2L6JA

Tah1 complexed by meevd
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TPR repeat-containing protein associated with Hsp90
publication title Structure of minimal tetratricopeptide repeat domain protein Tah1 reveals mechanism of its interaction with Pih1 and Hsp90.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 32
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2l6jA00
1WAO1 1XNFA 2WPVA 2VGYA 4BWRA 2XCCA 4UQYA 3S7JA 2BUGA 3TG4A 4RG9A 4GA1A 5ARFA 2XGSA 4GYOA 3PE3A 4YVQC 3LY7A 4G26A 2VYIA 1YA0A 4Y6WA 4I2WA 5FT9A 2JLBA 1TJCA 4N3CA 2C0LA 4F3VA 5D0OD 4XIFA 4G24A 2UY1A 3UUXA 4WNGA 2PQRA 4A1SA 3CVNA 4WNEA 2LSUA 2VQ2A 4G2VA 4GZ5A 4CDRA 5ARGA 4WUYA 4CGVA 2IFUA 2XCBA 4ABNA 3RKVA 5BT1A 4U0UA 4U0ZA 4KXKB 4UI9K 3GZ2A 3ASHA 3SF4A 3ZPJA 3R9AB 2FBNA 3ZFWA 1ELRA 4J8DA 1ELWA 3OXGA 3RJVA 3Q47B 4N3BA 1KT1A 2VGXA 3CK7A 3U4TA 2VSYA 3Q5MA 3CV0A 3GW4A 3CKCA 3IEGA 3OXFA 2ONDA 5AYWD 4JA7A 4UI9J 2UY1B 4U04A 4I17A 3FFLA 2YHCA 5G04J 3ASFA 5HI7A 5JJTA 4BTBA 5DBKA 4UI9C 2HYZA 4LEUA 1IYGA 3EDTB 5BNWA 2UWJG 3RU0A 2V5FA 2KATA 4RG6A 5EKQD 2OOEA 4GPKA 4APOA 3VTXA 1W3BA 4AY5A 3CKBA 2XGOA 3QWVA 5HQ8A 4UQZA 3Q49B 5LCWJ 3QDNA 1QZ2A 3LY8A 2VGXB 3CVQA 3LPZA 5LCWC 4U07A 2L6JA 4J8FA 1HH8A 4I9EA 3CK8A 3KAEA 3KD7A 1ZU2A 1P5QA 3RO3A 5EX3A 4U0SA 3Q15A 2YQ8A 3CVPA 3S7FA 3AS8A 3BEEA 5C1DA 5FJYA 2I6HA 3S7BA 3AS5A 5EX0A 3TGOA 2GW1A 3CEQA 3SZ7A 2FI7A 2HR2A 3QWWA 4HOSA 4BTAA 4NQ0A 2LNIA 3ZHEA 5KJNA 3FWVA 5BW8C 3UQ3A 5JJ6A 2KCKA 2XPIA 4GCNA 2FF4A 4H7XA 4J0UA 5KJMA 3QOUA 3ULQA 3E4BA 4BT9A 2Y4TA 4I1AA 3LYAA 2J9QA 2FO7A 3ASGA 2Y4UA 5FZSA 3ESKA 4GYYA 4HOUA 2KC7A 3N71A 4GYWA 4GA2A 4IN3B 4BT8A 4J8EA 5FTPA 4N5CA 3MKRA 1A17A 2MHKA 4I2ZA 2LSVA 1IHGA 4GCOA 4YVOA 4HORA 4GZ6A 1WM5A 4N39A 4GZ3A 1OUVA 4XI9A 3TG5A 5G04C 2XEVA 2XGMA 3LCAA 2IF4A 3ZHEB 4AM9A 4G23A 2PZIA 4H7YA 1Y8MA 4N2SA 3AS4A 5CCMA 3QKYA 3S7DA 3MV3B 2C2LA 1NZNA 4HOQA 4KBQA 1KT0A 1QQEA 4NRHB 3CVLA 3Q4AB 3NF1A 3GYZA 3UPVA 3HYMB 2DBAA 2HO1A 1HXIA 3VTYA 3TAXA 5CCLA 4W9RA 3RO2A 2KCVA 4GA0A 3ZGQA 4ME2A 1HZ4A 5FZRA 4YNDA 5A7DB 5D0QD 3ZN3A 1NA0A 3MV2B 4KYOB 3OXLA 4JHRA 3MA5A 2R5SA 4UQXA 3MEKA 3CK9A 4N2QA 3LY9A 4G1TA 3PE4A 4EQFA 3PDNA 2QFCA 1FCHA 1B89A 3QWPA 4XI0A 2C0MA 4I9CA 3ASDA 4WNFA 2KCLA 4B94A 4CGWA 2PL2A 2PQNA 3FP3A 3RIBA 2NC9A 3O48A 5CHEE 3U3WA 5DIZA 2E2EA 3KS2A 3LKUA 1KLXA 3GZ1A 5M72A 5FZQA 3URZA 5JJ7A 2WQHA 5KJKA 2FEZA 5G05J 2AVPA 3K9IA 4WNDA 4G25A 4AIFA 2Q7FA 4HOTA 5G05C 3WXXA 4JA9A 4O6FA 2VSNA 4JL0A 4Y6CA 4N3AA 1PC2A 4AY6A 5KJLA 3JYSA 1ZBPA 1NA3A 1E96B 2P58C 5A6CA
chains in the Genus database with same CATH superfamily
3AU4A 4GTQA 3AG1E 2F37A 3DWLG 4JB8P 5CBNA 3FUKA 4JEHA 2NYJA 4GA1A 2XGSA 4WWPA 3EHNA 5CEDB 1TNZA 4YVQC 4BERA 4HFGA 3Q78A 2X6KA 3G2VA 4OAUC 4E6HA 4Y6WA 5LFAA 4I2WA 1N4SA 3JCKC 5FT9A 4NURA 5HKPA 4N3CA 5FWQA 5ANRA 4F3VA 4TXQA 4ILGA 1FVFA 1HG5A 1Z3XA 2UY1A 1OCCE 5EDSA 3O4ZA 2LSUA 4HQDA 1N94A 2XQ0A 3DRAA 5D66A 3FDHA 2AXUA 2ZGDA 4CDRA 4GTOA 5ARGA 2CHXA 5FIOA 2OEWA 4CGVA 4B8AA 2IFUA 1UN9A 4MS6A 4GMJA 3IKOB 3RKVA 4YDOA 2IOLA 2V0PA 4U0ZA 2EINE 4V3IA 4KXKB 5KCMA 3SF4A 3R9AB 3FU0A 2EIJE 3UMVA 4OAVB 4HBDA 1PAQA 3FUMA 4J8DA 2P9UG 3SY2A 4D10C 4PUCA 4DLQA 3CK7A 3ISMC 4APFA 3U4TA 3SHFA 1QBQA 3CSFA 3Q5MA 2IO2C 3FUIA 4F6RD 1E7VA 3IEGA 2J8SD 1BI8B 3OXFA 3LXUX 2ONDA 5ENSD 4UI9J 3FTWA 1JUQA 4BX9A 4CYMD 2CFZA 3FFLA 2YHCA 5G04J 3ZIMA 5CBOA 3JXIA 3ASOE 3CHOA 4ANWA 2L0TB 4KVOA 1IYGA 3MKQA 2VJ8A 2UWJG 3PVLA 2KATA 4RG6A 5KNGA 3DSWA 5EKQD 2OOEA 3FUFA 4APOA 1OCZE 4I6JA 3L08A 1W3BA 4K03A 3QWVA 4JC8A 4Q94A 5E76A 4CDMA 1QZ2A 1QYMA 4AVXA 1H6OA 3Q7AA 1G3NB 5A23A 2L6JA 3B95A 1ZU2A 3RO3A 1N95A 3UT7A 3Q15A 1FVHA 2GGFA 3BEEA 3ZYMA 2I6HA 3J5QB 2M63A 2GW1A 1E90A 1JWGA 3HDXA 3ZUVB 2BTDA 4NQ0A 4GZCA 2LNIA 3DPYA 3LVRE 2OV8A 2ZISA 5IY5E 4ANVA 3L16A 3UQ3A 1KPSB 2XZTG 1DNPA 2XHEA 4PDXA 2P9NG 1U3DA 1Z6TA 2H6IA 2BEDA 3CQGB 2V5QC 1QNFA 1UW4B 4JPSA 3LYAA 2X6IA 5H7PA 4HRLA 4UWHA 2QZAA 1VDYA 3NQPA 3TWVA 3CVVA 4GYWA 4GA2A 3B7SA 2IEJA 4J8EA 4BT8A 4HXIA 5JA4D 5AAOA 3DSSA 4I2ZA 2AJAA 1L5JA 2OVBA 3ESLA 2DYSE 3CVWA 4GZ6A 3CSTA 4GZ3A 1OUVA 4FULA 3FUHA 5LX8A 4U96D 5G04C 1RZ4A 2F8YA 3EIJA 4GB9A 4F53A 2XEVA 2XGMA 3ZHEB 2X6HA 4ANXA 2PZIA 3AS4A 4B93B 4EBAG 2DVWA 4K5AB 2GRNB 5FQ6A 3MV3B 4U8YD 1MYOA 1NZNA 3ULYA 2IO3C 1SW6A 3LEWA 1H2UA 3UIPC 2Y3AA 3UPVA 3KEAA 3VTYA 2H6HA 5CCLA 3U64A 2WXRA 3NBNB 2KCVA 1FT2A 3ZGQA 3Q7FA 5B1BE 4ME2A 5A7DB 3MCXA 4GAAA 4EZJA 1LD7A 1NI1A 3ZEFA 3EHRA 1WY6A 3P2BA 3OXLA 4JHRA 3HG0D 1S0PA 4R7LA 2OEVA 2RG8A 3ABKE 2EIKE 4FP7A 3FH7A 1B89A 4LRZA 5HS0A 3UM2A 3QWPA 2IU1A 2X3MA 1ZB1A 3DXKG 5AN8A 2OCCE 3EHMA 4ATGA 4C0EA 2QY7A 2KCLA 1TNOA 1LF8A 3E30A 4XKCA 2PM6A 3T5VA 3O48A 4L9PA 1MX2A 1U3CA 3UXGA 3LKUA 3LJ3A 3GZ1A 5ANLA 4PS8A 2WQHA 3K9IA 3LVQE 4G25A 2WQ7A 4UUCA 1HFAA 2HE0A 4CRWA 5G05C 4KZCA 3V2OA 3BG1B 3ZXPA 2VTBA 2VSNA 2AXVA 2DIWA 3CLJA 2LAIA 4JHKA 1NA3A 3I3NA 4I43A 1E96B 4GU5A 5CMWA 3ZW3A 2VGEA 3U9WA 2P2CP 1XNFA 1E8XA 2VGYA 5FQ4A 4BWRA 2XCCA 3TG4A 2EILE 2P9IG 5G2NA 2Y1LE 3RRMB 4ACLA 3PS6A 4EZLA 1YA0A 3DPDA 2I1JA 5EILA 2KXPC 4XIFA 4LCTA 4WWNA 4JHJA 2CHWA 2IY0C 4MKTA 1MHQA 3F6QA 4GZ5A 4WUYA 3MKQB 1OXJA 3QB2A 2LO6A 3APFA 3ASNE 2WM9A 1V54E 3UT8A 3GZ2A 2BKGA 3ZPJA 3D9JA 5ENTD 2LAHA 3ZFWA 3E32A 1ELRA 4CEMA 4B8CB 1ELWA 3OXGA 4N3BA 3HXCA 5KNHD 2VSYA 1HF8A 5ENRD 1N4PA 3FULA 3CV0A 2KZTB 3NOGD 2WXQA 5ENOD 1EPUA 3D9IA 4JA7A 3PZDA 4FLBA 3V30A 1YMPA 3UM0A 3TJPA 2IJGX 4BTBA 4XE0A 1Z5SC 2ZXWE 2HYZA 1O1TA 3EIQC 3HXEA 4AOFA 5KWDA 5BNWA 4KMOA 3CHMA 4JVSA 2V5FA 4U8VD 3ONLA 3FUDA 1DCEA 3C5RA 4GTPA 3BQOA 4TUUA 2XZDG 2XGOA 2V4LA 1OCRE 3FTYA 4U7EB 3ML9A 2L6BA 4NIKA 2YINA 3CQCB 1KZOA 4GTMA 2VGXB 3NZUA 4U8HA 3TWQA 2JEKA 4A55A 5LCWC 2CFUA 3CR3A 4J8FA 3TXNA 4GZDA 3D9LA 3KAEA 3Q9UC 3KD7A 4FLHA 1MJ0A 2DYRE 3IBEA 2RFAA 1KZPA 5C1DA 3TL5A 5FJYA 3S7BA 3AS5A 1D9SA 1UG3A 3SZ7A 2WXHA 1JCRA 2DZOA 1S64A 3UKUG 3HIZA 3FWVA 5BW8C 3T8KA 2ETCA 4GCNA 3APCA 5AQAA 2MYOA 3CHRA 2KBXA 2WXIA 5LOZA 2KM4A 2A5UA 2WMOA 4U63A 2JABA 4BT9A 3R7RA 3PNLB 4GTSA 4I1AA 5ENNA 2ETAA 1HE8A 2P9SG 4TRQA 5JHBA 1TN7A 3ASGA 1N54A 5FZSA 1S63A 4GYYA 3VLEA 4N5CA 4PS3A 3MKRA 1SQMA 2FULA 2MOWA 1A17A 3E37A 3DBSA 1LD8A 3FH8A 4J8SA 4HLLA 2LSVA 5EIDA 1IHGA 3V2XA 2X6JA 1OT8A 1TNUA 3E33A 5FQ8A 4ILHB 4K5BA 3LCAA 2YNQA 2IF4A 2VSOE 4B0ZA 3PUJA 5HRYA 1JWFA 4H7YA 1Y8MA 1JCSA 5CCMA 2XPZA 3FY4A 2C2LA 4KBQA 3UINC 2RD0A 3QJZA 4NRHB 4RLYA 3CVLA 3Q4AB 3NF1A 1UN8A 4DJAA 3HYMB 1INZA 1HXIA 1TN6A 2J49A 3SBSA 3C72A 3TXMA 1FPPA 5FZRA 4YNDA 5BV1A 5D0QD 4EHMA 4DX6D 2L0IA 3ZYLA 1NA0A 1BPOA 3PEVB 2R17C 3UI2A 3FU3A 2EIME 2R5SA 4ZFHA 4UQXA 5G55A 5CRVA 1SA5A 2QYUA 1TR4A 2WVIA 5FINA 1OWNA 2A4ZA 4G1TA 4HRMB 3V79K 1E7UA 3C3OA 2WMNA 3SQVA 3RRUA 4Z68A 4DRXE 1UJKA 2R03A 3MGBA 3IV0A 2ZU6B 1N4QA 4UWKA 1K3ZD 4K0RA 3L17A 2WB2A 3ZKJA 4I9CA 3ENEA 2XEHA 4U95D 5FQ7A 3SD5A 2F8XK 4EPZA 3FHEA 5T4YA 4WNFA 3UX4A 4BSZB 2PQNA 4AJWA 3RIBA 3AJIA 1NFIE 3B7UX 3NOCD 3ML8A 3BU8A 1KLXA 3PZ1A 1WG0A 2XRYA 3UKRG 3DSTA 4A63B 2FEZA 5G05J 3I5PA 4WNDA 3CVXA 2AXZA 2GRLA 1D8DA 3D9KA 3DEOA 3X2QE 4HOTA 1DC2A 2QYJA 3HVEB 2J08A 3AG4E 3PREA 1ELKA 4O6FA 2R02A 4CT0A 4A3TA 3LS8A 3MJWA 4Y6CA 3W9FA 1PC2A 4I1MA 2AW6A 5KJLA 2ZIRA 3JYSA 2AWIA 2WXNA 1UJJA 1ZBPA 2P9PG 5A6CA 3UT4A 2J09A 1TNYA 4HNAD 4OYSA 4XKBA 4ILIA 4BESA 3S7JA 2BUGA 1H19A 5LP0A 4J6IA 3PE3A 4BEPA 2R59A 3SNXA 2GROB 2VYIA 1DCQA 1OY3D 4A3VA 1HO8A 2C0LA 5D0OD 2P9KG 1OWLA 3PH0C 3ABME 4G24A 2WXMA 4TUMA 2PQRA 4WNGA 4BX8A 5BUZA 4DI4A 3CVNA 4WNEA 3EU9A 2VQ2A 1AP7A 4G2VA 5AARA 5EYLA 2XCBA 4ABNA 1E8WA 5BT1A 4U0UA 3FTZA 2DCPA 4UI9K 4URKA 4JEUA 1OWMA 3ASHA 5CECB 4MLPA 5BV0A 3V31A 1MX4A 4KVMA 3RJVA 3Q47B 1IHBA 1N0QA 3FU5A 2R2LA 4I6EA 4G8LA 3GW4A 4Q96A 3FTVA 3B7RL 5C2YA 4UWFA 3RK6A 3C98A 1RW2A 2H6FA 3UM1A 2UY1B 4U04A 5AQBA 3ASFA 5HI7A 5JJTA 5DBKA 2X38A 4LUNU 4LNGA 4O1PA 4LEUA 4RQIA 3NAWA 4GPKA 2WXJA 3FU6A 2LXMA 5HQ8A 4UQZA 4DLOA 1SVXA 3DSUA 4B89A 3Q49B 3D9MA 5LCWJ 1BU9A 3QDNA 3LY8A 2XS1A 4I9EA 3SFZA 2GRMA 1P5QA 2BKKB 3MZLB 4JZYA 4U0SA 3G2UA 2PNNA 2YQ8A 3ZYKA 3ZXSA 2Y69E 2XENA 3CEQA 4HOSA 1O1SA 4BTAA 3ZHEA 3DXMG 3QC1A 5JJ6A 5AJDA 4H7XA 4J0UA 4LSZE 2V4HC 5KJMA 4DUIA 2WXOA 5E75A 3ZRHA 2Y4TA 3PNTB 3ONKA 2FO7A 2I1KA 2WXPA 3NZSA 4DX1A 5JHAA 4FJYA 4GTRA 5AIJA 4L2LA 4IN3B 1IXVA 3L54A 2LXLA 4L23A 3L9TA 2X6FA 4LNBA 4OVVA 3DSXA 3RRNB 3FUNA 1K1BA 1TEZA 3NB2A 3SFYA 3D9PA 4PS7A 3R9MA 4GCOA 4YVOA 4MRUA 1WM5A 4N39A 2L9BA 1TYQG 4XI9A 4AXHA 3I4GA 3TG5A 3I4RB 1SZ9A 4TXRA 5B3SE 1A5EA 4LERA 3G2SA 5T3RA 2CG2A 4AM9A 4N2SA 3IXEA 4DX2A 3QKYA 5AQ9A 1N11A 4OVUA 3TWXA 2DWZA 4IRUA 1Z3YA 3JQ1A 4YDWA 4GMRA 1QQEA 2XEEA 3RSEG 2WXKA 4P29A 2DBAA 3LDZA 1UOHA 2NSZA 4W9RA 3RO2A 3IHYA 4XX5A 4UWGA 3CGHA 1Q2ZA 1X81A 4GA0A 2IOSA 4BETA 4CZ2D 5BXUA 1HZ4A 4DX5D 2B6CA 3FEXA 1OWOA 5CEAA 4I1OB 3T9KA 4KYOB 4HI8A 3MA5A 4YDEA 3MEKA 4FU3A 3HXBA 2GRPB 3HXFA 3JXJA 3CK9A 4LG6A 1MX6A 3L82A 2XPYA 1H6PA 3LJNA 4HB5A 4EZKA 4AV7A 4RSYA 1SZAA 4XI0A 4J7WA 3Q75A 2VSXE 4WAFA 2FO1E 3GZSA 4HLEA 1U2VG 2BF0X 4DX7D 3ASDA 4E85A 2NXPA 3L22A 4K5CA 4B94A 2PL2A 4F1PA 1MQSA 3MX3A 4KZ0A 5J90A 4GMLA 5CRUA 3T5XA 3DEPA 3L13A 5CHEE 5DIZA 3SFXA 3AU5A 2E2EA 4XZ4A 4BSXA 1TN8A 3URZA 2QC9A 5JJ7A 1IKND 1JCQA 1Y6IA 1K1AA 3EUVA 1LTXA 3SI5A 3G2TA 4DPRA 3IHVA 3C3QA 2WXFA 3CHPA 3WXXA 2I2OA 3EJNA 4JA9A 4HRNA 4JL0A 5T8IA 2J4DA 4AY6A 2B0OE 1E8ZA 2I9CA 3AG2E 1GW6A 1D8EA 3BG0B 3PRZA 3D9NA 2P58C 4ZHBA 1BI7B 5AENA 1WAO1 2E0IA 2WPVA 2YHEA 1H0AA 4JXTA 4UQYA 3ULEG 4RG9A 5ARFA 4GYOA 3SGHA 4FJZA 4M3OA 2ZGGA 3LY7A 4G26A 4WWOA 4AEZC 2KZTA 4MBGA 1N9AA 2JLBA 1TJCA 4JD2G 1X5BA 3ZNGA 1TJFA 4L7TA 3UUXA 2WXLA 2ETBA 3JUIA 1H2TC 4A1SA 4HI9A 3TWWA 3HRAA 2VTBB 5BPPA 4PH4B 3P1UA 4IYPA 3W9GA 3APDA 1EYHA 1H2VC 3SBTB 1HU3A 4RVBA 1PY1A 2RFMA 3OAWA 1SA4A 3C3RA 4KT6B 3E34A 3JUEA 3D3MA 2FBNA 2PM7A 5ENQD 1K8KG 3MYVA 1KT1A 2VGXA 2A5EA 2ILRA 4F7AA 3CKCA 4Q69A 1N4RA 2LUHA 4ATZD 1H6KA 5AYWD 3TWUA 2H6GA 4UWLA 3VLFA 2J4BA 4I17A 4QFVA 4IULA 4UI9C 4C48B 5D2MC 3EDTB 3ZU7B 3FUEA 3RU0A 1O5MA 2CG3A 5CERB 3SO8A 2EQXA 3G2WA 5EYPF 3ZYQA 3VTXA 4AY5A 3CKBA 1OWPA 1JPLA 2J07A 3B7TA 3PEUB 4DK5A 3KSLA 2MRIA 4CT4A 3PZ2A 3QNKA 3CVQA 3LPZA 1EF1C 4U07A 1HH8A 2F0YA 3CK8A 4QQIA 4ANUA 3QAQA 2R05A 5EX3A 3HHMA 4JW1A 3CVPA 3S7FA 3AS8A 2IQCA 3T8MA 3FTSA 1WDYA 3KEZA 4L1BA 3TWSA 3AG3E 3FEYA 5EX0A 5AJLA 2GRRB 4C0MA 3CHQA 3TGOA 4A1GA 2FI7A 2HR2A 3QWWA 4GTTA 3B7BA 2V8SE 1YCSB 1BLXB 5KJNA 4TV3A 1TNBA 2KCKA 3TWTA 3D9OA 2XPIA 5EIBE 2FF4A 4BFRA 3U66A 3OTNA 3HXDA 4X8QA 1FT1A 3QOUA 3ULQA 3TWRA 5ENPD 1N0RA 1DVPA 3E4BA 3BUAA 1XGWA 1O1RA 4FADA 2J9QA 3Q79A 1NP7A 2Y4UA 3ESKA 3R7QA 4HOUA 2KC7A 3N71A 4O1OA 5B1AE 5FTPA 5BXOA 1YYHA 2MHKA 5JMND 1HS6A 3L6AA 4FHJA 4HORA 1IQRA 1HX8A 3ZVVA 3EU5A 3B13A 4FHKA 4G23A 4XEIG 1AWCB 2RKKA 3S7DA 4YDYA 5ITZF 4HOQA 3QK0A 4I6GA 1KT0A 2CHZA 1N52A 3FH5A 4J8YA 3UIOC 2OVFA 1OCOE 3WG7E 2WXGA 3GYZA 5EN5D 4G11A 2HO1A 3FTXA 3DSVA 2Y0BG 2HM8A 3TAXA 2XRZA 1EDUA 2GRQB 4CCAA 3EHQA 4CDNA 3Q9NC 4L2YA 3Q73A 3KSQA 3ZN3A 4C9BB 4HVBA 4GPMA 3MV2B 4GTVA 3UM3A 3FUJA 3HVEA 3CVYA 4F1SA 3JQ0A 4N2QA 3LY9A 4EQFA 3PE4A 1IQUA 4BY6A 3PZ4A 1MZCA 3PDNA 4G8KA 4NACA 1V55E 2QFCA 2DZNA 2IONA 1FCHA 3D9HA 3J5PA 1S70B 2C0MA 1HG2A 2P9LG 4N5QA 3CVUA 4M7CA 4DI3A 2WQ6A 3CHSA 3QARA 5CMYA 5AQ7A 4CGWA 3S2AA 4TXPA 3FP3A 3AAAC 2NC9A 3U3WA 3KS2A 5M72A 5FZQA 2XS8A 3PUKA 3UTMA 5KJKA 4AP2A 2AVPA 4ACKA 4AIFA 5J08A 2Q7FA 1NL4A 1BD8A 3FTUA 4LNUD 4FC8A 4HS2A 4O60A 5KBAA 3ABLE 4N3AA 3PZ3A 3VLDA 3CIAA 4FA6A 1E8YA 4EBAA 4EECA 3RAUA
chains in the Genus database with same CATH topology
3AU4A 3U9WA 5AENA 1WAO1 1XNFA 1E8XA 2E0IA 2VGYA 2WPVA 2YHEA 4OYSA 4XKBA 5FQ4A 4BWRA 4ILIA 1H0AA 2XCCA 4JXTA 4UQYA 2BUGA 3S7JA 3TG4A 3FUKA 4JEHA 4RG9A 1H19A 4GA1A 5LP0A 5G2NA 5ARFA 2XGSA 4GYOA 3SGHA 4J6IA 3EHNA 4WWPA 3RRMB 4ACLA 3PS6A 3PE3A 4FJZA 4M3OA 4YVQC 4EZLA 3LY7A 4G26A 4HFGA 4WWOA 2R59A 3SNXA 2X6KA 3G2VA 4AEZC 2KZTA 2VYIA 4E6HA 1YA0A 4Y6WA 5LFAA 3DPDA 4I2WA 5FT9A 2JLBA 3JCKC 4NURA 4A3VA 1HO8A 1TJCA 2I1JA 4N3CA 5FWQA 2C0LA 5ANRA 4F3VA 1X5BA 5D0OD 4ILGA 4XIFA 1OWLA 3PH0C 1FVFA 1HG5A 1TJFA 1Z3XA 4L7TA 4G24A 4LCTA 2UY1A 3UUXA 2WXMA 4WNGA 2PQRA 4BX8A 2WXLA 5EDSA 4WWNA 4JHJA 3O4ZA 5BUZA 2CHWA 3JUIA 4DI4A 1H2TC 4MKTA 4A1SA 3CVNA 4WNEA 2LSUA 2XQ0A 2VQ2A 3FDHA 2AXUA 1MHQA 2VTBB 4G2VA 4GZ5A 5BPPA 4CDRA 4PH4B 5ARGA 2CHXA 4WUYA 4ANUA 3MKQB 3P1UA 4CGVA 4IYPA 4B8AA 2IFUA 3QB2A 1UN9A 3APDA 1EYHA 1H2VC 4MS6A 3SBTB 4GMJA 2LO6A 3APFA 2XCBA 4ABNA 1HU3A 4RVBA 2WM9A 3IKOB 1E8WA 3RKVA 1PY1A 5BT1A 2IOLA 2V0PA 4U0UA 4U0ZA 4V3IA 3OAWA 3FTZA 3UT8A 4KXKB 2DCPA 4UI9K 4URKA 3GZ2A 4JEUA 1OWMA 3ASHA 4KT6B 5KCMA 3SF4A 3ZPJA 4MLPA 3D9JA 3R9AB 5BV0A 3D3MA 2FBNA 3FU0A 2LAHA 2PM7A 3UMVA 3ZFWA 1PAQA 1ELRA 4CEMA 3FUMA 4J8DA 4B8CB 1ELWA 4KVMA 3OXGA 4D10C 3RJVA 3Q47B 3MYVA 4N3BA 1KT1A 4PUCA 4DLQA 2VGXA 3CK7A 4APFA 3U4TA 2VSYA 3SHFA 3FU5A 2ILRA 3CSFA 3Q5MA 4I6EA 1HF8A 3FULA 4F7AA 3CV0A 3FUIA 3GW4A 3CKCA 1E7VA 3IEGA 4Q96A 4Q69A 2KZTB 3FTVA 3B7RL 5C2YA 2WXQA 4UWFA 1H6KA 3OXFA 3LXUX 1EPUA 2ONDA 3RK6A 3D9IA 5AYWD 3C98A 4JA7A 4UI9J 4UWLA 3FTWA 3VLFA 2J4BA 1JUQA 2UY1B 4U04A 4BX9A 3PZDA 2CFZA 4FLBA 4I17A 3FFLA 4QFVA 2YHCA 5G04J 3ZIMA 3ASFA 3CHOA 5HI7A 5JJTA 3TJPA 2IJGX 4IULA 4ANWA 4XE0A 4BTBA 2L0TB 5DBKA 2X38A 4KVOA 4LUNU 4UI9C 2HYZA 4LEUA 3EIQC 1IYGA 4AOFA 3EDTB 2VJ8A 3MKQA 5BNWA 4KMOA 3FUEA 3CHMA 2UWJG 3RU0A 4JVSA 2V5FA 2CG3A 3PVLA 2KATA 4RG6A 3ONLA 5EKQD 3FUDA 2OOEA 2EQXA 3G2WA 3FUFA 4GPKA 3ZYQA 4APOA 2WXJA 4I6JA 3FU6A 3VTXA 3L08A 1W3BA 4AY5A 3CKBA 1OWPA 4TUUA 4K03A 2XGOA 1JPLA 2J07A 2V4LA 3B7TA 3QWVA 5HQ8A 4UQZA 4DLOA 3PEUB 4B89A 4JC8A 3Q49B 3FTYA 4Q94A 4DK5A 3D9MA 3ML9A 2MRIA 5E76A 5LCWJ 4CDMA 4CT4A 3QDNA 1QZ2A 4AVXA 2YINA 3CQCB 3QNKA 3LY8A 5A23A 2VGXB 3NZUA 4U8HA 2JEKA 3CVQA 3LPZA 2CFUA 3CR3A 1EF1C 4U07A 2L6JA 4J8FA 3TXNA 4A55A 5LCWC 1HH8A 4I9EA 4GZDA 3D9LA 3SFZA 3CK8A 3KAEA 2GRMA 3KD7A 1ZU2A 1P5QA 3MZLB 3QAQA 4FLHA 5EX3A 3RO3A 3HHMA 4JZYA 4U0SA 3G2UA 4JW1A 3IBEA 3UT7A 3Q15A 2YQ8A 3CVPA 3S7FA 1FVHA 2GGFA 3AS8A 3BEEA 3ZYKA 5C1DA 3ZYMA 2IQCA 3T8MA 3FTSA 3TL5A 5FJYA 2I6HA 3KEZA 4L1BA 3S7BA 3AS5A 3FEYA 5EX0A 3ZXSA 2M63A 5AJLA 4C0MA 3CHQA 3TGOA 1UG3A 2GW1A 3CEQA 4A1GA 3SZ7A 2FI7A 2WXHA 1E90A 2HR2A 1JWGA 3HDXA 3QWWA 4HOSA 4BTAA 2BTDA 2V8SE 4NQ0A 4GZCA 2LNIA 3HIZA 3LVRE 3ZHEA 2OV8A 5KJNA 3FWVA 5BW8C 4ANVA 4TV3A 3L16A 3UQ3A 3QC1A 5JJ6A 2KCKA 3D9OA 2XPIA 4GCNA 2FF4A 3APCA 5AJDA 4H7XA 4BFRA 3U66A 3OTNA 1DNPA 2XHEA 4J0UA 4PDXA 3CHRA 5KJMA 1U3DA 1Z6TA 2WXIA 5LOZA 2KM4A 2A5UA 2WMOA 3QOUA 3CQGB 3ULQA 4U63A 1QNFA 2WXOA 5E75A 3ZRHA 1DVPA 3E4BA 4BT9A 2Y4TA 1XGWA 3R7RA 4FADA 3PNLB 1UW4B 4I1AA 4JPSA 5ENNA 3PNTB 1HE8A 3ONKA 3LYAA 2J9QA 2X6IA 2FO7A 4TRQA 2I1KA 2WXPA 5JHBA 3NZSA 4UWHA 3ASGA 1NP7A 5JHAA 1VDYA 1N54A 2Y4UA 4FJYA 5FZSA 3NQPA 3ESKA 4GYYA 3R7QA 5AIJA 4HOUA 2KC7A 4L2LA 3N71A 3CVVA 4GYWA 4GA2A 4IN3B 3L54A 3B7SA 4BT8A 4J8EA 5FTPA 4L23A 3VLEA 2X6FA 4N5CA 4PS3A 3MKRA 4HXIA 1SQMA 2FULA 2MOWA 1A17A 4OVVA 3DBSA 3RRNB 3FH8A 3FUNA 2MHKA 1TEZA 4I2ZA 4J8SA 1L5JA 3D9PA 1HS6A 2OVBA 3L6AA 2LSVA 4FHJA 4PS7A 3ESLA 1IHGA 4GCOA 4YVOA 2X6JA 3CVWA 4HORA 4GZ6A 4MRUA 1IQRA 1WM5A 4N39A 2L9BA 3CSTA 4GZ3A 1OUVA 1HX8A 4FULA 4XI9A 3FUHA 5LX8A 3ZVVA 4AXHA 3I4GA 3TG5A 3I4RB 1SZ9A 5G04C 3EIJA 4GB9A 5FQ8A 4F53A 4ILHB 2XEVA 2XGMA 3LCAA 2YNQA 2IF4A 4FHKA 3B13A 2VSOE 4LERA 3ZHEB 4B0ZA 3G2SA 2X6HA 5T3RA 2CG2A 4ANXA 4AM9A 4G23A 3PUJA 1JWFA 2PZIA 4H7YA 1Y8MA 4N2SA 3AS4A 5CCMA 4EBAG 3QKYA 2XPZA 3FY4A 3S7DA 5FQ6A 3MV3B 2C2LA 4OVUA 1NZNA 4HOQA 4IRUA 3QK0A 1Z3YA 3JQ1A 4I6GA 4KBQA 1KT0A 2CHZA 1N52A 3FH5A 1QQEA 2RD0A 3QJZA 2OVFA 4NRHB 3LEWA 1H2UA 3CVLA 3Q4AB 3NF1A 1UN8A 2Y3AA 2WXKA 4P29A 2WXGA 3GYZA 4DJAA 3UPVA 4G11A 3HYMB 1INZA 2DBAA 3LDZA 2HO1A 3FTXA 1HXIA 3VTYA 2HM8A 2NSZA 3TAXA 5CCLA 4W9RA 3U64A 2WXRA 3IHYA 4XX5A 4UWGA 3CGHA 3RO2A 1EDUA 2XRZA 4CCAA 2KCVA 2J49A 4GA0A 4CDNA 3SBSA 2IOSA 3ZGQA 3TXMA 4L2YA 4ME2A 1HZ4A 5FZRA 4YNDA 5BV1A 5A7DB 5D0QD 3ZN3A 3MCXA 4GAAA 3FEXA 2L0IA 1OWOA 4C9BB 4EZJA 4HVBA 3ZYLA 1NA0A 1BPOA 3PEVB 2R17C 3MV2B 3ZEFA 4I1OB 1WY6A 3P2BA 4KYOB 3OXLA 4JHRA 3FU3A 3MA5A 2R5SA 4UQXA 3FUJA 3MEKA 5G55A 4FU3A 3HVEA 3CVYA 4F1SA 1S0PA 2WVIA 3CK9A 3JQ0A 4R7LA 4N2QA 1OWNA 2A4ZA 3LY9A 2RG8A 4G1TA 3PE4A 4EQFA 1E7UA 1IQUA 4BY6A 4FP7A 3PDNA 3FH7A 2XPYA 2WMNA 4NACA 2QFCA 3RRUA 2IONA 1FCHA 1B89A 4LRZA 4EZKA 4AV7A 3QWPA 4RSYA 1SZAA 1UJKA 2IU1A 4XI0A 3MGBA 2X3MA 3IV0A 2ZU6B 2C0MA 1HG2A 2VSXE 4UWKA 4WAFA 3GZSA 4K0RA 3L17A 2WB2A 4HLEA 3CVUA 4I9CA 3ENEA 5FQ7A 3SD5A 2BF0X 3EHMA 3ASDA 4DI3A 4E85A 4EPZA 2NXPA 2WQ6A 3L22A 4ATGA 4C0EA 3CHSA 3FHEA 5T4YA 3QARA 2QY7A 2KCLA 4WNFA 5CMYA 3UX4A 3S2AA 2PL2A 4B94A 4CGWA 2PQNA 1LF8A 1MQSA 3MX3A 4KZ0A 3FP3A 4GMLA 4AJWA 5J90A 3T5XA 3RIBA 4XKCA 2NC9A 2PM6A 3T5VA 3B7UX 3O48A 3L13A 5CHEE 3U3WA 1U3CA 5DIZA 3AU5A 2E2EA 3KS2A 3LKUA 3LJ3A 3ML8A 4XZ4A 4BSXA 1KLXA 3GZ1A 5M72A 5FZQA 5ANLA 3URZA 4PS8A 2XRYA 5JJ7A 3PUKA 2WQHA 5KJKA 2FEZA 5G05J 4AP2A 1Y6IA 2AVPA 3I5PA 3K9IA 4WNDA 4ACKA 3CVXA 2AXZA 5A6CA 3LVQE 2GRLA 4G25A 2WQ7A 4AIFA 5J08A 1HFAA 2Q7FA 3SI5A 3D9KA 3G2TA 4CRWA 4DPRA 3IHVA 4HOTA 5G05C 2WXFA 3HVEB 2J08A 3CHPA 4KZCA 3WXXA 3FTUA 3PREA 4FC8A 2I2OA 3EJNA 4HS2A 4JA9A 1ELKA 3BG1B 4O6FA 4CT0A 2VTBA 2VSNA 2AXVA 4A3TA 3LS8A 2DIWA 3MJWA 4JL0A 4Y6CA 5T8IA 3CLJA 2J4DA 4N3AA 1PC2A 4I1MA 2AW6A 2LAIA 4AY6A 5KJLA 3JYSA 2AWIA 2WXNA 4JHKA 1UJJA 3VLDA 1E8ZA 1ZBPA 1NA3A 2I9CA 3CIAA 3I3NA 4I43A 1GW6A 1E96B 3BG0B 4GU5A 4FA6A 5CMWA 3PRZA 3ZW3A 1E8YA 3D9NA 4EBAA 2P58C 4EECA 3UT4A 2J09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAO 1;  1XNF A;  2WPV A;  2VGY A;  4BWR A;  2XCC A;  4UQY A;  3S7J A;  2BUG A;  3TG4 A;  4RG9 A;  4GA1 A;  5ARF A;  2XGS A;  4GYO A;  3PE3 A;  4YVQ C;  3LY7 A;  4G26 A;  2VYI A;  1YA0 A;  4Y6W A;  4I2W A;  5FT9 A;  2JLB A;  1TJC A;  4N3C A;  2C0L A;  4F3V A;  5D0O D;  4XIF A;  4G24 A;  2UY1 A;  3UUX A;  4WNG A;  2PQR A;  4A1S A;  3CVN A;  4WNE A;  2LSU A;  2VQ2 A;  4G2V A;  4GZ5 A;  4CDR A;  5ARG A;  4WUY A;  4CGV A;  2IFU A;  2XCB A;  4ABN A;  3RKV A;  5BT1 A;  4U0U A;  4U0Z A;  4KXK B;  4UI9 K;  3GZ2 A;  3ASH A;  3SF4 A;  3ZPJ A;  3R9A B;  2FBN A;  3ZFW A;  1ELR A;  4J8D A;  1ELW A;  3OXG A;  3RJV A;  3Q47 B;  4N3B A;  1KT1 A;  2VGX A;  3CK7 A;  3U4T A;  2VSY A;  3Q5M A;  3CV0 A;  3GW4 A;  3CKC A;  3IEG A;  3OXF A;  2OND A;  5AYW D;  4JA7 A;  4UI9 J;  2UY1 B;  4U04 A;  4I17 A;  3FFL A;  2YHC A;  5G04 J;  3ASF A;  5HI7 A;  5JJT A;  4BTB A;  5DBK A;  4UI9 C;  2HYZ A;  4LEU A;  1IYG A;  3EDT B;  5BNW A;  2UWJ G;  3RU0 A;  2V5F A;  2KAT A;  4RG6 A;  5EKQ D;  2OOE A;  4GPK A;  4APO A;  3VTX A;  1W3B A;  4AY5 A;  3CKB A;  2XGO A;  3QWV A;  5HQ8 A;  4UQZ A;  3Q49 B;  5LCW J;  3QDN A;  1QZ2 A;  3LY8 A;  2VGX B;  3CVQ A;  3LPZ A;  5LCW C;  4U07 A;  2L6J A;  4J8F A;  1HH8 A;  4I9E A;  3CK8 A;  3KAE A;  3KD7 A;  1ZU2 A;  1P5Q A;  3RO3 A;  5EX3 A;  4U0S A;  3Q15 A;  2YQ8 A;  3CVP A;  3S7F A;  3AS8 A;  3BEE A;  5C1D A;  5FJY A;  2I6H A;  3S7B A;  3AS5 A;  5EX0 A;  3TGO A;  2GW1 A;  3CEQ A;  3SZ7 A;  2FI7 A;  2HR2 A;  3QWW A;  4HOS A;  4BTA A;  4NQ0 A;  2LNI A;  3ZHE A;  5KJN A;  3FWV A;  5BW8 C;  3UQ3 A;  5JJ6 A;  2KCK A;  2XPI A;  4GCN A;  2FF4 A;  4H7X A;  4J0U A;  5KJM A;  3QOU A;  3ULQ A;  3E4B A;  4BT9 A;  2Y4T A;  4I1A A;  3LYA A;  2J9Q A;  2FO7 A;  3ASG A;  2Y4U A;  5FZS A;  3ESK A;  4GYY A;  4HOU A;  2KC7 A;  3N71 A;  4GYW A;  4GA2 A;  4IN3 B;  4BT8 A;  4J8E A;  5FTP A;  4N5C A;  3MKR A;  1A17 A;  2MHK A;  4I2Z A;  2LSV A;  1IHG A;  4GCO A;  4YVO A;  4HOR A;  4GZ6 A;  1WM5 A;  4N39 A;  4GZ3 A;  1OUV A;  4XI9 A;  3TG5 A;  5G04 C;  2XEV A;  2XGM A;  3LCA A;  2IF4 A;  3ZHE B;  4AM9 A;  4G23 A;  2PZI A;  4H7Y A;  1Y8M A;  4N2S A;  3AS4 A;  5CCM A;  3QKY A;  3S7D A;  3MV3 B;  2C2L A;  1NZN A;  4HOQ A;  4KBQ A;  1KT0 A;  1QQE A;  4NRH B;  3CVL A;  3Q4A B;  3NF1 A;  3GYZ A;  3UPV A;  3HYM B;  2DBA A;  2HO1 A;  1HXI A;  3VTY A;  3TAX A;  5CCL A;  4W9R A;  3RO2 A;  2KCV A;  4GA0 A;  3ZGQ A;  4ME2 A;  1HZ4 A;  5FZR A;  4YND A;  5A7D B;  5D0Q D;  3ZN3 A;  1NA0 A;  3MV2 B;  4KYO B;  3OXL A;  4JHR A;  3MA5 A;  2R5S A;  4UQX A;  3MEK A;  3CK9 A;  4N2Q A;  3LY9 A;  4G1T A;  3PE4 A;  4EQF A;  3PDN A;  2QFC A;  1FCH A;  1B89 A;  3QWP A;  4XI0 A;  2C0M A;  4I9C A;  3ASD A;  4WNF A;  2KCL A;  4B94 A;  4CGW A;  2PL2 A;  2PQN A;  3FP3 A;  3RIB A;  2NC9 A;  3O48 A;  5CHE E;  3U3W A;  5DIZ A;  2E2E A;  3KS2 A;  3LKU A;  1KLX A;  3GZ1 A;  5M72 A;  5FZQ A;  3URZ A;  5JJ7 A;  2WQH A;  5KJK A;  2FEZ A;  5G05 J;  2AVP A;  3K9I A;  4WND A;  4G25 A;  4AIF A;  2Q7F A;  4HOT A;  5G05 C;  3WXX A;  4JA9 A;  4O6F A;  2VSN A;  4JL0 A;  4Y6C A;  4N3A A;  1PC2 A;  4AY6 A;  5KJL A;  3JYS A;  1ZBP A;  1NA3 A;  1E96 B;  2P58 C;  5A6C A; 
#chains in the Genus database with same CATH topology
 3AU4 A;  4GTQ A;  3AG1 E;  2F37 A;  3DWL G;  4JB8 P;  5CBN A;  3FUK A;  4JEH A;  2NYJ A;  4GA1 A;  2XGS A;  4WWP A;  3EHN A;  5CED B;  1TNZ A;  4YVQ C;  4BER A;  4HFG A;  3Q78 A;  2X6K A;  3G2V A;  4OAU C;  4E6H A;  4Y6W A;  5LFA A;  4I2W A;  1N4S A;  3JCK C;  5FT9 A;  4NUR A;  5HKP A;  4N3C A;  5FWQ A;  5ANR A;  4F3V A;  4TXQ A;  4ILG A;  1FVF A;  1HG5 A;  1Z3X A;  2UY1 A;  1OCC E;  5EDS A;  3O4Z A;  2LSU A;  4HQD A;  1N94 A;  2XQ0 A;  3DRA A;  5D66 A;  3FDH A;  2AXU A;  2ZGD A;  4CDR A;  4GTO A;  5ARG A;  2CHX A;  5FIO A;  2OEW A;  4CGV A;  4B8A A;  2IFU A;  1UN9 A;  4MS6 A;  4GMJ A;  3IKO B;  3RKV A;  4YDO A;  2IOL A;  2V0P A;  4U0Z A;  2EIN E;  4V3I A;  4KXK B;  5KCM A;  3SF4 A;  3R9A B;  3FU0 A;  2EIJ E;  3UMV A;  4OAV B;  4HBD A;  1PAQ A;  3FUM A;  4J8D A;  2P9U G;  3SY2 A;  4D10 C;  4PUC A;  4DLQ A;  3CK7 A;  3ISM C;  4APF A;  3U4T A;  3SHF A;  1QBQ A;  3CSF A;  3Q5M A;  2IO2 C;  3FUI A;  4F6R D;  1E7V A;  3IEG A;  2J8S D;  1BI8 B;  3OXF A;  3LXU X;  2OND A;  5ENS D;  4UI9 J;  3FTW A;  1JUQ A;  4BX9 A;  4CYM D;  2CFZ A;  3FFL A;  2YHC A;  5G04 J;  3ZIM A;  5CBO A;  3JXI A;  3ASO E;  3CHO A;  4ANW A;  2L0T B;  4KVO A;  1IYG A;  3MKQ A;  2VJ8 A;  2UWJ G;  3PVL A;  2KAT A;  4RG6 A;  5KNG A;  3DSW A;  5EKQ D;  2OOE A;  3FUF A;  4APO A;  1OCZ E;  4I6J A;  3L08 A;  1W3B A;  4K03 A;  3QWV A;  4JC8 A;  4Q94 A;  5E76 A;  4CDM A;  1QZ2 A;  1QYM A;  4AVX A;  1H6O A;  3Q7A A;  1G3N B;  5A23 A;  2L6J A;  3B95 A;  1ZU2 A;  3RO3 A;  1N95 A;  3UT7 A;  3Q15 A;  1FVH A;  2GGF A;  3BEE A;  3ZYM A;  2I6H A;  3J5Q B;  2M63 A;  2GW1 A;  1E90 A;  1JWG A;  3HDX A;  3ZUV B;  2BTD A;  4NQ0 A;  4GZC A;  2LNI A;  3DPY A;  3LVR E;  2OV8 A;  2ZIS A;  5IY5 E;  4ANV A;  3L16 A;  3UQ3 A;  1KPS B;  2XZT G;  1DNP A;  2XHE A;  4PDX A;  2P9N G;  1U3D A;  1Z6T A;  2H6I A;  2BED A;  3CQG B;  2V5Q C;  1QNF A;  1UW4 B;  4JPS A;  3LYA A;  2X6I A;  5H7P A;  4HRL A;  4UWH A;  2QZA A;  1VDY A;  3NQP A;  3TWV A;  3CVV A;  4GYW A;  4GA2 A;  3B7S A;  2IEJ A;  4J8E A;  4BT8 A;  4HXI A;  5JA4 D;  5AAO A;  3DSS A;  4I2Z A;  2AJA A;  1L5J A;  2OVB A;  3ESL A;  2DYS E;  3CVW A;  4GZ6 A;  3CST A;  4GZ3 A;  1OUV A;  4FUL A;  3FUH A;  5LX8 A;  4U96 D;  5G04 C;  1RZ4 A;  2F8Y A;  3EIJ A;  4GB9 A;  4F53 A;  2XEV A;  2XGM A;  3ZHE B;  2X6H A;  4ANX A;  2PZI A;  3AS4 A;  4B93 B;  4EBA G;  2DVW A;  4K5A B;  2GRN B;  5FQ6 A;  3MV3 B;  4U8Y D;  1MYO A;  1NZN A;  3ULY A;  2IO3 C;  1SW6 A;  3LEW A;  1H2U A;  3UIP C;  2Y3A A;  3UPV A;  3KEA A;  3VTY A;  2H6H A;  5CCL A;  3U64 A;  2WXR A;  3NBN B;  2KCV A;  1FT2 A;  3ZGQ A;  3Q7F A;  5B1B E;  4ME2 A;  5A7D B;  3MCX A;  4GAA A;  4EZJ A;  1LD7 A;  1NI1 A;  3ZEF A;  3EHR A;  1WY6 A;  3P2B A;  3OXL A;  4JHR A;  3HG0 D;  1S0P A;  4R7L A;  2OEV A;  2RG8 A;  3ABK E;  2EIK E;  4FP7 A;  3FH7 A;  1B89 A;  4LRZ A;  5HS0 A;  3UM2 A;  3QWP A;  2IU1 A;  2X3M A;  1ZB1 A;  3DXK G;  5AN8 A;  2OCC E;  3EHM A;  4ATG A;  4C0E A;  2QY7 A;  2KCL A;  1TNO A;  1LF8 A;  3E30 A;  4XKC A;  2PM6 A;  3T5V A;  3O48 A;  4L9P A;  1MX2 A;  1U3C A;  3UXG A;  3LKU A;  3LJ3 A;  3GZ1 A;  5ANL A;  4PS8 A;  2WQH A;  3K9I A;  3LVQ E;  4G25 A;  2WQ7 A;  4UUC A;  1HFA A;  2HE0 A;  4CRW A;  5G05 C;  4KZC A;  3V2O A;  3BG1 B;  3ZXP A;  2VTB A;  2VSN A;  2AXV A;  2DIW A;  3CLJ A;  2LAI A;  4JHK A;  1NA3 A;  3I3N A;  4I43 A;  1E96 B;  4GU5 A;  5CMW A;  3ZW3 A;  2VGE A;  3U9W A;  2P2C P;  1XNF A;  1E8X A;  2VGY A;  5FQ4 A;  4BWR A;  2XCC A;  3TG4 A;  2EIL E;  2P9I G;  5G2N A;  2Y1L E;  3RRM B;  4ACL A;  3PS6 A;  4EZL A;  1YA0 A;  3DPD A;  2I1J A;  5EIL A;  2KXP C;  4XIF A;  4LCT A;  4WWN A;  4JHJ A;  2CHW A;  2IY0 C;  4MKT A;  1MHQ A;  3F6Q A;  4GZ5 A;  4WUY A;  3MKQ B;  1OXJ A;  3QB2 A;  2LO6 A;  3APF A;  3ASN E;  2WM9 A;  1V54 E;  3UT8 A;  3GZ2 A;  2BKG A;  3ZPJ A;  3D9J A;  5ENT D;  2LAH A;  3ZFW A;  3E32 A;  1ELR A;  4CEM A;  4B8C B;  1ELW A;  3OXG A;  4N3B A;  3HXC A;  5KNH D;  2VSY A;  1HF8 A;  5ENR D;  1N4P A;  3FUL A;  3CV0 A;  2KZT B;  3NOG D;  2WXQ A;  5ENO D;  1EPU A;  3D9I A;  4JA7 A;  3PZD A;  4FLB A;  3V30 A;  1YMP A;  3UM0 A;  3TJP A;  2IJG X;  4BTB A;  4XE0 A;  1Z5S C;  2ZXW E;  2HYZ A;  1O1T A;  3EIQ C;  3HXE A;  4AOF A;  5KWD A;  5BNW A;  4KMO A;  3CHM A;  4JVS A;  2V5F A;  4U8V D;  3ONL A;  3FUD A;  1DCE A;  3C5R A;  4GTP A;  3BQO A;  4TUU A;  2XZD G;  2XGO A;  2V4L A;  1OCR E;  3FTY A;  4U7E B;  3ML9 A;  2L6B A;  4NIK A;  2YIN A;  3CQC B;  1KZO A;  4GTM A;  2VGX B;  3NZU A;  4U8H A;  3TWQ A;  2JEK A;  4A55 A;  5LCW C;  2CFU A;  3CR3 A;  4J8F A;  3TXN A;  4GZD A;  3D9L A;  3KAE A;  3Q9U C;  3KD7 A;  4FLH A;  1MJ0 A;  2DYR E;  3IBE A;  2RFA A;  1KZP A;  5C1D A;  3TL5 A;  5FJY A;  3S7B A;  3AS5 A;  1D9S A;  1UG3 A;  3SZ7 A;  2WXH A;  1JCR A;  2DZO A;  1S64 A;  3UKU G;  3HIZ A;  3FWV A;  5BW8 C;  3T8K A;  2ETC A;  4GCN A;  3APC A;  5AQA A;  2MYO A;  3CHR A;  2KBX A;  2WXI A;  5LOZ A;  2KM4 A;  2A5U A;  2WMO A;  4U63 A;  2JAB A;  4BT9 A;  3R7R A;  3PNL B;  4GTS A;  4I1A A;  5ENN A;  2ETA A;  1HE8 A;  2P9S G;  4TRQ A;  5JHB A;  1TN7 A;  3ASG A;  1N54 A;  5FZS A;  1S63 A;  4GYY A;  3VLE A;  4N5C A;  4PS3 A;  3MKR A;  1SQM A;  2FUL A;  2MOW A;  1A17 A;  3E37 A;  3DBS A;  1LD8 A;  3FH8 A;  4J8S A;  4HLL A;  2LSV A;  5EID A;  1IHG A;  3V2X A;  2X6J A;  1OT8 A;  1TNU A;  3E33 A;  5FQ8 A;  4ILH B;  4K5B A;  3LCA A;  2YNQ A;  2IF4 A;  2VSO E;  4B0Z A;  3PUJ A;  5HRY A;  1JWF A;  4H7Y A;  1Y8M A;  1JCS A;  5CCM A;  2XPZ A;  3FY4 A;  2C2L A;  4KBQ A;  3UIN C;  2RD0 A;  3QJZ A;  4NRH B;  4RLY A;  3CVL A;  3Q4A B;  3NF1 A;  1UN8 A;  4DJA A;  3HYM B;  1INZ A;  1HXI A;  1TN6 A;  2J49 A;  3SBS A;  3C72 A;  3TXM A;  1FPP A;  5FZR A;  4YND A;  5BV1 A;  5D0Q D;  4EHM A;  4DX6 D;  2L0I A;  3ZYL A;  1NA0 A;  1BPO A;  3PEV B;  2R17 C;  3UI2 A;  3FU3 A;  2EIM E;  2R5S A;  4ZFH A;  4UQX A;  5G55 A;  5CRV A;  1SA5 A;  2QYU A;  1TR4 A;  2WVI A;  5FIN A;  1OWN A;  2A4Z A;  4G1T A;  4HRM B;  3V79 K;  1E7U A;  3C3O A;  2WMN A;  3SQV A;  3RRU A;  4Z68 A;  4DRX E;  1UJK A;  2R03 A;  3MGB A;  3IV0 A;  2ZU6 B;  1N4Q A;  4UWK A;  1K3Z D;  4K0R A;  3L17 A;  2WB2 A;  3ZKJ A;  4I9C A;  3ENE A;  2XEH A;  4U95 D;  5FQ7 A;  3SD5 A;  2F8X K;  4EPZ A;  3FHE A;  5T4Y A;  4WNF A;  3UX4 A;  4BSZ B;  2PQN A;  4AJW A;  3RIB A;  3AJI A;  1NFI E;  3B7U X;  3NOC D;  3ML8 A;  3BU8 A;  1KLX A;  3PZ1 A;  1WG0 A;  2XRY A;  3UKR G;  3DST A;  4A63 B;  2FEZ A;  5G05 J;  3I5P A;  4WND A;  3CVX A;  2AXZ A;  2GRL A;  1D8D A;  3D9K A;  3DEO A;  3X2Q E;  4HOT A;  1DC2 A;  2QYJ A;  3HVE B;  2J08 A;  3AG4 E;  3PRE A;  1ELK A;  4O6F A;  2R02 A;  4CT0 A;  4A3T A;  3LS8 A;  3MJW A;  4Y6C A;  3W9F A;  1PC2 A;  4I1M A;  2AW6 A;  5KJL A;  2ZIR A;  3JYS A;  2AWI A;  2WXN A;  1UJJ A;  1ZBP A;  2P9P G;  5A6C A;  3UT4 A;  2J09 A;  1TNY A;  4HNA D;  4OYS A;  4XKB A;  4ILI A;  4BES A;  3S7J A;  2BUG A;  1H19 A;  5LP0 A;  4J6I A;  3PE3 A;  4BEP A;  2R59 A;  3SNX A;  2GRO B;  2VYI A;  1DCQ A;  1OY3 D;  4A3V A;  1HO8 A;  2C0L A;  5D0O D;  2P9K G;  1OWL A;  3PH0 C;  3ABM E;  4G24 A;  2WXM A;  4TUM A;  2PQR A;  4WNG A;  4BX8 A;  5BUZ A;  4DI4 A;  3CVN A;  4WNE A;  3EU9 A;  2VQ2 A;  1AP7 A;  4G2V A;  5AAR A;  5EYL A;  2XCB A;  4ABN A;  1E8W A;  5BT1 A;  4U0U A;  3FTZ A;  2DCP A;  4UI9 K;  4URK A;  4JEU A;  1OWM A;  3ASH A;  5CEC B;  4MLP A;  5BV0 A;  3V31 A;  1MX4 A;  4KVM A;  3RJV A;  3Q47 B;  1IHB A;  1N0Q A;  3FU5 A;  2R2L A;  4I6E A;  4G8L A;  3GW4 A;  4Q96 A;  3FTV A;  3B7R L;  5C2Y A;  4UWF A;  3RK6 A;  3C98 A;  1RW2 A;  2H6F A;  3UM1 A;  2UY1 B;  4U04 A;  5AQB A;  3ASF A;  5HI7 A;  5JJT A;  5DBK A;  2X38 A;  4LUN U;  4LNG A;  4O1P A;  4LEU A;  4RQI A;  3NAW A;  4GPK A;  2WXJ A;  3FU6 A;  2LXM A;  5HQ8 A;  4UQZ A;  4DLO A;  1SVX A;  3DSU A;  4B89 A;  3Q49 B;  3D9M A;  5LCW J;  1BU9 A;  3QDN A;  3LY8 A;  2XS1 A;  4I9E A;  3SFZ A;  2GRM A;  1P5Q A;  2BKK B;  3MZL B;  4JZY A;  4U0S A;  3G2U A;  2PNN A;  2YQ8 A;  3ZYK A;  3ZXS A;  2Y69 E;  2XEN A;  3CEQ A;  4HOS A;  1O1S A;  4BTA A;  3ZHE A;  3DXM G;  3QC1 A;  5JJ6 A;  5AJD A;  4H7X A;  4J0U A;  4LSZ E;  2V4H C;  5KJM A;  4DUI A;  2WXO A;  5E75 A;  3ZRH A;  2Y4T A;  3PNT B;  3ONK A;  2FO7 A;  2I1K A;  2WXP A;  3NZS A;  4DX1 A;  5JHA A;  4FJY A;  4GTR A;  5AIJ A;  4L2L A;  4IN3 B;  1IXV A;  3L54 A;  2LXL A;  4L23 A;  3L9T A;  2X6F A;  4LNB A;  4OVV A;  3DSX A;  3RRN B;  3FUN A;  1K1B A;  1TEZ A;  3NB2 A;  3SFY A;  3D9P A;  4PS7 A;  3R9M A;  4GCO A;  4YVO A;  4MRU A;  1WM5 A;  4N39 A;  2L9B A;  1TYQ G;  4XI9 A;  4AXH A;  3I4G A;  3TG5 A;  3I4R B;  1SZ9 A;  4TXR A;  5B3S E;  1A5E A;  4LER A;  3G2S A;  5T3R A;  2CG2 A;  4AM9 A;  4N2S A;  3IXE A;  4DX2 A;  3QKY A;  5AQ9 A;  1N11 A;  4OVU A;  3TWX A;  2DWZ A;  4IRU A;  1Z3Y A;  3JQ1 A;  4YDW A;  4GMR A;  1QQE A;  2XEE A;  3RSE G;  2WXK A;  4P29 A;  2DBA A;  3LDZ A;  1UOH A;  2NSZ A;  4W9R A;  3RO2 A;  3IHY A;  4XX5 A;  4UWG A;  3CGH A;  1Q2Z A;  1X81 A;  4GA0 A;  2IOS A;  4BET A;  4CZ2 D;  5BXU A;  1HZ4 A;  4DX5 D;  2B6C A;  3FEX A;  1OWO A;  5CEA A;  4I1O B;  3T9K A;  4KYO B;  4HI8 A;  3MA5 A;  4YDE A;  3MEK A;  4FU3 A;  3HXB A;  2GRP B;  3HXF A;  3JXJ A;  3CK9 A;  4LG6 A;  1MX6 A;  3L82 A;  2XPY A;  1H6P A;  3LJN A;  4HB5 A;  4EZK A;  4AV7 A;  4RSY A;  1SZA A;  4XI0 A;  4J7W A;  3Q75 A;  2VSX E;  4WAF A;  2FO1 E;  3GZS A;  4HLE A;  1U2V G;  2BF0 X;  4DX7 D;  3ASD A;  4E85 A;  2NXP A;  3L22 A;  4K5C A;  4B94 A;  2PL2 A;  4F1P A;  1MQS A;  3MX3 A;  4KZ0 A;  5J90 A;  4GML A;  5CRU A;  3T5X A;  3DEP A;  3L13 A;  5CHE E;  5DIZ A;  3SFX A;  3AU5 A;  2E2E A;  4XZ4 A;  4BSX A;  1TN8 A;  3URZ A;  2QC9 A;  5JJ7 A;  1IKN D;  1JCQ A;  1Y6I A;  1K1A A;  3EUV A;  1LTX A;  3SI5 A;  3G2T A;  4DPR A;  3IHV A;  3C3Q A;  2WXF A;  3CHP A;  3WXX A;  2I2O A;  3EJN A;  4JA9 A;  4HRN A;  4JL0 A;  5T8I A;  2J4D A;  4AY6 A;  2B0O E;  1E8Z A;  2I9C A;  3AG2 E;  1GW6 A;  1D8E A;  3BG0 B;  3PRZ A;  3D9N A;  2P58 C;  4ZHB A;  1BI7 B;  5AEN A;  1WAO 1;  2E0I A;  2WPV A;  2YHE A;  1H0A A;  4JXT A;  4UQY A;  3ULE G;  4RG9 A;  5ARF A;  4GYO A;  3SGH A;  4FJZ A;  4M3O A;  2ZGG A;  3LY7 A;  4G26 A;  4WWO A;  4AEZ C;  2KZT A;  4MBG A;  1N9A A;  2JLB A;  1TJC A;  4JD2 G;  1X5B A;  3ZNG A;  1TJF A;  4L7T A;  3UUX A;  2WXL A;  2ETB A;  3JUI A;  1H2T C;  4A1S A;  4HI9 A;  3TWW A;  3HRA A;  2VTB B;  5BPP A;  4PH4 B;  3P1U A;  4IYP A;  3W9G A;  3APD A;  1EYH A;  1H2V C;  3SBT B;  1HU3 A;  4RVB A;  1PY1 A;  2RFM A;  3OAW A;  1SA4 A;  3C3R A;  4KT6 B;  3E34 A;  3JUE A;  3D3M A;  2FBN A;  2PM7 A;  5ENQ D;  1K8K G;  3MYV A;  1KT1 A;  2VGX A;  2A5E A;  2ILR A;  4F7A A;  3CKC A;  4Q69 A;  1N4R A;  2LUH A;  4ATZ D;  1H6K A;  5AYW D;  3TWU A;  2H6G A;  4UWL A;  3VLF A;  2J4B A;  4I17 A;  4QFV A;  4IUL A;  4UI9 C;  4C48 B;  5D2M C;  3EDT B;  3ZU7 B;  3FUE A;  3RU0 A;  1O5M A;  2CG3 A;  5CER B;  3SO8 A;  2EQX A;  3G2W A;  5EYP F;  3ZYQ A;  3VTX A;  4AY5 A;  3CKB A;  1OWP A;  1JPL A;  2J07 A;  3B7T A;  3PEU B;  4DK5 A;  3KSL A;  2MRI A;  4CT4 A;  3PZ2 A;  3QNK A;  3CVQ A;  3LPZ A;  1EF1 C;  4U07 A;  1HH8 A;  2F0Y A;  3CK8 A;  4QQI A;  4ANU A;  3QAQ A;  2R05 A;  5EX3 A;  3HHM A;  4JW1 A;  3CVP A;  3S7F A;  3AS8 A;  2IQC A;  3T8M A;  3FTS A;  1WDY A;  3KEZ A;  4L1B A;  3TWS A;  3AG3 E;  3FEY A;  5EX0 A;  5AJL A;  2GRR B;  4C0M A;  3CHQ A;  3TGO A;  4A1G A;  2FI7 A;  2HR2 A;  3QWW A;  4GTT A;  3B7B A;  2V8S E;  1YCS B;  1BLX B;  5KJN A;  4TV3 A;  1TNB A;  2KCK A;  3TWT A;  3D9O A;  2XPI A;  5EIB E;  2FF4 A;  4BFR A;  3U66 A;  3OTN A;  3HXD A;  4X8Q A;  1FT1 A;  3QOU A;  3ULQ A;  3TWR A;  5ENP D;  1N0R A;  1DVP A;  3E4B A;  3BUA A;  1XGW A;  1O1R A;  4FAD A;  2J9Q A;  3Q79 A;  1NP7 A;  2Y4U A;  3ESK A;  3R7Q A;  4HOU A;  2KC7 A;  3N71 A;  4O1O A;  5B1A E;  5FTP A;  5BXO A;  1YYH A;  2MHK A;  5JMN D;  1HS6 A;  3L6A A;  4FHJ A;  4HOR A;  1IQR A;  1HX8 A;  3ZVV A;  3EU5 A;  3B13 A;  4FHK A;  4G23 A;  4XEI G;  1AWC B;  2RKK A;  3S7D A;  4YDY A;  5ITZ F;  4HOQ A;  3QK0 A;  4I6G A;  1KT0 A;  2CHZ A;  1N52 A;  3FH5 A;  4J8Y A;  3UIO C;  2OVF A;  1OCO E;  3WG7 E;  2WXG A;  3GYZ A;  5EN5 D;  4G11 A;  2HO1 A;  3FTX A;  3DSV A;  2Y0B G;  2HM8 A;  3TAX A;  2XRZ A;  1EDU A;  2GRQ B;  4CCA A;  3EHQ A;  4CDN A;  3Q9N C;  4L2Y A;  3Q73 A;  3KSQ A;  3ZN3 A;  4C9B B;  4HVB A;  4GPM A;  3MV2 B;  4GTV A;  3UM3 A;  3FUJ A;  3HVE A;  3CVY A;  4F1S A;  3JQ0 A;  4N2Q A;  3LY9 A;  4EQF A;  3PE4 A;  1IQU A;  4BY6 A;  3PZ4 A;  1MZC A;  3PDN A;  4G8K A;  4NAC A;  1V55 E;  2QFC A;  2DZN A;  2ION A;  1FCH A;  3D9H A;  3J5P A;  1S70 B;  2C0M A;  1HG2 A;  2P9L G;  4N5Q A;  3CVU A;  4M7C A;  4DI3 A;  2WQ6 A;  3CHS A;  3QAR A;  5CMY A;  5AQ7 A;  4CGW A;  3S2A A;  4TXP A;  3FP3 A;  3AAA C;  2NC9 A;  3U3W A;  3KS2 A;  5M72 A;  5FZQ A;  2XS8 A;  3PUK A;  3UTM A;  5KJK A;  4AP2 A;  2AVP A;  4ACK A;  4AIF A;  5J08 A;  2Q7F A;  1NL4 A;  1BD8 A;  3FTU A;  4LNU D;  4FC8 A;  4HS2 A;  4O60 A;  5KBA A;  3ABL E;  4N3A A;  3PZ3 A;  3VLD A;  3CIA A;  4FA6 A;  1E8Y A;  4EBA A;  4EEC A;  3RAU A; 
#chains in the Genus database with same CATH homology
 3AU4 A;  3U9W A;  5AEN A;  1WAO 1;  1XNF A;  1E8X A;  2E0I A;  2VGY A;  2WPV A;  2YHE A;  4OYS A;  4XKB A;  5FQ4 A;  4BWR A;  4ILI A;  1H0A A;  2XCC A;  4JXT A;  4UQY A;  2BUG A;  3S7J A;  3TG4 A;  3FUK A;  4JEH A;  4RG9 A;  1H19 A;  4GA1 A;  5LP0 A;  5G2N A;  5ARF A;  2XGS A;  4GYO A;  3SGH A;  4J6I A;  3EHN A;  4WWP A;  3RRM B;  4ACL A;  3PS6 A;  3PE3 A;  4FJZ A;  4M3O A;  4YVQ C;  4EZL A;  3LY7 A;  4G26 A;  4HFG A;  4WWO A;  2R59 A;  3SNX A;  2X6K A;  3G2V A;  4AEZ C;  2KZT A;  2VYI A;  4E6H A;  1YA0 A;  4Y6W A;  5LFA A;  3DPD A;  4I2W A;  5FT9 A;  2JLB A;  3JCK C;  4NUR A;  4A3V A;  1HO8 A;  1TJC A;  2I1J A;  4N3C A;  5FWQ A;  2C0L A;  5ANR A;  4F3V A;  1X5B A;  5D0O D;  4ILG A;  4XIF A;  1OWL A;  3PH0 C;  1FVF A;  1HG5 A;  1TJF A;  1Z3X A;  4L7T A;  4G24 A;  4LCT A;  2UY1 A;  3UUX A;  2WXM A;  4WNG A;  2PQR A;  4BX8 A;  2WXL A;  5EDS A;  4WWN A;  4JHJ A;  3O4Z A;  5BUZ A;  2CHW A;  3JUI A;  4DI4 A;  1H2T C;  4MKT A;  4A1S A;  3CVN A;  4WNE A;  2LSU A;  2XQ0 A;  2VQ2 A;  3FDH A;  2AXU A;  1MHQ A;  2VTB B;  4G2V A;  4GZ5 A;  5BPP A;  4CDR A;  4PH4 B;  5ARG A;  2CHX A;  4WUY A;  4ANU A;  3MKQ B;  3P1U A;  4CGV A;  4IYP A;  4B8A A;  2IFU A;  3QB2 A;  1UN9 A;  3APD A;  1EYH A;  1H2V C;  4MS6 A;  3SBT B;  4GMJ A;  2LO6 A;  3APF A;  2XCB A;  4ABN A;  1HU3 A;  4RVB A;  2WM9 A;  3IKO B;  1E8W A;  3RKV A;  1PY1 A;  5BT1 A;  2IOL A;  2V0P A;  4U0U A;  4U0Z A;  4V3I A;  3OAW A;  3FTZ A;  3UT8 A;  4KXK B;  2DCP A;  4UI9 K;  4URK A;  3GZ2 A;  4JEU A;  1OWM A;  3ASH A;  4KT6 B;  5KCM A;  3SF4 A;  3ZPJ A;  4MLP A;  3D9J A;  3R9A B;  5BV0 A;  3D3M A;  2FBN A;  3FU0 A;  2LAH A;  2PM7 A;  3UMV A;  3ZFW A;  1PAQ A;  1ELR A;  4CEM A;  3FUM A;  4J8D A;  4B8C B;  1ELW A;  4KVM A;  3OXG A;  4D10 C;  3RJV A;  3Q47 B;  3MYV A;  4N3B A;  1KT1 A;  4PUC A;  4DLQ A;  2VGX A;  3CK7 A;  4APF A;  3U4T A;  2VSY A;  3SHF A;  3FU5 A;  2ILR A;  3CSF A;  3Q5M A;  4I6E A;  1HF8 A;  3FUL A;  4F7A A;  3CV0 A;  3FUI A;  3GW4 A;  3CKC A;  1E7V A;  3IEG A;  4Q96 A;  4Q69 A;  2KZT B;  3FTV A;  3B7R L;  5C2Y A;  2WXQ A;  4UWF A;  1H6K A;  3OXF A;  3LXU X;  1EPU A;  2OND A;  3RK6 A;  3D9I A;  5AYW D;  3C98 A;  4JA7 A;  4UI9 J;  4UWL A;  3FTW A;  3VLF A;  2J4B A;  1JUQ A;  2UY1 B;  4U04 A;  4BX9 A;  3PZD A;  2CFZ A;  4FLB A;  4I17 A;  3FFL A;  4QFV A;  2YHC A;  5G04 J;  3ZIM A;  3ASF A;  3CHO A;  5HI7 A;  5JJT A;  3TJP A;  2IJG X;  4IUL A;  4ANW A;  4XE0 A;  4BTB A;  2L0T B;  5DBK A;  2X38 A;  4KVO A;  4LUN U;  4UI9 C;  2HYZ A;  4LEU A;  3EIQ C;  1IYG A;  4AOF A;  3EDT B;  2VJ8 A;  3MKQ A;  5BNW A;  4KMO A;  3FUE A;  3CHM A;  2UWJ G;  3RU0 A;  4JVS A;  2V5F A;  2CG3 A;  3PVL A;  2KAT A;  4RG6 A;  3ONL A;  5EKQ D;  3FUD A;  2OOE A;  2EQX A;  3G2W A;  3FUF A;  4GPK A;  3ZYQ A;  4APO A;  2WXJ A;  4I6J A;  3FU6 A;  3VTX A;  3L08 A;  1W3B A;  4AY5 A;  3CKB A;  1OWP A;  4TUU A;  4K03 A;  2XGO A;  1JPL A;  2J07 A;  2V4L A;  3B7T A;  3QWV A;  5HQ8 A;  4UQZ A;  4DLO A;  3PEU B;  4B89 A;  4JC8 A;  3Q49 B;  3FTY A;  4Q94 A;  4DK5 A;  3D9M A;  3ML9 A;  2MRI A;  5E76 A;  5LCW J;  4CDM A;  4CT4 A;  3QDN A;  1QZ2 A;  4AVX A;  2YIN A;  3CQC B;  3QNK A;  3LY8 A;  5A23 A;  2VGX B;  3NZU A;  4U8H A;  2JEK A;  3CVQ A;  3LPZ A;  2CFU A;  3CR3 A;  1EF1 C;  4U07 A;  2L6J A;  4J8F A;  3TXN A;  4A55 A;  5LCW C;  1HH8 A;  4I9E A;  4GZD A;  3D9L A;  3SFZ A;  3CK8 A;  3KAE A;  2GRM A;  3KD7 A;  1ZU2 A;  1P5Q A;  3MZL B;  3QAQ A;  4FLH A;  5EX3 A;  3RO3 A;  3HHM A;  4JZY A;  4U0S A;  3G2U A;  4JW1 A;  3IBE A;  3UT7 A;  3Q15 A;  2YQ8 A;  3CVP A;  3S7F A;  1FVH A;  2GGF A;  3AS8 A;  3BEE A;  3ZYK A;  5C1D A;  3ZYM A;  2IQC A;  3T8M A;  3FTS A;  3TL5 A;  5FJY A;  2I6H A;  3KEZ A;  4L1B A;  3S7B A;  3AS5 A;  3FEY A;  5EX0 A;  3ZXS A;  2M63 A;  5AJL A;  4C0M A;  3CHQ A;  3TGO A;  1UG3 A;  2GW1 A;  3CEQ A;  4A1G A;  3SZ7 A;  2FI7 A;  2WXH A;  1E90 A;  2HR2 A;  1JWG A;  3HDX A;  3QWW A;  4HOS A;  4BTA A;  2BTD A;  2V8S E;  4NQ0 A;  4GZC A;  2LNI A;  3HIZ A;  3LVR E;  3ZHE A;  2OV8 A;  5KJN A;  3FWV A;  5BW8 C;  4ANV A;  4TV3 A;  3L16 A;  3UQ3 A;  3QC1 A;  5JJ6 A;  2KCK A;  3D9O A;  2XPI A;  4GCN A;  2FF4 A;  3APC A;  5AJD A;  4H7X A;  4BFR A;  3U66 A;  3OTN A;  1DNP A;  2XHE A;  4J0U A;  4PDX A;  3CHR A;  5KJM A;  1U3D A;  1Z6T A;  2WXI A;  5LOZ A;  2KM4 A;  2A5U A;  2WMO A;  3QOU A;  3CQG B;  3ULQ A;  4U63 A;  1QNF A;  2WXO A;  5E75 A;  3ZRH A;  1DVP A;  3E4B A;  4BT9 A;  2Y4T A;  1XGW A;  3R7R A;  4FAD A;  3PNL B;  1UW4 B;  4I1A A;  4JPS A;  5ENN A;  3PNT B;  1HE8 A;  3ONK A;  3LYA A;  2J9Q A;  2X6I A;  2FO7 A;  4TRQ A;  2I1K A;  2WXP A;  5JHB A;  3NZS A;  4UWH A;  3ASG A;  1NP7 A;  5JHA A;  1VDY A;  1N54 A;  2Y4U A;  4FJY A;  5FZS A;  3NQP A;  3ESK A;  4GYY A;  3R7Q A;  5AIJ A;  4HOU A;  2KC7 A;  4L2L A;  3N71 A;  3CVV A;  4GYW A;  4GA2 A;  4IN3 B;  3L54 A;  3B7S A;  4BT8 A;  4J8E A;  5FTP A;  4L23 A;  3VLE A;  2X6F A;  4N5C A;  4PS3 A;  3MKR A;  4HXI A;  1SQM A;  2FUL A;  2MOW A;  1A17 A;  4OVV A;  3DBS A;  3RRN B;  3FH8 A;  3FUN A;  2MHK A;  1TEZ A;  4I2Z A;  4J8S A;  1L5J A;  3D9P A;  1HS6 A;  2OVB A;  3L6A A;  2LSV A;  4FHJ A;  4PS7 A;  3ESL A;  1IHG A;  4GCO A;  4YVO A;  2X6J A;  3CVW A;  4HOR A;  4GZ6 A;  4MRU A;  1IQR A;  1WM5 A;  4N39 A;  2L9B A;  3CST A;  4GZ3 A;  1OUV A;  1HX8 A;  4FUL A;  4XI9 A;  3FUH A;  5LX8 A;  3ZVV A;  4AXH A;  3I4G A;  3TG5 A;  3I4R B;  1SZ9 A;  5G04 C;  3EIJ A;  4GB9 A;  5FQ8 A;  4F53 A;  4ILH B;  2XEV A;  2XGM A;  3LCA A;  2YNQ A;  2IF4 A;  4FHK A;  3B13 A;  2VSO E;  4LER A;  3ZHE B;  4B0Z A;  3G2S A;  2X6H A;  5T3R A;  2CG2 A;  4ANX A;  4AM9 A;  4G23 A;  3PUJ A;  1JWF A;  2PZI A;  4H7Y A;  1Y8M A;  4N2S A;  3AS4 A;  5CCM A;  4EBA G;  3QKY A;  2XPZ A;  3FY4 A;  3S7D A;  5FQ6 A;  3MV3 B;  2C2L A;  4OVU A;  1NZN A;  4HOQ A;  4IRU A;  3QK0 A;  1Z3Y A;  3JQ1 A;  4I6G A;  4KBQ A;  1KT0 A;  2CHZ A;  1N52 A;  3FH5 A;  1QQE A;  2RD0 A;  3QJZ A;  2OVF A;  4NRH B;  3LEW A;  1H2U A;  3CVL A;  3Q4A B;  3NF1 A;  1UN8 A;  2Y3A A;  2WXK A;  4P29 A;  2WXG A;  3GYZ A;  4DJA A;  3UPV A;  4G11 A;  3HYM B;  1INZ A;  2DBA A;  3LDZ A;  2HO1 A;  3FTX A;  1HXI A;  3VTY A;  2HM8 A;  2NSZ A;  3TAX A;  5CCL A;  4W9R A;  3U64 A;  2WXR A;  3IHY A;  4XX5 A;  4UWG A;  3CGH A;  3RO2 A;  1EDU A;  2XRZ A;  4CCA A;  2KCV A;  2J49 A;  4GA0 A;  4CDN A;  3SBS A;  2IOS A;  3ZGQ A;  3TXM A;  4L2Y A;  4ME2 A;  1HZ4 A;  5FZR A;  4YND A;  5BV1 A;  5A7D B;  5D0Q D;  3ZN3 A;  3MCX A;  4GAA A;  3FEX A;  2L0I A;  1OWO A;  4C9B B;  4EZJ A;  4HVB A;  3ZYL A;  1NA0 A;  1BPO A;  3PEV B;  2R17 C;  3MV2 B;  3ZEF A;  4I1O B;  1WY6 A;  3P2B A;  4KYO B;  3OXL A;  4JHR A;  3FU3 A;  3MA5 A;  2R5S A;  4UQX A;  3FUJ A;  3MEK A;  5G55 A;  4FU3 A;  3HVE A;  3CVY A;  4F1S A;  1S0P A;  2WVI A;  3CK9 A;  3JQ0 A;  4R7L A;  4N2Q A;  1OWN A;  2A4Z A;  3LY9 A;  2RG8 A;  4G1T A;  3PE4 A;  4EQF A;  1E7U A;  1IQU A;  4BY6 A;  4FP7 A;  3PDN A;  3FH7 A;  2XPY A;  2WMN A;  4NAC A;  2QFC A;  3RRU A;  2ION A;  1FCH A;  1B89 A;  4LRZ A;  4EZK A;  4AV7 A;  3QWP A;  4RSY A;  1SZA A;  1UJK A;  2IU1 A;  4XI0 A;  3MGB A;  2X3M A;  3IV0 A;  2ZU6 B;  2C0M A;  1HG2 A;  2VSX E;  4UWK A;  4WAF A;  3GZS A;  4K0R A;  3L17 A;  2WB2 A;  4HLE A;  3CVU A;  4I9C A;  3ENE A;  5FQ7 A;  3SD5 A;  2BF0 X;  3EHM A;  3ASD A;  4DI3 A;  4E85 A;  4EPZ A;  2NXP A;  2WQ6 A;  3L22 A;  4ATG A;  4C0E A;  3CHS A;  3FHE A;  5T4Y A;  3QAR A;  2QY7 A;  2KCL A;  4WNF A;  5CMY A;  3UX4 A;  3S2A A;  2PL2 A;  4B94 A;  4CGW A;  2PQN A;  1LF8 A;  1MQS A;  3MX3 A;  4KZ0 A;  3FP3 A;  4GML A;  4AJW A;  5J90 A;  3T5X A;  3RIB A;  4XKC A;  2NC9 A;  2PM6 A;  3T5V A;  3B7U X;  3O48 A;  3L13 A;  5CHE E;  3U3W A;  1U3C A;  5DIZ A;  3AU5 A;  2E2E A;  3KS2 A;  3LKU A;  3LJ3 A;  3ML8 A;  4XZ4 A;  4BSX A;  1KLX A;  3GZ1 A;  5M72 A;  5FZQ A;  5ANL A;  3URZ A;  4PS8 A;  2XRY A;  5JJ7 A;  3PUK A;  2WQH A;  5KJK A;  2FEZ A;  5G05 J;  4AP2 A;  1Y6I A;  2AVP A;  3I5P A;  3K9I A;  4WND A;  4ACK A;  3CVX A;  2AXZ A;  5A6C A;  3LVQ E;  2GRL A;  4G25 A;  2WQ7 A;  4AIF A;  5J08 A;  1HFA A;  2Q7F A;  3SI5 A;  3D9K A;  3G2T A;  4CRW A;  4DPR A;  3IHV A;  4HOT A;  5G05 C;  2WXF A;  3HVE B;  2J08 A;  3CHP A;  4KZC A;  3WXX A;  3FTU A;  3PRE A;  4FC8 A;  2I2O A;  3EJN A;  4HS2 A;  4JA9 A;  1ELK A;  3BG1 B;  4O6F A;  4CT0 A;  2VTB A;  2VSN A;  2AXV A;  4A3T A;  3LS8 A;  2DIW A;  3MJW A;  4JL0 A;  4Y6C A;  5T8I A;  3CLJ A;  2J4D A;  4N3A A;  1PC2 A;  4I1M A;  2AW6 A;  2LAI A;  4AY6 A;  5KJL A;  3JYS A;  2AWI A;  2WXN A;  4JHK A;  1UJJ A;  3VLD A;  1E8Z A;  1ZBP A;  1NA3 A;  2I9C A;  3CIA A;  3I3N A;  4I43 A;  1GW6 A;  1E96 B;  3BG0 B;  4GU5 A;  4FA6 A;  5CMW A;  3PRZ A;  3ZW3 A;  1E8Y A;  3D9N A;  4EBA A;  2P58 C;  4EEC A;  3UT4 A;  2J09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...