2L6JA

Tah1 complexed by meevd
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords TPR repeat-containing protein associated with Hsp90
publication title Structure of minimal tetratricopeptide repeat domain protein Tah1 reveals mechanism of its interaction with Pih1 and Hsp90.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 32
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2l6jA00
2KC7A 5KJNA 3RO2A 3E4BA 3U4TA 1ELWA 1QQEA 4N2QA 4G23A 3PE4A 1Y8MA 2WPVA 5D0QD 5ARFA 1KLXA 2ONDA 3CVLA 3LY9A 4NQ0A 4H7YA 4WNFA 2JLBA 3SZ7A 2FO7A 4RG9A 4G2VA 2UWJG 2HYZA 3CKCA 2XPIA 3S7FA 3IEGA 4GZ3A 2VSNA 2VSYA 1HH8A 2IF4A 5FZRA 4BT9A 4G24A 5BT1A 4O6FA 4N3AA 3TG5A 2C0MA 5DBKA 2BUGA 1NA3A 3RIBA 1E96B 4GYYA 3FWVA 2VGXB 3NF1A 4XI0A 1HXIA 3QDNA 3LY8A 3OXLA 5G05C 4J0UA 4H7XA 2Y4TA 4XI9A 3QWVA 3AS5A 3QWPA 3QOUA 5C1DA 4G1TA 4U0ZA 4BT8A 4U04A 4AY6A 2MHKA 4KBQA 1NZNA 4BTAA 3WXXA 3GYZA 2L6JA 2LSUA 4U0SA 4HOUA 4KXKB 4JA9A 3RO3A 4I9CA 3Q49B 5FJYA 3CEQA 4AY5A 3S7BA 1A17A 3GZ2A 4HOSA 1YA0A 2P58C 5FZQA 2Q7FA 3UQ3A 4UQXA 1HZ4A 4NRHB 5BNWA 3TAXA 2KCLA 3JYSA 4N2SA 2LNIA 3PE3A 4GCOA 4HORA 5M72A 2FBNA 3Q47B 3O48A 3UUXA 5FZSA 4B94A 2R5SA 3ASDA 4UQYA 3AS4A 4UI9K 4YVQC 2FEZA 5KJMA 5ARGA 4JA7A 5KJKA 4UI9C 1QZ2A 4N39A 3CK9A 5G05J 1WAO1 2XCBA 3ZFWA 4CGWA 3ZHEB 3CK8A 2YHCA 3MV3B 4F3VA 2C2LA 4IN3B 3HYMB 4XIFA 2UY1A 3MEKA 3EDTB 3R9AB 4JHRA 2FF4A 2NC9A 1W3BA 1WM5A 2OOEA 2WQHA 4GYWA 3Q15A 4G25A 2VQ2A 2XGSA 3KAEA 5DIZA 4GZ5A 3CK7A 2QFCA 3ASHA 5CHEE 4KYOB 4HOQA 5EX0A 4EQFA 4Y6WA 4J8DA 2C0LA 3RKVA 4WUYA 4CDRA 3FP3A 3CVPA 2HO1A 4JL0A 2AVPA 2GW1A 1OUVA 3QWWA 3QKYA 3RJVA 3URZA 4WNEA 4AM9A 4APOA 2I6HA 5BW8C 3SF4A 3S7JA 1TJCA 5LCWC 4UI9J 3MKRA 2YQ8A 4YVOA 4GPKA 4I2WA 4GCNA 4N5CA 1XNFA 3Q4AB 3CKBA 4LEUA 1ZBPA 2KCKA 5HQ8A 3CVNA 2PL2A 1KT1A 4N3CA 4CGVA 3ZGQA 5FTPA 4HOTA 4U0UA 4BTBA 4WNDA 1IYGA 3BEEA 3Q5MA 1PC2A 3N71A 2KATA 2V5FA 4J8FA 3ZPJA 1NA0A 3ASFA 4GA1A 4J8EA 4WNGA 1P5QA 2LSVA 2HR2A 2IFUA 5A6CA 2XEVA 2XGOA 4I2ZA 1FCHA 2PQRA 4W9RA 3S7DA 3ULQA 3ZN3A 4UQZA 4A1SA 3LKUA 3K9IA 3CVQA 4GA2A 5G04C 5EX3A 5KJLA 2FI7A 2KCVA 4GYOA 1B89A 4I1AA 3TGOA 3ESKA 5D0OD 5LCWJ 5JJ7A 3FFLA 5EKQD 3LYAA 3LCAA 4AIFA 2XGMA 3PDNA 4N3BA 3UPVA 3KS2A 3AS8A 3VTXA 1ELRA 4I17A 4ME2A 3MA5A 5AYWD 3RU0A 2E2EA 3U3WA 4G26A 4GZ6A 3GZ1A 4YNDA 3TG4A 5A7DB 3OXGA 3VTYA 2XCCA 2DBAA 3ZHEA 5JJTA 3KD7A 4Y6CA 1KT0A 2PQNA 2UY1B 4RG6A 3ASGA 4I9EA 5HI7A 2VYIA 3OXFA 2J9QA 4BWRA 5JJ6A 4U07A 3CV0A 1IHGA 2Y4UA 5FT9A 3LY7A 4ABNA 5CCMA 2VGXA 4GA0A 3MV2B 2VGYA 5CCLA 2PZIA 3GW4A 3LPZA 5G04J 1ZU2A
chains in the Genus database with same CATH superfamily
3U4TA 3UIPC 2X6KA 4DK5A 3CVYA 1HFAA 1E8ZA 4ANWA 3GZSA 4BEPA 4A63B 5BV1A 3L9TA 2I1JA 4TXPA 2XQ0A 1LF8A 1G3NB 5D0QD 5ARFA 3DBSA 3WG7E 2P9IG 3HXBA 4KVMA 3CVLA 3LY9A 4NQ0A 4H7YA 2JLBA 5LP0A 2YHEA 2RG8A 3PZ4A 2H6GA 3PZ2A 3CSFA 2F8YA 3ZNGA 3EU9A 3NOGD 4O1OA 2XENA 3ML9A 3AG2E 5D2MC 1HH8A 2WXRA 4TV3A 3D9LA 4N3AA 2BUGA 5ENNA 1E96B 4L1BA 3AG1E 5ENRD 4GYYA 4GMLA 4PS3A 2VGXB 5LX8A 1VDYA 3D3MA 3AU4A 5FQ4A 1IXVA 3V31A 4XI0A 1HXIA 3QDNA 3OXLA 1DCQA 3FUHA 4J0UA 5T3RA 2DZNA 2EIME 2IQCA 5AARA 3EJNA 3QAQA 2DYRE 2RD0A 3SBTB 4XI9A 3R9MA 3DSVA 3RAUA 3RK6A 3ULYA 5ENSD 3QOUA 4BESA 3ONKA 4U04A 3JXIA 5JHBA 4TXRA 3T5VA 1FT2A 2Y0BG 3ZUVB 2L6JA 2LSUA 3L6AA 3FUIA 3E33A 2AXVA 2VGEA 4KXKB 4M3OA 3T5XA 4FADA 2PM6A 1OCRE 3RO3A 1HX8A 4EPZA 2V4HC 3S7BA 4HOSA 3UMVA 5FZQA 1N4PA 5T4YA 3UQ3A 2KM4A 4GTMA 3CVUA 4L2LA 3TWVA 3UKRG 4DX6D 4UQXA 4JHJA 4F7AA 5FINA 4AV7A 1IKND 3ZXPA 2LNIA 3NAWA 2L9BA 4KMOA 4HORA 5M72A 1RZ4A 3Q47B 5KCMA 3DWLG 1MX6A 4G8KA 4HRNA 2Y69E 2R5SA 3AG4E 3ASDA 4UQYA 4HB5A 4UI9K 5BV0A 3FU6A 4YVQC 5KJMA 2ZISA 4TUUA 2BTDA 4A55A 4BX9A 2BKGA 5BXUA 2X6FA 2YINA 4UI9C 4ATZD 2AXUA 4N39A 5B1BE 2M63A 3FTVA 1QYMA 3ULEG 3CK8A 2YHCA 4CZ2D 2CFUA 1WG0A 2P2CP 1EDUA 1Y6IA 2QYJA 2DVWA 4JHRA 2FF4A 1W3BA 2OOEA 2A5EA 1LD8A 3SI5A 4I6JA 4UWFA 3X2QE 2XGSA 1MX2A 1TNOA 3KSQA 4KYOB 3QK0A 4HRLA 2J07A 2WXIA 4A3TA 2ETBA 3KEAA 3I4RB 2C0LA 4V3IA 3FUKA 4RLYA 1MZCA 2P9KG 3LS8A 1HU3A 5EIBE 2HO1A 4F6RD 3QWWA 3D9IA 4B89A 1WY6A 1E7UA 4B93B 3C5RA 2ZXWE 4TUMA 2VSXE 3S7JA 1TJCA 4Q94A 4FLBA 1Z6TA 4KT6B 3FDHA 1N94A 3APCA 4A3VA 2Y1LE 4YDWA 4GPMA 5T8IA 2CHZA 1JWFA 3RRUA 4YVOA 1MX4A 3DEPA 4JC8A 1D8EA 5AIJA 5LOZA 1H2TC 2A5UA 3W9GA 4GTVA 3D9PA 4AXHA 4WNDA 3BEEA 1N52A 5AN8A 1YMPA 1Z5SC 4QFVA 3V79K 4J8EA 2HR2A 2ETCA 2DZOA 4PS8A 3ULQA 3ZN3A 5J08A 3JQ0A 3UX4A 4DLQA 4A1SA 2AW6A 3HXEA 4LSZE 2XS8A 2GROB 3ONLA 2FI7A 3QJZA 4G8LA 4GAAA 4GYOA 2ZGDA 5CERB 1HO8A 1B89A 4I1AA 4KZ0A 4AVXA 5ANLA 3ESKA 4ANUA 3LYAA 2WXQA 3LCAA 3D9KA 2OVFA 5EYPF 2DIWA 4J8YA 3R7QA 1H6OA 3E32A 4CEMA 3JQ1A 4I17A 3ISMC 5AYWD 2GRNB 1AWCB 1TNYA 1UJKA 1S64A 4G26A 3GZ1A 4NIKA 4F1PA 4APFA 2J09A 2BEDA 5A7DB 1MYOA 2XPYA 2XCCA 2GRLA 3C72A 3MX3A 1KT0A 4K03A 3EHNA 4RG6A 3ASGA 5LFAA 1IHBA 2IO2C 3G2WA 3UT8A 3MJWA 5JHAA 3U66A 4EZJA 2KBXA 4U07A 1V55E 1IHGA 2Y4UA 4MBGA 5FT9A 3NBNB 2WXNA 2V4LA 3MV2B 2NXPA 4HS2A 2PZIA 4EECA 5KJNA 2OCCE 3E4BA 2QY7A 1ELWA 4ATGA 4N2QA 4WWOA 4G23A 1GW6A 1SVXA 5C2YA 2WMNA 1OWPA 4DUIA 1AP7A 3IBEA 3CHOA 2WPVA 2CHXA 4HVBA 4XX5A 4LCTA 1KLXA 5HKPA 2ONDA 1TN6A 1X5BA 3EHQA 4RG9A 4G2VA 4BY6A 2UWJG 3CKCA 2B6CA 3S7FA 3IEGA 4GZ3A 2F8XK 4GMJA 3C3OA 3PEVB 2IF4A 3EUVA 4ILGA 5BT1A 4O6FA 3TG5A 3VLDA 1SW6A 1NA3A 1E7VA 1N95A 2LO6A 5H7PA 3FWVA 2PM7A 3E34A 3Q9NC 1OWOA 1TNZA 1FVFA 4DPRA 3LY8A 4ILHB 5JA4D 3E30A 1YCSB 2R17C 2ILRA 4K5BA 5B1AE 1JPLA 2A4ZA 2ZIRA 3HDXA 3QWVA 1QBQA 3AS5A 1O1RA 3HVEB 3QWPA 2QYUA 2WXKA 4G1TA 4BT8A 3Q9UC 2MHKA 4BTAA 3WXXA 1EF1C 3L54A 4HOUA 4JA9A 3MYVA 5A23A 4I9CA 2WXLA 4ANVA 1UJJA 2VTBB 2MRIA 3GZ2A 1YA0A 5KBAA 2Q7FA 3FEXA 3IKOB 4GZDA 3PNLB 2I2OA 1E90A 4R7LA 3TAXA 2KCLA 3JYSA 5E75A 1N9AA 2WMOA 3Q78A 3C3QA 2I1KA 1TR4A 1PY1A 3EIJA 4DJAA 3EU5A 2EILE 1Z3XA 2LXLA 2L0TB 4PUCA 4OAUC 2IEJA 4JPSA 3Q79A 4RQIA 5ARGA 2RKKA 3L13A 2RFMA 3ASNE 5G05J 2XCBA 3P1UA 3UXGA 3BU8A 3TWQA 4F3VA 3CSTA 2C2LA 5AQAA 4U8HA 2DYSE 1EYHA 4IN3B 4XIFA 4GTSA 3SFXA 3MEKA 2MOWA 3BG1B 4U96D 3FTWA 1N4SA 4L2YA 1SQMA 4JB8P 3EIQC 4O1PA 4GYWA 4FJYA 2P9UG 2VQ2A 4Q96A 3DRAA 5FWQA 3PRZA 1HF8A 3CK7A 5CHEE 3W9FA 5CRUA 1FT1A 2AJAA 3CVWA 2IOLA 1JWGA 4CRWA 2L0IA 4HLLA 4WAFA 4J8DA 2R59A 3J5PA 3TWUA 3RKVA 3ML8A 3EHMA 3DSWA 3RSEG 2EIJE 4CDRA 3FP3A 3KSLA 3ENEA 2P9SG 3Q75A 3RJVA 3URZA 3UM1A 2V0PA 4DI3A 5CEAA 3SFZA 2RFAA 2LUHA 3SF4A 3ABKE 3L16A 5BW8C 3U64A 4L9PA 3FU3A 4K0RA 3FUJA 1OWLA 2EQXA 3CHQA 4DX2A 1SZ9A 2IOSA 1SA4A 1S0PA 2I9CA 3DXMG 4XZ4A 4GCNA 3Q4AB 2P9NG 3NQPA 1EPUA 1ZBPA 4X8QA 4CDNA 3CVNA 4U8VD 3ZIMA 3ZGQA 4LG6A 5HS0A 4U0UA 3PUJA 4LNUD 2ZGGA 2KZTB 3L22A 2V5FA 1N11A 3UI2A 1DVPA 3AG3E 3ASFA 3UTMA 3PZ1A 5EN5D 2J08A 3QC1A 4GA1A 3LVQE 4WNGA 4UWLA 1P5QA 1N54A 5A6CA 4DX1A 4D10C 2PQRA 3FTYA 1H2VC 3QNKA 4UQZA 1JUQA 3CLJA 4FU3A 5BUZA 3MKQB 4YDOA 5CRVA 3CVQA 4GA2A 4HLEA 5D66A 2DCPA 3LJ3A 1U3CA 3FTXA 2V8SE 3AAAC 3ZW3A 4OVUA 1NP7A 5LCWJ 2J49A 3TWTA 5FQ7A 3TWWA 4DX5D 1TYQG 2XGMA 4N3BA 1SA5A 4JEHA 3FTZA 3FUDA 4JW1A 4XKBA 1ELRA 1KPSB 4LNBA 3UKUG 1BI8B 1UN8A 3RU0A 1H6KA 4HI8A 4JXTA 2LAHA 3CQCB 3IHVA 4LNGA 4F53A 2X6HA 3OXGA 3D9MA 4U8YD 2DBAA 3AJIA 3NZUA 5JJTA 2PQNA 2UY1B 1IQRA 1N4RA 3I3NA 1BPOA 4AEZC 1OT8A 2VYIA 5EYLA 4GTTA 4EBAA 4WWNA 1OWNA 3CV0A 3P2BA 5CCMA 2VGXA 4GA0A 4XKCA 3SGHA 5CCLA 3FUFA 3ZEFA 3LPZA 1ZU2A 2JABA 3TJPA 4HQDA 4URKA 4CDMA 3RO2A 4NURA 5ENPD 5B3SE 4YDYA 3G2SA 1E8WA 1K8KG 1QQEA 4E85A 3PE4A 4G11A 2WXJA 3V2OA 4LERA 4GTQA 4PDXA 4AOFA 1Y8MA 4I1MA 2IJGX 5KNHD 2IU1A 3HHMA 2H6FA 3ZYLA 4WNFA 1OWMA 3APDA 3JCKC 3NB2A 3UT7A 5ANRA 3V30A 4FP7A 4MRUA 1JCSA 2VSNA 3I4GA 4I43A 2WXMA 3FH8A 2GRQB 2R05A 4FULA 5DBKA 3RIBA 3DSTA 2ETAA 4FA6A 3SD5A 2XHEA 3NF1A 3MCXA 3BG0B 3CVXA 2WXOA 5G05C 2EINE 3JUEA 4E6HA 4H7XA 1FVHA 4GZCA 3ZYQA 4Q69A 2X6IA 2Y4TA 5C1DA 4GMRA 3U9WA 2R02A 1HG5A 4JHKA 4AY6A 4KBQA 3GYZA 4L23A 3RRNB 3T8MA 4C48B 4U7EB 3T9KA 3Q49B 3AU5A 3C3RA 1BD8A 3VLFA 4AY5A 1S63A 1A17A 4HFGA 2P58C 3FULA 5CBNA 3UT4A 4BFRA 4NRHB 3PS6A 3L17A 4ACKA 5CMYA 1KZOA 3FUEA 3ZU7B 4GCOA 2H6HA 4B8AA 2FBNA 4PH4B 3O48A 4BETA 3G2VA 5AQ7A 4B94A 4ILIA 2YNQA 2WXFA 1OXJA 4JVSA 3T8KA 1E8XA 3PZ3A 3Q7AA 3CHPA 1Q2ZA 1QZ2A 2J4BA 4L7TA 2DWZA 4CCAA 3CK9A 2XRZA 4AP2A 5AENA 1WAO1 4OAVB 4CGWA 5CBOA 2XS1A 4ACLA 1OCCE 3HYMB 2UY1A 2FULA 2MYOA 4HBDA 2WXHA 1WM5A 3FH5A 2WQHA 3Q15A 3CGHA 1UN9A 3IV0A 2GRPB 3ASOE 2IO3C 3FU0A 4XE0A 3ASHA 1TJFA 3TL5A 4HOQA 5KWDA 3OTNA 2IONA 1D8DA 4Y6WA 2WQ6A 3PREA 5ENQD 5KNGA 1NL4A 4HNAD 4O60A 1TNUA 3ZKJA 1DCEA 4WUYA 2NSZA 4Z68A 5EDSA 4TXQA 3CVPA 3HXCA 4JL0A 3HXFA 3L08A 4WNEA 2XZTG 1N0RA 4APOA 4JD2G 4C0MA 4HXIA 2I6HA 4OYSA 5LCWC 3ZYKA 2OEVA 4TRQA 3SQVA 3TWRA 1V54E 4ANXA 2F0YA 1K1AA 4UWKA 3MKRA 1ELKA 2YQ8A 4GPKA 1MQSA 4EZKA 4QQIA 4N5CA 5CECB 3TWSA 3CKBA 4LEUA 2KCKA 2PL2A 1KT1A 4N3CA 4CGVA 1N4QA 3APFA 4HOTA 4GTRA 3ZVVA 3MGBA 4U63A 1IYGA 1O1SA 1PC2A 3N71A 3UINC 2CHWA 2KATA 3ZPJA 1O5MA 5BPPA 3KEZA 5E76A 1NFIE 2LSVA 4A1GA 4DRXE 1N0QA 3S7DA 3B13A 4FHKA 3LKUA 5EX3A 4HI9A 5BXOA 3D9JA 5KJLA 2KCVA 5EILA 5FQ8A 4YDEA 2X3MA 1PAQA 4BSXA 2WM9A 3CR3A 3DSSA 5J90A 5JJ7A 3FFLA 1MJ0A 5EKQD 1H19A 5G2NA 3SO8A 3SY2A 1JCQA 4AIFA 3PDNA 2AWIA 3UPVA 3KS2A 3AS8A 1S70B 1L5JA 3PUKA 2LAIA 4OVVA 2XRYA 4GZ6A 1X81A 4J7WA 3TG4A 4GTPA 2WXPA 3D9OA 3VTYA 3KD7A 3ABME 4PS7A 1KZPA 1YYHA 1O1TA 3Q7FA 3UM3A 5HRYA 4FLHA 1A5EA 3VLEA 3OXFA 1LTXA 3LVRE 3ZRHA 5JJ6A 1U3DA 4ABNA 3LJNA 2LXMA 2J4DA 2WXGA 2VGYA 3FH7A 4MKTA 1SZAA 5G04J 3JXJA 2KC7A 3DSUA 4IYPA 4MS6A 2VSOE 3HVEA 3FTUA 2GRMA 2H6IA 1LD7A 5ITZF 1BLXB 3LXUX 4C9BB 4F1SA 3O4ZA 4J6IA 2VTBA 4WWPA 2QZAA 3F6QA 3SZ7A 2FO7A 3G2TA 3J5QB 3QARA 4B8CB 2HYZA 1E8YA 1TN7A 2WB2A 2XPIA 3SNXA 1RW2A 2XPZA 2VSYA 5FZRA 4BT9A 4G24A 3IXEA 1UOHA 2CFZA 2C0MA 2B0OE 3LEWA 4DI4A 4UUCA 1HS6A 4XEIG 1FPPA 4K5AB 3S2AA 1H0AA 4CT0A 2R2LA 3BQOA 2HE0A 3ZYMA 1MHQA 2X38A 1U2VG 2OVBA 1IQUA 3QB2A 3ZXSA 3E37A 4U0ZA 1Z3YA 3TXNA 3B7RL 3CHSA 5ENOD 1NZNA 2BKKB 4JEUA 4FHJA 4U0SA 2BF0X 4ZHBA 3D9NA 5CMWA 1K1BA 3I5PA 2NYJA 5FJYA 4C0EA 2AXZA 3CEQA 4LRZA 1TEZA 3CIAA 2WQ7A 1UW4B 3FUNA 4I1OB 3FHEA 1HZ4A 3UM0A 3NOCD 5BNWA 1TNBA 3LDZA 3FU5A 4N2SA 2HM8A 3PE3A 3HRAA 5AJLA 1BU9A 3MZLB 3UUXA 5FZSA 3B7SA 2JEKA 3B7UX 3UM2A 3AS4A 1XGWA 2FEZA 5IY5E 3DPYA 2IY0C 2P9LG 4JA7A 5KJKA 3IHYA 3CVVA 4K5CA 3UIOC 3ZFWA 3ZHEB 2CG3A 3MV3B 2KXPC 4MLPA 2OV8A 1D9SA 1DC2A 1OCOE 2ZU6B 3EDTB 3R9AB 2NC9A 4U95D 2XEEA 2F37A 2Y3AA 3PNTB 2WVIA 4G25A 3G2UA 1JCRA 3DEOA 3KAEA 5DIZA 4I6GA 2R03A 4GZ5A 4M7CA 1UG3A 2QFCA 3SHFA 1WDYA 4BX8A 5ENTD 2X6JA 3TWXA 1DNPA 2KZTA 5EX0A 3TXMA 4EQFA 5CEDB 2OEWA 1ZB1A 1INZA 3DSXA 4B0ZA 4EZLA 4KZCA 4AJWA 4GU5A 3B7BA 3ABLE 2AVPA 2GW1A 1OUVA 3CHRA 1H6PA 4RVBA 3QKYA 2PNNA 4AM9A 3C98A 3MKQA 4GB9A 4UI9J 4EBAG 3HG0D 4I2WA 3JUIA 3FEYA 2J8SD 1XNFA 3R7RA 3HXDA 3CQGB 5HQ8A 2P9PG 4GTOA 5FTPA 1OY3D 4BTBA 3OAWA 3SFYA 5AJDA 3PEUB 3Q5MA 5JMND 3Q73A 3RRMB 3CHMA 4J8FA 4RSYA 4UWGA 1NA0A 5EIDA 2GRRB 2E0IA 2FO1E 1BI7B 4IRUA 5FQ6A 4BERA 2IFUA 5G55A 2XEVA 2XGOA 4I2ZA 1FCHA 4W9RA 1HG2A 1H2UA 4CYMD 3FUMA 3DPDA 1HE8A 5AQBA 3K9IA 2CG2A 3FTSA 5G04C 2EIKE 4DLOA 4IULA 4ZFHA 3TGOA 5D0OD 3SBSA 1K3ZD 4UWHA 4CT4A 2QC9A 3PZDA 4N5QA 3VTXA 3EHRA 4ME2A 4HRMB 4BSZB 3MA5A 2VJ8A 4J8SA 5FIOA 2E2EA 3U3WA 4KVOA 2XEHA 5AAOA 4P29A 4I6EA 1OCZE 4YNDA 2L6BA 1NI1A 3FY4A 3B7TA 3PH0C 3ZHEA 1TN8A 4Y6CA 2V5QC 4DX7D 4NACA 4LUNU 3D9HA 4FJZA 4I9EA 5AQ9A 5HI7A 3V2XA 2J9QA 4JZYA 3HIZA 4BWRA 4EHMA 3LY7A 1QNFA 3BUAA 4FC8A 2XZDG 3DXKG 2GGFA 3NZSA 3GW4A 3B95A 3L82A 3ESLA 3PVLA
chains in the Genus database with same CATH topology
2KC7A 4CDMA 5KJNA 3RO2A 4NURA 3E4BA 2QY7A 4IYPA 4MS6A 3G2SA 3U4TA 1ELWA 1E8WA 2X6KA 1QQEA 4DK5A 4ATGA 2VSOE 1HFAA 4E85A 3CVYA 4WWOA 4N2QA 1E8ZA 4G23A 1GW6A 4ANWA 3GZSA 3HVEA 3PE4A 3FTUA 4G11A 5C2YA 2WXJA 2GRMA 2WMNA 5BV1A 1OWPA 4LERA 4PDXA 4AOFA 1Y8MA 2I1JA 4I1MA 2XQ0A 3IBEA 3CHOA 1LF8A 2WPVA 2CHXA 3LXUX 5D0QD 2IJGX 4HVBA 4XX5A 4C9BB 2IU1A 3HHMA 5ARFA 4LCTA 1KLXA 4F1SA 3DBSA 2ONDA 3O4ZA 1X5BA 3CVLA 3LY9A 4KVMA 3ZYLA 4NQ0A 4J6IA 2VTBA 4H7YA 4WWPA 4WNFA 2JLBA 1OWMA 3SZ7A 5LP0A 2FO7A 3G2TA 4RG9A 2YHEA 2RG8A 3APDA 3JCKC 4G2VA 4BY6A 3QARA 3CSFA 2UWJG 4B8CB 2HYZA 1E8YA 3CKCA 3UT7A 2WB2A 5ANRA 4FP7A 2XPIA 4MRUA 3S7FA 3ML9A 3IEGA 4GZ3A 2VSNA 4GMJA 3SNXA 3I4GA 4I43A 2XPZA 2VSYA 2WXMA 1HH8A 2IF4A 2WXRA 3FH8A 3PEVB 5FZRA 4ILGA 4BT9A 4TV3A 3D9LA 4G24A 5BT1A 4O6FA 4N3AA 3TG5A 4FULA 2CFZA 2C0MA 3VLDA 5DBKA 2BUGA 1NA3A 5ENNA 3RIBA 1E96B 1E7VA 3LEWA 4DI4A 1HS6A 2LO6A 4L1BA 4GYYA 3FWVA 4GMLA 4PS3A 2PM7A 2VGXB 5LX8A 1VDYA 3D3MA 3AU4A 5FQ4A 3SD5A 4FA6A 1OWOA 2XHEA 3NF1A 4XI0A 3S2AA 1HXIA 1FVFA 1H0AA 3QDNA 4CT0A 3LY8A 4DPRA 3MCXA 3BG0B 4ILHB 3CVXA 3OXLA 2WXOA 5G05C 3FUHA 4J0UA 5T3RA 4E6HA 2IQCA 2R17C 2ILRA 4H7XA 1FVHA 4GZCA 3EJNA 3QAQA 1JPLA 2RD0A 3ZYQA 3SBTB 4Q69A 2X6IA 3ZYMA 2Y4TA 2A4ZA 1MHQA 2X38A 2OVBA 3HDXA 4XI9A 3QWVA 1IQUA 3QB2A 3ZXSA 3AS5A 3RK6A 3HVEB 3QWPA 2WXKA 3QOUA 3U9WA 5C1DA 4G1TA 4U0ZA 4BT8A 3ONKA 4U04A 1Z3YA 1HG5A 4JHKA 5JHBA 3TXNA 4AY6A 2MHKA 4KBQA 3B7RL 3T5VA 3CHSA 1NZNA 4BTAA 3WXXA 3GYZA 4JEUA 2L6JA 2LSUA 3L6AA 3FUIA 4L23A 4FHJA 4U0SA 3RRNB 2AXVA 3T8MA 1EF1C 3L54A 4HOUA 4KXKB 4M3OA 3T5XA 4FADA 2BF0X 2PM6A 3MYVA 4JA9A 5A23A 3RO3A 4I9CA 3D9NA 5CMWA 3Q49B 1HX8A 2WXLA 4EPZA 3AU5A 4ANVA 1UJJA 3I5PA 5FJYA 4C0EA 2AXZA 2VTBB 3CEQA 4LRZA 3VLFA 4AY5A 2MRIA 3S7BA 1TEZA 3CIAA 1A17A 3GZ2A 4HOSA 1YA0A 4HFGA 3UMVA 2P58C 2WQ7A 3FULA 5FZQA 2Q7FA 1UW4B 5T4YA 3FUNA 2KM4A 3UQ3A 3UT4A 4BFRA 3CVUA 3FEXA 3IKOB 3FHEA 4GZDA 3PNLB 4I1OB 4L2LA 4UQXA 1HZ4A 4JHJA 4F7AA 2I2OA 4NRHB 3PS6A 1E90A 3L17A 4R7LA 3LDZA 3TAXA 4ACKA 4AV7A 5BNWA 2KCLA 5CMYA 3FU5A 3JYSA 2HM8A 4N2SA 3FUEA 5E75A 2LNIA 2WMOA 3PE3A 4GCOA 2L9BA 5AJLA 4KMOA 4HORA 5M72A 4B8AA 2FBNA 4PH4B 3Q47B 5KCMA 3O48A 3MZLB 2I1KA 3UUXA 1PY1A 5FZSA 3EIJA 3G2VA 4DJAA 3B7SA 4B94A 4ILIA 2JEKA 2YNQA 2WXFA 2R5SA 3B7UX 1Z3XA 3ASDA 4JVSA 4UQYA 3AS4A 4UI9K 1XGWA 2L0TB 3FU6A 4PUCA 5BV0A 1E8XA 4YVQC 2FEZA 4JPSA 5KJMA 4TUUA 2BTDA 3CHPA 5ARGA 4A55A 4BX9A 4JA7A 2X6FA 2YINA 4UI9C 1QZ2A 5KJKA 2J4BA 2AXUA 4L7TA 3L13A 4N39A 4CCAA 3CK9A 3IHYA 4AP2A 3CVVA 2XRZA 5G05J 5AENA 1WAO1 2XCBA 3ZFWA 3P1UA 2M63A 3FTVA 4CGWA 3ZHEB 4ACLA 3CK8A 2CG3A 2YHCA 3MV3B 2CFUA 4F3VA 3CSTA 2C2LA 4MLPA 4U8HA 1EDUA 1EYHA 4IN3B 1Y6IA 3HYMB 2OV8A 4XIFA 2UY1A 2FULA 2ZU6B 3MEKA 2MOWA 3EDTB 2WXHA 3BG1B 4JHRA 3R9AB 2FF4A 2NC9A 3FTWA 1W3BA 1WM5A 2OOEA 4L2YA 1SQMA 3EIQC 3FH5A 2WQHA 2Y3AA 4GYWA 3PNTB 3Q15A 2WVIA 4G25A 4FJYA 3G2UA 3SI5A 3CGHA 4I6JA 1UN9A 4UWFA 2VQ2A 4Q96A 3IV0A 5FWQA 2XGSA 3KAEA 3PRZA 1HF8A 3CK7A 4GZ5A 4I6GA 1UG3A 2QFCA 5DIZA 3FU0A 4XE0A 3ASHA 3SHFA 5CHEE 1TJFA 4BX8A 3CVWA 2IOLA 2X6JA 4KYOB 3TL5A 1DNPA 2KZTA 1JWGA 4HOQA 3OTNA 3QK0A 5EX0A 3TXMA 4CRWA 2L0IA 2IONA 4EQFA 2J07A 4WAFA 4Y6WA 2WQ6A 2WXIA 3PREA 4J8DA 2R59A 4A3TA 3I4RB 2C0LA 3RKVA 1INZA 3ML8A 3EHMA 4WUYA 2NSZA 4B0ZA 4V3IA 3FUKA 4CDRA 4EZLA 5EDSA 3FP3A 4KZCA 4AJWA 4GU5A 3CVPA 1HU3A 3LS8A 2HO1A 4JL0A 2AVPA 2GW1A 1OUVA 3CHRA 3TJPA 4RVBA 3ENEA 3QWWA 3D9IA 4B89A 1WY6A 3QKYA 3RJVA 1E7UA 3L08A 3URZA 2V0PA 4WNEA 4DI3A 4AM9A 3C98A 4APOA 3SFZA 4C0MA 2VSXE 3MKQA 4HXIA 2I6HA 4GB9A 3L16A 4OYSA 5BW8C 3SF4A 3U64A 3S7JA 1TJCA 4Q94A 5LCWC 3ZYKA 4FLBA 4TRQA 1Z6TA 4KT6B 3FU3A 4K0RA 3FDHA 4UI9J 3APCA 4ANXA 3FUJA 4A3VA 4EBAG 1OWLA 5T8IA 2EQXA 4UWKA 3MKRA 3CHQA 2CHZA 1ELKA 1JWFA 2YQ8A 4YVOA 3RRUA 1SZ9A 2IOSA 4I2WA 3JUIA 4GPKA 1MQSA 1S0PA 2I9CA 3FEYA 4EZKA 4XZ4A 4GCNA 4JC8A 4N5CA 1XNFA 3Q4AB 3R7RA 3CKBA 4LEUA 3NQPA 5AIJA 1EPUA 5LOZA 1ZBPA 2KCKA 3CQGB 4CDNA 5HQ8A 3CVNA 2PL2A 1KT1A 4N3CA 4CGVA 1H2TC 3ZIMA 3ZGQA 3APFA 5FTPA 4HOTA 4U0UA 4BTBA 2A5UA 3MGBA 3ZVVA 3D9PA 4AXHA 3OAWA 3PUJA 4WNDA 4U63A 1IYGA 3BEEA 2KZTB 1N52A 5AJDA 3PEUB 3Q5MA 1PC2A 3N71A 3L22A 3RRMB 2CHWA 2KATA 2V5FA 3CHMA 4J8FA 1DVPA 3ZPJA 4RSYA 4UWGA 1NA0A 3ASFA 5BPPA 2E0IA 3KEZA 4QFVA 5E76A 2J08A 3QC1A 4GA1A 3LVQE 4J8EA 4WNGA 4UWLA 1P5QA 2LSVA 4IRUA 2HR2A 5FQ6A 4A1GA 2IFUA 1N54A 5A6CA 5G55A 2XEVA 2XGOA 4I2ZA 1FCHA 4D10C 2PQRA 3FTYA 4PS8A 4W9RA 1HG2A 3S7DA 3B13A 1H2UA 1H2VC 3QNKA 3ULQA 3ZN3A 4UQZA 4FHKA 5J08A 3JQ0A 1JUQA 3CLJA 3FUMA 4FU3A 3UX4A 4DLQA 4A1SA 2AW6A 3DPDA 5BUZA 3LKUA 3MKQB 1HE8A 3K9IA 2CG2A 3CVQA 3FTSA 4GA2A 5EX3A 5G04C 4HLEA 3ONLA 3D9JA 5KJLA 2FI7A 3QJZA 4GAAA 4DLOA 2DCPA 3LJ3A 2KCVA 1U3CA 4GYOA 1HO8A 4IULA 1B89A 3FTXA 4I1AA 2V8SE 5FQ8A 4KZ0A 3TGOA 3ZW3A 2X3MA 1PAQA 4AVXA 5ANLA 3ESKA 4BSXA 4OVUA 2WM9A 5D0OD 3CR3A 1NP7A 5LCWJ 5J90A 3SBSA 5JJ7A 2J49A 4ANUA 3FFLA 5EKQD 1H19A 5G2NA 5FQ7A 4UWHA 3LYAA 2WXQA 3LCAA 4AIFA 2XGMA 3D9KA 2OVFA 3PDNA 4CT4A 2DIWA 2AWIA 4N3BA 3UPVA 4JEHA 3R7QA 3FTZA 3FUDA 4JW1A 3KS2A 3PZDA 4CEMA 3AS8A 4XKBA 3VTXA 1ELRA 3JQ1A 4I17A 4ME2A 3MA5A 5AYWD 1L5JA 3PUKA 2LAIA 4OVVA 2VJ8A 2XRYA 4J8SA 1UN8A 3RU0A 2E2EA 1UJKA 1H6KA 4KVOA 3U3WA 4P29A 4I6EA 4G26A 4JXTA 2LAHA 3CQCB 4GZ6A 3GZ1A 4YNDA 4APFA 3IHVA 3FY4A 3TG4A 2X6HA 4F53A 2J09A 5A7DB 2WXPA 3B7TA 3D9OA 2XPYA 3D9MA 3OXGA 3VTYA 2XCCA 2GRLA 3PH0C 2DBAA 3ZHEA 3NZUA 5JJTA 3KD7A 3MX3A 4Y6CA 4PS7A 1KT0A 4K03A 2PQNA 2UY1B 3EHNA 4NACA 4RG6A 3ASGA 1IQRA 4LUNU 3I3NA 5LFAA 3G2WA 1BPOA 4FJZA 4AEZC 4I9EA 4FLHA 3UT8A 3MJWA 3VLEA 2VYIA 5HI7A 5JHAA 3OXFA 2J9QA 3LVRE 4JZYA 4EBAA 3U66A 4EZJA 3HIZA 3ZRHA 4BWRA 4WWNA 1OWNA 5JJ6A 4U07A 3CV0A 1IHGA 1U3DA 2Y4UA 5FT9A 3LY7A 4ABNA 1QNFA 2WXNA 4FC8A 2V4LA 3P2BA 5CCMA 2VGXA 4GA0A 4XKCA 3SGHA 2J4DA 2NXPA 2WXGA 3MV2B 2VGYA 2GGFA 5CCLA 3FH7A 3FUFA 3NZSA 4HS2A 2PZIA 3GW4A 1SZAA 3LPZA 4MKTA 5G04J 3ZEFA 4EECA 1ZU2A 3ESLA 3PVLA 4URKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KC7 A;  5KJN A;  3RO2 A;  3E4B A;  3U4T A;  1ELW A;  1QQE A;  4N2Q A;  4G23 A;  3PE4 A;  1Y8M A;  2WPV A;  5D0Q D;  5ARF A;  1KLX A;  2OND A;  3CVL A;  3LY9 A;  4NQ0 A;  4H7Y A;  4WNF A;  2JLB A;  3SZ7 A;  2FO7 A;  4RG9 A;  4G2V A;  2UWJ G;  2HYZ A;  3CKC A;  2XPI A;  3S7F A;  3IEG A;  4GZ3 A;  2VSN A;  2VSY A;  1HH8 A;  2IF4 A;  5FZR A;  4BT9 A;  4G24 A;  5BT1 A;  4O6F A;  4N3A A;  3TG5 A;  2C0M A;  5DBK A;  2BUG A;  1NA3 A;  3RIB A;  1E96 B;  4GYY A;  3FWV A;  2VGX B;  3NF1 A;  4XI0 A;  1HXI A;  3QDN A;  3LY8 A;  3OXL A;  5G05 C;  4J0U A;  4H7X A;  2Y4T A;  4XI9 A;  3QWV A;  3AS5 A;  3QWP A;  3QOU A;  5C1D A;  4G1T A;  4U0Z A;  4BT8 A;  4U04 A;  4AY6 A;  2MHK A;  4KBQ A;  1NZN A;  4BTA A;  3WXX A;  3GYZ A;  2L6J A;  2LSU A;  4U0S A;  4HOU A;  4KXK B;  4JA9 A;  3RO3 A;  4I9C A;  3Q49 B;  5FJY A;  3CEQ A;  4AY5 A;  3S7B A;  1A17 A;  3GZ2 A;  4HOS A;  1YA0 A;  2P58 C;  5FZQ A;  2Q7F A;  3UQ3 A;  4UQX A;  1HZ4 A;  4NRH B;  5BNW A;  3TAX A;  2KCL A;  3JYS A;  4N2S A;  2LNI A;  3PE3 A;  4GCO A;  4HOR A;  5M72 A;  2FBN A;  3Q47 B;  3O48 A;  3UUX A;  5FZS A;  4B94 A;  2R5S A;  3ASD A;  4UQY A;  3AS4 A;  4UI9 K;  4YVQ C;  2FEZ A;  5KJM A;  5ARG A;  4JA7 A;  5KJK A;  4UI9 C;  1QZ2 A;  4N39 A;  3CK9 A;  5G05 J;  1WAO 1;  2XCB A;  3ZFW A;  4CGW A;  3ZHE B;  3CK8 A;  2YHC A;  3MV3 B;  4F3V A;  2C2L A;  4IN3 B;  3HYM B;  4XIF A;  2UY1 A;  3MEK A;  3EDT B;  3R9A B;  4JHR A;  2FF4 A;  2NC9 A;  1W3B A;  1WM5 A;  2OOE A;  2WQH A;  4GYW A;  3Q15 A;  4G25 A;  2VQ2 A;  2XGS A;  3KAE A;  5DIZ A;  4GZ5 A;  3CK7 A;  2QFC A;  3ASH A;  5CHE E;  4KYO B;  4HOQ A;  5EX0 A;  4EQF A;  4Y6W A;  4J8D A;  2C0L A;  3RKV A;  4WUY A;  4CDR A;  3FP3 A;  3CVP A;  2HO1 A;  4JL0 A;  2AVP A;  2GW1 A;  1OUV A;  3QWW A;  3QKY A;  3RJV A;  3URZ A;  4WNE A;  4AM9 A;  4APO A;  2I6H A;  5BW8 C;  3SF4 A;  3S7J A;  1TJC A;  5LCW C;  4UI9 J;  3MKR A;  2YQ8 A;  4YVO A;  4GPK A;  4I2W A;  4GCN A;  4N5C A;  1XNF A;  3Q4A B;  3CKB A;  4LEU A;  1ZBP A;  2KCK A;  5HQ8 A;  3CVN A;  2PL2 A;  1KT1 A;  4N3C A;  4CGV A;  3ZGQ A;  5FTP A;  4HOT A;  4U0U A;  4BTB A;  4WND A;  1IYG A;  3BEE A;  3Q5M A;  1PC2 A;  3N71 A;  2KAT A;  2V5F A;  4J8F A;  3ZPJ A;  1NA0 A;  3ASF A;  4GA1 A;  4J8E A;  4WNG A;  1P5Q A;  2LSV A;  2HR2 A;  2IFU A;  5A6C A;  2XEV A;  2XGO A;  4I2Z A;  1FCH A;  2PQR A;  4W9R A;  3S7D A;  3ULQ A;  3ZN3 A;  4UQZ A;  4A1S A;  3LKU A;  3K9I A;  3CVQ A;  4GA2 A;  5G04 C;  5EX3 A;  5KJL A;  2FI7 A;  2KCV A;  4GYO A;  1B89 A;  4I1A A;  3TGO A;  3ESK A;  5D0O D;  5LCW J;  5JJ7 A;  3FFL A;  5EKQ D;  3LYA A;  3LCA A;  4AIF A;  2XGM A;  3PDN A;  4N3B A;  3UPV A;  3KS2 A;  3AS8 A;  3VTX A;  1ELR A;  4I17 A;  4ME2 A;  3MA5 A;  5AYW D;  3RU0 A;  2E2E A;  3U3W A;  4G26 A;  4GZ6 A;  3GZ1 A;  4YND A;  3TG4 A;  5A7D B;  3OXG A;  3VTY A;  2XCC A;  2DBA A;  3ZHE A;  5JJT A;  3KD7 A;  4Y6C A;  1KT0 A;  2PQN A;  2UY1 B;  4RG6 A;  3ASG A;  4I9E A;  5HI7 A;  2VYI A;  3OXF A;  2J9Q A;  4BWR A;  5JJ6 A;  4U07 A;  3CV0 A;  1IHG A;  2Y4U A;  5FT9 A;  3LY7 A;  4ABN A;  5CCM A;  2VGX A;  4GA0 A;  3MV2 B;  2VGY A;  5CCL A;  2PZI A;  3GW4 A;  3LPZ A;  5G04 J;  1ZU2 A; 
#chains in the Genus database with same CATH topology
 3U4T A;  3UIP C;  2X6K A;  4DK5 A;  3CVY A;  1HFA A;  1E8Z A;  4ANW A;  3GZS A;  4BEP A;  4A63 B;  5BV1 A;  3L9T A;  2I1J A;  4TXP A;  2XQ0 A;  1LF8 A;  1G3N B;  5D0Q D;  5ARF A;  3DBS A;  3WG7 E;  2P9I G;  3HXB A;  4KVM A;  3CVL A;  3LY9 A;  4NQ0 A;  4H7Y A;  2JLB A;  5LP0 A;  2YHE A;  2RG8 A;  3PZ4 A;  2H6G A;  3PZ2 A;  3CSF A;  2F8Y A;  3ZNG A;  3EU9 A;  3NOG D;  4O1O A;  2XEN A;  3ML9 A;  3AG2 E;  5D2M C;  1HH8 A;  2WXR A;  4TV3 A;  3D9L A;  4N3A A;  2BUG A;  5ENN A;  1E96 B;  4L1B A;  3AG1 E;  5ENR D;  4GYY A;  4GML A;  4PS3 A;  2VGX B;  5LX8 A;  1VDY A;  3D3M A;  3AU4 A;  5FQ4 A;  1IXV A;  3V31 A;  4XI0 A;  1HXI A;  3QDN A;  3OXL A;  1DCQ A;  3FUH A;  4J0U A;  5T3R A;  2DZN A;  2EIM E;  2IQC A;  5AAR A;  3EJN A;  3QAQ A;  2DYR E;  2RD0 A;  3SBT B;  4XI9 A;  3R9M A;  3DSV A;  3RAU A;  3RK6 A;  3ULY A;  5ENS D;  3QOU A;  4BES A;  3ONK A;  4U04 A;  3JXI A;  5JHB A;  4TXR A;  3T5V A;  1FT2 A;  2Y0B G;  3ZUV B;  2L6J A;  2LSU A;  3L6A A;  3FUI A;  3E33 A;  2AXV A;  2VGE A;  4KXK B;  4M3O A;  3T5X A;  4FAD A;  2PM6 A;  1OCR E;  3RO3 A;  1HX8 A;  4EPZ A;  2V4H C;  3S7B A;  4HOS A;  3UMV A;  5FZQ A;  1N4P A;  5T4Y A;  3UQ3 A;  2KM4 A;  4GTM A;  3CVU A;  4L2L A;  3TWV A;  3UKR G;  4DX6 D;  4UQX A;  4JHJ A;  4F7A A;  5FIN A;  4AV7 A;  1IKN D;  3ZXP A;  2LNI A;  3NAW A;  2L9B A;  4KMO A;  4HOR A;  5M72 A;  1RZ4 A;  3Q47 B;  5KCM A;  3DWL G;  1MX6 A;  4G8K A;  4HRN A;  2Y69 E;  2R5S A;  3AG4 E;  3ASD A;  4UQY A;  4HB5 A;  4UI9 K;  5BV0 A;  3FU6 A;  4YVQ C;  5KJM A;  2ZIS A;  4TUU A;  2BTD A;  4A55 A;  4BX9 A;  2BKG A;  5BXU A;  2X6F A;  2YIN A;  4UI9 C;  4ATZ D;  2AXU A;  4N39 A;  5B1B E;  2M63 A;  3FTV A;  1QYM A;  3ULE G;  3CK8 A;  2YHC A;  4CZ2 D;  2CFU A;  1WG0 A;  2P2C P;  1EDU A;  1Y6I A;  2QYJ A;  2DVW A;  4JHR A;  2FF4 A;  1W3B A;  2OOE A;  2A5E A;  1LD8 A;  3SI5 A;  4I6J A;  4UWF A;  3X2Q E;  2XGS A;  1MX2 A;  1TNO A;  3KSQ A;  4KYO B;  3QK0 A;  4HRL A;  2J07 A;  2WXI A;  4A3T A;  2ETB A;  3KEA A;  3I4R B;  2C0L A;  4V3I A;  3FUK A;  4RLY A;  1MZC A;  2P9K G;  3LS8 A;  1HU3 A;  5EIB E;  2HO1 A;  4F6R D;  3QWW A;  3D9I A;  4B89 A;  1WY6 A;  1E7U A;  4B93 B;  3C5R A;  2ZXW E;  4TUM A;  2VSX E;  3S7J A;  1TJC A;  4Q94 A;  4FLB A;  1Z6T A;  4KT6 B;  3FDH A;  1N94 A;  3APC A;  4A3V A;  2Y1L E;  4YDW A;  4GPM A;  5T8I A;  2CHZ A;  1JWF A;  3RRU A;  4YVO A;  1MX4 A;  3DEP A;  4JC8 A;  1D8E A;  5AIJ A;  5LOZ A;  1H2T C;  2A5U A;  3W9G A;  4GTV A;  3D9P A;  4AXH A;  4WND A;  3BEE A;  1N52 A;  5AN8 A;  1YMP A;  1Z5S C;  4QFV A;  3V79 K;  4J8E A;  2HR2 A;  2ETC A;  2DZO A;  4PS8 A;  3ULQ A;  3ZN3 A;  5J08 A;  3JQ0 A;  3UX4 A;  4DLQ A;  4A1S A;  2AW6 A;  3HXE A;  4LSZ E;  2XS8 A;  2GRO B;  3ONL A;  2FI7 A;  3QJZ A;  4G8L A;  4GAA A;  4GYO A;  2ZGD A;  5CER B;  1HO8 A;  1B89 A;  4I1A A;  4KZ0 A;  4AVX A;  5ANL A;  3ESK A;  4ANU A;  3LYA A;  2WXQ A;  3LCA A;  3D9K A;  2OVF A;  5EYP F;  2DIW A;  4J8Y A;  3R7Q A;  1H6O A;  3E32 A;  4CEM A;  3JQ1 A;  4I17 A;  3ISM C;  5AYW D;  2GRN B;  1AWC B;  1TNY A;  1UJK A;  1S64 A;  4G26 A;  3GZ1 A;  4NIK A;  4F1P A;  4APF A;  2J09 A;  2BED A;  5A7D B;  1MYO A;  2XPY A;  2XCC A;  2GRL A;  3C72 A;  3MX3 A;  1KT0 A;  4K03 A;  3EHN A;  4RG6 A;  3ASG A;  5LFA A;  1IHB A;  2IO2 C;  3G2W A;  3UT8 A;  3MJW A;  5JHA A;  3U66 A;  4EZJ A;  2KBX A;  4U07 A;  1V55 E;  1IHG A;  2Y4U A;  4MBG A;  5FT9 A;  3NBN B;  2WXN A;  2V4L A;  3MV2 B;  2NXP A;  4HS2 A;  2PZI A;  4EEC A;  5KJN A;  2OCC E;  3E4B A;  2QY7 A;  1ELW A;  4ATG A;  4N2Q A;  4WWO A;  4G23 A;  1GW6 A;  1SVX A;  5C2Y A;  2WMN A;  1OWP A;  4DUI A;  1AP7 A;  3IBE A;  3CHO A;  2WPV A;  2CHX A;  4HVB A;  4XX5 A;  4LCT A;  1KLX A;  5HKP A;  2OND A;  1TN6 A;  1X5B A;  3EHQ A;  4RG9 A;  4G2V A;  4BY6 A;  2UWJ G;  3CKC A;  2B6C A;  3S7F A;  3IEG A;  4GZ3 A;  2F8X K;  4GMJ A;  3C3O A;  3PEV B;  2IF4 A;  3EUV A;  4ILG A;  5BT1 A;  4O6F A;  3TG5 A;  3VLD A;  1SW6 A;  1NA3 A;  1E7V A;  1N95 A;  2LO6 A;  5H7P A;  3FWV A;  2PM7 A;  3E34 A;  3Q9N C;  1OWO A;  1TNZ A;  1FVF A;  4DPR A;  3LY8 A;  4ILH B;  5JA4 D;  3E30 A;  1YCS B;  2R17 C;  2ILR A;  4K5B A;  5B1A E;  1JPL A;  2A4Z A;  2ZIR A;  3HDX A;  3QWV A;  1QBQ A;  3AS5 A;  1O1R A;  3HVE B;  3QWP A;  2QYU A;  2WXK A;  4G1T A;  4BT8 A;  3Q9U C;  2MHK A;  4BTA A;  3WXX A;  1EF1 C;  3L54 A;  4HOU A;  4JA9 A;  3MYV A;  5A23 A;  4I9C A;  2WXL A;  4ANV A;  1UJJ A;  2VTB B;  2MRI A;  3GZ2 A;  1YA0 A;  5KBA A;  2Q7F A;  3FEX A;  3IKO B;  4GZD A;  3PNL B;  2I2O A;  1E90 A;  4R7L A;  3TAX A;  2KCL A;  3JYS A;  5E75 A;  1N9A A;  2WMO A;  3Q78 A;  3C3Q A;  2I1K A;  1TR4 A;  1PY1 A;  3EIJ A;  4DJA A;  3EU5 A;  2EIL E;  1Z3X A;  2LXL A;  2L0T B;  4PUC A;  4OAU C;  2IEJ A;  4JPS A;  3Q79 A;  4RQI A;  5ARG A;  2RKK A;  3L13 A;  2RFM A;  3ASN E;  5G05 J;  2XCB A;  3P1U A;  3UXG A;  3BU8 A;  3TWQ A;  4F3V A;  3CST A;  2C2L A;  5AQA A;  4U8H A;  2DYS E;  1EYH A;  4IN3 B;  4XIF A;  4GTS A;  3SFX A;  3MEK A;  2MOW A;  3BG1 B;  4U96 D;  3FTW A;  1N4S A;  4L2Y A;  1SQM A;  4JB8 P;  3EIQ C;  4O1P A;  4GYW A;  4FJY A;  2P9U G;  2VQ2 A;  4Q96 A;  3DRA A;  5FWQ A;  3PRZ A;  1HF8 A;  3CK7 A;  5CHE E;  3W9F A;  5CRU A;  1FT1 A;  2AJA A;  3CVW A;  2IOL A;  1JWG A;  4CRW A;  2L0I A;  4HLL A;  4WAF A;  4J8D A;  2R59 A;  3J5P A;  3TWU A;  3RKV A;  3ML8 A;  3EHM A;  3DSW A;  3RSE G;  2EIJ E;  4CDR A;  3FP3 A;  3KSL A;  3ENE A;  2P9S G;  3Q75 A;  3RJV A;  3URZ A;  3UM1 A;  2V0P A;  4DI3 A;  5CEA A;  3SFZ A;  2RFA A;  2LUH A;  3SF4 A;  3ABK E;  3L16 A;  5BW8 C;  3U64 A;  4L9P A;  3FU3 A;  4K0R A;  3FUJ A;  1OWL A;  2EQX A;  3CHQ A;  4DX2 A;  1SZ9 A;  2IOS A;  1SA4 A;  1S0P A;  2I9C A;  3DXM G;  4XZ4 A;  4GCN A;  3Q4A B;  2P9N G;  3NQP A;  1EPU A;  1ZBP A;  4X8Q A;  4CDN A;  3CVN A;  4U8V D;  3ZIM A;  3ZGQ A;  4LG6 A;  5HS0 A;  4U0U A;  3PUJ A;  4LNU D;  2ZGG A;  2KZT B;  3L22 A;  2V5F A;  1N11 A;  3UI2 A;  1DVP A;  3AG3 E;  3ASF A;  3UTM A;  3PZ1 A;  5EN5 D;  2J08 A;  3QC1 A;  4GA1 A;  3LVQ E;  4WNG A;  4UWL A;  1P5Q A;  1N54 A;  5A6C A;  4DX1 A;  4D10 C;  2PQR A;  3FTY A;  1H2V C;  3QNK A;  4UQZ A;  1JUQ A;  3CLJ A;  4FU3 A;  5BUZ A;  3MKQ B;  4YDO A;  5CRV A;  3CVQ A;  4GA2 A;  4HLE A;  5D66 A;  2DCP A;  3LJ3 A;  1U3C A;  3FTX A;  2V8S E;  3AAA C;  3ZW3 A;  4OVU A;  1NP7 A;  5LCW J;  2J49 A;  3TWT A;  5FQ7 A;  3TWW A;  4DX5 D;  1TYQ G;  2XGM A;  4N3B A;  1SA5 A;  4JEH A;  3FTZ A;  3FUD A;  4JW1 A;  4XKB A;  1ELR A;  1KPS B;  4LNB A;  3UKU G;  1BI8 B;  1UN8 A;  3RU0 A;  1H6K A;  4HI8 A;  4JXT A;  2LAH A;  3CQC B;  3IHV A;  4LNG A;  4F53 A;  2X6H A;  3OXG A;  3D9M A;  4U8Y D;  2DBA A;  3AJI A;  3NZU A;  5JJT A;  2PQN A;  2UY1 B;  1IQR A;  1N4R A;  3I3N A;  1BPO A;  4AEZ C;  1OT8 A;  2VYI A;  5EYL A;  4GTT A;  4EBA A;  4WWN A;  1OWN A;  3CV0 A;  3P2B A;  5CCM A;  2VGX A;  4GA0 A;  4XKC A;  3SGH A;  5CCL A;  3FUF A;  3ZEF A;  3LPZ A;  1ZU2 A;  2JAB A;  3TJP A;  4HQD A;  4URK A;  4CDM A;  3RO2 A;  4NUR A;  5ENP D;  5B3S E;  4YDY A;  3G2S A;  1E8W A;  1K8K G;  1QQE A;  4E85 A;  3PE4 A;  4G11 A;  2WXJ A;  3V2O A;  4LER A;  4GTQ A;  4PDX A;  4AOF A;  1Y8M A;  4I1M A;  2IJG X;  5KNH D;  2IU1 A;  3HHM A;  2H6F A;  3ZYL A;  4WNF A;  1OWM A;  3APD A;  3JCK C;  3NB2 A;  3UT7 A;  5ANR A;  3V30 A;  4FP7 A;  4MRU A;  1JCS A;  2VSN A;  3I4G A;  4I43 A;  2WXM A;  3FH8 A;  2GRQ B;  2R05 A;  4FUL A;  5DBK A;  3RIB A;  3DST A;  2ETA A;  4FA6 A;  3SD5 A;  2XHE A;  3NF1 A;  3MCX A;  3BG0 B;  3CVX A;  2WXO A;  5G05 C;  2EIN E;  3JUE A;  4E6H A;  4H7X A;  1FVH A;  4GZC A;  3ZYQ A;  4Q69 A;  2X6I A;  2Y4T A;  5C1D A;  4GMR A;  3U9W A;  2R02 A;  1HG5 A;  4JHK A;  4AY6 A;  4KBQ A;  3GYZ A;  4L23 A;  3RRN B;  3T8M A;  4C48 B;  4U7E B;  3T9K A;  3Q49 B;  3AU5 A;  3C3R A;  1BD8 A;  3VLF A;  4AY5 A;  1S63 A;  1A17 A;  4HFG A;  2P58 C;  3FUL A;  5CBN A;  3UT4 A;  4BFR A;  4NRH B;  3PS6 A;  3L17 A;  4ACK A;  5CMY A;  1KZO A;  3FUE A;  3ZU7 B;  4GCO A;  2H6H A;  4B8A A;  2FBN A;  4PH4 B;  3O48 A;  4BET A;  3G2V A;  5AQ7 A;  4B94 A;  4ILI A;  2YNQ A;  2WXF A;  1OXJ A;  4JVS A;  3T8K A;  1E8X A;  3PZ3 A;  3Q7A A;  3CHP A;  1Q2Z A;  1QZ2 A;  2J4B A;  4L7T A;  2DWZ A;  4CCA A;  3CK9 A;  2XRZ A;  4AP2 A;  5AEN A;  1WAO 1;  4OAV B;  4CGW A;  5CBO A;  2XS1 A;  4ACL A;  1OCC E;  3HYM B;  2UY1 A;  2FUL A;  2MYO A;  4HBD A;  2WXH A;  1WM5 A;  3FH5 A;  2WQH A;  3Q15 A;  3CGH A;  1UN9 A;  3IV0 A;  2GRP B;  3ASO E;  2IO3 C;  3FU0 A;  4XE0 A;  3ASH A;  1TJF A;  3TL5 A;  4HOQ A;  5KWD A;  3OTN A;  2ION A;  1D8D A;  4Y6W A;  2WQ6 A;  3PRE A;  5ENQ D;  5KNG A;  1NL4 A;  4HNA D;  4O60 A;  1TNU A;  3ZKJ A;  1DCE A;  4WUY A;  2NSZ A;  4Z68 A;  5EDS A;  4TXQ A;  3CVP A;  3HXC A;  4JL0 A;  3HXF A;  3L08 A;  4WNE A;  2XZT G;  1N0R A;  4APO A;  4JD2 G;  4C0M A;  4HXI A;  2I6H A;  4OYS A;  5LCW C;  3ZYK A;  2OEV A;  4TRQ A;  3SQV A;  3TWR A;  1V54 E;  4ANX A;  2F0Y A;  1K1A A;  4UWK A;  3MKR A;  1ELK A;  2YQ8 A;  4GPK A;  1MQS A;  4EZK A;  4QQI A;  4N5C A;  5CEC B;  3TWS A;  3CKB A;  4LEU A;  2KCK A;  2PL2 A;  1KT1 A;  4N3C A;  4CGV A;  1N4Q A;  3APF A;  4HOT A;  4GTR A;  3ZVV A;  3MGB A;  4U63 A;  1IYG A;  1O1S A;  1PC2 A;  3N71 A;  3UIN C;  2CHW A;  2KAT A;  3ZPJ A;  1O5M A;  5BPP A;  3KEZ A;  5E76 A;  1NFI E;  2LSV A;  4A1G A;  4DRX E;  1N0Q A;  3S7D A;  3B13 A;  4FHK A;  3LKU A;  5EX3 A;  4HI9 A;  5BXO A;  3D9J A;  5KJL A;  2KCV A;  5EIL A;  5FQ8 A;  4YDE A;  2X3M A;  1PAQ A;  4BSX A;  2WM9 A;  3CR3 A;  3DSS A;  5J90 A;  5JJ7 A;  3FFL A;  1MJ0 A;  5EKQ D;  1H19 A;  5G2N A;  3SO8 A;  3SY2 A;  1JCQ A;  4AIF A;  3PDN A;  2AWI A;  3UPV A;  3KS2 A;  3AS8 A;  1S70 B;  1L5J A;  3PUK A;  2LAI A;  4OVV A;  2XRY A;  4GZ6 A;  1X81 A;  4J7W A;  3TG4 A;  4GTP A;  2WXP A;  3D9O A;  3VTY A;  3KD7 A;  3ABM E;  4PS7 A;  1KZP A;  1YYH A;  1O1T A;  3Q7F A;  3UM3 A;  5HRY A;  4FLH A;  1A5E A;  3VLE A;  3OXF A;  1LTX A;  3LVR E;  3ZRH A;  5JJ6 A;  1U3D A;  4ABN A;  3LJN A;  2LXM A;  2J4D A;  2WXG A;  2VGY A;  3FH7 A;  4MKT A;  1SZA A;  5G04 J;  3JXJ A;  2KC7 A;  3DSU A;  4IYP A;  4MS6 A;  2VSO E;  3HVE A;  3FTU A;  2GRM A;  2H6I A;  1LD7 A;  5ITZ F;  1BLX B;  3LXU X;  4C9B B;  4F1S A;  3O4Z A;  4J6I A;  2VTB A;  4WWP A;  2QZA A;  3F6Q A;  3SZ7 A;  2FO7 A;  3G2T A;  3J5Q B;  3QAR A;  4B8C B;  2HYZ A;  1E8Y A;  1TN7 A;  2WB2 A;  2XPI A;  3SNX A;  1RW2 A;  2XPZ A;  2VSY A;  5FZR A;  4BT9 A;  4G24 A;  3IXE A;  1UOH A;  2CFZ A;  2C0M A;  2B0O E;  3LEW A;  4DI4 A;  4UUC A;  1HS6 A;  4XEI G;  1FPP A;  4K5A B;  3S2A A;  1H0A A;  4CT0 A;  2R2L A;  3BQO A;  2HE0 A;  3ZYM A;  1MHQ A;  2X38 A;  1U2V G;  2OVB A;  1IQU A;  3QB2 A;  3ZXS A;  3E37 A;  4U0Z A;  1Z3Y A;  3TXN A;  3B7R L;  3CHS A;  5ENO D;  1NZN A;  2BKK B;  4JEU A;  4FHJ A;  4U0S A;  2BF0 X;  4ZHB A;  3D9N A;  5CMW A;  1K1B A;  3I5P A;  2NYJ A;  5FJY A;  4C0E A;  2AXZ A;  3CEQ A;  4LRZ A;  1TEZ A;  3CIA A;  2WQ7 A;  1UW4 B;  3FUN A;  4I1O B;  3FHE A;  1HZ4 A;  3UM0 A;  3NOC D;  5BNW A;  1TNB A;  3LDZ A;  3FU5 A;  4N2S A;  2HM8 A;  3PE3 A;  3HRA A;  5AJL A;  1BU9 A;  3MZL B;  3UUX A;  5FZS A;  3B7S A;  2JEK A;  3B7U X;  3UM2 A;  3AS4 A;  1XGW A;  2FEZ A;  5IY5 E;  3DPY A;  2IY0 C;  2P9L G;  4JA7 A;  5KJK A;  3IHY A;  3CVV A;  4K5C A;  3UIO C;  3ZFW A;  3ZHE B;  2CG3 A;  3MV3 B;  2KXP C;  4MLP A;  2OV8 A;  1D9S A;  1DC2 A;  1OCO E;  2ZU6 B;  3EDT B;  3R9A B;  2NC9 A;  4U95 D;  2XEE A;  2F37 A;  2Y3A A;  3PNT B;  2WVI A;  4G25 A;  3G2U A;  1JCR A;  3DEO A;  3KAE A;  5DIZ A;  4I6G A;  2R03 A;  4GZ5 A;  4M7C A;  1UG3 A;  2QFC A;  3SHF A;  1WDY A;  4BX8 A;  5ENT D;  2X6J A;  3TWX A;  1DNP A;  2KZT A;  5EX0 A;  3TXM A;  4EQF A;  5CED B;  2OEW A;  1ZB1 A;  1INZ A;  3DSX A;  4B0Z A;  4EZL A;  4KZC A;  4AJW A;  4GU5 A;  3B7B A;  3ABL E;  2AVP A;  2GW1 A;  1OUV A;  3CHR A;  1H6P A;  4RVB A;  3QKY A;  2PNN A;  4AM9 A;  3C98 A;  3MKQ A;  4GB9 A;  4UI9 J;  4EBA G;  3HG0 D;  4I2W A;  3JUI A;  3FEY A;  2J8S D;  1XNF A;  3R7R A;  3HXD A;  3CQG B;  5HQ8 A;  2P9P G;  4GTO A;  5FTP A;  1OY3 D;  4BTB A;  3OAW A;  3SFY A;  5AJD A;  3PEU B;  3Q5M A;  5JMN D;  3Q73 A;  3RRM B;  3CHM A;  4J8F A;  4RSY A;  4UWG A;  1NA0 A;  5EID A;  2GRR B;  2E0I A;  2FO1 E;  1BI7 B;  4IRU A;  5FQ6 A;  4BER A;  2IFU A;  5G55 A;  2XEV A;  2XGO A;  4I2Z A;  1FCH A;  4W9R A;  1HG2 A;  1H2U A;  4CYM D;  3FUM A;  3DPD A;  1HE8 A;  5AQB A;  3K9I A;  2CG2 A;  3FTS A;  5G04 C;  2EIK E;  4DLO A;  4IUL A;  4ZFH A;  3TGO A;  5D0O D;  3SBS A;  1K3Z D;  4UWH A;  4CT4 A;  2QC9 A;  3PZD A;  4N5Q A;  3VTX A;  3EHR A;  4ME2 A;  4HRM B;  4BSZ B;  3MA5 A;  2VJ8 A;  4J8S A;  5FIO A;  2E2E A;  3U3W A;  4KVO A;  2XEH A;  5AAO A;  4P29 A;  4I6E A;  1OCZ E;  4YND A;  2L6B A;  1NI1 A;  3FY4 A;  3B7T A;  3PH0 C;  3ZHE A;  1TN8 A;  4Y6C A;  2V5Q C;  4DX7 D;  4NAC A;  4LUN U;  3D9H A;  4FJZ A;  4I9E A;  5AQ9 A;  5HI7 A;  3V2X A;  2J9Q A;  4JZY A;  3HIZ A;  4BWR A;  4EHM A;  3LY7 A;  1QNF A;  3BUA A;  4FC8 A;  2XZD G;  3DXK G;  2GGF A;  3NZS A;  3GW4 A;  3B95 A;  3L82 A;  3ESL A;  3PVL A; 
#chains in the Genus database with same CATH homology
 2KC7 A;  4CDM A;  5KJN A;  3RO2 A;  4NUR A;  3E4B A;  2QY7 A;  4IYP A;  4MS6 A;  3G2S A;  3U4T A;  1ELW A;  1E8W A;  2X6K A;  1QQE A;  4DK5 A;  4ATG A;  2VSO E;  1HFA A;  4E85 A;  3CVY A;  4WWO A;  4N2Q A;  1E8Z A;  4G23 A;  1GW6 A;  4ANW A;  3GZS A;  3HVE A;  3PE4 A;  3FTU A;  4G11 A;  5C2Y A;  2WXJ A;  2GRM A;  2WMN A;  5BV1 A;  1OWP A;  4LER A;  4PDX A;  4AOF A;  1Y8M A;  2I1J A;  4I1M A;  2XQ0 A;  3IBE A;  3CHO A;  1LF8 A;  2WPV A;  2CHX A;  3LXU X;  5D0Q D;  2IJG X;  4HVB A;  4XX5 A;  4C9B B;  2IU1 A;  3HHM A;  5ARF A;  4LCT A;  1KLX A;  4F1S A;  3DBS A;  2OND A;  3O4Z A;  1X5B A;  3CVL A;  3LY9 A;  4KVM A;  3ZYL A;  4NQ0 A;  4J6I A;  2VTB A;  4H7Y A;  4WWP A;  4WNF A;  2JLB A;  1OWM A;  3SZ7 A;  5LP0 A;  2FO7 A;  3G2T A;  4RG9 A;  2YHE A;  2RG8 A;  3APD A;  3JCK C;  4G2V A;  4BY6 A;  3QAR A;  3CSF A;  2UWJ G;  4B8C B;  2HYZ A;  1E8Y A;  3CKC A;  3UT7 A;  2WB2 A;  5ANR A;  4FP7 A;  2XPI A;  4MRU A;  3S7F A;  3ML9 A;  3IEG A;  4GZ3 A;  2VSN A;  4GMJ A;  3SNX A;  3I4G A;  4I43 A;  2XPZ A;  2VSY A;  2WXM A;  1HH8 A;  2IF4 A;  2WXR A;  3FH8 A;  3PEV B;  5FZR A;  4ILG A;  4BT9 A;  4TV3 A;  3D9L A;  4G24 A;  5BT1 A;  4O6F A;  4N3A A;  3TG5 A;  4FUL A;  2CFZ A;  2C0M A;  3VLD A;  5DBK A;  2BUG A;  1NA3 A;  5ENN A;  3RIB A;  1E96 B;  1E7V A;  3LEW A;  4DI4 A;  1HS6 A;  2LO6 A;  4L1B A;  4GYY A;  3FWV A;  4GML A;  4PS3 A;  2PM7 A;  2VGX B;  5LX8 A;  1VDY A;  3D3M A;  3AU4 A;  5FQ4 A;  3SD5 A;  4FA6 A;  1OWO A;  2XHE A;  3NF1 A;  4XI0 A;  3S2A A;  1HXI A;  1FVF A;  1H0A A;  3QDN A;  4CT0 A;  3LY8 A;  4DPR A;  3MCX A;  3BG0 B;  4ILH B;  3CVX A;  3OXL A;  2WXO A;  5G05 C;  3FUH A;  4J0U A;  5T3R A;  4E6H A;  2IQC A;  2R17 C;  2ILR A;  4H7X A;  1FVH A;  4GZC A;  3EJN A;  3QAQ A;  1JPL A;  2RD0 A;  3ZYQ A;  3SBT B;  4Q69 A;  2X6I A;  3ZYM A;  2Y4T A;  2A4Z A;  1MHQ A;  2X38 A;  2OVB A;  3HDX A;  4XI9 A;  3QWV A;  1IQU A;  3QB2 A;  3ZXS A;  3AS5 A;  3RK6 A;  3HVE B;  3QWP A;  2WXK A;  3QOU A;  3U9W A;  5C1D A;  4G1T A;  4U0Z A;  4BT8 A;  3ONK A;  4U04 A;  1Z3Y A;  1HG5 A;  4JHK A;  5JHB A;  3TXN A;  4AY6 A;  2MHK A;  4KBQ A;  3B7R L;  3T5V A;  3CHS A;  1NZN A;  4BTA A;  3WXX A;  3GYZ A;  4JEU A;  2L6J A;  2LSU A;  3L6A A;  3FUI A;  4L23 A;  4FHJ A;  4U0S A;  3RRN B;  2AXV A;  3T8M A;  1EF1 C;  3L54 A;  4HOU A;  4KXK B;  4M3O A;  3T5X A;  4FAD A;  2BF0 X;  2PM6 A;  3MYV A;  4JA9 A;  5A23 A;  3RO3 A;  4I9C A;  3D9N A;  5CMW A;  3Q49 B;  1HX8 A;  2WXL A;  4EPZ A;  3AU5 A;  4ANV A;  1UJJ A;  3I5P A;  5FJY A;  4C0E A;  2AXZ A;  2VTB B;  3CEQ A;  4LRZ A;  3VLF A;  4AY5 A;  2MRI A;  3S7B A;  1TEZ A;  3CIA A;  1A17 A;  3GZ2 A;  4HOS A;  1YA0 A;  4HFG A;  3UMV A;  2P58 C;  2WQ7 A;  3FUL A;  5FZQ A;  2Q7F A;  1UW4 B;  5T4Y A;  3FUN A;  2KM4 A;  3UQ3 A;  3UT4 A;  4BFR A;  3CVU A;  3FEX A;  3IKO B;  3FHE A;  4GZD A;  3PNL B;  4I1O B;  4L2L A;  4UQX A;  1HZ4 A;  4JHJ A;  4F7A A;  2I2O A;  4NRH B;  3PS6 A;  1E90 A;  3L17 A;  4R7L A;  3LDZ A;  3TAX A;  4ACK A;  4AV7 A;  5BNW A;  2KCL A;  5CMY A;  3FU5 A;  3JYS A;  2HM8 A;  4N2S A;  3FUE A;  5E75 A;  2LNI A;  2WMO A;  3PE3 A;  4GCO A;  2L9B A;  5AJL A;  4KMO A;  4HOR A;  5M72 A;  4B8A A;  2FBN A;  4PH4 B;  3Q47 B;  5KCM A;  3O48 A;  3MZL B;  2I1K A;  3UUX A;  1PY1 A;  5FZS A;  3EIJ A;  3G2V A;  4DJA A;  3B7S A;  4B94 A;  4ILI A;  2JEK A;  2YNQ A;  2WXF A;  2R5S A;  3B7U X;  1Z3X A;  3ASD A;  4JVS A;  4UQY A;  3AS4 A;  4UI9 K;  1XGW A;  2L0T B;  3FU6 A;  4PUC A;  5BV0 A;  1E8X A;  4YVQ C;  2FEZ A;  4JPS A;  5KJM A;  4TUU A;  2BTD A;  3CHP A;  5ARG A;  4A55 A;  4BX9 A;  4JA7 A;  2X6F A;  2YIN A;  4UI9 C;  1QZ2 A;  5KJK A;  2J4B A;  2AXU A;  4L7T A;  3L13 A;  4N39 A;  4CCA A;  3CK9 A;  3IHY A;  4AP2 A;  3CVV A;  2XRZ A;  5G05 J;  5AEN A;  1WAO 1;  2XCB A;  3ZFW A;  3P1U A;  2M63 A;  3FTV A;  4CGW A;  3ZHE B;  4ACL A;  3CK8 A;  2CG3 A;  2YHC A;  3MV3 B;  2CFU A;  4F3V A;  3CST A;  2C2L A;  4MLP A;  4U8H A;  1EDU A;  1EYH A;  4IN3 B;  1Y6I A;  3HYM B;  2OV8 A;  4XIF A;  2UY1 A;  2FUL A;  2ZU6 B;  3MEK A;  2MOW A;  3EDT B;  2WXH A;  3BG1 B;  4JHR A;  3R9A B;  2FF4 A;  2NC9 A;  3FTW A;  1W3B A;  1WM5 A;  2OOE A;  4L2Y A;  1SQM A;  3EIQ C;  3FH5 A;  2WQH A;  2Y3A A;  4GYW A;  3PNT B;  3Q15 A;  2WVI A;  4G25 A;  4FJY A;  3G2U A;  3SI5 A;  3CGH A;  4I6J A;  1UN9 A;  4UWF A;  2VQ2 A;  4Q96 A;  3IV0 A;  5FWQ A;  2XGS A;  3KAE A;  3PRZ A;  1HF8 A;  3CK7 A;  4GZ5 A;  4I6G A;  1UG3 A;  2QFC A;  5DIZ A;  3FU0 A;  4XE0 A;  3ASH A;  3SHF A;  5CHE E;  1TJF A;  4BX8 A;  3CVW A;  2IOL A;  2X6J A;  4KYO B;  3TL5 A;  1DNP A;  2KZT A;  1JWG A;  4HOQ A;  3OTN A;  3QK0 A;  5EX0 A;  3TXM A;  4CRW A;  2L0I A;  2ION A;  4EQF A;  2J07 A;  4WAF A;  4Y6W A;  2WQ6 A;  2WXI A;  3PRE A;  4J8D A;  2R59 A;  4A3T A;  3I4R B;  2C0L A;  3RKV A;  1INZ A;  3ML8 A;  3EHM A;  4WUY A;  2NSZ A;  4B0Z A;  4V3I A;  3FUK A;  4CDR A;  4EZL A;  5EDS A;  3FP3 A;  4KZC A;  4AJW A;  4GU5 A;  3CVP A;  1HU3 A;  3LS8 A;  2HO1 A;  4JL0 A;  2AVP A;  2GW1 A;  1OUV A;  3CHR A;  3TJP A;  4RVB A;  3ENE A;  3QWW A;  3D9I A;  4B89 A;  1WY6 A;  3QKY A;  3RJV A;  1E7U A;  3L08 A;  3URZ A;  2V0P A;  4WNE A;  4DI3 A;  4AM9 A;  3C98 A;  4APO A;  3SFZ A;  4C0M A;  2VSX E;  3MKQ A;  4HXI A;  2I6H A;  4GB9 A;  3L16 A;  4OYS A;  5BW8 C;  3SF4 A;  3U64 A;  3S7J A;  1TJC A;  4Q94 A;  5LCW C;  3ZYK A;  4FLB A;  4TRQ A;  1Z6T A;  4KT6 B;  3FU3 A;  4K0R A;  3FDH A;  4UI9 J;  3APC A;  4ANX A;  3FUJ A;  4A3V A;  4EBA G;  1OWL A;  5T8I A;  2EQX A;  4UWK A;  3MKR A;  3CHQ A;  2CHZ A;  1ELK A;  1JWF A;  2YQ8 A;  4YVO A;  3RRU A;  1SZ9 A;  2IOS A;  4I2W A;  3JUI A;  4GPK A;  1MQS A;  1S0P A;  2I9C A;  3FEY A;  4EZK A;  4XZ4 A;  4GCN A;  4JC8 A;  4N5C A;  1XNF A;  3Q4A B;  3R7R A;  3CKB A;  4LEU A;  3NQP A;  5AIJ A;  1EPU A;  5LOZ A;  1ZBP A;  2KCK A;  3CQG B;  4CDN A;  5HQ8 A;  3CVN A;  2PL2 A;  1KT1 A;  4N3C A;  4CGV A;  1H2T C;  3ZIM A;  3ZGQ A;  3APF A;  5FTP A;  4HOT A;  4U0U A;  4BTB A;  2A5U A;  3MGB A;  3ZVV A;  3D9P A;  4AXH A;  3OAW A;  3PUJ A;  4WND A;  4U63 A;  1IYG A;  3BEE A;  2KZT B;  1N52 A;  5AJD A;  3PEU B;  3Q5M A;  1PC2 A;  3N71 A;  3L22 A;  3RRM B;  2CHW A;  2KAT A;  2V5F A;  3CHM A;  4J8F A;  1DVP A;  3ZPJ A;  4RSY A;  4UWG A;  1NA0 A;  3ASF A;  5BPP A;  2E0I A;  3KEZ A;  4QFV A;  5E76 A;  2J08 A;  3QC1 A;  4GA1 A;  3LVQ E;  4J8E A;  4WNG A;  4UWL A;  1P5Q A;  2LSV A;  4IRU A;  2HR2 A;  5FQ6 A;  4A1G A;  2IFU A;  1N54 A;  5A6C A;  5G55 A;  2XEV A;  2XGO A;  4I2Z A;  1FCH A;  4D10 C;  2PQR A;  3FTY A;  4PS8 A;  4W9R A;  1HG2 A;  3S7D A;  3B13 A;  1H2U A;  1H2V C;  3QNK A;  3ULQ A;  3ZN3 A;  4UQZ A;  4FHK A;  5J08 A;  3JQ0 A;  1JUQ A;  3CLJ A;  3FUM A;  4FU3 A;  3UX4 A;  4DLQ A;  4A1S A;  2AW6 A;  3DPD A;  5BUZ A;  3LKU A;  3MKQ B;  1HE8 A;  3K9I A;  2CG2 A;  3CVQ A;  3FTS A;  4GA2 A;  5EX3 A;  5G04 C;  4HLE A;  3ONL A;  3D9J A;  5KJL A;  2FI7 A;  3QJZ A;  4GAA A;  4DLO A;  2DCP A;  3LJ3 A;  2KCV A;  1U3C A;  4GYO A;  1HO8 A;  4IUL A;  1B89 A;  3FTX A;  4I1A A;  2V8S E;  5FQ8 A;  4KZ0 A;  3TGO A;  3ZW3 A;  2X3M A;  1PAQ A;  4AVX A;  5ANL A;  3ESK A;  4BSX A;  4OVU A;  2WM9 A;  5D0O D;  3CR3 A;  1NP7 A;  5LCW J;  5J90 A;  3SBS A;  5JJ7 A;  2J49 A;  4ANU A;  3FFL A;  5EKQ D;  1H19 A;  5G2N A;  5FQ7 A;  4UWH A;  3LYA A;  2WXQ A;  3LCA A;  4AIF A;  2XGM A;  3D9K A;  2OVF A;  3PDN A;  4CT4 A;  2DIW A;  2AWI A;  4N3B A;  3UPV A;  4JEH A;  3R7Q A;  3FTZ A;  3FUD A;  4JW1 A;  3KS2 A;  3PZD A;  4CEM A;  3AS8 A;  4XKB A;  3VTX A;  1ELR A;  3JQ1 A;  4I17 A;  4ME2 A;  3MA5 A;  5AYW D;  1L5J A;  3PUK A;  2LAI A;  4OVV A;  2VJ8 A;  2XRY A;  4J8S A;  1UN8 A;  3RU0 A;  2E2E A;  1UJK A;  1H6K A;  4KVO A;  3U3W A;  4P29 A;  4I6E A;  4G26 A;  4JXT A;  2LAH A;  3CQC B;  4GZ6 A;  3GZ1 A;  4YND A;  4APF A;  3IHV A;  3FY4 A;  3TG4 A;  2X6H A;  4F53 A;  2J09 A;  5A7D B;  2WXP A;  3B7T A;  3D9O A;  2XPY A;  3D9M A;  3OXG A;  3VTY A;  2XCC A;  2GRL A;  3PH0 C;  2DBA A;  3ZHE A;  3NZU A;  5JJT A;  3KD7 A;  3MX3 A;  4Y6C A;  4PS7 A;  1KT0 A;  4K03 A;  2PQN A;  2UY1 B;  3EHN A;  4NAC A;  4RG6 A;  3ASG A;  1IQR A;  4LUN U;  3I3N A;  5LFA A;  3G2W A;  1BPO A;  4FJZ A;  4AEZ C;  4I9E A;  4FLH A;  3UT8 A;  3MJW A;  3VLE A;  2VYI A;  5HI7 A;  5JHA A;  3OXF A;  2J9Q A;  3LVR E;  4JZY A;  4EBA A;  3U66 A;  4EZJ A;  3HIZ A;  3ZRH A;  4BWR A;  4WWN A;  1OWN A;  5JJ6 A;  4U07 A;  3CV0 A;  1IHG A;  1U3D A;  2Y4U A;  5FT9 A;  3LY7 A;  4ABN A;  1QNF A;  2WXN A;  4FC8 A;  2V4L A;  3P2B A;  5CCM A;  2VGX A;  4GA0 A;  4XKC A;  3SGH A;  2J4D A;  2NXP A;  2WXG A;  3MV2 B;  2VGY A;  2GGF A;  5CCL A;  3FH7 A;  3FUF A;  3NZS A;  4HS2 A;  2PZI A;  3GW4 A;  1SZA A;  3LPZ A;  4MKT A;  5G04 J;  3ZEF A;  4EEC A;  1ZU2 A;  3ESL A;  3PVL A;  4URK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...