4TUMA

Crystal structure of ankyrin repeat domain of akr2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
122
structure length
122
Chain Sequence
ESIVHQTASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNSQLEVVKLLEKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ankyrin repeat domain-containing protein 2
publication title An Ankyrin Repeat Domain of AKR2 Drives Chloroplast Targeting through Coincident Binding of Two Chloroplast Lipids.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 41
structure length 122
sequence length 122
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4tumA00
5CECB 2DZNA 3KEAA 3T9KA 4OAUC 4CZ2D 1S70B 2AJAA 3B7BA 4BEPA 1SW6A 4N5QA 4HQDA 3TWUA 5AQ7A 4K5CA 3TWVA 4BETA 3V31A 4A63B 5FINA 5EILA 3F6QA 3TWSA 4YDYA 5KBAA 4HLLA 5KNHD 4QQIA 5CEAA 4HRNA 5BXUA 4QFVA 3JUEA 2F8XK 5KWDA 1TR4A 3J5PA 3IXEA 3C5RA 3EHQA 4LG6A 1K3ZD 5HS0A 1IXVA 5D66A 2B0OE 4B93B 4O60A 2ETAA 2PNNA 2JABA 1A5EA 2P2CP 3NOCD 4BERA 5CBOA 1MYOA 1UOHA 4U96D 4CYMD 4HB5A 4J7WA 4BESA 4O1OA 1BLXB 3ZUVB 4RLYA 1BD8A 4HNAD 4BSZB 4C48B 3UTMA 2KBXA 1DCQA 1YYHA 1MJ0A 1G3NB 5EYLA 4Z68A 4ZFHA 1OY3D 2DWZA 2ZGDA 1AP7A 3TWQA 3UXGA 5HKPA 4LNUD 2RFMA 1WDYA 4HI8A 5AN8A 4JB8P 3V2OA 4DX5D 1D9SA 4F6RD 2Y0BG 5CBNA 2MYOA 1AWCB 3V2XA 2XEHA 4O1PA 4DX6D 4HBDA 5EYPF 3T8KA 4HRMB 1BU9A 2BKGA 3DEPA 5FIOA 3TWRA 3DEOA 5KNGA 3ZKJA 5ENQD 2A5EA 5ENTD 4GMRA 3J5QB 5ITZF 2KXPC 1IKND 2HE0A 5ENRD 2RFAA 4U8VD 4DX1A 3Q9UC 4DRXE 1WG0A 3EU9A 3HG0D 3JXJA 4YDWA 3ZNGA 3W9FA 3ZU7B 3TWWA 2DZOA 5EN5D 3EHRA 3NOGD 4NIKA 3NBNB 2NYJA 5CERB 5AARA 5JA4D 5JMND 2BKKB 3B95A 2ZGGA 1MX4A 5AQ9A 4K5AB 1N0QA 5BXOA 4TUMA 1NFIE 3TWXA 5EIDA 1SVXA 4G8KA 1IHBA 3JXIA 3HRAA 4J8YA 5HRYA 2XZDG 2V5QC 2XZTG 3D9HA 3AAAC 4GPMA 1OT8A 4HI9A 4DX7D 1N11A 4U95D 2XEEA 3W9GA 4ATZD 4F1PA 4K5BA 4DUIA 5ENSD 3V79K 2L6BA 2F8YA 1DC2A 4UUCA 3TWTA 4ZHBA 4OAVB 5AQBA 4HRLA 1K1BA 5ENOD 1BI7B 1QYMA 2QYJA 5AQAA 5AAOA 3Q9NC 2ETBA 4G8LA 1MX2A 3UI2A 5CEDB 1YCSB 2ETCA 3LJNA 1N0RA 2Y1LE 1K1AA 2J8SD 5EIBE 2F37A 1YMPA 4DX2A 2QC9A 2VGEA 5ENPD 1MX6A 2DVWA 2V4HC 3V30A 3SO8A 2FO1E 4LSZE 2XENA 4U8YD 3AJIA 1BI8B
chains in the Genus database with same CATH superfamily
1FT1A 4KVOA 3FUHA 4CZ2D 3Q78A 4N3BA 2XRZA 3CR3A 4UQYA 2KZTA 3NQPA 3CVYA 4HRNA 4AOFA 2VTBA 1K8KG 4I9EA 4XI0A 3ULEG 4BERA 1MYOA 2X6IA 2J49A 4UQZA 5ENNA 3FTYA 4L1BA 4YNDA 3IV0A 1OUVA 2RKKA 1IHGA 2WXKA 5KJLA 4L9PA 3HXFA 3MX3A 3QWPA 4GA0A 3T8MA 4O1PA 3G2SA 3CVQA 5AYWD 3B7UX 3AS5A 4PDXA 5CMYA 1O1SA 4I1MA 1OCZE 3ASDA 2V5FA 3HXCA 3GYZA 3PEVB 5DIZA 1N0QA 3QB2A 1H2TC 4UI9J 4YDEA 2L6BA 5JJ6A 4KBQA 1H6KA 5AQBA 1BI7B 3LY9A 3NB2A 2EILE 5G04J 3E32A 4O6FA 3MKQA 4MLPA 4G11A 1Q2ZA 3FUNA 3KEAA 2Y4UA 3WG7E 1OCOE 4HQDA 3AS4A 1E90A 4A63B 5T8IA 4I1AA 4HLLA 2YQ8A 4RG6A 3C5RA 3EHQA 4LUNU 3UT7A 2JABA 2XHEA 4CYMD 5JHAA 5BUZA 5CRVA 3O4ZA 1NA0A 3AG1E 4HNAD 3C3QA 1DCQA 1LTXA 3UIOC 1TJFA 2DWZA 1E96B 1WM5A 2XPZA 2P9IG 2DBAA 4N39A 4HXIA 3AG4E 2PZIA 2R03A 2XCBA 1SZAA 3LKUA 2XGSA 3I5PA 1JPLA 3OTNA 3ZGQA 5AJLA 1H6OA 2ZISA 2EIKE 2PQRA 1IYGA 4GA2A 2OVBA 4DX7D 4BT8A 1U2VG 3QWVA 3FUJA 4HFGA 2GRQB 4DI3A 2KC7A 4Q94A 1QYMA 3FU0A 4BX9A 3QNKA 3VLDA 3Q9NC 4G8LA 1K1AA 3FU5A 2HM8A 3QK0A 4WUYA 1MX6A 2WXNA 2DVWA 4GTVA 4GTSA 3CQGB 4N3AA 4LCTA 2IOSA 1N95A 1HH8A 2HO1A 3BEEA 5CEAA 2J09A 3UT4A 2FI7A 3HYMB 1N4RA 3SZ7A 3L17A 4WNDA 4MRUA 2BEDA 3L54A 3FTVA 3B7RL 5EYLA 4Z68A 2ZGDA 3UXGA 4E6HA 5FTPA 4HOSA 3K9IA 4ME2A 3CVUA 2WXGA 3SQVA 2EIME 2Y0BG 3SHFA 3V2XA 5JJTA 5FIOA 4L2LA 3UM1A 5KNGA 3ML9A 3PDNA 5ENQD 2YHEA 4B8CB 1IKND 1H19A 3T5VA 1FPPA 4GAAA 2WXIA 2P9UG 2NYJA 5AARA 4GCOA 4FHJA 4J8YA 1TN8A 3AAAC 4EBAA 4ATZD 5EKQD 3DSSA 4UUCA 5LX8A 3TXMA 4HRLA 3B13A 4Q96A 2H6IA 1OWPA 3KAEA 5AAOA 1EDUA 4FLBA 1Z6TA 3HVEA 2GW1A 4KXKB 3ZPJA 4A1GA 4EZLA 4I6EA 2L9BA 4AXHA 5AQ7A 3CIAA 4A55A 3BUAA 2DZNA 3I4RB 4IULA 4I9CA 3QJZA 3DSVA 5JHBA 5CHEE 3CVPA 3TG5A 1IQUA 2CHWA 4ANUA 2WMNA 1UJKA 4JD2G 5A6CA 5D66A 1A5EA 1H6PA 5E76A 4A3TA 1O1TA 4FHKA 4WWNA 1OWOA 2WXPA 2QYUA 3AG2E 3FUFA 3ESKA 4I43A 3TG4A 2XPYA 2WXJA 2KCKA 5EYPF 1Z3YA 2YNQA 2WXHA 5FQ6A 1GW6A 2EINE 3Q75A 1TEZA 1HF8A 3B7TA 3EU9A 3JXJA 3ZU7B 3ZRHA 2ZXWE 2I1JA 1OWNA 2R02A 4JZYA 5CERB 2I6HA 5AQ9A 4APOA 2XEVA 5BXOA 4TUMA 2XZDG 2V5QC 4HI9A 4GTMA 2XEEA 4BFRA 4DUIA 2Y4TA 2DCPA 2P9KG 3ZFWA 2CHZA 2ZU6B 2P9SG 1O1RA 4WWPA 4FJYA 3E34A 4P29A 1QNFA 1H2UA 4EECA 2EIJE 2J8SD 4Q69A 3RRNB 1N9AA 1KPSB 4FLHA 4PS3A 2V4HC 1TN7A 4K5CA 3AJIA 3N71A 1L5JA 3B7BA 5HQ8A 1SW6A 5EILA 3CK8A 5KBAA 2WPVA 3PNLB 2AXVA 4A3VA 5KWDA 3J5PA 3MV3B 4LG6A 3DWLG 4WAFA 4HORA 1PY1A 2F0YA 3U4TA 2A4ZA 4AVXA 3DPDA 4M7CA 2I9CA 3ASHA 3APDA 3IBEA 5AIJA 2BF0X 2AVPA 2PQNA 4NURA 4HLEA 1G3NB 1E7UA 2FF4A 2IOLA 3V2OA 4DX5D 4U07A 4TUUA 2XS8A 5KJKA 4JXTA 4ATGA 1OWLA 3FULA 1BU9A 2Y3AA 1D8EA 4GMRA 3JCKC 5ITZF 4N2QA 3FTZA 3D9JA 4JPSA 4GMLA 3LDZA 5EX3A 1E8WA 4PS7A 1MX4A 2JEKA 3R9MA 5FQ4A 3CGHA 3FTUA 2E2EA 3LS8A 2LSUA 2VYIA 1INZA 5HRYA 2FO7A 1JUQA 4WNFA 3ZYKA 1MQSA 2RG8A 3TWTA 4ZHBA 4F3VA 3RKVA 3ZVVA 3D9NA 4TRQA 3FUMA 5ARFA 4JHJA 5DBKA 4I1OB 3UINC 1QBQA 1OWMA 3APCA 4YDOA 4ANWA 2XENA 4FULA 5CECB 3UM2A 5T3RA 1HZ4A 3ENEA 3PNTB 3NZUA 4U7EB 4O60A 3NOCD 3CVNA 3HDXA 3RRUA 1ZB1A 4BSXA 4ILGA 5CMWA 4HOTA 4TXPA 3MJWA 4I17A 3S7DA 4FJZA 2WXFA 1YYHA 4EHMA 3JUIA 4CDMA 5T4YA 4J8DA 4GZ5A 4PH4B 3FTSA 5CBNA 2XEHA 3GW4A 3I4GA 4B0ZA 2V4LA 3VTXA 4YDWA 3ZNGA 3HHMA 4GZCA 1NP7A 2LXLA 1OT8A 3ESLA 5ENSD 3GZSA 4GZDA 1K1BA 3CQCB 2XGOA 5AQAA 4G25A 2GRNB 1N0RA 2Y1LE 1OCCE 1PC2A 4IRUA 1FT2A 4RG9A 3ABLE 3ZYLA 3LY7A 3L22A 2ILRA 2R59A 2NSZA 1PAQA 3FUIA 2LAHA 3DXMG 2AJAA 2MOWA 1WY6A 1NL4A 3UKUG 5KNHD 5BXUA 3CKBA 4QFVA 3L13A 1TNBA 2AW6A 1V55E 3OXLA 1N4QA 5FZQA 3ULYA 4C0EA 3MEKA 2L6JA 4HB5A 4A1SA 5D0OD 2P58C 4BSZB 3DXKG 2IFUA 3EHNA 3PUKA 4B89A 4WNGA 4LNGA 3DSTA 1E8XA 4LRZA 3B7SA 4G1TA 3ONKA 2XGMA 1TYQG 3E33A 4C9BB 4EBAG 4GTOA 1KZPA 5H7PA 4DX1A 1WG0A 5EN5D 5G55A 1ZU2A 1U3DA 2IQCA 4U63A 3ZXPA 4XEIG 3PZ3A 3W9GA 3QOUA 5M72A 3V79K 5LCWC 2X38A 2VSNA 3Q7FA 3RU0A 3SY2A 3PZ2A 5C2YA 4GMJA 4RQIA 5EIBE 3BQOA 4EPZA 3APFA 1YMPA 4BTBA 3V30A 3Q47B 4ACLA 4OAUC 4AM9A 3OXGA 4GCNA 4B94A 5FINA 5BPPA 3AG3E 1H0AA 3TWSA 4IYPA 3O48A 4GZ6A 4K03A 1Z3XA 3NF1A 1OXJA 1K3ZD 5HS0A 1IXVA 3FEXA 2P2CP 4U0SA 4GTTA 3EDTB 3TL5A 3MV2B 4UWGA 3DSUA 4U0ZA 1MJ0A 1SA5A 3C98A 2RFMA 3L08A 3UUXA 4F6RD 4HBDA 2IEJA 4AV7A 2CFUA 3ZKJA 1SQMA 2HE0A 3R7QA 1E7VA 3W9FA 1LF8A 3G2WA 3UIPC 1XGWA 3NBNB 2X6JA 3RRMB 3ZW3A 2BKKB 3PUJA 3WXXA 2VSYA 3T5XA 2XS1A 3FU3A 3TWXA 3CHSA 1LD8A 3HXEA 4F1PA 3Q5MA 4WWOA 3RK6A 4G2VA 3UI2A 3LVQE 4FP7A 3BU8A 5ARGA 3QKYA 4LSZE 4U8YD 4GA1A 5A7DB 4F1SA 3D3MA 2J07A 4N5QA 3FP3A 1A17A 4JEUA 1N54A 4U04A 3DRAA 4IN3B 3R9AB 1JWGA 1TR4A 4PUCA 3NAWA 4HVBA 5G05C 3L9TA 4CRWA 2YHCA 3QC1A 1HU3A 1WAO1 3CVLA 5FQ7A 2OOEA 2KCLA 2UWJG 3L82A 2WQ7A 3PREA 4MS6A 2HR2A 3E37A 3S7FA 3NZSA 2DYSE 2LO6A 4XE0A 3CVWA 5LP0A 2MRIA 2A5EA 2WXLA 4GZ3A 5ENRD 3Q9UC 4DRXE 5FT9A 4GYOA 4UWKA 2LSVA 3ML8A 3HXBA 3NOGD 4UWLA 4G26A 5C1DA 3MA5A 3CHRA 4BY6A 4ILHB 4CT4A 3B95A 4ILIA 4MBGA 3RO3A 2RD0A 1SVXA 5LCWJ 1KLXA 3HRAA 1UN8A 3ZN3A 1HXIA 4ACKA 4XKCA 1QZ2A 5BT1A 5KJNA 2QYJA 4HOQA 3LXUX 4AIFA 2F37A 4MKTA 2VGEA 3Q7AA 4BWRA 4D10C 3LPZA 5FZSA 2IO3C 2PL2A 1HG5A 2QFCA 5CCMA 4AY6A 5KJMA 4BETA 2B6CA 3D9OA 4F53A 4ANVA 2FEZA 4QQIA 4BT9A 2GRPB 2KATA 3P1UA 1UN9A 2F8XK 2X6FA 1N4PA 3EIQC 3Q73A 4EZKA 4RVBA 5A23A 1JCRA 4H7YA 4J6IA 4JVSA 3QAQA 5EX0A 2WXRA 4J7WA 3UM3A 2VJ8A 4U0UA 3FUDA 3U66A 4NRHB 1FCHA 4H7XA 4HS2A 4GTRA 2VSOE 2XPIA 3PE4A 3PH0C 4OYSA 4LNUD 2OCCE 3DEOA 3FU6A 3FDHA 2OEWA 1HO8A 1RZ4A 2DZOA 1HX8A 2YINA 3FWVA 3QDNA 4J8EA 1QQEA 2LUHA 3ZIMA 5G04C 3R7RA 3RJVA 4GPMA 4U95D 1TNYA 2R5SA 3D9KA 1DCEA 2F8YA 3RSEG 4J8FA 1JCSA 4GB9A 2CFZA 3PZ4A 4YVQC 3CHPA 3Q79A 3GZ2A 3CHOA 4PS8A 1NA3A 4DX2A 2HYZA 3ZXSA 3RAUA 4CCAA 2UY1B 1BI8B 4FU3A 3AU4A 1EPUA 4DLQA 2X3MA 2IY0C 3D9IA 3EU5A 1SZ9A 3FTWA 3VLFA 1UW4B 2J9QA 3FY4A 3V31A 5G05J 1DVPA 4YDYA 1ELKA 2WVIA 2XRYA 3IXEA 3PEUB 3UX4A 2WXMA 3GZ1A 2J08A 4AJWA 4R7LA 3ASFA 3UTMA 4L2YA 3SBSA 1U3CA 3HXDA 3SFXA 2P9LG 1WDYA 3CEQA 2AXZA 2MYOA 4GYYA 4F7AA 1AWCB 3ZHEB 2AXUA 3LY8A 2WMOA 3VLEA 4J8SA 3TWRA 3CVXA 4FADA 3FH5A 1KZOA 2KCVA 2Y69E 3DPYA 4B8AA 1S0PA 4TXRA 3IKOB 2WQ6A 2WB2A 2PM6A 3UMVA 1O5MA 4CGWA 1NFIE 1KT1A 3SF4A 3VTYA 3ABME 1N11A 2H6HA 2P9PG 1DC2A 3PS6A 1RW2A 5E75A 3G2UA 4KZ0A 3ZYMA 1B89A 5BV1A 1TNUA 4FC8A 4KYOB 3TGOA 1XNFA 2LNIA 4ANXA 2QY7A 3Q49B 2M63A 3CSFA 3UKRG 2DIWA 3Q15A 3BG1B 3PE3A 3RIBA 3S7BA 3KSLA 4DI4A 3ONLA 4X8QA 3MGBA 5FQ8A 3KS2A 4C48B 2XQ0A 4RSYA 3ZYQA 2L0TB 3FH8A 1DNPA 2KBXA 1ZBPA 1OY3D 2V0PA 2A5UA 3PRZA 2I2OA 2CHXA 3G2TA 1UJJA 3ASGA 1Y6IA 3TJPA 1H2VC 4I2ZA 3QARA 5ENTD 3G2VA 4K0RA 4JC8A 4I6JA 2VGYA 2J4BA 1D8DA 3I3NA 3EHRA 4NIKA 2C0MA 2EQXA 2V8SE 3KSQA 1TN6A 5JMND 4EQFA 4K5AB 5BNWA 4G8KA 1IQRA 3TAXA 3D9HA 3UM0A 4N5CA 1YA0A 3BG0B 3OXFA 3FEYA 3MZLB 4JA9A 5ENOD 4DPRA 4G24A 2ETBA 4HOUA 1YCSB 2ETCA 2H6FA 5KCMA 4LEUA 4YVOA 4M3OA 4Y6CA 4JHRA 2AWIA 3T9KA 2DYRE 4NACA 1S70B 4XX5A 4LERA 3FH7A 2OVFA 3ASNE 4CEMA 1X5BA 1E8ZA 4B93B 4AP2A 2ETAA 3S7JA 2Q7FA 1TNZA 1S63A 4AY5A 4KVMA 4O1OA 2KZTB 3SBTB 1BD8A 1HE8A 2JLBA 4XZ4A 4BX8A 5AJDA 2VTBB 4ZFHA 2L0IA 2IU1A 3DBSA 3TWQA 1TNOA 1TJCA 2GRLA 4HI8A 3Q4AB 1D9SA 3C3OA 2R2LA 1W3BA 5HI7A 3ABKE 3E4BA 2KXPC 4DJAA 2R05A 1ELRA 3AS8A 5J90A 3EHMA 5B1BE 2X6KA 4CT0A 3IHYA 1BPOA 3KEZA 4TXQA 1FVHA 4UWHA 4KT6B 2LAIA 3RO2A 1HFAA 4AEZC 3EUVA 4OAVB 3ISMC 4GU5A 2VQ2A 5BV0A 2P9NG 4BTAA 3KD7A 5CEDB 2GGFA 5ENPD 1UG3A 4ABNA 3SO8A 3CHMA 1OCRE 4XI9A 3PVLA 3U64A 4U8HA 3CK9A 3FHEA 4URKA 3TWUA 3FUEA 3TWVA 1SA4A 4APFA 2BTDA 3MKQB 1MHQA 2VGXA 3CKCA 4L23A 5FZRA 5B3SE 5JJ7A 3SGHA 2PNNA 1EYHA 1UOHA 2H6GA 4NQ0A 3DSXA 2OV8A 4BESA 1E8YA 1BLXB 3ZUVB 2WXOA 4KZCA 4RLYA 2IJGX 2GRRB 5D2MC 1KT0A 5BW8C 2CG2A 3U9WA 2NC9A 3AU5A 5AN8A 3E30A 4GYWA 4JB8P 1JWFA 3JQ1A 2WXQA 5CRUA 3T8KA 3MKRA 4HRMB 2BKGA 2GROB 3X2QE 2RFAA 4C0MA 1JCQA 3L16A 4E85A 3OAWA 5B1AE 2C0LA 4N2SA 3PZDA 3JXIA 2FULA 5D0QD 3U3WA 2UY1A 2WQHA 5LOZA 2GRMA 1LD7A 3IHVA 3JQ0A 3HIZA 3EIJA 3JYSA 5CCLA 3UPVA 3SI5A 3QWWA 1N94A 4G23A 4UWFA 4WNEA 1P5QA 2J4DA 4XIFA 3D9LA 2IF4A 1N4SA 3JUEA 3C3RA 4UI9K 2WM9A 3LVRE 1N52A 3MCXA 1FVFA 1S64A 2KM4A 3ZHEA 3SNXA 4DLOA 1EF1C 3UT8A 1AP7A 2VSXE 4UQXA 4DX6D 4GTQA 1HS6A 3LYAA 3DEPA 1V54E 2R17C 1NZNA 4XKBA 3J5QB 1HG2A 3CK7A 5J08A 3CV0A 4U8VD 2FBNA 3HG0D 3UQ3A 4OVUA 4GPKA 5JA4D 2VGXB 5ANRA 1X81A 4L7TA 5EIDA 2CG3A 1ELWA 1IHBA 3S2AA 3D9MA 1VDYA 2OEVA 5ANLA 4UI9C 2MHKA 2E0IA 5AENA 1MZCA 3LJNA 4DK5A 2PM7A 4CDRA 3LEWA 2FO1E 4CGVA 4JHKA 4JEHA 2QZAA 3LJ3A 4TV3A 4BEPA 3HVEB 3F6QA 2ONDA 4N3CA 4JA7A 3PZ1A 3FUKA 2B0OE 4OVVA 5CBOA 4I2WA 4U96D 4I6GA 2BUGA 3TXNA 3P2BA 1Z5SC 3DSWA 5LFAA 2IONA 2X6HA 4Y6WA 3ZEFA 4J0UA 3IEGA 5HKPA 4V3IA 5IY5E 2XCCA 3C72A 1NI1A 4LNBA 4FA6A 2I1KA 4GTPA 3LCAA 5EDSA 5FWQA 3CVVA 3EJNA 3L6AA 3FFLA 3TWWA 2IO2C 2LXMA 3ULQA 4KMOA 2ZGGA 4EZJA 3SFYA 2XZTG 2ZIRA 4W9RA 4JL0A 4K5BA 3URZA 3FTXA 3MYVA 4CDNA 2NXPA 2C2LA 3D9PA 3ASOE 1Y8MA 3CSTA 5FJYA 1MX2A 3SD5A 5G2NA 3CHQA 4JW1A 3CLJA 2QC9A 3SFZA
chains in the Genus database with same CATH topology
5CECB 2DZNA 3KEAA 3T9KA 4OAUC 4CZ2D 1S70B 2AJAA 3B7BA 4BEPA 1SW6A 4N5QA 4HQDA 3TWUA 5AQ7A 4K5CA 3TWVA 4BETA 3V31A 4A63B 5FINA 5EILA 3F6QA 3TWSA 4YDYA 5KBAA 4HLLA 5KNHD 4QQIA 5CEAA 4HRNA 5BXUA 4QFVA 3JUEA 2F8XK 5KWDA 1TR4A 3J5PA 3IXEA 3C5RA 3EHQA 4LG6A 1K3ZD 5HS0A 1IXVA 5D66A 2B0OE 4B93B 4O60A 2ETAA 2PNNA 2JABA 1A5EA 2P2CP 3NOCD 4BERA 5CBOA 1MYOA 1UOHA 4U96D 4CYMD 4HB5A 4J7WA 4BESA 4O1OA 1BLXB 3ZUVB 4RLYA 1BD8A 4HNAD 4BSZB 4C48B 3UTMA 2KBXA 1DCQA 1YYHA 1MJ0A 1G3NB 5EYLA 4Z68A 4ZFHA 1OY3D 2DWZA 2ZGDA 1AP7A 3TWQA 3UXGA 5HKPA 4LNUD 2RFMA 1WDYA 4HI8A 5AN8A 4JB8P 3V2OA 4DX5D 1D9SA 4F6RD 2Y0BG 5CBNA 2MYOA 1AWCB 3V2XA 2XEHA 4O1PA 4DX6D 4HBDA 5EYPF 3T8KA 4HRMB 1BU9A 2BKGA 3DEPA 5FIOA 3TWRA 3DEOA 5KNGA 3ZKJA 5ENQD 2A5EA 5ENTD 4GMRA 3J5QB 5ITZF 2KXPC 1IKND 2HE0A 5ENRD 2RFAA 4U8VD 4DX1A 3Q9UC 4DRXE 1WG0A 3EU9A 3HG0D 3JXJA 4YDWA 3ZNGA 3W9FA 3ZU7B 3TWWA 2DZOA 5EN5D 3EHRA 3NOGD 4NIKA 3NBNB 2NYJA 5CERB 5AARA 5JA4D 5JMND 2BKKB 3B95A 2ZGGA 1MX4A 5AQ9A 4K5AB 1N0QA 5BXOA 4TUMA 1NFIE 3TWXA 5EIDA 1SVXA 4G8KA 1IHBA 3JXIA 3HRAA 4J8YA 5HRYA 2XZDG 2V5QC 2XZTG 3D9HA 3AAAC 4GPMA 1OT8A 4HI9A 4DX7D 1N11A 4U95D 2XEEA 3W9GA 4ATZD 4F1PA 4K5BA 4DUIA 5ENSD 3V79K 2L6BA 2F8YA 1DC2A 4UUCA 3TWTA 4ZHBA 4OAVB 5AQBA 4HRLA 1K1BA 5ENOD 1BI7B 1QYMA 2QYJA 5AQAA 5AAOA 3Q9NC 2ETBA 4G8LA 1MX2A 3UI2A 5CEDB 1YCSB 2ETCA 3LJNA 1N0RA 2Y1LE 1K1AA 2J8SD 5EIBE 2F37A 1YMPA 4DX2A 2QC9A 2VGEA 5ENPD 1MX6A 2DVWA 2V4HC 3V30A 3SO8A 2FO1E 4LSZE 2XENA 4U8YD 3AJIA 1BI8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CEC B;  2DZN A;  3KEA A;  3T9K A;  4OAU C;  4CZ2 D;  1S70 B;  2AJA A;  3B7B A;  4BEP A;  1SW6 A;  4N5Q A;  4HQD A;  3TWU A;  5AQ7 A;  4K5C A;  3TWV A;  4BET A;  3V31 A;  4A63 B;  5FIN A;  5EIL A;  3F6Q A;  3TWS A;  4YDY A;  5KBA A;  4HLL A;  5KNH D;  4QQI A;  5CEA A;  4HRN A;  5BXU A;  4QFV A;  3JUE A;  2F8X K;  5KWD A;  1TR4 A;  3J5P A;  3IXE A;  3C5R A;  3EHQ A;  4LG6 A;  1K3Z D;  5HS0 A;  1IXV A;  5D66 A;  2B0O E;  4B93 B;  4O60 A;  2ETA A;  2PNN A;  2JAB A;  1A5E A;  2P2C P;  3NOC D;  4BER A;  5CBO A;  1MYO A;  1UOH A;  4U96 D;  4CYM D;  4HB5 A;  4J7W A;  4BES A;  4O1O A;  1BLX B;  3ZUV B;  4RLY A;  1BD8 A;  4HNA D;  4BSZ B;  4C48 B;  3UTM A;  2KBX A;  1DCQ A;  1YYH A;  1MJ0 A;  1G3N B;  5EYL A;  4Z68 A;  4ZFH A;  1OY3 D;  2DWZ A;  2ZGD A;  1AP7 A;  3TWQ A;  3UXG A;  5HKP A;  4LNU D;  2RFM A;  1WDY A;  4HI8 A;  5AN8 A;  4JB8 P;  3V2O A;  4DX5 D;  1D9S A;  4F6R D;  2Y0B G;  5CBN A;  2MYO A;  1AWC B;  3V2X A;  2XEH A;  4O1P A;  4DX6 D;  4HBD A;  5EYP F;  3T8K A;  4HRM B;  1BU9 A;  2BKG A;  3DEP A;  5FIO A;  3TWR A;  3DEO A;  5KNG A;  3ZKJ A;  5ENQ D;  2A5E A;  5ENT D;  4GMR A;  3J5Q B;  5ITZ F;  2KXP C;  1IKN D;  2HE0 A;  5ENR D;  2RFA A;  4U8V D;  4DX1 A;  3Q9U C;  4DRX E;  1WG0 A;  3EU9 A;  3HG0 D;  3JXJ A;  4YDW A;  3ZNG A;  3W9F A;  3ZU7 B;  3TWW A;  2DZO A;  5EN5 D;  3EHR A;  3NOG D;  4NIK A;  3NBN B;  2NYJ A;  5CER B;  5AAR A;  5JA4 D;  5JMN D;  2BKK B;  3B95 A;  2ZGG A;  1MX4 A;  5AQ9 A;  4K5A B;  1N0Q A;  5BXO A;  4TUM A;  1NFI E;  3TWX A;  5EID A;  1SVX A;  4G8K A;  1IHB A;  3JXI A;  3HRA A;  4J8Y A;  5HRY A;  2XZD G;  2V5Q C;  2XZT G;  3D9H A;  3AAA C;  4GPM A;  1OT8 A;  4HI9 A;  4DX7 D;  1N11 A;  4U95 D;  2XEE A;  3W9G A;  4ATZ D;  4F1P A;  4K5B A;  4DUI A;  5ENS D;  3V79 K;  2L6B A;  2F8Y A;  1DC2 A;  4UUC A;  3TWT A;  4ZHB A;  4OAV B;  5AQB A;  4HRL A;  1K1B A;  5ENO D;  1BI7 B;  1QYM A;  2QYJ A;  5AQA A;  5AAO A;  3Q9N C;  2ETB A;  4G8L A;  1MX2 A;  3UI2 A;  5CED B;  1YCS B;  2ETC A;  3LJN A;  1N0R A;  2Y1L E;  1K1A A;  2J8S D;  5EIB E;  2F37 A;  1YMP A;  4DX2 A;  2QC9 A;  2VGE A;  5ENP D;  1MX6 A;  2DVW A;  2V4H C;  3V30 A;  3SO8 A;  2FO1 E;  4LSZ E;  2XEN A;  4U8Y D;  3AJI A;  1BI8 B; 
#chains in the Genus database with same CATH topology
 1FT1 A;  4KVO A;  3FUH A;  4CZ2 D;  3Q78 A;  4N3B A;  2XRZ A;  3CR3 A;  4UQY A;  2KZT A;  3NQP A;  3CVY A;  4HRN A;  4AOF A;  2VTB A;  1K8K G;  4I9E A;  4XI0 A;  3ULE G;  4BER A;  1MYO A;  2X6I A;  2J49 A;  4UQZ A;  5ENN A;  3FTY A;  4L1B A;  4YND A;  3IV0 A;  1OUV A;  2RKK A;  1IHG A;  2WXK A;  5KJL A;  4L9P A;  3HXF A;  3MX3 A;  3QWP A;  4GA0 A;  3T8M A;  4O1P A;  3G2S A;  3CVQ A;  5AYW D;  3B7U X;  3AS5 A;  4PDX A;  5CMY A;  1O1S A;  4I1M A;  1OCZ E;  3ASD A;  2V5F A;  3HXC A;  3GYZ A;  3PEV B;  5DIZ A;  1N0Q A;  3QB2 A;  1H2T C;  4UI9 J;  4YDE A;  2L6B A;  5JJ6 A;  4KBQ A;  1H6K A;  5AQB A;  1BI7 B;  3LY9 A;  3NB2 A;  2EIL E;  5G04 J;  3E32 A;  4O6F A;  3MKQ A;  4MLP A;  4G11 A;  1Q2Z A;  3FUN A;  3KEA A;  2Y4U A;  3WG7 E;  1OCO E;  4HQD A;  3AS4 A;  1E90 A;  4A63 B;  5T8I A;  4I1A A;  4HLL A;  2YQ8 A;  4RG6 A;  3C5R A;  3EHQ A;  4LUN U;  3UT7 A;  2JAB A;  2XHE A;  4CYM D;  5JHA A;  5BUZ A;  5CRV A;  3O4Z A;  1NA0 A;  3AG1 E;  4HNA D;  3C3Q A;  1DCQ A;  1LTX A;  3UIO C;  1TJF A;  2DWZ A;  1E96 B;  1WM5 A;  2XPZ A;  2P9I G;  2DBA A;  4N39 A;  4HXI A;  3AG4 E;  2PZI A;  2R03 A;  2XCB A;  1SZA A;  3LKU A;  2XGS A;  3I5P A;  1JPL A;  3OTN A;  3ZGQ A;  5AJL A;  1H6O A;  2ZIS A;  2EIK E;  2PQR A;  1IYG A;  4GA2 A;  2OVB A;  4DX7 D;  4BT8 A;  1U2V G;  3QWV A;  3FUJ A;  4HFG A;  2GRQ B;  4DI3 A;  2KC7 A;  4Q94 A;  1QYM A;  3FU0 A;  4BX9 A;  3QNK A;  3VLD A;  3Q9N C;  4G8L A;  1K1A A;  3FU5 A;  2HM8 A;  3QK0 A;  4WUY A;  1MX6 A;  2WXN A;  2DVW A;  4GTV A;  4GTS A;  3CQG B;  4N3A A;  4LCT A;  2IOS A;  1N95 A;  1HH8 A;  2HO1 A;  3BEE A;  5CEA A;  2J09 A;  3UT4 A;  2FI7 A;  3HYM B;  1N4R A;  3SZ7 A;  3L17 A;  4WND A;  4MRU A;  2BED A;  3L54 A;  3FTV A;  3B7R L;  5EYL A;  4Z68 A;  2ZGD A;  3UXG A;  4E6H A;  5FTP A;  4HOS A;  3K9I A;  4ME2 A;  3CVU A;  2WXG A;  3SQV A;  2EIM E;  2Y0B G;  3SHF A;  3V2X A;  5JJT A;  5FIO A;  4L2L A;  3UM1 A;  5KNG A;  3ML9 A;  3PDN A;  5ENQ D;  2YHE A;  4B8C B;  1IKN D;  1H19 A;  3T5V A;  1FPP A;  4GAA A;  2WXI A;  2P9U G;  2NYJ A;  5AAR A;  4GCO A;  4FHJ A;  4J8Y A;  1TN8 A;  3AAA C;  4EBA A;  4ATZ D;  5EKQ D;  3DSS A;  4UUC A;  5LX8 A;  3TXM A;  4HRL A;  3B13 A;  4Q96 A;  2H6I A;  1OWP A;  3KAE A;  5AAO A;  1EDU A;  4FLB A;  1Z6T A;  3HVE A;  2GW1 A;  4KXK B;  3ZPJ A;  4A1G A;  4EZL A;  4I6E A;  2L9B A;  4AXH A;  5AQ7 A;  3CIA A;  4A55 A;  3BUA A;  2DZN A;  3I4R B;  4IUL A;  4I9C A;  3QJZ A;  3DSV A;  5JHB A;  5CHE E;  3CVP A;  3TG5 A;  1IQU A;  2CHW A;  4ANU A;  2WMN A;  1UJK A;  4JD2 G;  5A6C A;  5D66 A;  1A5E A;  1H6P A;  5E76 A;  4A3T A;  1O1T A;  4FHK A;  4WWN A;  1OWO A;  2WXP A;  2QYU A;  3AG2 E;  3FUF A;  3ESK A;  4I43 A;  3TG4 A;  2XPY A;  2WXJ A;  2KCK A;  5EYP F;  1Z3Y A;  2YNQ A;  2WXH A;  5FQ6 A;  1GW6 A;  2EIN E;  3Q75 A;  1TEZ A;  1HF8 A;  3B7T A;  3EU9 A;  3JXJ A;  3ZU7 B;  3ZRH A;  2ZXW E;  2I1J A;  1OWN A;  2R02 A;  4JZY A;  5CER B;  2I6H A;  5AQ9 A;  4APO A;  2XEV A;  5BXO A;  4TUM A;  2XZD G;  2V5Q C;  4HI9 A;  4GTM A;  2XEE A;  4BFR A;  4DUI A;  2Y4T A;  2DCP A;  2P9K G;  3ZFW A;  2CHZ A;  2ZU6 B;  2P9S G;  1O1R A;  4WWP A;  4FJY A;  3E34 A;  4P29 A;  1QNF A;  1H2U A;  4EEC A;  2EIJ E;  2J8S D;  4Q69 A;  3RRN B;  1N9A A;  1KPS B;  4FLH A;  4PS3 A;  2V4H C;  1TN7 A;  4K5C A;  3AJI A;  3N71 A;  1L5J A;  3B7B A;  5HQ8 A;  1SW6 A;  5EIL A;  3CK8 A;  5KBA A;  2WPV A;  3PNL B;  2AXV A;  4A3V A;  5KWD A;  3J5P A;  3MV3 B;  4LG6 A;  3DWL G;  4WAF A;  4HOR A;  1PY1 A;  2F0Y A;  3U4T A;  2A4Z A;  4AVX A;  3DPD A;  4M7C A;  2I9C A;  3ASH A;  3APD A;  3IBE A;  5AIJ A;  2BF0 X;  2AVP A;  2PQN A;  4NUR A;  4HLE A;  1G3N B;  1E7U A;  2FF4 A;  2IOL A;  3V2O A;  4DX5 D;  4U07 A;  4TUU A;  2XS8 A;  5KJK A;  4JXT A;  4ATG A;  1OWL A;  3FUL A;  1BU9 A;  2Y3A A;  1D8E A;  4GMR A;  3JCK C;  5ITZ F;  4N2Q A;  3FTZ A;  3D9J A;  4JPS A;  4GML A;  3LDZ A;  5EX3 A;  1E8W A;  4PS7 A;  1MX4 A;  2JEK A;  3R9M A;  5FQ4 A;  3CGH A;  3FTU A;  2E2E A;  3LS8 A;  2LSU A;  2VYI A;  1INZ A;  5HRY A;  2FO7 A;  1JUQ A;  4WNF A;  3ZYK A;  1MQS A;  2RG8 A;  3TWT A;  4ZHB A;  4F3V A;  3RKV A;  3ZVV A;  3D9N A;  4TRQ A;  3FUM A;  5ARF A;  4JHJ A;  5DBK A;  4I1O B;  3UIN C;  1QBQ A;  1OWM A;  3APC A;  4YDO A;  4ANW A;  2XEN A;  4FUL A;  5CEC B;  3UM2 A;  5T3R A;  1HZ4 A;  3ENE A;  3PNT B;  3NZU A;  4U7E B;  4O60 A;  3NOC D;  3CVN A;  3HDX A;  3RRU A;  1ZB1 A;  4BSX A;  4ILG A;  5CMW A;  4HOT A;  4TXP A;  3MJW A;  4I17 A;  3S7D A;  4FJZ A;  2WXF A;  1YYH A;  4EHM A;  3JUI A;  4CDM A;  5T4Y A;  4J8D A;  4GZ5 A;  4PH4 B;  3FTS A;  5CBN A;  2XEH A;  3GW4 A;  3I4G A;  4B0Z A;  2V4L A;  3VTX A;  4YDW A;  3ZNG A;  3HHM A;  4GZC A;  1NP7 A;  2LXL A;  1OT8 A;  3ESL A;  5ENS D;  3GZS A;  4GZD A;  1K1B A;  3CQC B;  2XGO A;  5AQA A;  4G25 A;  2GRN B;  1N0R A;  2Y1L E;  1OCC E;  1PC2 A;  4IRU A;  1FT2 A;  4RG9 A;  3ABL E;  3ZYL A;  3LY7 A;  3L22 A;  2ILR A;  2R59 A;  2NSZ A;  1PAQ A;  3FUI A;  2LAH A;  3DXM G;  2AJA A;  2MOW A;  1WY6 A;  1NL4 A;  3UKU G;  5KNH D;  5BXU A;  3CKB A;  4QFV A;  3L13 A;  1TNB A;  2AW6 A;  1V55 E;  3OXL A;  1N4Q A;  5FZQ A;  3ULY A;  4C0E A;  3MEK A;  2L6J A;  4HB5 A;  4A1S A;  5D0O D;  2P58 C;  4BSZ B;  3DXK G;  2IFU A;  3EHN A;  3PUK A;  4B89 A;  4WNG A;  4LNG A;  3DST A;  1E8X A;  4LRZ A;  3B7S A;  4G1T A;  3ONK A;  2XGM A;  1TYQ G;  3E33 A;  4C9B B;  4EBA G;  4GTO A;  1KZP A;  5H7P A;  4DX1 A;  1WG0 A;  5EN5 D;  5G55 A;  1ZU2 A;  1U3D A;  2IQC A;  4U63 A;  3ZXP A;  4XEI G;  3PZ3 A;  3W9G A;  3QOU A;  5M72 A;  3V79 K;  5LCW C;  2X38 A;  2VSN A;  3Q7F A;  3RU0 A;  3SY2 A;  3PZ2 A;  5C2Y A;  4GMJ A;  4RQI A;  5EIB E;  3BQO A;  4EPZ A;  3APF A;  1YMP A;  4BTB A;  3V30 A;  3Q47 B;  4ACL A;  4OAU C;  4AM9 A;  3OXG A;  4GCN A;  4B94 A;  5FIN A;  5BPP A;  3AG3 E;  1H0A A;  3TWS A;  4IYP A;  3O48 A;  4GZ6 A;  4K03 A;  1Z3X A;  3NF1 A;  1OXJ A;  1K3Z D;  5HS0 A;  1IXV A;  3FEX A;  2P2C P;  4U0S A;  4GTT A;  3EDT B;  3TL5 A;  3MV2 B;  4UWG A;  3DSU A;  4U0Z A;  1MJ0 A;  1SA5 A;  3C98 A;  2RFM A;  3L08 A;  3UUX A;  4F6R D;  4HBD A;  2IEJ A;  4AV7 A;  2CFU A;  3ZKJ A;  1SQM A;  2HE0 A;  3R7Q A;  1E7V A;  3W9F A;  1LF8 A;  3G2W A;  3UIP C;  1XGW A;  3NBN B;  2X6J A;  3RRM B;  3ZW3 A;  2BKK B;  3PUJ A;  3WXX A;  2VSY A;  3T5X A;  2XS1 A;  3FU3 A;  3TWX A;  3CHS A;  1LD8 A;  3HXE A;  4F1P A;  3Q5M A;  4WWO A;  3RK6 A;  4G2V A;  3UI2 A;  3LVQ E;  4FP7 A;  3BU8 A;  5ARG A;  3QKY A;  4LSZ E;  4U8Y D;  4GA1 A;  5A7D B;  4F1S A;  3D3M A;  2J07 A;  4N5Q A;  3FP3 A;  1A17 A;  4JEU A;  1N54 A;  4U04 A;  3DRA A;  4IN3 B;  3R9A B;  1JWG A;  1TR4 A;  4PUC A;  3NAW A;  4HVB A;  5G05 C;  3L9T A;  4CRW A;  2YHC A;  3QC1 A;  1HU3 A;  1WAO 1;  3CVL A;  5FQ7 A;  2OOE A;  2KCL A;  2UWJ G;  3L82 A;  2WQ7 A;  3PRE A;  4MS6 A;  2HR2 A;  3E37 A;  3S7F A;  3NZS A;  2DYS E;  2LO6 A;  4XE0 A;  3CVW A;  5LP0 A;  2MRI A;  2A5E A;  2WXL A;  4GZ3 A;  5ENR D;  3Q9U C;  4DRX E;  5FT9 A;  4GYO A;  4UWK A;  2LSV A;  3ML8 A;  3HXB A;  3NOG D;  4UWL A;  4G26 A;  5C1D A;  3MA5 A;  3CHR A;  4BY6 A;  4ILH B;  4CT4 A;  3B95 A;  4ILI A;  4MBG A;  3RO3 A;  2RD0 A;  1SVX A;  5LCW J;  1KLX A;  3HRA A;  1UN8 A;  3ZN3 A;  1HXI A;  4ACK A;  4XKC A;  1QZ2 A;  5BT1 A;  5KJN A;  2QYJ A;  4HOQ A;  3LXU X;  4AIF A;  2F37 A;  4MKT A;  2VGE A;  3Q7A A;  4BWR A;  4D10 C;  3LPZ A;  5FZS A;  2IO3 C;  2PL2 A;  1HG5 A;  2QFC A;  5CCM A;  4AY6 A;  5KJM A;  4BET A;  2B6C A;  3D9O A;  4F53 A;  4ANV A;  2FEZ A;  4QQI A;  4BT9 A;  2GRP B;  2KAT A;  3P1U A;  1UN9 A;  2F8X K;  2X6F A;  1N4P A;  3EIQ C;  3Q73 A;  4EZK A;  4RVB A;  5A23 A;  1JCR A;  4H7Y A;  4J6I A;  4JVS A;  3QAQ A;  5EX0 A;  2WXR A;  4J7W A;  3UM3 A;  2VJ8 A;  4U0U A;  3FUD A;  3U66 A;  4NRH B;  1FCH A;  4H7X A;  4HS2 A;  4GTR A;  2VSO E;  2XPI A;  3PE4 A;  3PH0 C;  4OYS A;  4LNU D;  2OCC E;  3DEO A;  3FU6 A;  3FDH A;  2OEW A;  1HO8 A;  1RZ4 A;  2DZO A;  1HX8 A;  2YIN A;  3FWV A;  3QDN A;  4J8E A;  1QQE A;  2LUH A;  3ZIM A;  5G04 C;  3R7R A;  3RJV A;  4GPM A;  4U95 D;  1TNY A;  2R5S A;  3D9K A;  1DCE A;  2F8Y A;  3RSE G;  4J8F A;  1JCS A;  4GB9 A;  2CFZ A;  3PZ4 A;  4YVQ C;  3CHP A;  3Q79 A;  3GZ2 A;  3CHO A;  4PS8 A;  1NA3 A;  4DX2 A;  2HYZ A;  3ZXS A;  3RAU A;  4CCA A;  2UY1 B;  1BI8 B;  4FU3 A;  3AU4 A;  1EPU A;  4DLQ A;  2X3M A;  2IY0 C;  3D9I A;  3EU5 A;  1SZ9 A;  3FTW A;  3VLF A;  1UW4 B;  2J9Q A;  3FY4 A;  3V31 A;  5G05 J;  1DVP A;  4YDY A;  1ELK A;  2WVI A;  2XRY A;  3IXE A;  3PEU B;  3UX4 A;  2WXM A;  3GZ1 A;  2J08 A;  4AJW A;  4R7L A;  3ASF A;  3UTM A;  4L2Y A;  3SBS A;  1U3C A;  3HXD A;  3SFX A;  2P9L G;  1WDY A;  3CEQ A;  2AXZ A;  2MYO A;  4GYY A;  4F7A A;  1AWC B;  3ZHE B;  2AXU A;  3LY8 A;  2WMO A;  3VLE A;  4J8S A;  3TWR A;  3CVX A;  4FAD A;  3FH5 A;  1KZO A;  2KCV A;  2Y69 E;  3DPY A;  4B8A A;  1S0P A;  4TXR A;  3IKO B;  2WQ6 A;  2WB2 A;  2PM6 A;  3UMV A;  1O5M A;  4CGW A;  1NFI E;  1KT1 A;  3SF4 A;  3VTY A;  3ABM E;  1N11 A;  2H6H A;  2P9P G;  1DC2 A;  3PS6 A;  1RW2 A;  5E75 A;  3G2U A;  4KZ0 A;  3ZYM A;  1B89 A;  5BV1 A;  1TNU A;  4FC8 A;  4KYO B;  3TGO A;  1XNF A;  2LNI A;  4ANX A;  2QY7 A;  3Q49 B;  2M63 A;  3CSF A;  3UKR G;  2DIW A;  3Q15 A;  3BG1 B;  3PE3 A;  3RIB A;  3S7B A;  3KSL A;  4DI4 A;  3ONL A;  4X8Q A;  3MGB A;  5FQ8 A;  3KS2 A;  4C48 B;  2XQ0 A;  4RSY A;  3ZYQ A;  2L0T B;  3FH8 A;  1DNP A;  2KBX A;  1ZBP A;  1OY3 D;  2V0P A;  2A5U A;  3PRZ A;  2I2O A;  2CHX A;  3G2T A;  1UJJ A;  3ASG A;  1Y6I A;  3TJP A;  1H2V C;  4I2Z A;  3QAR A;  5ENT D;  3G2V A;  4K0R A;  4JC8 A;  4I6J A;  2VGY A;  2J4B A;  1D8D A;  3I3N A;  3EHR A;  4NIK A;  2C0M A;  2EQX A;  2V8S E;  3KSQ A;  1TN6 A;  5JMN D;  4EQF A;  4K5A B;  5BNW A;  4G8K A;  1IQR A;  3TAX A;  3D9H A;  3UM0 A;  4N5C A;  1YA0 A;  3BG0 B;  3OXF A;  3FEY A;  3MZL B;  4JA9 A;  5ENO D;  4DPR A;  4G24 A;  2ETB A;  4HOU A;  1YCS B;  2ETC A;  2H6F A;  5KCM A;  4LEU A;  4YVO A;  4M3O A;  4Y6C A;  4JHR A;  2AWI A;  3T9K A;  2DYR E;  4NAC A;  1S70 B;  4XX5 A;  4LER A;  3FH7 A;  2OVF A;  3ASN E;  4CEM A;  1X5B A;  1E8Z A;  4B93 B;  4AP2 A;  2ETA A;  3S7J A;  2Q7F A;  1TNZ A;  1S63 A;  4AY5 A;  4KVM A;  4O1O A;  2KZT B;  3SBT B;  1BD8 A;  1HE8 A;  2JLB A;  4XZ4 A;  4BX8 A;  5AJD A;  2VTB B;  4ZFH A;  2L0I A;  2IU1 A;  3DBS A;  3TWQ A;  1TNO A;  1TJC A;  2GRL A;  4HI8 A;  3Q4A B;  1D9S A;  3C3O A;  2R2L A;  1W3B A;  5HI7 A;  3ABK E;  3E4B A;  2KXP C;  4DJA A;  2R05 A;  1ELR A;  3AS8 A;  5J90 A;  3EHM A;  5B1B E;  2X6K A;  4CT0 A;  3IHY A;  1BPO A;  3KEZ A;  4TXQ A;  1FVH A;  4UWH A;  4KT6 B;  2LAI A;  3RO2 A;  1HFA A;  4AEZ C;  3EUV A;  4OAV B;  3ISM C;  4GU5 A;  2VQ2 A;  5BV0 A;  2P9N G;  4BTA A;  3KD7 A;  5CED B;  2GGF A;  5ENP D;  1UG3 A;  4ABN A;  3SO8 A;  3CHM A;  1OCR E;  4XI9 A;  3PVL A;  3U64 A;  4U8H A;  3CK9 A;  3FHE A;  4URK A;  3TWU A;  3FUE A;  3TWV A;  1SA4 A;  4APF A;  2BTD A;  3MKQ B;  1MHQ A;  2VGX A;  3CKC A;  4L23 A;  5FZR A;  5B3S E;  5JJ7 A;  3SGH A;  2PNN A;  1EYH A;  1UOH A;  2H6G A;  4NQ0 A;  3DSX A;  2OV8 A;  4BES A;  1E8Y A;  1BLX B;  3ZUV B;  2WXO A;  4KZC A;  4RLY A;  2IJG X;  2GRR B;  5D2M C;  1KT0 A;  5BW8 C;  2CG2 A;  3U9W A;  2NC9 A;  3AU5 A;  5AN8 A;  3E30 A;  4GYW A;  4JB8 P;  1JWF A;  3JQ1 A;  2WXQ A;  5CRU A;  3T8K A;  3MKR A;  4HRM B;  2BKG A;  2GRO B;  3X2Q E;  2RFA A;  4C0M A;  1JCQ A;  3L16 A;  4E85 A;  3OAW A;  5B1A E;  2C0L A;  4N2S A;  3PZD A;  3JXI A;  2FUL A;  5D0Q D;  3U3W A;  2UY1 A;  2WQH A;  5LOZ A;  2GRM A;  1LD7 A;  3IHV A;  3JQ0 A;  3HIZ A;  3EIJ A;  3JYS A;  5CCL A;  3UPV A;  3SI5 A;  3QWW A;  1N94 A;  4G23 A;  4UWF A;  4WNE A;  1P5Q A;  2J4D A;  4XIF A;  3D9L A;  2IF4 A;  1N4S A;  3JUE A;  3C3R A;  4UI9 K;  2WM9 A;  3LVR E;  1N52 A;  3MCX A;  1FVF A;  1S64 A;  2KM4 A;  3ZHE A;  3SNX A;  4DLO A;  1EF1 C;  3UT8 A;  1AP7 A;  2VSX E;  4UQX A;  4DX6 D;  4GTQ A;  1HS6 A;  3LYA A;  3DEP A;  1V54 E;  2R17 C;  1NZN A;  4XKB A;  3J5Q B;  1HG2 A;  3CK7 A;  5J08 A;  3CV0 A;  4U8V D;  2FBN A;  3HG0 D;  3UQ3 A;  4OVU A;  4GPK A;  5JA4 D;  2VGX B;  5ANR A;  1X81 A;  4L7T A;  5EID A;  2CG3 A;  1ELW A;  1IHB A;  3S2A A;  3D9M A;  1VDY A;  2OEV A;  5ANL A;  4UI9 C;  2MHK A;  2E0I A;  5AEN A;  1MZC A;  3LJN A;  4DK5 A;  2PM7 A;  4CDR A;  3LEW A;  2FO1 E;  4CGV A;  4JHK A;  4JEH A;  2QZA A;  3LJ3 A;  4TV3 A;  4BEP A;  3HVE B;  3F6Q A;  2OND A;  4N3C A;  4JA7 A;  3PZ1 A;  3FUK A;  2B0O E;  4OVV A;  5CBO A;  4I2W A;  4U96 D;  4I6G A;  2BUG A;  3TXN A;  3P2B A;  1Z5S C;  3DSW A;  5LFA A;  2ION A;  2X6H A;  4Y6W A;  3ZEF A;  4J0U A;  3IEG A;  5HKP A;  4V3I A;  5IY5 E;  2XCC A;  3C72 A;  1NI1 A;  4LNB A;  4FA6 A;  2I1K A;  4GTP A;  3LCA A;  5EDS A;  5FWQ A;  3CVV A;  3EJN A;  3L6A A;  3FFL A;  3TWW A;  2IO2 C;  2LXM A;  3ULQ A;  4KMO A;  2ZGG A;  4EZJ A;  3SFY A;  2XZT G;  2ZIR A;  4W9R A;  4JL0 A;  4K5B A;  3URZ A;  3FTX A;  3MYV A;  4CDN A;  2NXP A;  2C2L A;  3D9P A;  3ASO E;  1Y8M A;  3CST A;  5FJY A;  1MX2 A;  3SD5 A;  5G2N A;  3CHQ A;  4JW1 A;  3CLJ A;  2QC9 A;  3SFZ A; 
#chains in the Genus database with same CATH homology
 5CEC B;  2DZN A;  3KEA A;  3T9K A;  4OAU C;  4CZ2 D;  1S70 B;  2AJA A;  3B7B A;  4BEP A;  1SW6 A;  4N5Q A;  4HQD A;  3TWU A;  5AQ7 A;  4K5C A;  3TWV A;  4BET A;  3V31 A;  4A63 B;  5FIN A;  5EIL A;  3F6Q A;  3TWS A;  4YDY A;  5KBA A;  4HLL A;  5KNH D;  4QQI A;  5CEA A;  4HRN A;  5BXU A;  4QFV A;  3JUE A;  2F8X K;  5KWD A;  1TR4 A;  3J5P A;  3IXE A;  3C5R A;  3EHQ A;  4LG6 A;  1K3Z D;  5HS0 A;  1IXV A;  5D66 A;  2B0O E;  4B93 B;  4O60 A;  2ETA A;  2PNN A;  2JAB A;  1A5E A;  2P2C P;  3NOC D;  4BER A;  5CBO A;  1MYO A;  1UOH A;  4U96 D;  4CYM D;  4HB5 A;  4J7W A;  4BES A;  4O1O A;  1BLX B;  3ZUV B;  4RLY A;  1BD8 A;  4HNA D;  4BSZ B;  4C48 B;  3UTM A;  2KBX A;  1DCQ A;  1YYH A;  1MJ0 A;  1G3N B;  5EYL A;  4Z68 A;  4ZFH A;  1OY3 D;  2DWZ A;  2ZGD A;  1AP7 A;  3TWQ A;  3UXG A;  5HKP A;  4LNU D;  2RFM A;  1WDY A;  4HI8 A;  5AN8 A;  4JB8 P;  3V2O A;  4DX5 D;  1D9S A;  4F6R D;  2Y0B G;  5CBN A;  2MYO A;  1AWC B;  3V2X A;  2XEH A;  4O1P A;  4DX6 D;  4HBD A;  5EYP F;  3T8K A;  4HRM B;  1BU9 A;  2BKG A;  3DEP A;  5FIO A;  3TWR A;  3DEO A;  5KNG A;  3ZKJ A;  5ENQ D;  2A5E A;  5ENT D;  4GMR A;  3J5Q B;  5ITZ F;  2KXP C;  1IKN D;  2HE0 A;  5ENR D;  2RFA A;  4U8V D;  4DX1 A;  3Q9U C;  4DRX E;  1WG0 A;  3EU9 A;  3HG0 D;  3JXJ A;  4YDW A;  3ZNG A;  3W9F A;  3ZU7 B;  3TWW A;  2DZO A;  5EN5 D;  3EHR A;  3NOG D;  4NIK A;  3NBN B;  2NYJ A;  5CER B;  5AAR A;  5JA4 D;  5JMN D;  2BKK B;  3B95 A;  2ZGG A;  1MX4 A;  5AQ9 A;  4K5A B;  1N0Q A;  5BXO A;  4TUM A;  1NFI E;  3TWX A;  5EID A;  1SVX A;  4G8K A;  1IHB A;  3JXI A;  3HRA A;  4J8Y A;  5HRY A;  2XZD G;  2V5Q C;  2XZT G;  3D9H A;  3AAA C;  4GPM A;  1OT8 A;  4HI9 A;  4DX7 D;  1N11 A;  4U95 D;  2XEE A;  3W9G A;  4ATZ D;  4F1P A;  4K5B A;  4DUI A;  5ENS D;  3V79 K;  2L6B A;  2F8Y A;  1DC2 A;  4UUC A;  3TWT A;  4ZHB A;  4OAV B;  5AQB A;  4HRL A;  1K1B A;  5ENO D;  1BI7 B;  1QYM A;  2QYJ A;  5AQA A;  5AAO A;  3Q9N C;  2ETB A;  4G8L A;  1MX2 A;  3UI2 A;  5CED B;  1YCS B;  2ETC A;  3LJN A;  1N0R A;  2Y1L E;  1K1A A;  2J8S D;  5EIB E;  2F37 A;  1YMP A;  4DX2 A;  2QC9 A;  2VGE A;  5ENP D;  1MX6 A;  2DVW A;  2V4H C;  3V30 A;  3SO8 A;  2FO1 E;  4LSZ E;  2XEN A;  4U8Y D;  3AJI A;  1BI8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...