3I4RB

Nup107(aa658-925)/nup133(aa517-1156) complex, h.sapiens
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
639
structure length
528
Chain Sequence
KIKLLKAAFLQYCRKDLGHAQMVVDELFSSHSDLDSDSELDRAVTQISVDLMDDYPASIILHQLEDKMKAHSFLMDFIHQVGLFGRLGSFPVRLLLCEHAEKLSAAIVLKNHHSRLSDLVNTAILIALNKREYEIPSNLTPADVFFREVSQVDTICECLLEHEEQVLRDSIEWAEVVINVNNILKDMLQAASHYRQNRRTVIIRQHEIVLKVAYPQADSNLRNIVTEQLVALIDCFLDGYVSQLKSVDKSSNRERYDNLEMEYLQKRSDLLSPLLSLGQYLWAASLAEKYCDFDILVQMCEQTDNQSRLQRYMTQFADQNFSDFLFRWYLEQHGQLANFLQAHEHLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDININDLKLEILCKALQRDNWVSKDSIFVKILLPEVKDLLQADEFVLKANYEYYVQGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architectural nucleoporins Nup157/170 and Nup133 are structurally related and descend from a second ancestral element.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Nuclear pore complex protein Nup107
total genus 101
structure length 528
sequence length 639
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03177 Nucleoporin_C Non-repetitive/WGA-negative nucleoporin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.700 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3i4rB00
3CQCB 3I4RB 3CQGB
chains in the Genus database with same CATH superfamily
5ENNA 1V55E 4DX6D 4N5CA 2UY1A 2WXIA 4NRHB 1TNYA 4V3IA 4J8YA 1UW4B 3GZ2A 4DLQA 1PAQA 4QQIA 4N3BA 3AU4A 1BD8A 5H7PA 1DVPA 2J4BA 4JW1A 1E90A 2Y69E 2F8XK 4GTMA 2V0PA 3FH7A 5EIDA 3D9LA 4GYYA 4U95D 3Q73A 3JYSA 3UMVA 2VSNA 5J08A 2OV8A 1JCSA 2GGFA 3QARA 3UM2A 4LUNU 2YHEA 3SFYA 3PEUB 4ANWA 3Q5MA 3PNLB 4J8DA 1FT1A 4U96D 3UKUG 4I1AA 3HXFA 5CMWA 3RSEG 3ENEA 4BETA 3RAUA 3ASGA 4JEHA 2VGEA 4HI8A 3E34A 2KCKA 4PS7A 2OOEA 3TWXA 3QWWA 2DIWA 4DX2A 3FULA 4PH4B 2A5EA 2XPZA 4HOSA 2LNIA 1D8EA 1IHGA 3ZEFA 3CHPA 2DZOA 3V2OA 4GTOA 2LXMA 3EIJA 3Q4AB 2AWIA 2EIME 4HOQA 1S70B 3L17A 2ILRA 4OYSA 5C2YA 4EHMA 2HM8A 3ULEG 3GYZA 4YVQC 3J5QB 3T9KA 4NIKA 2OEVA 2ZXWE 3APDA 4DUIA 3L16A 2R03A 2KXPC 3LKUA 1D9SA 2LUHA 3G2VA 5CBOA 5FZQA 2BF0X 2Y0BG 3U66A 1SA4A 1N52A 1FCHA 1OWNA 1O1TA 4UWLA 5E75A 4LRZA 1OUVA 4ANXA 3GZ1A 4EQFA 4WWOA 2ZU6B 4TUMA 5BPPA 5B3SE 1TN7A 3B7TA 4N3CA 5JJ6A 3EU9A 5KJKA 3Q7FA 2J09A 1H0AA 4GZ3A 2KATA 2PM6A 3CKBA 4HVBA 2CG2A 4D10C 4JPSA 4I17A 2HR2A 2IONA 2XEVA 1WM5A 4JHJA 1UJJA 4X8QA 5FZSA 3NB2A 5KJLA 3L9TA 3VLEA 2L9BA 2PNNA 3BU8A 4HLLA 3EHMA 4ATZD 1FPPA 2XS1A 4CZ2D 4N2SA 2QZAA 3SNXA 3E4BA 3BQOA 1HZ4A 4URKA 4LNGA 4UWFA 2EIKE 2WXRA 3HVEA 5FZRA 3EHQA 3CIAA 3RJVA 1BPOA 2A4ZA 4UI9J 2WXNA 3MEKA 2C0MA 2RG8A 4HORA 2WPVA 3ZFWA 5B1BE 3TWWA 3W9FA 4Q94A 3ONKA 3ASNE 2XGMA 5D0QD 1ELKA 2X3MA 4B93B 2KCLA 3UTMA 5CBNA 2DZNA 3ZUVB 3FTZA 1S64A 4E6HA 3PDNA 3JQ1A 4NACA 3AAAC 2WXGA 1QBQA 4U8VD 4U0UA 3HXEA 3ZGQA 1TNZA 1JWGA 3QWVA 5A7DB 5BV1A 1SVXA 3GZSA 2WQ6A 4F3VA 5AQ7A 3WXXA 4AVXA 2F37A 3Q49B 3CVLA 4GTPA 2YINA 3L13A 2DBAA 3I3NA 4O6FA 4CDNA 3E37A 4JC8A 3ZHEA 5AQ9A 1UG3A 1BU9A 3AS5A 3ZYLA 3UX4A 1O5MA 3UUXA 5DBKA 3QAQA 2WXHA 4M3OA 2L6JA 2VSXE 2WM9A 5ANLA 3LJ3A 4HRLA 1JPLA 1A17A 3LPZA 4FJZA 3ZN3A 5BV0A 3CVWA 3L22A 3HDXA 1FVFA 2XRZA 4G8KA 5AENA 2BKKB 3HXBA 3SD5A 5JA4D 1RZ4A 3AS4A 2J8SD 3RK6A 3TL5A 3FU5A 1K3ZD 2BEDA 3ZRHA 4XZ4A 4JVSA 4J0UA 1U3DA 3UI2A 1NZNA 4G23A 2DYSE 1NL4A 4JEUA 4KZCA 4YDOA 3RIBA 3CK7A 3DSVA 4FJYA 2OEWA 2V8SE 3Q9UC 4N5QA 5CCMA 1WAO1 4XI9A 2ETCA 3URZA 4AIFA 2V5FA 4HI9A 3T8MA 4J8SA 2CHZA 1AWCB 2WXJA 3SBTB 4XX5A 4I6GA 2XZDG 4BT9A 2WQ7A 4WWPA 4G24A 3U64A 4GPKA 3D9MA 4FHKA 4RSYA 2MYOA 1N4QA 2Y4TA 3MV2B 4FLBA 5HQ8A 2XGOA 5G04J 4UUCA 2FF4A 4Q69A 2XRYA 1QQEA 1LF8A 3LVQE 2Y1LE 1PC2A 2WVIA 3CSFA 3ZXSA 5ARFA 1OWPA 4ILHB 4DI4A 3JCKC 2P9NG 2QYJA 4J8EA 3L54A 3TWSA 1KT0A 2X6KA 1JUQA 1OWOA 2OCCE 3S7DA 1AP7A 3ULYA 3ZIMA 3UKRG 4DX5D 1E8WA 1OXJA 1G3NB 3DPYA 2VQ2A 3EHNA 2Q7FA 3AG4E 3QKYA 3CSTA 2BTDA 2P9KG 4R7LA 4RQIA 4U0SA 1TJFA 4G11A 4G2VA 2H6HA 1N94A 2YNQA 3CVPA 4GA1A 2XCBA 4CT0A 3IHVA 5BUZA 4E85A 1YYHA 1P5QA 3MJWA 4J8FA 3G2SA 2J4DA 5AAOA 2XPIA 1IYGA 5EX3A 3C98A 5AARA 3CVNA 3ZKJA 2UWJG 3D9IA 3TWVA 3AU5A 3B7UX 4EZJA 2QY7A 3FUKA 4U04A 2IOLA 1FVHA 1E7VA 2LSUA 5D66A 3UM0A 4BT8A 2UY1B 1DC2A 3LCAA 1TJCA 2Y4UA 3HXCA 2P9IG 4WNDA 4UWKA 4AY5A 3CHSA 2MHKA 4JXTA 1YMPA 1OCOE 3CHOA 3ZU7B 2P9LG 1ZBPA 1N11A 3AS8A 4OVVA 3C5RA 2BUGA 4HB5A 5ENPD 4HRMB 5EKQD 5EYLA 1Z5SC 4AY6A 2CFUA 5IY5E 2ETAA 3FUDA 5G05J 2KZTA 1OWLA 4BSXA 2IOSA 2IEJA 2R02A 3TWTA 1XGWA 4U63A 3G2WA 3FP3A 3CVQA 3LYAA 3AG3E 1N9AA 3LS8A 4CGWA 4I1MA 4FHJA 3CVUA 4HQDA 4KVOA 3OAWA 1JCQA 1S63A 5D0OD 1HFAA 5CECB 3EU5A 2NYJA 4JD2G 2V4HC 3FFLA 3J5PA 3R7RA 5AJLA 1E8YA 4F7AA 2VTBA 3HHMA 5CEDB 4A1GA 4CDMA 3PZ3A 3Q15A 4GCNA 3OTNA 2WXKA 5ENSD 4C0MA 4CEMA 1ZB1A 1Z3YA 3G2UA 1MX4A 2NXPA 4K5AB 3ASHA 2MOWA 5BW8C 2GRLA 4HNAD 2FBNA 3PRZA 4DRXE 4GYWA 2XZTG 5AQAA 3EJNA 1KZPA 3ASOE 3MZLB 2ONDA 4EPZA 4I9EA 3AG2E 1BI8B 2XEEA 4KVMA 2P9UG 3PS6A 4FC8A 5ENRD 3TAXA 4GMRA 4A1SA 3O4ZA 4EZLA 5LFAA 3D3MA 3TXNA 2I9CA 3IEGA 1TN6A 5CRVA 3B7BA 4L7TA 5FINA 3NAWA 4HFGA 2I1KA 3NZSA 2KC7A 3SGHA 2IF4A 2VSYA 3L6AA 4LERA 4ACLA 2DCPA 2R5SA 4YDWA 4WAFA 5CCLA 4U0ZA 4ATGA 5FQ7A 5ARGA 3D9OA 1QYMA 3APFA 4LG6A 2XCCA 3TG4A 5EILA 4MRUA 5CEAA 3L08A 5LOZA 3PREA 2LAIA 3ZYQA 3HVEB 3ABKE 2V4LA 4U07A 5LP0A 3ONLA 1MYOA 3C3OA 3PUKA 1FT2A 2JLBA 4L2LA 1MZCA 4U7EB 4AXHA 3PZ4A 3KD7A 4ZFHA 5HRYA 2X6JA 4HXIA 1OCCE 1GW6A 3PE3A 5KCMA 3PVLA 2JABA 2J9QA 4PDXA 4ACKA 2ZGGA 4DK5A 3I5PA 4F1PA 3E33A 3SFXA 2F0YA 4HS2A 1SZAA 4GCOA 3NF1A 3HYMB 2R17C 1H2VC 1N95A 2DYRE 4KBQA 4JA7A 1Y6IA 4L1BA 4CT4A 3QOUA 2X6HA 3CGHA 2AXUA 2I1JA 2PQNA 5AQBA 4N3AA 2P9SG 4WNGA 3MYVA 3NOGD 3F6QA 1VDYA 3ISMC 2KCVA 2E2EA 3ULQA 1K8KG 3I4GA 4BEPA 2WXMA 4DJAA 5KNHD 4B0ZA 3BUAA 4ANVA 2LXLA 3MCXA 3PH0C 3W9GA 4IULA 4M7CA 4UWHA 4ZHBA 1OWMA 3DXKG 3PZ2A 1HE8A 4L9PA 3MX3A 3MKQA 3T5VA 4RLYA 5C1DA 4U8YD 1WDYA 1JWFA 5ENTD 2VGXB 1D8DA 4K5BA 1L5JA 4IRUA 3S7BA 4DI3A 1N4SA 4KXKB 1SQMA 1UN8A 3CQGB 1INZA 2CHXA 3FTVA 1Y8MA 5CERB 4ME2A 2IO3C 2J07A 4O1OA 1TN8A 3UT4A 1IHBA 1YCSB 4B8AA 5KWDA 3FUMA 2AW6A 2YQ8A 3FU0A 2FO7A 3U9WA 5HS0A 4K03A 1HH8A 3QWPA 4APOA 2PM7A 3T8KA 3B7SA 4B8CB 4IYPA 4GMLA 2B0OE 2JEKA 1NP7A 3OXLA 4PS8A 3L82A 3WG7E 1UOHA 4AV7A 2FULA 3B7RL 2WMNA 3B95A 4A63B 2XGSA 4F1SA 4JL0A 1MHQA 4I9CA 3CHQA 4EECA 2DWZA 4DLOA 4P29A 3IV0A 5E76A 3ABME 3X2QE 4LSZE 1KPSB 3DRAA 5AIJA 1TR4A 2R05A 4C9BB 4GZ5A 4NQ0A 3CHRA 5G2NA 3BG0B 4TXRA 2XS8A 4XE0A 5JMND 1IQRA 4I2ZA 1KT1A 3UT8A 3OXGA 3UM1A 2GRNB 3OXFA 5EDSA 1TEZA 1N54A 3UIOC 4BX9A 3D9JA 5BXOA 1TNUA 3FTWA 3DWLG 1ZU2A 3FU3A 1Z3XA 1NFIE 3B13A 4ILIA 5EIBE 5T4YA 2HO1A 3DEPA 3V79K 4HBDA 4UQXA 2FEZA 3FDHA 3AG1E 1Q2ZA 1TNBA 4GYOA 3CV0A 3DBSA 2C2LA 1H6PA 4GTQA 3HRAA 4RG9A 2ETBA 2PQRA 3FWVA 4B89A 4QFVA 4G8LA 1TNOA 3KSQA 3ML9A 3ESLA 4G1TA 3LY9A 3FUFA 4I6JA 4MS6A 3FTYA 3U3WA 3HXDA 4BESA 2AJAA 4A3TA 2ZIRA 4O60A 3E30A 2GW1A 2L6BA 4GTTA 4OVUA 4OAUC 3FTXA 4GZCA 3DSTA 2AXVA 2ZGDA 3ASFA 4DPRA 1HU3A 4JZYA 3LY7A 3CKCA 4EBAG 3EDTB 4YNDA 5M72A 5EX0A 3TWUA 3LJNA 3UINC 3IBEA 3HIZA 4WWNA 1EF1C 3DPDA 5FTPA 2M63A 3RRNB 4CYMD 1QNFA 3PUJA 4GMJA 4F53A 2AXZA 4YDEA 3LY8A 2OVFA 3QJZA 3CVYA 3CHMA 3TXMA 5FIOA 1E7UA 4K5CA 4MBGA 3FH8A 2X38A 3ESKA 2DVWA 4CRWA 3LXUX 3DSXA 5CMYA 4N39A 4BY6A 3V31A 3Q78A 4G26A 3AJIA 3K9IA 2WXOA 3ZW3A 5G05C 3U4TA 1S0PA 3IXEA 3TJPA 4LNBA 1X5BA 4FULA 2WMOA 3ZHEB 4NURA 4UQZA 3Q7AA 5FQ4A 4CCAA 2R2LA 1N0RA 4C48B 2H6IA 2A5UA 3SO8A 2J08A 3VLFA 1MQSA 3RO2A 2I2OA 3Q79A 4IN3B 3R7QA 3Q9NC 1ELWA 3IHYA 4A55A 4GTRA 2J49A 4XIFA 3FTSA 3LVRE 4AJWA 5HKPA 3ZVVA 1EPUA 4FLHA 4EBAA 4BFRA 1W3BA 4F6RD 5JHBA 2BKGA 2WXFA 2VGYA 2XEHA 4UI9K 4BX8A 3C72A 3ZYMA 1H2TC 3RRUA 4CDRA 1N4RA 1Z6TA 4GZDA 1WG0A 1OY3D 3CQCB 2XQ0A 2RD0A 4W9RA 5ENOD 3D9NA 2HE0A 3QB2A 3NBNB 2RFMA 2V5QC 1EYHA 2NSZA 1KZOA 4XKBA 3T5XA 3SI5A 1H19A 2LO6A 4WUYA 2WXPA 4C0EA 4XI0A 3Q47B 2XHEA 4LNUD 3SZ7A 3FU6A 1H6OA 3LEWA 5AJDA 4ANUA 5CHEE 1H2UA 2QFCA 4YDYA 3RU0A 3D9HA 1E8XA 4FU3A 4GA0A 3QC1A 4WNFA 4BSZB 4BERA 4RG6A 3FEYA 4XKCA 1KLXA 3ZPJA 3QNKA 3ML8A 5A6CA 3ZNGA 1X81A 4I43A 3FUJA 2LSVA 4HOUA 4LCTA 3DXMG 3CVVA 4JB8P 4I2WA 1ELRA 3N71A 4HLEA 1DCQA 2GROB 3NOCD 1LD8A 3CVXA 3I4RB 2F8YA 3MKRA 4FADA 3UQ3A 3CEQA 5KJMA 3UPVA 3D9PA 1YA0A 4DX7D 2P9PG 1V54E 5LX8A 3P1UA 1BLXB 2WXQA 4BWRA 5G04C 2EIJE 2EILE 3C3RA 1UJKA 5HI7A 3FUNA 4MLPA 2GRRB 4U8HA 5EYPF 4K0RA 2KM4A 4WNEA 2PZIA 2C0LA 4H7XA 3VLDA 5ENQD 5D2MC 4UWGA 4UI9C 3PNTB 1JCRA 3CK9A 4CGVA 1DNPA 2CG3A 3NQPA 1TYQG 3EHRA 1HXIA 3R9AB 2QYUA 3MV3B 3FEXA 4PUCA 5ANRA 4ILGA 3KS2A 3CR3A 1HG5A 4JHKA 3R9MA 3TGOA 3PEVB 2MRIA 5BT1A 5J90A 4KMOA 1MX2A 4KYOB 1U2VG 3MKQB 2GRQB 4TV3A 3ASDA 4XEIG 3NZUA 3FH5A 5A23A 4Y6CA 3SFZA 1HF8A 2QC9A 3HG0D 3ZYKA 2VGXA 2KBXA 1OCRE 1RW2A 1H6KA 1A5EA 1SW6A 3CK8A 2XENA 1U3CA 4GAAA 3SF4A 2E0IA 5BXUA 4BTBA 3PZ1A 3JXJA 3MGBA 4LEUA 1DCEA 2CFZA 5AN8A 1IQUA 3KAEA 4J7WA 3V30A 2H6FA 3FUEA 4AM9A 4Y6WA 3Q75A 3VTXA 4B94A 4G25A 4KZ0A 5KJNA 5FQ6A 5LCWC 3FUIA 2EQXA 4HOTA 3S2AA 2P2CP 5FQ8A 4GTVA 1O1SA 2GRPB 3FTUA 4I1OB 2CHWA 4AP2A 4J6IA 4GU5A 1MX6A 2Y3AA 3APCA 1HS6A 5EN5D 1HX8A 5FWQA 2P58C 4TUUA 1OT8A 2VSOE 3DSUA 1K1AA 2R59A 4FP7A 4DX1A 2B6CA 4HRNA 3SHFA 3DEOA 2IJGX 3FHEA 3TWRA 3DSWA 3O48A 2WQHA 3QK0A 2RFAA 2IFUA 4PS3A 1XNFA 2AVPA 4GZ6A 2XPYA 5JJ7A 3V2XA 3JUEA 3FUHA 2VYIA 5KBAA 1QZ2A 3EIQC 3JXIA 4AEZC 3SY2A 5DIZA 4TXQA 2VJ8A 3S7JA 3KEZA 4GB9A 5T8IA 5T3RA 3UM3A 5BNWA 1BI7B 3PE4A 2IO2C 3SBSA 3UIPC 1UN9A 2FO1E 4Q96A 2IU1A 5AYWD 4JHRA 3D9KA 4MKTA 3QDNA 1E96B 3E32A 3MA5A 5B1AE 3ZXPA 4OAVB 4KT6B 3UXGA 1NA3A 2X6FA 3IKOB 2LAHA 4H7YA 3BEEA 1LD7A 2FI7A 5CRUA 3EUVA 4N2QA 4GPMA 1HG2A 1NI1A 1HO8A 2YHCA 5LCWJ 1NA0A 1IKND 3DSSA 2OVBA 4AOFA 4A3VA 1E8ZA 4UQYA 1PY1A 3SQVA 1EDUA 3P2BA 2KZTB 3G2TA 1OCZE 3RRMB 2EINE 4L23A 3BG1B 3TG5A 4GA2A 3C3QA 1SZ9A 3VTYA 3S7FA 4O1PA 2X6IA 5KNGA 1SA5A 4TRQA 3UT7A 4TXPA 2VTBB 4L2YA 2GRMA 2H6GA 2WXLA 2PL2A 1K1BA 2HYZA 4ABNA 5ITZF 3PZDA 4Z68A 4BTAA 2IQCA 1B89A 3JQ0A 1IXVA 1N0QA 5JHAA 5FT9A 4YVOA 4I6EA 1MJ0A 1WY6A 2I6HA 3LDZA 4RVBA 2RKKA 3RO3A 4APFA 1LTXA 5JJTA 3JUIA 1N4PA 2L0IA 5FJYA 3KSLA 3RKVA 3KEAA 3FY4A 2IY0C 2ZISA 4JA9A 1O1RA 5G55A 2NC9A 2L0TB 2WB2A 3GW4A 3TWQA 4GTSA 4EZKA 3ABLE 4FA6A 3CLJA
chains in the Genus database with same CATH topology
5ENNA 1E8XA 3MX3A 2UY1A 3MKQA 2WXIA 4N5CA 4FU3A 2Y4TA 3MV2B 4NRHB 4V3IA 5C1DA 4FLBA 4GA0A 5HQ8A 1UW4B 2XGOA 3QC1A 1JWFA 3GZ2A 4DLQA 2VGXB 1PAQA 5G04J 4WNFA 4N3BA 3AU4A 1L5JA 4IRUA 4RG6A 3S7BA 4DI3A 3FEYA 2FF4A 4XKCA 1DVPA 1KLXA 4KXKB 4Q69A 2XRYA 3ZPJA 1SQMA 2J4BA 3QNKA 1QQEA 4JW1A 1UN8A 3ML8A 1E90A 3CQGB 1LF8A 1INZA 2CHXA 3LVQE 3FTVA 5A6CA 4I43A 3FUJA 2LSVA 4HOUA 1Y8MA 4LCTA 1PC2A 2V0PA 2WVIA 4ME2A 3CSFA 3ZXSA 2J07A 3FH7A 5ARFA 1OWPA 3CVVA 4I2WA 3D9LA 1ELRA 3N71A 4GYYA 4ILHB 4DI4A 3JCKC 4HLEA 3UT4A 3JYSA 4J8EA 3L54A 4B8AA 3UMVA 1KT0A 2X6KA 3CVXA 3I4RB 1JUQA 1OWOA 3S7DA 3FUMA 2AW6A 3ZIMA 2VSNA 2YQ8A 5J08A 3MKRA 4FADA 2OV8A 3FU0A 3UQ3A 2GGFA 1E8WA 3CEQA 3QARA 5KJMA 3UPVA 3D9PA 4LUNU 1YA0A 2FO7A 2VQ2A 3EHNA 3U9WA 2YHEA 5LX8A 2Q7FA 3P1UA 3PEUB 3QKYA 3CSTA 4ANWA 4K03A 3Q5MA 2WXQA 3PNLB 5G04C 4BWRA 1HH8A 4J8DA 2BTDA 3QWPA 4R7LA 4APOA 1UJKA 2PM7A 3B7SA 4U0SA 5HI7A 4B8CB 4I1AA 3FUNA 4MLPA 4U8HA 4K0RA 5CMWA 2KM4A 4WNEA 3ENEA 1TJFA 4G11A 4G2VA 4GMLA 4IYPA 2JEKA 2PZIA 3ASGA 2C0LA 2YNQA 4JEHA 4H7XA 3VLDA 1NP7A 3CVPA 4UWGA 4GA1A 2XCBA 4CT0A 4UI9C 2KCKA 3IHVA 4PS7A 2OOEA 3OXLA 3PNTB 3QWWA 5BUZA 4E85A 4PS8A 2DIWA 1P5QA 3MJWA 3FULA 4PH4B 4J8FA 3G2SA 2J4DA 3CK9A 4CGVA 2XPIA 1DNPA 2CG3A 2XPZA 3NQPA 3R9AB 1HXIA 4HOSA 2LNIA 5EX3A 1IYGA 3C98A 3CVNA 3MV3B 3FEXA 1IHGA 4AV7A 2FULA 3ZEFA 3CHPA 2UWJG 3B7RL 3D9IA 4PUCA 4ILGA 5ANRA 3KS2A 3AU5A 3B7UX 3CR3A 3EIJA 1HG5A 4JHKA 4EZJA 2WMNA 3Q4AB 3TGOA 3PEVB 2QY7A 2AWIA 2XGSA 2MRIA 3FUKA 4U04A 4F1SA 4JL0A 2IOLA 4HOQA 1MHQA 3L17A 1FVHA 5BT1A 2ILRA 1E7VA 4OYSA 4KMOA 5J90A 2LSUA 5C2YA 4I9CA 3CHQA 2HM8A 4KYOB 4BT8A 2UY1B 3MKQB 4EECA 4DLOA 4P29A 3GYZA 3IV0A 4YVQC 5E76A 4TV3A 3ASDA 3LCAA 5AIJA 1TJCA 2Y4UA 3FH5A 3NZUA 5A23A 4Y6CA 3SFZA 3APDA 1HF8A 4GZ5A 4C9BB 3L16A 3CHRA 4NQ0A 5G2NA 3BG0B 4WNDA 4UWKA 4XE0A 4AY5A 3CHSA 2MHKA 4JXTA 3ZYKA 2VGXA 1IQRA 4I2ZA 1KT1A 1H6KA 3LKUA 3CHOA 3UT8A 3CK8A 3OXGA 1U3CA 4GAAA 1ZBPA 3G2VA 3AS8A 5FZQA 2BF0X 3SF4A 2E0IA 3U66A 1N52A 3OXFA 4OVVA 5EDSA 1FCHA 1TEZA 1OWNA 4BTBA 1N54A 2BUGA 4UWLA 4BX9A 5E75A 4LRZA 1OUVA 3MGBA 5EKQD 3GZ1A 4ANXA 4LEUA 3D9JA 4EQFA 2CFZA 1IQUA 3FTWA 4WWOA 1ZU2A 2ZU6B 4AY6A 3KAEA 2CFUA 3FU3A 3FUDA 1Z3XA 5BPPA 3FUEA 3B13A 4AM9A 4ILIA 4Y6WA 5T4YA 2HO1A 5G05J 2KZTA 1OWLA 3B7TA 4BSXA 2IOSA 4N3CA 3VTXA 5JJ6A 4B94A 4G25A 4KZ0A 5KJNA 5FQ6A 5KJKA 5LCWC 1XGWA 4U63A 3G2WA 2EQXA 3FUIA 4UQXA 2FEZA 3FDHA 2J09A 3FP3A 4HOTA 1H0AA 4GZ3A 3S2AA 3CVQA 5FQ8A 3LYAA 4GYOA 2KATA 2PM6A 3CKBA 3CV0A 3LS8A 3DBSA 4HVBA 2CG2A 3FTUA 4I1OB 2C2LA 4CGWA 2CHWA 4I1MA 4D10C 4FHJA 3CVUA 4RG9A 4AP2A 4KVOA 3OAWA 4JPSA 4J6IA 4GU5A 2Y3AA 4I17A 5D0OD 3APCA 1HFAA 2PQRA 2HR2A 2IONA 1HS6A 3FFLA 3R7RA 1HX8A 3FWVA 4B89A 4QFVA 5AJLA 2XEVA 1E8YA 5FWQA 1WM5A 2P58C 4JHJA 1UJJA 4TUUA 3HHMA 2VSOE 4F7AA 2VTBA 3ML9A 5FZSA 4A1GA 4CDMA 3ESLA 4G1TA 3LY9A 3Q15A 5KJLA 4GCNA 3VLEA 3OTNA 2L9BA 3FUFA 2R59A 4I6JA 2WXKA 4MS6A 3FTYA 3EHMA 4FP7A 4C0MA 3U3WA 4N2SA 4CEMA 4A3TA 3SNXA 3E4BA 3SHFA 1HZ4A 4URKA 2IJGX 1Z3YA 3FHEA 4UWFA 2WXRA 3O48A 3G2UA 2NXPA 2WQHA 3ASHA 3QK0A 2IFUA 2MOWA 5BW8C 4PS3A 1XNFA 2GRLA 3HVEA 2AVPA 5FZRA 2GW1A 2FBNA 3PRZA 3CIAA 4GZ6A 2XPYA 3RJVA 1BPOA 2A4ZA 4OVUA 4GYWA 5JJ7A 4UI9J 2WXNA 3EJNA 2C0MA 2RG8A 3FTXA 3MEKA 3MZLB 2WPVA 4GZCA 4HORA 2ONDA 2AXVA 3ASFA 3ZFWA 4DPRA 3FUHA 4EPZA 1HU3A 2VYIA 4I9EA 4JZYA 4Q94A 1QZ2A 3ONKA 3EIQC 3LY7A 2XGMA 4AEZC 3CKCA 4EBAG 5D0QD 1ELKA 2X3MA 4KVMA 2KCLA 5DIZA 3EDTB 4YNDA 2VJ8A 3S7JA 3PS6A 3KEZA 5M72A 4FC8A 4GB9A 3TAXA 4A1SA 5T8IA 5T3RA 5BNWA 3O4ZA 4EZLA 3FTZA 5EX0A 5LFAA 3PE4A 4E6HA 3PDNA 3JQ1A 3SBSA 3IBEA 4NACA 3HIZA 3D3MA 3TXNA 4WWNA 2I9CA 1EF1C 1UN9A 3IEGA 2WXGA 3DPDA 4Q96A 5FTPA 4U0UA 2IU1A 2M63A 3RRNB 1QNFA 3PUJA 4GMJA 3ZGQA 4F53A 1JWGA 5AYWD 4L7TA 2AXZA 3QWVA 5A7DB 4HFGA 3LY8A 5BV1A 4JHRA 3D9KA 2OVFA 3QJZA 3QDNA 2I1KA 3NZSA 2KC7A 3CHMA 4MKTA 3TXMA 3CVYA 1E96B 3SGHA 2IF4A 3GZSA 3MA5A 1E7UA 2WQ6A 3FH8A 2VSYA 2X38A 3L6AA 4F3VA 4LERA 4ACLA 4KT6B 3ESKA 1NA3A 3WXXA 2DCPA 4AVXA 2X6FA 3IKOB 3Q49B 2LAHA 4CRWA 2R5SA 3CVLA 3LXUX 4H7YA 3BEEA 2FI7A 4WAFA 5CMYA 4N2QA 2YINA 5CCLA 4N39A 3L13A 4BY6A 4U0ZA 1HG2A 4ATGA 5FQ7A 5ARGA 3D9OA 2DBAA 4G26A 1HO8A 2YHCA 3K9IA 3I3NA 2WXOA 4O6FA 5LCWJ 4CDNA 3ZW3A 5G05C 3U4TA 1NA0A 3APFA 4JC8A 3ZHEA 1S0PA 2XCCA 1UG3A 3TG4A 3TJPA 3AS5A 2OVBA 4MRUA 3UX4A 3UUXA 3ZYLA 1X5BA 4AOFA 3L08A 4FULA 2WMOA 5DBKA 3ZHEB 5LOZA 1E8ZA 3PREA 4A3VA 2LAIA 4UQYA 1PY1A 4NURA 1EDUA 3P2BA 2KZTB 2WXHA 3G2TA 3QAQA 4M3OA 3ZYQA 4UQZA 3HVEB 2L6JA 3RRMB 5FQ4A 2VSXE 2WM9A 2V4LA 4CCAA 4L23A 3BG1B 5ANLA 3TG5A 3LJ3A 4GA2A 4U07A 1JPLA 1A17A 3LPZA 5LP0A 3ONLA 4FJZA 3ZN3A 1SZ9A 3VTYA 5BV0A 3CVWA 2A5UA 3S7FA 3L22A 2X6IA 3HDXA 1FVFA 3PUKA 2J08A 2XRZA 2JLBA 4L2LA 3VLFA 4TRQA 3UT7A 4AXHA 1MQSA 5AENA 3RO2A 2I2OA 3SD5A 2VTBB 4IN3B 3KD7A 3R7QA 3AS4A 4L2YA 3RK6A 2GRMA 1ELWA 3IHYA 4A55A 3TL5A 2X6JA 2WXLA 4HXIA 2PL2A 3FU5A 1GW6A 3PE3A 5KCMA 3T5VA 2J49A 4XIFA 2HYZA 4ABNA 3PVLA 3FTSA 3LVRE 3PZDA 4AJWA 4BTAA 2IQCA 3ZRHA 3ZVVA 1EPUA 1B89A 3JQ0A 4FLHA 4XZ4A 4EBAA 4BFRA 2J9QA 1W3BA 4JVSA 4PDXA 4J0UA 1U3DA 4ACKA 5JHBA 4DK5A 2WXFA 5JHAA 5FT9A 3I5PA 2VGYA 1NZNA 4G23A 4YVOA 4I6EA 4UI9K 4BX8A 3ZYMA 1H2TC 3RRUA 4CDRA 1WY6A 4JEUA 1Z6TA 4GZDA 4HS2A 2I6HA 1SZAA 3CQCB 3LDZA 2XQ0A 2RD0A 4KZCA 4RVBA 4GCOA 4W9RA 3NF1A 3D9NA 2R17C 3HYMB 3RIBA 1H2VC 3CK7A 3RO3A 4KBQA 4JA7A 1Y6IA 3QB2A 4FJYA 4L1BA 4APFA 4CT4A 3QOUA 5JJTA 2V8SE 3JUIA 5CCMA 1EYHA 2X6HA 3CGHA 2NSZA 1WAO1 2AXUA 4XI9A 2I1JA 2PQNA 2L0IA 4XKBA 3T5XA 3SI5A 5FJYA 3URZA 1H19A 4N3AA 2LO6A 4WUYA 3RKVA 4WNGA 3MYVA 4AIFA 2V5FA 3FY4A 1VDYA 3T8MA 2KCVA 2E2EA 3ULQA 3I4GA 2WXPA 4J8SA 2CHZA 4C0EA 2WXMA 4DJAA 4JA9A 3Q47B 4XI0A 2WXJA 4B0ZA 4ANVA 2XHEA 3MCXA 3PH0C 4XX5A 5G55A 4I6GA 3SBTB 3SZ7A 2NC9A 4BT9A 3FU6A 4IULA 2WQ7A 2L0TB 3LEWA 4UWHA 2WB2A 5AJDA 3GW4A 4WWPA 4G24A 3U64A 4ANUA 5CHEE 1H2UA 4GPKA 3D9MA 4FHKA 4RSYA 4EZKA 2QFCA 1OWMA 4FA6A 3CLJA 3RU0A 1HE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQC B;  3I4R B;  3CQG B; 
#chains in the Genus database with same CATH topology
 5ENN A;  1V55 E;  4DX6 D;  4N5C A;  2UY1 A;  2WXI A;  4NRH B;  1TNY A;  4V3I A;  4J8Y A;  1UW4 B;  3GZ2 A;  4DLQ A;  1PAQ A;  4QQI A;  4N3B A;  3AU4 A;  1BD8 A;  5H7P A;  1DVP A;  2J4B A;  4JW1 A;  1E90 A;  2Y69 E;  2F8X K;  4GTM A;  2V0P A;  3FH7 A;  5EID A;  3D9L A;  4GYY A;  4U95 D;  3Q73 A;  3JYS A;  3UMV A;  2VSN A;  5J08 A;  2OV8 A;  1JCS A;  2GGF A;  3QAR A;  3UM2 A;  4LUN U;  2YHE A;  3SFY A;  3PEU B;  4ANW A;  3Q5M A;  3PNL B;  4J8D A;  1FT1 A;  4U96 D;  3UKU G;  4I1A A;  3HXF A;  5CMW A;  3RSE G;  3ENE A;  4BET A;  3RAU A;  3ASG A;  4JEH A;  2VGE A;  4HI8 A;  3E34 A;  2KCK A;  4PS7 A;  2OOE A;  3TWX A;  3QWW A;  2DIW A;  4DX2 A;  3FUL A;  4PH4 B;  2A5E A;  2XPZ A;  4HOS A;  2LNI A;  1D8E A;  1IHG A;  3ZEF A;  3CHP A;  2DZO A;  3V2O A;  4GTO A;  2LXM A;  3EIJ A;  3Q4A B;  2AWI A;  2EIM E;  4HOQ A;  1S70 B;  3L17 A;  2ILR A;  4OYS A;  5C2Y A;  4EHM A;  2HM8 A;  3ULE G;  3GYZ A;  4YVQ C;  3J5Q B;  3T9K A;  4NIK A;  2OEV A;  2ZXW E;  3APD A;  4DUI A;  3L16 A;  2R03 A;  2KXP C;  3LKU A;  1D9S A;  2LUH A;  3G2V A;  5CBO A;  5FZQ A;  2BF0 X;  2Y0B G;  3U66 A;  1SA4 A;  1N52 A;  1FCH A;  1OWN A;  1O1T A;  4UWL A;  5E75 A;  4LRZ A;  1OUV A;  4ANX A;  3GZ1 A;  4EQF A;  4WWO A;  2ZU6 B;  4TUM A;  5BPP A;  5B3S E;  1TN7 A;  3B7T A;  4N3C A;  5JJ6 A;  3EU9 A;  5KJK A;  3Q7F A;  2J09 A;  1H0A A;  4GZ3 A;  2KAT A;  2PM6 A;  3CKB A;  4HVB A;  2CG2 A;  4D10 C;  4JPS A;  4I17 A;  2HR2 A;  2ION A;  2XEV A;  1WM5 A;  4JHJ A;  1UJJ A;  4X8Q A;  5FZS A;  3NB2 A;  5KJL A;  3L9T A;  3VLE A;  2L9B A;  2PNN A;  3BU8 A;  4HLL A;  3EHM A;  4ATZ D;  1FPP A;  2XS1 A;  4CZ2 D;  4N2S A;  2QZA A;  3SNX A;  3E4B A;  3BQO A;  1HZ4 A;  4URK A;  4LNG A;  4UWF A;  2EIK E;  2WXR A;  3HVE A;  5FZR A;  3EHQ A;  3CIA A;  3RJV A;  1BPO A;  2A4Z A;  4UI9 J;  2WXN A;  3MEK A;  2C0M A;  2RG8 A;  4HOR A;  2WPV A;  3ZFW A;  5B1B E;  3TWW A;  3W9F A;  4Q94 A;  3ONK A;  3ASN E;  2XGM A;  5D0Q D;  1ELK A;  2X3M A;  4B93 B;  2KCL A;  3UTM A;  5CBN A;  2DZN A;  3ZUV B;  3FTZ A;  1S64 A;  4E6H A;  3PDN A;  3JQ1 A;  4NAC A;  3AAA C;  2WXG A;  1QBQ A;  4U8V D;  4U0U A;  3HXE A;  3ZGQ A;  1TNZ A;  1JWG A;  3QWV A;  5A7D B;  5BV1 A;  1SVX A;  3GZS A;  2WQ6 A;  4F3V A;  5AQ7 A;  3WXX A;  4AVX A;  2F37 A;  3Q49 B;  3CVL A;  4GTP A;  2YIN A;  3L13 A;  2DBA A;  3I3N A;  4O6F A;  4CDN A;  3E37 A;  4JC8 A;  3ZHE A;  5AQ9 A;  1UG3 A;  1BU9 A;  3AS5 A;  3ZYL A;  3UX4 A;  1O5M A;  3UUX A;  5DBK A;  3QAQ A;  2WXH A;  4M3O A;  2L6J A;  2VSX E;  2WM9 A;  5ANL A;  3LJ3 A;  4HRL A;  1JPL A;  1A17 A;  3LPZ A;  4FJZ A;  3ZN3 A;  5BV0 A;  3CVW A;  3L22 A;  3HDX A;  1FVF A;  2XRZ A;  4G8K A;  5AEN A;  2BKK B;  3HXB A;  3SD5 A;  5JA4 D;  1RZ4 A;  3AS4 A;  2J8S D;  3RK6 A;  3TL5 A;  3FU5 A;  1K3Z D;  2BED A;  3ZRH A;  4XZ4 A;  4JVS A;  4J0U A;  1U3D A;  3UI2 A;  1NZN A;  4G23 A;  2DYS E;  1NL4 A;  4JEU A;  4KZC A;  4YDO A;  3RIB A;  3CK7 A;  3DSV A;  4FJY A;  2OEW A;  2V8S E;  3Q9U C;  4N5Q A;  5CCM A;  1WAO 1;  4XI9 A;  2ETC A;  3URZ A;  4AIF A;  2V5F A;  4HI9 A;  3T8M A;  4J8S A;  2CHZ A;  1AWC B;  2WXJ A;  3SBT B;  4XX5 A;  4I6G A;  2XZD G;  4BT9 A;  2WQ7 A;  4WWP A;  4G24 A;  3U64 A;  4GPK A;  3D9M A;  4FHK A;  4RSY A;  2MYO A;  1N4Q A;  2Y4T A;  3MV2 B;  4FLB A;  5HQ8 A;  2XGO A;  5G04 J;  4UUC A;  2FF4 A;  4Q69 A;  2XRY A;  1QQE A;  1LF8 A;  3LVQ E;  2Y1L E;  1PC2 A;  2WVI A;  3CSF A;  3ZXS A;  5ARF A;  1OWP A;  4ILH B;  4DI4 A;  3JCK C;  2P9N G;  2QYJ A;  4J8E A;  3L54 A;  3TWS A;  1KT0 A;  2X6K A;  1JUQ A;  1OWO A;  2OCC E;  3S7D A;  1AP7 A;  3ULY A;  3ZIM A;  3UKR G;  4DX5 D;  1E8W A;  1OXJ A;  1G3N B;  3DPY A;  2VQ2 A;  3EHN A;  2Q7F A;  3AG4 E;  3QKY A;  3CST A;  2BTD A;  2P9K G;  4R7L A;  4RQI A;  4U0S A;  1TJF A;  4G11 A;  4G2V A;  2H6H A;  1N94 A;  2YNQ A;  3CVP A;  4GA1 A;  2XCB A;  4CT0 A;  3IHV A;  5BUZ A;  4E85 A;  1YYH A;  1P5Q A;  3MJW A;  4J8F A;  3G2S A;  2J4D A;  5AAO A;  2XPI A;  1IYG A;  5EX3 A;  3C98 A;  5AAR A;  3CVN A;  3ZKJ A;  2UWJ G;  3D9I A;  3TWV A;  3AU5 A;  3B7U X;  4EZJ A;  2QY7 A;  3FUK A;  4U04 A;  2IOL A;  1FVH A;  1E7V A;  2LSU A;  5D66 A;  3UM0 A;  4BT8 A;  2UY1 B;  1DC2 A;  3LCA A;  1TJC A;  2Y4U A;  3HXC A;  2P9I G;  4WND A;  4UWK A;  4AY5 A;  3CHS A;  2MHK A;  4JXT A;  1YMP A;  1OCO E;  3CHO A;  3ZU7 B;  2P9L G;  1ZBP A;  1N11 A;  3AS8 A;  4OVV A;  3C5R A;  2BUG A;  4HB5 A;  5ENP D;  4HRM B;  5EKQ D;  5EYL A;  1Z5S C;  4AY6 A;  2CFU A;  5IY5 E;  2ETA A;  3FUD A;  5G05 J;  2KZT A;  1OWL A;  4BSX A;  2IOS A;  2IEJ A;  2R02 A;  3TWT A;  1XGW A;  4U63 A;  3G2W A;  3FP3 A;  3CVQ A;  3LYA A;  3AG3 E;  1N9A A;  3LS8 A;  4CGW A;  4I1M A;  4FHJ A;  3CVU A;  4HQD A;  4KVO A;  3OAW A;  1JCQ A;  1S63 A;  5D0O D;  1HFA A;  5CEC B;  3EU5 A;  2NYJ A;  4JD2 G;  2V4H C;  3FFL A;  3J5P A;  3R7R A;  5AJL A;  1E8Y A;  4F7A A;  2VTB A;  3HHM A;  5CED B;  4A1G A;  4CDM A;  3PZ3 A;  3Q15 A;  4GCN A;  3OTN A;  2WXK A;  5ENS D;  4C0M A;  4CEM A;  1ZB1 A;  1Z3Y A;  3G2U A;  1MX4 A;  2NXP A;  4K5A B;  3ASH A;  2MOW A;  5BW8 C;  2GRL A;  4HNA D;  2FBN A;  3PRZ A;  4DRX E;  4GYW A;  2XZT G;  5AQA A;  3EJN A;  1KZP A;  3ASO E;  3MZL B;  2OND A;  4EPZ A;  4I9E A;  3AG2 E;  1BI8 B;  2XEE A;  4KVM A;  2P9U G;  3PS6 A;  4FC8 A;  5ENR D;  3TAX A;  4GMR A;  4A1S A;  3O4Z A;  4EZL A;  5LFA A;  3D3M A;  3TXN A;  2I9C A;  3IEG A;  1TN6 A;  5CRV A;  3B7B A;  4L7T A;  5FIN A;  3NAW A;  4HFG A;  2I1K A;  3NZS A;  2KC7 A;  3SGH A;  2IF4 A;  2VSY A;  3L6A A;  4LER A;  4ACL A;  2DCP A;  2R5S A;  4YDW A;  4WAF A;  5CCL A;  4U0Z A;  4ATG A;  5FQ7 A;  5ARG A;  3D9O A;  1QYM A;  3APF A;  4LG6 A;  2XCC A;  3TG4 A;  5EIL A;  4MRU A;  5CEA A;  3L08 A;  5LOZ A;  3PRE A;  2LAI A;  3ZYQ A;  3HVE B;  3ABK E;  2V4L A;  4U07 A;  5LP0 A;  3ONL A;  1MYO A;  3C3O A;  3PUK A;  1FT2 A;  2JLB A;  4L2L A;  1MZC A;  4U7E B;  4AXH A;  3PZ4 A;  3KD7 A;  4ZFH A;  5HRY A;  2X6J A;  4HXI A;  1OCC E;  1GW6 A;  3PE3 A;  5KCM A;  3PVL A;  2JAB A;  2J9Q A;  4PDX A;  4ACK A;  2ZGG A;  4DK5 A;  3I5P A;  4F1P A;  3E33 A;  3SFX A;  2F0Y A;  4HS2 A;  1SZA A;  4GCO A;  3NF1 A;  3HYM B;  2R17 C;  1H2V C;  1N95 A;  2DYR E;  4KBQ A;  4JA7 A;  1Y6I A;  4L1B A;  4CT4 A;  3QOU A;  2X6H A;  3CGH A;  2AXU A;  2I1J A;  2PQN A;  5AQB A;  4N3A A;  2P9S G;  4WNG A;  3MYV A;  3NOG D;  3F6Q A;  1VDY A;  3ISM C;  2KCV A;  2E2E A;  3ULQ A;  1K8K G;  3I4G A;  4BEP A;  2WXM A;  4DJA A;  5KNH D;  4B0Z A;  3BUA A;  4ANV A;  2LXL A;  3MCX A;  3PH0 C;  3W9G A;  4IUL A;  4M7C A;  4UWH A;  4ZHB A;  1OWM A;  3DXK G;  3PZ2 A;  1HE8 A;  4L9P A;  3MX3 A;  3MKQ A;  3T5V A;  4RLY A;  5C1D A;  4U8Y D;  1WDY A;  1JWF A;  5ENT D;  2VGX B;  1D8D A;  4K5B A;  1L5J A;  4IRU A;  3S7B A;  4DI3 A;  1N4S A;  4KXK B;  1SQM A;  1UN8 A;  3CQG B;  1INZ A;  2CHX A;  3FTV A;  1Y8M A;  5CER B;  4ME2 A;  2IO3 C;  2J07 A;  4O1O A;  1TN8 A;  3UT4 A;  1IHB A;  1YCS B;  4B8A A;  5KWD A;  3FUM A;  2AW6 A;  2YQ8 A;  3FU0 A;  2FO7 A;  3U9W A;  5HS0 A;  4K03 A;  1HH8 A;  3QWP A;  4APO A;  2PM7 A;  3T8K A;  3B7S A;  4B8C B;  4IYP A;  4GML A;  2B0O E;  2JEK A;  1NP7 A;  3OXL A;  4PS8 A;  3L82 A;  3WG7 E;  1UOH A;  4AV7 A;  2FUL A;  3B7R L;  2WMN A;  3B95 A;  4A63 B;  2XGS A;  4F1S A;  4JL0 A;  1MHQ A;  4I9C A;  3CHQ A;  4EEC A;  2DWZ A;  4DLO A;  4P29 A;  3IV0 A;  5E76 A;  3ABM E;  3X2Q E;  4LSZ E;  1KPS B;  3DRA A;  5AIJ A;  1TR4 A;  2R05 A;  4C9B B;  4GZ5 A;  4NQ0 A;  3CHR A;  5G2N A;  3BG0 B;  4TXR A;  2XS8 A;  4XE0 A;  5JMN D;  1IQR A;  4I2Z A;  1KT1 A;  3UT8 A;  3OXG A;  3UM1 A;  2GRN B;  3OXF A;  5EDS A;  1TEZ A;  1N54 A;  3UIO C;  4BX9 A;  3D9J A;  5BXO A;  1TNU A;  3FTW A;  3DWL G;  1ZU2 A;  3FU3 A;  1Z3X A;  1NFI E;  3B13 A;  4ILI A;  5EIB E;  5T4Y A;  2HO1 A;  3DEP A;  3V79 K;  4HBD A;  4UQX A;  2FEZ A;  3FDH A;  3AG1 E;  1Q2Z A;  1TNB A;  4GYO A;  3CV0 A;  3DBS A;  2C2L A;  1H6P A;  4GTQ A;  3HRA A;  4RG9 A;  2ETB A;  2PQR A;  3FWV A;  4B89 A;  4QFV A;  4G8L A;  1TNO A;  3KSQ A;  3ML9 A;  3ESL A;  4G1T A;  3LY9 A;  3FUF A;  4I6J A;  4MS6 A;  3FTY A;  3U3W A;  3HXD A;  4BES A;  2AJA A;  4A3T A;  2ZIR A;  4O60 A;  3E30 A;  2GW1 A;  2L6B A;  4GTT A;  4OVU A;  4OAU C;  3FTX A;  4GZC A;  3DST A;  2AXV A;  2ZGD A;  3ASF A;  4DPR A;  1HU3 A;  4JZY A;  3LY7 A;  3CKC A;  4EBA G;  3EDT B;  4YND A;  5M72 A;  5EX0 A;  3TWU A;  3LJN A;  3UIN C;  3IBE A;  3HIZ A;  4WWN A;  1EF1 C;  3DPD A;  5FTP A;  2M63 A;  3RRN B;  4CYM D;  1QNF A;  3PUJ A;  4GMJ A;  4F53 A;  2AXZ A;  4YDE A;  3LY8 A;  2OVF A;  3QJZ A;  3CVY A;  3CHM A;  3TXM A;  5FIO A;  1E7U A;  4K5C A;  4MBG A;  3FH8 A;  2X38 A;  3ESK A;  2DVW A;  4CRW A;  3LXU X;  3DSX A;  5CMY A;  4N39 A;  4BY6 A;  3V31 A;  3Q78 A;  4G26 A;  3AJI A;  3K9I A;  2WXO A;  3ZW3 A;  5G05 C;  3U4T A;  1S0P A;  3IXE A;  3TJP A;  4LNB A;  1X5B A;  4FUL A;  2WMO A;  3ZHE B;  4NUR A;  4UQZ A;  3Q7A A;  5FQ4 A;  4CCA A;  2R2L A;  1N0R A;  4C48 B;  2H6I A;  2A5U A;  3SO8 A;  2J08 A;  3VLF A;  1MQS A;  3RO2 A;  2I2O A;  3Q79 A;  4IN3 B;  3R7Q A;  3Q9N C;  1ELW A;  3IHY A;  4A55 A;  4GTR A;  2J49 A;  4XIF A;  3FTS A;  3LVR E;  4AJW A;  5HKP A;  3ZVV A;  1EPU A;  4FLH A;  4EBA A;  4BFR A;  1W3B A;  4F6R D;  5JHB A;  2BKG A;  2WXF A;  2VGY A;  2XEH A;  4UI9 K;  4BX8 A;  3C72 A;  3ZYM A;  1H2T C;  3RRU A;  4CDR A;  1N4R A;  1Z6T A;  4GZD A;  1WG0 A;  1OY3 D;  3CQC B;  2XQ0 A;  2RD0 A;  4W9R A;  5ENO D;  3D9N A;  2HE0 A;  3QB2 A;  3NBN B;  2RFM A;  2V5Q C;  1EYH A;  2NSZ A;  1KZO A;  4XKB A;  3T5X A;  3SI5 A;  1H19 A;  2LO6 A;  4WUY A;  2WXP A;  4C0E A;  4XI0 A;  3Q47 B;  2XHE A;  4LNU D;  3SZ7 A;  3FU6 A;  1H6O A;  3LEW A;  5AJD A;  4ANU A;  5CHE E;  1H2U A;  2QFC A;  4YDY A;  3RU0 A;  3D9H A;  1E8X A;  4FU3 A;  4GA0 A;  3QC1 A;  4WNF A;  4BSZ B;  4BER A;  4RG6 A;  3FEY A;  4XKC A;  1KLX A;  3ZPJ A;  3QNK A;  3ML8 A;  5A6C A;  3ZNG A;  1X81 A;  4I43 A;  3FUJ A;  2LSV A;  4HOU A;  4LCT A;  3DXM G;  3CVV A;  4JB8 P;  4I2W A;  1ELR A;  3N71 A;  4HLE A;  1DCQ A;  2GRO B;  3NOC D;  1LD8 A;  3CVX A;  3I4R B;  2F8Y A;  3MKR A;  4FAD A;  3UQ3 A;  3CEQ A;  5KJM A;  3UPV A;  3D9P A;  1YA0 A;  4DX7 D;  2P9P G;  1V54 E;  5LX8 A;  3P1U A;  1BLX B;  2WXQ A;  4BWR A;  5G04 C;  2EIJ E;  2EIL E;  3C3R A;  1UJK A;  5HI7 A;  3FUN A;  4MLP A;  2GRR B;  4U8H A;  5EYP F;  4K0R A;  2KM4 A;  4WNE A;  2PZI A;  2C0L A;  4H7X A;  3VLD A;  5ENQ D;  5D2M C;  4UWG A;  4UI9 C;  3PNT B;  1JCR A;  3CK9 A;  4CGV A;  1DNP A;  2CG3 A;  3NQP A;  1TYQ G;  3EHR A;  1HXI A;  3R9A B;  2QYU A;  3MV3 B;  3FEX A;  4PUC A;  5ANR A;  4ILG A;  3KS2 A;  3CR3 A;  1HG5 A;  4JHK A;  3R9M A;  3TGO A;  3PEV B;  2MRI A;  5BT1 A;  5J90 A;  4KMO A;  1MX2 A;  4KYO B;  1U2V G;  3MKQ B;  2GRQ B;  4TV3 A;  3ASD A;  4XEI G;  3NZU A;  3FH5 A;  5A23 A;  4Y6C A;  3SFZ A;  1HF8 A;  2QC9 A;  3HG0 D;  3ZYK A;  2VGX A;  2KBX A;  1OCR E;  1RW2 A;  1H6K A;  1A5E A;  1SW6 A;  3CK8 A;  2XEN A;  1U3C A;  4GAA A;  3SF4 A;  2E0I A;  5BXU A;  4BTB A;  3PZ1 A;  3JXJ A;  3MGB A;  4LEU A;  1DCE A;  2CFZ A;  5AN8 A;  1IQU A;  3KAE A;  4J7W A;  3V30 A;  2H6F A;  3FUE A;  4AM9 A;  4Y6W A;  3Q75 A;  3VTX A;  4B94 A;  4G25 A;  4KZ0 A;  5KJN A;  5FQ6 A;  5LCW C;  3FUI A;  2EQX A;  4HOT A;  3S2A A;  2P2C P;  5FQ8 A;  4GTV A;  1O1S A;  2GRP B;  3FTU A;  4I1O B;  2CHW A;  4AP2 A;  4J6I A;  4GU5 A;  1MX6 A;  2Y3A A;  3APC A;  1HS6 A;  5EN5 D;  1HX8 A;  5FWQ A;  2P58 C;  4TUU A;  1OT8 A;  2VSO E;  3DSU A;  1K1A A;  2R59 A;  4FP7 A;  4DX1 A;  2B6C A;  4HRN A;  3SHF A;  3DEO A;  2IJG X;  3FHE A;  3TWR A;  3DSW A;  3O48 A;  2WQH A;  3QK0 A;  2RFA A;  2IFU A;  4PS3 A;  1XNF A;  2AVP A;  4GZ6 A;  2XPY A;  5JJ7 A;  3V2X A;  3JUE A;  3FUH A;  2VYI A;  5KBA A;  1QZ2 A;  3EIQ C;  3JXI A;  4AEZ C;  3SY2 A;  5DIZ A;  4TXQ A;  2VJ8 A;  3S7J A;  3KEZ A;  4GB9 A;  5T8I A;  5T3R A;  3UM3 A;  5BNW A;  1BI7 B;  3PE4 A;  2IO2 C;  3SBS A;  3UIP C;  1UN9 A;  2FO1 E;  4Q96 A;  2IU1 A;  5AYW D;  4JHR A;  3D9K A;  4MKT A;  3QDN A;  1E96 B;  3E32 A;  3MA5 A;  5B1A E;  3ZXP A;  4OAV B;  4KT6 B;  3UXG A;  1NA3 A;  2X6F A;  3IKO B;  2LAH A;  4H7Y A;  3BEE A;  1LD7 A;  2FI7 A;  5CRU A;  3EUV A;  4N2Q A;  4GPM A;  1HG2 A;  1NI1 A;  1HO8 A;  2YHC A;  5LCW J;  1NA0 A;  1IKN D;  3DSS A;  2OVB A;  4AOF A;  4A3V A;  1E8Z A;  4UQY A;  1PY1 A;  3SQV A;  1EDU A;  3P2B A;  2KZT B;  3G2T A;  1OCZ E;  3RRM B;  2EIN E;  4L23 A;  3BG1 B;  3TG5 A;  4GA2 A;  3C3Q A;  1SZ9 A;  3VTY A;  3S7F A;  4O1P A;  2X6I A;  5KNG A;  1SA5 A;  4TRQ A;  3UT7 A;  4TXP A;  2VTB B;  4L2Y A;  2GRM A;  2H6G A;  2WXL A;  2PL2 A;  1K1B A;  2HYZ A;  4ABN A;  5ITZ F;  3PZD A;  4Z68 A;  4BTA A;  2IQC A;  1B89 A;  3JQ0 A;  1IXV A;  1N0Q A;  5JHA A;  5FT9 A;  4YVO A;  4I6E A;  1MJ0 A;  1WY6 A;  2I6H A;  3LDZ A;  4RVB A;  2RKK A;  3RO3 A;  4APF A;  1LTX A;  5JJT A;  3JUI A;  1N4P A;  2L0I A;  5FJY A;  3KSL A;  3RKV A;  3KEA A;  3FY4 A;  2IY0 C;  2ZIS A;  4JA9 A;  1O1R A;  5G55 A;  2NC9 A;  2L0T B;  2WB2 A;  3GW4 A;  3TWQ A;  4GTS A;  4EZK A;  3ABL E;  4FA6 A;  3CLJ A; 
#chains in the Genus database with same CATH homology
 5ENN A;  1E8X A;  3MX3 A;  2UY1 A;  3MKQ A;  2WXI A;  4N5C A;  4FU3 A;  2Y4T A;  3MV2 B;  4NRH B;  4V3I A;  5C1D A;  4FLB A;  4GA0 A;  5HQ8 A;  1UW4 B;  2XGO A;  3QC1 A;  1JWF A;  3GZ2 A;  4DLQ A;  2VGX B;  1PAQ A;  5G04 J;  4WNF A;  4N3B A;  3AU4 A;  1L5J A;  4IRU A;  4RG6 A;  3S7B A;  4DI3 A;  3FEY A;  2FF4 A;  4XKC A;  1DVP A;  1KLX A;  4KXK B;  4Q69 A;  2XRY A;  3ZPJ A;  1SQM A;  2J4B A;  3QNK A;  1QQE A;  4JW1 A;  1UN8 A;  3ML8 A;  1E90 A;  3CQG B;  1LF8 A;  1INZ A;  2CHX A;  3LVQ E;  3FTV A;  5A6C A;  4I43 A;  3FUJ A;  2LSV A;  4HOU A;  1Y8M A;  4LCT A;  1PC2 A;  2V0P A;  2WVI A;  4ME2 A;  3CSF A;  3ZXS A;  2J07 A;  3FH7 A;  5ARF A;  1OWP A;  3CVV A;  4I2W A;  3D9L A;  1ELR A;  3N71 A;  4GYY A;  4ILH B;  4DI4 A;  3JCK C;  4HLE A;  3UT4 A;  3JYS A;  4J8E A;  3L54 A;  4B8A A;  3UMV A;  1KT0 A;  2X6K A;  3CVX A;  3I4R B;  1JUQ A;  1OWO A;  3S7D A;  3FUM A;  2AW6 A;  3ZIM A;  2VSN A;  2YQ8 A;  5J08 A;  3MKR A;  4FAD A;  2OV8 A;  3FU0 A;  3UQ3 A;  2GGF A;  1E8W A;  3CEQ A;  3QAR A;  5KJM A;  3UPV A;  3D9P A;  4LUN U;  1YA0 A;  2FO7 A;  2VQ2 A;  3EHN A;  3U9W A;  2YHE A;  5LX8 A;  2Q7F A;  3P1U A;  3PEU B;  3QKY A;  3CST A;  4ANW A;  4K03 A;  3Q5M A;  2WXQ A;  3PNL B;  5G04 C;  4BWR A;  1HH8 A;  4J8D A;  2BTD A;  3QWP A;  4R7L A;  4APO A;  1UJK A;  2PM7 A;  3B7S A;  4U0S A;  5HI7 A;  4B8C B;  4I1A A;  3FUN A;  4MLP A;  4U8H A;  4K0R A;  5CMW A;  2KM4 A;  4WNE A;  3ENE A;  1TJF A;  4G11 A;  4G2V A;  4GML A;  4IYP A;  2JEK A;  2PZI A;  3ASG A;  2C0L A;  2YNQ A;  4JEH A;  4H7X A;  3VLD A;  1NP7 A;  3CVP A;  4UWG A;  4GA1 A;  2XCB A;  4CT0 A;  4UI9 C;  2KCK A;  3IHV A;  4PS7 A;  2OOE A;  3OXL A;  3PNT B;  3QWW A;  5BUZ A;  4E85 A;  4PS8 A;  2DIW A;  1P5Q A;  3MJW A;  3FUL A;  4PH4 B;  4J8F A;  3G2S A;  2J4D A;  3CK9 A;  4CGV A;  2XPI A;  1DNP A;  2CG3 A;  2XPZ A;  3NQP A;  3R9A B;  1HXI A;  4HOS A;  2LNI A;  5EX3 A;  1IYG A;  3C98 A;  3CVN A;  3MV3 B;  3FEX A;  1IHG A;  4AV7 A;  2FUL A;  3ZEF A;  3CHP A;  2UWJ G;  3B7R L;  3D9I A;  4PUC A;  4ILG A;  5ANR A;  3KS2 A;  3AU5 A;  3B7U X;  3CR3 A;  3EIJ A;  1HG5 A;  4JHK A;  4EZJ A;  2WMN A;  3Q4A B;  3TGO A;  3PEV B;  2QY7 A;  2AWI A;  2XGS A;  2MRI A;  3FUK A;  4U04 A;  4F1S A;  4JL0 A;  2IOL A;  4HOQ A;  1MHQ A;  3L17 A;  1FVH A;  5BT1 A;  2ILR A;  1E7V A;  4OYS A;  4KMO A;  5J90 A;  2LSU A;  5C2Y A;  4I9C A;  3CHQ A;  2HM8 A;  4KYO B;  4BT8 A;  2UY1 B;  3MKQ B;  4EEC A;  4DLO A;  4P29 A;  3GYZ A;  3IV0 A;  4YVQ C;  5E76 A;  4TV3 A;  3ASD A;  3LCA A;  5AIJ A;  1TJC A;  2Y4U A;  3FH5 A;  3NZU A;  5A23 A;  4Y6C A;  3SFZ A;  3APD A;  1HF8 A;  4GZ5 A;  4C9B B;  3L16 A;  3CHR A;  4NQ0 A;  5G2N A;  3BG0 B;  4WND A;  4UWK A;  4XE0 A;  4AY5 A;  3CHS A;  2MHK A;  4JXT A;  3ZYK A;  2VGX A;  1IQR A;  4I2Z A;  1KT1 A;  1H6K A;  3LKU A;  3CHO A;  3UT8 A;  3CK8 A;  3OXG A;  1U3C A;  4GAA A;  1ZBP A;  3G2V A;  3AS8 A;  5FZQ A;  2BF0 X;  3SF4 A;  2E0I A;  3U66 A;  1N52 A;  3OXF A;  4OVV A;  5EDS A;  1FCH A;  1TEZ A;  1OWN A;  4BTB A;  1N54 A;  2BUG A;  4UWL A;  4BX9 A;  5E75 A;  4LRZ A;  1OUV A;  3MGB A;  5EKQ D;  3GZ1 A;  4ANX A;  4LEU A;  3D9J A;  4EQF A;  2CFZ A;  1IQU A;  3FTW A;  4WWO A;  1ZU2 A;  2ZU6 B;  4AY6 A;  3KAE A;  2CFU A;  3FU3 A;  3FUD A;  1Z3X A;  5BPP A;  3FUE A;  3B13 A;  4AM9 A;  4ILI A;  4Y6W A;  5T4Y A;  2HO1 A;  5G05 J;  2KZT A;  1OWL A;  3B7T A;  4BSX A;  2IOS A;  4N3C A;  3VTX A;  5JJ6 A;  4B94 A;  4G25 A;  4KZ0 A;  5KJN A;  5FQ6 A;  5KJK A;  5LCW C;  1XGW A;  4U63 A;  3G2W A;  2EQX A;  3FUI A;  4UQX A;  2FEZ A;  3FDH A;  2J09 A;  3FP3 A;  4HOT A;  1H0A A;  4GZ3 A;  3S2A A;  3CVQ A;  5FQ8 A;  3LYA A;  4GYO A;  2KAT A;  2PM6 A;  3CKB A;  3CV0 A;  3LS8 A;  3DBS A;  4HVB A;  2CG2 A;  3FTU A;  4I1O B;  2C2L A;  4CGW A;  2CHW A;  4I1M A;  4D10 C;  4FHJ A;  3CVU A;  4RG9 A;  4AP2 A;  4KVO A;  3OAW A;  4JPS A;  4J6I A;  4GU5 A;  2Y3A A;  4I17 A;  5D0O D;  3APC A;  1HFA A;  2PQR A;  2HR2 A;  2ION A;  1HS6 A;  3FFL A;  3R7R A;  1HX8 A;  3FWV A;  4B89 A;  4QFV A;  5AJL A;  2XEV A;  1E8Y A;  5FWQ A;  1WM5 A;  2P58 C;  4JHJ A;  1UJJ A;  4TUU A;  3HHM A;  2VSO E;  4F7A A;  2VTB A;  3ML9 A;  5FZS A;  4A1G A;  4CDM A;  3ESL A;  4G1T A;  3LY9 A;  3Q15 A;  5KJL A;  4GCN A;  3VLE A;  3OTN A;  2L9B A;  3FUF A;  2R59 A;  4I6J A;  2WXK A;  4MS6 A;  3FTY A;  3EHM A;  4FP7 A;  4C0M A;  3U3W A;  4N2S A;  4CEM A;  4A3T A;  3SNX A;  3E4B A;  3SHF A;  1HZ4 A;  4URK A;  2IJG X;  1Z3Y A;  3FHE A;  4UWF A;  2WXR A;  3O48 A;  3G2U A;  2NXP A;  2WQH A;  3ASH A;  3QK0 A;  2IFU A;  2MOW A;  5BW8 C;  4PS3 A;  1XNF A;  2GRL A;  3HVE A;  2AVP A;  5FZR A;  2GW1 A;  2FBN A;  3PRZ A;  3CIA A;  4GZ6 A;  2XPY A;  3RJV A;  1BPO A;  2A4Z A;  4OVU A;  4GYW A;  5JJ7 A;  4UI9 J;  2WXN A;  3EJN A;  2C0M A;  2RG8 A;  3FTX A;  3MEK A;  3MZL B;  2WPV A;  4GZC A;  4HOR A;  2OND A;  2AXV A;  3ASF A;  3ZFW A;  4DPR A;  3FUH A;  4EPZ A;  1HU3 A;  2VYI A;  4I9E A;  4JZY A;  4Q94 A;  1QZ2 A;  3ONK A;  3EIQ C;  3LY7 A;  2XGM A;  4AEZ C;  3CKC A;  4EBA G;  5D0Q D;  1ELK A;  2X3M A;  4KVM A;  2KCL A;  5DIZ A;  3EDT B;  4YND A;  2VJ8 A;  3S7J A;  3PS6 A;  3KEZ A;  5M72 A;  4FC8 A;  4GB9 A;  3TAX A;  4A1S A;  5T8I A;  5T3R A;  5BNW A;  3O4Z A;  4EZL A;  3FTZ A;  5EX0 A;  5LFA A;  3PE4 A;  4E6H A;  3PDN A;  3JQ1 A;  3SBS A;  3IBE A;  4NAC A;  3HIZ A;  3D3M A;  3TXN A;  4WWN A;  2I9C A;  1EF1 C;  1UN9 A;  3IEG A;  2WXG A;  3DPD A;  4Q96 A;  5FTP A;  4U0U A;  2IU1 A;  2M63 A;  3RRN B;  1QNF A;  3PUJ A;  4GMJ A;  3ZGQ A;  4F53 A;  1JWG A;  5AYW D;  4L7T A;  2AXZ A;  3QWV A;  5A7D B;  4HFG A;  3LY8 A;  5BV1 A;  4JHR A;  3D9K A;  2OVF A;  3QJZ A;  3QDN A;  2I1K A;  3NZS A;  2KC7 A;  3CHM A;  4MKT A;  3TXM A;  3CVY A;  1E96 B;  3SGH A;  2IF4 A;  3GZS A;  3MA5 A;  1E7U A;  2WQ6 A;  3FH8 A;  2VSY A;  2X38 A;  3L6A A;  4F3V A;  4LER A;  4ACL A;  4KT6 B;  3ESK A;  1NA3 A;  3WXX A;  2DCP A;  4AVX A;  2X6F A;  3IKO B;  3Q49 B;  2LAH A;  4CRW A;  2R5S A;  3CVL A;  3LXU X;  4H7Y A;  3BEE A;  2FI7 A;  4WAF A;  5CMY A;  4N2Q A;  2YIN A;  5CCL A;  4N39 A;  3L13 A;  4BY6 A;  4U0Z A;  1HG2 A;  4ATG A;  5FQ7 A;  5ARG A;  3D9O A;  2DBA A;  4G26 A;  1HO8 A;  2YHC A;  3K9I A;  3I3N A;  2WXO A;  4O6F A;  5LCW J;  4CDN A;  3ZW3 A;  5G05 C;  3U4T A;  1NA0 A;  3APF A;  4JC8 A;  3ZHE A;  1S0P A;  2XCC A;  1UG3 A;  3TG4 A;  3TJP A;  3AS5 A;  2OVB A;  4MRU A;  3UX4 A;  3UUX A;  3ZYL A;  1X5B A;  4AOF A;  3L08 A;  4FUL A;  2WMO A;  5DBK A;  3ZHE B;  5LOZ A;  1E8Z A;  3PRE A;  4A3V A;  2LAI A;  4UQY A;  1PY1 A;  4NUR A;  1EDU A;  3P2B A;  2KZT B;  2WXH A;  3G2T A;  3QAQ A;  4M3O A;  3ZYQ A;  4UQZ A;  3HVE B;  2L6J A;  3RRM B;  5FQ4 A;  2VSX E;  2WM9 A;  2V4L A;  4CCA A;  4L23 A;  3BG1 B;  5ANL A;  3TG5 A;  3LJ3 A;  4GA2 A;  4U07 A;  1JPL A;  1A17 A;  3LPZ A;  5LP0 A;  3ONL A;  4FJZ A;  3ZN3 A;  1SZ9 A;  3VTY A;  5BV0 A;  3CVW A;  2A5U A;  3S7F A;  3L22 A;  2X6I A;  3HDX A;  1FVF A;  3PUK A;  2J08 A;  2XRZ A;  2JLB A;  4L2L A;  3VLF A;  4TRQ A;  3UT7 A;  4AXH A;  1MQS A;  5AEN A;  3RO2 A;  2I2O A;  3SD5 A;  2VTB B;  4IN3 B;  3KD7 A;  3R7Q A;  3AS4 A;  4L2Y A;  3RK6 A;  2GRM A;  1ELW A;  3IHY A;  4A55 A;  3TL5 A;  2X6J A;  2WXL A;  4HXI A;  2PL2 A;  3FU5 A;  1GW6 A;  3PE3 A;  5KCM A;  3T5V A;  2J49 A;  4XIF A;  2HYZ A;  4ABN A;  3PVL A;  3FTS A;  3LVR E;  3PZD A;  4AJW A;  4BTA A;  2IQC A;  3ZRH A;  3ZVV A;  1EPU A;  1B89 A;  3JQ0 A;  4FLH A;  4XZ4 A;  4EBA A;  4BFR A;  2J9Q A;  1W3B A;  4JVS A;  4PDX A;  4J0U A;  1U3D A;  4ACK A;  5JHB A;  4DK5 A;  2WXF A;  5JHA A;  5FT9 A;  3I5P A;  2VGY A;  1NZN A;  4G23 A;  4YVO A;  4I6E A;  4UI9 K;  4BX8 A;  3ZYM A;  1H2T C;  3RRU A;  4CDR A;  1WY6 A;  4JEU A;  1Z6T A;  4GZD A;  4HS2 A;  2I6H A;  1SZA A;  3CQC B;  3LDZ A;  2XQ0 A;  2RD0 A;  4KZC A;  4RVB A;  4GCO A;  4W9R A;  3NF1 A;  3D9N A;  2R17 C;  3HYM B;  3RIB A;  1H2V C;  3CK7 A;  3RO3 A;  4KBQ A;  4JA7 A;  1Y6I A;  3QB2 A;  4FJY A;  4L1B A;  4APF A;  4CT4 A;  3QOU A;  5JJT A;  2V8S E;  3JUI A;  5CCM A;  1EYH A;  2X6H A;  3CGH A;  2NSZ A;  1WAO 1;  2AXU A;  4XI9 A;  2I1J A;  2PQN A;  2L0I A;  4XKB A;  3T5X A;  3SI5 A;  5FJY A;  3URZ A;  1H19 A;  4N3A A;  2LO6 A;  4WUY A;  3RKV A;  4WNG A;  3MYV A;  4AIF A;  2V5F A;  3FY4 A;  1VDY A;  3T8M A;  2KCV A;  2E2E A;  3ULQ A;  3I4G A;  2WXP A;  4J8S A;  2CHZ A;  4C0E A;  2WXM A;  4DJA A;  4JA9 A;  3Q47 B;  4XI0 A;  2WXJ A;  4B0Z A;  4ANV A;  2XHE A;  3MCX A;  3PH0 C;  4XX5 A;  5G55 A;  4I6G A;  3SBT B;  3SZ7 A;  2NC9 A;  4BT9 A;  3FU6 A;  4IUL A;  2WQ7 A;  2L0T B;  3LEW A;  4UWH A;  2WB2 A;  5AJD A;  3GW4 A;  4WWP A;  4G24 A;  3U64 A;  4ANU A;  5CHE E;  1H2U A;  4GPK A;  3D9M A;  4FHK A;  4RSY A;  4EZK A;  2QFC A;  1OWM A;  4FA6 A;  3CLJ A;  3RU0 A;  1HE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...