4TUMA

Crystal structure of ankyrin repeat domain of akr2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
122
structure length
122
Chain Sequence
ESIVHQTASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNSQLEVVKLLEKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Ankyrin repeat domain-containing protein 2
publication title An Ankyrin Repeat Domain of AKR2 Drives Chloroplast Targeting through Coincident Binding of Two Chloroplast Lipids.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 41
structure length 122
sequence length 122
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4tumA00
3SO8A 3V79K 1OY3D 2ZGGA 1K1AA 3Q9NC 4HRLA 4A63B 4QFVA 5EYPF 5EIBE 4F1PA 1S70B 1BU9A 4DUIA 2FO1E 5KWDA 3UTMA 2NYJA 4G8LA 5FIOA 4HRNA 1BD8A 1MX6A 4G8KA 1IXVA 4HRMB 1TR4A 3KEAA 3ZUVB 4DRXE 2PNNA 3EU9A 5CBNA 2BKGA 2DVWA 1MX2A 2F8YA 3EHRA 4K5CA 3DEPA 4U96D 2AJAA 5ENSD 3AAAC 3TWWA 4J8YA 2ETAA 5CEAA 1N0QA 5EILA 1SW6A 5CEDB 2RFMA 1OT8A 5CERB 4BESA 4DX1A 1AP7A 1D9SA 5JA4D 3ZKJA 5JMND 3V2OA 5ENRD 4O1OA 3TWSA 5BXOA 2F8XK 5KNGA 1MX4A 3V30A 3UXGA 2F37A 5ENQD 4OAVB 4OAUC 3Q9UC 4U8YD 5AQAA 3TWUA 3J5QB 3W9FA 5AN8A 3NOCD 1MJ0A 4ZFHA 1YCSB 2ZGDA 2XEEA 4O60A 3D9HA 3B7BA 4YDWA 4LNUD 2DZNA 2KBXA 3JUEA 5HRYA 4CZ2D 4DX7D 3F6QA 3J5PA 5KBAA 5AAOA 1IHBA 3TWTA 4LSZE 3B95A 4K5BA 4RLYA 5HKPA 1DCQA 2ETBA 4HI8A 4C48B 4DX5D 5ENPD 1QYMA 4F6RD 1DC2A 3NOGD 2JABA 4YDYA 2V4HC 3AJIA 2QYJA 2V5QC 3LJNA 5ENTD 3TWQA 3ZU7B 5CECB 3C5RA 3NBNB 2XZTG 3ZNGA 2XEHA 3EHQA 4U8VD 3UI2A 4BERA 1WDYA 2A5EA 4HB5A 1BI7B 1N0RA 3TWVA 4HNAD 5FINA 2J8SD 1N11A 3HRAA 4K5AB 4U95D 3T9KA 1MYOA 2P2CP 3IXEA 1A5EA 4JB8P 5EN5D 1G3NB 2Y0BG 4O1PA 5HS0A 4DX6D 4NIKA 1BI8B 4N5QA 1BLXB 2DZOA 3HG0D 3JXIA 5AARA 3JXJA 4BSZB 2L6BA 4HQDA 3DEOA 1SVXA 2B0OE 2Y1LE 5AQ9A 4DX2A 5ENOD 3TWRA 5EYLA 5BXUA 2VGEA 5CBOA 4QQIA 1YYHA 4ZHBA 5KNHD 1IKND 2HE0A 3V2XA 4B93B 4CYMD 2BKKB 1WG0A 5AQBA 2ETCA 2QC9A 5ITZF 4BEPA 1NFIE 5D66A 4BETA 5AQ7A 2KXPC 2MYOA 4HLLA 3TWXA 3W9GA 1AWCB 3V31A 3T8KA 2DWZA 5EIDA 4Z68A 1UOHA 4J7WA 1K1BA 2RFAA 2XENA 4HBDA 4ATZD 4LG6A 1K3ZD 4GMRA 4HI9A 4GPMA 2XZDG 4TUMA 1YMPA 4UUCA
chains in the Genus database with same CATH superfamily
4GTVA 5CMWA 2A4ZA 2V5FA 3Q9NC 5G05C 2FEZA 3Q15A 2ZU6B 1GW6A 3JQ0A 2HR2A 4G8LA 4XIFA 1N95A 5CHEE 3UM0A 5HI7A 1TR4A 3U66A 4GTSA 3OTNA 5LCWJ 4E6HA 4V3IA 2ETAA 3ZIMA 4ILHB 5LOZA 3PZDA 2JLBA 3ONLA 3KEZA 4JHRA 5D0OD 2KBXA 2OVBA 4GA1A 2XPIA 2H6FA 5KCMA 3D9KA 2IU1A 4TXPA 4UWFA 3Q4AB 3NZUA 1WDYA 5B1AE 2GGFA 3HRAA 1SZAA 2P2CP 2ONDA 2Y0BG 5BV1A 2KC7A 4GZ6A 5KJMA 2PQNA 3FUJA 3CR3A 3MA5A 1SVXA 3TWRA 2J07A 2WXLA 5CBOA 3SBSA 4JHJA 4ABNA 3UT7A 2XQ0A 3P2BA 1OWMA 3PZ3A 2BKKB 1WG0A 4APOA 4CGWA 2LAIA 4PH4B 3S7JA 4LG6A 4GMRA 4J8DA 2L0IA 1Z3YA 1H6OA 2VSNA 5B1BE 1ZBPA 4I9EA 4ILIA 3UTMA 1KZPA 2OV8A 3G2VA 3NB2A 3TAXA 3UKRG 2WPVA 4A3VA 4DRXE 5ANRA 4XKBA 1KPSB 4WNFA 3C3OA 3KSLA 4I1MA 4I6GA 1E7UA 4EPZA 3ESKA 3RRMB 3UIPC 3QARA 3UXGA 5A23A 4F3VA 4G2VA 2CFUA 4CDNA 3MYVA 2H6IA 2LSUA 4AP2A 4K5BA 4N3CA 3QC1A 3L13A 3ULYA 4EQFA 2WM9A 4R7LA 3JYSA 3EUVA 2IFUA 1X5BA 4UQZA 4JL0A 2JEKA 2I1KA 1Y6IA 4NIKA 2OEVA 4BX9A 5FQ4A 4BSZB 1L5JA 1ELWA 4B0ZA 4HOSA 2VJ8A 1X81A 3TJPA 3HXBA 2WXHA 2QC9A 3ABLE 4HOTA 4BT9A 3HXFA 3MKQB 5G05J 2KATA 5ANLA 3FP3A 5EX3A 4ATZD 3PZ4A 3SFXA 3V79K 4UQXA 4HRLA 3JUIA 1MHQA 3SFYA 5EDSA 2QFCA 2IOLA 2EILE 3CSTA 4JXTA 1IQRA 1KZOA 2GRQB 3ML9A 4XZ4A 3APFA 4GZCA 3U9WA 4LERA 5BNWA 1TJFA 3U64A 2IF4A 4XI0A 3IBEA 4RG6A 4GB9A 5JMND 4OYSA 4D10C 5AQAA 4CDRA 2EIME 2VGXA 1N4SA 1PC2A 4DX7D 3TWTA 4LSZE 3LS8A 1HXIA 2AXUA 3GZ1A 2XS1A 2DYSE 4GCNA 1FT2A 3DSWA 3EHQA 4U8VD 3TWVA 1N11A 1H6KA 3CVVA 5H7PA 4AY5A 3QK0A 4O1PA 3FU3A 1ELKA 4HQDA 4FLHA 1LF8A 2OVFA 3PE3A 2RKKA 3LYAA 4QQIA 4CGVA 4Y6WA 3ASGA 3KS2A 2XEVA 4IRUA 3AS5A 3LJ3A 4HXIA 2XRZA 4PS7A 3Q79A 4IULA 3W9GA 1TNZA 4AIFA 4HBDA 2XENA 2KCKA 3QKYA 5FQ7A 3VTXA 4WWNA 5KJKA 3JCKC 1Z3XA 4G23A 3Q47B 3ZEFA 1K1AA 2RD0A 3ABME 5D0QD 5DBKA 1JWGA 2WXPA 4LUNU 3UQ3A 2BKGA 1OWOA 3ZVVA 3D9NA 4NACA 1HG5A 1AP7A 3AS4A 5ENRD 2WXOA 2E2EA 4U8YD 3TL5A 4PS8A 1MJ0A 1BPOA 1YCSB 2KCLA 3ONKA 5FZRA 5HRYA 1H19A 3F6QA 4UI9J 2KM4A 2L9BA 2ETBA 3FTWA 4DX5D 2J4BA 2JABA 4U63A 4YDYA 5T8IA 4TXQA 4K5AB 5LCWC 1HFAA 5EN5D 1H2UA 3DWLG 5G2NA 3TXNA 1EYHA 4TUUA 4GYWA 5JJ6A 3E32A 2PM7A 4WNEA 1YYHA 5KNHD 4G26A 1ZB1A 4LNGA 2WXMA 4U0SA 2R2LA 1OCCE 3RAUA 1UN9A 3UUXA 3D9LA 4ANWA 3IV0A 4ATGA 4GMJA 4UWLA 4UQYA 3IHVA 4J8SA 2R02A 3SY2A 1OWLA 3LDZA 3RU0A 1DVPA 5B3SE 5EIBE 2M63A 3RKVA 5KWDA 3ZRHA 3FHEA 4AY6A 1NA0A 4MKTA 2VGYA 4I6JA 5T3RA 2WB2A 2XHEA 2WQ7A 2B6CA 4I17A 3E34A 1OWPA 2XGMA 4DLQA 3CHSA 2CHZA 3ABKE 3ZW3A 1XNFA 3PNTB 3FUHA 3WG7E 3QOUA 2ZGDA 2XEEA 2DZNA 4JW1A 4Q96A 2YINA 3ISMC 4YDEA 2PQRA 4IYPA 4L7TA 3CVWA 3HXDA 2GRNB 5C1DA 4FHJA 2XZTG 2XEHA 1O1TA 2IO2C 4HB5A 3FTYA 5JHAA 4CT0A 3DSVA 3MZLB 3U3WA 1A5EA 1HS6A 3T5XA 5HS0A 4DX6D 4N3AA 3QB2A 4KVMA 1N4RA 1JWFA 4JPSA 5ENOD 4GTTA 2VSOE 4RVBA 4Q69A 4BTAA 5KJLA 3FTSA 3DRAA 4G11A 4I1AA 4AEZC 2L6JA 4HOUA 4HS2A 3ZGQA 4BETA 4O6FA 5EIDA 1B89A 3L6AA 2OEWA 3QWWA 4B94A 4TUMA 4KYOB 3AS8A 4MBGA 3FH8A 1OY3D 4A63B 2CHWA 3B7SA 3ULEG 3HXEA 3N71A 1O1SA 4AXHA 2A5UA 2R17C 5ENSD 5A6CA 4GPKA 5E76A 5CERB 1WY6A 5JA4D 2Y4TA 2J49A 4L2LA 2KCVA 2P9LG 4U7EB 3QAQA 3JUEA 2X3MA 3OXFA 5AAOA 3CVPA 3QNKA 1UG3A 3NAWA 3L82A 3C3RA 1KLXA 2X38A 3FUIA 4WNGA 1O5MA 3LVRE 3HHMA 4DJAA 3VLEA 5AIJA 1A17A 4F1SA 2F0YA 3SFZA 2AXZA 4HLEA 1BI7B 3FTUA 2V8SE 5A7DB 2KZTB 3AG1E 3GZSA 3SD5A 2P9PG 4N5QA 2X6IA 1YA0A 2VSYA 4XI9A 2Y3AA 3KSQA 1IYGA 1SZ9A 4C0MA 4B93B 3I5PA 4GZ5A 3UMVA 1SA5A 3HVEB 3TWXA 4FHKA 2J9QA 5LX8A 1HU3A 3ZYQA 1K8KG 3G2UA 2WQHA 3ZXSA 5G55A 4F1PA 2IEJA 2J4DA 1Z5SC 2UWJG 2DIWA 2YNQA 3UM1A 1BD8A 3DSUA 4C0EA 2WXFA 1U2VG 1Q2ZA 3FY4A 2F8YA 2Q7FA 4K5CA 3AAAC 4CT4A 2RG8A 3I3NA 4N5CA 4J8EA 3PNLB 2VQ2A 3S2AA 4BESA 3GYZA 2HM8A 3FTZA 3IHYA 5IY5E 4OAUC 1QZ2A 4GTOA 2GROB 2WXRA 3CHRA 2XCBA 4N2QA 3D3MA 3E30A 3FTVA 3C72A 4NRHB 2NSZA 3L08A 2NXPA 1UN8A 5CCLA 3BEEA 4ANXA 3NQPA 3I4RB 1TJCA 1TNYA 4TRQA 3UKUG 3IXEA 1JPLA 1N52A 2J08A 3MKQA 3UX4A 3WXXA 1FT1A 2IOSA 2XGSA 1EF1C 2ETCA 3URZA 4BEPA 3R7RA 4FC8A 4BWRA 5D66A 4Q94A 4UI9C 4FULA 3L54A 5FZSA 2P9UG 4PS3A 4GPMA 2C0LA 1UJKA 2UY1B 4CCAA 2WXIA 3RO3A 5AJDA 2FO1E 2EIJE 4URKA 4KZ0A 3GW4A 3EIQC 4FP7A 4OVVA 1INZA 3AU5A 3UINC 4TV3A 1N0QA 4J8FA 1SW6A 2R03A 1TEZA 1LTXA 5ENQD 3Q9UC 3B7BA 3FWVA 4KBQA 1FVFA 5G04C 1XGWA 3ZHEB 4RLYA 5FZQA 4UWHA 4ANVA 2IONA 5ENPD 1WAO1 5CECB 2XRYA 2LAHA 3D9IA 1U3CA 3FU0A 3APCA 5FINA 2FF4A 3HDXA 5ARGA 3MJWA 3JXIA 2HO1A 4AV7A 4L2YA 2WXNA 2FULA 4A3TA 3ML8A 2XGOA 2X6JA 3ZXPA 2HYZA 3RIBA 2ZISA 4BT8A 4U0UA 1HH8A 3EJNA 4GZDA 2VTBA 2XPYA 2DWZA 3HYMB 4ANUA 2NC9A 3CHOA 2OCCE 1DNPA 3UIOC 1P5QA 4XKCA 4BTBA 4U07A 2E0IA 2H6HA 1PAQA 1W3BA 3EHRA 4LCTA 4YNDA 2VTBB 1TNBA 1D8EA 3MCXA 3G2TA 2F8XK 3V30A 3FTXA 2WQ6A 3OXGA 3CVQA 4O60A 2P9IG 2QZAA 3R7QA 3FH7A 4JHKA 1VDYA 3KD7A 3QWVA 1H2VC 3L17A 5AENA 2MOWA 3PREA 2IY0C 4C48B 1OWNA 2YQ8A 5ENTD 5JHBA 4UWKA 1LD7A 1ELRA 3B7RL 2R5SA 4C9BB 4MLPA 3KAEA 1TN6A 1Z6TA 2DBAA 3NZSA 4M7CA 3X2QE 2WXJA 1TN8A 5EX0A 4FA6A 3V2XA 5AQBA 5ITZF 3VTYA 4HLLA 4ACLA 3V31A 2EQXA 3FEXA 2C0MA 3ASOE 4Y6CA 2I2OA 3LVQE 4IN3B 1S0PA 1HG2A 3MGBA 3DXKG 3CLJA 3B13A 1S70B 2IJGX 3ZPJA 3C98A 1HF8A 2PL2A 3FDHA 4U8HA 3HXCA 4JA7A 3GZ2A 2BUGA 4OVUA 1E96B 4U96D 3VLFA 3MKRA 5G04J 3CHPA 3S7BA 4DX1A 3AU4A 3NF1A 3ZKJA 3SGHA 3TWUA 2LNIA 3NOCD 1OUVA 5J08A 2I9CA 4BFRA 1FCHA 4MS6A 3BU8A 3B95A 4WNDA 4EZJA 4I43A 2V5QC 3NBNB 4F7AA 4NQ0A 2EINE 3BQOA 4DI4A 3UI2A 4BERA 1S64A 2A5EA 4PDXA 2V0PA 1JCRA 4HNAD 1OXJA 2H6GA 2CFZA 4KVOA 2LXMA 5M72A 5DIZA 4WWOA 1BI8B 1BLXB 4GA2A 4WWPA 4KT6B 4DX2A 5BXUA 3D9PA 3CKBA 3HIZA 4FLBA 2XCCA 5CRVA 3AG4E 2PM6A 4K0RA 4CYMD 3DXMG 1NFIE 4NURA 2J09A 3E4BA 2DYRE 3OXLA 1N94A 2MYOA 4ME2A 4APFA 1AWCB 4GAAA 3T8KA 5FQ8A 4EBAG 1SA4A 3R9AB 4YVQC 4HI9A 3ZN3A 2XPZA 4UUCA 5CMYA 1Y8MA 3ASHA 3Q49B 5EYPF 3ENEA 3EHMA 2MRIA 4N39A 1N54A 2NYJA 1JCQA 4HRNA 2FBNA 1IXVA 4ACKA 3JQ1A 3EU9A 1MX2A 4KXKB 3TWWA 3CGHA 1PY1A 5EILA 4FU3A 5T4YA 4I2ZA 1D9SA 4U0ZA 3V2OA 4O1OA 2L0TB 3TXMA 4KZCA 4CDMA 3Q7AA 3FULA 5BW8C 3PE4A 3RJVA 5KBAA 2KZTA 4G1TA 1QYMA 3ZU7B 1RZ4A 3LJNA 5JJTA 4G25A 2VYIA 4I9CA 3ASNE 3PUJA 4TXRA 3U4TA 3D9MA 5AYWD 3BG1B 3L9TA 3P1UA 3DSTA 3HVEA 4GTRA 3CVYA 3CIAA 2BTDA 3MV2B 4EHMA 3PEUB 3CHQA 4JEUA 1H6PA 2GRMA 4XE0A 3CQGB 3EU5A 5ENNA 3AG2E 4JD2G 2XS8A 5J90A 3SI5A 2WXKA 3G2SA 5CCMA 1JUQA 1OCZE 2P9KG 3ZYLA 4EZLA 2IQCA 3SF4A 4CRWA 1BU9A 1OCRE 1NL4A 2LUHA 5BPPA 2QYUA 3E33A 3KEAA 3ASFA 3EIJA 5CBNA 3DEPA 4E85A 3FUMA 3CVUA 5CEDB 5E75A 1OT8A 1RW2A 3CHMA 1E7VA 1H2TC 4OAVB 3Q78A 3W9FA 3CVXA 1HO8A 2AW6A 4YDWA 3PEVB 4G24A 3FUNA 4DPRA 3FEYA 3T5VA 2WVIA 1DCQA 2AXVA 3C5RA 4ILGA 3PUKA 1TN7A 4L9PA 3O48A 3T8MA 3T9KA 1V55E 3B7UX 4FADA 1QBQA 4LRZA 3TG4A 2ZIRA 3RRUA 3HG0D 3CVLA 1E8WA 3L22A 3RSEG 2Y1LE 5AQ9A 3CK9A 3MEKA 4MRUA 1IKND 3G2WA 4JZYA 1DCEA 1NZNA 5FQ6A 2UY1A 4I6EA 1HE8A 3OAWA 1E8XA 3ESLA 4YDOA 3ULQA 3EDTB 3PRZA 1MZCA 4GMLA 3UM2A 3Q73A 4QFVA 2FI7A 4CEMA 5FIOA 4JA9A 2X6FA 3CVNA 4HRMB 5LFAA 4DI3A 3SHFA 5BUZA 4WAFA 2AJAA 3QDNA 3PH0C 5CEAA 5BV0A 3FH5A 1N4QA 2P58C 3ZHEA 2I6HA 5KNGA 1MX4A 3QJZA 1NA3A 4JC8A 3TG5A 4ZFHA 3I4GA 5AN8A 1UW4B 2DCPA 3D9HA 4L23A 4LNUD 4GCOA 3MV3B 4HI8A 3AG3E 3FUDA 1DC2A 3NOGD 3AJIA 2QYJA 4GYOA 4L1BA 3ASDA 3PZ1A 1N0RA 3IKOB 4GYYA 5KJNA 4H7YA 3SZ7A 3LEWA 1TNUA 1TNOA 4B8CB 3L16A 4RSYA 5AJLA 4EBAA 3UT8A 2PZIA 3CQCB 3LKUA 3LY8A 1KT1A 3Q7FA 2Y69E 4YVOA 5FWQA 2GRRB 2WXQA 5FJYA 2QY7A 4J7WA 2RFAA 3DBSA 2WMNA 1EDUA 2XZDG 4JVSA 4LNBA 5HQ8A 3PDNA 1EPUA 3UPVA 4A55A 1FVHA 4DUIA 4G8KA 2PNNA 4I1OB 4J8YA 2I1JA 3CSFA 4UWGA 3TWSA 5BXOA 2AVPA 1O1RA 2F37A 2CHXA 2CG3A 2X6KA 4DLOA 3FFLA 3J5PA 1IHBA 4EZKA 4FJZA 4UI9K 3C3QA 2FO7A 3UM3A 2VGXB 1V54E 3FUFA 2P9SG 5C2YA 2J8SD 1MYOA 3FU6A 1JCSA 1FPPA 4JB8P 1G3NB 4B89A 5AARA 2L6BA 3DEOA 4AOFA 3DSXA 5EYLA 2VGEA 3LY9A 4JEHA 5D2MC 5JJ7A 4EECA 3FUKA 2YHEA 3QWPA 3BG0B 4N3BA 4I2WA 5ARFA 4HOQA 1YMPA 4F53A 3SQVA 3SO8A 1QQEA 4X8QA 4GTMA 3CK8A 4M3OA 1N9AA 3RO2A 3DPYA 1MX6A 3ZUVB 4AM9A 2DVWA 3EHNA 1QNFA 2MHKA 2WMOA 1U3DA 3ZYMA 3APDA 2GW1A 3D9JA 4N2SA 4HORA 2V4LA 2R59A 1HZ4A 4RQIA 3IEGA 5HKPA 3R9MA 4H7XA 4F6RD 4GTQA 3O4ZA 4A1SA 2IO3C 1UJJA 3E37A 1MQSA 3TWQA 2GRLA 1TYQG 2OOEA 2R05A 3ZYKA 3D9OA 1NP7A 2C2LA 3VLDA 4FJYA 4HVBA 3Q75A 2LO6A 3JXJA 1S63A 3CEQA 3Q5MA 3S7FA 1HX8A 4ZHBA 2HE0A 3LXUX 4W9RA 4GTPA 4GZ3A 3LCAA 2EIKE 2GRPB 5BT1A 2LXLA 4Z68A 1UOHA 3CKCA 1K1BA 3PZ2A 4GU5A 3DSSA 1D8DA 1K3ZD 4LEUA 2ILRA 3FUEA 3PVLA 3K9IA 3S7DA 1ZU2A 4U04A 2Y4UA 1WM5A 1LD8A 2ZGGA 4BY6A 4DK5A 4A1GA 3ZFWA 1IQUA 4WUYA 5EKQD 5FTPA 2BEDA 4J6IA 1SQMA 4BX8A 2BF0X 3MX3A 2YHCA 2RFMA 1H0AA 3PS6A 3UT4A 3RRNB 3DPDA 3J5QB 2LSVA 1OCOE 3BUAA 4K03A 4CZ2D 3TGOA 2AWIA 1N4PA 3B7TA 2CG2A 2V4HC 2WXGA 4HFGA 4AJWA 4J0UA 3ZNGA 1E8ZA 3SBTB 4B8AA 4XX5A 4U95D 3LY7A 1NI1A 4BSXA 3CK7A 4XEIG 2DZOA 5CRUA 2X6HA 2B0OE 2VSXE 5LP0A 3CV0A 4KMOA 1E90A 1KT0A 2P9NG 3LPZA 4RG9A 3SNXA 5AQ7A 2KXPC 5FT9A 3RK6A 1E8YA 3FU5A 1IHGA 4GA0A 4AVXA 2ZXWE 4PUCA 4P29A
chains in the Genus database with same CATH topology
3SO8A 3V79K 1OY3D 2ZGGA 1K1AA 3Q9NC 4HRLA 4A63B 4QFVA 5EYPF 5EIBE 4F1PA 1S70B 1BU9A 4DUIA 2FO1E 5KWDA 3UTMA 2NYJA 4G8LA 5FIOA 4HRNA 1BD8A 1MX6A 4G8KA 1IXVA 4HRMB 1TR4A 3KEAA 3ZUVB 4DRXE 2PNNA 3EU9A 5CBNA 2BKGA 2DVWA 1MX2A 2F8YA 3EHRA 4K5CA 3DEPA 4U96D 2AJAA 5ENSD 3AAAC 3TWWA 4J8YA 2ETAA 5CEAA 1N0QA 5EILA 1SW6A 5CEDB 2RFMA 1OT8A 5CERB 4BESA 4DX1A 1AP7A 1D9SA 5JA4D 3ZKJA 5JMND 3V2OA 5ENRD 4O1OA 3TWSA 5BXOA 2F8XK 5KNGA 1MX4A 3V30A 3UXGA 2F37A 5ENQD 4OAVB 4OAUC 3Q9UC 4U8YD 5AQAA 3TWUA 3J5QB 3W9FA 5AN8A 3NOCD 1MJ0A 4ZFHA 1YCSB 2ZGDA 2XEEA 4O60A 3D9HA 3B7BA 4YDWA 4LNUD 2DZNA 2KBXA 3JUEA 5HRYA 4CZ2D 4DX7D 3F6QA 3J5PA 5KBAA 5AAOA 1IHBA 3TWTA 4LSZE 3B95A 4K5BA 4RLYA 5HKPA 1DCQA 2ETBA 4HI8A 4C48B 4DX5D 5ENPD 1QYMA 4F6RD 1DC2A 3NOGD 2JABA 4YDYA 2V4HC 3AJIA 2QYJA 2V5QC 3LJNA 5ENTD 3TWQA 3ZU7B 5CECB 3C5RA 3NBNB 2XZTG 3ZNGA 2XEHA 3EHQA 4U8VD 3UI2A 4BERA 1WDYA 2A5EA 4HB5A 1BI7B 1N0RA 3TWVA 4HNAD 5FINA 2J8SD 1N11A 3HRAA 4K5AB 4U95D 3T9KA 1MYOA 2P2CP 3IXEA 1A5EA 4JB8P 5EN5D 1G3NB 2Y0BG 4O1PA 5HS0A 4DX6D 4NIKA 1BI8B 4N5QA 1BLXB 2DZOA 3HG0D 3JXIA 5AARA 3JXJA 4BSZB 2L6BA 4HQDA 3DEOA 1SVXA 2B0OE 2Y1LE 5AQ9A 4DX2A 5ENOD 3TWRA 5EYLA 5BXUA 2VGEA 5CBOA 4QQIA 1YYHA 4ZHBA 5KNHD 1IKND 2HE0A 3V2XA 4B93B 4CYMD 2BKKB 1WG0A 5AQBA 2ETCA 2QC9A 5ITZF 4BEPA 1NFIE 5D66A 4BETA 5AQ7A 2KXPC 2MYOA 4HLLA 3TWXA 3W9GA 1AWCB 3V31A 3T8KA 2DWZA 5EIDA 4Z68A 1UOHA 4J7WA 1K1BA 2RFAA 2XENA 4HBDA 4ATZD 4LG6A 1K3ZD 4GMRA 4HI9A 4GPMA 2XZDG 4TUMA 1YMPA 4UUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SO8 A;  3V79 K;  1OY3 D;  2ZGG A;  1K1A A;  3Q9N C;  4HRL A;  4A63 B;  4QFV A;  5EYP F;  5EIB E;  4F1P A;  1S70 B;  1BU9 A;  4DUI A;  2FO1 E;  5KWD A;  3UTM A;  2NYJ A;  4G8L A;  5FIO A;  4HRN A;  1BD8 A;  1MX6 A;  4G8K A;  1IXV A;  4HRM B;  1TR4 A;  3KEA A;  3ZUV B;  4DRX E;  2PNN A;  3EU9 A;  5CBN A;  2BKG A;  2DVW A;  1MX2 A;  2F8Y A;  3EHR A;  4K5C A;  3DEP A;  4U96 D;  2AJA A;  5ENS D;  3AAA C;  3TWW A;  4J8Y A;  2ETA A;  5CEA A;  1N0Q A;  5EIL A;  1SW6 A;  5CED B;  2RFM A;  1OT8 A;  5CER B;  4BES A;  4DX1 A;  1AP7 A;  1D9S A;  5JA4 D;  3ZKJ A;  5JMN D;  3V2O A;  5ENR D;  4O1O A;  3TWS A;  5BXO A;  2F8X K;  5KNG A;  1MX4 A;  3V30 A;  3UXG A;  2F37 A;  5ENQ D;  4OAV B;  4OAU C;  3Q9U C;  4U8Y D;  5AQA A;  3TWU A;  3J5Q B;  3W9F A;  5AN8 A;  3NOC D;  1MJ0 A;  4ZFH A;  1YCS B;  2ZGD A;  2XEE A;  4O60 A;  3D9H A;  3B7B A;  4YDW A;  4LNU D;  2DZN A;  2KBX A;  3JUE A;  5HRY A;  4CZ2 D;  4DX7 D;  3F6Q A;  3J5P A;  5KBA A;  5AAO A;  1IHB A;  3TWT A;  4LSZ E;  3B95 A;  4K5B A;  4RLY A;  5HKP A;  1DCQ A;  2ETB A;  4HI8 A;  4C48 B;  4DX5 D;  5ENP D;  1QYM A;  4F6R D;  1DC2 A;  3NOG D;  2JAB A;  4YDY A;  2V4H C;  3AJI A;  2QYJ A;  2V5Q C;  3LJN A;  5ENT D;  3TWQ A;  3ZU7 B;  5CEC B;  3C5R A;  3NBN B;  2XZT G;  3ZNG A;  2XEH A;  3EHQ A;  4U8V D;  3UI2 A;  4BER A;  1WDY A;  2A5E A;  4HB5 A;  1BI7 B;  1N0R A;  3TWV A;  4HNA D;  5FIN A;  2J8S D;  1N11 A;  3HRA A;  4K5A B;  4U95 D;  3T9K A;  1MYO A;  2P2C P;  3IXE A;  1A5E A;  4JB8 P;  5EN5 D;  1G3N B;  2Y0B G;  4O1P A;  5HS0 A;  4DX6 D;  4NIK A;  1BI8 B;  4N5Q A;  1BLX B;  2DZO A;  3HG0 D;  3JXI A;  5AAR A;  3JXJ A;  4BSZ B;  2L6B A;  4HQD A;  3DEO A;  1SVX A;  2B0O E;  2Y1L E;  5AQ9 A;  4DX2 A;  5ENO D;  3TWR A;  5EYL A;  5BXU A;  2VGE A;  5CBO A;  4QQI A;  1YYH A;  4ZHB A;  5KNH D;  1IKN D;  2HE0 A;  3V2X A;  4B93 B;  4CYM D;  2BKK B;  1WG0 A;  5AQB A;  2ETC A;  2QC9 A;  5ITZ F;  4BEP A;  1NFI E;  5D66 A;  4BET A;  5AQ7 A;  2KXP C;  2MYO A;  4HLL A;  3TWX A;  3W9G A;  1AWC B;  3V31 A;  3T8K A;  2DWZ A;  5EID A;  4Z68 A;  1UOH A;  4J7W A;  1K1B A;  2RFA A;  2XEN A;  4HBD A;  4ATZ D;  4LG6 A;  1K3Z D;  4GMR A;  4HI9 A;  4GPM A;  2XZD G;  4TUM A;  1YMP A;  4UUC A; 
#chains in the Genus database with same CATH topology
 4GTV A;  5CMW A;  2A4Z A;  2V5F A;  3Q9N C;  5G05 C;  2FEZ A;  3Q15 A;  2ZU6 B;  1GW6 A;  3JQ0 A;  2HR2 A;  4G8L A;  4XIF A;  1N95 A;  5CHE E;  3UM0 A;  5HI7 A;  1TR4 A;  3U66 A;  4GTS A;  3OTN A;  5LCW J;  4E6H A;  4V3I A;  2ETA A;  3ZIM A;  4ILH B;  5LOZ A;  3PZD A;  2JLB A;  3ONL A;  3KEZ A;  4JHR A;  5D0O D;  2KBX A;  2OVB A;  4GA1 A;  2XPI A;  2H6F A;  5KCM A;  3D9K A;  2IU1 A;  4TXP A;  4UWF A;  3Q4A B;  3NZU A;  1WDY A;  5B1A E;  2GGF A;  3HRA A;  1SZA A;  2P2C P;  2OND A;  2Y0B G;  5BV1 A;  2KC7 A;  4GZ6 A;  5KJM A;  2PQN A;  3FUJ A;  3CR3 A;  3MA5 A;  1SVX A;  3TWR A;  2J07 A;  2WXL A;  5CBO A;  3SBS A;  4JHJ A;  4ABN A;  3UT7 A;  2XQ0 A;  3P2B A;  1OWM A;  3PZ3 A;  2BKK B;  1WG0 A;  4APO A;  4CGW A;  2LAI A;  4PH4 B;  3S7J A;  4LG6 A;  4GMR A;  4J8D A;  2L0I A;  1Z3Y A;  1H6O A;  2VSN A;  5B1B E;  1ZBP A;  4I9E A;  4ILI A;  3UTM A;  1KZP A;  2OV8 A;  3G2V A;  3NB2 A;  3TAX A;  3UKR G;  2WPV A;  4A3V A;  4DRX E;  5ANR A;  4XKB A;  1KPS B;  4WNF A;  3C3O A;  3KSL A;  4I1M A;  4I6G A;  1E7U A;  4EPZ A;  3ESK A;  3RRM B;  3UIP C;  3QAR A;  3UXG A;  5A23 A;  4F3V A;  4G2V A;  2CFU A;  4CDN A;  3MYV A;  2H6I A;  2LSU A;  4AP2 A;  4K5B A;  4N3C A;  3QC1 A;  3L13 A;  3ULY A;  4EQF A;  2WM9 A;  4R7L A;  3JYS A;  3EUV A;  2IFU A;  1X5B A;  4UQZ A;  4JL0 A;  2JEK A;  2I1K A;  1Y6I A;  4NIK A;  2OEV A;  4BX9 A;  5FQ4 A;  4BSZ B;  1L5J A;  1ELW A;  4B0Z A;  4HOS A;  2VJ8 A;  1X81 A;  3TJP A;  3HXB A;  2WXH A;  2QC9 A;  3ABL E;  4HOT A;  4BT9 A;  3HXF A;  3MKQ B;  5G05 J;  2KAT A;  5ANL A;  3FP3 A;  5EX3 A;  4ATZ D;  3PZ4 A;  3SFX A;  3V79 K;  4UQX A;  4HRL A;  3JUI A;  1MHQ A;  3SFY A;  5EDS A;  2QFC A;  2IOL A;  2EIL E;  3CST A;  4JXT A;  1IQR A;  1KZO A;  2GRQ B;  3ML9 A;  4XZ4 A;  3APF A;  4GZC A;  3U9W A;  4LER A;  5BNW A;  1TJF A;  3U64 A;  2IF4 A;  4XI0 A;  3IBE A;  4RG6 A;  4GB9 A;  5JMN D;  4OYS A;  4D10 C;  5AQA A;  4CDR A;  2EIM E;  2VGX A;  1N4S A;  1PC2 A;  4DX7 D;  3TWT A;  4LSZ E;  3LS8 A;  1HXI A;  2AXU A;  3GZ1 A;  2XS1 A;  2DYS E;  4GCN A;  1FT2 A;  3DSW A;  3EHQ A;  4U8V D;  3TWV A;  1N11 A;  1H6K A;  3CVV A;  5H7P A;  4AY5 A;  3QK0 A;  4O1P A;  3FU3 A;  1ELK A;  4HQD A;  4FLH A;  1LF8 A;  2OVF A;  3PE3 A;  2RKK A;  3LYA A;  4QQI A;  4CGV A;  4Y6W A;  3ASG A;  3KS2 A;  2XEV A;  4IRU A;  3AS5 A;  3LJ3 A;  4HXI A;  2XRZ A;  4PS7 A;  3Q79 A;  4IUL A;  3W9G A;  1TNZ A;  4AIF A;  4HBD A;  2XEN A;  2KCK A;  3QKY A;  5FQ7 A;  3VTX A;  4WWN A;  5KJK A;  3JCK C;  1Z3X A;  4G23 A;  3Q47 B;  3ZEF A;  1K1A A;  2RD0 A;  3ABM E;  5D0Q D;  5DBK A;  1JWG A;  2WXP A;  4LUN U;  3UQ3 A;  2BKG A;  1OWO A;  3ZVV A;  3D9N A;  4NAC A;  1HG5 A;  1AP7 A;  3AS4 A;  5ENR D;  2WXO A;  2E2E A;  4U8Y D;  3TL5 A;  4PS8 A;  1MJ0 A;  1BPO A;  1YCS B;  2KCL A;  3ONK A;  5FZR A;  5HRY A;  1H19 A;  3F6Q A;  4UI9 J;  2KM4 A;  2L9B A;  2ETB A;  3FTW A;  4DX5 D;  2J4B A;  2JAB A;  4U63 A;  4YDY A;  5T8I A;  4TXQ A;  4K5A B;  5LCW C;  1HFA A;  5EN5 D;  1H2U A;  3DWL G;  5G2N A;  3TXN A;  1EYH A;  4TUU A;  4GYW A;  5JJ6 A;  3E32 A;  2PM7 A;  4WNE A;  1YYH A;  5KNH D;  4G26 A;  1ZB1 A;  4LNG A;  2WXM A;  4U0S A;  2R2L A;  1OCC E;  3RAU A;  1UN9 A;  3UUX A;  3D9L A;  4ANW A;  3IV0 A;  4ATG A;  4GMJ A;  4UWL A;  4UQY A;  3IHV A;  4J8S A;  2R02 A;  3SY2 A;  1OWL A;  3LDZ A;  3RU0 A;  1DVP A;  5B3S E;  5EIB E;  2M63 A;  3RKV A;  5KWD A;  3ZRH A;  3FHE A;  4AY6 A;  1NA0 A;  4MKT A;  2VGY A;  4I6J A;  5T3R A;  2WB2 A;  2XHE A;  2WQ7 A;  2B6C A;  4I17 A;  3E34 A;  1OWP A;  2XGM A;  4DLQ A;  3CHS A;  2CHZ A;  3ABK E;  3ZW3 A;  1XNF A;  3PNT B;  3FUH A;  3WG7 E;  3QOU A;  2ZGD A;  2XEE A;  2DZN A;  4JW1 A;  4Q96 A;  2YIN A;  3ISM C;  4YDE A;  2PQR A;  4IYP A;  4L7T A;  3CVW A;  3HXD A;  2GRN B;  5C1D A;  4FHJ A;  2XZT G;  2XEH A;  1O1T A;  2IO2 C;  4HB5 A;  3FTY A;  5JHA A;  4CT0 A;  3DSV A;  3MZL B;  3U3W A;  1A5E A;  1HS6 A;  3T5X A;  5HS0 A;  4DX6 D;  4N3A A;  3QB2 A;  4KVM A;  1N4R A;  1JWF A;  4JPS A;  5ENO D;  4GTT A;  2VSO E;  4RVB A;  4Q69 A;  4BTA A;  5KJL A;  3FTS A;  3DRA A;  4G11 A;  4I1A A;  4AEZ C;  2L6J A;  4HOU A;  4HS2 A;  3ZGQ A;  4BET A;  4O6F A;  5EID A;  1B89 A;  3L6A A;  2OEW A;  3QWW A;  4B94 A;  4TUM A;  4KYO B;  3AS8 A;  4MBG A;  3FH8 A;  1OY3 D;  4A63 B;  2CHW A;  3B7S A;  3ULE G;  3HXE A;  3N71 A;  1O1S A;  4AXH A;  2A5U A;  2R17 C;  5ENS D;  5A6C A;  4GPK A;  5E76 A;  5CER B;  1WY6 A;  5JA4 D;  2Y4T A;  2J49 A;  4L2L A;  2KCV A;  2P9L G;  4U7E B;  3QAQ A;  3JUE A;  2X3M A;  3OXF A;  5AAO A;  3CVP A;  3QNK A;  1UG3 A;  3NAW A;  3L82 A;  3C3R A;  1KLX A;  2X38 A;  3FUI A;  4WNG A;  1O5M A;  3LVR E;  3HHM A;  4DJA A;  3VLE A;  5AIJ A;  1A17 A;  4F1S A;  2F0Y A;  3SFZ A;  2AXZ A;  4HLE A;  1BI7 B;  3FTU A;  2V8S E;  5A7D B;  2KZT B;  3AG1 E;  3GZS A;  3SD5 A;  2P9P G;  4N5Q A;  2X6I A;  1YA0 A;  2VSY A;  4XI9 A;  2Y3A A;  3KSQ A;  1IYG A;  1SZ9 A;  4C0M A;  4B93 B;  3I5P A;  4GZ5 A;  3UMV A;  1SA5 A;  3HVE B;  3TWX A;  4FHK A;  2J9Q A;  5LX8 A;  1HU3 A;  3ZYQ A;  1K8K G;  3G2U A;  2WQH A;  3ZXS A;  5G55 A;  4F1P A;  2IEJ A;  2J4D A;  1Z5S C;  2UWJ G;  2DIW A;  2YNQ A;  3UM1 A;  1BD8 A;  3DSU A;  4C0E A;  2WXF A;  1U2V G;  1Q2Z A;  3FY4 A;  2F8Y A;  2Q7F A;  4K5C A;  3AAA C;  4CT4 A;  2RG8 A;  3I3N A;  4N5C A;  4J8E A;  3PNL B;  2VQ2 A;  3S2A A;  4BES A;  3GYZ A;  2HM8 A;  3FTZ A;  3IHY A;  5IY5 E;  4OAU C;  1QZ2 A;  4GTO A;  2GRO B;  2WXR A;  3CHR A;  2XCB A;  4N2Q A;  3D3M A;  3E30 A;  3FTV A;  3C72 A;  4NRH B;  2NSZ A;  3L08 A;  2NXP A;  1UN8 A;  5CCL A;  3BEE A;  4ANX A;  3NQP A;  3I4R B;  1TJC A;  1TNY A;  4TRQ A;  3UKU G;  3IXE A;  1JPL A;  1N52 A;  2J08 A;  3MKQ A;  3UX4 A;  3WXX A;  1FT1 A;  2IOS A;  2XGS A;  1EF1 C;  2ETC A;  3URZ A;  4BEP A;  3R7R A;  4FC8 A;  4BWR A;  5D66 A;  4Q94 A;  4UI9 C;  4FUL A;  3L54 A;  5FZS A;  2P9U G;  4PS3 A;  4GPM A;  2C0L A;  1UJK A;  2UY1 B;  4CCA A;  2WXI A;  3RO3 A;  5AJD A;  2FO1 E;  2EIJ E;  4URK A;  4KZ0 A;  3GW4 A;  3EIQ C;  4FP7 A;  4OVV A;  1INZ A;  3AU5 A;  3UIN C;  4TV3 A;  1N0Q A;  4J8F A;  1SW6 A;  2R03 A;  1TEZ A;  1LTX A;  5ENQ D;  3Q9U C;  3B7B A;  3FWV A;  4KBQ A;  1FVF A;  5G04 C;  1XGW A;  3ZHE B;  4RLY A;  5FZQ A;  4UWH A;  4ANV A;  2ION A;  5ENP D;  1WAO 1;  5CEC B;  2XRY A;  2LAH A;  3D9I A;  1U3C A;  3FU0 A;  3APC A;  5FIN A;  2FF4 A;  3HDX A;  5ARG A;  3MJW A;  3JXI A;  2HO1 A;  4AV7 A;  4L2Y A;  2WXN A;  2FUL A;  4A3T A;  3ML8 A;  2XGO A;  2X6J A;  3ZXP A;  2HYZ A;  3RIB A;  2ZIS A;  4BT8 A;  4U0U A;  1HH8 A;  3EJN A;  4GZD A;  2VTB A;  2XPY A;  2DWZ A;  3HYM B;  4ANU A;  2NC9 A;  3CHO A;  2OCC E;  1DNP A;  3UIO C;  1P5Q A;  4XKC A;  4BTB A;  4U07 A;  2E0I A;  2H6H A;  1PAQ A;  1W3B A;  3EHR A;  4LCT A;  4YND A;  2VTB B;  1TNB A;  1D8E A;  3MCX A;  3G2T A;  2F8X K;  3V30 A;  3FTX A;  2WQ6 A;  3OXG A;  3CVQ A;  4O60 A;  2P9I G;  2QZA A;  3R7Q A;  3FH7 A;  4JHK A;  1VDY A;  3KD7 A;  3QWV A;  1H2V C;  3L17 A;  5AEN A;  2MOW A;  3PRE A;  2IY0 C;  4C48 B;  1OWN A;  2YQ8 A;  5ENT D;  5JHB A;  4UWK A;  1LD7 A;  1ELR A;  3B7R L;  2R5S A;  4C9B B;  4MLP A;  3KAE A;  1TN6 A;  1Z6T A;  2DBA A;  3NZS A;  4M7C A;  3X2Q E;  2WXJ A;  1TN8 A;  5EX0 A;  4FA6 A;  3V2X A;  5AQB A;  5ITZ F;  3VTY A;  4HLL A;  4ACL A;  3V31 A;  2EQX A;  3FEX A;  2C0M A;  3ASO E;  4Y6C A;  2I2O A;  3LVQ E;  4IN3 B;  1S0P A;  1HG2 A;  3MGB A;  3DXK G;  3CLJ A;  3B13 A;  1S70 B;  2IJG X;  3ZPJ A;  3C98 A;  1HF8 A;  2PL2 A;  3FDH A;  4U8H A;  3HXC A;  4JA7 A;  3GZ2 A;  2BUG A;  4OVU A;  1E96 B;  4U96 D;  3VLF A;  3MKR A;  5G04 J;  3CHP A;  3S7B A;  4DX1 A;  3AU4 A;  3NF1 A;  3ZKJ A;  3SGH A;  3TWU A;  2LNI A;  3NOC D;  1OUV A;  5J08 A;  2I9C A;  4BFR A;  1FCH A;  4MS6 A;  3BU8 A;  3B95 A;  4WND A;  4EZJ A;  4I43 A;  2V5Q C;  3NBN B;  4F7A A;  4NQ0 A;  2EIN E;  3BQO A;  4DI4 A;  3UI2 A;  4BER A;  1S64 A;  2A5E A;  4PDX A;  2V0P A;  1JCR A;  4HNA D;  1OXJ A;  2H6G A;  2CFZ A;  4KVO A;  2LXM A;  5M72 A;  5DIZ A;  4WWO A;  1BI8 B;  1BLX B;  4GA2 A;  4WWP A;  4KT6 B;  4DX2 A;  5BXU A;  3D9P A;  3CKB A;  3HIZ A;  4FLB A;  2XCC A;  5CRV A;  3AG4 E;  2PM6 A;  4K0R A;  4CYM D;  3DXM G;  1NFI E;  4NUR A;  2J09 A;  3E4B A;  2DYR E;  3OXL A;  1N94 A;  2MYO A;  4ME2 A;  4APF A;  1AWC B;  4GAA A;  3T8K A;  5FQ8 A;  4EBA G;  1SA4 A;  3R9A B;  4YVQ C;  4HI9 A;  3ZN3 A;  2XPZ A;  4UUC A;  5CMY A;  1Y8M A;  3ASH A;  3Q49 B;  5EYP F;  3ENE A;  3EHM A;  2MRI A;  4N39 A;  1N54 A;  2NYJ A;  1JCQ A;  4HRN A;  2FBN A;  1IXV A;  4ACK A;  3JQ1 A;  3EU9 A;  1MX2 A;  4KXK B;  3TWW A;  3CGH A;  1PY1 A;  5EIL A;  4FU3 A;  5T4Y A;  4I2Z A;  1D9S A;  4U0Z A;  3V2O A;  4O1O A;  2L0T B;  3TXM A;  4KZC A;  4CDM A;  3Q7A A;  3FUL A;  5BW8 C;  3PE4 A;  3RJV A;  5KBA A;  2KZT A;  4G1T A;  1QYM A;  3ZU7 B;  1RZ4 A;  3LJN A;  5JJT A;  4G25 A;  2VYI A;  4I9C A;  3ASN E;  3PUJ A;  4TXR A;  3U4T A;  3D9M A;  5AYW D;  3BG1 B;  3L9T A;  3P1U A;  3DST A;  3HVE A;  4GTR A;  3CVY A;  3CIA A;  2BTD A;  3MV2 B;  4EHM A;  3PEU B;  3CHQ A;  4JEU A;  1H6P A;  2GRM A;  4XE0 A;  3CQG B;  3EU5 A;  5ENN A;  3AG2 E;  4JD2 G;  2XS8 A;  5J90 A;  3SI5 A;  2WXK A;  3G2S A;  5CCM A;  1JUQ A;  1OCZ E;  2P9K G;  3ZYL A;  4EZL A;  2IQC A;  3SF4 A;  4CRW A;  1BU9 A;  1OCR E;  1NL4 A;  2LUH A;  5BPP A;  2QYU A;  3E33 A;  3KEA A;  3ASF A;  3EIJ A;  5CBN A;  3DEP A;  4E85 A;  3FUM A;  3CVU A;  5CED B;  5E75 A;  1OT8 A;  1RW2 A;  3CHM A;  1E7V A;  1H2T C;  4OAV B;  3Q78 A;  3W9F A;  3CVX A;  1HO8 A;  2AW6 A;  4YDW A;  3PEV B;  4G24 A;  3FUN A;  4DPR A;  3FEY A;  3T5V A;  2WVI A;  1DCQ A;  2AXV A;  3C5R A;  4ILG A;  3PUK A;  1TN7 A;  4L9P A;  3O48 A;  3T8M A;  3T9K A;  1V55 E;  3B7U X;  4FAD A;  1QBQ A;  4LRZ A;  3TG4 A;  2ZIR A;  3RRU A;  3HG0 D;  3CVL A;  1E8W A;  3L22 A;  3RSE G;  2Y1L E;  5AQ9 A;  3CK9 A;  3MEK A;  4MRU A;  1IKN D;  3G2W A;  4JZY A;  1DCE A;  1NZN A;  5FQ6 A;  2UY1 A;  4I6E A;  1HE8 A;  3OAW A;  1E8X A;  3ESL A;  4YDO A;  3ULQ A;  3EDT B;  3PRZ A;  1MZC A;  4GML A;  3UM2 A;  3Q73 A;  4QFV A;  2FI7 A;  4CEM A;  5FIO A;  4JA9 A;  2X6F A;  3CVN A;  4HRM B;  5LFA A;  4DI3 A;  3SHF A;  5BUZ A;  4WAF A;  2AJA A;  3QDN A;  3PH0 C;  5CEA A;  5BV0 A;  3FH5 A;  1N4Q A;  2P58 C;  3ZHE A;  2I6H A;  5KNG A;  1MX4 A;  3QJZ A;  1NA3 A;  4JC8 A;  3TG5 A;  4ZFH A;  3I4G A;  5AN8 A;  1UW4 B;  2DCP A;  3D9H A;  4L23 A;  4LNU D;  4GCO A;  3MV3 B;  4HI8 A;  3AG3 E;  3FUD A;  1DC2 A;  3NOG D;  3AJI A;  2QYJ A;  4GYO A;  4L1B A;  3ASD A;  3PZ1 A;  1N0R A;  3IKO B;  4GYY A;  5KJN A;  4H7Y A;  3SZ7 A;  3LEW A;  1TNU A;  1TNO A;  4B8C B;  3L16 A;  4RSY A;  5AJL A;  4EBA A;  3UT8 A;  2PZI A;  3CQC B;  3LKU A;  3LY8 A;  1KT1 A;  3Q7F A;  2Y69 E;  4YVO A;  5FWQ A;  2GRR B;  2WXQ A;  5FJY A;  2QY7 A;  4J7W A;  2RFA A;  3DBS A;  2WMN A;  1EDU A;  2XZD G;  4JVS A;  4LNB A;  5HQ8 A;  3PDN A;  1EPU A;  3UPV A;  4A55 A;  1FVH A;  4DUI A;  4G8K A;  2PNN A;  4I1O B;  4J8Y A;  2I1J A;  3CSF A;  4UWG A;  3TWS A;  5BXO A;  2AVP A;  1O1R A;  2F37 A;  2CHX A;  2CG3 A;  2X6K A;  4DLO A;  3FFL A;  3J5P A;  1IHB A;  4EZK A;  4FJZ A;  4UI9 K;  3C3Q A;  2FO7 A;  3UM3 A;  2VGX B;  1V54 E;  3FUF A;  2P9S G;  5C2Y A;  2J8S D;  1MYO A;  3FU6 A;  1JCS A;  1FPP A;  4JB8 P;  1G3N B;  4B89 A;  5AAR A;  2L6B A;  3DEO A;  4AOF A;  3DSX A;  5EYL A;  2VGE A;  3LY9 A;  4JEH A;  5D2M C;  5JJ7 A;  4EEC A;  3FUK A;  2YHE A;  3QWP A;  3BG0 B;  4N3B A;  4I2W A;  5ARF A;  4HOQ A;  1YMP A;  4F53 A;  3SQV A;  3SO8 A;  1QQE A;  4X8Q A;  4GTM A;  3CK8 A;  4M3O A;  1N9A A;  3RO2 A;  3DPY A;  1MX6 A;  3ZUV B;  4AM9 A;  2DVW A;  3EHN A;  1QNF A;  2MHK A;  2WMO A;  1U3D A;  3ZYM A;  3APD A;  2GW1 A;  3D9J A;  4N2S A;  4HOR A;  2V4L A;  2R59 A;  1HZ4 A;  4RQI A;  3IEG A;  5HKP A;  3R9M A;  4H7X A;  4F6R D;  4GTQ A;  3O4Z A;  4A1S A;  2IO3 C;  1UJJ A;  3E37 A;  1MQS A;  3TWQ A;  2GRL A;  1TYQ G;  2OOE A;  2R05 A;  3ZYK A;  3D9O A;  1NP7 A;  2C2L A;  3VLD A;  4FJY A;  4HVB A;  3Q75 A;  2LO6 A;  3JXJ A;  1S63 A;  3CEQ A;  3Q5M A;  3S7F A;  1HX8 A;  4ZHB A;  2HE0 A;  3LXU X;  4W9R A;  4GTP A;  4GZ3 A;  3LCA A;  2EIK E;  2GRP B;  5BT1 A;  2LXL A;  4Z68 A;  1UOH A;  3CKC A;  1K1B A;  3PZ2 A;  4GU5 A;  3DSS A;  1D8D A;  1K3Z D;  4LEU A;  2ILR A;  3FUE A;  3PVL A;  3K9I A;  3S7D A;  1ZU2 A;  4U04 A;  2Y4U A;  1WM5 A;  1LD8 A;  2ZGG A;  4BY6 A;  4DK5 A;  4A1G A;  3ZFW A;  1IQU A;  4WUY A;  5EKQ D;  5FTP A;  2BED A;  4J6I A;  1SQM A;  4BX8 A;  2BF0 X;  3MX3 A;  2YHC A;  2RFM A;  1H0A A;  3PS6 A;  3UT4 A;  3RRN B;  3DPD A;  3J5Q B;  2LSV A;  1OCO E;  3BUA A;  4K03 A;  4CZ2 D;  3TGO A;  2AWI A;  1N4P A;  3B7T A;  2CG2 A;  2V4H C;  2WXG A;  4HFG A;  4AJW A;  4J0U A;  3ZNG A;  1E8Z A;  3SBT B;  4B8A A;  4XX5 A;  4U95 D;  3LY7 A;  1NI1 A;  4BSX A;  3CK7 A;  4XEI G;  2DZO A;  5CRU A;  2X6H A;  2B0O E;  2VSX E;  5LP0 A;  3CV0 A;  4KMO A;  1E90 A;  1KT0 A;  2P9N G;  3LPZ A;  4RG9 A;  3SNX A;  5AQ7 A;  2KXP C;  5FT9 A;  3RK6 A;  1E8Y A;  3FU5 A;  1IHG A;  4GA0 A;  4AVX A;  2ZXW E;  4PUC A;  4P29 A; 
#chains in the Genus database with same CATH homology
 3SO8 A;  3V79 K;  1OY3 D;  2ZGG A;  1K1A A;  3Q9N C;  4HRL A;  4A63 B;  4QFV A;  5EYP F;  5EIB E;  4F1P A;  1S70 B;  1BU9 A;  4DUI A;  2FO1 E;  5KWD A;  3UTM A;  2NYJ A;  4G8L A;  5FIO A;  4HRN A;  1BD8 A;  1MX6 A;  4G8K A;  1IXV A;  4HRM B;  1TR4 A;  3KEA A;  3ZUV B;  4DRX E;  2PNN A;  3EU9 A;  5CBN A;  2BKG A;  2DVW A;  1MX2 A;  2F8Y A;  3EHR A;  4K5C A;  3DEP A;  4U96 D;  2AJA A;  5ENS D;  3AAA C;  3TWW A;  4J8Y A;  2ETA A;  5CEA A;  1N0Q A;  5EIL A;  1SW6 A;  5CED B;  2RFM A;  1OT8 A;  5CER B;  4BES A;  4DX1 A;  1AP7 A;  1D9S A;  5JA4 D;  3ZKJ A;  5JMN D;  3V2O A;  5ENR D;  4O1O A;  3TWS A;  5BXO A;  2F8X K;  5KNG A;  1MX4 A;  3V30 A;  3UXG A;  2F37 A;  5ENQ D;  4OAV B;  4OAU C;  3Q9U C;  4U8Y D;  5AQA A;  3TWU A;  3J5Q B;  3W9F A;  5AN8 A;  3NOC D;  1MJ0 A;  4ZFH A;  1YCS B;  2ZGD A;  2XEE A;  4O60 A;  3D9H A;  3B7B A;  4YDW A;  4LNU D;  2DZN A;  2KBX A;  3JUE A;  5HRY A;  4CZ2 D;  4DX7 D;  3F6Q A;  3J5P A;  5KBA A;  5AAO A;  1IHB A;  3TWT A;  4LSZ E;  3B95 A;  4K5B A;  4RLY A;  5HKP A;  1DCQ A;  2ETB A;  4HI8 A;  4C48 B;  4DX5 D;  5ENP D;  1QYM A;  4F6R D;  1DC2 A;  3NOG D;  2JAB A;  4YDY A;  2V4H C;  3AJI A;  2QYJ A;  2V5Q C;  3LJN A;  5ENT D;  3TWQ A;  3ZU7 B;  5CEC B;  3C5R A;  3NBN B;  2XZT G;  3ZNG A;  2XEH A;  3EHQ A;  4U8V D;  3UI2 A;  4BER A;  1WDY A;  2A5E A;  4HB5 A;  1BI7 B;  1N0R A;  3TWV A;  4HNA D;  5FIN A;  2J8S D;  1N11 A;  3HRA A;  4K5A B;  4U95 D;  3T9K A;  1MYO A;  2P2C P;  3IXE A;  1A5E A;  4JB8 P;  5EN5 D;  1G3N B;  2Y0B G;  4O1P A;  5HS0 A;  4DX6 D;  4NIK A;  1BI8 B;  4N5Q A;  1BLX B;  2DZO A;  3HG0 D;  3JXI A;  5AAR A;  3JXJ A;  4BSZ B;  2L6B A;  4HQD A;  3DEO A;  1SVX A;  2B0O E;  2Y1L E;  5AQ9 A;  4DX2 A;  5ENO D;  3TWR A;  5EYL A;  5BXU A;  2VGE A;  5CBO A;  4QQI A;  1YYH A;  4ZHB A;  5KNH D;  1IKN D;  2HE0 A;  3V2X A;  4B93 B;  4CYM D;  2BKK B;  1WG0 A;  5AQB A;  2ETC A;  2QC9 A;  5ITZ F;  4BEP A;  1NFI E;  5D66 A;  4BET A;  5AQ7 A;  2KXP C;  2MYO A;  4HLL A;  3TWX A;  3W9G A;  1AWC B;  3V31 A;  3T8K A;  2DWZ A;  5EID A;  4Z68 A;  1UOH A;  4J7W A;  1K1B A;  2RFA A;  2XEN A;  4HBD A;  4ATZ D;  4LG6 A;  1K3Z D;  4GMR A;  4HI9 A;  4GPM A;  2XZD G;  4TUM A;  1YMP A;  4UUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...