4JHRA

An auto-inhibited conformation of lgn reveals a distinct interaction mode between goloco motifs and tpr motifs
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
305
structure length
290
Chain Sequence
NFDEAIVCCQRHLDISRELNDKVGEARALYNLGNVYHAKGKSEDVRNALQAAVDLYEENLSLVTALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELKDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGDLEVLFPPDEDFFDILVKCQGSRLDDQRCAPPSAATKGPTVPDEDFFSLILRSQAKRMDEQRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An autoinhibited conformation of LGN reveals a distinct interaction mode between GoLoco motifs and TPR motifs
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords G-protein-signaling modulator 2
total genus 119
structure length 290
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02188 GoLoco GoLoco motif
A PF13176 TPR_7 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4jhrA00
3RU0A 1PC2A 3GYZA 4J8EA 4GA2A 5C1DA 4CGWA 4JA9A 3TG5A 4I9CA 5BW8C 4XI9A 1HXIA 5G05J 2UWJG 5KJLA 1NA0A 2VSNA 1P5QA 4GA0A 5HI7A 1W3BA 3TAXA 2VGXB 4APOA 5KJKA 2VSYA 4I17A 4I1AA 4JHRA 5LCWJ 1IYGA 2KATA 4U0UA 2V5FA 1TJCA 3FWVA 5DIZA 4N3CA 4HORA 2IF4A 4ABNA 5EKQD 3QWWA 2L6JA 4ME2A 2VQ2A 3BEEA 2KCLA 3LPZA 3QWVA 1E96B 4JL0A 4UI9J 2PQRA 4YVQC 3LCAA 3CK9A 3SF4A 3MV3B 4N39A 4A1SA 3UPVA 3Q49B 4HOTA 2OOEA 4JA7A 3RO3A 3NF1A 3CEQA 4KXKB 1ZU2A 2C0LA 2QFCA 4IN3B 4NQ0A 5ARFA 4KYOB 5D0OD 4Y6WA 5G05C 3CK7A 3PE3A 3EDTB 4BTAA 2KCKA 3RJVA 2XCBA 1FCHA 5CCMA 4RG9A 2ONDA 3TG4A 1A17A 2Q7FA 2XGSA 2YQ8A 3O48A 3ESKA 3MA5A 4WNDA 5ARGA 3VTXA 5JJ7A 4BT8A 2FEZA 2Y4TA 3PDNA 4LEUA 4N3BA 1QQEA 2UY1B 3KS2A 4F3VA 3ULQA 4WUYA 3S7DA 4GCNA 3ZN3A 3KD7A 5G04J 4N2SA 3QDNA 2JLBA 1HH8A 5JJ6A 4AY6A 4YNDA 5FJYA 1ZBPA 2PL2A 4UQZA 4HOSA 4N2QA 2KCVA 4G26A 3GZ2A 1QZ2A 3OXGA 4I2WA 5KJNA 4B94A 4G2VA 3ZFWA 1HZ4A 4GZ3A 2FBNA 2UY1A 2XPIA 4N5CA 1NA3A 4KBQA 5AYWD 4J8FA 2NC9A 2HR2A 1KT1A 2Y4UA 3LKUA 5M72A 3E4BA 3Q5MA 2PZIA 4NRHB 3IEGA 4U0SA 3VTYA 4EQFA 4G24A 3Q47B 3Q4AB 4G1TA 4GA1A 4HOQA 2FI7A 4UQXA 3ZHEB 3ZGQA 5HQ8A 3Q15A 3TGOA 2LSVA 3ASFA 3ASDA 5G04C 3URZA 3FP3A 2J9QA 5KJMA 3CKBA 2C0MA 3AS8A 4H7XA 4AIFA 4G25A 4UQYA 2XCCA 4W9RA 2VYIA 2WQHA 4GYOA 4BT9A 2FO7A 2PQNA 2XEVA 4J8DA 4G23A 4WNGA 5BT1A 4YVOA 5FT9A 2E2EA 3ZHEA 3RIBA 4BTBA 2VGYA 3UQ3A 2BUGA 2DBAA 4CGVA 3GZ1A 3GW4A 4U0ZA 1OUVA 1Y8MA 3CV0A 3QWPA 3FFLA 2R5SA 2FF4A 4GZ5A 3LYAA 4Y6CA 3CVLA 3QKYA 4GZ6A 3R9AB 5FTPA 5CCLA 2XGOA 3ASGA 3CKCA 2P58C 4GYYA 3AS5A 3K9IA 3RKVA 5FZQA 2IFUA 2HO1A 4O6FA 1YA0A 2LNIA 3SZ7A 3S7FA 2HYZA 3LY8A 4I9EA 5EX3A 5EX0A 2LSUA 4UI9C 3MV2B 3N71A 5FZSA 3U4TA 1ELRA 4CDRA 1NZNA 1XNFA 3AS4A 3ZPJA 3S7BA 5JJTA 3HYMB 3PE4A 1B89A 4GPKA 4J0UA 2KC7A 5CHEE 2XGMA 3S7JA 3OXLA 1WAO1 4RG6A 4N3AA 2GW1A 3KAEA 3LY9A 5DBKA 4AY5A 3OXFA 4I2ZA 4U07A 5LCWC 5A6CA 4WNFA 1IHGA 5D0QD 3JYSA 2MHKA 4UI9K 3WXXA 1ELWA 2I6HA 4GYWA 3CVNA 3MKRA 2AVPA 3LY7A 4XI0A 3UUXA 1WM5A 4HOUA 4AM9A 4BWRA 3CK8A 3ASHA 3CVPA 3MEKA 4GCOA 4H7YA 1KLXA 4U04A 3CVQA 4WNEA 2YHCA 2C2LA 2VGXA 5A7DB 5BNWA 3RO2A 1KT0A 3QOUA 3U3WA 5FZRA 4XIFA 2WPVA
chains in the Genus database with same CATH superfamily
1U3DA 4EHMA 3ABME 3TWQA 4I9CA 5HI7A 3TWTA 5LCWJ 5AJLA 2IO3C 2RFAA 5FQ4A 4ME2A 3B95A 2GRQB 3UPVA 3CIAA 4JXTA 2OVBA 2WXJA 4KYOB 1TNUA 5G05C 5EIBE 2XCBA 4YDWA 2YHEA 3P2BA 3PH0C 2Y4TA 3PDNA 4HI9A 4LEUA 5G04J 4CT4A 1SA5A 5FJYA 3DSSA 3GZ2A 1RZ4A 4I2WA 4B94A 3AG2E 3DBSA 1U2VG 1GW6A 1Y6IA 2Y4UA 1HO8A 5CCLA 2GRRB 3FP3A 2C0MA 2BKKB 3D9PA 4CRWA 5CBNA 2F8YA 2Y3AA 2BUGA 4UWFA 3UM2A 4CT0A 4FHJA 3LYAA 4JHKA 2XEEA 5LFAA 4HRNA 4BSXA 4WWNA 4GYYA 1H2TC 4JD2G 4Q69A 2DIWA 4L7TA 3JQ1A 5CHEE 3ASNE 1WAO1 2GW1A 4BY6A 2MHKA 3APCA 4MBGA 3CVNA 3DXKG 5BNWA 3E32A 2ZU6B 3RU0A 3FTWA 4YDOA 3FH7A 3DXMG 2P9KG 3B7SA 1KZOA 3CGHA 3HXBA 3Q78A 3ABLE 5A23A 1MQSA 5JJ7A 1K3ZD 3FEYA 2L6BA 3E30A 4M7CA 4TXPA 3JUEA 4E6HA 3SO8A 3FH8A 1UW4B 1A17A 5ENQD 3VTXA 3T8KA 3ONLA 4O60A 2M63A 3LVRE 2J07A 3SD5A 4ILGA 4A1GA 4AY6A 2X38A 4GMJA 4CCAA 4KT6B 1HZ4A 4DX1A 2NSZA 3HVEA 3SFYA 1OCZE 1Z5SC 4KBQA 4F1SA 4U0SA 2H6HA 4HOQA 1LD8A 3ZYKA 3D9HA 2H6IA 4HI8A 3T5XA 1BPOA 3TWVA 3TL5A 3V79K 4U0ZA 3OAWA 2DZNA 2VTBA 4CZ2D 3CHOA 1E8YA 3L17A 2LNIA 3FUEA 4WWPA 5D2MC 3SBTB 3MGBA 4N3AA 4A55A 1ZB1A 5A6CA 2Y69E 1IHGA 3PEUB 2I6HA 2YINA 2QY7A 3C98A 4H7YA 1K1BA 2V4HC 2LO6A 1IQRA 5C1DA 1TR4A 3TG5A 4ACLA 5G05J 4TV3A 1JPLA 4HB5A 3AG3E 2VQ2A 3LPZA 4PDXA 1N4PA 2IO2C 4N5QA 1VDYA 2EILE 3MV3B 3L82A 3ZYMA 1DCQA 2F0YA 3G2TA 3PE3A 3VLEA 3ASOE 2AXUA 1JWFA 2WM9A 1INZA 3NZUA 3G2UA 1ZBPA 3D9MA 3PREA 1QZ2A 1MJ0A 2X6IA 1BD8A 4G2VA 3ZFWA 2XS8A 4N5CA 4BFRA 4L9PA 2WB2A 2DYRE 2L9BA 2DCPA 3HIZA 1FT2A 4KZ0A 3Q15A 4DRXE 3GZSA 2RFMA 2DWZA 1TN8A 4K5AB 2WQ6A 4XE0A 2V0PA 4I6JA 2VSOE 5C2YA 5KNGA 5B3SE 2XGOA 4BSZB 1Z3YA 4FLHA 1HFAA 1YA0A 3SZ7A 4G11A 5D66A 1N94A 2ETCA 3BG1B 5BUZA 3T5VA 1XNFA 4L23A 3QARA 4J0UA 2HE0A 2XZDG 3IHYA 4L2YA 4ACKA 5ENNA 3UUXA 4XI0A 4ZHBA 5E75A 2YHCA 2R03A 1WDYA 1PC2A 5BXUA 1OCRE 4CGWA 1N4SA 4DX6D 1E8XA 3JXIA 5AAOA 2WXGA 3MKQA 3ZU7B 3EJNA 4O1OA 4HORA 3SHFA 4K03A 5CRUA 1E7VA 3PZ2A 4N3BA 4IYPA 4C0EA 4CDNA 4N2SA 3NB2A 2RG8A 4FU3A 2DZOA 3HDXA 3TWRA 5B1AE 1IXVA 1Z6TA 3RK6A 3NOGD 3CQGB 1ELKA 4EPZA 3J5PA 3Q9UC 4UQXA 3ZGQA 3L54A 3ASFA 4PH4B 2HM8A 4W9RA 2XCCA 2X6HA 4KVMA 2I1KA 1Y8MA 1N54A 3PEVB 5EYPF 5FQ7A 3CVVA 2P58C 5G2NA 3SY2A 3PUJA 3S7FA 1HE8A 2LSUA 4BETA 2IU1A 4GTOA 1NZNA 3S7BA 1B89A 2V8SE 3ZYQA 3E34A 4C48B 4BX8A 3MJWA 1SVXA 5ENOD 3ZUVB 3CK8A 3RO2A 4DK5A 1PY1A 1TJCA 3DSWA 5KJLA 1NA0A 1TNBA 4UWHA 4U0UA 1OT8A 5EKQD 2WXMA 2DYSE 3BEEA 2KCLA 4U95D 4PS8A 5KWDA 3LXUX 3CHQA 3RO3A 4HRLA 4MS6A 1FPPA 2J4DA 3PNLB 2B0OE 4RG9A 4AV7A 1OWNA 2L0TB 2IONA 4UWKA 3V31A 1D9SA 4JEHA 4GTSA 3KD7A 3QDNA 2I2OA 1S63A 4HOSA 1N52A 1MYOA 1NFIE 3J5QB 1E8ZA 3FTVA 2HR2A 5B1BE 3D3MA 4Z68A 4TXRA 3E33A 4TXQA 4EQFA 3Q4AB 3ZHEB 3D9OA 5KJMA 3EIQC 2CHZA 1N0RA 1YMPA 2ILRA 4YVOA 4M3OA 2VGYA 3GW4A 2FO1E 3ZKJA 1E8WA 2GRMA 3ZNGA 4B8CB 3LY8A 4UI9C 5CMWA 4YDEA 4I1MA 1HG2A 1TYQG 2P9NG 3CVUA 3CVQA 4GTQA 5G04C 5ENPD 4XIFA 3ML8A 4GTRA 3SFZA 4HVBA 2YNQA 1HXIA 3ZRHA 3QC1A 1MX4A 3LDZA 2KATA 3FWVA 2CG3A 2WXPA 3UIPC 4UI9J 4G8LA 3SQVA 4A1SA 3NF1A 3AAAC 1ZU2A 4DI4A 4IRUA 4EZJA 4I43A 3FU5A 5E76A 3ML9A 1EF1C 2ONDA 3FUFA 3C3OA 1QQEA 2JLBA 4XZ4A 4YNDA 2H6GA 5FIOA 4G26A 1EYHA 4JZYA 3EHRA 3FU6A 5HS0A 3DPYA 2CHXA 4TRQA 1BI7B 3TGOA 3CKBA 2WQHA 4BT9A 3I3NA 1D8DA 1DNPA 1IKND 2XEVA 4FADA 1A5EA 3UM0A 3UIOC 1MZCA 2R5SA 4NACA 3RKVA 1RW2A 3IXEA 1OXJA 1UOHA 3NOCD 2WMNA 5EX3A 5EX0A 5AARA 1HU3A 2ZGGA 3AS4A 2F8XK 2IOLA 4A63B 4GPKA 2QZAA 4XKCA 3S7JA 3OXLA 5DBKA 4F53A 1QNFA 4I2ZA 4R7LA 1XGWA 2XPYA 1EDUA 3AU5A 4HOUA 4GCOA 2WPVA 4DJAA 5LX8A 4J8EA 4XI9A 4OVUA 4Q94A 1P5QA 4B0ZA 2VGXB 2VSYA 2V5FA 1U3CA 1JUQA 3TWUA 3DSTA 3FU0A 3UT7A 4PS7A 1UJKA 5AQBA 2KCKA 1OWPA 5T4YA 4DI3A 2WXKA 1UN9A 1SW6A 4GMRA 5EDSA 1MX6A 3ZVVA 1S70B 5T8IA 4QQIA 4QFVA 3AG4E 5T3RA 4XEIG 1SQMA 2EIKE 3FTUA 5H7PA 2I9CA 4TUUA 4FJYA 1KT1A 2LUHA 4BEPA 3D9NA 4GTVA 2WXNA 3ZEFA 3JUIA 4HQDA 3S2AA 1JWGA 2PQNA 3DSXA 4K5CA 2P9LG 1H2VC 4F6RD 4URKA 3HXDA 3I4RB 3V30A 3LS8A 4FP7A 4MLPA 3ASGA 3PVLA 3UX4A 3U66A 1K1AA 4AJWA 3TWSA 2XZTG 1DCEA 2EIME 3AJIA 3HYMB 5KCMA 5LCWC 3UINC 1K8KG 5D0QD 4AOFA 3C5RA 4WNEA 2GROB 4GTTA 1KT0A 2VSXE 3FULA 5FZRA 2WQ7A 4GA2A 4JA9A 4AVXA 1NI1A 2BF0X 5ENTD 4I17A 4JHRA 3FUIA 5DIZA 2BTDA 3HVEB 4ABNA 3SF4A 4ILHB 2RD0A 3HHMA 4EBAA 2OOEA 4JA7A 5FQ6A 3TXMA 4HFGA 3PRZA 1BU9A 3Q75A 2E0IA 3APFA 3IKOB 5LP0A 4GTPA 4MKTA 3RSEG 3FUNA 5JMND 4GCNA 2VTBB 3L9TA 2A4ZA 2PL2A 2RKKA 3CLJA 2XENA 5J08A 4FC8A 4JB8P 1TJFA 2V5QC 3Q47B 1N4QA 2ETAA 1IHBA 4HNAD 4GU5A 4APFA 3I5PA 3CVWA 2WXHA 4J8DA 1JCSA 3PZ4A 1N4RA 3RRNB 5ANLA 4CGVA 4RQIA 1OUVA 3LJ3A 5AQ9A 3FFLA 3R9AB 3QKYA 4AXHA 3C72A 4A3TA 4ZFHA 1H19A 5JJTA 4AY5A 5ITZF 2KBXA 4NURA 4B8AA 4OVVA 4N2QA 4GZDA 4DPRA 1G3NB 3U3WA 3PNTB 3GYZA 3AU4A 4U8VD 2LAIA 1D8EA 4I6GA 1O5MA 2IF4A 1X5BA 2L6JA 1E96B 3CK9A 1OWLA 3Q49B 4CEMA 4NQ0A 3HXEA 1FCHA 2I1JA 5CCMA 3TG4A 3EHNA 3W9GA 2BKGA 2CG2A 2FEZA 4LRZA 4I1OB 4XKBA 3UXGA 4UWLA 3QK0A 2A5EA 4GZ3A 2FBNA 2XPIA 4ANWA 1TN6A 5AYWD 2NC9A 4PS3A 4K0RA 3CHSA 4G1TA 2L0IA 4NIKA 2LAHA 3R7QA 2LSVA 1FT1A 2X6FA 4MRUA 3TWWA 4HXIA 3UQ3A 2VJ8A 3ISMC 3GZ1A 3CV0A 3QWPA 2EIJE 3NZSA 5AENA 3N71A 3T9KA 3ZPJA 4FLBA 2OEVA 2CFUA 2OVFA 1MX2A 3KAEA 3OXFA 4HBDA 4U07A 4U7EB 3UMVA 3DEPA 4U04A 3ASHA 2J09A 3CVYA 5FQ8A 3F6QA 4ATGA 3FTZA 1UJJA 1MHQA 2PM7A 4U63A 2AW6A 4P29A 4X8QA 4XX5A 4FHKA 2X6KA 3D9LA 4FULA 2QYUA 4YVQC 2XS1A 4N39A 4KVOA 1TNYA 4IN3B 1V55E 2R2LA 4Y6WA 1YYHA 1HX8A 1OCOE 3O48A 1DC2A 3BU8A 3QJZA 4BT8A 2UY1B 3FUJA 4WUYA 4JC8A 3TXNA 3MKQB 2ZGDA 3L08A 1EPUA 3CSTA 3BUAA 2UY1A 2JEKA 5J90A 2BEDA 3PZ1A 3UM1A 4G24A 4GA1A 3LJNA 4GTMA 4DX5D 2J9QA 4AIFA 2AJAA 4LG6A 2DVWA 2XQ0A 4BERA 1LTXA 2WXOA 3FU3A 3RRUA 1HF8A 2FF4A 2XRYA 3AS5A 2H6FA 2IFUA 3CQCB 5EYLA 2WMOA 4U8YD 1YCSB 3KEZA 4FJZA 3DPDA 2ETBA 3QNKA 4GYWA 3R9MA 3FUKA 2IY0C 3D9JA 5A7DB 2VGXA 3U64A 2AXVA 2WXQA 2ZISA 5BW8C 4GA0A 4F1PA 1SA4A 3FUHA 3FEXA 3Q7AA 3FHEA 3UT8A 3VLFA 3SGHA 1UN8A 2C0LA 3G2SA 3CK7A 1TEZA 3SBSA 2J8SD 4F3VA 1IYGA 2JABA 3EU5A 3FUMA 3KS2A 4IULA 4B93B 2KZTA 5JJ6A 4WWOA 4GMLA 3OXGA 1HS6A 4EBAG 3EU9A 3ZIMA 4V3IA 2QC9A 1NA3A 5BV0A 3L22A 3E4BA 2PZIA 1N9AA 4NRHB 3W9FA 1LF8A 3I4GA 2WXLA 3CR3A 3MCXA 3B7UX 2V4LA 2F37A 4G25A 2LXLA 4UQYA 3G2WA 3RIBA 2WXIA 1WY6A 5FTPA 2XHEA 2A5UA 2XPZA 2XRZA 5EIDA 5FZSA 5AJDA 3CVXA 1QBQA 2KC7A 3BQOA 5HRYA 5KNHD 1N95A 3JYSA 2CHWA 2P2CP 3CVPA 3D9IA 3MYVA 3IV0A 2WXRA 1SZ9A 4DX2A 3CHPA 4HLEA 2NYJA 4TUMA 3APDA 4LSZE 3QWWA 4BWRA 2MOWA 2PQRA 5KBAA 3Q7FA 3FY4A 3ESLA 2QFCA 4BTAA 2OEWA 2Y0BG 3RRMB 1IQUA 5ARGA 3B7RL 3IHVA 3MA5A 3DWLG 1BI8B 3ULQA 3CHMA 4RSYA 1JCQA 1HH8A 4U8HA 2CFZA 5LOZA 2KCVA 3JQ0A 1Q2ZA 2ZXWE 1O1SA 3D9KA 3P1UA 3UI2A 3HXCA 3ABKE 3DSVA 3C3RA 2FO7A 4GB9A 5BXOA 1TNOA 2E2EA 4J6IA 4L2LA 4KMOA 5G55A 3ZYLA 4OYSA 4C9BB 3MX3A 1OCCE 3DSUA 4LUNU 2HO1A 2HYZA 1TN7A 3BG0B 3EIJA 3FTYA 1S64A 3WXXA 4FA6A 2GRPB 2AVPA 1AWCB 5CRVA 1L5JA 1KLXA 2C2LA 3ULEG 3B7BA 2IJGX 5AIJA 3LVQE 1W3BA 2GRNB 5JA4D 4UWGA 1JCRA 4GZCA 3L13A 2P9IG 2R05A 3JCKC 4KZCA 3SI5A 3KEAA 4PUCA 1E7UA 5D0OD 4DUIA 2XGSA 2Q7FA 2YQ8A 4WNDA 2WVIA 3SNXA 3S7DA 4CYMD 1KZPA 1OWOA 3SFXA 5KJNA 2P9UG 2VGEA 4J8FA 5JHAA 4A3VA 5EILA 3O4ZA 5HKPA 2FI7A 4HLLA 5CMYA 5HQ8A 5EN5D 4BESA 3AS8A 4H7XA 2J08A 3B7TA 3RAUA 4DX7D 5CEDB 4BTBA 2WXFA 4C0MA 1H0AA 4GZ5A 4Y6CA 2R02A 2P9PG 3U4TA 2R17C 2X3MA 3T8MA 2MYOA 4UI9K 3Q9NC 3MKRA 4Q96A 2OCCE 1FVFA 3QOUA 5FINA 3C3QA 4LERA 3TJPA 2UWJG 2QYJA 4APOA 5KJKA 4I1AA 5AN8A 1AP7A 2J4BA 5CBOA 4OAVB 3DEOA 1KPSB 3Q79A 5ANRA 3FTXA 4DLQA 1FVHA 2FULA 3VLDA 4AEZC 3TWXA 1SZAA 4HRMB 4EZLA 3ZW3A 4DLOA 4ANXA 2AWIA 3LKUA 3IEGA 2IOSA 4RVBA 2KM4A 4ATZD 1HG5A 3JXJA 4G23A 3ZHEA 3HG0D 2PM6A 4JW1A 4U96D 3NBNB 3V2OA 1NP7A 5BV1A 4GZ6A 1Z3XA 1X81A 4GAAA 3UKUG 4O6FA 4JEUA 4RLYA 3MV2B 2IEJA 4ILIA 4CDRA 3PE4A 3WG7E 3EHMA 4G8KA 4EZKA 1ELWA 1WM5A 3ENEA 1UG3A 3CHRA 4I6EA 2EINE 3L16A 2VSNA 3TAXA 3AG1E 3UM3A 3FH5A 4N3CA 2GRLA 4D10C 4JL0A 3QWVA 3MZLB 5BPPA 3IBEA 4HOTA 2EQXA 3X2QE 5ARFA 1E90A 1H6PA 5FWQA 2OV8A 2R59A 2J49A 2GGFA 5JHBA 3ESKA 1BLXB 3FTSA 3V2XA 1S0PA 4UUCA 4UQZA 1H2UA 3PUKA 3UT4A 4LNBA 2KZTB 4O1PA 5IY5E 3Q5MA 3PZ3A 2P9SG 3KSLA 3VTYA 3URZA 4ANVA 2IQCA 4JPSA 5AQ7A 2VYIA 4JHJA 2DBAA 4GPMA 4ANUA 3B13A 3PZDA 3ULYA 3CVLA 3ONKA 3CKCA 3K9IA 5FZQA 2NXPA 3L6AA 4BX9A 1ELRA 2B6CA 2ZIRA 2MRIA 4J8YA 2XGMA 4EECA 4AM9A 3LY7A 3E37A 3MEKA 4J8SA 3FDHA 3QB2A 5CERB 1N0QA 3U9WA 3LCAA 4LNUD 1V54E 4J7WA 3CEQA 4KXKB 1OWMA 4L1BA 2XEHA 3EDTB 3LEWA 3RJVA 1WG0A 4WAFA 5ENRD 2LXMA 4HS2A 3ZN3A 2AXZA 3ZXSA 3HXFA 4LNGA 1H6KA 4OAUC 3HRAA 5AQAA 5CEAA 4E85A 2Y1LE 3ZXPA 5ENSD 4YDYA 1OY3D 5M72A 1NL4A 3R7RA 3ASDA 2PNNA 4GYOA 1O1RA 2X6JA 4WNGA 5BT1A 4F7AA 5FT9A 1O1TA 4AP2A 1TNZA 4LCTA 5CECB 3QAQA 4CDMA 3DRAA 3NAWA 4JVSA 3EHQA 1H6OA 3KSQA 3OTNA 1N11A 1PAQA 3NQPA 2KXPC 4I9EA 3UTMA 4RG6A 3LY9A 1LD7A 3UKRG 4WNFA 3EUVA 3G2VA 1DVPA 3FUDA 1QYMA 4K5BA 3Q73A 3PS6A 3CSFA 4B89A
chains in the Genus database with same CATH topology
3GYZA 3AU4A 1U3DA 2IJGX 5AIJA 2LAIA 3LVQE 4I9CA 5KJLA 1NA0A 5HI7A 1W3BA 4I6GA 5LCWJ 5AJLA 4UWHA 4U0UA 4UWGA 4GZCA 3L13A 2IF4A 5EKQD 2WXMA 5FQ4A 1X5BA 2L6JA 4ME2A 3BEEA 2KCLA 1E96B 3CK9A 3JCKC 4PS8A 3LXUX 1OWLA 3CHQA 3Q49B 3UPVA 3CIAA 4JXTA 3RO3A 4MS6A 4CEMA 4KZCA 3SI5A 2J4DA 2OVBA 2WXJA 4NQ0A 4PUCA 1E7UA 4KYOB 5D0OD 5G05C 3PNLB 2XCBA 1FCHA 2I1JA 5CCMA 4RG9A 4AV7A 2YHEA 3EHNA 2XGSA 1OWNA 2Q7FA 2YQ8A 2L0TB 3P2BA 2IONA 3TG4A 4WNDA 3PH0C 4UWKA 2CG2A 2FEZA 2Y4TA 3PDNA 2WVIA 4LEUA 4LRZA 4I1OB 4JEHA 3SNXA 3S7DA 3KD7A 5G04J 4CT4A 3QDNA 4XKBA 2I2OA 5FJYA 4HOSA 1OWOA 1N52A 3GZ2A 4UWLA 4I2WA 1E8ZA 3QK0A 4B94A 5KJNA 4GZ3A 2FBNA 2XPIA 4ANWA 3DBSA 3FTVA 5AYWD 4J8FA 2NC9A 1GW6A 1Y6IA 2HR2A 4PS3A 5JHAA 2Y4UA 4K0RA 3D3MA 3CHSA 4A3VA 1HO8A 3O4ZA 4EQFA 4G1TA 2L0IA 3Q4AB 3ZHEB 5CCLA 2FI7A 5CMYA 5HQ8A 2LAHA 3D9OA 3R7QA 2LSVA 5KJMA 3EIQC 3FP3A 2CHZA 2X6FA 2C0MA 3AS8A 2J08A 4H7XA 3D9PA 3B7TA 4MRUA 4CRWA 2ILRA 4YVOA 4M3OA 2Y3AA 4HXIA 4BTBA 2VGYA 2VJ8A 3UQ3A 2BUGA 2WXFA 3GZ1A 3GW4A 4UWFA 3CV0A 3QWPA 4C0MA 4CT0A 1H0AA 4FHJA 4GZ5A 3LYAA 4Y6CA 4JHKA 5LFAA 4BSXA 4WWNA 4GYYA 1H2TC 3NZSA 4Q69A 1E8WA 2GRMA 4B8CB 3LY8A 5AENA 4UI9C 3N71A 5CMWA 3U4TA 3ZPJA 2DIWA 2R17C 4I1MA 4L7TA 4FLBA 1HG2A 3JQ1A 2CFUA 5CHEE 2OVFA 2X3MA 1WAO1 2GW1A 3KAEA 4BY6A 3OXFA 4U07A 3UMVA 3T8MA 2MHKA 4UI9K 3APCA 3CVNA 3MKRA 4Q96A 4U04A 3ASHA 3CVUA 5BNWA 3CVQA 1FVFA 2J09A 3QOUA 2ZU6B 5G04C 3CVYA 4XIFA 3ML8A 4LERA 5FQ8A 3RU0A 4ATGA 3FTWA 3SFZA 4HVBA 3FH7A 3FTZA 1UJJA 3TJPA 1MHQA 2PM7A 2YNQA 4U63A 1HXIA 2AW6A 3ZRHA 2UWJG 3B7SA 3QC1A 4P29A 4APOA 5KJKA 4I1AA 3LDZA 3CGHA 2KATA 3FWVA 2CG3A 4XX5A 4FHKA 2X6KA 2WXPA 5A23A 3D9LA 1MQSA 2J4BA 4FULA 5JJ7A 4UI9J 4YVQC 3FEYA 4N39A 4A1SA 4KVOA 3NF1A 1ZU2A 4IN3B 4DI4A 4IRUA 4EZJA 4Y6WA 5ANRA 4I43A 3FU5A 5E76A 4E6HA 3ML9A 3FH8A 1UW4B 1EF1C 1HX8A 2ONDA 3FUFA 1A17A 3FTXA 3O48A 4DLQA 3VTXA 3QJZA 4BT8A 3ONLA 2M63A 3LVRE 1QQEA 2J07A 1FVHA 2UY1B 3FUJA 4WUYA 4ILGA 3SD5A 4JC8A 2FULA 3TXNA 4A1GA 2JLBA 4AY6A 4XZ4A 4YNDA 2X38A 3VLDA 4AEZC 4G26A 3MKQB 4GMJA 1EYHA 1SZAA 4CCAA 4JZYA 3L08A 4KT6B 1EPUA 3FU6A 4EZLA 3CSTA 1HZ4A 3ZW3A 4DLOA 2UY1A 2NSZA 3HVEA 4ANXA 2AWIA 4KBQA 2JEKA 5J90A 4F1SA 3LKUA 4U0SA 3IEGA 2CHXA 4G24A 4GA1A 4TRQA 4HOQA 2IOSA 3TGOA 3ZYKA 4RVBA 2J9QA 3CKBA 4AIFA 2KM4A 3T5XA 2WQHA 4BT9A 1HG5A 3I3NA 1BPOA 1DNPA 2XQ0A 2XEVA 4G23A 3ZHEA 4FADA 2PM6A 4JW1A 3TL5A 4U0ZA 2WXOA 2R5SA 3FU3A 1HF8A 2FF4A 1NP7A 3OAWA 4GZ6A 3RRUA 5BV1A 2XRYA 2VTBA 4NACA 3RKVA 1Z3XA 3AS5A 3CHOA 4GAAA 1E8YA 3L17A 2IFUA 4O6FA 2LNIA 3CQCB 4JEUA 2WMNA 3FUEA 5EX3A 5EX0A 4WWPA 3MV2B 3SBTB 1HU3A 4ILIA 4CDRA 3AS4A 2IOLA 2WMOA 3PE4A 4GPKA 4XKCA 3S7JA 3MGBA 3OXLA 3EHMA 4N3AA 5DBKA 4A55A 4F53A 3KEZA 1QNFA 4FJZA 4I2ZA 3DPDA 4R7LA 5A6CA 1XGWA 1IHGA 2XPYA 1EDUA 3PEUB 4EZKA 1ELWA 2I6HA 3QNKA 4GYWA 2YINA 2QY7A 3FUKA 1WM5A 3AU5A 4HOUA 3C98A 4H7YA 4GCOA 3D9JA 5A7DB 2VGXA 3ENEA 3U64A 1UG3A 2WPVA 2LO6A 2AXVA 4DJAA 5LX8A 4J8EA 3CHRA 2WXQA 1IQRA 5C1DA 4I6EA 3L16A 3TG5A 4ACLA 5BW8C 4XI9A 4OVUA 4Q94A 5G05J 2VSNA 1P5QA 4GA0A 4TV3A 3TAXA 2VGXB 4B0ZA 2VSYA 1JPLA 2V5FA 1U3CA 3FUHA 3FH5A 4N3CA 3FEXA 1JUQA 2GRLA 4D10C 2VQ2A 3FHEA 3LPZA 3QWVA 3MZLB 4JL0A 4PDXA 3FU0A 3UT8A 3IBEA 3UT7A 3VLFA 4PS7A 5BPPA 1VDYA 3MV3B 4HOTA 2EQXA 3SGHA 3ZYMA 1UN8A 1UJKA 2C0LA 5ARFA 3G2TA 3G2SA 3CK7A 3PE3A 1E90A 2KCKA 1OWPA 5FWQA 5T4YA 1TEZA 2OV8A 3VLEA 2R59A 2WXKA 4DI3A 2J49A 3SBSA 2GGFA 5JHBA 1UN9A 2AXUA 3ESKA 3FTSA 1S0PA 1JWFA 2WM9A 4F3VA 5EDSA 1INZA 1IYGA 3FUMA 3KS2A 3NZUA 4IULA 3G2UA 2KZTA 5JJ6A 3ZVVA 1ZBPA 4UQZA 3D9MA 4WWOA 1H2UA 3PREA 5T8IA 4GMLA 1QZ2A 2X6IA 3OXGA 1HS6A 3PUKA 4QFVA 4EBAG 3UT4A 5T3RA 3ZIMA 4G2VA 3ZFWA 4V3IA 1SQMA 3FTUA 2I9CA 4TUUA 4FJYA 1NA3A 4N5CA 4BFRA 5BV0A 2KZTB 2WB2A 2L9BA 1KT1A 2DCPA 3HIZA 3L22A 3E4BA 3Q5MA 2PZIA 4NRHB 3VTYA 1LF8A 3I4GA 2WXLA 3CR3A 3D9NA 3MCXA 4KZ0A 3Q15A 3URZA 2WXNA 3GZSA 3B7UX 4ANVA 2V4LA 2IQCA 4JPSA 4G25A 3JUIA 4UQYA 3ZEFA 2VYIA 3S2AA 1JWGA 2PQNA 3G2WA 2WQ6A 4JHJA 4XE0A 1H2VC 2V0PA 3RIBA 4I6JA 2DBAA 2VSOE 4URKA 5C2YA 3B13A 3I4RB 4ANUA 2WXIA 3PZDA 1WY6A 3CVLA 3ONKA 3LS8A 4FP7A 2XGOA 2XHEA 3ASGA 3CKCA 4MLPA 1Z3YA 3K9IA 5FTPA 2A5UA 2XPZA 3PVLA 5FZQA 4FLHA 1HFAA 1YA0A 2NXPA 3SZ7A 3L6AA 4G11A 3UX4A 2XRZA 3U66A 5FZSA 5AJDA 3BG1B 4AJWA 4BX9A 1ELRA 5BUZA 3T5VA 3CVXA 1XNFA 4L23A 3QARA 2MRIA 3HYMB 4J0UA 2KC7A 2XGMA 5KCMA 5LCWC 3IHYA 4L2YA 4ACKA 5D0QD 5ENNA 4EECA 3JYSA 4AM9A 3UUXA 3LY7A 4XI0A 2CHWA 5E75A 4AOFA 3CVPA 3MEKA 4WNEA 2YHCA 2VSXE 1KT0A 3FULA 4J8SA 5FZRA 2WQ7A 1PC2A 3D9IA 3MYVA 3IV0A 4GA2A 4CGWA 4JA9A 2WXRA 1SZ9A 3FDHA 4AVXA 1E8XA 3QB2A 2BF0X 2WXGA 3MKQA 3CHPA 4I17A 4JHRA 4HLEA 3FUIA 3APDA 3U9WA 5DIZA 3EJNA 2BTDA 3HVEB 4HORA 4ABNA 3QWWA 4BWRA 3SF4A 4ILHB 2MOWA 2PQRA 3LCAA 2RD0A 3HHMA 3FY4A 4EBAA 2OOEA 4JA7A 3SHFA 3CEQA 4KXKB 3ESLA 4K03A 1OWMA 2QFCA 5FQ6A 3TXMA 4HFGA 4L1BA 3PRZA 3EDTB 3LEWA 4BTAA 3RJVA 4WAFA 2E0IA 3APFA 3IKOB 3RRMB 1IQUA 1E7VA 5LP0A 5ARGA 3B7RL 3IHVA 3MA5A 4MKTA 3FUNA 4HS2A 4N3BA 4IYPA 4C0EA 4CDNA 3ULQA 3CHMA 4GCNA 4RSYA 3ZN3A 2VTBB 2AXZA 4N2SA 2RG8A 1HH8A 4U8HA 2CFZA 3ZXSA 2A4ZA 1H6KA 2PL2A 5LOZA 4FU3A 2KCVA 3JQ0A 3HDXA 3CLJA 5J08A 4E85A 1Z6TA 3RK6A 3D9KA 4FC8A 1TJFA 3P1UA 3CQGB 1ELKA 4EPZA 5M72A 3Q47B 4UQXA 3ZGQA 3L54A 3R7RA 3ASFA 3ASDA 4PH4B 2HM8A 4GU5A 4W9RA 3I5PA 2XCCA 4APFA 3CVWA 4GYOA 2FO7A 2WXHA 4GB9A 2X6JA 4J8DA 4WNGA 5BT1A 4F7AA 2X6HA 5FT9A 4AP2A 4LCTA 2E2EA 4J6IA 4L2LA 4KMOA 3RRNB 5ANLA 4KVMA 5G55A 4CGVA 3ZYLA 2I1KA 1OUVA 1Y8MA 3LJ3A 4OYSA 3FFLA 4C9BB 3QAQA 3MX3A 3R9AB 1N54A 3PEVB 3QKYA 4CDMA 4LUNU 4JVSA 5FQ7A 3CVVA 4AXHA 2P58C 5G2NA 3OTNA 1PAQA 2HO1A 3NQPA 3PUJA 4A3TA 3S7FA 1HE8A 2HYZA 4I9EA 2LSUA 2IU1A 1H19A 1NZNA 3S7BA 3BG0B 3EIJA 3FTYA 5JJTA 1B89A 2V8SE 4RG6A 4AY5A 3ZYQA 3LY9A 4NURA 4WNFA 4B8AA 4BX8A 3WXXA 4FA6A 3MJWA 4OVVA 4N2QA 2AVPA 4GZDA 4DPRA 3G2VA 3CK8A 1DVPA 1L5JA 3FUDA 1KLXA 3PS6A 2C2LA 3CSFA 3PNTB 3RO2A 4DK5A 3U3WA 4B89A 1PY1A 1TJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RU0 A;  1PC2 A;  3GYZ A;  4J8E A;  4GA2 A;  5C1D A;  4CGW A;  4JA9 A;  3TG5 A;  4I9C A;  5BW8 C;  4XI9 A;  1HXI A;  5G05 J;  2UWJ G;  5KJL A;  1NA0 A;  2VSN A;  1P5Q A;  4GA0 A;  5HI7 A;  1W3B A;  3TAX A;  2VGX B;  4APO A;  5KJK A;  2VSY A;  4I17 A;  4I1A A;  4JHR A;  5LCW J;  1IYG A;  2KAT A;  4U0U A;  2V5F A;  1TJC A;  3FWV A;  5DIZ A;  4N3C A;  4HOR A;  2IF4 A;  4ABN A;  5EKQ D;  3QWW A;  2L6J A;  4ME2 A;  2VQ2 A;  3BEE A;  2KCL A;  3LPZ A;  3QWV A;  1E96 B;  4JL0 A;  4UI9 J;  2PQR A;  4YVQ C;  3LCA A;  3CK9 A;  3SF4 A;  3MV3 B;  4N39 A;  4A1S A;  3UPV A;  3Q49 B;  4HOT A;  2OOE A;  4JA7 A;  3RO3 A;  3NF1 A;  3CEQ A;  4KXK B;  1ZU2 A;  2C0L A;  2QFC A;  4IN3 B;  4NQ0 A;  5ARF A;  4KYO B;  5D0O D;  4Y6W A;  5G05 C;  3CK7 A;  3PE3 A;  3EDT B;  4BTA A;  2KCK A;  3RJV A;  2XCB A;  1FCH A;  5CCM A;  4RG9 A;  2OND A;  3TG4 A;  1A17 A;  2Q7F A;  2XGS A;  2YQ8 A;  3O48 A;  3ESK A;  3MA5 A;  4WND A;  5ARG A;  3VTX A;  5JJ7 A;  4BT8 A;  2FEZ A;  2Y4T A;  3PDN A;  4LEU A;  4N3B A;  1QQE A;  2UY1 B;  3KS2 A;  4F3V A;  3ULQ A;  4WUY A;  3S7D A;  4GCN A;  3ZN3 A;  3KD7 A;  5G04 J;  4N2S A;  3QDN A;  2JLB A;  1HH8 A;  5JJ6 A;  4AY6 A;  4YND A;  5FJY A;  1ZBP A;  2PL2 A;  4UQZ A;  4HOS A;  4N2Q A;  2KCV A;  4G26 A;  3GZ2 A;  1QZ2 A;  3OXG A;  4I2W A;  5KJN A;  4B94 A;  4G2V A;  3ZFW A;  1HZ4 A;  4GZ3 A;  2FBN A;  2UY1 A;  2XPI A;  4N5C A;  1NA3 A;  4KBQ A;  5AYW D;  4J8F A;  2NC9 A;  2HR2 A;  1KT1 A;  2Y4U A;  3LKU A;  5M72 A;  3E4B A;  3Q5M A;  2PZI A;  4NRH B;  3IEG A;  4U0S A;  3VTY A;  4EQF A;  4G24 A;  3Q47 B;  3Q4A B;  4G1T A;  4GA1 A;  4HOQ A;  2FI7 A;  4UQX A;  3ZHE B;  3ZGQ A;  5HQ8 A;  3Q15 A;  3TGO A;  2LSV A;  3ASF A;  3ASD A;  5G04 C;  3URZ A;  3FP3 A;  2J9Q A;  5KJM A;  3CKB A;  2C0M A;  3AS8 A;  4H7X A;  4AIF A;  4G25 A;  4UQY A;  2XCC A;  4W9R A;  2VYI A;  2WQH A;  4GYO A;  4BT9 A;  2FO7 A;  2PQN A;  2XEV A;  4J8D A;  4G23 A;  4WNG A;  5BT1 A;  4YVO A;  5FT9 A;  2E2E A;  3ZHE A;  3RIB A;  4BTB A;  2VGY A;  3UQ3 A;  2BUG A;  2DBA A;  4CGV A;  3GZ1 A;  3GW4 A;  4U0Z A;  1OUV A;  1Y8M A;  3CV0 A;  3QWP A;  3FFL A;  2R5S A;  2FF4 A;  4GZ5 A;  3LYA A;  4Y6C A;  3CVL A;  3QKY A;  4GZ6 A;  3R9A B;  5FTP A;  5CCL A;  2XGO A;  3ASG A;  3CKC A;  2P58 C;  4GYY A;  3AS5 A;  3K9I A;  3RKV A;  5FZQ A;  2IFU A;  2HO1 A;  4O6F A;  1YA0 A;  2LNI A;  3SZ7 A;  3S7F A;  2HYZ A;  3LY8 A;  4I9E A;  5EX3 A;  5EX0 A;  2LSU A;  4UI9 C;  3MV2 B;  3N71 A;  5FZS A;  3U4T A;  1ELR A;  4CDR A;  1NZN A;  1XNF A;  3AS4 A;  3ZPJ A;  3S7B A;  5JJT A;  3HYM B;  3PE4 A;  1B89 A;  4GPK A;  4J0U A;  2KC7 A;  5CHE E;  2XGM A;  3S7J A;  3OXL A;  1WAO 1;  4RG6 A;  4N3A A;  2GW1 A;  3KAE A;  3LY9 A;  5DBK A;  4AY5 A;  3OXF A;  4I2Z A;  4U07 A;  5LCW C;  5A6C A;  4WNF A;  1IHG A;  5D0Q D;  3JYS A;  2MHK A;  4UI9 K;  3WXX A;  1ELW A;  2I6H A;  4GYW A;  3CVN A;  3MKR A;  2AVP A;  3LY7 A;  4XI0 A;  3UUX A;  1WM5 A;  4HOU A;  4AM9 A;  4BWR A;  3CK8 A;  3ASH A;  3CVP A;  3MEK A;  4GCO A;  4H7Y A;  1KLX A;  4U04 A;  3CVQ A;  4WNE A;  2YHC A;  2C2L A;  2VGX A;  5A7D B;  5BNW A;  3RO2 A;  1KT0 A;  3QOU A;  3U3W A;  5FZR A;  4XIF A;  2WPV A; 
#chains in the Genus database with same CATH topology
 1U3D A;  4EHM A;  3ABM E;  3TWQ A;  4I9C A;  5HI7 A;  3TWT A;  5LCW J;  5AJL A;  2IO3 C;  2RFA A;  5FQ4 A;  4ME2 A;  3B95 A;  2GRQ B;  3UPV A;  3CIA A;  4JXT A;  2OVB A;  2WXJ A;  4KYO B;  1TNU A;  5G05 C;  5EIB E;  2XCB A;  4YDW A;  2YHE A;  3P2B A;  3PH0 C;  2Y4T A;  3PDN A;  4HI9 A;  4LEU A;  5G04 J;  4CT4 A;  1SA5 A;  5FJY A;  3DSS A;  3GZ2 A;  1RZ4 A;  4I2W A;  4B94 A;  3AG2 E;  3DBS A;  1U2V G;  1GW6 A;  1Y6I A;  2Y4U A;  1HO8 A;  5CCL A;  2GRR B;  3FP3 A;  2C0M A;  2BKK B;  3D9P A;  4CRW A;  5CBN A;  2F8Y A;  2Y3A A;  2BUG A;  4UWF A;  3UM2 A;  4CT0 A;  4FHJ A;  3LYA A;  4JHK A;  2XEE A;  5LFA A;  4HRN A;  4BSX A;  4WWN A;  4GYY A;  1H2T C;  4JD2 G;  4Q69 A;  2DIW A;  4L7T A;  3JQ1 A;  5CHE E;  3ASN E;  1WAO 1;  2GW1 A;  4BY6 A;  2MHK A;  3APC A;  4MBG A;  3CVN A;  3DXK G;  5BNW A;  3E32 A;  2ZU6 B;  3RU0 A;  3FTW A;  4YDO A;  3FH7 A;  3DXM G;  2P9K G;  3B7S A;  1KZO A;  3CGH A;  3HXB A;  3Q78 A;  3ABL E;  5A23 A;  1MQS A;  5JJ7 A;  1K3Z D;  3FEY A;  2L6B A;  3E30 A;  4M7C A;  4TXP A;  3JUE A;  4E6H A;  3SO8 A;  3FH8 A;  1UW4 B;  1A17 A;  5ENQ D;  3VTX A;  3T8K A;  3ONL A;  4O60 A;  2M63 A;  3LVR E;  2J07 A;  3SD5 A;  4ILG A;  4A1G A;  4AY6 A;  2X38 A;  4GMJ A;  4CCA A;  4KT6 B;  1HZ4 A;  4DX1 A;  2NSZ A;  3HVE A;  3SFY A;  1OCZ E;  1Z5S C;  4KBQ A;  4F1S A;  4U0S A;  2H6H A;  4HOQ A;  1LD8 A;  3ZYK A;  3D9H A;  2H6I A;  4HI8 A;  3T5X A;  1BPO A;  3TWV A;  3TL5 A;  3V79 K;  4U0Z A;  3OAW A;  2DZN A;  2VTB A;  4CZ2 D;  3CHO A;  1E8Y A;  3L17 A;  2LNI A;  3FUE A;  4WWP A;  5D2M C;  3SBT B;  3MGB A;  4N3A A;  4A55 A;  1ZB1 A;  5A6C A;  2Y69 E;  1IHG A;  3PEU B;  2I6H A;  2YIN A;  2QY7 A;  3C98 A;  4H7Y A;  1K1B A;  2V4H C;  2LO6 A;  1IQR A;  5C1D A;  1TR4 A;  3TG5 A;  4ACL A;  5G05 J;  4TV3 A;  1JPL A;  4HB5 A;  3AG3 E;  2VQ2 A;  3LPZ A;  4PDX A;  1N4P A;  2IO2 C;  4N5Q A;  1VDY A;  2EIL E;  3MV3 B;  3L82 A;  3ZYM A;  1DCQ A;  2F0Y A;  3G2T A;  3PE3 A;  3VLE A;  3ASO E;  2AXU A;  1JWF A;  2WM9 A;  1INZ A;  3NZU A;  3G2U A;  1ZBP A;  3D9M A;  3PRE A;  1QZ2 A;  1MJ0 A;  2X6I A;  1BD8 A;  4G2V A;  3ZFW A;  2XS8 A;  4N5C A;  4BFR A;  4L9P A;  2WB2 A;  2DYR E;  2L9B A;  2DCP A;  3HIZ A;  1FT2 A;  4KZ0 A;  3Q15 A;  4DRX E;  3GZS A;  2RFM A;  2DWZ A;  1TN8 A;  4K5A B;  2WQ6 A;  4XE0 A;  2V0P A;  4I6J A;  2VSO E;  5C2Y A;  5KNG A;  5B3S E;  2XGO A;  4BSZ B;  1Z3Y A;  4FLH A;  1HFA A;  1YA0 A;  3SZ7 A;  4G11 A;  5D66 A;  1N94 A;  2ETC A;  3BG1 B;  5BUZ A;  3T5V A;  1XNF A;  4L23 A;  3QAR A;  4J0U A;  2HE0 A;  2XZD G;  3IHY A;  4L2Y A;  4ACK A;  5ENN A;  3UUX A;  4XI0 A;  4ZHB A;  5E75 A;  2YHC A;  2R03 A;  1WDY A;  1PC2 A;  5BXU A;  1OCR E;  4CGW A;  1N4S A;  4DX6 D;  1E8X A;  3JXI A;  5AAO A;  2WXG A;  3MKQ A;  3ZU7 B;  3EJN A;  4O1O A;  4HOR A;  3SHF A;  4K03 A;  5CRU A;  1E7V A;  3PZ2 A;  4N3B A;  4IYP A;  4C0E A;  4CDN A;  4N2S A;  3NB2 A;  2RG8 A;  4FU3 A;  2DZO A;  3HDX A;  3TWR A;  5B1A E;  1IXV A;  1Z6T A;  3RK6 A;  3NOG D;  3CQG B;  1ELK A;  4EPZ A;  3J5P A;  3Q9U C;  4UQX A;  3ZGQ A;  3L54 A;  3ASF A;  4PH4 B;  2HM8 A;  4W9R A;  2XCC A;  2X6H A;  4KVM A;  2I1K A;  1Y8M A;  1N54 A;  3PEV B;  5EYP F;  5FQ7 A;  3CVV A;  2P58 C;  5G2N A;  3SY2 A;  3PUJ A;  3S7F A;  1HE8 A;  2LSU A;  4BET A;  2IU1 A;  4GTO A;  1NZN A;  3S7B A;  1B89 A;  2V8S E;  3ZYQ A;  3E34 A;  4C48 B;  4BX8 A;  3MJW A;  1SVX A;  5ENO D;  3ZUV B;  3CK8 A;  3RO2 A;  4DK5 A;  1PY1 A;  1TJC A;  3DSW A;  5KJL A;  1NA0 A;  1TNB A;  4UWH A;  4U0U A;  1OT8 A;  5EKQ D;  2WXM A;  2DYS E;  3BEE A;  2KCL A;  4U95 D;  4PS8 A;  5KWD A;  3LXU X;  3CHQ A;  3RO3 A;  4HRL A;  4MS6 A;  1FPP A;  2J4D A;  3PNL B;  2B0O E;  4RG9 A;  4AV7 A;  1OWN A;  2L0T B;  2ION A;  4UWK A;  3V31 A;  1D9S A;  4JEH A;  4GTS A;  3KD7 A;  3QDN A;  2I2O A;  1S63 A;  4HOS A;  1N52 A;  1MYO A;  1NFI E;  3J5Q B;  1E8Z A;  3FTV A;  2HR2 A;  5B1B E;  3D3M A;  4Z68 A;  4TXR A;  3E33 A;  4TXQ A;  4EQF A;  3Q4A B;  3ZHE B;  3D9O A;  5KJM A;  3EIQ C;  2CHZ A;  1N0R A;  1YMP A;  2ILR A;  4YVO A;  4M3O A;  2VGY A;  3GW4 A;  2FO1 E;  3ZKJ A;  1E8W A;  2GRM A;  3ZNG A;  4B8C B;  3LY8 A;  4UI9 C;  5CMW A;  4YDE A;  4I1M A;  1HG2 A;  1TYQ G;  2P9N G;  3CVU A;  3CVQ A;  4GTQ A;  5G04 C;  5ENP D;  4XIF A;  3ML8 A;  4GTR A;  3SFZ A;  4HVB A;  2YNQ A;  1HXI A;  3ZRH A;  3QC1 A;  1MX4 A;  3LDZ A;  2KAT A;  3FWV A;  2CG3 A;  2WXP A;  3UIP C;  4UI9 J;  4G8L A;  3SQV A;  4A1S A;  3NF1 A;  3AAA C;  1ZU2 A;  4DI4 A;  4IRU A;  4EZJ A;  4I43 A;  3FU5 A;  5E76 A;  3ML9 A;  1EF1 C;  2OND A;  3FUF A;  3C3O A;  1QQE A;  2JLB A;  4XZ4 A;  4YND A;  2H6G A;  5FIO A;  4G26 A;  1EYH A;  4JZY A;  3EHR A;  3FU6 A;  5HS0 A;  3DPY A;  2CHX A;  4TRQ A;  1BI7 B;  3TGO A;  3CKB A;  2WQH A;  4BT9 A;  3I3N A;  1D8D A;  1DNP A;  1IKN D;  2XEV A;  4FAD A;  1A5E A;  3UM0 A;  3UIO C;  1MZC A;  2R5S A;  4NAC A;  3RKV A;  1RW2 A;  3IXE A;  1OXJ A;  1UOH A;  3NOC D;  2WMN A;  5EX3 A;  5EX0 A;  5AAR A;  1HU3 A;  2ZGG A;  3AS4 A;  2F8X K;  2IOL A;  4A63 B;  4GPK A;  2QZA A;  4XKC A;  3S7J A;  3OXL A;  5DBK A;  4F53 A;  1QNF A;  4I2Z A;  4R7L A;  1XGW A;  2XPY A;  1EDU A;  3AU5 A;  4HOU A;  4GCO A;  2WPV A;  4DJA A;  5LX8 A;  4J8E A;  4XI9 A;  4OVU A;  4Q94 A;  1P5Q A;  4B0Z A;  2VGX B;  2VSY A;  2V5F A;  1U3C A;  1JUQ A;  3TWU A;  3DST A;  3FU0 A;  3UT7 A;  4PS7 A;  1UJK A;  5AQB A;  2KCK A;  1OWP A;  5T4Y A;  4DI3 A;  2WXK A;  1UN9 A;  1SW6 A;  4GMR A;  5EDS A;  1MX6 A;  3ZVV A;  1S70 B;  5T8I A;  4QQI A;  4QFV A;  3AG4 E;  5T3R A;  4XEI G;  1SQM A;  2EIK E;  3FTU A;  5H7P A;  2I9C A;  4TUU A;  4FJY A;  1KT1 A;  2LUH A;  4BEP A;  3D9N A;  4GTV A;  2WXN A;  3ZEF A;  3JUI A;  4HQD A;  3S2A A;  1JWG A;  2PQN A;  3DSX A;  4K5C A;  2P9L G;  1H2V C;  4F6R D;  4URK A;  3HXD A;  3I4R B;  3V30 A;  3LS8 A;  4FP7 A;  4MLP A;  3ASG A;  3PVL A;  3UX4 A;  3U66 A;  1K1A A;  4AJW A;  3TWS A;  2XZT G;  1DCE A;  2EIM E;  3AJI A;  3HYM B;  5KCM A;  5LCW C;  3UIN C;  1K8K G;  5D0Q D;  4AOF A;  3C5R A;  4WNE A;  2GRO B;  4GTT A;  1KT0 A;  2VSX E;  3FUL A;  5FZR A;  2WQ7 A;  4GA2 A;  4JA9 A;  4AVX A;  1NI1 A;  2BF0 X;  5ENT D;  4I17 A;  4JHR A;  3FUI A;  5DIZ A;  2BTD A;  3HVE B;  4ABN A;  3SF4 A;  4ILH B;  2RD0 A;  3HHM A;  4EBA A;  2OOE A;  4JA7 A;  5FQ6 A;  3TXM A;  4HFG A;  3PRZ A;  1BU9 A;  3Q75 A;  2E0I A;  3APF A;  3IKO B;  5LP0 A;  4GTP A;  4MKT A;  3RSE G;  3FUN A;  5JMN D;  4GCN A;  2VTB B;  3L9T A;  2A4Z A;  2PL2 A;  2RKK A;  3CLJ A;  2XEN A;  5J08 A;  4FC8 A;  4JB8 P;  1TJF A;  2V5Q C;  3Q47 B;  1N4Q A;  2ETA A;  1IHB A;  4HNA D;  4GU5 A;  4APF A;  3I5P A;  3CVW A;  2WXH A;  4J8D A;  1JCS A;  3PZ4 A;  1N4R A;  3RRN B;  5ANL A;  4CGV A;  4RQI A;  1OUV A;  3LJ3 A;  5AQ9 A;  3FFL A;  3R9A B;  3QKY A;  4AXH A;  3C72 A;  4A3T A;  4ZFH A;  1H19 A;  5JJT A;  4AY5 A;  5ITZ F;  2KBX A;  4NUR A;  4B8A A;  4OVV A;  4N2Q A;  4GZD A;  4DPR A;  1G3N B;  3U3W A;  3PNT B;  3GYZ A;  3AU4 A;  4U8V D;  2LAI A;  1D8E A;  4I6G A;  1O5M A;  2IF4 A;  1X5B A;  2L6J A;  1E96 B;  3CK9 A;  1OWL A;  3Q49 B;  4CEM A;  4NQ0 A;  3HXE A;  1FCH A;  2I1J A;  5CCM A;  3TG4 A;  3EHN A;  3W9G A;  2BKG A;  2CG2 A;  2FEZ A;  4LRZ A;  4I1O B;  4XKB A;  3UXG A;  4UWL A;  3QK0 A;  2A5E A;  4GZ3 A;  2FBN A;  2XPI A;  4ANW A;  1TN6 A;  5AYW D;  2NC9 A;  4PS3 A;  4K0R A;  3CHS A;  4G1T A;  2L0I A;  4NIK A;  2LAH A;  3R7Q A;  2LSV A;  1FT1 A;  2X6F A;  4MRU A;  3TWW A;  4HXI A;  3UQ3 A;  2VJ8 A;  3ISM C;  3GZ1 A;  3CV0 A;  3QWP A;  2EIJ E;  3NZS A;  5AEN A;  3N71 A;  3T9K A;  3ZPJ A;  4FLB A;  2OEV A;  2CFU A;  2OVF A;  1MX2 A;  3KAE A;  3OXF A;  4HBD A;  4U07 A;  4U7E B;  3UMV A;  3DEP A;  4U04 A;  3ASH A;  2J09 A;  3CVY A;  5FQ8 A;  3F6Q A;  4ATG A;  3FTZ A;  1UJJ A;  1MHQ A;  2PM7 A;  4U63 A;  2AW6 A;  4P29 A;  4X8Q A;  4XX5 A;  4FHK A;  2X6K A;  3D9L A;  4FUL A;  2QYU A;  4YVQ C;  2XS1 A;  4N39 A;  4KVO A;  1TNY A;  4IN3 B;  1V55 E;  2R2L A;  4Y6W A;  1YYH A;  1HX8 A;  1OCO E;  3O48 A;  1DC2 A;  3BU8 A;  3QJZ A;  4BT8 A;  2UY1 B;  3FUJ A;  4WUY A;  4JC8 A;  3TXN A;  3MKQ B;  2ZGD A;  3L08 A;  1EPU A;  3CST A;  3BUA A;  2UY1 A;  2JEK A;  5J90 A;  2BED A;  3PZ1 A;  3UM1 A;  4G24 A;  4GA1 A;  3LJN A;  4GTM A;  4DX5 D;  2J9Q A;  4AIF A;  2AJA A;  4LG6 A;  2DVW A;  2XQ0 A;  4BER A;  1LTX A;  2WXO A;  3FU3 A;  3RRU A;  1HF8 A;  2FF4 A;  2XRY A;  3AS5 A;  2H6F A;  2IFU A;  3CQC B;  5EYL A;  2WMO A;  4U8Y D;  1YCS B;  3KEZ A;  4FJZ A;  3DPD A;  2ETB A;  3QNK A;  4GYW A;  3R9M A;  3FUK A;  2IY0 C;  3D9J A;  5A7D B;  2VGX A;  3U64 A;  2AXV A;  2WXQ A;  2ZIS A;  5BW8 C;  4GA0 A;  4F1P A;  1SA4 A;  3FUH A;  3FEX A;  3Q7A A;  3FHE A;  3UT8 A;  3VLF A;  3SGH A;  1UN8 A;  2C0L A;  3G2S A;  3CK7 A;  1TEZ A;  3SBS A;  2J8S D;  4F3V A;  1IYG A;  2JAB A;  3EU5 A;  3FUM A;  3KS2 A;  4IUL A;  4B93 B;  2KZT A;  5JJ6 A;  4WWO A;  4GML A;  3OXG A;  1HS6 A;  4EBA G;  3EU9 A;  3ZIM A;  4V3I A;  2QC9 A;  1NA3 A;  5BV0 A;  3L22 A;  3E4B A;  2PZI A;  1N9A A;  4NRH B;  3W9F A;  1LF8 A;  3I4G A;  2WXL A;  3CR3 A;  3MCX A;  3B7U X;  2V4L A;  2F37 A;  4G25 A;  2LXL A;  4UQY A;  3G2W A;  3RIB A;  2WXI A;  1WY6 A;  5FTP A;  2XHE A;  2A5U A;  2XPZ A;  2XRZ A;  5EID A;  5FZS A;  5AJD A;  3CVX A;  1QBQ A;  2KC7 A;  3BQO A;  5HRY A;  5KNH D;  1N95 A;  3JYS A;  2CHW A;  2P2C P;  3CVP A;  3D9I A;  3MYV A;  3IV0 A;  2WXR A;  1SZ9 A;  4DX2 A;  3CHP A;  4HLE A;  2NYJ A;  4TUM A;  3APD A;  4LSZ E;  3QWW A;  4BWR A;  2MOW A;  2PQR A;  5KBA A;  3Q7F A;  3FY4 A;  3ESL A;  2QFC A;  4BTA A;  2OEW A;  2Y0B G;  3RRM B;  1IQU A;  5ARG A;  3B7R L;  3IHV A;  3MA5 A;  3DWL G;  1BI8 B;  3ULQ A;  3CHM A;  4RSY A;  1JCQ A;  1HH8 A;  4U8H A;  2CFZ A;  5LOZ A;  2KCV A;  3JQ0 A;  1Q2Z A;  2ZXW E;  1O1S A;  3D9K A;  3P1U A;  3UI2 A;  3HXC A;  3ABK E;  3DSV A;  3C3R A;  2FO7 A;  4GB9 A;  5BXO A;  1TNO A;  2E2E A;  4J6I A;  4L2L A;  4KMO A;  5G55 A;  3ZYL A;  4OYS A;  4C9B B;  3MX3 A;  1OCC E;  3DSU A;  4LUN U;  2HO1 A;  2HYZ A;  1TN7 A;  3BG0 B;  3EIJ A;  3FTY A;  1S64 A;  3WXX A;  4FA6 A;  2GRP B;  2AVP A;  1AWC B;  5CRV A;  1L5J A;  1KLX A;  2C2L A;  3ULE G;  3B7B A;  2IJG X;  5AIJ A;  3LVQ E;  1W3B A;  2GRN B;  5JA4 D;  4UWG A;  1JCR A;  4GZC A;  3L13 A;  2P9I G;  2R05 A;  3JCK C;  4KZC A;  3SI5 A;  3KEA A;  4PUC A;  1E7U A;  5D0O D;  4DUI A;  2XGS A;  2Q7F A;  2YQ8 A;  4WND A;  2WVI A;  3SNX A;  3S7D A;  4CYM D;  1KZP A;  1OWO A;  3SFX A;  5KJN A;  2P9U G;  2VGE A;  4J8F A;  5JHA A;  4A3V A;  5EIL A;  3O4Z A;  5HKP A;  2FI7 A;  4HLL A;  5CMY A;  5HQ8 A;  5EN5 D;  4BES A;  3AS8 A;  4H7X A;  2J08 A;  3B7T A;  3RAU A;  4DX7 D;  5CED B;  4BTB A;  2WXF A;  4C0M A;  1H0A A;  4GZ5 A;  4Y6C A;  2R02 A;  2P9P G;  3U4T A;  2R17 C;  2X3M A;  3T8M A;  2MYO A;  4UI9 K;  3Q9N C;  3MKR A;  4Q96 A;  2OCC E;  1FVF A;  3QOU A;  5FIN A;  3C3Q A;  4LER A;  3TJP A;  2UWJ G;  2QYJ A;  4APO A;  5KJK A;  4I1A A;  5AN8 A;  1AP7 A;  2J4B A;  5CBO A;  4OAV B;  3DEO A;  1KPS B;  3Q79 A;  5ANR A;  3FTX A;  4DLQ A;  1FVH A;  2FUL A;  3VLD A;  4AEZ C;  3TWX A;  1SZA A;  4HRM B;  4EZL A;  3ZW3 A;  4DLO A;  4ANX A;  2AWI A;  3LKU A;  3IEG A;  2IOS A;  4RVB A;  2KM4 A;  4ATZ D;  1HG5 A;  3JXJ A;  4G23 A;  3ZHE A;  3HG0 D;  2PM6 A;  4JW1 A;  4U96 D;  3NBN B;  3V2O A;  1NP7 A;  5BV1 A;  4GZ6 A;  1Z3X A;  1X81 A;  4GAA A;  3UKU G;  4O6F A;  4JEU A;  4RLY A;  3MV2 B;  2IEJ A;  4ILI A;  4CDR A;  3PE4 A;  3WG7 E;  3EHM A;  4G8K A;  4EZK A;  1ELW A;  1WM5 A;  3ENE A;  1UG3 A;  3CHR A;  4I6E A;  2EIN E;  3L16 A;  2VSN A;  3TAX A;  3AG1 E;  3UM3 A;  3FH5 A;  4N3C A;  2GRL A;  4D10 C;  4JL0 A;  3QWV A;  3MZL B;  5BPP A;  3IBE A;  4HOT A;  2EQX A;  3X2Q E;  5ARF A;  1E90 A;  1H6P A;  5FWQ A;  2OV8 A;  2R59 A;  2J49 A;  2GGF A;  5JHB A;  3ESK A;  1BLX B;  3FTS A;  3V2X A;  1S0P A;  4UUC A;  4UQZ A;  1H2U A;  3PUK A;  3UT4 A;  4LNB A;  2KZT B;  4O1P A;  5IY5 E;  3Q5M A;  3PZ3 A;  2P9S G;  3KSL A;  3VTY A;  3URZ A;  4ANV A;  2IQC A;  4JPS A;  5AQ7 A;  2VYI A;  4JHJ A;  2DBA A;  4GPM A;  4ANU A;  3B13 A;  3PZD A;  3ULY A;  3CVL A;  3ONK A;  3CKC A;  3K9I A;  5FZQ A;  2NXP A;  3L6A A;  4BX9 A;  1ELR A;  2B6C A;  2ZIR A;  2MRI A;  4J8Y A;  2XGM A;  4EEC A;  4AM9 A;  3LY7 A;  3E37 A;  3MEK A;  4J8S A;  3FDH A;  3QB2 A;  5CER B;  1N0Q A;  3U9W A;  3LCA A;  4LNU D;  1V54 E;  4J7W A;  3CEQ A;  4KXK B;  1OWM A;  4L1B A;  2XEH A;  3EDT B;  3LEW A;  3RJV A;  1WG0 A;  4WAF A;  5ENR D;  2LXM A;  4HS2 A;  3ZN3 A;  2AXZ A;  3ZXS A;  3HXF A;  4LNG A;  1H6K A;  4OAU C;  3HRA A;  5AQA A;  5CEA A;  4E85 A;  2Y1L E;  3ZXP A;  5ENS D;  4YDY A;  1OY3 D;  5M72 A;  1NL4 A;  3R7R A;  3ASD A;  2PNN A;  4GYO A;  1O1R A;  2X6J A;  4WNG A;  5BT1 A;  4F7A A;  5FT9 A;  1O1T A;  4AP2 A;  1TNZ A;  4LCT A;  5CEC B;  3QAQ A;  4CDM A;  3DRA A;  3NAW A;  4JVS A;  3EHQ A;  1H6O A;  3KSQ A;  3OTN A;  1N11 A;  1PAQ A;  3NQP A;  2KXP C;  4I9E A;  3UTM A;  4RG6 A;  3LY9 A;  1LD7 A;  3UKR G;  4WNF A;  3EUV A;  3G2V A;  1DVP A;  3FUD A;  1QYM A;  4K5B A;  3Q73 A;  3PS6 A;  3CSF A;  4B89 A; 
#chains in the Genus database with same CATH homology
 3GYZ A;  3AU4 A;  1U3D A;  2IJG X;  5AIJ A;  2LAI A;  3LVQ E;  4I9C A;  5KJL A;  1NA0 A;  5HI7 A;  1W3B A;  4I6G A;  5LCW J;  5AJL A;  4UWH A;  4U0U A;  4UWG A;  4GZC A;  3L13 A;  2IF4 A;  5EKQ D;  2WXM A;  5FQ4 A;  1X5B A;  2L6J A;  4ME2 A;  3BEE A;  2KCL A;  1E96 B;  3CK9 A;  3JCK C;  4PS8 A;  3LXU X;  1OWL A;  3CHQ A;  3Q49 B;  3UPV A;  3CIA A;  4JXT A;  3RO3 A;  4MS6 A;  4CEM A;  4KZC A;  3SI5 A;  2J4D A;  2OVB A;  2WXJ A;  4NQ0 A;  4PUC A;  1E7U A;  4KYO B;  5D0O D;  5G05 C;  3PNL B;  2XCB A;  1FCH A;  2I1J A;  5CCM A;  4RG9 A;  4AV7 A;  2YHE A;  3EHN A;  2XGS A;  1OWN A;  2Q7F A;  2YQ8 A;  2L0T B;  3P2B A;  2ION A;  3TG4 A;  4WND A;  3PH0 C;  4UWK A;  2CG2 A;  2FEZ A;  2Y4T A;  3PDN A;  2WVI A;  4LEU A;  4LRZ A;  4I1O B;  4JEH A;  3SNX A;  3S7D A;  3KD7 A;  5G04 J;  4CT4 A;  3QDN A;  4XKB A;  2I2O A;  5FJY A;  4HOS A;  1OWO A;  1N52 A;  3GZ2 A;  4UWL A;  4I2W A;  1E8Z A;  3QK0 A;  4B94 A;  5KJN A;  4GZ3 A;  2FBN A;  2XPI A;  4ANW A;  3DBS A;  3FTV A;  5AYW D;  4J8F A;  2NC9 A;  1GW6 A;  1Y6I A;  2HR2 A;  4PS3 A;  5JHA A;  2Y4U A;  4K0R A;  3D3M A;  3CHS A;  4A3V A;  1HO8 A;  3O4Z A;  4EQF A;  4G1T A;  2L0I A;  3Q4A B;  3ZHE B;  5CCL A;  2FI7 A;  5CMY A;  5HQ8 A;  2LAH A;  3D9O A;  3R7Q A;  2LSV A;  5KJM A;  3EIQ C;  3FP3 A;  2CHZ A;  2X6F A;  2C0M A;  3AS8 A;  2J08 A;  4H7X A;  3D9P A;  3B7T A;  4MRU A;  4CRW A;  2ILR A;  4YVO A;  4M3O A;  2Y3A A;  4HXI A;  4BTB A;  2VGY A;  2VJ8 A;  3UQ3 A;  2BUG A;  2WXF A;  3GZ1 A;  3GW4 A;  4UWF A;  3CV0 A;  3QWP A;  4C0M A;  4CT0 A;  1H0A A;  4FHJ A;  4GZ5 A;  3LYA A;  4Y6C A;  4JHK A;  5LFA A;  4BSX A;  4WWN A;  4GYY A;  1H2T C;  3NZS A;  4Q69 A;  1E8W A;  2GRM A;  4B8C B;  3LY8 A;  5AEN A;  4UI9 C;  3N71 A;  5CMW A;  3U4T A;  3ZPJ A;  2DIW A;  2R17 C;  4I1M A;  4L7T A;  4FLB A;  1HG2 A;  3JQ1 A;  2CFU A;  5CHE E;  2OVF A;  2X3M A;  1WAO 1;  2GW1 A;  3KAE A;  4BY6 A;  3OXF A;  4U07 A;  3UMV A;  3T8M A;  2MHK A;  4UI9 K;  3APC A;  3CVN A;  3MKR A;  4Q96 A;  4U04 A;  3ASH A;  3CVU A;  5BNW A;  3CVQ A;  1FVF A;  2J09 A;  3QOU A;  2ZU6 B;  5G04 C;  3CVY A;  4XIF A;  3ML8 A;  4LER A;  5FQ8 A;  3RU0 A;  4ATG A;  3FTW A;  3SFZ A;  4HVB A;  3FH7 A;  3FTZ A;  1UJJ A;  3TJP A;  1MHQ A;  2PM7 A;  2YNQ A;  4U63 A;  1HXI A;  2AW6 A;  3ZRH A;  2UWJ G;  3B7S A;  3QC1 A;  4P29 A;  4APO A;  5KJK A;  4I1A A;  3LDZ A;  3CGH A;  2KAT A;  3FWV A;  2CG3 A;  4XX5 A;  4FHK A;  2X6K A;  2WXP A;  5A23 A;  3D9L A;  1MQS A;  2J4B A;  4FUL A;  5JJ7 A;  4UI9 J;  4YVQ C;  3FEY A;  4N39 A;  4A1S A;  4KVO A;  3NF1 A;  1ZU2 A;  4IN3 B;  4DI4 A;  4IRU A;  4EZJ A;  4Y6W A;  5ANR A;  4I43 A;  3FU5 A;  5E76 A;  4E6H A;  3ML9 A;  3FH8 A;  1UW4 B;  1EF1 C;  1HX8 A;  2OND A;  3FUF A;  1A17 A;  3FTX A;  3O48 A;  4DLQ A;  3VTX A;  3QJZ A;  4BT8 A;  3ONL A;  2M63 A;  3LVR E;  1QQE A;  2J07 A;  1FVH A;  2UY1 B;  3FUJ A;  4WUY A;  4ILG A;  3SD5 A;  4JC8 A;  2FUL A;  3TXN A;  4A1G A;  2JLB A;  4AY6 A;  4XZ4 A;  4YND A;  2X38 A;  3VLD A;  4AEZ C;  4G26 A;  3MKQ B;  4GMJ A;  1EYH A;  1SZA A;  4CCA A;  4JZY A;  3L08 A;  4KT6 B;  1EPU A;  3FU6 A;  4EZL A;  3CST A;  1HZ4 A;  3ZW3 A;  4DLO A;  2UY1 A;  2NSZ A;  3HVE A;  4ANX A;  2AWI A;  4KBQ A;  2JEK A;  5J90 A;  4F1S A;  3LKU A;  4U0S A;  3IEG A;  2CHX A;  4G24 A;  4GA1 A;  4TRQ A;  4HOQ A;  2IOS A;  3TGO A;  3ZYK A;  4RVB A;  2J9Q A;  3CKB A;  4AIF A;  2KM4 A;  3T5X A;  2WQH A;  4BT9 A;  1HG5 A;  3I3N A;  1BPO A;  1DNP A;  2XQ0 A;  2XEV A;  4G23 A;  3ZHE A;  4FAD A;  2PM6 A;  4JW1 A;  3TL5 A;  4U0Z A;  2WXO A;  2R5S A;  3FU3 A;  1HF8 A;  2FF4 A;  1NP7 A;  3OAW A;  4GZ6 A;  3RRU A;  5BV1 A;  2XRY A;  2VTB A;  4NAC A;  3RKV A;  1Z3X A;  3AS5 A;  3CHO A;  4GAA A;  1E8Y A;  3L17 A;  2IFU A;  4O6F A;  2LNI A;  3CQC B;  4JEU A;  2WMN A;  3FUE A;  5EX3 A;  5EX0 A;  4WWP A;  3MV2 B;  3SBT B;  1HU3 A;  4ILI A;  4CDR A;  3AS4 A;  2IOL A;  2WMO A;  3PE4 A;  4GPK A;  4XKC A;  3S7J A;  3MGB A;  3OXL A;  3EHM A;  4N3A A;  5DBK A;  4A55 A;  4F53 A;  3KEZ A;  1QNF A;  4FJZ A;  4I2Z A;  3DPD A;  4R7L A;  5A6C A;  1XGW A;  1IHG A;  2XPY A;  1EDU A;  3PEU B;  4EZK A;  1ELW A;  2I6H A;  3QNK A;  4GYW A;  2YIN A;  2QY7 A;  3FUK A;  1WM5 A;  3AU5 A;  4HOU A;  3C98 A;  4H7Y A;  4GCO A;  3D9J A;  5A7D B;  2VGX A;  3ENE A;  3U64 A;  1UG3 A;  2WPV A;  2LO6 A;  2AXV A;  4DJA A;  5LX8 A;  4J8E A;  3CHR A;  2WXQ A;  1IQR A;  5C1D A;  4I6E A;  3L16 A;  3TG5 A;  4ACL A;  5BW8 C;  4XI9 A;  4OVU A;  4Q94 A;  5G05 J;  2VSN A;  1P5Q A;  4GA0 A;  4TV3 A;  3TAX A;  2VGX B;  4B0Z A;  2VSY A;  1JPL A;  2V5F A;  1U3C A;  3FUH A;  3FH5 A;  4N3C A;  3FEX A;  1JUQ A;  2GRL A;  4D10 C;  2VQ2 A;  3FHE A;  3LPZ A;  3QWV A;  3MZL B;  4JL0 A;  4PDX A;  3FU0 A;  3UT8 A;  3IBE A;  3UT7 A;  3VLF A;  4PS7 A;  5BPP A;  1VDY A;  3MV3 B;  4HOT A;  2EQX A;  3SGH A;  3ZYM A;  1UN8 A;  1UJK A;  2C0L A;  5ARF A;  3G2T A;  3G2S A;  3CK7 A;  3PE3 A;  1E90 A;  2KCK A;  1OWP A;  5FWQ A;  5T4Y A;  1TEZ A;  2OV8 A;  3VLE A;  2R59 A;  2WXK A;  4DI3 A;  2J49 A;  3SBS A;  2GGF A;  5JHB A;  1UN9 A;  2AXU A;  3ESK A;  3FTS A;  1S0P A;  1JWF A;  2WM9 A;  4F3V A;  5EDS A;  1INZ A;  1IYG A;  3FUM A;  3KS2 A;  3NZU A;  4IUL A;  3G2U A;  2KZT A;  5JJ6 A;  3ZVV A;  1ZBP A;  4UQZ A;  3D9M A;  4WWO A;  1H2U A;  3PRE A;  5T8I A;  4GML A;  1QZ2 A;  2X6I A;  3OXG A;  1HS6 A;  3PUK A;  4QFV A;  4EBA G;  3UT4 A;  5T3R A;  3ZIM A;  4G2V A;  3ZFW A;  4V3I A;  1SQM A;  3FTU A;  2I9C A;  4TUU A;  4FJY A;  1NA3 A;  4N5C A;  4BFR A;  5BV0 A;  2KZT B;  2WB2 A;  2L9B A;  1KT1 A;  2DCP A;  3HIZ A;  3L22 A;  3E4B A;  3Q5M A;  2PZI A;  4NRH B;  3VTY A;  1LF8 A;  3I4G A;  2WXL A;  3CR3 A;  3D9N A;  3MCX A;  4KZ0 A;  3Q15 A;  3URZ A;  2WXN A;  3GZS A;  3B7U X;  4ANV A;  2V4L A;  2IQC A;  4JPS A;  4G25 A;  3JUI A;  4UQY A;  3ZEF A;  2VYI A;  3S2A A;  1JWG A;  2PQN A;  3G2W A;  2WQ6 A;  4JHJ A;  4XE0 A;  1H2V C;  2V0P A;  3RIB A;  4I6J A;  2DBA A;  2VSO E;  4URK A;  5C2Y A;  3B13 A;  3I4R B;  4ANU A;  2WXI A;  3PZD A;  1WY6 A;  3CVL A;  3ONK A;  3LS8 A;  4FP7 A;  2XGO A;  2XHE A;  3ASG A;  3CKC A;  4MLP A;  1Z3Y A;  3K9I A;  5FTP A;  2A5U A;  2XPZ A;  3PVL A;  5FZQ A;  4FLH A;  1HFA A;  1YA0 A;  2NXP A;  3SZ7 A;  3L6A A;  4G11 A;  3UX4 A;  2XRZ A;  3U66 A;  5FZS A;  5AJD A;  3BG1 B;  4AJW A;  4BX9 A;  1ELR A;  5BUZ A;  3T5V A;  3CVX A;  1XNF A;  4L23 A;  3QAR A;  2MRI A;  3HYM B;  4J0U A;  2KC7 A;  2XGM A;  5KCM A;  5LCW C;  3IHY A;  4L2Y A;  4ACK A;  5D0Q D;  5ENN A;  4EEC A;  3JYS A;  4AM9 A;  3UUX A;  3LY7 A;  4XI0 A;  2CHW A;  5E75 A;  4AOF A;  3CVP A;  3MEK A;  4WNE A;  2YHC A;  2VSX E;  1KT0 A;  3FUL A;  4J8S A;  5FZR A;  2WQ7 A;  1PC2 A;  3D9I A;  3MYV A;  3IV0 A;  4GA2 A;  4CGW A;  4JA9 A;  2WXR A;  1SZ9 A;  3FDH A;  4AVX A;  1E8X A;  3QB2 A;  2BF0 X;  2WXG A;  3MKQ A;  3CHP A;  4I17 A;  4JHR A;  4HLE A;  3FUI A;  3APD A;  3U9W A;  5DIZ A;  3EJN A;  2BTD A;  3HVE B;  4HOR A;  4ABN A;  3QWW A;  4BWR A;  3SF4 A;  4ILH B;  2MOW A;  2PQR A;  3LCA A;  2RD0 A;  3HHM A;  3FY4 A;  4EBA A;  2OOE A;  4JA7 A;  3SHF A;  3CEQ A;  4KXK B;  3ESL A;  4K03 A;  1OWM A;  2QFC A;  5FQ6 A;  3TXM A;  4HFG A;  4L1B A;  3PRZ A;  3EDT B;  3LEW A;  4BTA A;  3RJV A;  4WAF A;  2E0I A;  3APF A;  3IKO B;  3RRM B;  1IQU A;  1E7V A;  5LP0 A;  5ARG A;  3B7R L;  3IHV A;  3MA5 A;  4MKT A;  3FUN A;  4HS2 A;  4N3B A;  4IYP A;  4C0E A;  4CDN A;  3ULQ A;  3CHM A;  4GCN A;  4RSY A;  3ZN3 A;  2VTB B;  2AXZ A;  4N2S A;  2RG8 A;  1HH8 A;  4U8H A;  2CFZ A;  3ZXS A;  2A4Z A;  1H6K A;  2PL2 A;  5LOZ A;  4FU3 A;  2KCV A;  3JQ0 A;  3HDX A;  3CLJ A;  5J08 A;  4E85 A;  1Z6T A;  3RK6 A;  3D9K A;  4FC8 A;  1TJF A;  3P1U A;  3CQG B;  1ELK A;  4EPZ A;  5M72 A;  3Q47 B;  4UQX A;  3ZGQ A;  3L54 A;  3R7R A;  3ASF A;  3ASD A;  4PH4 B;  2HM8 A;  4GU5 A;  4W9R A;  3I5P A;  2XCC A;  4APF A;  3CVW A;  4GYO A;  2FO7 A;  2WXH A;  4GB9 A;  2X6J A;  4J8D A;  4WNG A;  5BT1 A;  4F7A A;  2X6H A;  5FT9 A;  4AP2 A;  4LCT A;  2E2E A;  4J6I A;  4L2L A;  4KMO A;  3RRN B;  5ANL A;  4KVM A;  5G55 A;  4CGV A;  3ZYL A;  2I1K A;  1OUV A;  1Y8M A;  3LJ3 A;  4OYS A;  3FFL A;  4C9B B;  3QAQ A;  3MX3 A;  3R9A B;  1N54 A;  3PEV B;  3QKY A;  4CDM A;  4LUN U;  4JVS A;  5FQ7 A;  3CVV A;  4AXH A;  2P58 C;  5G2N A;  3OTN A;  1PAQ A;  2HO1 A;  3NQP A;  3PUJ A;  4A3T A;  3S7F A;  1HE8 A;  2HYZ A;  4I9E A;  2LSU A;  2IU1 A;  1H19 A;  1NZN A;  3S7B A;  3BG0 B;  3EIJ A;  3FTY A;  5JJT A;  1B89 A;  2V8S E;  4RG6 A;  4AY5 A;  3ZYQ A;  3LY9 A;  4NUR A;  4WNF A;  4B8A A;  4BX8 A;  3WXX A;  4FA6 A;  3MJW A;  4OVV A;  4N2Q A;  2AVP A;  4GZD A;  4DPR A;  3G2V A;  3CK8 A;  1DVP A;  1L5J A;  3FUD A;  1KLX A;  3PS6 A;  2C2L A;  3CSF A;  3PNT B;  3RO2 A;  4DK5 A;  3U3W A;  4B89 A;  1PY1 A;  1TJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...