 2KXPC 4ACLA 2ZGGA 2CFUA 3RO2A 3Q49B 3ZYMA 1MX2A 1E7UA 4V3IA 5CERB 1TN6A 4XI9A 3S2AA 1TYQG 3D3MA 1HXIA 3ZHEA 3BQOA 3CHMA 1U2VG 4URKA 4BT8A 3SY2A 3FH5A 2BEDA 1U3CA 4JEHA 4WNGA 3SBSA 4J6IA 4RSYA 3UUXA 2I2OA 4F3VA 1H6PA 2QZAA 1QQEA 2IF4A 2Y69E 1KLXA 1HFAA 4M7CA 4FJZA 4ATGA 1ZB1A 4FA6A 2X38A 3V79K 3MZLB 2OVFA 3PEVB 2OV8A 4XKBA 3SO8A 1HF8A 1NZNA 1QZ2A 1H19A 4I6JA 1KT1A 3BEEA 1KPSB 1EF1C 4HOQA 5G04C 1O1RA 2AVPA 2VSNA 2DBAA 1UG3A 4LNGA 4N3CA 3D9NA 5ANLA 4TUMA 2WXIA 4ANXA 4GTQA 2X6HA 3Q15A 3B7BA 3UINC 2VSOE 4PS3A 3D9PA 3CHOA 4GZ5A 3RAUA 3K9IA 2YQ8A 3JQ1A 3ASDA 4EECA 4CDNA 4AVXA 4P29A 4UWKA 2V5FA 4DRXE 4FLBA 4XX5A 4J8EA 2WXHA 1NA3A 3D9HA 4L2YA 3FDHA 5CRVA 2PNNA 4C0EA 2XENA 3TL5A 1OWPA 5CEDB 2VQ2A 2X6KA 5FQ8A 1S0PA 1DCQA 4NACA 2GRLA 3QWPA 1HU3A 3EJNA 5IY5E 2IOSA 4ABNA 4F7AA 3FTUA 4YDWA 2WXPA 3JUIA 1TNBA 2PM6A 1S70B 2CHXA 1YA0A 1KZOA 5EYPF 3AJIA 3E37A 2QYUA 3GZ1A 3AG3E 2IO3C 3S7DA 4DX7D 4ME2A 4JPSA 1FT1A 5JHBA 3NOCD 1EPUA 4K5AB 5JHAA 1RW2A 4YDYA 4F1SA 4J8YA 3D9LA 3SI5A 4ACKA 2JLBA 4K03A 1FT2A 3ESLA 2R2LA 4A63B 4FLHA 3CVUA 1N4PA 2OCCE 3FTXA 2DYRE 1WDYA 2P58C 2FEZA 2WPVA 4I9CA 3RKVA 3UKRG 2EQXA 1E90A 3FU0A 3FU5A 3D9OA 2C0MA 4LERA 4XIFA 3TJPA 3LY7A 3HDXA 5LCWC 2FO1E 3L16A 4TXRA 1YMPA 4EZLA 4IULA 2NXPA 3QWVA 4F53A 3ULYA 4J0UA 2PL2A 3JXJA 3CK7A 1Z5SC 2WB2A 3N71A 5EDSA 3GW4A 4HRMB 2CHWA 5AQ9A 4B0ZA 3T5XA 4JA7A 4O60A 3SZ7A 4JEUA 3D9KA 1HH8A 1UOHA 5B1AE 3J5PA 3SD5A 3JXIA 5KCMA 2YNQA 5B3SE 1NP7A 3ZNGA 5KJNA 2J49A 2LAHA 5ARFA 2HO1A 3QNKA 1EDUA 3F6QA 5EX0A 5E76A 3IEGA 2VGXA 3G2UA 4K0RA 1HO8A 2XS1A 4CT0A 5KNHD 3PE3A 1SZ9A 4GU5A 3TWWA 2OEWA 5T3RA 3HXEA 2WXNA 5BUZA 2F0YA 2QY7A 5CECB 3SNXA 2GW1A 4XEIG 4BFRA 2J9QA 4I43A 2VGYA 3C3RA 5CEAA 2IY0C 2WQHA 3TWVA 3VTYA 2DZOA 1P5QA 3ISMC 4U7EB 3E4BA 2XRZA 3ASNE 3CVLA 2AW6A 3MV3B 3Q7FA 4I2WA 1N4RA 5KJLA 4KVOA 4A1SA 2YHEA 4WNEA 3QC1A 3L13A 4KT6B 1N95A 2KBXA 3NZSA 5HQ8A 3LVRE 4HORA 2P9KG 1DC2A 2J4BA 2XHEA 3UTMA 3IHYA 3V30A 3T9KA 1JWGA 3LXUX 4LCTA 2ETCA 3QB2A 3B13A 3UX4A 4UI9K 4WUYA 5BV0A 1JPLA 4JXTA 3G2VA 2R02A 1UJKA 4NRHB 4K5BA 5ENSD 4YDOA 5HI7A 2PQNA 3LDZA 4E6HA 4JHRA 1JCRA 4LSZE 2XPZA 5BW8C 4GAAA 4RG9A 4XI0A 4GTVA 3KEAA 5LOZA 1E8WA 4CYMD 4C48B 1TNYA 3FUKA 1H0AA 4AM9A 3S7JA 5CBOA 3S7FA 3ZN3A 3CHSA 3CHRA 4CZ2D 2Y1LE 3FEYA 4HVBA 4G8KA 3CHPA 3U66A 3ZXSA 3B95A 3B7SA 3SGHA 5CMYA 1KZPA 4B8AA 5FT9A 2GGFA 3NZUA 3VLFA 2AWIA 4G2VA 4W9RA 2XQ0A 3X2QE 3UM3A 3CQCB 3GYZA 2QYJA 4GTMA 2DVWA 5FQ4A 4I6GA 5HKPA 3DSVA 4DX2A 3ZGQA 3UQ3A 4UWLA 3R7RA 1HE8A 5D0OD 3ASHA 4QFVA 1V54E 4FC8A 2JEKA 1D9SA 1SQMA 1TNOA 3DPYA 4UWGA 4KVMA 4KXKB 4GPKA 4N39A 4BTAA 5EX3A 4QQIA 3FU6A 4BESA 3ZYQA 4G23A 3U3WA 4U8VD 5H7PA 4HLEA 2V8SE 1UN8A 3G2SA 3FTVA 3UT7A 1MQSA 2XGMA 1Z3XA 3MKQB 1NI1A 1H6KA 4G11A 1TNUA 3U64A 3BG0B 3UKUG 3C3QA 4L9PA 3PS6A 4LUNU 4WWNA 1PC2A 5CMWA 4DK5A 3RK6A 3LVQE 2XZDG 1DVPA 2DWZA 4M3OA 3BG1B 5FQ6A 4DX5D 5FTPA 4ATZD 2LSVA 3JQ0A 2J08A 5ENQD 3MX3A 3UPVA 2VTBA 4N5CA 4PS8A 4Q94A 1ZU2A 5BPPA 3LYAA 3FUHA 3ZEFA 2XPYA 1H2UA 3CVPA 3L54A 4EQFA 4ZFHA 4ZHBA 1BD8A 2XEVA 4IRUA 4AJWA 3VLDA 2ZU6B 4DLOA 4LG6A 4UWHA 3ABME 2QFCA 3EHNA 5AIJA 1OUVA 4GTTA 3DSTA 5G05J 3DEPA 2R03A 2B6CA 3OTNA 4LEUA 2LNIA 3RJVA 2LO6A 4ILGA 4G24A 5BXUA 3CK8A 4APOA 3CEQA 4HFGA 5KJKA 3JUEA 2XEHA 3NQPA 2YHCA 5KJMA 4Z68A 4LNBA 4GA1A 3EIJA 4A55A 2C2LA 2WQ6A 3OXFA 2IU1A 4OVUA 4NIKA 1ELRA 4JHJA 3E32A 3PUJA 4GA2A 4XE0A 3HVEB 1XNFA 4HI8A 5AN8A 3EHQA 3FTSA 1U3DA 3MA5A 1IHBA 2ZIRA 4DPRA 3FU3A 3EU9A 1IYGA 5ARGA 1D8EA 4PUCA 3ABKE 2Q7FA 3AG4E 2EIME 1Q2ZA 4O1OA 5JJ6A 5C2YA 3TWTA 2RFMA 5LX8A 3Q9NC 3TWQA 1SZAA 3HXDA 3CGHA 3FTYA 5J08A 3LPZA 4N3AA 4JB8P 4B8CB 2PM7A 1HZ4A 4U96D 5CHEE 3Q78A 2EILE 5KNGA 3ZYKA 2KZTA 3RRMB 3G2WA 4MBGA 3HHMA 1G3NB 3T8MA 4XZ4A 3EHMA 5AQ7A 3KAEA 1O5MA 3FTWA 3L17A 2AJAA 4N2SA 1X81A 4U0ZA 4WWOA 2C0LA 4UQZA 1JWFA 3UMVA 2R05A 2WXFA 3MCXA 4MRUA 1MX6A 4F6RD 2AXUA 3JCKC
chains in the Genus database with same CATH topology
3CVYA 5EX0A 4NQ0A 5E76A 1L5JA 4CDRA 1NA0A 3LY9A 3IEGA 3O4ZA 3WXXA 2VGXA 3G2UA 4K0RA 1HO8A 3ENEA 3MGBA 4GYOA 5CCLA 4CT0A 3CSTA 1W3BA 2KZTB 1FCHA 3PE3A 3O48A 1SZ9A 4GU5A 5T3RA 4R7LA 4WAFA 4C0MA 2WXNA 2PQRA 4A1GA 5BUZA 4PS7A 2QY7A 3AU5A 3EIQC 3I4GA 1FVHA 3LS8A 3TG4A 2OVBA 3SNXA 1WY6A 2BF0X 2GW1A 2XCCA 4Y6WA 3R9AB 2WXLA 3TGOA 3CVQA 2X3MA 3APFA 4BFRA 3FUMA 1DNPA 2KCKA 4DJAA 2IFUA 3AS8A 2HYZA 2J9QA 4I43A 4KYOB 2VGYA 2BTDA 3FEXA 1MHQA 2A4ZA 2WQHA 2Y4UA 3FFLA 4GMJA 1HS6A 4CEMA 4LRZA 3VTYA 3FUFA 2VGXB 5A23A 1IQRA 2LAIA 3SHFA 3CV0A 4TRQA 1P5QA 3RU0A 5BV1A 4FADA 4L2LA 5LP0A 2J09A 4U07A 4GMLA 2LSUA 2RG8A 2IOLA 3E4BA 3ESKA 4FU3A 2XRZA 2E0IA 1HG5A 4Q69A 3CVLA 2AW6A 3EDTB 3MV3B 4JZYA 4I2WA 3UT4A 5FZRA 3TXNA 5KJLA 2X6FA 3IKOB 4KVOA 2XRYA 5EKQD 4AV7A 4A1SA 2YHEA 2E2EA 4WNEA 2WXOA 3QC1A 3L13A 4HOUA 1PY1A 4KT6B 1UW4B 3PEUB 4AEZC 4GYWA 4AY6A 4CRWA 3DBSA 3NZSA 3GZSA 4HXIA 1WAO1 5HQ8A 3LVRE 4HORA 5DIZA 2J4BA 2XHEA 5J90A 3IHYA 4GCNA 4BTBA 3TAXA 2CFZA 1JWGA 2I1JA 3LXUX 4BX8A 3TG5A 4LCTA 3QB2A 2IONA 3B13A 3B7TA 4AY5A 3UX4A 4UI9K 4WUYA 4KMOA 5BV0A 1JPLA 3IBEA 3OXLA 2R17C 4JXTA 3G2VA 1UJKA 3SBTB 4B94A 4FJYA 4NRHB 3PH0C 2L6JA 4L1BA 2WXMA 3FULA 3PNLB 5HI7A 2PQNA 1UN9A 3LY8A 4HS2A 2XGOA 3LDZA 4E6HA 4JHRA 4JHKA 2DCPA 5A7DB 3UT8A 2BUGA 2L9BA 2XPZA 3FUEA 5BW8C 4N3BA 2HM8A 4GAAA 2UY1A 2KCVA 4RG9A 1HG2A 4XI0A 5AJDA 3SFZA 4CDMA 5G2NA 5LOZA 3FP3A 4L23A 3GZ2A 4MLPA 3LCAA 1E8WA 4WNFA 3ZW3A 4N2QA 4Y6CA 4ILHB 2MRIA 2UWJG 2I1KA 3FUKA 1H0AA 4AM9A 3I5PA 4J8SA 3S7JA 3B7RL 1INZA 4GYYA 5JJTA 3S7FA 2X6IA 3FH7A 3AS5A 3CHSA 3CHRA 3ZN3A 3CVWA 4ACLA 3FEYA 4HVBA 4O6FA 4PDXA 3CHPA 2CFUA 3RO2A 3ZXSA 3Q49B 3ZYMA 4IYPA 3U66A 1E7UA 3B7SA 4JL0A 4V3IA 3CK9A 4XKCA 3SGHA 3AS4A 2CG3A 5ANRA 3RRUA 3SF4A 4XI9A 3S2AA 4EBAA 3D3MA 1HXIA 5CMYA 2WMOA 5FT9A 3ZHEA 4B8AA 2GGFA 1ELKA 3CHMA 3NZUA 4UWFA 4U8HA 3VLFA 4KZ0A 2AWIA 2R59A 4G2VA 4URKA 2WXGA 1Y6IA 1Y8MA 4BT8A 4HOSA 2UY1B 2XQ0A 4I1AA 4W9RA 3CQCB 3GYZA 5FQ7A 3VLEA 4U0SA 3FH5A 5FQ4A 4I6GA 3P2BA 4HOTA 3FUIA 2ONDA 3ZGQA 1U3CA 4JEHA 4D10C 3UQ3A 4G1TA 4UWLA 1OWLA 1Z3YA 4WNGA 3R7RA 3SBSA 1HE8A 5D0OD 4J6IA 4RSYA 3Q5MA 3UUXA 2I2OA 3ASHA 4QFVA 4F3VA 1N54A 2L0IA 3MV2B 4JW1A 4FC8A 4U04A 4CT4A 3MKQA 4I2ZA 3CLJA 3D9MA 2JEKA 1QQEA 2IF4A 4AP2A 1IHGA 1SQMA 1KLXA 5BT1A 4CCAA 3KEZA 1E7VA 4YNDA 1HFAA 3QKYA 4FJZA 4ATGA 1X5BA 1A17A 4UWGA 2KATA 4UI9C 3ZHEB 4KVMA 3IHVA 4C9BB 2MOWA 4KXKB 4TUUA 4GPKA 4N39A 4BTAA 4JVSA 5EX3A 4YVOA 4FA6A 4GCOA 3QARA 2X38A 3VTXA 3MZLB 1ZBPA 2FULA 2OVFA 3FU6A 3PEVB 4I6EA 2OV8A 3HYMB 3ZYQA 5G05C 3ASGA 3PUKA 1KT0A 2VYIA 4XKBA 1HF8A 4G23A 3U3WA 1NZNA 3ULQA 4TV3A 1QZ2A 1H19A 4OVVA 4HLEA 5JJ7A 2V8SE 5T4YA 4I6JA 1UN8A 1KT1A 2A5UA 3BEEA 4U63A 3G2SA 3FTVA 4CGWA 1EYHA 1EF1C 3UT7A 5CCMA 4HOQA 3B7UX 1MQSA 2XGMA 3PNTB 5G04C 1Z3XA 3MKQB 2AVPA 2VSNA 2WXKA 1H6KA 4G11A 2KC7A 3R7QA 3BG0B 2FO7A 4KBQA 3U64A 1N52A 3QWWA 2DBAA 3I4RB 3PVLA 1UG3A 2AXZA 2VSYA 1TJCA 1BPOA 3PS6A 4U0UA 4N3CA 3CR3A 4LUNU 4AXHA 3D9NA 5ANLA 4WWNA 1E8XA 1PC2A 5C1DA 5CMWA 3PZDA 3MKRA 4PH4B 4A3VA 2WXIA 3CSFA 4FHJA 5M72A 2Y3AA 4ANXA 2X6HA 2AXVA 4DK5A 3Q15A 4ANUA 3RK6A 2VSOE 3LVQE 3PE4A 1DVPA 5AYWD 4PS3A 1TJFA 1B89A 4M3OA 4CGVA 4J8FA 3DPDA 3BG1B 3TXMA 3D9PA 3FWVA 3I3NA 4I17A 3CHOA 4GZ5A 2WMNA 5FQ6A 4KZCA 4ANVA 3K9IA 5FTPA 3PREA 2YQ8A 2WQ7A 2LSVA 3JQ0A 2KM4A 3OXGA 3MYVA 4BSXA 4EBAG 2XCBA 3S7BA 2J08A 3JQ1A 2DIWA 3ML9A 3ASDA 2CG2A 4EECA 3MX3A 4CDNA 2XPIA 4FHKA 4AVXA 4P29A 3LJ3A 3UPVA 2VTBA 1OWNA 2KCLA 2V4LA 2XGSA 4N5CA 3CQGB 4Q94A 1ZU2A 2V5FA 3HIZA 4PS8A 3APDA 4FLBA 5BPPA 4EZJA 4XX5A 4YVQC 3FH8A 2WM9A 1E8YA 3LYAA 4J8EA 3C98A 2WVIA 3FUHA 2WXHA 1NA3A 5BNWA 3JYSA 4L2YA 3FDHA 3ZEFA 2XPYA 3CHQA 1H2UA 3CVPA 5DBKA 4C0EA 2Y4TA 3TL5A 1OWPA 2X6JA 2VQ2A 4RG6A 2X6KA 5FQ8A 3L54A 4G26A 4UWKA 1S0PA 4MS6A 4BT9A 4NACA 4Q96A 1XGWA 2GRLA 1H2TC 3QWPA 4BWRA 1HU3A 2XEVA 3EJNA 5ENNA 4IRUA 2YINA 2IOSA 1FVFA 4ABNA 4AJWA 4F7AA 5FWQA 3FTUA 2ZU6B 3VLDA 1GW6A 4DLQA 4UI9J 4DLOA 5FZQA 4UWHA 2QFCA 3EHNA 3U9WA 2OOEA 4ANWA 4EZKA 5AIJA 1OUVA 3ZRHA 2WXPA 3JUIA 2VTBB 4DI3A 3U4TA 3CVNA 3ML8A 5G05J 2PM6A 2HR2A 3Q47B 4IN3B 5G55A 3MEKA 3OTNA 5D0QD 2CHXA 1OWOA 1YA0A 3FUJA 4LEUA 3ZYLA 3APCA 4BY6A 2CHZA 2LNIA 3PRZA 3RJVA 3GZ1A 2I9CA 4DI4A 2LO6A 4ILGA 2M63A 3S7DA 5FZSA 5G04J 4G24A 3CK8A 4APOA 1E8ZA 3CEQA 4ME2A 4HFGA 4G25A 3HVEA 4JPSA 4APFA 5KJKA 3ONKA 4I1MA 5JHBA 3NQPA 3KS2A 1EPUA 5JHAA 2J07A 2GRMA 2YHCA 5KJMA 1UJJA 4F1SA 4H7XA 1PAQA 3D9LA 3CVVA 3SI5A 4I9EA 4GA1A 4ACKA 2JLBA 2NC9A 3CIAA 4K03A 3EIJA 2J4DA 2L0TB 3ESLA 4I1OB 4A55A 4E85A 3CKBA 3IV0A 5AJLA 4FLHA 3CVUA 2FBNA 4J8DA 1IQUA 2IJGX 3QOUA 1H2VC 2R5SA 3FTXA 3RIBA 2C2LA 2RD0A 2WQ6A 3OXFA 2IU1A 2WXRA 4OVUA 3ZIMA 5LCWJ 5LFAA 2P58C 4MKTA 4BX9A 2FEZA 1ELRA 4JHJA 3PUJA 3Q4AB 2WPVA 4GA2A 2VSXE 4JC8A 4XE0A 4A3TA 4H7YA 4I9CA 3D9JA 3RKVA 3HVEB 1XNFA 3L08A 4GZ6A 3KD7A 3FTSA 1LF8A 1E90A 1U3DA 2EQXA 3FU0A 3MA5A 4GB9A 4B89A 3FU5A 4DPRA 3FU3A 3P1UA 4RVBA 4UQXA 5AENA 3D9OA 1IYGA 3QDNA 5ARGA 3RRNB 4JA9A 2C0MA 4LERA 4PUCA 4GZDA 4XIFA 3QAQA 2Q7FA 3LEWA 3TJPA 2V0PA 3LY7A 3HDXA 4FP7A 5JJ6A 5C2YA 1JUQA 5LCWC 1E96B 4AIFA 5LX8A 1SZAA 2NSZA 3CGHA 4AOFA 3T5VA 3L16A 2VJ8A 3LKUA 2MHKA 3AU4A 4GZCA 3FTYA 4GA0A 2WXQA 4EZLA 5J08A 3RO3A 1QNFA 3PDNA 3LPZA 3ASFA 4N3AA 3ZVVA 3QK0A 4IULA 4WWPA 2NXPA 3QWVA 4L7TA 4F53A 3ZPJA 2PZIA 5E75A 4B8CB 3QJZA 2PM7A 3NF1A 1HZ4A 4J0UA 2PL2A 3CK7A 3ZFWA 2I6HA 3G2TA 3CKCA 3MJWA 5CHEE 5FJYA 1VDYA 3CVXA 2WB2A 1OWMA 3FHEA 3N71A 5EDSA 3ZYKA 3L6AA 3GW4A 2KZTA 3RRMB 2CHWA 3G2WA 5T8IA 3FUNA 3HHMA 2FF4A 3OAWA 4B0ZA 4NURA 3T5XA 1Z6TA 4JA7A 3T8MA 4XZ4A 5A6CA 3EHMA 2IQCA 3SZ7A 3KAEA 4OYSA 4GZ3A 4JEUA 3D9KA 1HH8A 3FTWA 1ELWA 3L17A 4ILIA 4N2SA 1TEZA 3FUDA 4U0ZA 4WWOA 2C0LA 3SD5A 2ILRA 5KCMA 4UQZA 1JWFA 3UMVA 4UQYA 2YNQA 4EPZA 1WM5A 3D9IA 3FTZA 4WNDA 1NP7A 2WXFA 5KJNA 4FULA 1HX8A 2J49A 2LAHA 2WXJA 3MCXA 2HO1A 3FY4A 3ONLA 3QNKA 1EDUA 4MRUA 5ARFA 4EQFA 3URZA 2FI7A 2AXUA 3L22A 3JCKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQG B;  3CQC B;  3I4R B; 
#chains in the Genus database with same CATH topology
 2NYJ A;  3CVY A;  4NQ0 A;  4CDR A;  3HXB A;  3LY9 A;  3WXX A;  3ENE A;  3MGB A;  2B0O E;  4U95 D;  3O48 A;  1K3Z D;  4C0M A;  2RFA A;  2PQR A;  4A1G A;  3AU5 A;  2OVB A;  2WXL A;  3TGO A;  3CVQ A;  2KCK A;  4DJA A;  2IFU A;  3AS8 A;  2HYZ A;  1MHQ A;  2A4Z A;  3FFL A;  4GMJ A;  5A23 A;  3L82 A;  1IQR A;  2F8Y A;  3ABL E;  4TRQ A;  5BV1 A;  4FAD A;  4L2L A;  2J09 A;  4U07 A;  4G8L A;  4GML A;  2LSU A;  2IOL A;  5ENO D;  2H6F A;  3WG7 E;  4Q69 A;  3EDT B;  4JZY A;  1LD8 A;  2X6F A;  2H6G A;  2E2E A;  4AY6 A;  4GYW A;  4CRW A;  3GZS A;  1WAO 1;  3BU8 A;  1BLX B;  3C5R A;  4JD2 G;  3Q75 A;  3TAX A;  4BX8 A;  3TG5 A;  2ION A;  1SW6 A;  4O1P A;  3DXM G;  4KMO A;  3OXL A;  3SBT B;  4FJY A;  2L6J A;  4L1B A;  2WXM A;  2A5E A;  3V31 A;  2BUG A;  2ETB A;  4N3B A;  2HM8 A;  1WG0 A;  3UM2 A;  4BEP A;  1TR4 A;  5EIB E;  2LXM A;  5G2N A;  3FP3 A;  4L23 A;  2IO2 C;  5BXO A;  4ILH B;  2QC9 A;  2MRI A;  2UWJ G;  3B7R L;  2X6I A;  4O6F A;  5ENT D;  4IYP A;  3RSE G;  4JL0 A;  3CK9 A;  4XKC A;  5ANR A;  3UXG A;  2P9S G;  2WMO A;  3BUA A;  4UWF A;  1O1T A;  4U8H A;  2R59 A;  2WXG A;  2UY1 B;  4I1A A;  4J7W A;  5ENP D;  3NBN B;  3P2B A;  4GTS A;  3TWU A;  4HOT A;  3FUI A;  5HS0 A;  1TN8 A;  1Z3Y A;  4LNU D;  2L0I A;  3MV2 B;  4U04 A;  4I2Z A;  3CLJ A;  3D9M A;  4GTO A;  4AP2 A;  4CCA A;  1E7V A;  3QKY A;  1X5B A;  1A17 A;  2KAT A;  3ZHE B;  3IHV A;  2MOW A;  4TUU A;  4YDE A;  4YVO A;  3UIP C;  1ZBP A;  2FUL A;  4X8Q A;  3HYM B;  5G05 C;  1KT0 A;  3ULQ A;  3W9F A;  4TV3 A;  5JJ7 A;  5T4Y A;  2P9P G;  3AG1 E;  2A5U A;  4CGW A;  3PZ2 A;  1EYH A;  1OCC E;  4OAV B;  2KC7 A;  3R7Q A;  2FO7 A;  3QWW A;  1MJ0 A;  2AXZ A;  2VSY A;  1TJC A;  3EUV A;  1E8X A;  3PZD A;  3MKR A;  4A3V A;  3CSF A;  4FHJ A;  5M72 A;  2Y3A A;  4HNA D;  1NL4 A;  2H6H A;  4U8Y D;  5AYW D;  1B89 A;  3UIO C;  4J8F A;  3DPD A;  3R9M A;  3PRE A;  3ZXP A;  3OXG A;  3MYV A;  4EBA G;  3ML9 A;  2CG2 A;  2XPI A;  3LJ3 A;  2KCL A;  2V4L A;  3HIZ A;  3APD A;  4EZJ A;  3FH8 A;  2WM9 A;  1E8Y A;  5EYL A;  5BNW A;  3CHQ A;  4DX6 D;  2X6J A;  4RG6 A;  2V5Q C;  4G26 A;  4BT9 A;  1XGW A;  5ENN A;  5FIN A;  1OT8 A;  1FVF A;  5FWQ A;  4DLQ A;  4UI9 J;  5AAO A;  3U9W A;  4EZK A;  3ZRH A;  4DI3 A;  4DUI A;  3U4T A;  3CVN A;  5G55 A;  3Q47 B;  1OWO A;  3FUJ A;  1QBQ A;  3ZYL A;  4BY6 A;  3PRZ A;  4DI4 A;  5FZS A;  5AAR A;  3ONK A;  3KSL A;  3ULE G;  1TNZ A;  2GRM A;  1UJJ A;  1PAQ A;  4BSZ B;  2J8S D;  1NFI E;  2NC9 A;  2J4D A;  4E85 A;  5AJL A;  3NB2 A;  4J8D A;  1IQU A;  2IJG X;  1MYO A;  2R5S A;  3RIB A;  2RD0 A;  2WXR A;  3ZIM A;  5LCW J;  4OAU C;  4JC8 A;  3T8K A;  4RLY A;  3Q7A A;  3D9J A;  3V2O A;  3KD7 A;  4GB9 A;  4B89 A;  4K5C A;  4RVB A;  5AEN A;  4UQX A;  4RQI A;  3QAQ A;  4HLL A;  4AOF A;  4BET A;  3LKU A;  2WXQ A;  1QNF A;  3PDN A;  2P9N G;  3QK0 A;  4WWP A;  2BKG A;  3ZPJ A;  3NF1 A;  3ZFW A;  2I6H A;  3MJW A;  3CKC A;  5FJY A;  1VDY A;  3CVX A;  3LJN A;  5EIL A;  1V55 E;  3ZUV B;  3L6A A;  3FUN A;  2FF4 A;  3OAW A;  2L6B A;  5A6C A;  1Z6T A;  4OYS A;  3DSW A;  4ILI A;  3FUD A;  3PZ3 A;  3HG0 D;  3NOG D;  4EPZ A;  1WM5 A;  3D9I A;  4FUL A;  3FY4 A;  3ONL A;  2FI7 A;  3L22 A;  3O4Z A;  1O1S A;  1IKN D;  5CCL A;  2BKK B;  5EID A;  4PS7 A;  3I4G A;  1FVH A;  1WY6 A;  2BF0 X;  1S63 A;  2F37 A;  3APF A;  3FUM A;  1DNP A;  1MX4 A;  1BI8 B;  2BTD A;  3FEX A;  2Y4U A;  4CEM A;  2Y0B G;  1SA5 A;  3FUF A;  2VGX B;  1OY3 D;  2DYS E;  2LAI A;  3SHF A;  5FIO A;  2GRR B;  3ESK A;  4FU3 A;  2E0I A;  1HG5 A;  4HI9 A;  3UT4 A;  5FZR A;  3TXN A;  2XRY A;  5EKQ D;  1RZ4 A;  4HRN A;  3PEU B;  1N9A A;  4AEZ C;  5JMN D;  2XZT G;  2F8X K;  5DIZ A;  5ITZ F;  2P9U G;  3DSU A;  3IBE A;  2R17 C;  4GTP A;  1K1B A;  3PH0 C;  3FUL A;  3PNL B;  1UN9 A;  3Q73 A;  2DCP A;  5EN5 D;  2L9B A;  3E34 A;  3EU5 A;  3AG2 E;  4UUC A;  4GMR A;  5AJD A;  5AQB A;  3ZW3 A;  4Y6C A;  3DXK G;  4J8S A;  5D2M C;  3C72 A;  4GYY A;  5JJT A;  4PDX A;  3DWL G;  1D8D A;  4GTR A;  3AS4 A;  2CG3 A;  2P9L G;  3RRU A;  3SF4 A;  4EBA A;  3DSS A;  1ELK A;  4KZ0 A;  1Y6I A;  1Y8M A;  4HOS A;  4TXP A;  5FQ7 A;  1BU9 A;  3VLE A;  4U0S A;  2OND A;  3J5Q B;  4D10 C;  4G1T A;  1OWL A;  1N4Q A;  3Q5M A;  1TN7 A;  3Q79 A;  1N54 A;  4JW1 A;  4CT4 A;  3MKQ A;  5AQA A;  3UM0 A;  1IHG A;  5BT1 A;  3KEZ A;  4YND A;  2H6I A;  4UI9 C;  4C9B B;  1LTX A;  5KWD A;  4JVS A;  4GCO A;  3HXC A;  3QAR A;  3ZKJ A;  3VTX A;  4I6E A;  3ASO E;  1AP7 A;  3ASG A;  3PUK A;  2OEV A;  2VYI A;  1S64 A;  4OVV A;  4GPM A;  2P2C P;  3UM1 A;  4U63 A;  1N0R A;  5CRU A;  5CCM A;  3B7U X;  3PNT B;  2WXK A;  1A5E A;  3UI2 A;  4KBQ A;  1N52 A;  3I4R B;  3PVL A;  1BPO A;  4U0U A;  3SQV A;  2EIN E;  3CR3 A;  4AXH A;  3TWR A;  5C1D A;  4PH4 B;  3ZU7 B;  2AXV A;  4ANU A;  2ZIS A;  3PE4 A;  4CGV A;  1TJF A;  3TXM A;  3PZ1 A;  3FWV A;  3I3N A;  2HE0 A;  4I17 A;  2WMN A;  4KZC A;  4ANV A;  2XS8 A;  2WQ7 A;  2KM4 A;  3V2X A;  4BSX A;  2XCB A;  3S7B A;  2DIW A;  1FPP A;  2EIK E;  4FHK A;  1OWN A;  2XGS A;  3CQG B;  2MYO A;  4YVQ C;  2XEE A;  1MZC A;  3C98 A;  2WVI A;  3Q9U C;  3JYS A;  1SVX A;  1K8K G;  5DBK A;  2Y4T A;  1YCS B;  2V4H C;  4MS6 A;  4Q96 A;  1H6O A;  1H2T C;  2DZN A;  4BWR A;  2YIN A;  3SFX A;  3NAW A;  1GW6 A;  5FZQ A;  1OCO E;  2OOE A;  2RKK A;  4ANW A;  4TXQ A;  2VTB B;  2ETA A;  3ML8 A;  2HR2 A;  4IN3 B;  3MEK A;  5D0Q D;  2LXL A;  4HRL A;  3APC A;  2CHZ A;  1YYH A;  2I9C A;  2M63 A;  5G04 J;  5HRY A;  1E8Z A;  4APF A;  4G25 A;  3HVE A;  3EHR A;  4I1M A;  1OCZ E;  2ZXW E;  3KS2 A;  2J07 A;  1JCS A;  4H7X A;  3CVV A;  4I9E A;  3CIA A;  2L0T B;  4I1O B;  3C3O A;  3CKB A;  3IV0 A;  1N4S A;  2FBN A;  3QOU A;  1H2V C;  5JA4 D;  4EHM A;  5LFA A;  4MKT A;  5CBN A;  4BX9 A;  2GRP B;  3Q4A B;  2VSX E;  3TWX A;  4A3T A;  4H7Y A;  3L08 A;  4GZ6 A;  1LF8 A;  3KSQ A;  1N11 A;  3P1U A;  5KBA A;  3QDN A;  3RRN B;  4JA9 A;  4GZD A;  3LEW A;  2V0P A;  4HB5 A;  4FP7 A;  1JUQ A;  1E96 B;  4AIF A;  2VGE A;  2NSZ A;  3HRA A;  2IEJ A;  2VJ8 A;  3T5V A;  1JCQ A;  2MHK A;  3AU4 A;  4GZC A;  4GA0 A;  3RO3 A;  3ASF A;  3ZVV A;  4L7T A;  2PZI A;  5E75 A;  3QJZ A;  1LD7 A;  3G2T A;  1OWM A;  3FHE A;  5T8I A;  4NUR A;  2IQC A;  4GZ3 A;  3HXF A;  1ELW A;  1TEZ A;  2GRO B;  2ILR A;  5D66 A;  4UQY A;  3FTZ A;  4WND A;  4F1P A;  1HX8 A;  2WXJ A;  3AAA C;  3URZ A;  1QYM A;  1L5J A;  1NA0 A;  4HQD A;  4GYO A;  3CST A;  1W3B A;  2KZT B;  1FCH A;  3DSX A;  1N0Q A;  4R7L A;  4WAF A;  1OCR E;  4HBD A;  5ENR D;  1SA4 A;  1IXV A;  3EIQ C;  3E33 A;  3LS8 A;  3TG4 A;  2XCC A;  4Y6W A;  3R9A B;  2X3M A;  4KYO B;  2GRN B;  1BI7 B;  3W9G A;  1HS6 A;  4LRZ A;  3DEO A;  3E30 A;  3CV0 A;  3RU0 A;  5LP0 A;  2RG8 A;  1OXJ A;  3IKO B;  4BER A;  2LUH A;  4AV7 A;  2WXO A;  2EIJ E;  1DCE A;  1PY1 A;  4HOU A;  1UW4 B;  4B93 B;  3IXE A;  3DBS A;  4HXI A;  5J90 A;  4GCN A;  4BTB A;  2CFZ A;  2I1J A;  5B1B E;  2ZGD A;  3B7T A;  4AY5 A;  4B94 A;  4N5Q A;  1AWC B;  3TWS A;  3LY8 A;  3L9T A;  2XGO A;  4HS2 A;  4JHK A;  5A7D B;  3UT8 A;  3FUE A;  1N94 A;  1K1A A;  3SFY A;  2UY1 A;  2KCV A;  1HG2 A;  3SFZ A;  4CDM A;  2P9I G;  3GZ2 A;  4MLP A;  3LCA A;  4WNF A;  2JAB A;  4N2Q A;  3PZ4 A;  2I1K A;  4DX1 A;  3I5P A;  3DRA A;  1INZ A;  2GRQ B;  3FH7 A;  3CVW A;  3AS5 A;  2KXP C;  4ACL A;  2ZGG A;  2CFU A;  3RO2 A;  3Q49 B;  3ZYM A;  1MX2 A;  1E7U A;  4V3I A;  5CER B;  1TN6 A;  4XI9 A;  3S2A A;  1TYQ G;  3D3M A;  1HXI A;  3ZHE A;  3BQO A;  3CHM A;  1U2V G;  4URK A;  4BT8 A;  3SY2 A;  3FH5 A;  2BED A;  1U3C A;  4JEH A;  4WNG A;  3SBS A;  4J6I A;  4RSY A;  3UUX A;  2I2O A;  4F3V A;  1H6P A;  2QZA A;  1QQE A;  2IF4 A;  2Y69 E;  1KLX A;  1HFA A;  4M7C A;  4FJZ A;  4ATG A;  1ZB1 A;  4FA6 A;  2X38 A;  3V79 K;  3MZL B;  2OVF A;  3PEV B;  2OV8 A;  4XKB A;  3SO8 A;  1HF8 A;  1NZN A;  1QZ2 A;  1H19 A;  4I6J A;  1KT1 A;  3BEE A;  1KPS B;  1EF1 C;  4HOQ A;  5G04 C;  1O1R A;  2AVP A;  2VSN A;  2DBA A;  1UG3 A;  4LNG A;  4N3C A;  3D9N A;  5ANL A;  4TUM A;  2WXI A;  4ANX A;  4GTQ A;  2X6H A;  3Q15 A;  3B7B A;  3UIN C;  2VSO E;  4PS3 A;  3D9P A;  3CHO A;  4GZ5 A;  3RAU A;  3K9I A;  2YQ8 A;  3JQ1 A;  3ASD A;  4EEC A;  4CDN A;  4AVX A;  4P29 A;  4UWK A;  2V5F A;  4DRX E;  4FLB A;  4XX5 A;  4J8E A;  2WXH A;  1NA3 A;  3D9H A;  4L2Y A;  3FDH A;  5CRV A;  2PNN A;  4C0E A;  2XEN A;  3TL5 A;  1OWP A;  5CED B;  2VQ2 A;  2X6K A;  5FQ8 A;  1S0P A;  1DCQ A;  4NAC A;  2GRL A;  3QWP A;  1HU3 A;  3EJN A;  5IY5 E;  2IOS A;  4ABN A;  4F7A A;  3FTU A;  4YDW A;  2WXP A;  3JUI A;  1TNB A;  2PM6 A;  1S70 B;  2CHX A;  1YA0 A;  1KZO A;  5EYP F;  3AJI A;  3E37 A;  2QYU A;  3GZ1 A;  3AG3 E;  2IO3 C;  3S7D A;  4DX7 D;  4ME2 A;  4JPS A;  1FT1 A;  5JHB A;  3NOC D;  1EPU A;  4K5A B;  5JHA A;  1RW2 A;  4YDY A;  4F1S A;  4J8Y A;  3D9L A;  3SI5 A;  4ACK A;  2JLB A;  4K03 A;  1FT2 A;  3ESL A;  2R2L A;  4A63 B;  4FLH A;  3CVU A;  1N4P A;  2OCC E;  3FTX A;  2DYR E;  1WDY A;  2P58 C;  2FEZ A;  2WPV A;  4I9C A;  3RKV A;  3UKR G;  2EQX A;  1E90 A;  3FU0 A;  3FU5 A;  3D9O A;  2C0M A;  4LER A;  4XIF A;  3TJP A;  3LY7 A;  3HDX A;  5LCW C;  2FO1 E;  3L16 A;  4TXR A;  1YMP A;  4EZL A;  4IUL A;  2NXP A;  3QWV A;  4F53 A;  3ULY A;  4J0U A;  2PL2 A;  3JXJ A;  3CK7 A;  1Z5S C;  2WB2 A;  3N71 A;  5EDS A;  3GW4 A;  4HRM B;  2CHW A;  5AQ9 A;  4B0Z A;  3T5X A;  4JA7 A;  4O60 A;  3SZ7 A;  4JEU A;  3D9K A;  1HH8 A;  1UOH A;  5B1A E;  3J5P A;  3SD5 A;  3JXI A;  5KCM A;  2YNQ A;  5B3S E;  1NP7 A;  3ZNG A;  5KJN A;  2J49 A;  2LAH A;  5ARF A;  2HO1 A;  3QNK A;  1EDU A;  3F6Q A;  5EX0 A;  5E76 A;  3IEG A;  2VGX A;  3G2U A;  4K0R A;  1HO8 A;  2XS1 A;  4CT0 A;  5KNH D;  3PE3 A;  1SZ9 A;  4GU5 A;  3TWW A;  2OEW A;  5T3R A;  3HXE A;  2WXN A;  5BUZ A;  2F0Y A;  2QY7 A;  5CEC B;  3SNX A;  2GW1 A;  4XEI G;  4BFR A;  2J9Q A;  4I43 A;  2VGY A;  3C3R A;  5CEA A;  2IY0 C;  2WQH A;  3TWV A;  3VTY A;  2DZO A;  1P5Q A;  3ISM C;  4U7E B;  3E4B A;  2XRZ A;  3ASN E;  3CVL A;  2AW6 A;  3MV3 B;  3Q7F A;  4I2W A;  1N4R A;  5KJL A;  4KVO A;  4A1S A;  2YHE A;  4WNE A;  3QC1 A;  3L13 A;  4KT6 B;  1N95 A;  2KBX A;  3NZS A;  5HQ8 A;  3LVR E;  4HOR A;  2P9K G;  1DC2 A;  2J4B A;  2XHE A;  3UTM A;  3IHY A;  3V30 A;  3T9K A;  1JWG A;  3LXU X;  4LCT A;  2ETC A;  3QB2 A;  3B13 A;  3UX4 A;  4UI9 K;  4WUY A;  5BV0 A;  1JPL A;  4JXT A;  3G2V A;  2R02 A;  1UJK A;  4NRH B;  4K5B A;  5ENS D;  4YDO A;  5HI7 A;  2PQN A;  3LDZ A;  4E6H A;  4JHR A;  1JCR A;  4LSZ E;  2XPZ A;  5BW8 C;  4GAA A;  4RG9 A;  4XI0 A;  4GTV A;  3KEA A;  5LOZ A;  1E8W A;  4CYM D;  4C48 B;  1TNY A;  3FUK A;  1H0A A;  4AM9 A;  3S7J A;  5CBO A;  3S7F A;  3ZN3 A;  3CHS A;  3CHR A;  4CZ2 D;  2Y1L E;  3FEY A;  4HVB A;  4G8K A;  3CHP A;  3U66 A;  3ZXS A;  3B95 A;  3B7S A;  3SGH A;  5CMY A;  1KZP A;  4B8A A;  5FT9 A;  2GGF A;  3NZU A;  3VLF A;  2AWI A;  4G2V A;  4W9R A;  2XQ0 A;  3X2Q E;  3UM3 A;  3CQC B;  3GYZ A;  2QYJ A;  4GTM A;  2DVW A;  5FQ4 A;  4I6G A;  5HKP A;  3DSV A;  4DX2 A;  3ZGQ A;  3UQ3 A;  4UWL A;  3R7R A;  1HE8 A;  5D0O D;  3ASH A;  4QFV A;  1V54 E;  4FC8 A;  2JEK A;  1D9S A;  1SQM A;  1TNO A;  3DPY A;  4UWG A;  4KVM A;  4KXK B;  4GPK A;  4N39 A;  4BTA A;  5EX3 A;  4QQI A;  3FU6 A;  4BES A;  3ZYQ A;  4G23 A;  3U3W A;  4U8V D;  5H7P A;  4HLE A;  2V8S E;  1UN8 A;  3G2S A;  3FTV A;  3UT7 A;  1MQS A;  2XGM A;  1Z3X A;  3MKQ B;  1NI1 A;  1H6K A;  4G11 A;  1TNU A;  3U64 A;  3BG0 B;  3UKU G;  3C3Q A;  4L9P A;  3PS6 A;  4LUN U;  4WWN A;  1PC2 A;  5CMW A;  4DK5 A;  3RK6 A;  3LVQ E;  2XZD G;  1DVP A;  2DWZ A;  4M3O A;  3BG1 B;  5FQ6 A;  4DX5 D;  5FTP A;  4ATZ D;  2LSV A;  3JQ0 A;  2J08 A;  5ENQ D;  3MX3 A;  3UPV A;  2VTB A;  4N5C A;  4PS8 A;  4Q94 A;  1ZU2 A;  5BPP A;  3LYA A;  3FUH A;  3ZEF A;  2XPY A;  1H2U A;  3CVP A;  3L54 A;  4EQF A;  4ZFH A;  4ZHB A;  1BD8 A;  2XEV A;  4IRU A;  4AJW A;  3VLD A;  2ZU6 B;  4DLO A;  4LG6 A;  4UWH A;  3ABM E;  2QFC A;  3EHN A;  5AIJ A;  1OUV A;  4GTT A;  3DST A;  5G05 J;  3DEP A;  2R03 A;  2B6C A;  3OTN A;  4LEU A;  2LNI A;  3RJV A;  2LO6 A;  4ILG A;  4G24 A;  5BXU A;  3CK8 A;  4APO A;  3CEQ A;  4HFG A;  5KJK A;  3JUE A;  2XEH A;  3NQP A;  2YHC A;  5KJM A;  4Z68 A;  4LNB A;  4GA1 A;  3EIJ A;  4A55 A;  2C2L A;  2WQ6 A;  3OXF A;  2IU1 A;  4OVU A;  4NIK A;  1ELR A;  4JHJ A;  3E32 A;  3PUJ A;  4GA2 A;  4XE0 A;  3HVE B;  1XNF A;  4HI8 A;  5AN8 A;  3EHQ A;  3FTS A;  1U3D A;  3MA5 A;  1IHB A;  2ZIR A;  4DPR A;  3FU3 A;  3EU9 A;  1IYG A;  5ARG A;  1D8E A;  4PUC A;  3ABK E;  2Q7F A;  3AG4 E;  2EIM E;  1Q2Z A;  4O1O A;  5JJ6 A;  5C2Y A;  3TWT A;  2RFM A;  5LX8 A;  3Q9N C;  3TWQ A;  1SZA A;  3HXD A;  3CGH A;  3FTY A;  5J08 A;  3LPZ A;  4N3A A;  4JB8 P;  4B8C B;  2PM7 A;  1HZ4 A;  4U96 D;  5CHE E;  3Q78 A;  2EIL E;  5KNG A;  3ZYK A;  2KZT A;  3RRM B;  3G2W A;  4MBG A;  3HHM A;  1G3N B;  3T8M A;  4XZ4 A;  3EHM A;  5AQ7 A;  3KAE A;  1O5M A;  3FTW A;  3L17 A;  2AJA A;  4N2S A;  1X81 A;  4U0Z A;  4WWO A;  2C0L A;  4UQZ A;  1JWF A;  3UMV A;  2R05 A;  2WXF A;  3MCX A;  4MRU A;  1MX6 A;  4F6R D;  2AXU A;  3JCK C; 
#chains in the Genus database with same CATH homology
 3CVY A;  5EX0 A;  4NQ0 A;  5E76 A;  1L5J A;  4CDR A;  1NA0 A;  3LY9 A;  3IEG A;  3O4Z A;  3WXX A;  2VGX A;  3G2U A;  4K0R A;  1HO8 A;  3ENE A;  3MGB A;  4GYO A;  5CCL A;  4CT0 A;  3CST A;  1W3B A;  2KZT B;  1FCH A;  3PE3 A;  3O48 A;  1SZ9 A;  4GU5 A;  5T3R A;  4R7L A;  4WAF A;  4C0M A;  2WXN A;  2PQR A;  4A1G A;  5BUZ A;  4PS7 A;  2QY7 A;  3AU5 A;  3EIQ C;  3I4G A;  1FVH A;  3LS8 A;  3TG4 A;  2OVB A;  3SNX A;  1WY6 A;  2BF0 X;  2GW1 A;  2XCC A;  4Y6W A;  3R9A B;  2WXL A;  3TGO A;  3CVQ A;  2X3M A;  3APF A;  4BFR A;  3FUM A;  1DNP A;  2KCK A;  4DJA A;  2IFU A;  3AS8 A;  2HYZ A;  2J9Q A;  4I43 A;  4KYO B;  2VGY A;  2BTD A;  3FEX A;  1MHQ A;  2A4Z A;  2WQH A;  2Y4U A;  3FFL A;  4GMJ A;  1HS6 A;  4CEM A;  4LRZ A;  3VTY A;  3FUF A;  2VGX B;  5A23 A;  1IQR A;  2LAI A;  3SHF A;  3CV0 A;  4TRQ A;  1P5Q A;  3RU0 A;  5BV1 A;  4FAD A;  4L2L A;  5LP0 A;  2J09 A;  4U07 A;  4GML A;  2LSU A;  2RG8 A;  2IOL A;  3E4B A;  3ESK A;  4FU3 A;  2XRZ A;  2E0I A;  1HG5 A;  4Q69 A;  3CVL A;  2AW6 A;  3EDT B;  3MV3 B;  4JZY A;  4I2W A;  3UT4 A;  5FZR A;  3TXN A;  5KJL A;  2X6F A;  3IKO B;  4KVO A;  2XRY A;  5EKQ D;  4AV7 A;  4A1S A;  2YHE A;  2E2E A;  4WNE A;  2WXO A;  3QC1 A;  3L13 A;  4HOU A;  1PY1 A;  4KT6 B;  1UW4 B;  3PEU B;  4AEZ C;  4GYW A;  4AY6 A;  4CRW A;  3DBS A;  3NZS A;  3GZS A;  4HXI A;  1WAO 1;  5HQ8 A;  3LVR E;  4HOR A;  5DIZ A;  2J4B A;  2XHE A;  5J90 A;  3IHY A;  4GCN A;  4BTB A;  3TAX A;  2CFZ A;  1JWG A;  2I1J A;  3LXU X;  4BX8 A;  3TG5 A;  4LCT A;  3QB2 A;  2ION A;  3B13 A;  3B7T A;  4AY5 A;  3UX4 A;  4UI9 K;  4WUY A;  4KMO A;  5BV0 A;  1JPL A;  3IBE A;  3OXL A;  2R17 C;  4JXT A;  3G2V A;  1UJK A;  3SBT B;  4B94 A;  4FJY A;  4NRH B;  3PH0 C;  2L6J A;  4L1B A;  2WXM A;  3FUL A;  3PNL B;  5HI7 A;  2PQN A;  1UN9 A;  3LY8 A;  4HS2 A;  2XGO A;  3LDZ A;  4E6H A;  4JHR A;  4JHK A;  2DCP A;  5A7D B;  3UT8 A;  2BUG A;  2L9B A;  2XPZ A;  3FUE A;  5BW8 C;  4N3B A;  2HM8 A;  4GAA A;  2UY1 A;  2KCV A;  4RG9 A;  1HG2 A;  4XI0 A;  5AJD A;  3SFZ A;  4CDM A;  5G2N A;  5LOZ A;  3FP3 A;  4L23 A;  3GZ2 A;  4MLP A;  3LCA A;  1E8W A;  4WNF A;  3ZW3 A;  4N2Q A;  4Y6C A;  4ILH B;  2MRI A;  2UWJ G;  2I1K A;  3FUK A;  1H0A A;  4AM9 A;  3I5P A;  4J8S A;  3S7J A;  3B7R L;  1INZ A;  4GYY A;  5JJT A;  3S7F A;  2X6I A;  3FH7 A;  3AS5 A;  3CHS A;  3CHR A;  3ZN3 A;  3CVW A;  4ACL A;  3FEY A;  4HVB A;  4O6F A;  4PDX A;  3CHP A;  2CFU A;  3RO2 A;  3ZXS A;  3Q49 B;  3ZYM A;  4IYP A;  3U66 A;  1E7U A;  3B7S A;  4JL0 A;  4V3I A;  3CK9 A;  4XKC A;  3SGH A;  3AS4 A;  2CG3 A;  5ANR A;  3RRU A;  3SF4 A;  4XI9 A;  3S2A A;  4EBA A;  3D3M A;  1HXI A;  5CMY A;  2WMO A;  5FT9 A;  3ZHE A;  4B8A A;  2GGF A;  1ELK A;  3CHM A;  3NZU A;  4UWF A;  4U8H A;  3VLF A;  4KZ0 A;  2AWI A;  2R59 A;  4G2V A;  4URK A;  2WXG A;  1Y6I A;  1Y8M A;  4BT8 A;  4HOS A;  2UY1 B;  2XQ0 A;  4I1A A;  4W9R A;  3CQC B;  3GYZ A;  5FQ7 A;  3VLE A;  4U0S A;  3FH5 A;  5FQ4 A;  4I6G A;  3P2B A;  4HOT A;  3FUI A;  2OND A;  3ZGQ A;  1U3C A;  4JEH A;  4D10 C;  3UQ3 A;  4G1T A;  4UWL A;  1OWL A;  1Z3Y A;  4WNG A;  3R7R A;  3SBS A;  1HE8 A;  5D0O D;  4J6I A;  4RSY A;  3Q5M A;  3UUX A;  2I2O A;  3ASH A;  4QFV A;  4F3V A;  1N54 A;  2L0I A;  3MV2 B;  4JW1 A;  4FC8 A;  4U04 A;  4CT4 A;  3MKQ A;  4I2Z A;  3CLJ A;  3D9M A;  2JEK A;  1QQE A;  2IF4 A;  4AP2 A;  1IHG A;  1SQM A;  1KLX A;  5BT1 A;  4CCA A;  3KEZ A;  1E7V A;  4YND A;  1HFA A;  3QKY A;  4FJZ A;  4ATG A;  1X5B A;  1A17 A;  4UWG A;  2KAT A;  4UI9 C;  3ZHE B;  4KVM A;  3IHV A;  4C9B B;  2MOW A;  4KXK B;  4TUU A;  4GPK A;  4N39 A;  4BTA A;  4JVS A;  5EX3 A;  4YVO A;  4FA6 A;  4GCO A;  3QAR A;  2X38 A;  3VTX A;  3MZL B;  1ZBP A;  2FUL A;  2OVF A;  3FU6 A;  3PEV B;  4I6E A;  2OV8 A;  3HYM B;  3ZYQ A;  5G05 C;  3ASG A;  3PUK A;  1KT0 A;  2VYI A;  4XKB A;  1HF8 A;  4G23 A;  3U3W A;  1NZN A;  3ULQ A;  4TV3 A;  1QZ2 A;  1H19 A;  4OVV A;  4HLE A;  5JJ7 A;  2V8S E;  5T4Y A;  4I6J A;  1UN8 A;  1KT1 A;  2A5U A;  3BEE A;  4U63 A;  3G2S A;  3FTV A;  4CGW A;  1EYH A;  1EF1 C;  3UT7 A;  5CCM A;  4HOQ A;  3B7U X;  1MQS A;  2XGM A;  3PNT B;  5G04 C;  1Z3X A;  3MKQ B;  2AVP A;  2VSN A;  2WXK A;  1H6K A;  4G11 A;  2KC7 A;  3R7Q A;  3BG0 B;  2FO7 A;  4KBQ A;  3U64 A;  1N52 A;  3QWW A;  2DBA A;  3I4R B;  3PVL A;  1UG3 A;  2AXZ A;  2VSY A;  1TJC A;  1BPO A;  3PS6 A;  4U0U A;  4N3C A;  3CR3 A;  4LUN U;  4AXH A;  3D9N A;  5ANL A;  4WWN A;  1E8X A;  1PC2 A;  5C1D A;  5CMW A;  3PZD A;  3MKR A;  4PH4 B;  4A3V A;  2WXI A;  3CSF A;  4FHJ A;  5M72 A;  2Y3A A;  4ANX A;  2X6H A;  2AXV A;  4DK5 A;  3Q15 A;  4ANU A;  3RK6 A;  2VSO E;  3LVQ E;  3PE4 A;  1DVP A;  5AYW D;  4PS3 A;  1TJF A;  1B89 A;  4M3O A;  4CGV A;  4J8F A;  3DPD A;  3BG1 B;  3TXM A;  3D9P A;  3FWV A;  3I3N A;  4I17 A;  3CHO A;  4GZ5 A;  2WMN A;  5FQ6 A;  4KZC A;  4ANV A;  3K9I A;  5FTP A;  3PRE A;  2YQ8 A;  2WQ7 A;  2LSV A;  3JQ0 A;  2KM4 A;  3OXG A;  3MYV A;  4BSX A;  4EBA G;  2XCB A;  3S7B A;  2J08 A;  3JQ1 A;  2DIW A;  3ML9 A;  3ASD A;  2CG2 A;  4EEC A;  3MX3 A;  4CDN A;  2XPI A;  4FHK A;  4AVX A;  4P29 A;  3LJ3 A;  3UPV A;  2VTB A;  1OWN A;  2KCL A;  2V4L A;  2XGS A;  4N5C A;  3CQG B;  4Q94 A;  1ZU2 A;  2V5F A;  3HIZ A;  4PS8 A;  3APD A;  4FLB A;  5BPP A;  4EZJ A;  4XX5 A;  4YVQ C;  3FH8 A;  2WM9 A;  1E8Y A;  3LYA A;  4J8E A;  3C98 A;  2WVI A;  3FUH A;  2WXH A;  1NA3 A;  5BNW A;  3JYS A;  4L2Y A;  3FDH A;  3ZEF A;  2XPY A;  3CHQ A;  1H2U A;  3CVP A;  5DBK A;  4C0E A;  2Y4T A;  3TL5 A;  1OWP A;  2X6J A;  2VQ2 A;  4RG6 A;  2X6K A;  5FQ8 A;  3L54 A;  4G26 A;  4UWK A;  1S0P A;  4MS6 A;  4BT9 A;  4NAC A;  4Q96 A;  1XGW A;  2GRL A;  1H2T C;  3QWP A;  4BWR A;  1HU3 A;  2XEV A;  3EJN A;  5ENN A;  4IRU A;  2YIN A;  2IOS A;  1FVF A;  4ABN A;  4AJW A;  4F7A A;  5FWQ A;  3FTU A;  2ZU6 B;  3VLD A;  1GW6 A;  4DLQ A;  4UI9 J;  4DLO A;  5FZQ A;  4UWH A;  2QFC A;  3EHN A;  3U9W A;  2OOE A;  4ANW A;  4EZK A;  5AIJ A;  1OUV A;  3ZRH A;  2WXP A;  3JUI A;  2VTB B;  4DI3 A;  3U4T A;  3CVN A;  3ML8 A;  5G05 J;  2PM6 A;  2HR2 A;  3Q47 B;  4IN3 B;  5G55 A;  3MEK A;  3OTN A;  5D0Q D;  2CHX A;  1OWO A;  1YA0 A;  3FUJ A;  4LEU A;  3ZYL A;  3APC A;  4BY6 A;  2CHZ A;  2LNI A;  3PRZ A;  3RJV A;  3GZ1 A;  2I9C A;  4DI4 A;  2LO6 A;  4ILG A;  2M63 A;  3S7D A;  5FZS A;  5G04 J;  4G24 A;  3CK8 A;  4APO A;  1E8Z A;  3CEQ A;  4ME2 A;  4HFG A;  4G25 A;  3HVE A;  4JPS A;  4APF A;  5KJK A;  3ONK A;  4I1M A;  5JHB A;  3NQP A;  3KS2 A;  1EPU A;  5JHA A;  2J07 A;  2GRM A;  2YHC A;  5KJM A;  1UJJ A;  4F1S A;  4H7X A;  1PAQ A;  3D9L A;  3CVV A;  3SI5 A;  4I9E A;  4GA1 A;  4ACK A;  2JLB A;  2NC9 A;  3CIA A;  4K03 A;  3EIJ A;  2J4D A;  2L0T B;  3ESL A;  4I1O B;  4A55 A;  4E85 A;  3CKB A;  3IV0 A;  5AJL A;  4FLH A;  3CVU A;  2FBN A;  4J8D A;  1IQU A;  2IJG X;  3QOU A;  1H2V C;  2R5S A;  3FTX A;  3RIB A;  2C2L A;  2RD0 A;  2WQ6 A;  3OXF A;  2IU1 A;  2WXR A;  4OVU A;  3ZIM A;  5LCW J;  5LFA A;  2P58 C;  4MKT A;  4BX9 A;  2FEZ A;  1ELR A;  4JHJ A;  3PUJ A;  3Q4A B;  2WPV A;  4GA2 A;  2VSX E;  4JC8 A;  4XE0 A;  4A3T A;  4H7Y A;  4I9C A;  3D9J A;  3RKV A;  3HVE B;  1XNF A;  3L08 A;  4GZ6 A;  3KD7 A;  3FTS A;  1LF8 A;  1E90 A;  1U3D A;  2EQX A;  3FU0 A;  3MA5 A;  4GB9 A;  4B89 A;  3FU5 A;  4DPR A;  3FU3 A;  3P1U A;  4RVB A;  4UQX A;  5AEN A;  3D9O A;  1IYG A;  3QDN A;  5ARG A;  3RRN B;  4JA9 A;  2C0M A;  4LER A;  4PUC A;  4GZD A;  4XIF A;  3QAQ A;  2Q7F A;  3LEW A;  3TJP A;  2V0P A;  3LY7 A;  3HDX A;  4FP7 A;  5JJ6 A;  5C2Y A;  1JUQ A;  5LCW C;  1E96 B;  4AIF A;  5LX8 A;  1SZA A;  2NSZ A;  3CGH A;  4AOF A;  3T5V A;  3L16 A;  2VJ8 A;  3LKU A;  2MHK A;  3AU4 A;  4GZC A;  3FTY A;  4GA0 A;  2WXQ A;  4EZL A;  5J08 A;  3RO3 A;  1QNF A;  3PDN A;  3LPZ A;  3ASF A;  4N3A A;  3ZVV A;  3QK0 A;  4IUL A;  4WWP A;  2NXP A;  3QWV A;  4L7T A;  4F53 A;  3ZPJ A;  2PZI A;  5E75 A;  4B8C B;  3QJZ A;  2PM7 A;  3NF1 A;  1HZ4 A;  4J0U A;  2PL2 A;  3CK7 A;  3ZFW A;  2I6H A;  3G2T A;  3CKC A;  3MJW A;  5CHE E;  5FJY A;  1VDY A;  3CVX A;  2WB2 A;  1OWM A;  3FHE A;  3N71 A;  5EDS A;  3ZYK A;  3L6A A;  3GW4 A;  2KZT A;  3RRM B;  2CHW A;  3G2W A;  5T8I A;  3FUN A;  3HHM A;  2FF4 A;  3OAW A;  4B0Z A;  4NUR A;  3T5X A;  1Z6T A;  4JA7 A;  3T8M A;  4XZ4 A;  5A6C A;  3EHM A;  2IQC A;  3SZ7 A;  3KAE A;  4OYS A;  4GZ3 A;  4JEU A;  3D9K A;  1HH8 A;  3FTW A;  1ELW A;  3L17 A;  4ILI A;  4N2S A;  1TEZ A;  3FUD A;  4U0Z A;  4WWO A;  2C0L A;  3SD5 A;  2ILR A;  5KCM A;  4UQZ A;  1JWF A;  3UMV A;  4UQY A;  2YNQ A;  4EPZ A;  1WM5 A;  3D9I A;  3FTZ A;  4WND A;  1NP7 A;  2WXF A;  5KJN A;  4FUL A;  1HX8 A;  2J49 A;  2LAH A;  2WXJ A;  3MCX A;  2HO1 A;  3FY4 A;  3ONL A;  3QNK A;  1EDU A;  4MRU A;  5ARF A;  4EQF A;  3URZ A;  2FI7 A;  2AXU A;  3L22 A;  3JCK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...