2L6JA

Tah1 complexed by meevd
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of minimal tetratricopeptide repeat domain protein Tah1 reveals mechanism of its interaction with Pih1 and Hsp90.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords TPR repeat-containing protein associated with Hsp90
total genus 32
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2l6jA00
4GZ3A 2PL2A 5KJMA 4A1SA 2FO7A 3FFLA 4J0UA 3BEEA 5EX0A 4HOQA 3FP3A 2R5SA 3ZN3A 5LCWC 1KT1A 4I9EA 2YQ8A 4UQYA 1IYGA 2C0LA 3Q15A 1OUVA 3CK7A 2IF4A 5ARFA 4HOTA 3Q47B 1ZU2A 3AS8A 3CVLA 1TJCA 4NRHB 5JJ6A 4LEUA 4GA2A 3QKYA 1A17A 4KBQA 2NC9A 4BT8A 4N2SA 2Y4TA 3TG4A 2BUGA 5CHEE 4AY5A 1P5QA 4GYWA 3ULQA 4BTBA 4GCOA 4U0SA 4NQ0A 5FT9A 5BW8C 5KJNA 2XGSA 2XGOA 3QDNA 4HOUA 3RU0A 1E96B 1HH8A 2PZIA 3ASHA 4RG9A 5G04J 3CKBA 4N2QA 2E2EA 2ONDA 3HYMB 4G2VA 3QWWA 5KJLA 4GZ6A 3ZFWA 4G26A 3FWVA 4J8DA 5LCWJ 5G05J 1ELRA 3KD7A 5D0OD 3O48A 2VYIA 3ZHEA 3OXLA 1IHGA 5DIZA 2FBNA 3RO2A 4O6FA 3MV2B 3CK8A 2HO1A 4XI9A 5BT1A 4GCNA 3CK9A 2P58C 3E4BA 4RG6A 5EX3A 3TAXA 3ZPJA 3PE3A 5CCLA 5KJKA 5DBKA 3IEGA 5AYWD 4JHRA 4U04A 4U0UA 5FZRA 3QWVA 5G05C 3ESKA 4WNEA 2KCLA 4AY6A 3RKVA 1WM5A 3MEKA 4J8EA 3TG5A 4UI9J 2VGXA 1WAO1 3CKCA 3KAEA 3PDNA 5ARGA 3ZGQA 4H7XA 4APOA 5JJ7A 3CVNA 1Y8MA 3EDTB 5HI7A 5A6CA 1NA0A 5FJYA 4BT9A 4YVQC 3VTXA 2YHCA 4N39A 3ASGA 4N3AA 4CDRA 3S7FA 2XCBA 4UI9K 4G24A 4ME2A 5G04C 2J9QA 3SF4A 1KT0A 4G25A 2KC7A 4UI9C 4F3VA 4GA0A 1QZ2A 3TGOA 4HOSA 3CEQA 2VSYA 3ASFA 4WUYA 2XPIA 4YVOA 3AS5A 2FEZA 1HXIA 2UY1A 3CVPA 2LNIA 2QFCA 4GZ5A 1KLXA 3MA5A 4W9RA 3RJVA 2Y4UA 1QQEA 2VGXB 3ASDA 4ABNA 3CV0A 4YNDA 3S7BA 5D0QD 3URZA 3RO3A 2LSVA 1NZNA 3LY9A 3UUXA 1W3BA 3LY8A 4BWRA 4WNDA 3QWPA 3S7DA 1XNFA 1ELWA 3S7JA 4G1TA 1B89A 3N71A 4I1AA 3RIBA 4AM9A 2WPVA 5CCMA 3LCAA 3MV3B 3Q4AB 4JA9A 2KATA 3U4TA 5C1DA 2I6HA 4N3CA 2UWJG 3ZHEB 1HZ4A 3OXFA 2FI7A 5A7DB 4JL0A 2GW1A 2Q7FA 2KCVA 4U07A 4I2ZA 4GYOA 3OXGA 4WNFA 2XEVA 2WQHA 4UQXA 1FCHA 5HQ8A 3UQ3A 5BNWA 4XIFA 3SZ7A 2XCCA 3PE4A 3GZ2A 3R9AB 3U3WA 4GA1A 4CGWA 2LSUA 4UQZA 3LPZA 2VQ2A 2AVPA 2DBAA 4EQFA 1ZBPA 4I17A 3WXXA 5M72A 4WNGA 4BTAA 4GYYA 3GZ1A 3MKRA 3CVQA 2C2LA 3Q49B 4KYOB 4GPKA 2PQRA 2V5FA 1YA0A 4J8FA 4IN3B 4G23A 4XI0A 3AS4A 4JA7A 4N5CA 3K9IA 3Q5MA 3LYAA 2C0MA 2L6JA 3KS2A 1PC2A 4H7YA 5FZSA 2OOEA 3UPVA 4Y6WA 3GYZA 2HYZA 4HORA 2VGYA 5FZQA 4AIFA 2UY1B 3LY7A 2XGMA 5FTPA 4CGVA 4U0ZA 2HR2A 3LKUA 2FF4A 4I9CA 4B94A 2IFUA 2MHKA 2KCKA 2PQNA 3GW4A 3NF1A 3JYSA 3QOUA 4KXKB 4N3BA 5EKQD 4I2WA 3VTYA 5JJTA 4Y6CA 1NA3A 2VSNA 2JLBA
chains in the Genus database with same CATH superfamily
1S63A 3FFLA 3BEEA 2IOLA 2AXZA 3B13A 3OTNA 3UT4A 4KMOA 1Y6IA 4URKA 4HOTA 3TL5A 5AN8A 4Q96A 1TJFA 1PAQA 4A1GA 1P5QA 4U63A 5AQ9A 4RG9A 5G04J 1H6OA 1WY6A 4I6GA 4UWKA 3B7SA 4YDWA 3PNTB 4PUCA 3DPDA 2WXHA 5CERB 2WXFA 5BT1A 3LEWA 4U8VD 2F37A 2I2OA 2X6JA 2ZGGA 1PY1A 1O1SA 4BX8A 3EDTB 3FULA 4UUCA 4LRZA 4HBDA 2XQ0A 3V2OA 3P2BA 4GZ5A 5KNHD 4YNDA 3S7BA 3RO3A 1W3BA 4B89A 3ASNE 5C1DA 1QYMA 2V8SE 1O1RA 3OXGA 1FVHA 3UQ3A 2XCCA 4CGWA 4NIKA 2YHEA 3RSEG 1RZ4A 1JUQA 3CVQA 4JPSA 4MKTA 2NSZA 5CEAA 5JHBA 4L9PA 2UY1B 4U0ZA 2HR2A 4OVUA 2PQNA 4Y6CA 3FP3A 3HG0D 4MLPA 5JHAA 2C0LA 1E7VA 5JJ6A 4LEUA 3V31A 1BI8B 4KBQA 1SA4A 4BTBA 4XX5A 3HXEA 3L22A 4N2QA 5KJLA 1ELRA 2IEJA 3MZLB 5EX3A 2J09A 4OVVA 3MEKA 4HB5A 4WWNA 4AEZC 3ZRHA 1Y8MA 5A6CA 2VSOE 1KZPA 1QZ2A 2L6BA 3ULYA 3TWVA 3PUKA 1UW4B 1E8WA 4J8SA 1ELKA 2V0PA 3UUXA 1DC2A 1NZNA 2H6FA 4PS8A 3FUIA 3UKRG 4G1TA 4I1AA 4UWGA 4JA9A 2KATA 2I6HA 2VTBB 3SBTB 2AWIA 3FUKA 1E8ZA 5JMND 3PUJA 3NAWA 2E0IA 1N4RA 2Y69E 4ZHBA 2XPYA 5LX8A 1YA0A 5ENQD 2P9KG 2OCCE 1SVXA 3VLDA 3FEXA 3SNXA 4GZ3A 1N0RA 4A1SA 1YMPA 2R5SA 3EHNA 2IF4A 1XGWA 1BD8A 5BPPA 2GROB 2XEHA 1LD7A 4XE0A 3C98A 3JXIA 3IXEA 1JCQA 3ZFWA 3C3QA 3KD7A 4YDYA 2VYIA 3RO2A 5AJLA 3E4BA 4CT4A 5KJKA 3BG1B 5FZRA 4AVXA 2OEVA 4APOA 1N54A 4C0MA 3U9WA 4UWHA 3FTWA 4CDRA 3SF4A 1KT0A 5LP0A 1H2TC 4YDOA 5EYLA 2WQ7A 3D9NA 3VLFA 3L6AA 4WNDA 3N71A 4CCAA 2I1JA 4M7CA 4R7LA 4U8HA 2Q7FA 2QYUA 2F0YA 2QY7A 5FIOA 3PZ3A 3LPZA 2XS1A 3HXCA 4GTVA 2QYJA 2XZDG 3FUDA 3QC1A 5JA4D 3FDHA 3LYAA 3Q5MA 3L08A 3D9KA 2VGYA 4DPRA 3PVLA 5AQBA 4HRMB 3CK7A 3NBNB 5ANLA 1IYGA 4I9EA 2VSXE 3D9JA 5G55A 4PS3A 2WXNA 4DJAA 5CHEE 5FT9A 1SZ9A 4G11A 3ASHA 2ONDA 2IOSA 4TXPA 3FU6A 1JPLA 5HRYA 1BU9A 1WDYA 2DZNA 1UJKA 2FBNA 4XI9A 3KEZA 4KZ0A 3VLEA 2AXVA 3PE3A 2PM6A 3HRAA 1OCOE 2P9NG 3UIPC 1D8EA 1V55E 1DVPA 4N39A 4BERA 4JXTA 2WXIA 3UKUG 4GTTA 4YVOA 2L9BA 4J8YA 3FH7A 3RRUA 1Z3YA 4ABNA 3LY8A 3S7JA 4PS7A 4OYSA 1Z5SC 2P9SG 2KZTA 4DRXE 1N4PA 3I4GA 4GTMA 3TXNA 4WNFA 4UQXA 2IO3C 2EINE 3GZ2A 4DUIA 1HF8A 2J08A 2DBAA 4HI8A 3D9HA 3DPYA 2C2LA 1H0AA 2F8YA 3G2SA 4JHJA 4H7YA 4RQIA 2CFZA 1U2VG 3P1UA 3LXUX 4GTOA 2MHKA 3T5XA 2A4ZA 4FU3A 3AS8A 4O60A 3E37A 4BT8A 4ANVA 4GU5A 2DYRE 2WM9A 4BY6A 1E96B 1HH8A 5BV1A 5CMYA 2J8SD 3L16A 4BSZB 5H7PA 5CBNA 4MBGA 1D9SA 2R02A 4LSZE 5DBKA 4ANXA 4DX6D 4WNEA 5EYPF 2AW6A 4J8EA 4UI9J 1TNBA 4H7XA 3B7UX 3JQ0A 5HI7A 2GRLA 3PREA 3ASGA 4DX7D 1WG0A 2WXQA 1N95A 1UN9A 3CR3A 3PS6A 3DSTA 3CEQA 5ENOD 3ULEG 1FVFA 2FULA 1MJ0A 3R7RA 1OCRE 4HXIA 3LY9A 3SFZA 5CMWA 3BUAA 1N52A 2MOWA 4N3CA 2CHWA 3ZEFA 3W9FA 2X38A 4JL0A 2KCVA 4Q69A 3TWUA 3RK6A 1O1TA 2XS8A 2RFAA 2VGEA 4GYYA 5FQ4A 2V5FA 2OVFA 4N5CA 4PDXA 3UPVA 1NL4A 4I6JA 2HYZA 3QJZA 3ML8A 4TXQA 5D2MC 2KCKA 4K0RA 4GTSA 5KJMA 3FUHA 2WXKA 3O4ZA 3Q9NC 4L2YA 4F1SA 1FT2A 2LUHA 3HHMA 1S70B 1HS6A 4U0SA 1FT1A 2XGOA 2QC9A 2GRMA 2XRYA 3U66A 4CDMA 4GZ6A 1SZAA 3EHMA 3SI5A 1K1AA 2LO6A 1TEZA 5AYWD 2KCLA 2H6IA 2M63A 3APDA 3MKQA 1WM5A 4AY6A 3IHYA 2RD0A 4GAAA 5B3SE 3Q79A 5EN5D 1H2VC 4N3AA 1KZOA 1MX4A 4G24A 3NQPA 2V5QC 3TGOA 4B0ZA 2FEZA 4JHKA 1KLXA 2GRNB 4LNBA 4A55A 5D0QD 4EZLA 3IKOB 3UM2A 1TNOA 2LXMA 3QNKA 4HFGA 2XRZA 4G8LA 3ZXSA 3LCAA 2R03A 3ZYQA 3UM0A 5CRUA 4GYOA 4Z68A 5CECB 3Q75A 3MYVA 4IYPA 3IBEA 3T5VA 1ZBPA 4UWFA 3CHSA 5FQ8A 2A5EA 1O5MA 1TN8A 3JUEA 1ZB1A 2L6JA 2IU1A 2CG2A 4Y6WA 1JCSA 4HORA 3PZ4A 4KXKB 2J4DA 4JEUA 2B0OE 2JLBA 4A3VA 4AOFA 2FO7A 4D10C 5EX0A 5LCWC 2DWZA 4MRUA 4FC8A 2L0TB 2EIJE 1TR4A 3TG4A 4GYWA 1N4QA 2XGSA 2ZU6B 2E2EA 4KVOA 4DLOA 2OV8A 3MX3A 1NP7A 4TUUA 2WVIA 3AG3E 3FU5A 5CCLA 4HVBA 2IO2C 3ESLA 5G05C 3R9MA 3RKVA 5JJ7A 4LUNU 5HS0A 3HIZA 1IQRA 5KWDA 4YVQC 5A23A 4UI9K 3FUEA 1EYHA 4ATZD 4GTPA 4LERA 4QQIA 3NB2A 3PNLB 3RJVA 3JXJA 2VGXB 3SQVA 1ELWA 4HNAD 2ZISA 1OCZE 2PNNA 5B1BE 2P9UG 3CHMA 3B95A 1Z3XA 3PZ2A 4GMRA 3UMVA 5HQ8A 3AG2E 5BNWA 4JVSA 4UQZA 3U64A 4M3OA 4GPKA 2EQXA 3UM1A 2X6FA 3DSSA 3DBSA 4OAUC 4DX5D 3Q73A 4DX1A 5G2NA 1NA3A 3DSWA 5EIBE 4J0UA 3ZN3A 1UOHA 1V54E 3ZYKA 2Y4TA 3UTMA 3ULQA 4RLYA 1OCCE 4ACLA 4TRQA 4G2VA 3L13A 3ZHEA 4IULA 4GCNA 3CK9A 4RG6A 3EIJA 3EIQC 2F8XK 1E90A 3AG4E 3C72A 4G8KA 4BSXA 2J9QA 2NXPA 4XZ4A 4WWOA 4YDEA 1Z6TA 5LFAA 3CVPA 3CVWA 3LVQE 4W9RA 4PH4B 3ZYLA 2EILE 2I9CA 3QAQA 3UM3A 1S64A 3Q4AB 3U4TA 5HKPA 3EHRA 3DEPA 2WXMA 1HO8A 1N0QA 2XHEA 2XEVA 5ENPD 3PE4A 3FTSA 4EQFA 1X5BA 4U95D 5M72A 3FU0A 3PZ1A 4HS2A 3CGHA 3AS4A 2GRRB 1UJJA 2RFMA 3HVEB 3JYSA 4K5AB 1MQSA 1OXJA 3NOCD 5FQ7A 1JCRA 2R59A 1ZU2A 3HXBA 1BI7B 2YINA 4N2SA 2BUGA 3PZDA 3C3RA 1YYHA 3AJIA 4J8DA 5LCWJ 5D0OD 2A5UA 2KZTB 4N5QA 3D9OA 3FUNA 4HRLA 4JZYA 3TG5A 3CVNA 4ME2A 4CZ2D 4HOSA 4WUYA 4B93B 3ZIMA 2XENA 3FTXA 3CIAA 4NACA 1BLXB 4TUMA 4P29A 4HI9A 3S7DA 4ANUA 3CSFA 3ZXPA 2WXPA 3MV3B 4EZJA 2UWJG 3T8KA 4ATGA 5A7DB 5FWQA 1E8YA 4XIFA 2J4BA 2OVBA 3OAWA 3G2WA 4WNGA 3ONLA 2P9PG 3MKRA 2X6KA 4A3TA 3UT7A 4NURA 2C0MA 3SFXA 5ITZF 3DSUA 2XGMA 5FTPA 4LNUD 3Q7AA 3MCXA 2RKKA 4HOQA 3I4RB 2L0IA 4I6EA 2ILRA 4NRHB 3NZUA 3I3NA 1A17A 2NC9A 4AY5A 4ANWA 3QARA 4HOUA 3JCKC 3HYMB 3FTVA 4EBAA 3FWVA 3T8MA 4EZKA 3WG7E 2BEDA 2P58C 2XPZA 3ZPJA 5BUZA 5CBOA 4JHRA 4GTRA 3ESKA 4F1PA 3DSXA 5LOZA 3NZSA 3ONKA 3KAEA 3PDNA 5ARGA 2X3MA 3FUFA 2NYJA 2WXGA 1E8XA 2MRIA 1EPUA 3LVRE 2V4LA 1MYOA 3FH5A 3LJ3A 4AXHA 3KEAA 3V2XA 3CQGB 3AU5A 1EF1C 2BKGA 1X81A 1HZ4A 2GW1A 1IXVA 3QK0A 3SBSA 1FCHA 4GA1A 2LSUA 3HXDA 2IQCA 4GZCA 2GRPB 3FU3A 1H6PA 3ABKE 3KS2A 1PC2A 3LS8A 1K3ZD 3GYZA 3APCA 4ZFHA 2IFUA 1OWOA 3QOUA 3EJNA 2BF0X 1KT1A 4UQYA 3EU9A 3FEYA 3CVVA 2DYSE 5ENRD 2Y0BG 3AU4A 4GCOA 3KSQA 5BW8C 1N4SA 1HX8A 4F7AA 4QFVA 4HRNA 2WMOA 2AJAA 4O6FA 2HO1A 4XKCA 5ENTD 3CHPA 3J5PA 2IY0C 3CVUA 3QB2A 1MX6A 1JWGA 5E76A 1KPSB 4DK5A 1HFAA 2EIKE 3S7FA 3BQOA 5CRVA 4C48B 2KC7A 4GA0A 3FHEA 3AS5A 2J07A 2XZTG 4E85A 1U3DA 1S0PA 4AM9A 3EU5A 1AP7A 3I5PA 3BU8A 3JQ1A 2H6HA 4FHKA 5ENSD 3ZYMA 3U3WA 3D9PA 3G2UA 4LCTA 3RRMB 4CDNA 5J08A 2RG8A 4O1OA 4K03A 2KBXA 2X6IA 5FZSA 4U8YD 4B8CB 3F6QA 2HE0A 3GW4A 4N3BA 4BFRA 3VTYA 5JJTA 4BETA 5AAOA 2KM4A 4JC8A 4FHJA 5AENA 3Q15A 3RAUA 5ARFA 5FQ6A 3QKYA 3HXFA 3PEUB 3MJWA 2PZIA 4L1BA 2CFUA 4TXRA 2P9IG 5T8IA 3CVXA 3L82A 3R7QA 1WAO1 4EPZA 4J6IA 3L17A 5EILA 4BT9A 1IHBA 1AWCB 3V30A 2J49A 3FH8A 4LG6A 5ENNA 2LNIA 4AJWA 1TNUA 1INZA 2FO1E 3CHOA 1LD8A 3D9MA 2DIWA 4FJZA 3FTZA 3B7TA 3ZHEB 3OXFA 2FI7A 1HG5A 1SQMA 2WXOA 4C9BB 3ABLE 4UWLA 2AVPA 1L5JA 4BEPA 4I17A 2AXUA 4WAFA 4IRUA 3GZ1A 2PQRA 2CHXA 2GRQB 3ZKJA 2Y3AA 5FINA 3LKUA 3TWQA 4MS6A 1IKND 2WXRA 5DIZA 2IONA 1Q2ZA 2V4HC 4GMLA 4WWPA 3CVLA 4FLBA 4GA2A 3D9IA 4I1MA 4NQ0A 1LF8A 2ZIRA 3UT8A 4BESA 3JUIA 3EUVA 2I1KA 5AIJA 4KVMA 3CLJA 1BPOA 2VGXA 3TWTA 5B1AE 4B8AA 3VTXA 2YHCA 3E34A 3RRNB 1G3NB 4UI9C 3L9TA 2WMNA 3D3MA 4J7WA 2WQ6A 1FPPA 3GZSA 3URZA 2PM7A 3DSVA 3ASOE 5CCMA 3RIBA 2P2CP 2EIME 1K1BA 3TWXA 1EDUA 1TYQG 5CEDB 4ILGA 3S2AA 1LTXA 2KXPC 2VQ2A 4BTAA 4DI3A 4J8FA 4G23A 3LJNA 4GPMA 3DWLG 3MGBA 3APFA 5FZQA 3SD5A 2ETCA 3E33A 3ABME 4B94A 3NF1A 4K5BA 4I1OB 4RSYA 4EHMA 3FTUA 2BKKB 2JEKA 2YQ8A 3TWWA 1OUVA 5BXUA 1N9AA 1H2UA 4XKBA 3Q7FA 4CRWA 3B7RL 1DNPA 5BXOA 2LAHA 1GW6A 2DVWA 4G26A 3O48A 4HLLA 3OXLA 2VTBA 4HQDA 3SHFA 3CK8A 2WB2A 1OWNA 3TAXA 3ZU7B 5IY5E 3IEGA 5ANRA 5BV0A 3QWVA 3C3OA 1SA5A 3ZGQA 3CVYA 1IQUA 2LXLA 4JEHA 1NA0A 5FJYA 1N94A 4XEIG 3DXKG 4E6HA 2CHZA 1NFIE 5AQAA 2QZAA 1SW6A 2XPIA 2R2LA 3TWSA 3C5RA 3TXMA 1QQEA 3ASDA 3NOGD 4K5CA 5AJDA 3UX4A 4FP7A 3T9KA 4C0EA 1B89A 3IV0A 5T4YA 2WXLA 2GGFA 4ILIA 4U7EB 1MX2A 3SFYA 3DEOA 3WXXA 3EHQA 4JA7A 4L2LA 2HM8A 2X6HA 1UG3A 2R05A 4ILHB 4AIFA 2JABA 4I9CA 4TV3A 3HDXA 5EKQD 3KSLA 2ZXWE 2VSNA 2PL2A 3E30A 3ZUVB 4AP2A 2Y1LE 4AV7A 1U3CA 3ZW3A 3UI2A 2VJ8A 5EIDA 1JWFA 1TJCA 3IHVA 2WXJA 3ISMC 3ZVVA 3RU0A 2MYOA 4U96D 4CEMA 4APFA 3CKBA 3CSTA 2H6GA 4EECA 2ZGDA 1OY3D 5G05J 2CG3A 1IHGA 3UIOC 5J90A 3MV2B 3UINC 1QNFA 4JW1A 4KZCA 1HE8A 1HU3A 3CHRA 4U04A 4U0UA 4DI4A 1NI1A 4KT6B 1RW2A 3X2QE 4OAVB 3HVEA 3PEVB 4RVBA 3D9LA 5T3RA 4DLQA 3BG0B 4V3IA 4LNGA 3G2TA 4G25A 4DX2A 2OEWA 3MKQB 3ASFA 1HXIA 4FA6A 3MA5A 2ETBA 1TN7A 2LSVA 1DCEA 4BWRA 3ZNGA 3LDZA 4BX9A 3L54A 3TJPA 1H19A 3Q78A 5E75A 3R9AB 3SO8A 1OWMA 3E32A 3Q9UC 2IJGX 3UXGA 2LAIA 1H6KA 4GMJA 4IN3B 3CHQA 3K9IA 2BTDA 2P9LG 1OWPA 4CGVA 4F53A 2DCPA 5KCMA 3PH0C 4HLEA 2ETAA 5KNGA 4A63B 2FF4A 3FUJA 1UN8A 1HG2A 4I43A 2YNQA 5D66A 5KBAA 3ML9A 3Q47B 1TN6A 2B6CA 3V79K 3SGHA 1TNZA 4CYMD 4FJYA 5KJNA 3FTYA 3QDNA 3W9GA 3QWWA 4JD2G 4L23A 3CQCB 4F6RD 4FADA 2DZOA 1VDYA 3CKCA 3ENEA 3AG1E 2R17C 3DXMG 2XCBA 5C2YA 5G04C 4F3VA 4EBAG 4FLHA 3SY2A 4FULA 2VSYA 4ACKA 1MZCA 2UY1A 2QFCA 2Y4UA 3CV0A 5AQ7A 4JB8P 3QWPA 1XNFA 1OT8A 3G2VA 3DRAA 2WPVA 1QBQA 4GB9A 1E7UA 4Q94A 4L7TA 4U07A 4I2ZA 4X8QA 3AAAC 2WQHA 4O1PA 1D8DA 3SZ7A 5AARA 3B7BA 1OWLA 3J5QB 1N11A 3Q49B 4KYOB 4GZDA 3FUMA 4XI0A 2XEEA 4GTQA 1A5EA 1DCQA 3TWRA 3FY4A 2OOEA 3PRZA 1YCSB 1MHQA 4CT0A 3LY7A 1K8KG 1TNYA 5EDSA 4I2WA
chains in the Genus database with same CATH topology
1MQSA 3FFLA 3BEEA 5FQ7A 2IOLA 2AXZA 3B13A 2R59A 3OTNA 4GMLA 3UT4A 4KMOA 2A4ZA 4WWPA 1Y6IA 4URKA 4HOTA 3TL5A 1ZU2A 4FU3A 3AS8A 3CVLA 4Q96A 4FLBA 1TJFA 1PAQA 4GA2A 4A1GA 4BT8A 2YINA 3D9IA 4N2SA 4ANVA 4I1MA 4GU5A 2BUGA 1P5QA 4NQ0A 2WM9A 1LF8A 4BY6A 1E96B 1HH8A 4U63A 4RG9A 5CMYA 5G04J 5BV1A 1WY6A 4I6GA 3PZDA 3B7SA 4UWKA 3UT8A 3PNTB 3L16A 4J8DA 5LCWJ 5D0OD 4PUCA 2A5UA 2KZTB 3JUIA 3DPDA 2WXHA 2WXFA 5BT1A 3D9OA 3FUNA 3LEWA 2I1KA 2I2OA 2X6JA 5DBKA 5AIJA 4ANXA 4WNEA 4JZYA 4KVMA 1PY1A 2AW6A 3CLJA 1BPOA 4J8EA 3TG5A 4UI9J 2VGXA 4BX8A 4H7XA 4B8AA 3B7UX 3CVNA 3JQ0A 3EDTB 5HI7A 2GRLA 3VTXA 3PREA 2YHCA 3ASGA 3FULA 3RRNB 2WXQA 4ME2A 4LRZA 1UN9A 2XQ0A 4UI9C 3CR3A 3PS6A 4HOSA 3CEQA 4WUYA 2WMNA 3ZIMA 3D3MA 3FTXA 1FVFA 2FULA 3P2BA 2WQ6A 3CIAA 4GZ5A 4NACA 3R7RA 3GZSA 4YNDA 4HXIA 3S7BA 2PM7A 3RO3A 3LY9A 3SFZA 4P29A 3URZA 1W3BA 5CMWA 4B89A 3S7DA 4ANUA 3CSFA 5CCMA 3RIBA 2WXPA 3MV3B 4EZJA 5C1DA 1N52A 4DI3A 2MOWA 4N3CA 2UWJG 2CHWA 3ZEFA 2V8SE 1EDUA 2X38A 5A7DB 4JL0A 4ATGA 2KCVA 3OXGA 1FVHA 4Q69A 5FWQA 4ILGA 3S2AA 3UQ3A 1E8YA 4XIFA 2XCCA 3RK6A 4CGWA 2J4BA 2OVBA 3OAWA 2VQ2A 3G2WA 2YHEA 4WNGA 3ONLA 4GYYA 4BTAA 3MKRA 1JUQA 3CVQA 4JPSA 2X6KA 5FQ4A 2V5FA 4J8FA 4A3TA 3UT7A 2OVFA 4G23A 4N5CA 4NURA 4MKTA 4PDXA 2C0MA 3MGBA 2NSZA 3UPVA 3APFA 4I6JA 5JHBA 2HYZA 3QJZA 3ML8A 5FZQA 2UY1B 3SD5A 2XGMA 5FTPA 4U0ZA 2HR2A 4OVUA 4B94A 2PQNA 2KCKA 3NF1A 4K0RA 3MCXA 4Y6CA 5KJMA 4I1OB 4RSYA 3FUHA 4HOQA 3FP3A 3FTUA 3I4RB 2JEKA 2L0IA 2YQ8A 4MLPA 2WXKA 5JHAA 2C0LA 1E7VA 3O4ZA 1OUVA 4L2YA 4I6EA 2ILRA 4F1SA 4NRHB 1H2UA 3HHMA 3NZUA 3I3NA 5JJ6A 4LEUA 1A17A 4KBQA 2NC9A 4XKBA 1HS6A 4AY5A 4BTBA 4U0SA 4CRWA 4ANWA 2XGOA 3B7RL 1DNPA 3QARA 4HOUA 3L22A 4XX5A 2GRMA 2XRYA 4N2QA 3U66A 2LAHA 3JCKC 3HYMB 1GW6A 4CDMA 5KJLA 4GZ6A 3FTVA 4EBAA 4G26A 3FWVA 1SZAA 1ELRA 3EHMA 3O48A 3T8MA 3OXLA 5DIZA 2VTBA 3MZLB 4EZKA 3SHFA 3CK8A 2WB2A 3SI5A 2P58C 1OWNA 2XPZA 5EX3A 3TAXA 3ZPJA 2LO6A 1TEZA 5BUZA 2J09A 3IEGA 5AYWD 4JHRA 4OVVA 5ANRA 5BV0A 3QWVA 3ESKA 2KCLA 2M63A 3APDA 5LOZA 3MKQA 1WM5A 3MEKA 3IHYA 3NZSA 3ONKA 3KAEA 3PDNA 4WWNA 3ZGQA 5ARGA 3CVYA 2RD0A 4GAAA 2X3MA 4AEZC 3ZRHA 1Y8MA 1IQUA 4JEHA 5A6CA 1NA0A 2VSOE 1H2VC 5FJYA 4N3AA 2CHZA 3FUFA 4E6HA 2WXGA 4G24A 3NQPA 1E8XA 1QZ2A 3TGOA 2MRIA 1EPUA 2XPIA 3LVRE 3PUKA 2FEZA 4B0ZA 2V4LA 1UW4B 1E8WA 4J8SA 4JHKA 1ELKA 2V0PA 1KLXA 3FH5A 3LJ3A 3TXMA 4AXHA 1QQEA 3ASDA 5AJDA 3UX4A 3UUXA 4FP7A 5D0QD 4A55A 4EZLA 1NZNA 4C0EA 3IKOB 4PS8A 3CQGB 3AU5A 3QNKA 3FUIA 4HFGA 4G1TA 2XRZA 1B89A 3IV0A 4I1AA 4UWGA 5T4YA 1EF1C 3LCAA 3ZXSA 2WXLA 4JA9A 2KATA 2I6HA 2GGFA 2VTBB 4ILIA 1HZ4A 3ZYQA 2GW1A 4GYOA 3SBTB 2AWIA 3FUKA 3QK0A 3SBSA 1E8ZA 1FCHA 3MYVA 4GA1A 2LSUA 4IYPA 2IQCA 3PUJA 4GZCA 3IBEA 3T5VA 2E0IA 1ZBPA 3WXXA 4UWFA 3CHSA 5FQ8A 2XPYA 5LX8A 3FU3A 1YA0A 4JA7A 4L2LA 2HM8A 2L6JA 1UG3A 2X6HA 1PC2A 2IU1A 2CG2A 3KS2A 3LS8A 4ILHB 4Y6WA 3GYZA 3APCA 4HORA 4AIFA 4I9CA 2IFUA 2J4DA 1OWOA 3QOUA 4KXKB 3VLDA 4TV3A 3HDXA 4JEUA 3FEXA 5EKQD 3SNXA 2VSNA 2JLBA 4GZ3A 4A3VA 2PL2A 3EJNA 4AOFA 4A1SA 2BF0X 2FO7A 5EX0A 4D10C 4AV7A 5LCWC 4AP2A 2R5SA 1KT1A 4UQYA 1U3CA 3EHNA 3ZW3A 2VJ8A 4MRUA 2IF4A 3FEYA 3CVVA 1JWFA 4FC8A 1XGWA 1TJCA 2L0TB 3IHVA 2WXJA 5BPPA 3TG4A 4GYWA 3AU4A 4GCOA 5BW8C 3ZVVA 2XGSA 4XE0A 3RU0A 4CEMA 3C98A 4APFA 2ZU6B 3CKBA 3CSTA 2E2EA 1HX8A 4EECA 4F7AA 4QFVA 4KVOA 3ZFWA 4DLOA 2WMOA 3KD7A 5G05J 2CG3A 2OV8A 2VYIA 1IHGA 3MX3A 3RO2A 1NP7A 3MV2B 4O6FA 2HO1A 4TUUA 5J90A 2WVIA 1QNFA 3FU5A 4XKCA 5AJLA 4JW1A 3E4BA 3CHPA 5CCLA 4CT4A 4HVBA 4KZCA 5KJKA 1HE8A 1HU3A 3CHRA 3BG1B 3ESLA 4U04A 4U0UA 5FZRA 5G05C 4DI4A 3RKVA 4AVXA 3CVUA 5JJ7A 4APOA 4LUNU 3HIZA 1N54A 3QB2A 4KT6B 4C0MA 3U9WA 1IQRA 3HVEA 5E76A 1JWGA 3PEVB 4RVBA 3D9LA 4UWHA 4YVQC 5T3RA 4DLQA 3FTWA 1HFAA 3BG0B 4V3IA 4DK5A 5A23A 4CDRA 3S7FA 4UI9K 3FUEA 1EYHA 3G2TA 3SF4A 1KT0A 4G25A 2KC7A 5LP0A 1H2TC 4GA0A 3FHEA 3MKQB 3ASFA 4LERA 3AS5A 2WQ7A 1HXIA 2J07A 4FA6A 3D9NA 3MA5A 3PNLB 3RJVA 3VLFA 2VGXB 3L6AA 2LSVA 4BWRA 4WNDA 1ELWA 3LDZA 1U3DA 4BX9A 3L54A 4E85A 1S0PA 3N71A 4AM9A 3TJPA 3CHMA 3I5PA 4CCAA 2I1JA 3JQ1A 4R7LA 4U8HA 1Z3XA 1H19A 2Q7FA 4FHKA 5E75A 3ZYMA 3UMVA 5HQ8A 2QY7A 5BNWA 3U3WA 3D9PA 3R9AB 3G2UA 4JVSA 4UQZA 4LCTA 3RRMB 3LPZA 1OWMA 4CDNA 3U64A 5J08A 2IJGX 2RG8A 4M3OA 2LAIA 4GPKA 1H6KA 3FUDA 4GMJA 4IN3B 2EQXA 3QC1A 4K03A 3CHQA 3K9IA 2BTDA 3FDHA 2X6IA 3LYAA 3L08A 3Q5MA 3D9KA 2X6FA 5FZSA 3DBSA 2VGYA 1OWPA 4CGVA 4F53A 2DCPA 4B8CB 5KCMA 3PH0C 3PVLA 3GW4A 4DPRA 4HLEA 4N3BA 4BFRA 3VTYA 5JJTA 5G2NA 1NA3A 3CK7A 2FF4A 2KM4A 4JC8A 3FUJA 1UN8A 1HG2A 4I43A 4FHJA 2YNQA 4J0UA 5AENA 3ZN3A 5ANLA 1IYGA 4I9EA 3Q15A 3ML9A 5ARFA 3Q47B 3SGHA 2VSXE 3D9JA 5G55A 4PS3A 5FQ6A 2WXNA 3QKYA 4DJAA 3ZYKA 2Y4TA 5CHEE 3ULQA 4FJYA 3PEUB 5FT9A 5KJNA 3FTYA 1SZ9A 3QDNA 4G11A 3MJWA 4ACLA 2PZIA 3ASHA 4L1BA 4TRQA 2ONDA 4G2VA 2IOSA 3QWWA 4L23A 2CFUA 3L13A 3CQCB 3FU6A 1JPLA 3ZHEA 1UJKA 2FBNA 5T8IA 4IULA 4XI9A 3KEZA 4KZ0A 4FADA 4GCNA 3CK9A 3CVXA 4RG6A 2AXVA 3EIJA 3VLEA 3PE3A 2PM6A 3R7QA 3EIQC 1E90A 1VDYA 1WAO1 3CKCA 4EPZA 3ENEA 4J6IA 3L17A 2R17C 4BT9A 1DVPA 4N39A 2XCBA 4BSXA 4JXTA 5G04C 2J9QA 5C2YA 2NXPA 4XZ4A 2WXIA 4WWOA 4F3VA 4EBAG 4FLHA 2J49A 4FULA 2VSYA 3FH8A 4AY6A 1Z6TA 4ACKA 4YVOA 5ENNA 2L9BA 5LFAA 2UY1A 3CVPA 2LNIA 4AJWA 2QFCA 3CVWA 3FH7A 3RRUA 1Z3YA 3LVQE 4W9RA 2Y4UA 4ABNA 4PH4B 3ZYLA 3CV0A 1INZA 3CHOA 3D9MA 3LY8A 2DIWA 2I9CA 1XNFA 3QWPA 3QAQA 3S7JA 3G2VA 4FJZA 2WPVA 4PS7A 3Q4AB 3U4TA 3FTZA 3B7TA 4OYSA 4GB9A 1E7UA 2KZTA 2WXMA 3I4GA 3ZHEB 3OXFA 2FI7A 4Q94A 4L7TA 1HG5A 3TXNA 4WNFA 1HO8A 2XHEA 4I2ZA 4U07A 2XEVA 2WQHA 4UQXA 1SQMA 3SZ7A 3PE4A 2WXOA 3FTSA 3GZ2A 4C9BB 1HF8A 4UWLA 2J08A 1OWLA 1X5BA 2AVPA 2DBAA 1L5JA 4EQFA 4I17A 5M72A 2AXUA 4WAFA 3FU0A 4IRUA 3GZ1A 3Q49B 2C2LA 4KYOB 2PQRA 4HS2A 4GZDA 1H0AA 3G2SA 3CGHA 2CHXA 3AS4A 3FUMA 4XI0A 1UJJA 4JHJA 4H7YA 3FY4A 2OOEA 3PRZA 1MHQA 2CFZA 4CT0A 2Y3AA 3LY7A 3LKUA 3P1UA 3LXUX 4MS6A 2MHKA 3HVEB 5EDSA 3JYSA 2WXRA 4I2WA 2IONA 3T5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZ3 A;  2PL2 A;  5KJM A;  4A1S A;  2FO7 A;  3FFL A;  4J0U A;  3BEE A;  5EX0 A;  4HOQ A;  3FP3 A;  2R5S A;  3ZN3 A;  5LCW C;  1KT1 A;  4I9E A;  2YQ8 A;  4UQY A;  1IYG A;  2C0L A;  3Q15 A;  1OUV A;  3CK7 A;  2IF4 A;  5ARF A;  4HOT A;  3Q47 B;  1ZU2 A;  3AS8 A;  3CVL A;  1TJC A;  4NRH B;  5JJ6 A;  4LEU A;  4GA2 A;  3QKY A;  1A17 A;  4KBQ A;  2NC9 A;  4BT8 A;  4N2S A;  2Y4T A;  3TG4 A;  2BUG A;  5CHE E;  4AY5 A;  1P5Q A;  4GYW A;  3ULQ A;  4BTB A;  4GCO A;  4U0S A;  4NQ0 A;  5FT9 A;  5BW8 C;  5KJN A;  2XGS A;  2XGO A;  3QDN A;  4HOU A;  3RU0 A;  1E96 B;  1HH8 A;  2PZI A;  3ASH A;  4RG9 A;  5G04 J;  3CKB A;  4N2Q A;  2E2E A;  2OND A;  3HYM B;  4G2V A;  3QWW A;  5KJL A;  4GZ6 A;  3ZFW A;  4G26 A;  3FWV A;  4J8D A;  5LCW J;  5G05 J;  1ELR A;  3KD7 A;  5D0O D;  3O48 A;  2VYI A;  3ZHE A;  3OXL A;  1IHG A;  5DIZ A;  2FBN A;  3RO2 A;  4O6F A;  3MV2 B;  3CK8 A;  2HO1 A;  4XI9 A;  5BT1 A;  4GCN A;  3CK9 A;  2P58 C;  3E4B A;  4RG6 A;  5EX3 A;  3TAX A;  3ZPJ A;  3PE3 A;  5CCL A;  5KJK A;  5DBK A;  3IEG A;  5AYW D;  4JHR A;  4U04 A;  4U0U A;  5FZR A;  3QWV A;  5G05 C;  3ESK A;  4WNE A;  2KCL A;  4AY6 A;  3RKV A;  1WM5 A;  3MEK A;  4J8E A;  3TG5 A;  4UI9 J;  2VGX A;  1WAO 1;  3CKC A;  3KAE A;  3PDN A;  5ARG A;  3ZGQ A;  4H7X A;  4APO A;  5JJ7 A;  3CVN A;  1Y8M A;  3EDT B;  5HI7 A;  5A6C A;  1NA0 A;  5FJY A;  4BT9 A;  4YVQ C;  3VTX A;  2YHC A;  4N39 A;  3ASG A;  4N3A A;  4CDR A;  3S7F A;  2XCB A;  4UI9 K;  4G24 A;  4ME2 A;  5G04 C;  2J9Q A;  3SF4 A;  1KT0 A;  4G25 A;  2KC7 A;  4UI9 C;  4F3V A;  4GA0 A;  1QZ2 A;  3TGO A;  4HOS A;  3CEQ A;  2VSY A;  3ASF A;  4WUY A;  2XPI A;  4YVO A;  3AS5 A;  2FEZ A;  1HXI A;  2UY1 A;  3CVP A;  2LNI A;  2QFC A;  4GZ5 A;  1KLX A;  3MA5 A;  4W9R A;  3RJV A;  2Y4U A;  1QQE A;  2VGX B;  3ASD A;  4ABN A;  3CV0 A;  4YND A;  3S7B A;  5D0Q D;  3URZ A;  3RO3 A;  2LSV A;  1NZN A;  3LY9 A;  3UUX A;  1W3B A;  3LY8 A;  4BWR A;  4WND A;  3QWP A;  3S7D A;  1XNF A;  1ELW A;  3S7J A;  4G1T A;  1B89 A;  3N71 A;  4I1A A;  3RIB A;  4AM9 A;  2WPV A;  5CCM A;  3LCA A;  3MV3 B;  3Q4A B;  4JA9 A;  2KAT A;  3U4T A;  5C1D A;  2I6H A;  4N3C A;  2UWJ G;  3ZHE B;  1HZ4 A;  3OXF A;  2FI7 A;  5A7D B;  4JL0 A;  2GW1 A;  2Q7F A;  2KCV A;  4U07 A;  4I2Z A;  4GYO A;  3OXG A;  4WNF A;  2XEV A;  2WQH A;  4UQX A;  1FCH A;  5HQ8 A;  3UQ3 A;  5BNW A;  4XIF A;  3SZ7 A;  2XCC A;  3PE4 A;  3GZ2 A;  3R9A B;  3U3W A;  4GA1 A;  4CGW A;  2LSU A;  4UQZ A;  3LPZ A;  2VQ2 A;  2AVP A;  2DBA A;  4EQF A;  1ZBP A;  4I17 A;  3WXX A;  5M72 A;  4WNG A;  4BTA A;  4GYY A;  3GZ1 A;  3MKR A;  3CVQ A;  2C2L A;  3Q49 B;  4KYO B;  4GPK A;  2PQR A;  2V5F A;  1YA0 A;  4J8F A;  4IN3 B;  4G23 A;  4XI0 A;  3AS4 A;  4JA7 A;  4N5C A;  3K9I A;  3Q5M A;  3LYA A;  2C0M A;  2L6J A;  3KS2 A;  1PC2 A;  4H7Y A;  5FZS A;  2OOE A;  3UPV A;  4Y6W A;  3GYZ A;  2HYZ A;  4HOR A;  2VGY A;  5FZQ A;  4AIF A;  2UY1 B;  3LY7 A;  2XGM A;  5FTP A;  4CGV A;  4U0Z A;  2HR2 A;  3LKU A;  2FF4 A;  4I9C A;  4B94 A;  2IFU A;  2MHK A;  2KCK A;  2PQN A;  3GW4 A;  3NF1 A;  3JYS A;  3QOU A;  4KXK B;  4N3B A;  5EKQ D;  4I2W A;  3VTY A;  5JJT A;  4Y6C A;  1NA3 A;  2VSN A;  2JLB A; 
#chains in the Genus database with same CATH topology
 1S63 A;  3FFL A;  3BEE A;  2IOL A;  2AXZ A;  3B13 A;  3OTN A;  3UT4 A;  4KMO A;  1Y6I A;  4URK A;  4HOT A;  3TL5 A;  5AN8 A;  4Q96 A;  1TJF A;  1PAQ A;  4A1G A;  1P5Q A;  4U63 A;  5AQ9 A;  4RG9 A;  5G04 J;  1H6O A;  1WY6 A;  4I6G A;  4UWK A;  3B7S A;  4YDW A;  3PNT B;  4PUC A;  3DPD A;  2WXH A;  5CER B;  2WXF A;  5BT1 A;  3LEW A;  4U8V D;  2F37 A;  2I2O A;  2X6J A;  2ZGG A;  1PY1 A;  1O1S A;  4BX8 A;  3EDT B;  3FUL A;  4UUC A;  4LRZ A;  4HBD A;  2XQ0 A;  3V2O A;  3P2B A;  4GZ5 A;  5KNH D;  4YND A;  3S7B A;  3RO3 A;  1W3B A;  4B89 A;  3ASN E;  5C1D A;  1QYM A;  2V8S E;  1O1R A;  3OXG A;  1FVH A;  3UQ3 A;  2XCC A;  4CGW A;  4NIK A;  2YHE A;  3RSE G;  1RZ4 A;  1JUQ A;  3CVQ A;  4JPS A;  4MKT A;  2NSZ A;  5CEA A;  5JHB A;  4L9P A;  2UY1 B;  4U0Z A;  2HR2 A;  4OVU A;  2PQN A;  4Y6C A;  3FP3 A;  3HG0 D;  4MLP A;  5JHA A;  2C0L A;  1E7V A;  5JJ6 A;  4LEU A;  3V31 A;  1BI8 B;  4KBQ A;  1SA4 A;  4BTB A;  4XX5 A;  3HXE A;  3L22 A;  4N2Q A;  5KJL A;  1ELR A;  2IEJ A;  3MZL B;  5EX3 A;  2J09 A;  4OVV A;  3MEK A;  4HB5 A;  4WWN A;  4AEZ C;  3ZRH A;  1Y8M A;  5A6C A;  2VSO E;  1KZP A;  1QZ2 A;  2L6B A;  3ULY A;  3TWV A;  3PUK A;  1UW4 B;  1E8W A;  4J8S A;  1ELK A;  2V0P A;  3UUX A;  1DC2 A;  1NZN A;  2H6F A;  4PS8 A;  3FUI A;  3UKR G;  4G1T A;  4I1A A;  4UWG A;  4JA9 A;  2KAT A;  2I6H A;  2VTB B;  3SBT B;  2AWI A;  3FUK A;  1E8Z A;  5JMN D;  3PUJ A;  3NAW A;  2E0I A;  1N4R A;  2Y69 E;  4ZHB A;  2XPY A;  5LX8 A;  1YA0 A;  5ENQ D;  2P9K G;  2OCC E;  1SVX A;  3VLD A;  3FEX A;  3SNX A;  4GZ3 A;  1N0R A;  4A1S A;  1YMP A;  2R5S A;  3EHN A;  2IF4 A;  1XGW A;  1BD8 A;  5BPP A;  2GRO B;  2XEH A;  1LD7 A;  4XE0 A;  3C98 A;  3JXI A;  3IXE A;  1JCQ A;  3ZFW A;  3C3Q A;  3KD7 A;  4YDY A;  2VYI A;  3RO2 A;  5AJL A;  3E4B A;  4CT4 A;  5KJK A;  3BG1 B;  5FZR A;  4AVX A;  2OEV A;  4APO A;  1N54 A;  4C0M A;  3U9W A;  4UWH A;  3FTW A;  4CDR A;  3SF4 A;  1KT0 A;  5LP0 A;  1H2T C;  4YDO A;  5EYL A;  2WQ7 A;  3D9N A;  3VLF A;  3L6A A;  4WND A;  3N71 A;  4CCA A;  2I1J A;  4M7C A;  4R7L A;  4U8H A;  2Q7F A;  2QYU A;  2F0Y A;  2QY7 A;  5FIO A;  3PZ3 A;  3LPZ A;  2XS1 A;  3HXC A;  4GTV A;  2QYJ A;  2XZD G;  3FUD A;  3QC1 A;  5JA4 D;  3FDH A;  3LYA A;  3Q5M A;  3L08 A;  3D9K A;  2VGY A;  4DPR A;  3PVL A;  5AQB A;  4HRM B;  3CK7 A;  3NBN B;  5ANL A;  1IYG A;  4I9E A;  2VSX E;  3D9J A;  5G55 A;  4PS3 A;  2WXN A;  4DJA A;  5CHE E;  5FT9 A;  1SZ9 A;  4G11 A;  3ASH A;  2OND A;  2IOS A;  4TXP A;  3FU6 A;  1JPL A;  5HRY A;  1BU9 A;  1WDY A;  2DZN A;  1UJK A;  2FBN A;  4XI9 A;  3KEZ A;  4KZ0 A;  3VLE A;  2AXV A;  3PE3 A;  2PM6 A;  3HRA A;  1OCO E;  2P9N G;  3UIP C;  1D8E A;  1V55 E;  1DVP A;  4N39 A;  4BER A;  4JXT A;  2WXI A;  3UKU G;  4GTT A;  4YVO A;  2L9B A;  4J8Y A;  3FH7 A;  3RRU A;  1Z3Y A;  4ABN A;  3LY8 A;  3S7J A;  4PS7 A;  4OYS A;  1Z5S C;  2P9S G;  2KZT A;  4DRX E;  1N4P A;  3I4G A;  4GTM A;  3TXN A;  4WNF A;  4UQX A;  2IO3 C;  2EIN E;  3GZ2 A;  4DUI A;  1HF8 A;  2J08 A;  2DBA A;  4HI8 A;  3D9H A;  3DPY A;  2C2L A;  1H0A A;  2F8Y A;  3G2S A;  4JHJ A;  4H7Y A;  4RQI A;  2CFZ A;  1U2V G;  3P1U A;  3LXU X;  4GTO A;  2MHK A;  3T5X A;  2A4Z A;  4FU3 A;  3AS8 A;  4O60 A;  3E37 A;  4BT8 A;  4ANV A;  4GU5 A;  2DYR E;  2WM9 A;  4BY6 A;  1E96 B;  1HH8 A;  5BV1 A;  5CMY A;  2J8S D;  3L16 A;  4BSZ B;  5H7P A;  5CBN A;  4MBG A;  1D9S A;  2R02 A;  4LSZ E;  5DBK A;  4ANX A;  4DX6 D;  4WNE A;  5EYP F;  2AW6 A;  4J8E A;  4UI9 J;  1TNB A;  4H7X A;  3B7U X;  3JQ0 A;  5HI7 A;  2GRL A;  3PRE A;  3ASG A;  4DX7 D;  1WG0 A;  2WXQ A;  1N95 A;  1UN9 A;  3CR3 A;  3PS6 A;  3DST A;  3CEQ A;  5ENO D;  3ULE G;  1FVF A;  2FUL A;  1MJ0 A;  3R7R A;  1OCR E;  4HXI A;  3LY9 A;  3SFZ A;  5CMW A;  3BUA A;  1N52 A;  2MOW A;  4N3C A;  2CHW A;  3ZEF A;  3W9F A;  2X38 A;  4JL0 A;  2KCV A;  4Q69 A;  3TWU A;  3RK6 A;  1O1T A;  2XS8 A;  2RFA A;  2VGE A;  4GYY A;  5FQ4 A;  2V5F A;  2OVF A;  4N5C A;  4PDX A;  3UPV A;  1NL4 A;  4I6J A;  2HYZ A;  3QJZ A;  3ML8 A;  4TXQ A;  5D2M C;  2KCK A;  4K0R A;  4GTS A;  5KJM A;  3FUH A;  2WXK A;  3O4Z A;  3Q9N C;  4L2Y A;  4F1S A;  1FT2 A;  2LUH A;  3HHM A;  1S70 B;  1HS6 A;  4U0S A;  1FT1 A;  2XGO A;  2QC9 A;  2GRM A;  2XRY A;  3U66 A;  4CDM A;  4GZ6 A;  1SZA A;  3EHM A;  3SI5 A;  1K1A A;  2LO6 A;  1TEZ A;  5AYW D;  2KCL A;  2H6I A;  2M63 A;  3APD A;  3MKQ A;  1WM5 A;  4AY6 A;  3IHY A;  2RD0 A;  4GAA A;  5B3S E;  3Q79 A;  5EN5 D;  1H2V C;  4N3A A;  1KZO A;  1MX4 A;  4G24 A;  3NQP A;  2V5Q C;  3TGO A;  4B0Z A;  2FEZ A;  4JHK A;  1KLX A;  2GRN B;  4LNB A;  4A55 A;  5D0Q D;  4EZL A;  3IKO B;  3UM2 A;  1TNO A;  2LXM A;  3QNK A;  4HFG A;  2XRZ A;  4G8L A;  3ZXS A;  3LCA A;  2R03 A;  3ZYQ A;  3UM0 A;  5CRU A;  4GYO A;  4Z68 A;  5CEC B;  3Q75 A;  3MYV A;  4IYP A;  3IBE A;  3T5V A;  1ZBP A;  4UWF A;  3CHS A;  5FQ8 A;  2A5E A;  1O5M A;  1TN8 A;  3JUE A;  1ZB1 A;  2L6J A;  2IU1 A;  2CG2 A;  4Y6W A;  1JCS A;  4HOR A;  3PZ4 A;  4KXK B;  2J4D A;  4JEU A;  2B0O E;  2JLB A;  4A3V A;  4AOF A;  2FO7 A;  4D10 C;  5EX0 A;  5LCW C;  2DWZ A;  4MRU A;  4FC8 A;  2L0T B;  2EIJ E;  1TR4 A;  3TG4 A;  4GYW A;  1N4Q A;  2XGS A;  2ZU6 B;  2E2E A;  4KVO A;  4DLO A;  2OV8 A;  3MX3 A;  1NP7 A;  4TUU A;  2WVI A;  3AG3 E;  3FU5 A;  5CCL A;  4HVB A;  2IO2 C;  3ESL A;  5G05 C;  3R9M A;  3RKV A;  5JJ7 A;  4LUN U;  5HS0 A;  3HIZ A;  1IQR A;  5KWD A;  4YVQ C;  5A23 A;  4UI9 K;  3FUE A;  1EYH A;  4ATZ D;  4GTP A;  4LER A;  4QQI A;  3NB2 A;  3PNL B;  3RJV A;  3JXJ A;  2VGX B;  3SQV A;  1ELW A;  4HNA D;  2ZIS A;  1OCZ E;  2PNN A;  5B1B E;  2P9U G;  3CHM A;  3B95 A;  1Z3X A;  3PZ2 A;  4GMR A;  3UMV A;  5HQ8 A;  3AG2 E;  5BNW A;  4JVS A;  4UQZ A;  3U64 A;  4M3O A;  4GPK A;  2EQX A;  3UM1 A;  2X6F A;  3DSS A;  3DBS A;  4OAU C;  4DX5 D;  3Q73 A;  4DX1 A;  5G2N A;  1NA3 A;  3DSW A;  5EIB E;  4J0U A;  3ZN3 A;  1UOH A;  1V54 E;  3ZYK A;  2Y4T A;  3UTM A;  3ULQ A;  4RLY A;  1OCC E;  4ACL A;  4TRQ A;  4G2V A;  3L13 A;  3ZHE A;  4IUL A;  4GCN A;  3CK9 A;  4RG6 A;  3EIJ A;  3EIQ C;  2F8X K;  1E90 A;  3AG4 E;  3C72 A;  4G8K A;  4BSX A;  2J9Q A;  2NXP A;  4XZ4 A;  4WWO A;  4YDE A;  1Z6T A;  5LFA A;  3CVP A;  3CVW A;  3LVQ E;  4W9R A;  4PH4 B;  3ZYL A;  2EIL E;  2I9C A;  3QAQ A;  3UM3 A;  1S64 A;  3Q4A B;  3U4T A;  5HKP A;  3EHR A;  3DEP A;  2WXM A;  1HO8 A;  1N0Q A;  2XHE A;  2XEV A;  5ENP D;  3PE4 A;  3FTS A;  4EQF A;  1X5B A;  4U95 D;  5M72 A;  3FU0 A;  3PZ1 A;  4HS2 A;  3CGH A;  3AS4 A;  2GRR B;  1UJJ A;  2RFM A;  3HVE B;  3JYS A;  4K5A B;  1MQS A;  1OXJ A;  3NOC D;  5FQ7 A;  1JCR A;  2R59 A;  1ZU2 A;  3HXB A;  1BI7 B;  2YIN A;  4N2S A;  2BUG A;  3PZD A;  3C3R A;  1YYH A;  3AJI A;  4J8D A;  5LCW J;  5D0O D;  2A5U A;  2KZT B;  4N5Q A;  3D9O A;  3FUN A;  4HRL A;  4JZY A;  3TG5 A;  3CVN A;  4ME2 A;  4CZ2 D;  4HOS A;  4WUY A;  4B93 B;  3ZIM A;  2XEN A;  3FTX A;  3CIA A;  4NAC A;  1BLX B;  4TUM A;  4P29 A;  4HI9 A;  3S7D A;  4ANU A;  3CSF A;  3ZXP A;  2WXP A;  3MV3 B;  4EZJ A;  2UWJ G;  3T8K A;  4ATG A;  5A7D B;  5FWQ A;  1E8Y A;  4XIF A;  2J4B A;  2OVB A;  3OAW A;  3G2W A;  4WNG A;  3ONL A;  2P9P G;  3MKR A;  2X6K A;  4A3T A;  3UT7 A;  4NUR A;  2C0M A;  3SFX A;  5ITZ F;  3DSU A;  2XGM A;  5FTP A;  4LNU D;  3Q7A A;  3MCX A;  2RKK A;  4HOQ A;  3I4R B;  2L0I A;  4I6E A;  2ILR A;  4NRH B;  3NZU A;  3I3N A;  1A17 A;  2NC9 A;  4AY5 A;  4ANW A;  3QAR A;  4HOU A;  3JCK C;  3HYM B;  3FTV A;  4EBA A;  3FWV A;  3T8M A;  4EZK A;  3WG7 E;  2BED A;  2P58 C;  2XPZ A;  3ZPJ A;  5BUZ A;  5CBO A;  4JHR A;  4GTR A;  3ESK A;  4F1P A;  3DSX A;  5LOZ A;  3NZS A;  3ONK A;  3KAE A;  3PDN A;  5ARG A;  2X3M A;  3FUF A;  2NYJ A;  2WXG A;  1E8X A;  2MRI A;  1EPU A;  3LVR E;  2V4L A;  1MYO A;  3FH5 A;  3LJ3 A;  4AXH A;  3KEA A;  3V2X A;  3CQG B;  3AU5 A;  1EF1 C;  2BKG A;  1X81 A;  1HZ4 A;  2GW1 A;  1IXV A;  3QK0 A;  3SBS A;  1FCH A;  4GA1 A;  2LSU A;  3HXD A;  2IQC A;  4GZC A;  2GRP B;  3FU3 A;  1H6P A;  3ABK E;  3KS2 A;  1PC2 A;  3LS8 A;  1K3Z D;  3GYZ A;  3APC A;  4ZFH A;  2IFU A;  1OWO A;  3QOU A;  3EJN A;  2BF0 X;  1KT1 A;  4UQY A;  3EU9 A;  3FEY A;  3CVV A;  2DYS E;  5ENR D;  2Y0B G;  3AU4 A;  4GCO A;  3KSQ A;  5BW8 C;  1N4S A;  1HX8 A;  4F7A A;  4QFV A;  4HRN A;  2WMO A;  2AJA A;  4O6F A;  2HO1 A;  4XKC A;  5ENT D;  3CHP A;  3J5P A;  2IY0 C;  3CVU A;  3QB2 A;  1MX6 A;  1JWG A;  5E76 A;  1KPS B;  4DK5 A;  1HFA A;  2EIK E;  3S7F A;  3BQO A;  5CRV A;  4C48 B;  2KC7 A;  4GA0 A;  3FHE A;  3AS5 A;  2J07 A;  2XZT G;  4E85 A;  1U3D A;  1S0P A;  4AM9 A;  3EU5 A;  1AP7 A;  3I5P A;  3BU8 A;  3JQ1 A;  2H6H A;  4FHK A;  5ENS D;  3ZYM A;  3U3W A;  3D9P A;  3G2U A;  4LCT A;  3RRM B;  4CDN A;  5J08 A;  2RG8 A;  4O1O A;  4K03 A;  2KBX A;  2X6I A;  5FZS A;  4U8Y D;  4B8C B;  3F6Q A;  2HE0 A;  3GW4 A;  4N3B A;  4BFR A;  3VTY A;  5JJT A;  4BET A;  5AAO A;  2KM4 A;  4JC8 A;  4FHJ A;  5AEN A;  3Q15 A;  3RAU A;  5ARF A;  5FQ6 A;  3QKY A;  3HXF A;  3PEU B;  3MJW A;  2PZI A;  4L1B A;  2CFU A;  4TXR A;  2P9I G;  5T8I A;  3CVX A;  3L82 A;  3R7Q A;  1WAO 1;  4EPZ A;  4J6I A;  3L17 A;  5EIL A;  4BT9 A;  1IHB A;  1AWC B;  3V30 A;  2J49 A;  3FH8 A;  4LG6 A;  5ENN A;  2LNI A;  4AJW A;  1TNU A;  1INZ A;  2FO1 E;  3CHO A;  1LD8 A;  3D9M A;  2DIW A;  4FJZ A;  3FTZ A;  3B7T A;  3ZHE B;  3OXF A;  2FI7 A;  1HG5 A;  1SQM A;  2WXO A;  4C9B B;  3ABL E;  4UWL A;  2AVP A;  1L5J A;  4BEP A;  4I17 A;  2AXU A;  4WAF A;  4IRU A;  3GZ1 A;  2PQR A;  2CHX A;  2GRQ B;  3ZKJ A;  2Y3A A;  5FIN A;  3LKU A;  3TWQ A;  4MS6 A;  1IKN D;  2WXR A;  5DIZ A;  2ION A;  1Q2Z A;  2V4H C;  4GML A;  4WWP A;  3CVL A;  4FLB A;  4GA2 A;  3D9I A;  4I1M A;  4NQ0 A;  1LF8 A;  2ZIR A;  3UT8 A;  4BES A;  3JUI A;  3EUV A;  2I1K A;  5AIJ A;  4KVM A;  3CLJ A;  1BPO A;  2VGX A;  3TWT A;  5B1A E;  4B8A A;  3VTX A;  2YHC A;  3E34 A;  3RRN B;  1G3N B;  4UI9 C;  3L9T A;  2WMN A;  3D3M A;  4J7W A;  2WQ6 A;  1FPP A;  3GZS A;  3URZ A;  2PM7 A;  3DSV A;  3ASO E;  5CCM A;  3RIB A;  2P2C P;  2EIM E;  1K1B A;  3TWX A;  1EDU A;  1TYQ G;  5CED B;  4ILG A;  3S2A A;  1LTX A;  2KXP C;  2VQ2 A;  4BTA A;  4DI3 A;  4J8F A;  4G23 A;  3LJN A;  4GPM A;  3DWL G;  3MGB A;  3APF A;  5FZQ A;  3SD5 A;  2ETC A;  3E33 A;  3ABM E;  4B94 A;  3NF1 A;  4K5B A;  4I1O B;  4RSY A;  4EHM A;  3FTU A;  2BKK B;  2JEK A;  2YQ8 A;  3TWW A;  1OUV A;  5BXU A;  1N9A A;  1H2U A;  4XKB A;  3Q7F A;  4CRW A;  3B7R L;  1DNP A;  5BXO A;  2LAH A;  1GW6 A;  2DVW A;  4G26 A;  3O48 A;  4HLL A;  3OXL A;  2VTB A;  4HQD A;  3SHF A;  3CK8 A;  2WB2 A;  1OWN A;  3TAX A;  3ZU7 B;  5IY5 E;  3IEG A;  5ANR A;  5BV0 A;  3QWV A;  3C3O A;  1SA5 A;  3ZGQ A;  3CVY A;  1IQU A;  2LXL A;  4JEH A;  1NA0 A;  5FJY A;  1N94 A;  4XEI G;  3DXK G;  4E6H A;  2CHZ A;  1NFI E;  5AQA A;  2QZA A;  1SW6 A;  2XPI A;  2R2L A;  3TWS A;  3C5R A;  3TXM A;  1QQE A;  3ASD A;  3NOG D;  4K5C A;  5AJD A;  3UX4 A;  4FP7 A;  3T9K A;  4C0E A;  1B89 A;  3IV0 A;  5T4Y A;  2WXL A;  2GGF A;  4ILI A;  4U7E B;  1MX2 A;  3SFY A;  3DEO A;  3WXX A;  3EHQ A;  4JA7 A;  4L2L A;  2HM8 A;  2X6H A;  1UG3 A;  2R05 A;  4ILH B;  4AIF A;  2JAB A;  4I9C A;  4TV3 A;  3HDX A;  5EKQ D;  3KSL A;  2ZXW E;  2VSN A;  2PL2 A;  3E30 A;  3ZUV B;  4AP2 A;  2Y1L E;  4AV7 A;  1U3C A;  3ZW3 A;  3UI2 A;  2VJ8 A;  5EID A;  1JWF A;  1TJC A;  3IHV A;  2WXJ A;  3ISM C;  3ZVV A;  3RU0 A;  2MYO A;  4U96 D;  4CEM A;  4APF A;  3CKB A;  3CST A;  2H6G A;  4EEC A;  2ZGD A;  1OY3 D;  5G05 J;  2CG3 A;  1IHG A;  3UIO C;  5J90 A;  3MV2 B;  3UIN C;  1QNF A;  4JW1 A;  4KZC A;  1HE8 A;  1HU3 A;  3CHR A;  4U04 A;  4U0U A;  4DI4 A;  1NI1 A;  4KT6 B;  1RW2 A;  3X2Q E;  4OAV B;  3HVE A;  3PEV B;  4RVB A;  3D9L A;  5T3R A;  4DLQ A;  3BG0 B;  4V3I A;  4LNG A;  3G2T A;  4G25 A;  4DX2 A;  2OEW A;  3MKQ B;  3ASF A;  1HXI A;  4FA6 A;  3MA5 A;  2ETB A;  1TN7 A;  2LSV A;  1DCE A;  4BWR A;  3ZNG A;  3LDZ A;  4BX9 A;  3L54 A;  3TJP A;  1H19 A;  3Q78 A;  5E75 A;  3R9A B;  3SO8 A;  1OWM A;  3E32 A;  3Q9U C;  2IJG X;  3UXG A;  2LAI A;  1H6K A;  4GMJ A;  4IN3 B;  3CHQ A;  3K9I A;  2BTD A;  2P9L G;  1OWP A;  4CGV A;  4F53 A;  2DCP A;  5KCM A;  3PH0 C;  4HLE A;  2ETA A;  5KNG A;  4A63 B;  2FF4 A;  3FUJ A;  1UN8 A;  1HG2 A;  4I43 A;  2YNQ A;  5D66 A;  5KBA A;  3ML9 A;  3Q47 B;  1TN6 A;  2B6C A;  3V79 K;  3SGH A;  1TNZ A;  4CYM D;  4FJY A;  5KJN A;  3FTY A;  3QDN A;  3W9G A;  3QWW A;  4JD2 G;  4L23 A;  3CQC B;  4F6R D;  4FAD A;  2DZO A;  1VDY A;  3CKC A;  3ENE A;  3AG1 E;  2R17 C;  3DXM G;  2XCB A;  5C2Y A;  5G04 C;  4F3V A;  4EBA G;  4FLH A;  3SY2 A;  4FUL A;  2VSY A;  4ACK A;  1MZC A;  2UY1 A;  2QFC A;  2Y4U A;  3CV0 A;  5AQ7 A;  4JB8 P;  3QWP A;  1XNF A;  1OT8 A;  3G2V A;  3DRA A;  2WPV A;  1QBQ A;  4GB9 A;  1E7U A;  4Q94 A;  4L7T A;  4U07 A;  4I2Z A;  4X8Q A;  3AAA C;  2WQH A;  4O1P A;  1D8D A;  3SZ7 A;  5AAR A;  3B7B A;  1OWL A;  3J5Q B;  1N11 A;  3Q49 B;  4KYO B;  4GZD A;  3FUM A;  4XI0 A;  2XEE A;  4GTQ A;  1A5E A;  1DCQ A;  3TWR A;  3FY4 A;  2OOE A;  3PRZ A;  1YCS B;  1MHQ A;  4CT0 A;  3LY7 A;  1K8K G;  1TNY A;  5EDS A;  4I2W A; 
#chains in the Genus database with same CATH homology
 1MQS A;  3FFL A;  3BEE A;  5FQ7 A;  2IOL A;  2AXZ A;  3B13 A;  2R59 A;  3OTN A;  4GML A;  3UT4 A;  4KMO A;  2A4Z A;  4WWP A;  1Y6I A;  4URK A;  4HOT A;  3TL5 A;  1ZU2 A;  4FU3 A;  3AS8 A;  3CVL A;  4Q96 A;  4FLB A;  1TJF A;  1PAQ A;  4GA2 A;  4A1G A;  4BT8 A;  2YIN A;  3D9I A;  4N2S A;  4ANV A;  4I1M A;  4GU5 A;  2BUG A;  1P5Q A;  4NQ0 A;  2WM9 A;  1LF8 A;  4BY6 A;  1E96 B;  1HH8 A;  4U63 A;  4RG9 A;  5CMY A;  5G04 J;  5BV1 A;  1WY6 A;  4I6G A;  3PZD A;  3B7S A;  4UWK A;  3UT8 A;  3PNT B;  3L16 A;  4J8D A;  5LCW J;  5D0O D;  4PUC A;  2A5U A;  2KZT B;  3JUI A;  3DPD A;  2WXH A;  2WXF A;  5BT1 A;  3D9O A;  3FUN A;  3LEW A;  2I1K A;  2I2O A;  2X6J A;  5DBK A;  5AIJ A;  4ANX A;  4WNE A;  4JZY A;  4KVM A;  1PY1 A;  2AW6 A;  3CLJ A;  1BPO A;  4J8E A;  3TG5 A;  4UI9 J;  2VGX A;  4BX8 A;  4H7X A;  4B8A A;  3B7U X;  3CVN A;  3JQ0 A;  3EDT B;  5HI7 A;  2GRL A;  3VTX A;  3PRE A;  2YHC A;  3ASG A;  3FUL A;  3RRN B;  2WXQ A;  4ME2 A;  4LRZ A;  1UN9 A;  2XQ0 A;  4UI9 C;  3CR3 A;  3PS6 A;  4HOS A;  3CEQ A;  4WUY A;  2WMN A;  3ZIM A;  3D3M A;  3FTX A;  1FVF A;  2FUL A;  3P2B A;  2WQ6 A;  3CIA A;  4GZ5 A;  4NAC A;  3R7R A;  3GZS A;  4YND A;  4HXI A;  3S7B A;  2PM7 A;  3RO3 A;  3LY9 A;  3SFZ A;  4P29 A;  3URZ A;  1W3B A;  5CMW A;  4B89 A;  3S7D A;  4ANU A;  3CSF A;  5CCM A;  3RIB A;  2WXP A;  3MV3 B;  4EZJ A;  5C1D A;  1N52 A;  4DI3 A;  2MOW A;  4N3C A;  2UWJ G;  2CHW A;  3ZEF A;  2V8S E;  1EDU A;  2X38 A;  5A7D B;  4JL0 A;  4ATG A;  2KCV A;  3OXG A;  1FVH A;  4Q69 A;  5FWQ A;  4ILG A;  3S2A A;  3UQ3 A;  1E8Y A;  4XIF A;  2XCC A;  3RK6 A;  4CGW A;  2J4B A;  2OVB A;  3OAW A;  2VQ2 A;  3G2W A;  2YHE A;  4WNG A;  3ONL A;  4GYY A;  4BTA A;  3MKR A;  1JUQ A;  3CVQ A;  4JPS A;  2X6K A;  5FQ4 A;  2V5F A;  4J8F A;  4A3T A;  3UT7 A;  2OVF A;  4G23 A;  4N5C A;  4NUR A;  4MKT A;  4PDX A;  2C0M A;  3MGB A;  2NSZ A;  3UPV A;  3APF A;  4I6J A;  5JHB A;  2HYZ A;  3QJZ A;  3ML8 A;  5FZQ A;  2UY1 B;  3SD5 A;  2XGM A;  5FTP A;  4U0Z A;  2HR2 A;  4OVU A;  4B94 A;  2PQN A;  2KCK A;  3NF1 A;  4K0R A;  3MCX A;  4Y6C A;  5KJM A;  4I1O B;  4RSY A;  3FUH A;  4HOQ A;  3FP3 A;  3FTU A;  3I4R B;  2JEK A;  2L0I A;  2YQ8 A;  4MLP A;  2WXK A;  5JHA A;  2C0L A;  1E7V A;  3O4Z A;  1OUV A;  4L2Y A;  4I6E A;  2ILR A;  4F1S A;  4NRH B;  1H2U A;  3HHM A;  3NZU A;  3I3N A;  5JJ6 A;  4LEU A;  1A17 A;  4KBQ A;  2NC9 A;  4XKB A;  1HS6 A;  4AY5 A;  4BTB A;  4U0S A;  4CRW A;  4ANW A;  2XGO A;  3B7R L;  1DNP A;  3QAR A;  4HOU A;  3L22 A;  4XX5 A;  2GRM A;  2XRY A;  4N2Q A;  3U66 A;  2LAH A;  3JCK C;  3HYM B;  1GW6 A;  4CDM A;  5KJL A;  4GZ6 A;  3FTV A;  4EBA A;  4G26 A;  3FWV A;  1SZA A;  1ELR A;  3EHM A;  3O48 A;  3T8M A;  3OXL A;  5DIZ A;  2VTB A;  3MZL B;  4EZK A;  3SHF A;  3CK8 A;  2WB2 A;  3SI5 A;  2P58 C;  1OWN A;  2XPZ A;  5EX3 A;  3TAX A;  3ZPJ A;  2LO6 A;  1TEZ A;  5BUZ A;  2J09 A;  3IEG A;  5AYW D;  4JHR A;  4OVV A;  5ANR A;  5BV0 A;  3QWV A;  3ESK A;  2KCL A;  2M63 A;  3APD A;  5LOZ A;  3MKQ A;  1WM5 A;  3MEK A;  3IHY A;  3NZS A;  3ONK A;  3KAE A;  3PDN A;  4WWN A;  3ZGQ A;  5ARG A;  3CVY A;  2RD0 A;  4GAA A;  2X3M A;  4AEZ C;  3ZRH A;  1Y8M A;  1IQU A;  4JEH A;  5A6C A;  1NA0 A;  2VSO E;  1H2V C;  5FJY A;  4N3A A;  2CHZ A;  3FUF A;  4E6H A;  2WXG A;  4G24 A;  3NQP A;  1E8X A;  1QZ2 A;  3TGO A;  2MRI A;  1EPU A;  2XPI A;  3LVR E;  3PUK A;  2FEZ A;  4B0Z A;  2V4L A;  1UW4 B;  1E8W A;  4J8S A;  4JHK A;  1ELK A;  2V0P A;  1KLX A;  3FH5 A;  3LJ3 A;  3TXM A;  4AXH A;  1QQE A;  3ASD A;  5AJD A;  3UX4 A;  3UUX A;  4FP7 A;  5D0Q D;  4A55 A;  4EZL A;  1NZN A;  4C0E A;  3IKO B;  4PS8 A;  3CQG B;  3AU5 A;  3QNK A;  3FUI A;  4HFG A;  4G1T A;  2XRZ A;  1B89 A;  3IV0 A;  4I1A A;  4UWG A;  5T4Y A;  1EF1 C;  3LCA A;  3ZXS A;  2WXL A;  4JA9 A;  2KAT A;  2I6H A;  2GGF A;  2VTB B;  4ILI A;  1HZ4 A;  3ZYQ A;  2GW1 A;  4GYO A;  3SBT B;  2AWI A;  3FUK A;  3QK0 A;  3SBS A;  1E8Z A;  1FCH A;  3MYV A;  4GA1 A;  2LSU A;  4IYP A;  2IQC A;  3PUJ A;  4GZC A;  3IBE A;  3T5V A;  2E0I A;  1ZBP A;  3WXX A;  4UWF A;  3CHS A;  5FQ8 A;  2XPY A;  5LX8 A;  3FU3 A;  1YA0 A;  4JA7 A;  4L2L A;  2HM8 A;  2L6J A;  1UG3 A;  2X6H A;  1PC2 A;  2IU1 A;  2CG2 A;  3KS2 A;  3LS8 A;  4ILH B;  4Y6W A;  3GYZ A;  3APC A;  4HOR A;  4AIF A;  4I9C A;  2IFU A;  2J4D A;  1OWO A;  3QOU A;  4KXK B;  3VLD A;  4TV3 A;  3HDX A;  4JEU A;  3FEX A;  5EKQ D;  3SNX A;  2VSN A;  2JLB A;  4GZ3 A;  4A3V A;  2PL2 A;  3EJN A;  4AOF A;  4A1S A;  2BF0 X;  2FO7 A;  5EX0 A;  4D10 C;  4AV7 A;  5LCW C;  4AP2 A;  2R5S A;  1KT1 A;  4UQY A;  1U3C A;  3EHN A;  3ZW3 A;  2VJ8 A;  4MRU A;  2IF4 A;  3FEY A;  3CVV A;  1JWF A;  4FC8 A;  1XGW A;  1TJC A;  2L0T B;  3IHV A;  2WXJ A;  5BPP A;  3TG4 A;  4GYW A;  3AU4 A;  4GCO A;  5BW8 C;  3ZVV A;  2XGS A;  4XE0 A;  3RU0 A;  4CEM A;  3C98 A;  4APF A;  2ZU6 B;  3CKB A;  3CST A;  2E2E A;  1HX8 A;  4EEC A;  4F7A A;  4QFV A;  4KVO A;  3ZFW A;  4DLO A;  2WMO A;  3KD7 A;  5G05 J;  2CG3 A;  2OV8 A;  2VYI A;  1IHG A;  3MX3 A;  3RO2 A;  1NP7 A;  3MV2 B;  4O6F A;  2HO1 A;  4TUU A;  5J90 A;  2WVI A;  1QNF A;  3FU5 A;  4XKC A;  5AJL A;  4JW1 A;  3E4B A;  3CHP A;  5CCL A;  4CT4 A;  4HVB A;  4KZC A;  5KJK A;  1HE8 A;  1HU3 A;  3CHR A;  3BG1 B;  3ESL A;  4U04 A;  4U0U A;  5FZR A;  5G05 C;  4DI4 A;  3RKV A;  4AVX A;  3CVU A;  5JJ7 A;  4APO A;  4LUN U;  3HIZ A;  1N54 A;  3QB2 A;  4KT6 B;  4C0M A;  3U9W A;  1IQR A;  3HVE A;  5E76 A;  1JWG A;  3PEV B;  4RVB A;  3D9L A;  4UWH A;  4YVQ C;  5T3R A;  4DLQ A;  3FTW A;  1HFA A;  3BG0 B;  4V3I A;  4DK5 A;  5A23 A;  4CDR A;  3S7F A;  4UI9 K;  3FUE A;  1EYH A;  3G2T A;  3SF4 A;  1KT0 A;  4G25 A;  2KC7 A;  5LP0 A;  1H2T C;  4GA0 A;  3FHE A;  3MKQ B;  3ASF A;  4LER A;  3AS5 A;  2WQ7 A;  1HXI A;  2J07 A;  4FA6 A;  3D9N A;  3MA5 A;  3PNL B;  3RJV A;  3VLF A;  2VGX B;  3L6A A;  2LSV A;  4BWR A;  4WND A;  1ELW A;  3LDZ A;  1U3D A;  4BX9 A;  3L54 A;  4E85 A;  1S0P A;  3N71 A;  4AM9 A;  3TJP A;  3CHM A;  3I5P A;  4CCA A;  2I1J A;  3JQ1 A;  4R7L A;  4U8H A;  1Z3X A;  1H19 A;  2Q7F A;  4FHK A;  5E75 A;  3ZYM A;  3UMV A;  5HQ8 A;  2QY7 A;  5BNW A;  3U3W A;  3D9P A;  3R9A B;  3G2U A;  4JVS A;  4UQZ A;  4LCT A;  3RRM B;  3LPZ A;  1OWM A;  4CDN A;  3U64 A;  5J08 A;  2IJG X;  2RG8 A;  4M3O A;  2LAI A;  4GPK A;  1H6K A;  3FUD A;  4GMJ A;  4IN3 B;  2EQX A;  3QC1 A;  4K03 A;  3CHQ A;  3K9I A;  2BTD A;  3FDH A;  2X6I A;  3LYA A;  3L08 A;  3Q5M A;  3D9K A;  2X6F A;  5FZS A;  3DBS A;  2VGY A;  1OWP A;  4CGV A;  4F53 A;  2DCP A;  4B8C B;  5KCM A;  3PH0 C;  3PVL A;  3GW4 A;  4DPR A;  4HLE A;  4N3B A;  4BFR A;  3VTY A;  5JJT A;  5G2N A;  1NA3 A;  3CK7 A;  2FF4 A;  2KM4 A;  4JC8 A;  3FUJ A;  1UN8 A;  1HG2 A;  4I43 A;  4FHJ A;  2YNQ A;  4J0U A;  5AEN A;  3ZN3 A;  5ANL A;  1IYG A;  4I9E A;  3Q15 A;  3ML9 A;  5ARF A;  3Q47 B;  3SGH A;  2VSX E;  3D9J A;  5G55 A;  4PS3 A;  5FQ6 A;  2WXN A;  3QKY A;  4DJA A;  3ZYK A;  2Y4T A;  5CHE E;  3ULQ A;  4FJY A;  3PEU B;  5FT9 A;  5KJN A;  3FTY A;  1SZ9 A;  3QDN A;  4G11 A;  3MJW A;  4ACL A;  2PZI A;  3ASH A;  4L1B A;  4TRQ A;  2OND A;  4G2V A;  2IOS A;  3QWW A;  4L23 A;  2CFU A;  3L13 A;  3CQC B;  3FU6 A;  1JPL A;  3ZHE A;  1UJK A;  2FBN A;  5T8I A;  4IUL A;  4XI9 A;  3KEZ A;  4KZ0 A;  4FAD A;  4GCN A;  3CK9 A;  3CVX A;  4RG6 A;  2AXV A;  3EIJ A;  3VLE A;  3PE3 A;  2PM6 A;  3R7Q A;  3EIQ C;  1E90 A;  1VDY A;  1WAO 1;  3CKC A;  4EPZ A;  3ENE A;  4J6I A;  3L17 A;  2R17 C;  4BT9 A;  1DVP A;  4N39 A;  2XCB A;  4BSX A;  4JXT A;  5G04 C;  2J9Q A;  5C2Y A;  2NXP A;  4XZ4 A;  2WXI A;  4WWO A;  4F3V A;  4EBA G;  4FLH A;  2J49 A;  4FUL A;  2VSY A;  3FH8 A;  4AY6 A;  1Z6T A;  4ACK A;  4YVO A;  5ENN A;  2L9B A;  5LFA A;  2UY1 A;  3CVP A;  2LNI A;  4AJW A;  2QFC A;  3CVW A;  3FH7 A;  3RRU A;  1Z3Y A;  3LVQ E;  4W9R A;  2Y4U A;  4ABN A;  4PH4 B;  3ZYL A;  3CV0 A;  1INZ A;  3CHO A;  3D9M A;  3LY8 A;  2DIW A;  2I9C A;  1XNF A;  3QWP A;  3QAQ A;  3S7J A;  3G2V A;  4FJZ A;  2WPV A;  4PS7 A;  3Q4A B;  3U4T A;  3FTZ A;  3B7T A;  4OYS A;  4GB9 A;  1E7U A;  2KZT A;  2WXM A;  3I4G A;  3ZHE B;  3OXF A;  2FI7 A;  4Q94 A;  4L7T A;  1HG5 A;  3TXN A;  4WNF A;  1HO8 A;  2XHE A;  4I2Z A;  4U07 A;  2XEV A;  2WQH A;  4UQX A;  1SQM A;  3SZ7 A;  3PE4 A;  2WXO A;  3FTS A;  3GZ2 A;  4C9B B;  1HF8 A;  4UWL A;  2J08 A;  1OWL A;  1X5B A;  2AVP A;  2DBA A;  1L5J A;  4EQF A;  4I17 A;  5M72 A;  2AXU A;  4WAF A;  3FU0 A;  4IRU A;  3GZ1 A;  3Q49 B;  2C2L A;  4KYO B;  2PQR A;  4HS2 A;  4GZD A;  1H0A A;  3G2S A;  3CGH A;  2CHX A;  3AS4 A;  3FUM A;  4XI0 A;  1UJJ A;  4JHJ A;  4H7Y A;  3FY4 A;  2OOE A;  3PRZ A;  1MHQ A;  2CFZ A;  4CT0 A;  2Y3A A;  3LY7 A;  3LKU A;  3P1U A;  3LXU X;  4MS6 A;  2MHK A;  3HVE B;  5EDS A;  3JYS A;  2WXR A;  4I2W A;  2ION A;  3T5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...