2L6JA

Tah1 complexed by meevd
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of minimal tetratricopeptide repeat domain protein Tah1 reveals mechanism of its interaction with Pih1 and Hsp90.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords TPR repeat-containing protein associated with Hsp90
total genus 32
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2l6jA00
5CHEE 2GW1A 3CK9A 3S7FA 3CK7A 4J0UA 4HOTA 2JLBA 5DIZA 2XEVA 1HH8A 2E2EA 2VQ2A 2VYIA 5FZRA 3LPZA 3QWVA 3LCAA 4BT9A 4KXKB 3CKBA 3CKCA 4BTAA 3CVNA 3Q49B 3U4TA 5BNWA 2HYZA 5M72A 3WXXA 1NA0A 3JYSA 5KJMA 4N2QA 4NRHB 4RG9A 3OXLA 4GZ3A 3QDNA 5BT1A 2NC9A 3AS5A 1PC2A 3BEEA 2KCLA 2XGSA 3LY9A 4GA2A 4KBQA 4N3BA 2KC7A 2XPIA 4UI9J 2FF4A 5ARGA 3VTYA 1E96B 3TGOA 3MEKA 1TJCA 1NZNA 4GYOA 4N2SA 3RJVA 3ZN3A 2QFCA 4UQYA 4GYWA 4UI9C 4H7XA 2PQRA 2XGOA 3MV3B 2IFUA 3Q4AB 3CK8A 4G23A 4O6FA 4U0SA 3CVPA 4UQZA 4BWRA 5EKQD 3RO2A 2FEZA 3GZ2A 2PL2A 3MA5A 3Q15A 4LEUA 4I9CA 5JJ6A 4U07A 4WNEA 5CCMA 3U3WA 1ZU2A 4ABNA 4N3CA 1HXIA 2LNIA 4JHRA 3S7DA 3UQ3A 4CGVA 3TG5A 4N39A 5LCWC 2PZIA 2WPVA 1IHGA 4NQ0A 4XIFA 3GYZA 4WNDA 4G1TA 2J9QA 4I2ZA 1KT0A 2UY1B 2YQ8A 3OXGA 5AYWD 3S7BA 3UUXA 4EQFA 4GYYA 2FBNA 4N3AA 2VGYA 3URZA 5FTPA 3ZPJA 5FJYA 2HO1A 5HQ8A 5KJNA 3PE3A 1OUVA 4G26A 5D0QD 4UI9K 3SF4A 4G24A 4Y6WA 4B94A 2C2LA 1WAO1 2R5SA 3ASHA 5HI7A 5CCLA 4ME2A 4WNFA 5KJLA 3ULQA 1HZ4A 1QQEA 5A6CA 2OOEA 2VSNA 1KT1A 4JA7A 3R9AB 4APOA 4AY5A 3N71A 2KCVA 4AM9A 3ZGQA 3UPVA 2PQNA 4W9RA 4HORA 4AIFA 2V5FA 4YVOA 3VTXA 4G2VA 3ASGA 3QOUA 5EX0A 5C1DA 1IYGA 4GPKA 1WM5A 4I17A 2VSYA 3OXFA 3KAEA 3LKUA 3LYAA 3Q47B 4KYOB 2BUGA 2C0LA 2KATA 2Q7FA 3QWWA 4GCOA 3NF1A 2XCBA 4JL0A 2Y4TA 5FZQA 4I1AA 5G05C 2L6JA 2HR2A 1Y8MA 2FI7A 2KCKA 3ASDA 1KLXA 5BW8C 5DBKA 3FP3A 4HOQA 5D0OD 4CDRA 3TG4A 3IEGA 3FWVA 3K9IA 5G04C 3KS2A 4RG6A 4BT8A 4U0UA 1ELWA 3GZ1A 3QKYA 4N5CA 2YHCA 3ZFWA 4J8FA 3PDNA 4XI0A 1P5QA 4AY6A 1ELRA 5G05J 5A7DB 3ZHEB 2UY1A 4JA9A 3KD7A 2I6HA 2ONDA 2P58C 3CEQA 3AS4A 3LY8A 3PE4A 2AVPA 4GCNA 1XNFA 2FO7A 5KJKA 3RU0A 3GW4A 4A1SA 4U0ZA 1ZBPA 5FZSA 3S7JA 4UQXA 4I9EA 3CVLA 3TAXA 4CGWA 4WUYA 3MKRA 1YA0A 5JJ7A 5JJTA 3O48A 4U04A 4G25A 3EDTB 3CVQA 4HOUA 3SZ7A 4F3VA 4YNDA 4GZ6A 3AS8A 2XGMA 5LCWJ 4IN3B 4WNGA 2DBAA 2UWJG 3E4BA 3FFLA 1FCHA 4J8EA 3CV0A 2IF4A 3QWPA 2LSUA 4GA0A 4Y6CA 5G04J 2Y4UA 3RKVA 3LY7A 1B89A 4J8DA 4I2WA 3HYMB 2XCCA 2C0MA 4YVQC 2VGXA 2VGXB 5FT9A 3RO3A 2WQHA 1A17A 3ASFA 2MHKA 4H7YA 3ESKA 4GZ5A 4XI9A 5ARFA 1QZ2A 3ZHEA 4GA1A 3Q5MA 1W3BA 3MV2B 5EX3A 2LSVA 3RIBA 4HOSA 1NA3A 4BTBA
chains in the Genus database with same CATH superfamily
2MYOA 1MX4A 3DEOA 4K03A 4FADA 4XE0A 3U4TA 1DVPA 3D9JA 4GZCA 2QC9A 3KEAA 4GYOA 2PQRA 1KZPA 1BI8B 5ENRD 4V3IA 5CEDB 2PL2A 4LEUA 4KVMA 2ETCA 5AJDA 5EN5D 2WQ6A 4EPZA 3DXKG 1TEZA 1TYQG 2R5SA 3VLFA 4C9BB 2X6FA 4TV3A 1RW2A 3G2UA 4D10C 5H7PA 2XS8A 3PZ1A 3FH8A 3NF1A 1V55E 5EIBE 3CSFA 5G04C 1OWMA 3AG3E 2X3MA 1SA4A 3CQGB 1MZCA 3DBSA 5JHAA 3CGHA 3TAXA 5JJ7A 1VDYA 3FY4A 4U04A 5ENPD 4KMOA 5AYWD 2DBAA 5C2YA 1MJ0A 5AARA 3ONKA 3LY7A 1LF8A 3KSQA 2XEEA 4L9PA 3Q75A 1PY1A 4GA1A 4LNBA 3RK6A 3FTXA 1S63A 5CHEE 3AU5A 3L08A 4ACLA 3QJZA 5BUZA 2QZAA 3LS8A 4BSZB 1JWFA 3FULA 5FQ4A 2RD0A 3RO2A 3TXNA 4H7XA 1KPSB 4UWHA 4JXTA 3BQOA 3MA5A 4EZLA 1N4RA 4CT0A 4JHRA 3L54A 4CGVA 1BI7B 3FEYA 4LG6A 1KT0A 3OXGA 5HQ8A 1HE8A 1TNOA 4GPMA 3SFYA 5T3RA 1OCRE 3AAAC 5D0QD 1N94A 4WNFA 2OOEA 2Y1LE 5JMND 5BXOA 4GTPA 3MCXA 4PS7A 4GPKA 4KYOB 3FEXA 2Q7FA 4GTTA 4JL0A 2HR2A 1KLXA 5DBKA 2WMOA 1H2VC 3G2SA 5FQ8A 3C3QA 3KD7A 2XENA 1LD8A 3EU9A 3L6AA 2P9UG 4WUYA 4HFGA 4Z68A 2LAHA 3ZXPA 2EIKE 4AVXA 2X38A 5G55A 1IQRA 1E7UA 1Z6TA 4FU3A 3CVXA 3MYVA 5AQ9A 2FO1E 3NZUA 3PZ2A 2V4LA 3ML9A 5KCMA 3FUFA 1N4SA 3BG0B 3QK0A 3Q73A 1YMPA 3UIOC 1YYHA 3HXEA 3CK7A 3D9PA 2GRRB 2VQ2A 5AIJA 3FU6A 3V79K 5CBOA 3CSTA 4CEMA 4RG9A 1DCQA 4AXHA 2R17C 1EDUA 3SNXA 4ABNA 3ISMC 3AG1E 2AXVA 5EYPF 3ZEFA 1IHBA 4PUCA 2CG3A 4B94A 3QC1A 3EU5A 4HI8A 1HU3A 2A4ZA 2GRMA 2ZGDA 4ILHB 4W9RA 3ASGA 1EYHA 4MBGA 3HXFA 2BUGA 1WY6A 4BFRA 2L6JA 4JC8A 3K9IA 4JW1A 3FTWA 4UWFA 3DSUA 3EHRA 4J8FA 2WB2A 3MKQB 4GMRA 5FZSA 1O1RA 3PVLA 3SZ7A 4J8EA 2KZTA 3DSVA 1EPUA 3VLEA 3MV2B 4ATGA 5CRVA 4GTSA 4BX9A 5J08A 5FZRA 2XQ0A 4WWNA 2IU1A 4KXKB 2HYZA 1NL4A 5IY5E 4HOTA 2NC9A 4A55A 4PS3A 4C0MA 1OWLA 3CIAA 4FJZA 1UG3A 4C48B 5B1AE 1OY3D 4BWRA 3HVEB 3W9FA 4QFVA 1H19A 4URKA 2XRYA 3APFA 4PDXA 3ASNE 2JEKA 3G2TA 1HO8A 5LP0A 3GYZA 1D8DA 3T5XA 4XKCA 4MS6A 5FJYA 4JHKA 4RQIA 5CCLA 2DZOA 2I9CA 5EDSA 4ME2A 4HVBA 5KNGA 3E33A 4I6JA 3ZXSA 1G3NB 3NOCD 4BY6A 3T8KA 3Q79A 2WXMA 4HXIA 3B13A 2ZU6B 3NZSA 2DIWA 5FWQA 1O1TA 5HS0A 2XS1A 3PEUB 2GRPB 3TG4A 2ZIRA 1TNBA 4AY6A 2WMNA 5G05J 2HE0A 2XZDG 4JA9A 2P9IG 4DI4A 3S7JA 1Z3YA 4UQXA 4EZKA 1YA0A 2LUHA 3D3MA 4TUUA 2AJAA 3CV0A 2Y0BG 5G04J 2Y4UA 4I2WA 1B89A 4QQIA 2L0IA 2VGXA 5FT9A 2WQHA 5LFAA 2BEDA 5AQBA 1TN7A 1QZ2A 3Q47B 4HOSA 3FUEA 3Q9UC 5A23A 1BLXB 5EILA 1SVXA 4TUMA 4FLBA 5ENOD 4NRHB 3OXLA 5AQAA 3QDNA 3CHSA 5ANRA 5CBNA 4UI9C 3V30A 2IFUA 4DX5D 3AG2E 4GZDA 4I2ZA 2WQ7A 3DSTA 3Q7AA 5FQ6A 3SF4A 1N0QA 2VSOE 3UKRG 1OXJA 2AXUA 3KSLA 2VSXE 2CG2A 1Z5SC 3ZGQA 1TN6A 2KBXA 5FQ7A 4RSYA 2AWIA 4OYSA 3L82A 3JQ0A 5FIOA 4EBAG 4GCOA 5AJLA 5ENSD 2DYSE 3DPYA 2KCKA 3PS6A 1OCZE 4BT8A 5BPPA 3QKYA 1WDYA 5BXUA 1ELRA 1LD7A 3ZUVB 3RU0A 3GW4A 1E8YA 1ZBPA 3UT8A 4GB9A 4ATZD 5ENQD 2NYJA 4E85A 1A5EA 2V4HC 3R7QA 4L7TA 4GZ5A 3ZHEA 4RLYA 1TNYA 3I4RB 1RZ4A 4HS2A 4U8YD 2R2LA 1LTXA 4DJAA 4M3OA 5BT1A 3CR3A 2WXKA 4DK5A 1TJCA 3I3NA 4GYWA 2XGOA 4GMLA 4HBDA 3TG5A 4UWKA 1O1SA 2B0OE 3TWXA 3UUXA 2VGYA 3L22A 3ZW3A 4O60A 4LERA 5ENNA 1TNUA 3FUNA 4A3TA 4AM9A 3VTXA 2KM4A 3V2OA 3OXFA 3QWWA 2XEHA 2QYUA 4G8KA 3CVWA 1AP7A 2FI7A 2CHZA 3BUAA 2B6CA 2DZNA 3MGBA 1MX6A 3J5QB 3ZHEB 3FTUA 4Q94A 5CMWA 3AS4A 4UWGA 3PH0C 1S70B 4APOA 1N95A 1S64A 3TWQA 2A5UA 3CHQA 4IN3B 1HG5A 3JXJA 2GRQB 4KVOA 4J8YA 1SZ9A 4J8DA 1ELKA 3HIZA 3NAWA 3B7RL 4U7EB 3HHMA 3EJNA 3CHOA 1HFAA 3FUMA 3UINC 2E2EA 3QWVA 3NBNB 4LRZA 3D9LA 4GZ3A 3LY9A 4GA2A 4DX1A 3VTYA 3TGOA 4HLLA 2QFCA 1D8EA 2OVFA 3L9TA 3MZLB 5LCWC 3LDZA 4IULA 3F6QA 2UY1B 4BETA 1H6KA 3S7BA 4GYYA 3URZA 3HXBA 3SBTB 4G26A 4LNGA 2PNNA 4DX7D 1JWGA 2WXGA 5E75A 3ZRHA 3P2BA 2PQNA 2CHXA 2V5FA 4ACKA 4LSZE 5BV1A 5C1DA 3PNLB 3DEPA 4CZ2D 1SZAA 2XCBA 3X2QE 4CDRA 3IEGA 1N52A 2R02A 3FTSA 3ZFWA 2GRLA 4DLQA 3FH7A 4XZ4A 4J7WA 3PEVB 4A1SA 1K8KG 3E37A 4CGWA 1SQMA 4PH4B 4LUNU 1Q2ZA 1UN9A 4CCAA 4GZ6A 1N9AA 4GTMA 3E32A 1FCHA 4GA0A 5AN8A 1MHQA 2X6KA 2P9LG 3S2AA 3ENEA 2ETBA 3QB2A 3UMVA 2LSVA 2GW1A 1E8XA 2P9KG 1UW4B 2XEVA 2AW6A 1FPPA 3WXXA 1NA0A 5AQ7A 4ANUA 1IKND 5HI7A 4JD2G 4CDMA 3D9OA 2XPZA 1NZNA 3MEKA 1IQUA 3KEZA 4U0SA 3HXDA 3PUKA 3FTYA 1ZU2A 2LNIA 4FC8A 5KNHD 2PZIA 3NOGD 4XIFA 1HS6A 3UKUG 1OCOE 2YINA 1OT8A 3ZYMA 1E90A 3C5RA 3PE3A 2GGFA 3ESLA 4G24A 4Y6WA 3ULQA 4DI3A 2WXFA 4AY5A 3C3RA 1E8ZA 2NSZA 4WWPA 2VTBA 2V8SE 1WM5A 3CHRA 4F1PA 4Q96A 2Y4TA 3RRMB 2QYJA 2VGEA 3ULEG 3KS2A 3UM3A 3EIQC 5A7DB 4AJWA 3LY8A 1E7VA 2EQXA 2OV8A 3UT4A 4U0ZA 4XKBA 5EIDA 3UI2A 2IJGX 4B89A 4G25A 1WG0A 4GTQA 4JPSA 4GTRA 2NXPA 4WNGA 4GTVA 3PZ4A 4Y6CA 2IOLA 1OCCE 3JXIA 5B3SE 3AJIA 2DWZA 3Q5MA 5G2NA 3RJVA 2GRNB 5T8IA 4M7CA 4B0ZA 1HH8A 5JHBA 3LPZA 4UUCA 3BG1B 4AV7A 5KJMA 3SY2A 3AS5A 1PC2A 1BD8A 4FHKA 3MV3B 4O6FA 5AAOA 2FEZA 3Q15A 4N3CA 4G8LA 1HXIA 3UQ3A 4N39A 3EHNA 5D2MC 3ULYA 3MJWA 2YQ8A 2QY7A 4HRMB 5KJKA 3IKOB 4UI9K 2RKKA 2PM7A 4K0RA 4X8QA 3BU8A 4TXQA 3SBSA 1BU9A 2EIJE 2VJ8A 1K1AA 4FLHA 2LXMA 3SFXA 3ABKE 3TWRA 5FZQA 3PRZA 1JCQA 1ZB1A 3TWWA 4I6EA 2ETAA 4KZ0A 2JABA 1S0PA 2YHCA 3G2WA 3RRUA 4MKTA 5CMYA 4HNAD 3IXEA 3AS8A 5D66A 4BTBA 4NACA 1TR4A 5HKPA 4XX5A 3CK9A 1H2UA 3LJ3A 4WAFA 3PZDA 4J0UA 2L6BA 3UM2A 2VYIA 4BESA 4N2QA 3UX4A 2XPIA 2XRZA 4I1MA 3L17A 3SO8A 4HLEA 3Q4AB 3CK8A 4EQFA 3I4GA 3UXGA 2DVWA 4J8SA 5CRUA 1UOHA 2WPVA 2RFAA 3ZU7B 4A3VA 3T8MA 1H0AA 2FBNA 2F8YA 5E76A 2P9NG 4NIKA 2X6JA 2IQCA 3FTZA 3V31A 1UJJA 2X6HA 1HZ4A 2J49A 2V5QC 4XEIG 3N71A 4A63B 4BX8A 4G2VA 3QOUA 2H6FA 4FP7A 5EX0A 4UWLA 3LYAA 4JEHA 2C0LA 2BKGA 2R05A 5BW8C 1Y8MA 1JCSA 4LNUD 3B7SA 4U0UA 5LX8A 3PDNA 1P5QA 3CHMA 4U95D 3C72A 2ONDA 3PE4A 3IHYA 3ZIMA 4I9EA 3CVLA 3EUVA 3PUJA 4YNDA 1DC2A 1OWNA 3RKVA 3QWPA 3ZKJA 4MRUA 1N0RA 4DX2A 3C98A 1BPOA 4DX6D 5JJ6A 1NA3A 3MKRA 3SFZA 5AENA 4KZCA 4BT9A 3CKCA 2RG8A 4CYMD 3JYSA 4AIFA 4UI9J 4KBQA 5ARGA 1E96B 4LCTA 2CFZA 4UQYA 1FT2A 5EKQD 4I9CA 3APCA 3ZVVA 4A1GA 3P1UA 3SI5A 3QAQA 5KJNA 1HG2A 4HQDA 5KBAA 3DSSA 1HX8A 1QQEA 1OWOA 5A6CA 3FH5A 3FU0A 2KCVA 3UPVA 4HORA 4AOFA 2VSYA 4E6HA 1U3CA 4HI9A 4EECA 2KATA 2F8XK 5G05C 2WXLA 4OVVA 4OAUC 3E34A 3GZ1A 2WXIA 2I1KA 1FVFA 1TN8A 2A5EA 4EZJA 4GCNA 2AVPA 1QYMA 1HF8A 3TL5A 3UTMA 4R7LA 1GW6A 4JZYA 4U63A 4YDWA 2R59A 4DUIA 2KZTB 2CFUA 2YHEA 4GTOA 5EYLA 3ESKA 2OEVA 3RIBA 3FUDA 3Q7FA 4K5CA 1N11A 4BTAA 2ZISA 1Z3XA 1SW6A 1QNFA 3AG4E 3EHQA 2XGSA 4L23A 3B7BA 4HRNA 3SQVA 2XPYA 3CVPA 5CCMA 4JHJA 5CERB 2WXRA 3CQCB 1K1BA 2J9QA 3FDHA 1N4QA 2HO1A 4FA6A 2OCCE 2GROB 3HXCA 3HRAA 3I5PA 2I1JA 3PNTB 4L2YA 3LKUA 4P29A 4OAVB 3FWVA 3ML8A 4RG6A 2J09A 3RSEG 2P2CP 4DLOA 3TWSA 2CHWA 4JEUA 1X81A 2KXPC 3EHMA 3C3OA 5JJTA 2F0YA 1EF1C 5LCWJ 4GMJA 1JCRA 4NURA 3FFLA 1X5BA 4EHMA 2BTDA 2H6IA 5T4YA 3O4ZA 2VGXB 1A17A 3HDXA 4TRQA 3UT7A 2IONA 3D9NA 4F3VA 2MOWA 2ZGGA 4DRXE 2JLBA 4U8VD 4BSXA 3LCAA 3ZNGA 3CLJA 4KT6B 3FUIA 4EBAA 5BNWA 1KZOA 4YDYA 3BEEA 3DSXA 5FINA 5ITZF 3ZN3A 2WXHA 2OEWA 5CECB 4ANWA 4K5BA 1FT1A 3FU3A 1N54A 3Q78A 4WNDA 2RFMA 3FU5A 3U64A 4ZHBA 1IXVA 1NP7A 1E8WA 3ABME 4ZFHA 2EIME 1YCSB 2VSNA 3R9AB 4FJYA 3WG7E 4F7AA 3DSWA 1SA5A 4GAAA 4B93B 2DYRE 1K3ZD 4FHJA 3RRNB 5KWDA 3J5PA 3D9MA 2J8SD 2I6HA 2P58C 3CEQA 4RVBA 4CT4A 4IYPA 2FO7A 3FUJA 3B95A 4C0EA 3O48A 3CVQA 3U66A 3LJNA 2UWJG 2DCPA 4YDOA 2WXQA 3JCKC 2R03A 4CDNA 2MRIA 5HRYA 2M63A 3E30A 2MHKA 3D9HA 3DXMG 2E0IA 4XI9A 1D9SA 1W3BA 5EX3A 2IY0C 4FULA 2HM8A 3CVNA 3LVRE 5M72A 1QBQA 1NFIE 4F6RD 2J07A 3LVQE 4N3BA 5J90A 2FF4A 3R9MA 3DRAA 4N2SA 2ZXWE 4G23A 4UQZA 2YNQA 2L0TB 3FTVA 4OVUA 4U07A 1MQSA 1MYOA 1UN8A 3FUHA 1IHGA 2ILRA 4G1TA 4F53A 3ZPJA 2WVIA 5JA4D 5KJLA 4Q69A 4JA7A 3W9GA 2V0PA 1FVHA 3CHPA 1O5MA 5ENTD 4WWOA 3KAEA 2J08A 3R7RA 2H6HA 1N4PA 2BKKB 1JUQA 4JB8P 5D0OD 2IEJA 2J4BA 4DPRA 4BERA 3B7UX 3L16A 1XNFA 3QNKA 4O1PA 2PM6A 3TWVA 3EDTB 4HOUA 5LOZA 2IF4A 1U2VG 2LSUA 1XGWA 4G11A 4YVQC 3APDA 4I43A 1H6OA 2XHEA 1TNZA 4ILIA 3HVEA 3SD5A 1MX2A 2IO2C 2J4DA 5DIZA 3ABLE 3L13A 3CVYA 3IV0A 3DWLG 4ILGA 2KCLA 4JVSA 4CRWA 4HRLA 2KC7A 2WXJA 3FHEA 3FUKA 3DPDA 3EIJA 3GZ2A 4HB5A 3U3WA 4WNEA 3TXMA 4B8CB 3S7DA 4AEZC 4NQ0A 5CEAA 1TJFA 2H6GA 3LXUX 1Y6IA 4YDEA 1DNPA 4N3AA 3VLDA 4O1OA 4B8AA 4ANXA 2C2LA 1WAO1 3LEWA 3PREA 2EILE 4ANVA 3T9KA 2I2OA 2WXOA 3IBEA 3UM0A 4BEPA 3AU4A 3JUEA 2IOSA 4I17A 3QARA 4K5AB 2LAIA 3ASOE 3B7TA 4GU5A 4I1AA 3D9IA 3CVVA 1DCEA 1ELWA 1OWPA 2Y3AA 4XI0A 2X6IA 2Y69E 4I6GA 4N5QA 1UJKA 2LO6A 4TXRA 4IRUA 3HYMB 2C0MA 3CVUA 3RO3A 2LXLA 3ASFA 4H7YA 3IHVA 4APFA 1U3DA 3HG0D 3TWUA 5ARFA 1H6PA 1AWCB 3S7FA 3TWTA 3SHFA 3GZSA 4I1OB 2BF0X 3CKBA 3Q49B 3U9WA 4F1SA 2F37A 2P9PG 1H2TC 3G2VA 3ONLA 3UM1A 3OTNA 3V2XA 3JUIA 3UIPC 2WM9A 4L2LA 4J6IA 5FTPA 1V54E 1OUVA 3JQ1A 3T5VA 2OVBA 3RAUA 2AXZA 3ASHA 1L5JA 5ANLA 2L9BA 1KT1A 4YVOA 2XZTG 3ZYQA 2VTBB 1IYGA 4PS8A 4MLPA 3ZYLA 3TJPA 3D9KA 3ZYKA 3NQPA 1PAQA 3ASDA 3FP3A 4HOQA 3MX3A 4TXPA 4U8HA 4N5CA 1INZA 5B1BE 2UY1A 3OAWA 3SGHA 3Q9NC 3PZ3A 4U96D 2XGMA 1JPLA 3E4BA 2P9SG 2FULA 2WXPA 2IO3C 2XCCA 1NI1A 2WXNA 3MKQA 2EINE 5BV0A 4AP2A 3NB2A 4L1BA
chains in the Genus database with same CATH topology
5T8IA 3FUEA 2JLBA 4B0ZA 1HH8A 4K03A 5A23A 5JHBA 3LPZA 4BSXA 3LCAA 3BG1B 4FADA 4XE0A 3CLJA 4AV7A 4FLBA 4KT6B 1DVPA 3FUIA 3U4TA 4EBAA 5BNWA 5KJMA 3D9JA 4NRHB 3OXLA 4GZCA 3QDNA 3CHSA 3AS5A 1PC2A 3BEEA 5ANRA 4FHKA 4GYOA 3ZN3A 4UI9C 2WXHA 2PQRA 3MV3B 4O6FA 2IFUA 4V3IA 2FEZA 2PL2A 3Q15A 4LEUA 4ANWA 4KVMA 4N3CA 3FU3A 1HXIA 3UQ3A 5AJDA 4N39A 1N54A 3EHNA 3MJWA 4WNDA 4GZDA 2WQ6A 4I2ZA 4EPZA 2WQ7A 2YQ8A 3FU5A 2QY7A 3U64A 5FQ6A 1TEZA 1NP7A 3SF4A 1E8WA 3IKOB 4UI9K 5KJKA 2R5SA 3VLFA 4C9BB 2PM7A 2X6FA 2VSOE 4K0RA 2VSNA 2AXUA 3R9AB 2VSXE 2CG2A 4FJYA 4TV3A 3ZGQA 3SBSA 3G2UA 5FQ7A 4D10C 2VJ8A 4RSYA 2AWIA 4F7AA 4OYSA 4FLHA 4GAAA 3JQ0A 4EBAG 4GCOA 3FH8A 3NF1A 4FHJA 5AJLA 5FZQA 3CSFA 3RRNB 3PRZA 2KCKA 3PS6A 5G04C 4I6EA 4KZ0A 4BT8A 5BPPA 1S0PA 3QKYA 2YHCA 1OWMA 3D9MA 1ELRA 3G2WA 2I6HA 2P58C 2X3MA 3CEQA 4RVBA 4CT4A 3CQGB 4IYPA 2FO7A 3DBSA 3FUJA 3RRUA 3GW4A 3RU0A 1E8YA 1ZBPA 3CGHA 3TAXA 5JJ7A 5JHAA 1VDYA 3UT8A 3FY4A 4GB9A 4MKTA 3O48A 5CMYA 4U04A 4C0EA 3CVQA 3U66A 3AS8A 4KMOA 5AYWD 2DBAA 2UWJG 2DCPA 4BTBA 5C2YA 3ONKA 4E85A 2WXQA 3LY7A 1LF8A 3JCKC 3R7QA 4CDNA 2MRIA 4NACA 4L7TA 2M63A 2MHKA 1PY1A 2E0IA 4GZ5A 4XI9A 3ZHEA 4GA1A 3RK6A 1W3BA 5EX3A 3FTXA 5CHEE 3I4RB 4XX5A 3AU5A 3L08A 3CK9A 4ACLA 1H2UA 3LJ3A 4WAFA 3PZDA 3QJZA 4J0UA 5BUZA 2VYIA 4HS2A 4FULA 3LS8A 2HM8A 4DJAA 3CVNA 4M3OA 3LVRE 1JWFA 5M72A 3FULA 5FQ4A 4N2QA 5BT1A 2RD0A 3CR3A 3RO2A 2J07A 2WXKA 3LVQE 3UX4A 4N3BA 4DK5A 2XPIA 5J90A 2FF4A 3TXNA 2XRZA 4I1MA 1TJCA 3L17A 4N2SA 3I3NA 4GYWA 4HLEA 4H7XA 2XGOA 3Q4AB 4G23A 3CK8A 4UQZA 4EQFA 4UWHA 2YNQA 2L0TB 3I4GA 4JXTA 3FTVA 3MA5A 4EZLA 4GMLA 4J8SA 4OVUA 4U07A 4CT0A 1MQSA 3L54A 4JHRA 4CGVA 1UN8A 3TG5A 3FUHA 2WPVA 1IHGA 4UWKA 3FEYA 4A3VA 2ILRA 3T8MA 4G1TA 1KT0A 3OXGA 3UUXA 1H0AA 4F53A 2FBNA 5HQ8A 1HE8A 2VGYA 3ZPJA 2WVIA 3L22A 5E76A 5T3RA 2X6JA 3ZW3A 5D0QD 2IQCA 4LERA 5ENNA 3FTZA 1UJJA 2X6HA 4WNFA 5KJLA 1HZ4A 2J49A 4Q69A 2OOEA 3FUNA 4JA7A 2V0PA 3N71A 4A3TA 4AM9A 1FVHA 4BX8A 3CHPA 3VTXA 4G2VA 3QOUA 3MCXA 4FP7A 5EX0A 5LCWJ 4PS7A 4GPKA 2KM4A 4UWLA 4WWOA 3OXFA 3KAEA 2J08A 3R7RA 3LYAA 4KYOB 4JEHA 3FEXA 2C0LA 2Q7FA 3QWWA 4JL0A 1JUQA 2HR2A 1Y8MA 2FI7A 5BW8C 3CVWA 1KLXA 2CHZA 5DBKA 5D0OD 2WMOA 3B7SA 1H2VC 2J4BA 4U0UA 4DPRA 3MGBA 5LX8A 3G2SA 3B7UX 1P5QA 3CHMA 3PDNA 5FQ8A 3ZHEB 3KD7A 3FTUA 4Q94A 2ONDA 5CMWA 3AS4A 3PE4A 3IHYA 3L16A 3PH0C 4UWGA 1XNFA 3ZIMA 4APOA 3QNKA 3L6AA 4I9EA 3CVLA 2PM6A 4WUYA 3PUJA 4HFGA 3EDTB 4HOUA 2A5UA 2LAHA 3CHQA 4YNDA 4AVXA 2X38A 4IN3B 1HG5A 1OWNA 5G55A 5LOZA 3RKVA 1IQRA 2IF4A 1XGWA 2LSUA 3QWPA 4KVOA 1E7UA 4MRUA 1SZ9A 1Z6TA 4J8DA 4FU3A 1ELKA 4G11A 4YVQC 3CVXA 3APDA 3MYVA 4I43A 2XHEA 3NZUA 3HIZA 2V4LA 3ML9A 5KCMA 3FUFA 3BG0B 4ILIA 3HVEA 3C98A 3QK0A 3B7RL 1BPOA 3HHMA 5JJ6A 3SD5A 1NA3A 3MKRA 3EJNA 3SFZA 3CHOA 5AENA 1HFAA 3CK7A 5DIZA 2J4DA 3D9PA 3FUMA 2E2EA 2VQ2A 3QWVA 3L13A 4KZCA 4BT9A 5AIJA 3CVYA 3FU6A 3IV0A 3CKCA 4LRZA 2RG8A 4ILGA 3JYSA 3CSTA 4CEMA 4RG9A 3D9LA 4GZ3A 3LY9A 2KCLA 4GA2A 4JVSA 4KBQA 4UI9J 5ARGA 2KC7A 2WXJA 3VTYA 4AIFA 3FHEA 4CRWA 1E96B 4LCTA 3TGOA 3FUKA 4AXHA 2CFZA 2QFCA 4UQYA 2R17C 3DPDA 3EIJA 5EKQD 2OVFA 3GZ2A 1EDUA 3SNXA 4I9CA 3U3WA 4WNEA 3APCA 4ABNA 3ZVVA 3TXMA 4A1GA 4B8CB 3MZLB 3S7DA 3P1UA 5LCWC 4AEZC 4NQ0A 3LDZA 4IULA 3SI5A 1TJFA 3LXUX 1Y6IA 2AXVA 2UY1B 1DNPA 1H6KA 3QAQA 3S7BA 4GYYA 3ZEFA 4N3AA 3URZA 5KJNA 4PUCA 3VLDA 3SBTB 1HG2A 4G26A 4B8AA 4ANXA 2CG3A 4B94A 3QC1A 2C2LA 1WAO1 3LEWA 3PREA 1JWGA 1HX8A 1QQEA 1OWOA 2WXGA 5E75A 1HU3A 4ANVA 3ZRHA 3FH5A 5A6CA 3FU0A 2I2OA 2KCVA 2A4ZA 2GRMA 2WXOA 3IBEA 3P2BA 4ILHB 2PQNA 4W9RA 3UPVA 4HORA 2CHXA 2V5FA 3AU4A 3ASGA 4ACKA 1EYHA 2IOSA 4AOFA 5BV1A 5C1DA 4I17A 3QARA 2VSYA 4E6HA 1U3CA 3PNLB 1SZAA 2BUGA 2LAIA 1WY6A 4BFRA 4EECA 2KATA 4HOSA 3B7TA 2XCBA 4GU5A 4I1AA 3D9IA 5G05C 2L6JA 2WXLA 4JC8A 4OVVA 3CVVA 4CDRA 3IEGA 3K9IA 1N52A 4JW1A 3FTSA 3FTWA 4UWFA 1ELWA 2WXIA 3GZ1A 3ZFWA 2GRLA 4DLQA 2I1KA 1OWPA 4J8FA 2Y3AA 4XI0A 1FVFA 2X6IA 3FH7A 2WB2A 4EZJA 4GCNA 4XZ4A 2AVPA 3MKQB 1HF8A 3PEVB 4I6GA 4A1SA 5FZSA 1UJKA 4CGWA 1SQMA 3TL5A 3PVLA 4PH4B 4LUNU 1UN9A 3SZ7A 4CCAA 4GZ6A 4R7LA 1GW6A 4JZYA 2LO6A 4J8EA 1FCHA 4IRUA 4U63A 4GA0A 2R59A 3HYMB 2C0MA 3CVUA 2KZTB 2CFUA 2KZTA 2YHEA 3RO3A 1MHQA 3ASFA 4H7YA 1EPUA 2X6KA 3VLEA 3S2AA 3IHVA 4APFA 1U3DA 3ENEA 3ESKA 5ARFA 3QB2A 3MV2B 3UMVA 2LSVA 3RIBA 4ATGA 2GW1A 3FUDA 1E8XA 3S7FA 3SHFA 3GZSA 4BX9A 1UW4B 5J08A 2XEVA 2AW6A 4I1OB 2BF0X 5FZRA 2XQ0A 4WWNA 2IU1A 4KXKB 3CKBA 4BTAA 3Q49B 3U9WA 2HYZA 3WXXA 1NA0A 4F1SA 1Z3XA 4HOTA 1QNFA 4ANUA 2NC9A 4A55A 1H2TC 2XGSA 5HI7A 4PS3A 4C0MA 1OWLA 4CDMA 3D9OA 2XPZA 1NZNA 3CIAA 3G2VA 1UG3A 3MEKA 4FJZA 4L23A 1IQUA 3ONLA 3RJVA 2XPYA 3KEZA 4U0SA 3CVPA 3HVEB 4BWRA 4QFVA 1H19A 3PUKA 4URKA 5CCMA 3FTYA 1ZU2A 2XRYA 4JHJA 3APFA 4PDXA 2LNIA 3OTNA 2JEKA 2WXRA 3G2TA 3JUIA 4FC8A 2PZIA 1HO8A 4XIFA 1HS6A 5LP0A 3CQCB 3GYZA 2WM9A 2YINA 2J9QA 4L2LA 3T5XA 3ZYMA 4XKCA 4J6IA 3FDHA 4MS6A 5FTPA 1E90A 2HO1A 5FJYA 3PE3A 1OUVA 3JQ1A 4FA6A 2GGFA 2OVBA 3ESLA 4G24A 4Y6WA 3T5VA 4JHKA 2AXZA 3ASHA 1L5JA 5ANLA 5CCLA 2I9CA 5EDSA 4ME2A 4HVBA 3I5PA 3ULQA 2I1JA 4DI3A 2L9BA 1KT1A 2WXFA 4AY5A 4I6JA 1E8ZA 3ZXSA 2NSZA 4YVOA 4BY6A 3PNTB 4WWPA 3ZYQA 2VTBB 2V8SE 2VTBA 1WM5A 1IYGA 4PS8A 4L2YA 4MLPA 2WXMA 3LKUA 3ZYLA 4HXIA 3CHRA 3TJPA 3B13A 3D9KA 4Q96A 2ZU6B 4P29A 2Y4TA 3NZSA 3RRMB 3ZYKA 2DIWA 5FWQA 3NQPA 1PAQA 3ASDA 3PEUB 3FP3A 4HOQA 3TG4A 3MX3A 3FWVA 3ML8A 4U8HA 3KS2A 4RG6A 2J09A 4N5CA 1INZA 4DLOA 3EIQC 4AY6A 2CHWA 2WMNA 4JEUA 5G05J 5A7DB 2UY1A 4JA9A 4AJWA 3LY8A 1E7VA 3EHMA 3OAWA 2EQXA 2OV8A 4DI4A 3SGHA 3UT4A 4U0ZA 4XKBA 1Z3YA 3S7JA 4UQXA 2IJGX 4EZKA 5JJTA 1YA0A 4B89A 4G25A 1EF1C 4JPSA 2XGMA 3D3MA 2NXPA 4GMJA 3E4BA 1JPLA 3FFLA 4NURA 4TUUA 4WNGA 3CV0A 4Y6CA 5G04J 2WXPA 2FULA 2IOLA 1B89A 2Y4UA 1X5BA 4I2WA 2XCCA 2L0IA 2BTDA 5T4YA 3O4ZA 2VGXA 2VGXB 5FT9A 2WQHA 5LFAA 1A17A 3HDXA 2WXNA 4TRQA 3MKQA 3UT7A 2IONA 3D9NA 1QZ2A 5BV0A 4AP2A 3Q5MA 5G2NA 3Q47B 4F3VA 4L1BA 2MOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHE E;  2GW1 A;  3CK9 A;  3S7F A;  3CK7 A;  4J0U A;  4HOT A;  2JLB A;  5DIZ A;  2XEV A;  1HH8 A;  2E2E A;  2VQ2 A;  2VYI A;  5FZR A;  3LPZ A;  3QWV A;  3LCA A;  4BT9 A;  4KXK B;  3CKB A;  3CKC A;  4BTA A;  3CVN A;  3Q49 B;  3U4T A;  5BNW A;  2HYZ A;  5M72 A;  3WXX A;  1NA0 A;  3JYS A;  5KJM A;  4N2Q A;  4NRH B;  4RG9 A;  3OXL A;  4GZ3 A;  3QDN A;  5BT1 A;  2NC9 A;  3AS5 A;  1PC2 A;  3BEE A;  2KCL A;  2XGS A;  3LY9 A;  4GA2 A;  4KBQ A;  4N3B A;  2KC7 A;  2XPI A;  4UI9 J;  2FF4 A;  5ARG A;  3VTY A;  1E96 B;  3TGO A;  3MEK A;  1TJC A;  1NZN A;  4GYO A;  4N2S A;  3RJV A;  3ZN3 A;  2QFC A;  4UQY A;  4GYW A;  4UI9 C;  4H7X A;  2PQR A;  2XGO A;  3MV3 B;  2IFU A;  3Q4A B;  3CK8 A;  4G23 A;  4O6F A;  4U0S A;  3CVP A;  4UQZ A;  4BWR A;  5EKQ D;  3RO2 A;  2FEZ A;  3GZ2 A;  2PL2 A;  3MA5 A;  3Q15 A;  4LEU A;  4I9C A;  5JJ6 A;  4U07 A;  4WNE A;  5CCM A;  3U3W A;  1ZU2 A;  4ABN A;  4N3C A;  1HXI A;  2LNI A;  4JHR A;  3S7D A;  3UQ3 A;  4CGV A;  3TG5 A;  4N39 A;  5LCW C;  2PZI A;  2WPV A;  1IHG A;  4NQ0 A;  4XIF A;  3GYZ A;  4WND A;  4G1T A;  2J9Q A;  4I2Z A;  1KT0 A;  2UY1 B;  2YQ8 A;  3OXG A;  5AYW D;  3S7B A;  3UUX A;  4EQF A;  4GYY A;  2FBN A;  4N3A A;  2VGY A;  3URZ A;  5FTP A;  3ZPJ A;  5FJY A;  2HO1 A;  5HQ8 A;  5KJN A;  3PE3 A;  1OUV A;  4G26 A;  5D0Q D;  4UI9 K;  3SF4 A;  4G24 A;  4Y6W A;  4B94 A;  2C2L A;  1WAO 1;  2R5S A;  3ASH A;  5HI7 A;  5CCL A;  4ME2 A;  4WNF A;  5KJL A;  3ULQ A;  1HZ4 A;  1QQE A;  5A6C A;  2OOE A;  2VSN A;  1KT1 A;  4JA7 A;  3R9A B;  4APO A;  4AY5 A;  3N71 A;  2KCV A;  4AM9 A;  3ZGQ A;  3UPV A;  2PQN A;  4W9R A;  4HOR A;  4AIF A;  2V5F A;  4YVO A;  3VTX A;  4G2V A;  3ASG A;  3QOU A;  5EX0 A;  5C1D A;  1IYG A;  4GPK A;  1WM5 A;  4I17 A;  2VSY A;  3OXF A;  3KAE A;  3LKU A;  3LYA A;  3Q47 B;  4KYO B;  2BUG A;  2C0L A;  2KAT A;  2Q7F A;  3QWW A;  4GCO A;  3NF1 A;  2XCB A;  4JL0 A;  2Y4T A;  5FZQ A;  4I1A A;  5G05 C;  2L6J A;  2HR2 A;  1Y8M A;  2FI7 A;  2KCK A;  3ASD A;  1KLX A;  5BW8 C;  5DBK A;  3FP3 A;  4HOQ A;  5D0O D;  4CDR A;  3TG4 A;  3IEG A;  3FWV A;  3K9I A;  5G04 C;  3KS2 A;  4RG6 A;  4BT8 A;  4U0U A;  1ELW A;  3GZ1 A;  3QKY A;  4N5C A;  2YHC A;  3ZFW A;  4J8F A;  3PDN A;  4XI0 A;  1P5Q A;  4AY6 A;  1ELR A;  5G05 J;  5A7D B;  3ZHE B;  2UY1 A;  4JA9 A;  3KD7 A;  2I6H A;  2OND A;  2P58 C;  3CEQ A;  3AS4 A;  3LY8 A;  3PE4 A;  2AVP A;  4GCN A;  1XNF A;  2FO7 A;  5KJK A;  3RU0 A;  3GW4 A;  4A1S A;  4U0Z A;  1ZBP A;  5FZS A;  3S7J A;  4UQX A;  4I9E A;  3CVL A;  3TAX A;  4CGW A;  4WUY A;  3MKR A;  1YA0 A;  5JJ7 A;  5JJT A;  3O48 A;  4U04 A;  4G25 A;  3EDT B;  3CVQ A;  4HOU A;  3SZ7 A;  4F3V A;  4YND A;  4GZ6 A;  3AS8 A;  2XGM A;  5LCW J;  4IN3 B;  4WNG A;  2DBA A;  2UWJ G;  3E4B A;  3FFL A;  1FCH A;  4J8E A;  3CV0 A;  2IF4 A;  3QWP A;  2LSU A;  4GA0 A;  4Y6C A;  5G04 J;  2Y4U A;  3RKV A;  3LY7 A;  1B89 A;  4J8D A;  4I2W A;  3HYM B;  2XCC A;  2C0M A;  4YVQ C;  2VGX A;  2VGX B;  5FT9 A;  3RO3 A;  2WQH A;  1A17 A;  3ASF A;  2MHK A;  4H7Y A;  3ESK A;  4GZ5 A;  4XI9 A;  5ARF A;  1QZ2 A;  3ZHE A;  4GA1 A;  3Q5M A;  1W3B A;  3MV2 B;  5EX3 A;  2LSV A;  3RIB A;  4HOS A;  1NA3 A;  4BTB A; 
#chains in the Genus database with same CATH topology
 2MYO A;  1MX4 A;  3DEO A;  4K03 A;  4FAD A;  4XE0 A;  3U4T A;  1DVP A;  3D9J A;  4GZC A;  2QC9 A;  3KEA A;  4GYO A;  2PQR A;  1KZP A;  1BI8 B;  5ENR D;  4V3I A;  5CED B;  2PL2 A;  4LEU A;  4KVM A;  2ETC A;  5AJD A;  5EN5 D;  2WQ6 A;  4EPZ A;  3DXK G;  1TEZ A;  1TYQ G;  2R5S A;  3VLF A;  4C9B B;  2X6F A;  4TV3 A;  1RW2 A;  3G2U A;  4D10 C;  5H7P A;  2XS8 A;  3PZ1 A;  3FH8 A;  3NF1 A;  1V55 E;  5EIB E;  3CSF A;  5G04 C;  1OWM A;  3AG3 E;  2X3M A;  1SA4 A;  3CQG B;  1MZC A;  3DBS A;  5JHA A;  3CGH A;  3TAX A;  5JJ7 A;  1VDY A;  3FY4 A;  4U04 A;  5ENP D;  4KMO A;  5AYW D;  2DBA A;  5C2Y A;  1MJ0 A;  5AAR A;  3ONK A;  3LY7 A;  1LF8 A;  3KSQ A;  2XEE A;  4L9P A;  3Q75 A;  1PY1 A;  4GA1 A;  4LNB A;  3RK6 A;  3FTX A;  1S63 A;  5CHE E;  3AU5 A;  3L08 A;  4ACL A;  3QJZ A;  5BUZ A;  2QZA A;  3LS8 A;  4BSZ B;  1JWF A;  3FUL A;  5FQ4 A;  2RD0 A;  3RO2 A;  3TXN A;  4H7X A;  1KPS B;  4UWH A;  4JXT A;  3BQO A;  3MA5 A;  4EZL A;  1N4R A;  4CT0 A;  4JHR A;  3L54 A;  4CGV A;  1BI7 B;  3FEY A;  4LG6 A;  1KT0 A;  3OXG A;  5HQ8 A;  1HE8 A;  1TNO A;  4GPM A;  3SFY A;  5T3R A;  1OCR E;  3AAA C;  5D0Q D;  1N94 A;  4WNF A;  2OOE A;  2Y1L E;  5JMN D;  5BXO A;  4GTP A;  3MCX A;  4PS7 A;  4GPK A;  4KYO B;  3FEX A;  2Q7F A;  4GTT A;  4JL0 A;  2HR2 A;  1KLX A;  5DBK A;  2WMO A;  1H2V C;  3G2S A;  5FQ8 A;  3C3Q A;  3KD7 A;  2XEN A;  1LD8 A;  3EU9 A;  3L6A A;  2P9U G;  4WUY A;  4HFG A;  4Z68 A;  2LAH A;  3ZXP A;  2EIK E;  4AVX A;  2X38 A;  5G55 A;  1IQR A;  1E7U A;  1Z6T A;  4FU3 A;  3CVX A;  3MYV A;  5AQ9 A;  2FO1 E;  3NZU A;  3PZ2 A;  2V4L A;  3ML9 A;  5KCM A;  3FUF A;  1N4S A;  3BG0 B;  3QK0 A;  3Q73 A;  1YMP A;  3UIO C;  1YYH A;  3HXE A;  3CK7 A;  3D9P A;  2GRR B;  2VQ2 A;  5AIJ A;  3FU6 A;  3V79 K;  5CBO A;  3CST A;  4CEM A;  4RG9 A;  1DCQ A;  4AXH A;  2R17 C;  1EDU A;  3SNX A;  4ABN A;  3ISM C;  3AG1 E;  2AXV A;  5EYP F;  3ZEF A;  1IHB A;  4PUC A;  2CG3 A;  4B94 A;  3QC1 A;  3EU5 A;  4HI8 A;  1HU3 A;  2A4Z A;  2GRM A;  2ZGD A;  4ILH B;  4W9R A;  3ASG A;  1EYH A;  4MBG A;  3HXF A;  2BUG A;  1WY6 A;  4BFR A;  2L6J A;  4JC8 A;  3K9I A;  4JW1 A;  3FTW A;  4UWF A;  3DSU A;  3EHR A;  4J8F A;  2WB2 A;  3MKQ B;  4GMR A;  5FZS A;  1O1R A;  3PVL A;  3SZ7 A;  4J8E A;  2KZT A;  3DSV A;  1EPU A;  3VLE A;  3MV2 B;  4ATG A;  5CRV A;  4GTS A;  4BX9 A;  5J08 A;  5FZR A;  2XQ0 A;  4WWN A;  2IU1 A;  4KXK B;  2HYZ A;  1NL4 A;  5IY5 E;  4HOT A;  2NC9 A;  4A55 A;  4PS3 A;  4C0M A;  1OWL A;  3CIA A;  4FJZ A;  1UG3 A;  4C48 B;  5B1A E;  1OY3 D;  4BWR A;  3HVE B;  3W9F A;  4QFV A;  1H19 A;  4URK A;  2XRY A;  3APF A;  4PDX A;  3ASN E;  2JEK A;  3G2T A;  1HO8 A;  5LP0 A;  3GYZ A;  1D8D A;  3T5X A;  4XKC A;  4MS6 A;  5FJY A;  4JHK A;  4RQI A;  5CCL A;  2DZO A;  2I9C A;  5EDS A;  4ME2 A;  4HVB A;  5KNG A;  3E33 A;  4I6J A;  3ZXS A;  1G3N B;  3NOC D;  4BY6 A;  3T8K A;  3Q79 A;  2WXM A;  4HXI A;  3B13 A;  2ZU6 B;  3NZS A;  2DIW A;  5FWQ A;  1O1T A;  5HS0 A;  2XS1 A;  3PEU B;  2GRP B;  3TG4 A;  2ZIR A;  1TNB A;  4AY6 A;  2WMN A;  5G05 J;  2HE0 A;  2XZD G;  4JA9 A;  2P9I G;  4DI4 A;  3S7J A;  1Z3Y A;  4UQX A;  4EZK A;  1YA0 A;  2LUH A;  3D3M A;  4TUU A;  2AJA A;  3CV0 A;  2Y0B G;  5G04 J;  2Y4U A;  4I2W A;  1B89 A;  4QQI A;  2L0I A;  2VGX A;  5FT9 A;  2WQH A;  5LFA A;  2BED A;  5AQB A;  1TN7 A;  1QZ2 A;  3Q47 B;  4HOS A;  3FUE A;  3Q9U C;  5A23 A;  1BLX B;  5EIL A;  1SVX A;  4TUM A;  4FLB A;  5ENO D;  4NRH B;  3OXL A;  5AQA A;  3QDN A;  3CHS A;  5ANR A;  5CBN A;  4UI9 C;  3V30 A;  2IFU A;  4DX5 D;  3AG2 E;  4GZD A;  4I2Z A;  2WQ7 A;  3DST A;  3Q7A A;  5FQ6 A;  3SF4 A;  1N0Q A;  2VSO E;  3UKR G;  1OXJ A;  2AXU A;  3KSL A;  2VSX E;  2CG2 A;  1Z5S C;  3ZGQ A;  1TN6 A;  2KBX A;  5FQ7 A;  4RSY A;  2AWI A;  4OYS A;  3L82 A;  3JQ0 A;  5FIO A;  4EBA G;  4GCO A;  5AJL A;  5ENS D;  2DYS E;  3DPY A;  2KCK A;  3PS6 A;  1OCZ E;  4BT8 A;  5BPP A;  3QKY A;  1WDY A;  5BXU A;  1ELR A;  1LD7 A;  3ZUV B;  3RU0 A;  3GW4 A;  1E8Y A;  1ZBP A;  3UT8 A;  4GB9 A;  4ATZ D;  5ENQ D;  2NYJ A;  4E85 A;  1A5E A;  2V4H C;  3R7Q A;  4L7T A;  4GZ5 A;  3ZHE A;  4RLY A;  1TNY A;  3I4R B;  1RZ4 A;  4HS2 A;  4U8Y D;  2R2L A;  1LTX A;  4DJA A;  4M3O A;  5BT1 A;  3CR3 A;  2WXK A;  4DK5 A;  1TJC A;  3I3N A;  4GYW A;  2XGO A;  4GML A;  4HBD A;  3TG5 A;  4UWK A;  1O1S A;  2B0O E;  3TWX A;  3UUX A;  2VGY A;  3L22 A;  3ZW3 A;  4O60 A;  4LER A;  5ENN A;  1TNU A;  3FUN A;  4A3T A;  4AM9 A;  3VTX A;  2KM4 A;  3V2O A;  3OXF A;  3QWW A;  2XEH A;  2QYU A;  4G8K A;  3CVW A;  1AP7 A;  2FI7 A;  2CHZ A;  3BUA A;  2B6C A;  2DZN A;  3MGB A;  1MX6 A;  3J5Q B;  3ZHE B;  3FTU A;  4Q94 A;  5CMW A;  3AS4 A;  4UWG A;  3PH0 C;  1S70 B;  4APO A;  1N95 A;  1S64 A;  3TWQ A;  2A5U A;  3CHQ A;  4IN3 B;  1HG5 A;  3JXJ A;  2GRQ B;  4KVO A;  4J8Y A;  1SZ9 A;  4J8D A;  1ELK A;  3HIZ A;  3NAW A;  3B7R L;  4U7E B;  3HHM A;  3EJN A;  3CHO A;  1HFA A;  3FUM A;  3UIN C;  2E2E A;  3QWV A;  3NBN B;  4LRZ A;  3D9L A;  4GZ3 A;  3LY9 A;  4GA2 A;  4DX1 A;  3VTY A;  3TGO A;  4HLL A;  2QFC A;  1D8E A;  2OVF A;  3L9T A;  3MZL B;  5LCW C;  3LDZ A;  4IUL A;  3F6Q A;  2UY1 B;  4BET A;  1H6K A;  3S7B A;  4GYY A;  3URZ A;  3HXB A;  3SBT B;  4G26 A;  4LNG A;  2PNN A;  4DX7 D;  1JWG A;  2WXG A;  5E75 A;  3ZRH A;  3P2B A;  2PQN A;  2CHX A;  2V5F A;  4ACK A;  4LSZ E;  5BV1 A;  5C1D A;  3PNL B;  3DEP A;  4CZ2 D;  1SZA A;  2XCB A;  3X2Q E;  4CDR A;  3IEG A;  1N52 A;  2R02 A;  3FTS A;  3ZFW A;  2GRL A;  4DLQ A;  3FH7 A;  4XZ4 A;  4J7W A;  3PEV B;  4A1S A;  1K8K G;  3E37 A;  4CGW A;  1SQM A;  4PH4 B;  4LUN U;  1Q2Z A;  1UN9 A;  4CCA A;  4GZ6 A;  1N9A A;  4GTM A;  3E32 A;  1FCH A;  4GA0 A;  5AN8 A;  1MHQ A;  2X6K A;  2P9L G;  3S2A A;  3ENE A;  2ETB A;  3QB2 A;  3UMV A;  2LSV A;  2GW1 A;  1E8X A;  2P9K G;  1UW4 B;  2XEV A;  2AW6 A;  1FPP A;  3WXX A;  1NA0 A;  5AQ7 A;  4ANU A;  1IKN D;  5HI7 A;  4JD2 G;  4CDM A;  3D9O A;  2XPZ A;  1NZN A;  3MEK A;  1IQU A;  3KEZ A;  4U0S A;  3HXD A;  3PUK A;  3FTY A;  1ZU2 A;  2LNI A;  4FC8 A;  5KNH D;  2PZI A;  3NOG D;  4XIF A;  1HS6 A;  3UKU G;  1OCO E;  2YIN A;  1OT8 A;  3ZYM A;  1E90 A;  3C5R A;  3PE3 A;  2GGF A;  3ESL A;  4G24 A;  4Y6W A;  3ULQ A;  4DI3 A;  2WXF A;  4AY5 A;  3C3R A;  1E8Z A;  2NSZ A;  4WWP A;  2VTB A;  2V8S E;  1WM5 A;  3CHR A;  4F1P A;  4Q96 A;  2Y4T A;  3RRM B;  2QYJ A;  2VGE A;  3ULE G;  3KS2 A;  3UM3 A;  3EIQ C;  5A7D B;  4AJW A;  3LY8 A;  1E7V A;  2EQX A;  2OV8 A;  3UT4 A;  4U0Z A;  4XKB A;  5EID A;  3UI2 A;  2IJG X;  4B89 A;  4G25 A;  1WG0 A;  4GTQ A;  4JPS A;  4GTR A;  2NXP A;  4WNG A;  4GTV A;  3PZ4 A;  4Y6C A;  2IOL A;  1OCC E;  3JXI A;  5B3S E;  3AJI A;  2DWZ A;  3Q5M A;  5G2N A;  3RJV A;  2GRN B;  5T8I A;  4M7C A;  4B0Z A;  1HH8 A;  5JHB A;  3LPZ A;  4UUC A;  3BG1 B;  4AV7 A;  5KJM A;  3SY2 A;  3AS5 A;  1PC2 A;  1BD8 A;  4FHK A;  3MV3 B;  4O6F A;  5AAO A;  2FEZ A;  3Q15 A;  4N3C A;  4G8L A;  1HXI A;  3UQ3 A;  4N39 A;  3EHN A;  5D2M C;  3ULY A;  3MJW A;  2YQ8 A;  2QY7 A;  4HRM B;  5KJK A;  3IKO B;  4UI9 K;  2RKK A;  2PM7 A;  4K0R A;  4X8Q A;  3BU8 A;  4TXQ A;  3SBS A;  1BU9 A;  2EIJ E;  2VJ8 A;  1K1A A;  4FLH A;  2LXM A;  3SFX A;  3ABK E;  3TWR A;  5FZQ A;  3PRZ A;  1JCQ A;  1ZB1 A;  3TWW A;  4I6E A;  2ETA A;  4KZ0 A;  2JAB A;  1S0P A;  2YHC A;  3G2W A;  3RRU A;  4MKT A;  5CMY A;  4HNA D;  3IXE A;  3AS8 A;  5D66 A;  4BTB A;  4NAC A;  1TR4 A;  5HKP A;  4XX5 A;  3CK9 A;  1H2U A;  3LJ3 A;  4WAF A;  3PZD A;  4J0U A;  2L6B A;  3UM2 A;  2VYI A;  4BES A;  4N2Q A;  3UX4 A;  2XPI A;  2XRZ A;  4I1M A;  3L17 A;  3SO8 A;  4HLE A;  3Q4A B;  3CK8 A;  4EQF A;  3I4G A;  3UXG A;  2DVW A;  4J8S A;  5CRU A;  1UOH A;  2WPV A;  2RFA A;  3ZU7 B;  4A3V A;  3T8M A;  1H0A A;  2FBN A;  2F8Y A;  5E76 A;  2P9N G;  4NIK A;  2X6J A;  2IQC A;  3FTZ A;  3V31 A;  1UJJ A;  2X6H A;  1HZ4 A;  2J49 A;  2V5Q C;  4XEI G;  3N71 A;  4A63 B;  4BX8 A;  4G2V A;  3QOU A;  2H6F A;  4FP7 A;  5EX0 A;  4UWL A;  3LYA A;  4JEH A;  2C0L A;  2BKG A;  2R05 A;  5BW8 C;  1Y8M A;  1JCS A;  4LNU D;  3B7S A;  4U0U A;  5LX8 A;  3PDN A;  1P5Q A;  3CHM A;  4U95 D;  3C72 A;  2OND A;  3PE4 A;  3IHY A;  3ZIM A;  4I9E A;  3CVL A;  3EUV A;  3PUJ A;  4YND A;  1DC2 A;  1OWN A;  3RKV A;  3QWP A;  3ZKJ A;  4MRU A;  1N0R A;  4DX2 A;  3C98 A;  1BPO A;  4DX6 D;  5JJ6 A;  1NA3 A;  3MKR A;  3SFZ A;  5AEN A;  4KZC A;  4BT9 A;  3CKC A;  2RG8 A;  4CYM D;  3JYS A;  4AIF A;  4UI9 J;  4KBQ A;  5ARG A;  1E96 B;  4LCT A;  2CFZ A;  4UQY A;  1FT2 A;  5EKQ D;  4I9C A;  3APC A;  3ZVV A;  4A1G A;  3P1U A;  3SI5 A;  3QAQ A;  5KJN A;  1HG2 A;  4HQD A;  5KBA A;  3DSS A;  1HX8 A;  1QQE A;  1OWO A;  5A6C A;  3FH5 A;  3FU0 A;  2KCV A;  3UPV A;  4HOR A;  4AOF A;  2VSY A;  4E6H A;  1U3C A;  4HI9 A;  4EEC A;  2KAT A;  2F8X K;  5G05 C;  2WXL A;  4OVV A;  4OAU C;  3E34 A;  3GZ1 A;  2WXI A;  2I1K A;  1FVF A;  1TN8 A;  2A5E A;  4EZJ A;  4GCN A;  2AVP A;  1QYM A;  1HF8 A;  3TL5 A;  3UTM A;  4R7L A;  1GW6 A;  4JZY A;  4U63 A;  4YDW A;  2R59 A;  4DUI A;  2KZT B;  2CFU A;  2YHE A;  4GTO A;  5EYL A;  3ESK A;  2OEV A;  3RIB A;  3FUD A;  3Q7F A;  4K5C A;  1N11 A;  4BTA A;  2ZIS A;  1Z3X A;  1SW6 A;  1QNF A;  3AG4 E;  3EHQ A;  2XGS A;  4L23 A;  3B7B A;  4HRN A;  3SQV A;  2XPY A;  3CVP A;  5CCM A;  4JHJ A;  5CER B;  2WXR A;  3CQC B;  1K1B A;  2J9Q A;  3FDH A;  1N4Q A;  2HO1 A;  4FA6 A;  2OCC E;  2GRO B;  3HXC A;  3HRA A;  3I5P A;  2I1J A;  3PNT B;  4L2Y A;  3LKU A;  4P29 A;  4OAV B;  3FWV A;  3ML8 A;  4RG6 A;  2J09 A;  3RSE G;  2P2C P;  4DLO A;  3TWS A;  2CHW A;  4JEU A;  1X81 A;  2KXP C;  3EHM A;  3C3O A;  5JJT A;  2F0Y A;  1EF1 C;  5LCW J;  4GMJ A;  1JCR A;  4NUR A;  3FFL A;  1X5B A;  4EHM A;  2BTD A;  2H6I A;  5T4Y A;  3O4Z A;  2VGX B;  1A17 A;  3HDX A;  4TRQ A;  3UT7 A;  2ION A;  3D9N A;  4F3V A;  2MOW A;  2ZGG A;  4DRX E;  2JLB A;  4U8V D;  4BSX A;  3LCA A;  3ZNG A;  3CLJ A;  4KT6 B;  3FUI A;  4EBA A;  5BNW A;  1KZO A;  4YDY A;  3BEE A;  3DSX A;  5FIN A;  5ITZ F;  3ZN3 A;  2WXH A;  2OEW A;  5CEC B;  4ANW A;  4K5B A;  1FT1 A;  3FU3 A;  1N54 A;  3Q78 A;  4WND A;  2RFM A;  3FU5 A;  3U64 A;  4ZHB A;  1IXV A;  1NP7 A;  1E8W A;  3ABM E;  4ZFH A;  2EIM E;  1YCS B;  2VSN A;  3R9A B;  4FJY A;  3WG7 E;  4F7A A;  3DSW A;  1SA5 A;  4GAA A;  4B93 B;  2DYR E;  1K3Z D;  4FHJ A;  3RRN B;  5KWD A;  3J5P A;  3D9M A;  2J8S D;  2I6H A;  2P58 C;  3CEQ A;  4RVB A;  4CT4 A;  4IYP A;  2FO7 A;  3FUJ A;  3B95 A;  4C0E A;  3O48 A;  3CVQ A;  3U66 A;  3LJN A;  2UWJ G;  2DCP A;  4YDO A;  2WXQ A;  3JCK C;  2R03 A;  4CDN A;  2MRI A;  5HRY A;  2M63 A;  3E30 A;  2MHK A;  3D9H A;  3DXM G;  2E0I A;  4XI9 A;  1D9S A;  1W3B A;  5EX3 A;  2IY0 C;  4FUL A;  2HM8 A;  3CVN A;  3LVR E;  5M72 A;  1QBQ A;  1NFI E;  4F6R D;  2J07 A;  3LVQ E;  4N3B A;  5J90 A;  2FF4 A;  3R9M A;  3DRA A;  4N2S A;  2ZXW E;  4G23 A;  4UQZ A;  2YNQ A;  2L0T B;  3FTV A;  4OVU A;  4U07 A;  1MQS A;  1MYO A;  1UN8 A;  3FUH A;  1IHG A;  2ILR A;  4G1T A;  4F53 A;  3ZPJ A;  2WVI A;  5JA4 D;  5KJL A;  4Q69 A;  4JA7 A;  3W9G A;  2V0P A;  1FVH A;  3CHP A;  1O5M A;  5ENT D;  4WWO A;  3KAE A;  2J08 A;  3R7R A;  2H6H A;  1N4P A;  2BKK B;  1JUQ A;  4JB8 P;  5D0O D;  2IEJ A;  2J4B A;  4DPR A;  4BER A;  3B7U X;  3L16 A;  1XNF A;  3QNK A;  4O1P A;  2PM6 A;  3TWV A;  3EDT B;  4HOU A;  5LOZ A;  2IF4 A;  1U2V G;  2LSU A;  1XGW A;  4G11 A;  4YVQ C;  3APD A;  4I43 A;  1H6O A;  2XHE A;  1TNZ A;  4ILI A;  3HVE A;  3SD5 A;  1MX2 A;  2IO2 C;  2J4D A;  5DIZ A;  3ABL E;  3L13 A;  3CVY A;  3IV0 A;  3DWL G;  4ILG A;  2KCL A;  4JVS A;  4CRW A;  4HRL A;  2KC7 A;  2WXJ A;  3FHE A;  3FUK A;  3DPD A;  3EIJ A;  3GZ2 A;  4HB5 A;  3U3W A;  4WNE A;  3TXM A;  4B8C B;  3S7D A;  4AEZ C;  4NQ0 A;  5CEA A;  1TJF A;  2H6G A;  3LXU X;  1Y6I A;  4YDE A;  1DNP A;  4N3A A;  3VLD A;  4O1O A;  4B8A A;  4ANX A;  2C2L A;  1WAO 1;  3LEW A;  3PRE A;  2EIL E;  4ANV A;  3T9K A;  2I2O A;  2WXO A;  3IBE A;  3UM0 A;  4BEP A;  3AU4 A;  3JUE A;  2IOS A;  4I17 A;  3QAR A;  4K5A B;  2LAI A;  3ASO E;  3B7T A;  4GU5 A;  4I1A A;  3D9I A;  3CVV A;  1DCE A;  1ELW A;  1OWP A;  2Y3A A;  4XI0 A;  2X6I A;  2Y69 E;  4I6G A;  4N5Q A;  1UJK A;  2LO6 A;  4TXR A;  4IRU A;  3HYM B;  2C0M A;  3CVU A;  3RO3 A;  2LXL A;  3ASF A;  4H7Y A;  3IHV A;  4APF A;  1U3D A;  3HG0 D;  3TWU A;  5ARF A;  1H6P A;  1AWC B;  3S7F A;  3TWT A;  3SHF A;  3GZS A;  4I1O B;  2BF0 X;  3CKB A;  3Q49 B;  3U9W A;  4F1S A;  2F37 A;  2P9P G;  1H2T C;  3G2V A;  3ONL A;  3UM1 A;  3OTN A;  3V2X A;  3JUI A;  3UIP C;  2WM9 A;  4L2L A;  4J6I A;  5FTP A;  1V54 E;  1OUV A;  3JQ1 A;  3T5V A;  2OVB A;  3RAU A;  2AXZ A;  3ASH A;  1L5J A;  5ANL A;  2L9B A;  1KT1 A;  4YVO A;  2XZT G;  3ZYQ A;  2VTB B;  1IYG A;  4PS8 A;  4MLP A;  3ZYL A;  3TJP A;  3D9K A;  3ZYK A;  3NQP A;  1PAQ A;  3ASD A;  3FP3 A;  4HOQ A;  3MX3 A;  4TXP A;  4U8H A;  4N5C A;  1INZ A;  5B1B E;  2UY1 A;  3OAW A;  3SGH A;  3Q9N C;  3PZ3 A;  4U96 D;  2XGM A;  1JPL A;  3E4B A;  2P9S G;  2FUL A;  2WXP A;  2IO3 C;  2XCC A;  1NI1 A;  2WXN A;  3MKQ A;  2EIN E;  5BV0 A;  4AP2 A;  3NB2 A;  4L1B A; 
#chains in the Genus database with same CATH homology
 5T8I A;  3FUE A;  2JLB A;  4B0Z A;  1HH8 A;  4K03 A;  5A23 A;  5JHB A;  3LPZ A;  4BSX A;  3LCA A;  3BG1 B;  4FAD A;  4XE0 A;  3CLJ A;  4AV7 A;  4FLB A;  4KT6 B;  1DVP A;  3FUI A;  3U4T A;  4EBA A;  5BNW A;  5KJM A;  3D9J A;  4NRH B;  3OXL A;  4GZC A;  3QDN A;  3CHS A;  3AS5 A;  1PC2 A;  3BEE A;  5ANR A;  4FHK A;  4GYO A;  3ZN3 A;  4UI9 C;  2WXH A;  2PQR A;  3MV3 B;  4O6F A;  2IFU A;  4V3I A;  2FEZ A;  2PL2 A;  3Q15 A;  4LEU A;  4ANW A;  4KVM A;  4N3C A;  3FU3 A;  1HXI A;  3UQ3 A;  5AJD A;  4N39 A;  1N54 A;  3EHN A;  3MJW A;  4WND A;  4GZD A;  2WQ6 A;  4I2Z A;  4EPZ A;  2WQ7 A;  2YQ8 A;  3FU5 A;  2QY7 A;  3U64 A;  5FQ6 A;  1TEZ A;  1NP7 A;  3SF4 A;  1E8W A;  3IKO B;  4UI9 K;  5KJK A;  2R5S A;  3VLF A;  4C9B B;  2PM7 A;  2X6F A;  2VSO E;  4K0R A;  2VSN A;  2AXU A;  3R9A B;  2VSX E;  2CG2 A;  4FJY A;  4TV3 A;  3ZGQ A;  3SBS A;  3G2U A;  5FQ7 A;  4D10 C;  2VJ8 A;  4RSY A;  2AWI A;  4F7A A;  4OYS A;  4FLH A;  4GAA A;  3JQ0 A;  4EBA G;  4GCO A;  3FH8 A;  3NF1 A;  4FHJ A;  5AJL A;  5FZQ A;  3CSF A;  3RRN B;  3PRZ A;  2KCK A;  3PS6 A;  5G04 C;  4I6E A;  4KZ0 A;  4BT8 A;  5BPP A;  1S0P A;  3QKY A;  2YHC A;  1OWM A;  3D9M A;  1ELR A;  3G2W A;  2I6H A;  2P58 C;  2X3M A;  3CEQ A;  4RVB A;  4CT4 A;  3CQG B;  4IYP A;  2FO7 A;  3DBS A;  3FUJ A;  3RRU A;  3GW4 A;  3RU0 A;  1E8Y A;  1ZBP A;  3CGH A;  3TAX A;  5JJ7 A;  5JHA A;  1VDY A;  3UT8 A;  3FY4 A;  4GB9 A;  4MKT A;  3O48 A;  5CMY A;  4U04 A;  4C0E A;  3CVQ A;  3U66 A;  3AS8 A;  4KMO A;  5AYW D;  2DBA A;  2UWJ G;  2DCP A;  4BTB A;  5C2Y A;  3ONK A;  4E85 A;  2WXQ A;  3LY7 A;  1LF8 A;  3JCK C;  3R7Q A;  4CDN A;  2MRI A;  4NAC A;  4L7T A;  2M63 A;  2MHK A;  1PY1 A;  2E0I A;  4GZ5 A;  4XI9 A;  3ZHE A;  4GA1 A;  3RK6 A;  1W3B A;  5EX3 A;  3FTX A;  5CHE E;  3I4R B;  4XX5 A;  3AU5 A;  3L08 A;  3CK9 A;  4ACL A;  1H2U A;  3LJ3 A;  4WAF A;  3PZD A;  3QJZ A;  4J0U A;  5BUZ A;  2VYI A;  4HS2 A;  4FUL A;  3LS8 A;  2HM8 A;  4DJA A;  3CVN A;  4M3O A;  3LVR E;  1JWF A;  5M72 A;  3FUL A;  5FQ4 A;  4N2Q A;  5BT1 A;  2RD0 A;  3CR3 A;  3RO2 A;  2J07 A;  2WXK A;  3LVQ E;  3UX4 A;  4N3B A;  4DK5 A;  2XPI A;  5J90 A;  2FF4 A;  3TXN A;  2XRZ A;  4I1M A;  1TJC A;  3L17 A;  4N2S A;  3I3N A;  4GYW A;  4HLE A;  4H7X A;  2XGO A;  3Q4A B;  4G23 A;  3CK8 A;  4UQZ A;  4EQF A;  4UWH A;  2YNQ A;  2L0T B;  3I4G A;  4JXT A;  3FTV A;  3MA5 A;  4EZL A;  4GML A;  4J8S A;  4OVU A;  4U07 A;  4CT0 A;  1MQS A;  3L54 A;  4JHR A;  4CGV A;  1UN8 A;  3TG5 A;  3FUH A;  2WPV A;  1IHG A;  4UWK A;  3FEY A;  4A3V A;  2ILR A;  3T8M A;  4G1T A;  1KT0 A;  3OXG A;  3UUX A;  1H0A A;  4F53 A;  2FBN A;  5HQ8 A;  1HE8 A;  2VGY A;  3ZPJ A;  2WVI A;  3L22 A;  5E76 A;  5T3R A;  2X6J A;  3ZW3 A;  5D0Q D;  2IQC A;  4LER A;  5ENN A;  3FTZ A;  1UJJ A;  2X6H A;  4WNF A;  5KJL A;  1HZ4 A;  2J49 A;  4Q69 A;  2OOE A;  3FUN A;  4JA7 A;  2V0P A;  3N71 A;  4A3T A;  4AM9 A;  1FVH A;  4BX8 A;  3CHP A;  3VTX A;  4G2V A;  3QOU A;  3MCX A;  4FP7 A;  5EX0 A;  5LCW J;  4PS7 A;  4GPK A;  2KM4 A;  4UWL A;  4WWO A;  3OXF A;  3KAE A;  2J08 A;  3R7R A;  3LYA A;  4KYO B;  4JEH A;  3FEX A;  2C0L A;  2Q7F A;  3QWW A;  4JL0 A;  1JUQ A;  2HR2 A;  1Y8M A;  2FI7 A;  5BW8 C;  3CVW A;  1KLX A;  2CHZ A;  5DBK A;  5D0O D;  2WMO A;  3B7S A;  1H2V C;  2J4B A;  4U0U A;  4DPR A;  3MGB A;  5LX8 A;  3G2S A;  3B7U X;  1P5Q A;  3CHM A;  3PDN A;  5FQ8 A;  3ZHE B;  3KD7 A;  3FTU A;  4Q94 A;  2OND A;  5CMW A;  3AS4 A;  3PE4 A;  3IHY A;  3L16 A;  3PH0 C;  4UWG A;  1XNF A;  3ZIM A;  4APO A;  3QNK A;  3L6A A;  4I9E A;  3CVL A;  2PM6 A;  4WUY A;  3PUJ A;  4HFG A;  3EDT B;  4HOU A;  2A5U A;  2LAH A;  3CHQ A;  4YND A;  4AVX A;  2X38 A;  4IN3 B;  1HG5 A;  1OWN A;  5G55 A;  5LOZ A;  3RKV A;  1IQR A;  2IF4 A;  1XGW A;  2LSU A;  3QWP A;  4KVO A;  1E7U A;  4MRU A;  1SZ9 A;  1Z6T A;  4J8D A;  4FU3 A;  1ELK A;  4G11 A;  4YVQ C;  3CVX A;  3APD A;  3MYV A;  4I43 A;  2XHE A;  3NZU A;  3HIZ A;  2V4L A;  3ML9 A;  5KCM A;  3FUF A;  3BG0 B;  4ILI A;  3HVE A;  3C98 A;  3QK0 A;  3B7R L;  1BPO A;  3HHM A;  5JJ6 A;  3SD5 A;  1NA3 A;  3MKR A;  3EJN A;  3SFZ A;  3CHO A;  5AEN A;  1HFA A;  3CK7 A;  5DIZ A;  2J4D A;  3D9P A;  3FUM A;  2E2E A;  2VQ2 A;  3QWV A;  3L13 A;  4KZC A;  4BT9 A;  5AIJ A;  3CVY A;  3FU6 A;  3IV0 A;  3CKC A;  4LRZ A;  2RG8 A;  4ILG A;  3JYS A;  3CST A;  4CEM A;  4RG9 A;  3D9L A;  4GZ3 A;  3LY9 A;  2KCL A;  4GA2 A;  4JVS A;  4KBQ A;  4UI9 J;  5ARG A;  2KC7 A;  2WXJ A;  3VTY A;  4AIF A;  3FHE A;  4CRW A;  1E96 B;  4LCT A;  3TGO A;  3FUK A;  4AXH A;  2CFZ A;  2QFC A;  4UQY A;  2R17 C;  3DPD A;  3EIJ A;  5EKQ D;  2OVF A;  3GZ2 A;  1EDU A;  3SNX A;  4I9C A;  3U3W A;  4WNE A;  3APC A;  4ABN A;  3ZVV A;  3TXM A;  4A1G A;  4B8C B;  3MZL B;  3S7D A;  3P1U A;  5LCW C;  4AEZ C;  4NQ0 A;  3LDZ A;  4IUL A;  3SI5 A;  1TJF A;  3LXU X;  1Y6I A;  2AXV A;  2UY1 B;  1DNP A;  1H6K A;  3QAQ A;  3S7B A;  4GYY A;  3ZEF A;  4N3A A;  3URZ A;  5KJN A;  4PUC A;  3VLD A;  3SBT B;  1HG2 A;  4G26 A;  4B8A A;  4ANX A;  2CG3 A;  4B94 A;  3QC1 A;  2C2L A;  1WAO 1;  3LEW A;  3PRE A;  1JWG A;  1HX8 A;  1QQE A;  1OWO A;  2WXG A;  5E75 A;  1HU3 A;  4ANV A;  3ZRH A;  3FH5 A;  5A6C A;  3FU0 A;  2I2O A;  2KCV A;  2A4Z A;  2GRM A;  2WXO A;  3IBE A;  3P2B A;  4ILH B;  2PQN A;  4W9R A;  3UPV A;  4HOR A;  2CHX A;  2V5F A;  3AU4 A;  3ASG A;  4ACK A;  1EYH A;  2IOS A;  4AOF A;  5BV1 A;  5C1D A;  4I17 A;  3QAR A;  2VSY A;  4E6H A;  1U3C A;  3PNL B;  1SZA A;  2BUG A;  2LAI A;  1WY6 A;  4BFR A;  4EEC A;  2KAT A;  4HOS A;  3B7T A;  2XCB A;  4GU5 A;  4I1A A;  3D9I A;  5G05 C;  2L6J A;  2WXL A;  4JC8 A;  4OVV A;  3CVV A;  4CDR A;  3IEG A;  3K9I A;  1N52 A;  4JW1 A;  3FTS A;  3FTW A;  4UWF A;  1ELW A;  2WXI A;  3GZ1 A;  3ZFW A;  2GRL A;  4DLQ A;  2I1K A;  1OWP A;  4J8F A;  2Y3A A;  4XI0 A;  1FVF A;  2X6I A;  3FH7 A;  2WB2 A;  4EZJ A;  4GCN A;  4XZ4 A;  2AVP A;  3MKQ B;  1HF8 A;  3PEV B;  4I6G A;  4A1S A;  5FZS A;  1UJK A;  4CGW A;  1SQM A;  3TL5 A;  3PVL A;  4PH4 B;  4LUN U;  1UN9 A;  3SZ7 A;  4CCA A;  4GZ6 A;  4R7L A;  1GW6 A;  4JZY A;  2LO6 A;  4J8E A;  1FCH A;  4IRU A;  4U63 A;  4GA0 A;  2R59 A;  3HYM B;  2C0M A;  3CVU A;  2KZT B;  2CFU A;  2KZT A;  2YHE A;  3RO3 A;  1MHQ A;  3ASF A;  4H7Y A;  1EPU A;  2X6K A;  3VLE A;  3S2A A;  3IHV A;  4APF A;  1U3D A;  3ENE A;  3ESK A;  5ARF A;  3QB2 A;  3MV2 B;  3UMV A;  2LSV A;  3RIB A;  4ATG A;  2GW1 A;  3FUD A;  1E8X A;  3S7F A;  3SHF A;  3GZS A;  4BX9 A;  1UW4 B;  5J08 A;  2XEV A;  2AW6 A;  4I1O B;  2BF0 X;  5FZR A;  2XQ0 A;  4WWN A;  2IU1 A;  4KXK B;  3CKB A;  4BTA A;  3Q49 B;  3U9W A;  2HYZ A;  3WXX A;  1NA0 A;  4F1S A;  1Z3X A;  4HOT A;  1QNF A;  4ANU A;  2NC9 A;  4A55 A;  1H2T C;  2XGS A;  5HI7 A;  4PS3 A;  4C0M A;  1OWL A;  4CDM A;  3D9O A;  2XPZ A;  1NZN A;  3CIA A;  3G2V A;  1UG3 A;  3MEK A;  4FJZ A;  4L23 A;  1IQU A;  3ONL A;  3RJV A;  2XPY A;  3KEZ A;  4U0S A;  3CVP A;  3HVE B;  4BWR A;  4QFV A;  1H19 A;  3PUK A;  4URK A;  5CCM A;  3FTY A;  1ZU2 A;  2XRY A;  4JHJ A;  3APF A;  4PDX A;  2LNI A;  3OTN A;  2JEK A;  2WXR A;  3G2T A;  3JUI A;  4FC8 A;  2PZI A;  1HO8 A;  4XIF A;  1HS6 A;  5LP0 A;  3CQC B;  3GYZ A;  2WM9 A;  2YIN A;  2J9Q A;  4L2L A;  3T5X A;  3ZYM A;  4XKC A;  4J6I A;  3FDH A;  4MS6 A;  5FTP A;  1E90 A;  2HO1 A;  5FJY A;  3PE3 A;  1OUV A;  3JQ1 A;  4FA6 A;  2GGF A;  2OVB A;  3ESL A;  4G24 A;  4Y6W A;  3T5V A;  4JHK A;  2AXZ A;  3ASH A;  1L5J A;  5ANL A;  5CCL A;  2I9C A;  5EDS A;  4ME2 A;  4HVB A;  3I5P A;  3ULQ A;  2I1J A;  4DI3 A;  2L9B A;  1KT1 A;  2WXF A;  4AY5 A;  4I6J A;  1E8Z A;  3ZXS A;  2NSZ A;  4YVO A;  4BY6 A;  3PNT B;  4WWP A;  3ZYQ A;  2VTB B;  2V8S E;  2VTB A;  1WM5 A;  1IYG A;  4PS8 A;  4L2Y A;  4MLP A;  2WXM A;  3LKU A;  3ZYL A;  4HXI A;  3CHR A;  3TJP A;  3B13 A;  3D9K A;  4Q96 A;  2ZU6 B;  4P29 A;  2Y4T A;  3NZS A;  3RRM B;  3ZYK A;  2DIW A;  5FWQ A;  3NQP A;  1PAQ A;  3ASD A;  3PEU B;  3FP3 A;  4HOQ A;  3TG4 A;  3MX3 A;  3FWV A;  3ML8 A;  4U8H A;  3KS2 A;  4RG6 A;  2J09 A;  4N5C A;  1INZ A;  4DLO A;  3EIQ C;  4AY6 A;  2CHW A;  2WMN A;  4JEU A;  5G05 J;  5A7D B;  2UY1 A;  4JA9 A;  4AJW A;  3LY8 A;  1E7V A;  3EHM A;  3OAW A;  2EQX A;  2OV8 A;  4DI4 A;  3SGH A;  3UT4 A;  4U0Z A;  4XKB A;  1Z3Y A;  3S7J A;  4UQX A;  2IJG X;  4EZK A;  5JJT A;  1YA0 A;  4B89 A;  4G25 A;  1EF1 C;  4JPS A;  2XGM A;  3D3M A;  2NXP A;  4GMJ A;  3E4B A;  1JPL A;  3FFL A;  4NUR A;  4TUU A;  4WNG A;  3CV0 A;  4Y6C A;  5G04 J;  2WXP A;  2FUL A;  2IOL A;  1B89 A;  2Y4U A;  1X5B A;  4I2W A;  2XCC A;  2L0I A;  2BTD A;  5T4Y A;  3O4Z A;  2VGX A;  2VGX B;  5FT9 A;  2WQH A;  5LFA A;  1A17 A;  3HDX A;  2WXN A;  4TRQ A;  3MKQ A;  3UT7 A;  2ION A;  3D9N A;  1QZ2 A;  5BV0 A;  4AP2 A;  3Q5M A;  5G2N A;  3Q47 B;  4F3V A;  4L1B A;  2MOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...