3I4RB

Nup107(aa658-925)/nup133(aa517-1156) complex, h.sapiens
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
639
structure length
528
Chain Sequence
KIKLLKAAFLQYCRKDLGHAQMVVDELFSSHSDLDSDSELDRAVTQISVDLMDDYPASIILHQLEDKMKAHSFLMDFIHQVGLFGRLGSFPVRLLLCEHAEKLSAAIVLKNHHSRLSDLVNTAILIALNKREYEIPSNLTPADVFFREVSQVDTICECLLEHEEQVLRDSIEWAEVVINVNNILKDMLQAASHYRQNRRTVIIRQHEIVLKVAYPQADSNLRNIVTEQLVALIDCFLDGYVSQLKSVDKSSNRERYDNLEMEYLQKRSDLLSPLLSLGQYLWAASLAEKYCDFDILVQMCEQTDNQSRLQRYMTQFADQNFSDFLFRWYLEQHGQLANFLQAHEHLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDININDLKLEILCKALQRDNWVSKDSIFVKILLPEVKDLLQADEFVLKANYEYYVQGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear pore complex protein Nup107
publication title Architectural nucleoporins Nup157/170 and Nup133 are structurally related and descend from a second ancestral element.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 101
structure length 528
sequence length 639
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03177 Nucleoporin_C Non-repetitive/WGA-negative nucleoporin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.700 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3i4rB00
3CQGB 3CQCB 3I4RB
chains in the Genus database with same CATH superfamily
3JXJA 1N11A 3LY8A 4DX2A 3ZGQA 4AXHA 3R9AB 3SI5A 2KCVA 4GA0A 2J8SD 1N0QA 2GRQB 1BI7B 4D10C 1LTXA 4GYWA 5AYWD 4JD2G 3KD7A 4C0EA 1HX8A 1HU3A 5CEAA 1UOHA 1A5EA 2LAIA 1ELRA 1OT8A 3GW4A 3I5PA 2XENA 2NYJA 3VLDA 3FP3A 4ME2A 4HI8A 1BU9A 4UQZA 4NQ0A 5CCLA 2WQHA 4L2LA 2WM9A 2X6JA 4KYOB 4I9EA 3X2QE 4RG9A 2AXUA 4E6HA 4GYYA 2X6FA 3NZUA 3PZ1A 3D3MA 4N5CA 3ZYQA 2WXOA 4OAUC 5FZQA 2Y1LE 3PZ4A 2J4BA 1KPSB 1LD7A 3ABKE 4R7LA 1KT0A 2QC9A 3DSWA 1E8YA 4MLPA 4GMJA 4F53A 5A7DB 2BUGA 3JUEA 3QWPA 2WXHA 3ZHEB 1OUVA 3PVLA 4G11A 3MKRA 1GW6A 5ENPD 2XQ0A 3IHVA 1HS6A 2R03A 4G23A 4F1SA 2R02A 3EJNA 3UPVA 4HRLA 3RO2A 3NQPA 4YDWA 2IOSA 2ZGDA 3DSXA 5B1AE 2VTBA 5HS0A 3ESKA 1MZCA 3ZW3A 5ARFA 4HLEA 1L5JA 2KCLA 4DLQA 2J49A 2XCCA 2XZDG 3SBSA 3PNTB 3TXNA 2P9IG 3DPDA 3MJWA 3EU9A 2VGYA 1FCHA 1TNZA 2HR2A 3MKQB 5B1BE 4TXPA 2FF4A 1TJFA 3PZ3A 2FBNA 3FFLA 3S7JA 4B8AA 5ITZF 2XZTG 1Y6IA 3FTZA 5D66A 1HF8A 3CHSA 2ZU6B 3QJZA 5D0QD 1IQRA 3HXEA 2HYZA 3O48A 2J09A 4GMLA 3OXLA 4G2VA 2GRMA 4A3TA 4BERA 5CCMA 2J07A 3TWTA 5D2MC 5AJDA 1S70B 4PS3A 3HXCA 3UUXA 3B95A 3CHRA 4H7XA 4BSZB 4PS7A 1EYHA 3D9IA 3IXEA 1IHBA 3VLEA 4GAAA 4C9BB 4E85A 5JMND 4K03A 1TEZA 4O1OA 1UW4B 3HIZA 3AJIA 1Z5SC 4ANXA 2HE0A 3FUDA 3CSTA 4I6JA 2XS8A 3CVXA 5KCMA 2FI7A 5AN8A 4N3BA 3NZSA 2QY7A 1E8ZA 4EZLA 3AG4E 3CSFA 2M63A 1TYQG 3HVEA 4LUNU 4WNEA 3LY7A 3TG4A 2XPZA 3CVQA 5BXOA 1N54A 1H2UA 4X8QA 5AIJA 4HOTA 3DRAA 2AVPA 4RVBA 3IHYA 4JB8P 3CKCA 2IY0C 1OY3D 5ENOD 4EBAA 4QFVA 1X81A 4DX5D 3T5XA 2F0YA 4XIFA 3KS2A 4LNUD 1EPUA 3CK9A 4BT9A 5CRUA 3OAWA 4U63A 4BTAA 1JCSA 1TN8A 2WXNA 1SZ9A 5ARGA 3FUMA 2GGFA 2Q7FA 3Q75A 4UWFA 3VLFA 5A23A 3FHEA 3HXBA 2QZAA 3NBNB 3PDNA 2LXLA 2XEHA 5EYPF 3PZ2A 2YNQA 2WXMA 3OXGA 5JJ7A 2LUHA 3AU5A 4MRUA 4FADA 1PAQA 3KSQA 4J8YA 3OXFA 3QWWA 4WWNA 4UI9J 3E32A 1TJCA 4LG6A 3NOGD 4JHJA 4I6EA 3I4GA 3CVWA 4CT0A 4A63B 1X5BA 4GTTA 1UG3A 2OVFA 5KJLA 5KJKA 5AAOA 2KZTB 4XZ4A 3EUVA 5ENNA 2XRYA 1OCOE 3FUNA 1TR4A 2LSUA 5AARA 4F6RD 2VSNA 4K5BA 1S63A 2LNIA 4U95D 1SZAA 3E33A 1RW2A 4V3IA 1SQMA 2P9UG 3QNKA 3RK6A 1U3CA 2R2LA 2EIKE 3V31A 2VQ2A 5CMWA 1O5MA 3PE3A 5EDSA 3SO8A 3FTXA 3Q9UC 4KXKB 1KLXA 1ZBPA 4U8HA 4CYMD 2WPVA 3ESLA 2YHEA 3FUFA 2JLBA 1NP7A 3GZ2A 1NZNA 4LERA 5FQ6A 4P29A 3QAQA 2IONA 4GTQA 3L82A 5KNGA 3EIJA 2WXJA 3Q15A 4U96D 5C2YA 2I6HA 3DSVA 5AQBA 3UTMA 3FUEA 1SVXA 2NC9A 3AG1E 4YNDA 3K9IA 5ENTD 4JA7A 4CZ2D 2V8SE 3HYMB 3DSUA 3PZDA 3P1UA 3IEGA 4CDMA 3S7DA 3B7TA 4W9RA 4APOA 4XX5A 5LX8A 3FTSA 5EX0A 1MYOA 4AIFA 3UIOC 3U64A 3W9GA 1QZ2A 3L16A 2I1KA 3B7BA 1WG0A 3GZ1A 4EBAG 1NA0A 5BNWA 4AM9A 1OWOA 4AY5A 4G25A 5BT1A 4I1AA 2C0LA 4U7EB 1H6KA 5M72A 1W3BA 3ZKJA 2R59A 1K1AA 2UWJG 3RRNB 2MRIA 1KZPA 2H6GA 2JABA 3EHMA 5BPPA 3ABLE 2F8XK 4KBQA 4I17A 3TL5A 5AENA 4AP2A 4KVOA 1TNUA 3AG2E 2BKGA 4HXIA 2L6JA 2UY1B 3BG1B 3CHOA 3FU0A 1N9AA 4ILHB 3LJNA 2MHKA 3TWSA 4A1GA 3ZRHA 3PUJA 3Q79A 1N94A 2DYSE 3MKQA 3L54A 3HDXA 4I2ZA 1WM5A 5DBKA 3CK7A 1MX4A 1BD8A 2FULA 1DCQA 4WWOA 3EDTB 4NRHB 3S2AA 2DBAA 5A6CA 4BESA 4WNDA 2IFUA 3DBSA 1OXJA 5FQ4A 4KZ0A 2ZGGA 4Q94A 3GZSA 4XKCA 4B93B 2WVIA 5G04J 1WDYA 2P9NG 4PS8A 5ENRD 2V5QC 3TXMA 3NAWA 4U04A 3D9LA 4J8FA 3EHNA 4OYSA 4FA6A 2GRRB 2QYJA 2EILE 2V4HC 3MV2B 4FULA 2X38A 1DNPA 3FDHA 4QQIA 5D0OD 2XEEA 4AJWA 1OCCE 2YINA 4FJZA 4TUMA 3MYVA 2XGOA 3CQGB 4GTSA 3D9JA 3BUAA 4PDXA 3CVUA 3SQVA 2DIWA 5KBAA 3G2TA 4BSXA 5CERB 5KWDA 4BY6A 3E30A 4L2YA 5CBNA 3JXIA 3D9HA 5LCWJ 3MGBA 4ANUA 3ASDA 1ZU2A 3C3RA 3Q47B 2FO7A 4G8KA 3AAAC 4HI9A 4JW1A 1BLXB 3KAEA 3SZ7A 4CRWA 3JUIA 2IO3C 4UUCA 3Q4AB 1N95A 2C0MA 2XGMA 3PH0C 2PL2A 4RSYA 2LXMA 5AJLA 4DX7D 1SW6A 2H6IA 1LF8A 4Y6CA 2CG3A 4AY6A 1XGWA 2JEKA 4JA9A 2EINE 1OCZE 3LVQE 2V4LA 4HRNA 3C3QA 2E0IA 2ONDA 3JQ0A 1MJ0A 4HFGA 4GZ5A 5ANRA 2RFMA 1E7UA 1N4QA 2XPIA 2BEDA 5DIZA 4BFRA 4IULA 4B8CB 3G2WA 5G05J 5KNHD 3CVYA 3ZYKA 4F1PA 4GA2A 5G2NA 1S64A 5T4YA 1U3DA 3CR3A 4NURA 2VGXA 2IO2C 3HXDA 4FHJA 1OWNA 2RKKA 3FU6A 4N3CA 4B89A 2CFZA 4DLOA 4Y6WA 2EIME 2L0IA 3R7RA 3ZU7B 2R5SA 4GB9A 2PZIA 1H0AA 2VSXE 3APCA 1H2TC 4KZCA 4BTBA 2OEWA 4FLHA 2IJGX 3C72A 3NB2A 3Q5MA 4J8DA 2CHZA 5AQ7A 4B0ZA 4AV7A 4J0UA 2WXFA 3C3OA 2CHXA 1INZA 2ETAA 5CMYA 1K1BA 2XRZA 2WXGA 3BG0B 2FEZA 4ILIA 4LNBA 3FUKA 1A17A 3QC1A 4TRQA 5FTPA 3DPYA 4ATGA 4N5QA 2YQ8A 4GCNA 2FO1E 2XS1A 1OCRE 5FINA 2P9KG 4ACKA 3KSLA 5E76A 1H6OA 1Y8MA 2VTBB 5IY5E 1DC2A 5JHAA 5KJMA 4HQDA 5CHEE 2RFAA 4FP7A 4GZ3A 1UJJA 3FU3A 3UM3A 2ETBA 2B0OE 2OOEA 4JEUA 4URKA 2VSYA 3MEKA 3RIBA 3LKUA 4HNAD 5HQ8A 3CKBA 3AG3E 3VTYA 3CQCB 3V79K 4DI4A 1KT1A 2BTDA 2VJ8A 1WAO1 5LP0A 5EIDA 3PUKA 4UI9K 5AQ9A 3FULA 3TWXA 2WMNA 4IN3B 2P2CP 3ULEG 3FH8A 3QB2A 4JHRA 1N4PA 1IKND 5FJYA 5CEDB 3KEAA 2B6CA 3T8KA 4GZDA 5ENQD 2ETCA 3QWVA 3DXMG 4FU3A 3UT7A 3GYZA 1TN6A 2PQNA 4DX1A 4GTPA 4L23A 3UM0A 4RLYA 1TN7A 1Z3XA 1OWLA 2IOLA 3RU0A 4EZKA 1U2VG 4HS2A 1D8DA 5BV1A 4CT4A 2KBXA 4U8VD 3RRMB 3TWQA 2BF0X 3QDNA 2LO6A 4UI9C 4BX9A 3RKVA 1LD8A 3PREA 2ZIRA 5FZRA 3RRUA 3FUHA 3ONKA 3S7FA 3MA5A 4I1OB 4IYPA 3DEOA 5EKQD 2DZOA 4TXQA 3SNXA 5EYLA 2IF4A 3HVEB 1HFAA 2ILRA 2WMOA 4XI0A 1QBQA 2OCCE 3CHQA 3ZYMA 3FUIA 1FPPA 4A3VA 1AWCB 4M7CA 4U0SA 3I3NA 4YDYA 1OWPA 1O1SA 3ASFA 4LCTA 4JC8A 4UWKA 2DVWA 2Y3AA 3SY2A 1SA5A 4WNFA 2MYOA 2VGEA 5JHBA 2QFCA 5JJ6A 1JWFA 1NFIE 3ASHA 2P9LG 4O6FA 2EQXA 2GRNB 4A1SA 3J5PA 3UQ3A 2A5EA 2AXZA 2XCBA 1QYMA 1FVFA 3CV0A 4Q96A 2WB2A 3LYAA 2OVBA 3FTUA 4F7AA 3PRZA 3W9FA 3LDZA 1YA0A 3EHRA 3ENEA 2R17C 1ELWA 2WXIA 5CBOA 4JPSA 3CHMA 1YMPA 2PNNA 3ONLA 4HORA 3FTWA 3OTNA 3DEPA 2IU1A 4NACA 4GZ6A 3WXXA 2WXKA 3P2BA 3ZHEA 5HI7A 1JWGA 3L9TA 3C5RA 4CGWA 4J7WA 4DUIA 4BWRA 1MQSA 2GRLA 2KXPC 5JA4D 3FTVA 3UT8A 1NL4A 5ANLA 3T5VA 2XGSA 3URZA 2OEVA 1SA4A 4I9CA 1D9SA 3UXGA 5E75A 4AEZC 1MHQA 1KZOA 3ZFWA 2OV8A 4IRUA 3FU5A 4GU5A 4HOQA 4PUCA 3TWRA 3SFYA 3N71A 3BQOA 1E8WA 4HB5A 3FTYA 3SFXA 3RSEG 1JCRA 2P9PG 4WAFA 3G2VA 3Q73A 4ZHBA 3CLJA 4EQFA 3J5QB 4J8SA 2KATA 3ULQA 1D8EA 1HH8A 2AJAA 2XHEA 3PEVB 3D9MA 2XEVA 3QK0A 3SFZA 4WUYA 4MS6A 1H6PA 3FEYA 3RJVA 3ML9A 2NXPA 1MX2A 2H6FA 2C2LA 4N39A 1O1RA 3V2OA 4G1TA 3D9PA 4HOSA 2LSVA 3L22A 4EPZA 3HXFA 1EDUA 3DSTA 3NOCD 3TAXA 4YVOA 3G2UA 4RQIA 4L7TA 2L0TB 1S0PA 2V0PA 5BXUA 3EU5A 3CK8A 2MOWA 4WNGA 4UWLA 3UKRG 4BEPA 4WWPA 4DX6D 3U3WA 4XI9A 1ZB1A 3QKYA 5G04C 5G55A 2WQ7A 3UM1A 2CFUA 4JEHA 2X6IA 3F6QA 1DVPA 3CVPA 1YCSB 4JXTA 3HHMA 3SBTB 3LPZA 5EN5D 4YDEA 4HVBA 3FWVA 3HRAA 3MZLB 3L6AA 3SD5A 4C48B 3VTXA 5BUZA 4ATZD 4OAVB 2NSZA 3PEUB 3CHPA 2I9CA 3ZEFA 1TNBA 2VYIA 1PC2A 4MKTA 3UINC 4Q69A 1UN9A 4UQXA 2A5UA 5FWQA 4G8LA 1V54E 4U0ZA 3L08A 3WG7E 3AS4A 4GYOA 4M3OA 5LCWC 1V55E 5J90A 1JCQA 1E90A 4XKBA 3ASOE 1DCEA 3DWLG 4GZCA 2PM7A 4I43A 4ANVA 5EX3A 4YVQC 1HXIA 4GTRA 3E34A 2GW1A 4GMRA 4B94A 4GPMA 2A4ZA 2X3MA 4NIKA 3R9MA 3Q7FA 3FH7A 4GTVA 3ZN3A 3LY9A 2BKKB 4J8EA 1N0RA 4AOFA 1NA3A 4O60A 4K0RA 2V5FA 3IV0A 2DWZA 3IBEA 3ASNE 2KZTA 3FUJA 3UM2A 1PY1A 4JZYA 4U07A 3DSSA 1E7VA 1H19A 5FIOA 5T8IA 4CEMA 3FY4A 5G05C 5HKPA 4OVVA 1OWMA 1IHGA 2KCKA 4BT8A 4I1MA 3TWUA 2Y4TA 1O1TA 2J9QA 4DI3A 4L1BA 4BETA 1K3ZD 1HG5A 2F8YA 3D9OA 4N3AA 4FC8A 2Y69E 3KEZA 1ELKA 3O4ZA 2L6BA 3Q9NC 3ZXSA 5J08A 4J6IA 1RZ4A 1YYHA 4KVMA 3LCAA 4ABNA 2DYRE 2PQRA 5CRVA 1N4RA 3CVVA 3ASGA 4JL0A 4DRXE 4N2QA 4HOUA 1BPOA 2GRPB 5EIBE 3EIQC 4EZJA 2P58C 3ABME 3I4RB 4GPKA 3CVLA 3PNLB 3UX4A 3JCKC 1HG2A 3ULYA 4XE0A 2ZISA 3V2XA 3ISMC 1QNFA 3PS6A 4K5CA 4HBDA 2CG2A 4LEUA 3SF4A 2DCPA 4ANWA 3APDA 1UN8A 5LOZA 3D9KA 2AWIA 2X6HA 4TV3A 1IYGA 4ILGA 2DZNA 2WXQA 5CECB 3L17A 1TNOA 4TXRA 3Q78A 5JJTA 4H7YA 1QQEA 3C98A 5FT9A 4JHKA 3FEXA 3MCXA 2ZXWE 3B7RL 3BEEA 5B3SE 3RAUA 3RO3A 3D9NA 1JUQA 1E8XA 1G3NB 2AXVA 1Z3YA 5BW8C 3UIPC 2Y4UA 2I2OA 3CVNA 3JQ1A 3ZXPA 4HLLA 2KC7A 4Z68A 2AW6A 2J08A 2VGXB 1UJKA 4FLBA 3AU4A 1FVHA 4I2WA 2WXPA 4DK5A 3LVRE 2LAHA 3FH5A 2X6KA 3TWVA 1B89A 1H2VC 3TGOA 2VSOE 1BI8B 1FT2A 1HE8A 2GROB 5T3RA 3T8MA 3U4TA 1N52A 3TJPA 3JYSA 2F37A 3SHFA 4GTMA 1XNFA 2YHCA 3BU8A 4I6GA 1EF1C 2UY1A 1HZ4A 3CIAA 4PH4B 4GA1A 5HRYA 3APFA 3QARA 5LFAA 1K8KG 3TWWA 2P9SG 3TG5A 3ZIMA 3R7QA 4GTOA 2CHWA 5FQ7A 4OVUA 4EHMA 2RD0A 3DXKG 1NI1A 1P5QA 4LNGA 3UMVA 3HG0D 4FJYA 2IQCA 1Z6TA 4UQYA 3G2SA 3UKUG 3LXUX 3ZVVA 4RG6A 1E96B 2I1JA 3B7SA 2EIJE 1N4SA 3MX3A 3AS8A 2H6HA 2IEJA 2HM8A 5BV0A 3IKOB 3B7UX 3SGHA 4YDOA 3V30A 4A55A 3B13A 4JVSA 4DJAA 3PE4A 4TUUA 4O1PA 2Y0BG 4CDNA 3CGHA 1WY6A 4U8YD 3Q7AA 4FHKA 1MX6A 5FQ8A 4ZFHA 3U66A 5KJNA 4MBGA 3ZNGA 3T9KA 5EILA 3ZYLA 5C1DA 4G26A 1HO8A 3S7BA 4KMOA 3AS5A 4KT6B 1AP7A 4XEIG 3ZPJA 4CCAA 4F3VA 3UT4A 4CDRA 3MV3B 4LSZE 4N2SA 1VDYA 4ACLA 4U0UA 3L13A 4K5AB 3CEQA 5H7PA 1TNYA 1IQUA 2HO1A 4AVXA 4GCOA 4UWHA 3LS8A 4HRMB 4G24A 2WXRA 4APFA 5ENSD 4L9PA 3E4BA 3E37A 3ZUVB 2PM6A 2KM4A 4LRZA 4CGVA 3NF1A 2R05A 3ML8A 1FT1A 2L9BA 3QOUA 1Q2ZA 1IXVA 5AQAA 3Q49B 2XPYA 2WXLA 4DPRA 3EHQA 4UWGA 3LEWA 1JPLA 2RG8A 3LJ3A 4BX8A 2QYUA 2WQ6A 3UI2A 3U9WA 5FZSA 2E2EA 2J4DA 4C0MA 4EECA
chains in the Genus database with same CATH topology
1ZBPA 3LY8A 4U8HA 4U0ZA 2WPVA 3ZGQA 4ACKA 5E76A 4AXHA 3L08A 1Y8MA 3R9AB 3ESLA 2VTBB 2YHEA 3SI5A 2KCVA 4GA0A 4D10C 3FUFA 2JLBA 5JHAA 1NP7A 3GZ2A 5KJMA 5CHEE 1NZNA 4FP7A 4GZ3A 4GYWA 1UJJA 4LERA 5FQ6A 3AS4A 3FU3A 5AYWD 4P29A 3KD7A 3QAQA 2IONA 4C0EA 4GYOA 4M3OA 5LCWC 1HX8A 5J90A 1HU3A 1E90A 2LAIA 3EIJA 2WXJA 1ELRA 2OOEA 4JEUA 3GW4A 3I5PA 3Q15A 4XKBA 3VLDA 4URKA 5C2YA 2I6HA 2VSYA 3FP3A 3MEKA 3LKUA 4ME2A 3RIBA 4GZCA 4UQZA 2PM7A 5HQ8A 3CKBA 4I43A 4NQ0A 3VTYA 4ANVA 5CCLA 3CQCB 3FUEA 4DI4A 1KT1A 2BTDA 2WQHA 2VJ8A 4L2LA 5EX3A 1WAO1 2NC9A 4YVQC 2WM9A 2X6JA 4YNDA 4KYOB 5LP0A 3K9IA 4I9EA 4JA7A 1HXIA 3PUKA 4UI9K 4RG9A 2AXUA 3FULA 2GW1A 2WMNA 4E6HA 4IN3B 4GYYA 4B94A 3FH8A 3QB2A 4JHRA 2A4ZA 2V8SE 2X3MA 2X6FA 3HYMB 3NZUA 5FJYA 3D3MA 4N5CA 3ZYQA 3FH7A 3PZDA 2WXOA 3P1UA 3ZN3A 3LY9A 5FZQA 4GZDA 4J8EA 3IEGA 4AOFA 4CDMA 2J4BA 1NA3A 3S7DA 3B7TA 3QWVA 4K0RA 4W9RA 4APOA 2V5FA 4FU3A 4R7LA 3UT7A 3IV0A 3IBEA 4XX5A 3FUJA 1KT0A 2KZTA 3GYZA 5LX8A 3FTSA 1PY1A 2PQNA 1E8YA 4JZYA 4L23A 4U07A 1E7VA 1H19A 5EX0A 5T8IA 4CEMA 4AIFA 3FY4A 5G05C 4MLPA 3U64A 4GMJA 1Z3XA 1QZ2A 4F53A 1OWLA 2IOLA 3L16A 3RU0A 2I1KA 4EZKA 5A7DB 4HS2A 4OVVA 5BV1A 1OWMA 2BUGA 3QWPA 3GZ1A 4CT4A 1IHGA 2KCKA 4BT8A 4EBAG 3RRMB 1NA0A 4I1MA 2BF0X 3QDNA 5BNWA 2LO6A 2Y4TA 4AM9A 1OWOA 2J9QA 4AY5A 4DI3A 4UI9C 2WXHA 4L1BA 3ZHEB 4G25A 5BT1A 1OUVA 4I1AA 3PREA 3RKVA 2C0LA 4BX9A 1HG5A 3PVLA 4G11A 3MKRA 1GW6A 1H6KA 3D9OA 4N3AA 4FC8A 2XQ0A 3IHVA 3KEZA 1ELKA 3O4ZA 5M72A 1HS6A 5FZRA 3RRUA 1W3BA 3ZXSA 5J08A 4J6IA 4G23A 2R59A 3FUHA 3ONKA 2UWJG 3S7FA 3MA5A 4KVMA 3RRNB 2MRIA 3LCAA 4ABNA 4I1OB 2PQRA 4F1SA 4IYPA 5EKQD 3EJNA 3CVVA 3EHMA 5BPPA 3ASGA 3UPVA 3SNXA 2IF4A 4JL0A 3NQPA 3RO2A 4N2QA 4HOUA 3HVEB 4KBQA 4I17A 1HFAA 3TL5A 2IOSA 2ILRA 2WMOA 4XI0A 5AENA 1BPOA 4AP2A 3CHQA 4KVOA 2VTBA 3ZYMA 4HXIA 3ESKA 3FUIA 2L6JA 2UY1B 3BG1B 3EIQC 4EZJA 2P58C 3CHOA 3ZW3A 4A3VA 5ARFA 4HLEA 1L5JA 2KCLA 4DLQA 2J49A 3FU0A 2XCCA 3I3NA 4ILHB 1OWPA 4U0SA 3SBSA 3I4RB 3ASFA 3PNTB 4LCTA 3TXNA 4GPKA 3DPDA 3MJWA 2MHKA 4JC8A 4UWKA 3CVLA 3PNLB 4A1GA 3ZRHA 3UX4A 2VGYA 1FCHA 1HG2A 3JCKC 3PUJA 4XE0A 2Y3AA 4WNFA 3MKQA 1QNFA 3PS6A 3L54A 2HR2A 3MKQB 3HDXA 5JHBA 2QFCA 4I2ZA 2CG2A 4LEUA 1WM5A 5DBKA 2FF4A 1TJFA 2FBNA 3CK7A 3SF4A 2FULA 1JWFA 3FFLA 5JJ6A 4WWOA 3S7JA 2DCPA 3ASHA 4ANWA 4B8AA 3EDTB 3APDA 4NRHB 3S2AA 1Y6IA 2DBAA 4O6FA 1UN8A 2EQXA 5A6CA 5LOZA 3D9KA 3FTZA 4A1SA 4WNDA 2AWIA 2X6HA 2IFUA 3DBSA 4TV3A 5FQ4A 1IYGA 4ILGA 4KZ0A 1HF8A 3CHSA 2ZU6B 3QJZA 5D0QD 1IQRA 3UQ3A 4Q94A 3GZSA 2WXQA 4XKCA 2HYZA 3L17A 3O48A 2J09A 4GMLA 3OXLA 2WVIA 5G04J 4G2VA 2GRMA 4A3TA 2AXZA 2XCBA 4PS8A 3TXMA 5CCMA 1FVFA 2J07A 4U04A 3D9LA 4J8FA 3CV0A 4Q96A 5AJDA 2WB2A 5JJTA 4H7YA 1QQEA 3LYAA 4PS3A 2OVBA 3C98A 3FTUA 5FT9A 4JHKA 3EHNA 3FEXA 3MCXA 3B7RL 3BEEA 4F7AA 4OYSA 3UUXA 3PRZA 3LDZA 3RO3A 1YA0A 3D9NA 1JUQA 2R17C 1E8XA 3ENEA 1ELWA 2AXVA 2WXIA 4FA6A 1Z3YA 3CHRA 5BW8C 4H7XA 2Y4UA 2I2OA 3CVNA 3JQ1A 4JPSA 3CHMA 3MV2B 4PS7A 1EYHA 2KC7A 3D9IA 4FULA 2X38A 3ONLA 4HORA 3FTWA 2AW6A 2J08A 3VLEA 2VGXB 1UJKA 1DNPA 3FDHA 4FLBA 3OTNA 4GAAA 4C9BB 4E85A 5D0OD 3AU4A 1FVHA 2IU1A 4NACA 4GZ6A 4I2WA 4AJWA 3WXXA 2WXKA 2WXPA 4K03A 1TEZA 4DK5A 3LVRE 3P2BA 1UW4B 3HIZA 3ZHEA 2LAHA 2YINA 4FJZA 3FH5A 5HI7A 1JWGA 2X6KA 3MYVA 2XGOA 4CGWA 4ANXA 3FUDA 3CQGB 4BWRA 1B89A 3CSTA 1H2VC 4I6JA 1MQSA 2GRLA 3FTVA 3UT8A 3TGOA 2VSOE 3CVXA 3D9JA 5ANLA 5KCMA 3T5VA 2FI7A 4PDXA 2XGSA 3CVUA 1HE8A 4N3BA 2DIWA 5T3RA 3NZSA 4I9CA 3URZA 5E75A 2QY7A 3T8MA 4AEZC 1E8ZA 3U4TA 1MHQA 4EZLA 3G2TA 1N52A 3ZFWA 4BSXA 2OV8A 4IRUA 3FU5A 3CSFA 4GU5A 2M63A 3TJPA 3HVEA 4LUNU 3JYSA 4HOQA 4WNEA 3LY7A 4PUCA 3SHFA 3TG4A 4BY6A 2XPZA 3N71A 3CVQA 1E8WA 4L2YA 1XNFA 2YHCA 4I6GA 1EF1C 3FTYA 5LCWJ 1N54A 1H2UA 2UY1A 3MGBA 1HZ4A 4ANUA 3CIAA 3ASDA 1ZU2A 5AIJA 4PH4B 4WAFA 3G2VA 4HOTA 3CLJA 4GA1A 3APFA 3QARA 4EQFA 5LFAA 3Q47B 4J8SA 2KATA 2FO7A 2AVPA 3ULQA 1HH8A 3TG5A 4JW1A 3ZIMA 4RVBA 2XHEA 3IHYA 3KAEA 3SZ7A 3CKCA 4CRWA 3R7QA 3JUIA 2CHWA 5FQ7A 3PEVB 4EBAA 3D9MA 2XEVA 4OVUA 4QFVA 3QK0A 3Q4AB 3SFZA 2C0MA 2RD0A 2XGMA 4WUYA 3PH0C 2PL2A 4MS6A 3FEYA 3T5XA 3RJVA 4RSYA 1P5QA 4XIFA 5AJLA 3KS2A 3UMVA 3ML9A 2NXPA 4FJYA 2IQCA 1EPUA 1LF8A 1Z6TA 3CK9A 4UQYA 4Y6CA 2CG3A 4BT9A 1XGWA 2JEKA 3OAWA 4JA9A 3G2SA 4AY6A 4U63A 3LVQE 3LXUX 3ZVVA 4BTAA 2C2LA 2WXNA 2V4LA 4RG6A 1SZ9A 1E96B 5ARGA 4N39A 2E0IA 2ONDA 2I1JA 3B7SA 3D9PA 3FUMA 3JQ0A 4G1TA 4HFGA 4HOSA 3MX3A 3AS8A 2LSVA 2GGFA 3L22A 4GZ5A 4EPZA 2Q7FA 4UWFA 2HM8A 3VLFA 3IKOB 5BV0A 5A23A 1EDUA 3B7UX 5ANRA 3FHEA 1E7UA 3TAXA 3PDNA 3SGHA 2XPIA 4A55A 3B13A 5DIZA 4JVSA 4BFRA 4DJAA 4YVOA 3PE4A 3G2UA 4IULA 4TUUA 4B8CB 3CGHA 4CDNA 3G2WA 1WY6A 5G05J 2YNQA 2WXMA 3CVYA 3ZYKA 3OXGA 5JJ7A 4FHKA 5FQ8A 4L7TA 3AU5A 4GA2A 2L0TB 4MRUA 1S0PA 5G2NA 4FADA 3U66A 2V0PA 5KJNA 1PAQA 3CK8A 5T4YA 1U3DA 2MOWA 3ZYLA 5C1DA 3CR3A 3OXFA 4G26A 1HO8A 3S7BA 3QWWA 4NURA 4WNGA 4KMOA 2VGXA 4UWLA 3AS5A 4WWNA 4KT6B 4UI9J 4FHJA 3ZPJA 1OWNA 1TJCA 4WWPA 4CCAA 3FU6A 4F3VA 3U3WA 4JHJA 4N3CA 3UT4A 4I6EA 3I4GA 2CFZA 4B89A 4XI9A 4CDRA 4DLOA 3CVWA 4Y6WA 3MV3B 4CT0A 1X5BA 2L0IA 3QKYA 3R7RA 4N2SA 5G04C 5G55A 2WQ7A 2R5SA 1VDYA 4ACLA 2CFUA 4GB9A 2PZIA 4JEHA 1UG3A 2OVFA 3L13A 4U0UA 3CEQA 1H0AA 5KJLA 2X6IA 2VSXE 1DVPA 3APCA 5KJKA 1H2TC 2KZTB 1IQUA 2HO1A 3CVPA 4XZ4A 4KZCA 4AVXA 4BTBA 4GCOA 4UWHA 3LS8A 5ENNA 2XRYA 4FLHA 2IJGX 4G24A 2WXRA 3FUNA 2LSUA 4JXTA 4APFA 2VSNA 3HHMA 3SBTB 2LNIA 3LPZA 3Q5MA 4J8DA 1SZAA 2CHZA 4V3IA 4HVBA 1SQMA 3E4BA 4B0ZA 3FWVA 3MZLB 3L6AA 4AV7A 3SD5A 2PM6A 2KM4A 4J0UA 4LRZA 2WXFA 3NF1A 4CGVA 3ML8A 3QNKA 3RK6A 3VTXA 1U3CA 5BUZA 2CHXA 1INZA 5CMYA 2XRZA 2L9BA 3QOUA 2WXGA 3Q49B 2XPYA 2VQ2A 2NSZA 2WXLA 3BG0B 3PEUB 2FEZA 3CHPA 4DPRA 2I9CA 4ILIA 3ZEFA 4UWGA 2VYIA 3FUKA 1PC2A 1JPLA 3LEWA 5CMWA 2RG8A 1A17A 3LJ3A 3PE3A 4BX8A 4MKTA 3QC1A 4TRQA 2WQ6A 5FTPA 4Q69A 5EDSA 4ATGA 3U9WA 2YQ8A 1UN9A 3FTXA 5FZSA 4GCNA 4KXKB 2E2EA 4UQXA 2J4DA 4C0MA 4EECA 2A5UA 5FWQA 1KLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQG B;  3CQC B;  3I4R B; 
#chains in the Genus database with same CATH topology
 3JXJ A;  1N11 A;  3LY8 A;  4DX2 A;  3ZGQ A;  4AXH A;  3R9A B;  3SI5 A;  2KCV A;  4GA0 A;  2J8S D;  1N0Q A;  2GRQ B;  1BI7 B;  4D10 C;  1LTX A;  4GYW A;  5AYW D;  4JD2 G;  3KD7 A;  4C0E A;  1HX8 A;  1HU3 A;  5CEA A;  1UOH A;  1A5E A;  2LAI A;  1ELR A;  1OT8 A;  3GW4 A;  3I5P A;  2XEN A;  2NYJ A;  3VLD A;  3FP3 A;  4ME2 A;  4HI8 A;  1BU9 A;  4UQZ A;  4NQ0 A;  5CCL A;  2WQH A;  4L2L A;  2WM9 A;  2X6J A;  4KYO B;  4I9E A;  3X2Q E;  4RG9 A;  2AXU A;  4E6H A;  4GYY A;  2X6F A;  3NZU A;  3PZ1 A;  3D3M A;  4N5C A;  3ZYQ A;  2WXO A;  4OAU C;  5FZQ A;  2Y1L E;  3PZ4 A;  2J4B A;  1KPS B;  1LD7 A;  3ABK E;  4R7L A;  1KT0 A;  2QC9 A;  3DSW A;  1E8Y A;  4MLP A;  4GMJ A;  4F53 A;  5A7D B;  2BUG A;  3JUE A;  3QWP A;  2WXH A;  3ZHE B;  1OUV A;  3PVL A;  4G11 A;  3MKR A;  1GW6 A;  5ENP D;  2XQ0 A;  3IHV A;  1HS6 A;  2R03 A;  4G23 A;  4F1S A;  2R02 A;  3EJN A;  3UPV A;  4HRL A;  3RO2 A;  3NQP A;  4YDW A;  2IOS A;  2ZGD A;  3DSX A;  5B1A E;  2VTB A;  5HS0 A;  3ESK A;  1MZC A;  3ZW3 A;  5ARF A;  4HLE A;  1L5J A;  2KCL A;  4DLQ A;  2J49 A;  2XCC A;  2XZD G;  3SBS A;  3PNT B;  3TXN A;  2P9I G;  3DPD A;  3MJW A;  3EU9 A;  2VGY A;  1FCH A;  1TNZ A;  2HR2 A;  3MKQ B;  5B1B E;  4TXP A;  2FF4 A;  1TJF A;  3PZ3 A;  2FBN A;  3FFL A;  3S7J A;  4B8A A;  5ITZ F;  2XZT G;  1Y6I A;  3FTZ A;  5D66 A;  1HF8 A;  3CHS A;  2ZU6 B;  3QJZ A;  5D0Q D;  1IQR A;  3HXE A;  2HYZ A;  3O48 A;  2J09 A;  4GML A;  3OXL A;  4G2V A;  2GRM A;  4A3T A;  4BER A;  5CCM A;  2J07 A;  3TWT A;  5D2M C;  5AJD A;  1S70 B;  4PS3 A;  3HXC A;  3UUX A;  3B95 A;  3CHR A;  4H7X A;  4BSZ B;  4PS7 A;  1EYH A;  3D9I A;  3IXE A;  1IHB A;  3VLE A;  4GAA A;  4C9B B;  4E85 A;  5JMN D;  4K03 A;  1TEZ A;  4O1O A;  1UW4 B;  3HIZ A;  3AJI A;  1Z5S C;  4ANX A;  2HE0 A;  3FUD A;  3CST A;  4I6J A;  2XS8 A;  3CVX A;  5KCM A;  2FI7 A;  5AN8 A;  4N3B A;  3NZS A;  2QY7 A;  1E8Z A;  4EZL A;  3AG4 E;  3CSF A;  2M63 A;  1TYQ G;  3HVE A;  4LUN U;  4WNE A;  3LY7 A;  3TG4 A;  2XPZ A;  3CVQ A;  5BXO A;  1N54 A;  1H2U A;  4X8Q A;  5AIJ A;  4HOT A;  3DRA A;  2AVP A;  4RVB A;  3IHY A;  4JB8 P;  3CKC A;  2IY0 C;  1OY3 D;  5ENO D;  4EBA A;  4QFV A;  1X81 A;  4DX5 D;  3T5X A;  2F0Y A;  4XIF A;  3KS2 A;  4LNU D;  1EPU A;  3CK9 A;  4BT9 A;  5CRU A;  3OAW A;  4U63 A;  4BTA A;  1JCS A;  1TN8 A;  2WXN A;  1SZ9 A;  5ARG A;  3FUM A;  2GGF A;  2Q7F A;  3Q75 A;  4UWF A;  3VLF A;  5A23 A;  3FHE A;  3HXB A;  2QZA A;  3NBN B;  3PDN A;  2LXL A;  2XEH A;  5EYP F;  3PZ2 A;  2YNQ A;  2WXM A;  3OXG A;  5JJ7 A;  2LUH A;  3AU5 A;  4MRU A;  4FAD A;  1PAQ A;  3KSQ A;  4J8Y A;  3OXF A;  3QWW A;  4WWN A;  4UI9 J;  3E32 A;  1TJC A;  4LG6 A;  3NOG D;  4JHJ A;  4I6E A;  3I4G A;  3CVW A;  4CT0 A;  4A63 B;  1X5B A;  4GTT A;  1UG3 A;  2OVF A;  5KJL A;  5KJK A;  5AAO A;  2KZT B;  4XZ4 A;  3EUV A;  5ENN A;  2XRY A;  1OCO E;  3FUN A;  1TR4 A;  2LSU A;  5AAR A;  4F6R D;  2VSN A;  4K5B A;  1S63 A;  2LNI A;  4U95 D;  1SZA A;  3E33 A;  1RW2 A;  4V3I A;  1SQM A;  2P9U G;  3QNK A;  3RK6 A;  1U3C A;  2R2L A;  2EIK E;  3V31 A;  2VQ2 A;  5CMW A;  1O5M A;  3PE3 A;  5EDS A;  3SO8 A;  3FTX A;  3Q9U C;  4KXK B;  1KLX A;  1ZBP A;  4U8H A;  4CYM D;  2WPV A;  3ESL A;  2YHE A;  3FUF A;  2JLB A;  1NP7 A;  3GZ2 A;  1NZN A;  4LER A;  5FQ6 A;  4P29 A;  3QAQ A;  2ION A;  4GTQ A;  3L82 A;  5KNG A;  3EIJ A;  2WXJ A;  3Q15 A;  4U96 D;  5C2Y A;  2I6H A;  3DSV A;  5AQB A;  3UTM A;  3FUE A;  1SVX A;  2NC9 A;  3AG1 E;  4YND A;  3K9I A;  5ENT D;  4JA7 A;  4CZ2 D;  2V8S E;  3HYM B;  3DSU A;  3PZD A;  3P1U A;  3IEG A;  4CDM A;  3S7D A;  3B7T A;  4W9R A;  4APO A;  4XX5 A;  5LX8 A;  3FTS A;  5EX0 A;  1MYO A;  4AIF A;  3UIO C;  3U64 A;  3W9G A;  1QZ2 A;  3L16 A;  2I1K A;  3B7B A;  1WG0 A;  3GZ1 A;  4EBA G;  1NA0 A;  5BNW A;  4AM9 A;  1OWO A;  4AY5 A;  4G25 A;  5BT1 A;  4I1A A;  2C0L A;  4U7E B;  1H6K A;  5M72 A;  1W3B A;  3ZKJ A;  2R59 A;  1K1A A;  2UWJ G;  3RRN B;  2MRI A;  1KZP A;  2H6G A;  2JAB A;  3EHM A;  5BPP A;  3ABL E;  2F8X K;  4KBQ A;  4I17 A;  3TL5 A;  5AEN A;  4AP2 A;  4KVO A;  1TNU A;  3AG2 E;  2BKG A;  4HXI A;  2L6J A;  2UY1 B;  3BG1 B;  3CHO A;  3FU0 A;  1N9A A;  4ILH B;  3LJN A;  2MHK A;  3TWS A;  4A1G A;  3ZRH A;  3PUJ A;  3Q79 A;  1N94 A;  2DYS E;  3MKQ A;  3L54 A;  3HDX A;  4I2Z A;  1WM5 A;  5DBK A;  3CK7 A;  1MX4 A;  1BD8 A;  2FUL A;  1DCQ A;  4WWO A;  3EDT B;  4NRH B;  3S2A A;  2DBA A;  5A6C A;  4BES A;  4WND A;  2IFU A;  3DBS A;  1OXJ A;  5FQ4 A;  4KZ0 A;  2ZGG A;  4Q94 A;  3GZS A;  4XKC A;  4B93 B;  2WVI A;  5G04 J;  1WDY A;  2P9N G;  4PS8 A;  5ENR D;  2V5Q C;  3TXM A;  3NAW A;  4U04 A;  3D9L A;  4J8F A;  3EHN A;  4OYS A;  4FA6 A;  2GRR B;  2QYJ A;  2EIL E;  2V4H C;  3MV2 B;  4FUL A;  2X38 A;  1DNP A;  3FDH A;  4QQI A;  5D0O D;  2XEE A;  4AJW A;  1OCC E;  2YIN A;  4FJZ A;  4TUM A;  3MYV A;  2XGO A;  3CQG B;  4GTS A;  3D9J A;  3BUA A;  4PDX A;  3CVU A;  3SQV A;  2DIW A;  5KBA A;  3G2T A;  4BSX A;  5CER B;  5KWD A;  4BY6 A;  3E30 A;  4L2Y A;  5CBN A;  3JXI A;  3D9H A;  5LCW J;  3MGB A;  4ANU A;  3ASD A;  1ZU2 A;  3C3R A;  3Q47 B;  2FO7 A;  4G8K A;  3AAA C;  4HI9 A;  4JW1 A;  1BLX B;  3KAE A;  3SZ7 A;  4CRW A;  3JUI A;  2IO3 C;  4UUC A;  3Q4A B;  1N95 A;  2C0M A;  2XGM A;  3PH0 C;  2PL2 A;  4RSY A;  2LXM A;  5AJL A;  4DX7 D;  1SW6 A;  2H6I A;  1LF8 A;  4Y6C A;  2CG3 A;  4AY6 A;  1XGW A;  2JEK A;  4JA9 A;  2EIN E;  1OCZ E;  3LVQ E;  2V4L A;  4HRN A;  3C3Q A;  2E0I A;  2OND A;  3JQ0 A;  1MJ0 A;  4HFG A;  4GZ5 A;  5ANR A;  2RFM A;  1E7U A;  1N4Q A;  2XPI A;  2BED A;  5DIZ A;  4BFR A;  4IUL A;  4B8C B;  3G2W A;  5G05 J;  5KNH D;  3CVY A;  3ZYK A;  4F1P A;  4GA2 A;  5G2N A;  1S64 A;  5T4Y A;  1U3D A;  3CR3 A;  4NUR A;  2VGX A;  2IO2 C;  3HXD A;  4FHJ A;  1OWN A;  2RKK A;  3FU6 A;  4N3C A;  4B89 A;  2CFZ A;  4DLO A;  4Y6W A;  2EIM E;  2L0I A;  3R7R A;  3ZU7 B;  2R5S A;  4GB9 A;  2PZI A;  1H0A A;  2VSX E;  3APC A;  1H2T C;  4KZC A;  4BTB A;  2OEW A;  4FLH A;  2IJG X;  3C72 A;  3NB2 A;  3Q5M A;  4J8D A;  2CHZ A;  5AQ7 A;  4B0Z A;  4AV7 A;  4J0U A;  2WXF A;  3C3O A;  2CHX A;  1INZ A;  2ETA A;  5CMY A;  1K1B A;  2XRZ A;  2WXG A;  3BG0 B;  2FEZ A;  4ILI A;  4LNB A;  3FUK A;  1A17 A;  3QC1 A;  4TRQ A;  5FTP A;  3DPY A;  4ATG A;  4N5Q A;  2YQ8 A;  4GCN A;  2FO1 E;  2XS1 A;  1OCR E;  5FIN A;  2P9K G;  4ACK A;  3KSL A;  5E76 A;  1H6O A;  1Y8M A;  2VTB B;  5IY5 E;  1DC2 A;  5JHA A;  5KJM A;  4HQD A;  5CHE E;  2RFA A;  4FP7 A;  4GZ3 A;  1UJJ A;  3FU3 A;  3UM3 A;  2ETB A;  2B0O E;  2OOE A;  4JEU A;  4URK A;  2VSY A;  3MEK A;  3RIB A;  3LKU A;  4HNA D;  5HQ8 A;  3CKB A;  3AG3 E;  3VTY A;  3CQC B;  3V79 K;  4DI4 A;  1KT1 A;  2BTD A;  2VJ8 A;  1WAO 1;  5LP0 A;  5EID A;  3PUK A;  4UI9 K;  5AQ9 A;  3FUL A;  3TWX A;  2WMN A;  4IN3 B;  2P2C P;  3ULE G;  3FH8 A;  3QB2 A;  4JHR A;  1N4P A;  1IKN D;  5FJY A;  5CED B;  3KEA A;  2B6C A;  3T8K A;  4GZD A;  5ENQ D;  2ETC A;  3QWV A;  3DXM G;  4FU3 A;  3UT7 A;  3GYZ A;  1TN6 A;  2PQN A;  4DX1 A;  4GTP A;  4L23 A;  3UM0 A;  4RLY A;  1TN7 A;  1Z3X A;  1OWL A;  2IOL A;  3RU0 A;  4EZK A;  1U2V G;  4HS2 A;  1D8D A;  5BV1 A;  4CT4 A;  2KBX A;  4U8V D;  3RRM B;  3TWQ A;  2BF0 X;  3QDN A;  2LO6 A;  4UI9 C;  4BX9 A;  3RKV A;  1LD8 A;  3PRE A;  2ZIR A;  5FZR A;  3RRU A;  3FUH A;  3ONK A;  3S7F A;  3MA5 A;  4I1O B;  4IYP A;  3DEO A;  5EKQ D;  2DZO A;  4TXQ A;  3SNX A;  5EYL A;  2IF4 A;  3HVE B;  1HFA A;  2ILR A;  2WMO A;  4XI0 A;  1QBQ A;  2OCC E;  3CHQ A;  3ZYM A;  3FUI A;  1FPP A;  4A3V A;  1AWC B;  4M7C A;  4U0S A;  3I3N A;  4YDY A;  1OWP A;  1O1S A;  3ASF A;  4LCT A;  4JC8 A;  4UWK A;  2DVW A;  2Y3A A;  3SY2 A;  1SA5 A;  4WNF A;  2MYO A;  2VGE A;  5JHB A;  2QFC A;  5JJ6 A;  1JWF A;  1NFI E;  3ASH A;  2P9L G;  4O6F A;  2EQX A;  2GRN B;  4A1S A;  3J5P A;  3UQ3 A;  2A5E A;  2AXZ A;  2XCB A;  1QYM A;  1FVF A;  3CV0 A;  4Q96 A;  2WB2 A;  3LYA A;  2OVB A;  3FTU A;  4F7A A;  3PRZ A;  3W9F A;  3LDZ A;  1YA0 A;  3EHR A;  3ENE A;  2R17 C;  1ELW A;  2WXI A;  5CBO A;  4JPS A;  3CHM A;  1YMP A;  2PNN A;  3ONL A;  4HOR A;  3FTW A;  3OTN A;  3DEP A;  2IU1 A;  4NAC A;  4GZ6 A;  3WXX A;  2WXK A;  3P2B A;  3ZHE A;  5HI7 A;  1JWG A;  3L9T A;  3C5R A;  4CGW A;  4J7W A;  4DUI A;  4BWR A;  1MQS A;  2GRL A;  2KXP C;  5JA4 D;  3FTV A;  3UT8 A;  1NL4 A;  5ANL A;  3T5V A;  2XGS A;  3URZ A;  2OEV A;  1SA4 A;  4I9C A;  1D9S A;  3UXG A;  5E75 A;  4AEZ C;  1MHQ A;  1KZO A;  3ZFW A;  2OV8 A;  4IRU A;  3FU5 A;  4GU5 A;  4HOQ A;  4PUC A;  3TWR A;  3SFY A;  3N71 A;  3BQO A;  1E8W A;  4HB5 A;  3FTY A;  3SFX A;  3RSE G;  1JCR A;  2P9P G;  4WAF A;  3G2V A;  3Q73 A;  4ZHB A;  3CLJ A;  4EQF A;  3J5Q B;  4J8S A;  2KAT A;  3ULQ A;  1D8E A;  1HH8 A;  2AJA A;  2XHE A;  3PEV B;  3D9M A;  2XEV A;  3QK0 A;  3SFZ A;  4WUY A;  4MS6 A;  1H6P A;  3FEY A;  3RJV A;  3ML9 A;  2NXP A;  1MX2 A;  2H6F A;  2C2L A;  4N39 A;  1O1R A;  3V2O A;  4G1T A;  3D9P A;  4HOS A;  2LSV A;  3L22 A;  4EPZ A;  3HXF A;  1EDU A;  3DST A;  3NOC D;  3TAX A;  4YVO A;  3G2U A;  4RQI A;  4L7T A;  2L0T B;  1S0P A;  2V0P A;  5BXU A;  3EU5 A;  3CK8 A;  2MOW A;  4WNG A;  4UWL A;  3UKR G;  4BEP A;  4WWP A;  4DX6 D;  3U3W A;  4XI9 A;  1ZB1 A;  3QKY A;  5G04 C;  5G55 A;  2WQ7 A;  3UM1 A;  2CFU A;  4JEH A;  2X6I A;  3F6Q A;  1DVP A;  3CVP A;  1YCS B;  4JXT A;  3HHM A;  3SBT B;  3LPZ A;  5EN5 D;  4YDE A;  4HVB A;  3FWV A;  3HRA A;  3MZL B;  3L6A A;  3SD5 A;  4C48 B;  3VTX A;  5BUZ A;  4ATZ D;  4OAV B;  2NSZ A;  3PEU B;  3CHP A;  2I9C A;  3ZEF A;  1TNB A;  2VYI A;  1PC2 A;  4MKT A;  3UIN C;  4Q69 A;  1UN9 A;  4UQX A;  2A5U A;  5FWQ A;  4G8L A;  1V54 E;  4U0Z A;  3L08 A;  3WG7 E;  3AS4 A;  4GYO A;  4M3O A;  5LCW C;  1V55 E;  5J90 A;  1JCQ A;  1E90 A;  4XKB A;  3ASO E;  1DCE A;  3DWL G;  4GZC A;  2PM7 A;  4I43 A;  4ANV A;  5EX3 A;  4YVQ C;  1HXI A;  4GTR A;  3E34 A;  2GW1 A;  4GMR A;  4B94 A;  4GPM A;  2A4Z A;  2X3M A;  4NIK A;  3R9M A;  3Q7F A;  3FH7 A;  4GTV A;  3ZN3 A;  3LY9 A;  2BKK B;  4J8E A;  1N0R A;  4AOF A;  1NA3 A;  4O60 A;  4K0R A;  2V5F A;  3IV0 A;  2DWZ A;  3IBE A;  3ASN E;  2KZT A;  3FUJ A;  3UM2 A;  1PY1 A;  4JZY A;  4U07 A;  3DSS A;  1E7V A;  1H19 A;  5FIO A;  5T8I A;  4CEM A;  3FY4 A;  5G05 C;  5HKP A;  4OVV A;  1OWM A;  1IHG A;  2KCK A;  4BT8 A;  4I1M A;  3TWU A;  2Y4T A;  1O1T A;  2J9Q A;  4DI3 A;  4L1B A;  4BET A;  1K3Z D;  1HG5 A;  2F8Y A;  3D9O A;  4N3A A;  4FC8 A;  2Y69 E;  3KEZ A;  1ELK A;  3O4Z A;  2L6B A;  3Q9N C;  3ZXS A;  5J08 A;  4J6I A;  1RZ4 A;  1YYH A;  4KVM A;  3LCA A;  4ABN A;  2DYR E;  2PQR A;  5CRV A;  1N4R A;  3CVV A;  3ASG A;  4JL0 A;  4DRX E;  4N2Q A;  4HOU A;  1BPO A;  2GRP B;  5EIB E;  3EIQ C;  4EZJ A;  2P58 C;  3ABM E;  3I4R B;  4GPK A;  3CVL A;  3PNL B;  3UX4 A;  3JCK C;  1HG2 A;  3ULY A;  4XE0 A;  2ZIS A;  3V2X A;  3ISM C;  1QNF A;  3PS6 A;  4K5C A;  4HBD A;  2CG2 A;  4LEU A;  3SF4 A;  2DCP A;  4ANW A;  3APD A;  1UN8 A;  5LOZ A;  3D9K A;  2AWI A;  2X6H A;  4TV3 A;  1IYG A;  4ILG A;  2DZN A;  2WXQ A;  5CEC B;  3L17 A;  1TNO A;  4TXR A;  3Q78 A;  5JJT A;  4H7Y A;  1QQE A;  3C98 A;  5FT9 A;  4JHK A;  3FEX A;  3MCX A;  2ZXW E;  3B7R L;  3BEE A;  5B3S E;  3RAU A;  3RO3 A;  3D9N A;  1JUQ A;  1E8X A;  1G3N B;  2AXV A;  1Z3Y A;  5BW8 C;  3UIP C;  2Y4U A;  2I2O A;  3CVN A;  3JQ1 A;  3ZXP A;  4HLL A;  2KC7 A;  4Z68 A;  2AW6 A;  2J08 A;  2VGX B;  1UJK A;  4FLB A;  3AU4 A;  1FVH A;  4I2W A;  2WXP A;  4DK5 A;  3LVR E;  2LAH A;  3FH5 A;  2X6K A;  3TWV A;  1B89 A;  1H2V C;  3TGO A;  2VSO E;  1BI8 B;  1FT2 A;  1HE8 A;  2GRO B;  5T3R A;  3T8M A;  3U4T A;  1N52 A;  3TJP A;  3JYS A;  2F37 A;  3SHF A;  4GTM A;  1XNF A;  2YHC A;  3BU8 A;  4I6G A;  1EF1 C;  2UY1 A;  1HZ4 A;  3CIA A;  4PH4 B;  4GA1 A;  5HRY A;  3APF A;  3QAR A;  5LFA A;  1K8K G;  3TWW A;  2P9S G;  3TG5 A;  3ZIM A;  3R7Q A;  4GTO A;  2CHW A;  5FQ7 A;  4OVU A;  4EHM A;  2RD0 A;  3DXK G;  1NI1 A;  1P5Q A;  4LNG A;  3UMV A;  3HG0 D;  4FJY A;  2IQC A;  1Z6T A;  4UQY A;  3G2S A;  3UKU G;  3LXU X;  3ZVV A;  4RG6 A;  1E96 B;  2I1J A;  3B7S A;  2EIJ E;  1N4S A;  3MX3 A;  3AS8 A;  2H6H A;  2IEJ A;  2HM8 A;  5BV0 A;  3IKO B;  3B7U X;  3SGH A;  4YDO A;  3V30 A;  4A55 A;  3B13 A;  4JVS A;  4DJA A;  3PE4 A;  4TUU A;  4O1P A;  2Y0B G;  4CDN A;  3CGH A;  1WY6 A;  4U8Y D;  3Q7A A;  4FHK A;  1MX6 A;  5FQ8 A;  4ZFH A;  3U66 A;  5KJN A;  4MBG A;  3ZNG A;  3T9K A;  5EIL A;  3ZYL A;  5C1D A;  4G26 A;  1HO8 A;  3S7B A;  4KMO A;  3AS5 A;  4KT6 B;  1AP7 A;  4XEI G;  3ZPJ A;  4CCA A;  4F3V A;  3UT4 A;  4CDR A;  3MV3 B;  4LSZ E;  4N2S A;  1VDY A;  4ACL A;  4U0U A;  3L13 A;  4K5A B;  3CEQ A;  5H7P A;  1TNY A;  1IQU A;  2HO1 A;  4AVX A;  4GCO A;  4UWH A;  3LS8 A;  4HRM B;  4G24 A;  2WXR A;  4APF A;  5ENS D;  4L9P A;  3E4B A;  3E37 A;  3ZUV B;  2PM6 A;  2KM4 A;  4LRZ A;  4CGV A;  3NF1 A;  2R05 A;  3ML8 A;  1FT1 A;  2L9B A;  3QOU A;  1Q2Z A;  1IXV A;  5AQA A;  3Q49 B;  2XPY A;  2WXL A;  4DPR A;  3EHQ A;  4UWG A;  3LEW A;  1JPL A;  2RG8 A;  3LJ3 A;  4BX8 A;  2QYU A;  2WQ6 A;  3UI2 A;  3U9W A;  5FZS A;  2E2E A;  2J4D A;  4C0M A;  4EEC A; 
#chains in the Genus database with same CATH homology
 1ZBP A;  3LY8 A;  4U8H A;  4U0Z A;  2WPV A;  3ZGQ A;  4ACK A;  5E76 A;  4AXH A;  3L08 A;  1Y8M A;  3R9A B;  3ESL A;  2VTB B;  2YHE A;  3SI5 A;  2KCV A;  4GA0 A;  4D10 C;  3FUF A;  2JLB A;  5JHA A;  1NP7 A;  3GZ2 A;  5KJM A;  5CHE E;  1NZN A;  4FP7 A;  4GZ3 A;  4GYW A;  1UJJ A;  4LER A;  5FQ6 A;  3AS4 A;  3FU3 A;  5AYW D;  4P29 A;  3KD7 A;  3QAQ A;  2ION A;  4C0E A;  4GYO A;  4M3O A;  5LCW C;  1HX8 A;  5J90 A;  1HU3 A;  1E90 A;  2LAI A;  3EIJ A;  2WXJ A;  1ELR A;  2OOE A;  4JEU A;  3GW4 A;  3I5P A;  3Q15 A;  4XKB A;  3VLD A;  4URK A;  5C2Y A;  2I6H A;  2VSY A;  3FP3 A;  3MEK A;  3LKU A;  4ME2 A;  3RIB A;  4GZC A;  4UQZ A;  2PM7 A;  5HQ8 A;  3CKB A;  4I43 A;  4NQ0 A;  3VTY A;  4ANV A;  5CCL A;  3CQC B;  3FUE A;  4DI4 A;  1KT1 A;  2BTD A;  2WQH A;  2VJ8 A;  4L2L A;  5EX3 A;  1WAO 1;  2NC9 A;  4YVQ C;  2WM9 A;  2X6J A;  4YND A;  4KYO B;  5LP0 A;  3K9I A;  4I9E A;  4JA7 A;  1HXI A;  3PUK A;  4UI9 K;  4RG9 A;  2AXU A;  3FUL A;  2GW1 A;  2WMN A;  4E6H A;  4IN3 B;  4GYY A;  4B94 A;  3FH8 A;  3QB2 A;  4JHR A;  2A4Z A;  2V8S E;  2X3M A;  2X6F A;  3HYM B;  3NZU A;  5FJY A;  3D3M A;  4N5C A;  3ZYQ A;  3FH7 A;  3PZD A;  2WXO A;  3P1U A;  3ZN3 A;  3LY9 A;  5FZQ A;  4GZD A;  4J8E A;  3IEG A;  4AOF A;  4CDM A;  2J4B A;  1NA3 A;  3S7D A;  3B7T A;  3QWV A;  4K0R A;  4W9R A;  4APO A;  2V5F A;  4FU3 A;  4R7L A;  3UT7 A;  3IV0 A;  3IBE A;  4XX5 A;  3FUJ A;  1KT0 A;  2KZT A;  3GYZ A;  5LX8 A;  3FTS A;  1PY1 A;  2PQN A;  1E8Y A;  4JZY A;  4L23 A;  4U07 A;  1E7V A;  1H19 A;  5EX0 A;  5T8I A;  4CEM A;  4AIF A;  3FY4 A;  5G05 C;  4MLP A;  3U64 A;  4GMJ A;  1Z3X A;  1QZ2 A;  4F53 A;  1OWL A;  2IOL A;  3L16 A;  3RU0 A;  2I1K A;  4EZK A;  5A7D B;  4HS2 A;  4OVV A;  5BV1 A;  1OWM A;  2BUG A;  3QWP A;  3GZ1 A;  4CT4 A;  1IHG A;  2KCK A;  4BT8 A;  4EBA G;  3RRM B;  1NA0 A;  4I1M A;  2BF0 X;  3QDN A;  5BNW A;  2LO6 A;  2Y4T A;  4AM9 A;  1OWO A;  2J9Q A;  4AY5 A;  4DI3 A;  4UI9 C;  2WXH A;  4L1B A;  3ZHE B;  4G25 A;  5BT1 A;  1OUV A;  4I1A A;  3PRE A;  3RKV A;  2C0L A;  4BX9 A;  1HG5 A;  3PVL A;  4G11 A;  3MKR A;  1GW6 A;  1H6K A;  3D9O A;  4N3A A;  4FC8 A;  2XQ0 A;  3IHV A;  3KEZ A;  1ELK A;  3O4Z A;  5M72 A;  1HS6 A;  5FZR A;  3RRU A;  1W3B A;  3ZXS A;  5J08 A;  4J6I A;  4G23 A;  2R59 A;  3FUH A;  3ONK A;  2UWJ G;  3S7F A;  3MA5 A;  4KVM A;  3RRN B;  2MRI A;  3LCA A;  4ABN A;  4I1O B;  2PQR A;  4F1S A;  4IYP A;  5EKQ D;  3EJN A;  3CVV A;  3EHM A;  5BPP A;  3ASG A;  3UPV A;  3SNX A;  2IF4 A;  4JL0 A;  3NQP A;  3RO2 A;  4N2Q A;  4HOU A;  3HVE B;  4KBQ A;  4I17 A;  1HFA A;  3TL5 A;  2IOS A;  2ILR A;  2WMO A;  4XI0 A;  5AEN A;  1BPO A;  4AP2 A;  3CHQ A;  4KVO A;  2VTB A;  3ZYM A;  4HXI A;  3ESK A;  3FUI A;  2L6J A;  2UY1 B;  3BG1 B;  3EIQ C;  4EZJ A;  2P58 C;  3CHO A;  3ZW3 A;  4A3V A;  5ARF A;  4HLE A;  1L5J A;  2KCL A;  4DLQ A;  2J49 A;  3FU0 A;  2XCC A;  3I3N A;  4ILH B;  1OWP A;  4U0S A;  3SBS A;  3I4R B;  3ASF A;  3PNT B;  4LCT A;  3TXN A;  4GPK A;  3DPD A;  3MJW A;  2MHK A;  4JC8 A;  4UWK A;  3CVL A;  3PNL B;  4A1G A;  3ZRH A;  3UX4 A;  2VGY A;  1FCH A;  1HG2 A;  3JCK C;  3PUJ A;  4XE0 A;  2Y3A A;  4WNF A;  3MKQ A;  1QNF A;  3PS6 A;  3L54 A;  2HR2 A;  3MKQ B;  3HDX A;  5JHB A;  2QFC A;  4I2Z A;  2CG2 A;  4LEU A;  1WM5 A;  5DBK A;  2FF4 A;  1TJF A;  2FBN A;  3CK7 A;  3SF4 A;  2FUL A;  1JWF A;  3FFL A;  5JJ6 A;  4WWO A;  3S7J A;  2DCP A;  3ASH A;  4ANW A;  4B8A A;  3EDT B;  3APD A;  4NRH B;  3S2A A;  1Y6I A;  2DBA A;  4O6F A;  1UN8 A;  2EQX A;  5A6C A;  5LOZ A;  3D9K A;  3FTZ A;  4A1S A;  4WND A;  2AWI A;  2X6H A;  2IFU A;  3DBS A;  4TV3 A;  5FQ4 A;  1IYG A;  4ILG A;  4KZ0 A;  1HF8 A;  3CHS A;  2ZU6 B;  3QJZ A;  5D0Q D;  1IQR A;  3UQ3 A;  4Q94 A;  3GZS A;  2WXQ A;  4XKC A;  2HYZ A;  3L17 A;  3O48 A;  2J09 A;  4GML A;  3OXL A;  2WVI A;  5G04 J;  4G2V A;  2GRM A;  4A3T A;  2AXZ A;  2XCB A;  4PS8 A;  3TXM A;  5CCM A;  1FVF A;  2J07 A;  4U04 A;  3D9L A;  4J8F A;  3CV0 A;  4Q96 A;  5AJD A;  2WB2 A;  5JJT A;  4H7Y A;  1QQE A;  3LYA A;  4PS3 A;  2OVB A;  3C98 A;  3FTU A;  5FT9 A;  4JHK A;  3EHN A;  3FEX A;  3MCX A;  3B7R L;  3BEE A;  4F7A A;  4OYS A;  3UUX A;  3PRZ A;  3LDZ A;  3RO3 A;  1YA0 A;  3D9N A;  1JUQ A;  2R17 C;  1E8X A;  3ENE A;  1ELW A;  2AXV A;  2WXI A;  4FA6 A;  1Z3Y A;  3CHR A;  5BW8 C;  4H7X A;  2Y4U A;  2I2O A;  3CVN A;  3JQ1 A;  4JPS A;  3CHM A;  3MV2 B;  4PS7 A;  1EYH A;  2KC7 A;  3D9I A;  4FUL A;  2X38 A;  3ONL A;  4HOR A;  3FTW A;  2AW6 A;  2J08 A;  3VLE A;  2VGX B;  1UJK A;  1DNP A;  3FDH A;  4FLB A;  3OTN A;  4GAA A;  4C9B B;  4E85 A;  5D0O D;  3AU4 A;  1FVH A;  2IU1 A;  4NAC A;  4GZ6 A;  4I2W A;  4AJW A;  3WXX A;  2WXK A;  2WXP A;  4K03 A;  1TEZ A;  4DK5 A;  3LVR E;  3P2B A;  1UW4 B;  3HIZ A;  3ZHE A;  2LAH A;  2YIN A;  4FJZ A;  3FH5 A;  5HI7 A;  1JWG A;  2X6K A;  3MYV A;  2XGO A;  4CGW A;  4ANX A;  3FUD A;  3CQG B;  4BWR A;  1B89 A;  3CST A;  1H2V C;  4I6J A;  1MQS A;  2GRL A;  3FTV A;  3UT8 A;  3TGO A;  2VSO E;  3CVX A;  3D9J A;  5ANL A;  5KCM A;  3T5V A;  2FI7 A;  4PDX A;  2XGS A;  3CVU A;  1HE8 A;  4N3B A;  2DIW A;  5T3R A;  3NZS A;  4I9C A;  3URZ A;  5E75 A;  2QY7 A;  3T8M A;  4AEZ C;  1E8Z A;  3U4T A;  1MHQ A;  4EZL A;  3G2T A;  1N52 A;  3ZFW A;  4BSX A;  2OV8 A;  4IRU A;  3FU5 A;  3CSF A;  4GU5 A;  2M63 A;  3TJP A;  3HVE A;  4LUN U;  3JYS A;  4HOQ A;  4WNE A;  3LY7 A;  4PUC A;  3SHF A;  3TG4 A;  4BY6 A;  2XPZ A;  3N71 A;  3CVQ A;  1E8W A;  4L2Y A;  1XNF A;  2YHC A;  4I6G A;  1EF1 C;  3FTY A;  5LCW J;  1N54 A;  1H2U A;  2UY1 A;  3MGB A;  1HZ4 A;  4ANU A;  3CIA A;  3ASD A;  1ZU2 A;  5AIJ A;  4PH4 B;  4WAF A;  3G2V A;  4HOT A;  3CLJ A;  4GA1 A;  3APF A;  3QAR A;  4EQF A;  5LFA A;  3Q47 B;  4J8S A;  2KAT A;  2FO7 A;  2AVP A;  3ULQ A;  1HH8 A;  3TG5 A;  4JW1 A;  3ZIM A;  4RVB A;  2XHE A;  3IHY A;  3KAE A;  3SZ7 A;  3CKC A;  4CRW A;  3R7Q A;  3JUI A;  2CHW A;  5FQ7 A;  3PEV B;  4EBA A;  3D9M A;  2XEV A;  4OVU A;  4QFV A;  3QK0 A;  3Q4A B;  3SFZ A;  2C0M A;  2RD0 A;  2XGM A;  4WUY A;  3PH0 C;  2PL2 A;  4MS6 A;  3FEY A;  3T5X A;  3RJV A;  4RSY A;  1P5Q A;  4XIF A;  5AJL A;  3KS2 A;  3UMV A;  3ML9 A;  2NXP A;  4FJY A;  2IQC A;  1EPU A;  1LF8 A;  1Z6T A;  3CK9 A;  4UQY A;  4Y6C A;  2CG3 A;  4BT9 A;  1XGW A;  2JEK A;  3OAW A;  4JA9 A;  3G2S A;  4AY6 A;  4U63 A;  3LVQ E;  3LXU X;  3ZVV A;  4BTA A;  2C2L A;  2WXN A;  2V4L A;  4RG6 A;  1SZ9 A;  1E96 B;  5ARG A;  4N39 A;  2E0I A;  2OND A;  2I1J A;  3B7S A;  3D9P A;  3FUM A;  3JQ0 A;  4G1T A;  4HFG A;  4HOS A;  3MX3 A;  3AS8 A;  2LSV A;  2GGF A;  3L22 A;  4GZ5 A;  4EPZ A;  2Q7F A;  4UWF A;  2HM8 A;  3VLF A;  3IKO B;  5BV0 A;  5A23 A;  1EDU A;  3B7U X;  5ANR A;  3FHE A;  1E7U A;  3TAX A;  3PDN A;  3SGH A;  2XPI A;  4A55 A;  3B13 A;  5DIZ A;  4JVS A;  4BFR A;  4DJA A;  4YVO A;  3PE4 A;  3G2U A;  4IUL A;  4TUU A;  4B8C B;  3CGH A;  4CDN A;  3G2W A;  1WY6 A;  5G05 J;  2YNQ A;  2WXM A;  3CVY A;  3ZYK A;  3OXG A;  5JJ7 A;  4FHK A;  5FQ8 A;  4L7T A;  3AU5 A;  4GA2 A;  2L0T B;  4MRU A;  1S0P A;  5G2N A;  4FAD A;  3U66 A;  2V0P A;  5KJN A;  1PAQ A;  3CK8 A;  5T4Y A;  1U3D A;  2MOW A;  3ZYL A;  5C1D A;  3CR3 A;  3OXF A;  4G26 A;  1HO8 A;  3S7B A;  3QWW A;  4NUR A;  4WNG A;  4KMO A;  2VGX A;  4UWL A;  3AS5 A;  4WWN A;  4KT6 B;  4UI9 J;  4FHJ A;  3ZPJ A;  1OWN A;  1TJC A;  4WWP A;  4CCA A;  3FU6 A;  4F3V A;  3U3W A;  4JHJ A;  4N3C A;  3UT4 A;  4I6E A;  3I4G A;  2CFZ A;  4B89 A;  4XI9 A;  4CDR A;  4DLO A;  3CVW A;  4Y6W A;  3MV3 B;  4CT0 A;  1X5B A;  2L0I A;  3QKY A;  3R7R A;  4N2S A;  5G04 C;  5G55 A;  2WQ7 A;  2R5S A;  1VDY A;  4ACL A;  2CFU A;  4GB9 A;  2PZI A;  4JEH A;  1UG3 A;  2OVF A;  3L13 A;  4U0U A;  3CEQ A;  1H0A A;  5KJL A;  2X6I A;  2VSX E;  1DVP A;  3APC A;  5KJK A;  1H2T C;  2KZT B;  1IQU A;  2HO1 A;  3CVP A;  4XZ4 A;  4KZC A;  4AVX A;  4BTB A;  4GCO A;  4UWH A;  3LS8 A;  5ENN A;  2XRY A;  4FLH A;  2IJG X;  4G24 A;  2WXR A;  3FUN A;  2LSU A;  4JXT A;  4APF A;  2VSN A;  3HHM A;  3SBT B;  2LNI A;  3LPZ A;  3Q5M A;  4J8D A;  1SZA A;  2CHZ A;  4V3I A;  4HVB A;  1SQM A;  3E4B A;  4B0Z A;  3FWV A;  3MZL B;  3L6A A;  4AV7 A;  3SD5 A;  2PM6 A;  2KM4 A;  4J0U A;  4LRZ A;  2WXF A;  3NF1 A;  4CGV A;  3ML8 A;  3QNK A;  3RK6 A;  3VTX A;  1U3C A;  5BUZ A;  2CHX A;  1INZ A;  5CMY A;  2XRZ A;  2L9B A;  3QOU A;  2WXG A;  3Q49 B;  2XPY A;  2VQ2 A;  2NSZ A;  2WXL A;  3BG0 B;  3PEU B;  2FEZ A;  3CHP A;  4DPR A;  2I9C A;  4ILI A;  3ZEF A;  4UWG A;  2VYI A;  3FUK A;  1PC2 A;  1JPL A;  3LEW A;  5CMW A;  2RG8 A;  1A17 A;  3LJ3 A;  3PE3 A;  4BX8 A;  4MKT A;  3QC1 A;  4TRQ A;  2WQ6 A;  5FTP A;  4Q69 A;  5EDS A;  4ATG A;  3U9W A;  2YQ8 A;  1UN9 A;  3FTX A;  5FZS A;  4GCN A;  4KXK B;  2E2E A;  4UQX A;  2J4D A;  4C0M A;  4EEC A;  2A5U A;  5FWQ A;  1KLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...