4JHRA

An auto-inhibited conformation of lgn reveals a distinct interaction mode between goloco motifs and tpr motifs
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
305
structure length
290
Chain Sequence
NFDEAIVCCQRHLDISRELNDKVGEARALYNLGNVYHAKGKSEDVRNALQAAVDLYEENLSLVTALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELKDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGDLEVLFPPDEDFFDILVKCQGSRLDDQRCAPPSAATKGPTVPDEDFFSLILRSQAKRMDEQRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords G-protein-signaling modulator 2
publication title An autoinhibited conformation of LGN reveals a distinct interaction mode between GoLoco motifs and TPR motifs
pubmed doi rcsb
source organism Mus musculus
total genus 119
structure length 290
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02188 GoLoco GoLoco motif
A PF13176 TPR_7 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4jhrA00
4APOA 2KC7A 4ABNA 3MV2B 3S7JA 2PQRA 4GZ5A 3GW4A 3TGOA 4XI0A 1ZU2A 2KATA 4GA0A 1HH8A 3MV3B 2C0LA 1W3BA 5G05C 4CGWA 4HOSA 3O48A 4ME2A 2KCVA 4HOQA 3CK7A 2Q7FA 2VSYA 4AY6A 2HR2A 3KD7A 3S7DA 5G05J 2Y4UA 4JHRA 4BT9A 3IEGA 5CCLA 3QKYA 3TG4A 2HO1A 4B94A 5D0OD 3SF4A 4EQFA 5FTPA 2LSUA 1KT1A 3Q15A 3BEEA 2JLBA 2UY1A 3CV0A 2UWJG 4I2WA 2I6HA 1YA0A 4BTAA 3LY8A 4N5CA 3UUXA 4IN3B 4N3BA 4NRHB 2KCLA 1ELRA 2MHKA 3ZPJA 2FEZA 2XGOA 4U0ZA 1IYGA 5AYWD 4HOUA 1XNFA 5EX0A 4AY5A 4NQ0A 1KT0A 5JJTA 2GW1A 3ZN3A 3LPZA 4O6FA 3PE3A 3ASGA 3QOUA 4XIFA 4G2VA 5A6CA 4N2SA 4GA1A 5ARFA 2FF4A 1FCHA 4I2ZA 4UI9K 4KXKB 2FO7A 3ASHA 5KJKA 4KYOB 3U3WA 2NC9A 4AIFA 4UQXA 1E96B 4I9EA 3CVLA 3Q47B 3ASDA 3FP3A 3ZGQA 4N3CA 4U0SA 1NZNA 4WNFA 4I17A 3PE4A 3CVQA 4Y6WA 1B89A 4LEUA 1WM5A 2VGXB 3NF1A 3QWWA 5C1DA 2XCCA 4G25A 3LKUA 3JYSA 4F3VA 2C2LA 5FT9A 1IHGA 4U07A 3RU0A 2DBAA 1TJCA 2PL2A 4RG9A 3N71A 2P58C 4GZ6A 4JA7A 2VQ2A 5DIZA 3LY7A 5JJ6A 2LSVA 5BNWA 4WNDA 4HORA 2VSNA 1HZ4A 1WAO1 4A1SA 4J8DA 2YHCA 5BT1A 3RKVA 2XGSA 2WPVA 3KS2A 4N3AA 4J8FA 2V5FA 3QWVA 4UQYA 4JA9A 4XI9A 5BW8C 4HOTA 3UQ3A 2VGXA 3AS5A 3GYZA 3EDTB 3CVPA 1OUVA 3MEKA 3ZHEB 3TAXA 3RIBA 3CEQA 2XEVA 3QWPA 3S7BA 4CDRA 5CCMA 1KLXA 3GZ2A 3Q4AB 3Q5MA 2XPIA 3LY9A 5FZRA 2KCKA 3CKCA 3OXLA 4GPKA 4GYOA 2OOEA 4J0UA 4UI9C 4WNEA 5A7DB 2IF4A 5JJ7A 3RJVA 5EX3A 5D0QD 4RG6A 5G04C 4UI9J 2WQHA 4YVQC 4GYWA 2HYZA 5KJNA 4GCOA 2FI7A 3VTXA 3MKRA 4G26A 3LCAA 1P5QA 3TG5A 5G04J 3U4TA 3LYAA 3S7FA 2IFUA 3UPVA 5EKQD 3MA5A 4YNDA 4U04A 4WUYA 3ZHEA 3FWVA 2QFCA 1HXIA 2R5SA 2FBNA 3URZA 5CHEE 4WNGA 3FFLA 1NA0A 1QZ2A 4CGVA 4BT8A 3VTYA 3KAEA 4H7YA 4N2QA 3OXFA 5M72A 3HYMB 4BWRA 2VYIA 3ESKA 4YVOA 1QQEA 1ELWA 5FZQA 2VGYA 5HQ8A 4GZ3A 2PQNA 4G23A 3GZ1A 4Y6CA 2XCBA 4AM9A 3WXXA 4N39A 2E2EA 4UQZA 4H7XA 1Y8MA 5HI7A 3E4BA 3SZ7A 4JL0A 3CKBA 5LCWC 4KBQA 1A17A 2Y4TA 4I9CA 4BTBA 3RO2A 2XGMA 3PDNA 3QDNA 4G1TA 5LCWJ 4GA2A 3R9AB 4G24A 4I1AA 3ASFA 3CK9A 2LNIA 2BUGA 5DBKA 5KJLA 3AS4A 3CVNA 2ONDA 4GYYA 2YQ8A 4W9RA 3RO3A 2L6JA 3ZFWA 5FJYA 3AS8A 3OXGA 5FZSA 5ARGA 1ZBPA 4U0UA 2UY1B 3Q49B 1NA3A 4GCNA 3CK8A 2AVPA 2C0MA 4J8EA 2PZIA 3K9IA 5KJMA 3ULQA 1PC2A 2J9QA
chains in the Genus database with same CATH superfamily
3X2QE 1UOHA 1WDYA 4FC8A 5EYPF 3FU5A 1HH8A 4CGWA 5CEDB 2WB2A 4ME2A 2KCVA 3Q73A 2KXPC 1YMPA 3KD7A 4APFA 5G05J 4BX8A 4Q69A 3TXNA 4JHRA 3RAUA 2P9LG 1S64A 5CCLA 4OAVB 4B94A 3IHYA 3SF4A 2LSUA 3L6AA 3PUJA 4I1MA 3SFXA 5AQ9A 2UY1A 2WXMA 3CV0A 4I2WA 2I6HA 2F8YA 1BI8B 1YA0A 4OVVA 4L23A 2LUHA 3ZVVA 3LY8A 3JUIA 4FHKA 2Y69E 3E33A 3UUXA 1OXJA 2VTBA 4NRHB 3IXEA 4DI3A 2MHKA 1IQRA 2XGOA 3HXFA 4HOUA 2LAHA 5LFAA 2GW1A 4HXIA 3LPZA 4YDEA 4C9BB 3PE3A 1IHBA 4GTQA 3QOUA 4GTOA 5B3SE 3CR3A 4XIFA 2GRMA 2IEJA 4NACA 4MS6A 2FF4A 4EHMA 2ETAA 4KXKB 2FO7A 4TV3A 5KJKA 1H6OA 2NC9A 4IRUA 4LCTA 4GU5A 1TNYA 1AWCB 4LSZE 1MJ0A 5ENPD 3C3OA 2V4HC 2X3MA 3ASDA 2ETCA 3ZIMA 3NBNB 4U0SA 3OAWA 1NZNA 4HB5A 3APCA 4IYPA 5G2NA 2DZNA 1B89A 2WQ7A 1WM5A 4CZ2D 1MHQA 3ZEFA 3NF1A 1INZA 4RQIA 4E6HA 2DVWA 2XCCA 4G25A 1YYHA 4Z68A 2RFMA 2GROB 3Q7FA 3UI2A 3SHFA 2C2LA 2R2LA 1IHGA 4U07A 3RU0A 2H6FA 1H2UA 1H6PA 3HVEB 3AG1E 4O60A 4BSXA 3W9GA 5DIZA 1YCSB 2IOLA 4JB8P 3ZXPA 4E85A 5A23A 3G2WA 4U8YD 4WNDA 3DPDA 1TN6A 4DK5A 1HZ4A 2KM4A 1N0QA 3LS8A 3UM1A 2YHCA 4DJAA 3RK6A 3RKVA 1IKND 1NFIE 4J7WA 3C3RA 3PZ3A 1TNZA 3QWVA 1OWPA 3KEAA 3UXGA 4HOTA 3UQ3A 3UKUG 1OCCE 3D9IA 1HE8A 3MJWA 4V3IA 5B1BE 3AG3E 1N11A 2V4LA 2R17C 2J07A 3FU0A 3CEQA 5ENSD 5G55A 2XEVA 5C2YA 3QWPA 3Q9NC 1KLXA 3HVEA 3Q4AB 2MYOA 5ENOD 3BG0B 3J5QB 5EDSA 5FZRA 3OXLA 1LTXA 1QNFA 2OOEA 3UM2A 4J0UA 3EU9A 3L08A 3CVYA 2ZU6B 3L9TA 4BEPA 5A7DB 5JJ7A 2V8SE 5D0QD 4HS2A 1K1BA 1KZOA 5HS0A 1HS6A 4FA6A 2FI7A 4JVSA 3D9LA 3LCAA 1OCZE 2DZOA 3UIPC 2IFUA 4ANXA 4GMLA 1N52A 4WUYA 2AW6A 3FWVA 4B93B 3EIJA 4I6EA 3I4GA 4BERA 3FTVA 3CHSA 2WXIA 5FQ7A 2R5SA 2JABA 5AQBA 5CHEE 3CHMA 1S63A 5HKPA 3DRAA 4M3OA 1HX8A 3QJZA 3SO8A 1E8XA 3VLFA 4CGVA 1HFAA 4N2QA 4C0EA 5M72A 3HYMB 4MKTA 4HLLA 4YVOA 1QQEA 1RW2A 3TL5A 4HQDA 2L0IA 3LJNA 2LO6A 2RKKA 2BKKB 4L7TA 2XCBA 3WXXA 4HRMB 2KZTA 4K5CA 1K3ZD 4HI9A 3DEPA 2OVBA 3CKBA 4NURA 4KBQA 4ILIA 2QYJA 2R03A 4I6GA 1HG2A 1QBQA 3ZYMA 5B1AE 2XGMA 5AQ7A 3PDNA 3PS6A 2QZAA 3R9AB 4G24A 1V55E 2J8SD 4HRLA 5KJLA 3AS4A 3CVNA 2ONDA 3SBTB 3G2SA 4FJZA 2XQ0A 4JZYA 3RO3A 2I1JA 2X38A 2V5QC 3OTNA 3FUHA 5FZSA 1N4RA 3FUEA 5CEAA 2GRPB 4I1OB 3SFYA 1ZBPA 4U0UA 4GTSA 5AARA 3CVXA 1QYMA 3C5RA 4FHJA 4ILHB 4CDNA 3FH8A 3LXUX 2X6KA 2PZIA 3K9IA 2RFAA 2NSZA 3DWLG 4APOA 2KC7A 1NI1A 2PQRA 3ZKJA 4GZ5A 3GW4A 3TGOA 4MRUA 3B7SA 3CVUA 5G05C 2WMNA 3CK7A 3ASNE 5T8IA 2Q7FA 4AY6A 2HM8A 4RVBA 3TWUA 2M63A 2Y4UA 3L16A 5ITZF 1JPLA 4ATZD 1E8WA 3BQOA 3IEGA 3PZ2A 3Q75A 2KBXA 1TN7A 2Y0BG 5BUZA 2X6HA 2XEHA 3FUFA 3QARA 5FTPA 3ULEG 4A55A 4LNGA 4MBGA 3Q15A 2WXQA 2AJAA 4ANUA 3PRZA 4FLHA 3AG4E 1EPUA 4EECA 3EUVA 3DPYA 4UWLA 4BTAA 4YDOA 3MGBA 2IU1A 1TNUA 4R7LA 5FQ8A 1K1AA 2Y3AA 4N3BA 3L17A 2CHWA 4A3VA 3F6QA 1IYGA 4AY5A 2A4ZA 4O6FA 3ASGA 2JEKA 1UN9A 1MX4A 5CRUA 4GMRA 4G2VA 4NIKA 5A6CA 4N2SA 3APDA 2DYRE 3DEOA 3IKOB 2XZDG 5ARFA 3SBSA 3DSTA 4I2ZA 3ASHA 1MYOA 3NZSA 3PREA 3TWXA 5ENNA 4KYOB 4QFVA 4AIFA 3V31A 1MX6A 4I9EA 2OEVA 3Q47B 3NAWA 3FY4A 4N3CA 4WNFA 3AU4A 2HE0A 4KVOA 4JD2G 3PE4A 4CT0A 4TXQA 2LXLA 3FUKA 2OVFA 4JEUA 4B0ZA 2GRNB 4QQIA 3FTWA 4TUMA 2VGXB 3QWWA 5JA4D 5T4YA 2J08A 3QB2A 1SA4A 2XS1A 5D66A 4DUIA 2DBAA 5JMND 2PL2A 2L6BA 2P9KG 4DLOA 4JA7A 3HXEA 2VQ2A 4ACLA 5BXOA 2XRYA 1N94A 3PZDA 1LD7A 4WAFA 4U96D 1KPSB 3UIOC 4LUNU 4MLPA 3ZNGA 3PNLB 3SQVA 3VLDA 4WWPA 3KS2A 4J8FA 4JPSA 2V5FA 2I1KA 1E8ZA 4XI9A 3QC1A 2VGXA 3AS5A 2WXLA 1X81A 3ZHEB 2DWZA 1HF8A 3S2AA 2RG8A 3TWTA 3ZYLA 3R9MA 1AP7A 1DC2A 3IHVA 2YNQA 4LERA 3Q5MA 3FTXA 2Y1LE 2KCKA 3CKCA 4GYOA 5CRVA 3V30A 4HFGA 4LRZA 4AVXA 3DSVA 1G3NB 5EX3A 5FQ4A 4RLYA 3SNXA 4RG6A 1SQMA 4UI9J 4YVQC 2YINA 1UN8A 4JHJA 4GCOA 3FU6A 5LOZA 2MOWA 3TWQA 5AAOA 2CG2A 3FU3A 5G04J 1BI7B 3SFZA 2PNNA 2CHZA 3C98A 1S70B 1Z3YA 4PS3A 3NQPA 3ULYA 3ZHEA 1E7UA 4DX5D 2R02A 5EILA 2BEDA 3URZA 4PDXA 3PNTB 1K8KG 3FFLA 1NA0A 2OEWA 1HG5A 4BT8A 1U2VG 3KAEA 2VYIA 3EJNA 5ENTD 2WM9A 5FZQA 5HQ8A 3VLEA 1SVXA 4F7AA 4GZDA 3B13A 3JXJA 3FTUA 2DCPA 5H7PA 4UQZA 4H7XA 5CMYA 5HI7A 3SZ7A 5CERB 2XZTG 2CFZA 4UWGA 3B7RL 3ZW3A 2B0OE 3HRAA 3CLJA 4BTBA 3QDNA 5KBAA 5LCWJ 3LDZA 4GA2A 1DCEA 3D9MA 3FULA 4ANWA 4UWFA 1OWLA 3CK9A 2R59A 5BV1A 1SZAA 4M7CA 5DBKA 5FQ6A 3V2OA 4I6JA 4GYYA 2NXPA 2YQ8A 3I5PA 4W9RA 1RZ4A 2L6JA 4OAUC 3W9FA 3ISMC 3SD5A 3UMVA 4TXRA 5KNHD 2KZTB 3FUDA 3KSLA 2IJGX 2J09A 5FIOA 3SGHA 3CK8A 2AVPA 2C0MA 2ZIRA 3ULQA 4ZHBA 4ABNA 3MV2B 3JXIA 2QY7A 2EILE 1OWOA 3MV3B 4HOSA 3O48A 1H19A 1LD8A 3FTSA 2EINE 2I2OA 2X6IA 3D9NA 4KVMA 4DI4A 3UM3A 3BG1B 3RSEG 4HI8A 3MCXA 2XS8A 2IO2C 3LVQE 1FPPA 2BKGA 3MX3A 2WXOA 4URKA 1HU3A 3QKYA 5ENRD 2GRQB 4EQFA 1FVFA 2F37A 4DX1A 1KT1A 2FULA 2JLBA 2UWJG 4GTPA 3UT7A 4F1SA 4N5CA 2P9UG 2FEZA 4U0ZA 1XNFA 5EX0A 4NQ0A 1KT0A 3IBEA 2PM7A 3ZN3A 4UUCA 3ZXSA 3PZ4A 5AIJA 5KCMA 4I43A 5AJLA 5EIBE 1JWGA 4JC8A 4GA1A 1Z6TA 3EU5A 3MYVA 1H2VC 4B89A 2ZISA 2ZGDA 2EIKE 4GB9A 3U64A 4JHKA 1E96B 4U95D 3ZGQA 3C3QA 4FP7A 5KWDA 5EN5D 3JUEA 3CVQA 3APFA 3E37A 4Y6WA 3FH7A 1DCQA 1TEZA 4U8HA 4LEUA 4CYMD 5BPPA 4Q94A 3Q9UC 5CBOA 3D9OA 3LKUA 2WVIA 3JYSA 3MZLB 4F53A 4F3VA 1HO8A 2X6JA 4B8CB 5FT9A 3ZU7B 4DRXE 2J4BA 2P9PG 3GZSA 1JCQA 3IV0A 1KZPA 3N71A 4UWKA 5ENQD 3G2UA 2QYUA 2A5EA 1D8EA 3FDHA 4U8VD 2LSVA 1EYHA 4RSYA 1FVHA 1N0RA 4FU3A 2VSNA 1S0PA 4CRWA 4BETA 1WAO1 3HXDA 4P29A 4A1SA 1LF8A 3FTYA 3L13A 5BT1A 4XX5A 2PM6A 5KNGA 2WPVA 3ONKA 3ZYKA 2P9NG 3T5VA 4G11A 3CGHA 3HIZA 1L5JA 3FUIA 4ATGA 4UQYA 4JA9A 1U3CA 4C48B 2L0TB 4D10C 3GYZA 4DX6D 5AJDA 4EZJA 3LVRE 3MEKA 4U7EB 2VSXE 4YDYA 1V54E 3P1UA 1TJFA 5BXUA 3RIBA 4ZFHA 2AXVA 4JEHA 5ANRA 1BLXB 2J4DA 2WXFA 2P2CP 4UWHA 4CDRA 4DPRA 1O1RA 2GRLA 3GZ2A 3SY2A 5J08A 4KZ0A 3LY9A 1MX2A 2WQ6A 2IY0C 1N4PA 4K0RA 4UI9C 4AEZC 4WNEA 1EDUA 4CCAA 3EHQA 3CHOA 3LEWA 4GTVA 3ABME 1N54A 5G04C 1TN8A 2WQHA 1O1TA 4J8YA 2HYZA 5KJNA 3L82A 3FEYA 4GAAA 3VTXA 3FH5A 3NOCD 1VDYA 3MKRA 4L9PA 2WXNA 4EBAA 4WWOA 3TG5A 1UG3A 2RD0A 2XENA 4XEIG 3S7FA 3UPVA 3D3MA 3UKRG 1BD8A 5JHBA 3HXBA 4TXPA 2WXJA 4FLBA 2LAIA 2A5UA 3E34A 2QFCA 1HXIA 5AENA 4C0MA 3BUAA 2FBNA 5LX8A 3AU5A 4WNGA 1N95A 3DSWA 4WWNA 4DX7D 3VTYA 4H7YA 3SI5A 4FADA 3T5XA 4F6RD 4BWRA 3ESKA 1UJJA 4KMOA 4AV7A 2GGFA 1WG0A 2ETBA 3FUJA 4GZ3A 4XKCA 1UJKA 3R7RA 4OVUA 3GZ1A 1TYQG 4Y6CA 4N39A 4IULA 4XE0A 2P9SG 3Q78A 1Y8MA 2ILRA 2EIME 3DSSA 4JL0A 5LCWC 2WXKA 1N4QA 2OCCE 4I9CA 2I9CA 4K5BA 3EHMA 5BV0A 2AWIA 4I1AA 3ASFA 1O1SA 2LNIA 3ZUVB 4OYSA 2R05A 4BY6A 1D9SA 1N9AA 3HXCA 1EF1C 3ML9A 3O4ZA 2LXMA 4JXTA 1A5EA 2WXPA 3RRNB 3FEXA 3AS8A 3OXGA 2B6CA 2H6GA 4XKBA 3D9HA 3B7UX 1BU9A 1Z3XA 1OCOE 3LJ3A 3ABKE 4L2LA 1NA3A 3UINC 1FT2A 3CHPA 2L9BA 5KJMA 2J9QA 2BTDA 3S7JA 3V2XA 1TNOA 4BFRA 4XI0A 1ZU2A 1NL4A 3E32A 2KATA 4GA0A 4GTTA 5D2MC 2VGEA 3DXMG 2C0LA 1W3BA 4G8KA 3DBSA 1H6KA 3CVWA 3CSTA 4HRNA 3CHRA 4HOQA 2VSYA 2HR2A 1MQSA 5ANLA 4L1BA 1H2TC 2VJ8A 3S7DA 1GW6A 4BT9A 2DIWA 4CEMA 4LNBA 4EPZA 4GTMA 5LP0A 4A63B 4AXHA 3EHRA 2CFUA 1UW4B 3TG4A 4O1OA 2HO1A 3EHNA 5D0OD 5EIDA 3TJPA 1JCRA 1IQUA 3V79K 1TR4A 4K5AB 1OWNA 3I3NA 4X8QA 3BEEA 1N4SA 3PVLA 2CHXA 3DSXA 2WXRA 4TUUA 1NP7A 4IN3B 1PAQA 3HG0D 2ZGGA 2KCLA 1ELRA 3ZPJA 3UT4A 3TWSA 4GPMA 5AYWD 5JJTA 4CDMA 2ZXWE 4EZLA 3FUNA 4PS7A 4A1GA 5FINA 3Q79A 4GZCA 5E76A 3UX4A 4XZ4A 3FTZA 2XRZA 2IO3C 1FCHA 4LG6A 4UI9K 2GRRB 3HDXA 3NB2A 1OWMA 3U3WA 2AXZA 4ILGA 4PH4B 3T8MA 3R7QA 2EIJE 4UQXA 2H6IA 4GMJA 1JWFA 3CVLA 3FP3A 3CVVA 4KZCA 2XEEA 4I17A 1JCSA 3NOGD 1XGWA 3CHQA 5HRYA 3TWVA 5T3RA 3B95A 3CQCB 4G8LA 5C1DA 4YDWA 4GTRA 4BSZB 1MZCA 4PS8A 3ZYQA 3U9WA 1WY6A 1D8DA 1Y6IA 1TJCA 3J5PA 4RG9A 2P58C 3B7TA 3G2VA 4BX9A 4GZ6A 4O1PA 2FO1E 3LY7A 3UM0A 3TXMA 3ESLA 4AJWA 5JJ6A 3T9KA 3PUKA 3MKQB 4L2YA 2OV8A 5BNWA 4DX2A 5AN8A 4HORA 3ASOE 3D9KA 3JQ0A 2H6HA 2XHEA 2X6FA 1O5MA 3ENEA 3CSFA 4J8DA 2XGSA 4FULA 3JQ1A 4N3AA 3RRMB 3AG2E 3E30A 5BW8C 1X5BA 3C72A 4EZKA 2WXGA 5JHAA 3EDTB 3CVPA 1OUVA 3TAXA 2QC9A 3CIAA 4FJYA 4HVBA 4AP2A 1OY3D 2NYJA 3S7BA 5CCMA 2XPIA 1BPOA 3D9PA 5EYLA 1Z5SC 5AQAA 4GPKA 2F0YA 3MKQA 3L54A 2IF4A 2AXUA 3RJVA 3UT8A 4J8SA 3T8KA 3PEVB 3CQGB 4ANVA 3KSQA 2E0IA 4GYWA 4G26A 3B7BA 1P5QA 3U4TA 3LYAA 3TWRA 2IONA 2YHEA 3WG7E 1ELKA 5EKQD 3MA5A 4YNDA 1PY1A 4U04A 2DYSE 1SA5A 3Q7AA 1Q2ZA 3L22A 2WXHA 4EBAG 1E90A 3UTMA 3PZ1A 2BF0X 3ABLE 2IOSA 2V0PA 4F1PA 3PH0C 4PUCA 1ZB1A 3RRUA 3JCKC 1QZ2A 5CECB 4K03A 3DXKG 3OXFA 4HBDA 3TWWA 3DSUA 2VSOE 3ONLA 1ELWA 4U63A 3FUMA 4KT6B 2VGYA 4AOFA 5CMWA 4N5QA 1TNBA 1E7VA 3FHEA 4ACKA 2CG3A 4DLQA 2PQNA 3P2BA 3D9JA 3QK0A 4G23A 3BU8A 5IY5E 4AM9A 3HHMA 2E2EA 3QAQA 1JUQA 3E4BA 4B8AA 1SZ9A 4JW1A 2MRIA 5E75A 5CBNA 1DVPA 3QNKA 1A17A 3U66A 5J90A 2XPZA 3G2TA 2Y4TA 2F8XK 3RO2A 4A3TA 4CT4A 4G1TA 3KEZA 1E8YA 3ZRHA 4TRQA 2BUGA 2IQCA 4J6IA 4Q96A 3NZUA 4LNUD 1IXVA 1H0AA 2J49A 3AJIA 2XPYA 3ZFWA 3AAAC 4HNAD 5FJYA 2EQXA 5ARGA 3ML8A 1FT1A 3I4RB 2WMOA 5FWQA 4HLEA 2UY1B 1OT8A 3Q49B 4GCNA 1DNPA 4BESA 1U3DA 3EIQC 1OCRE 3PEUB 4J8EA 2P9IG 2VTBB 1PC2A 1SW6A
chains in the Genus database with same CATH topology
4APOA 2BTDA 2KC7A 4ABNA 3MV2B 3S7JA 2PQRA 4FC8A 3GW4A 4GZ5A 4BFRA 3TGOA 4MRUA 4XI0A 1ZU2A 2KATA 2QY7A 1HH8A 3B7SA 3FU5A 4GA0A 1OWOA 3MV3B 3CVUA 2C0LA 1W3BA 5G05C 4CGWA 4HOSA 3DBSA 1H6KA 3CVWA 2WB2A 3CSTA 3O48A 2WMNA 3CHRA 4ME2A 1H19A 2KCVA 4HOQA 3FTSA 3CK7A 5T8IA 2I2OA 2Q7FA 2VSYA 2X6IA 2HR2A 4AY6A 2HM8A 1MQSA 3D9NA 4RVBA 5ANLA 3KD7A 4KVMA 4L1BA 1H2TC 4DI4A 2VJ8A 3S7DA 3BG1B 4APFA 5G05J 4BX8A 4Q69A 1GW6A 2M63A 3TXNA 2Y4UA 4JHRA 3L16A 4BT9A 3MCXA 1JPLA 2DIWA 4CEMA 1E8WA 3LVQE 4EPZA 3IEGA 5LP0A 3MX3A 2WXOA 5CCLA 4URKA 1HU3A 3QKYA 4AXHA 2CFUA 5BUZA 1UW4B 3TG4A 2X6HA 2HO1A 4B94A 3IHYA 3EHNA 5D0OD 3TJPA 3SF4A 4EQFA 3FUFA 3QARA 1IQUA 5FTPA 2LSUA 1FVFA 3L6AA 4A55A 1KT1A 3PUJA 4I1MA 3Q15A 2WXQA 1OWNA 3I3NA 2FULA 3BEEA 2JLBA 4ANUA 3PRZA 2UY1A 4FLHA 2WXMA 1EPUA 4EECA 3CV0A 2UWJG 4I2WA 2I6HA 3PVLA 2CHXA 4UWLA 1YA0A 4OVVA 4L23A 3ZVVA 4BTAA 3MGBA 2IU1A 3UT7A 5FQ8A 3LY8A 3JUIA 4FHKA 4R7LA 4F1SA 2WXRA 2Y3AA 4N5CA 4TUUA 1NP7A 4IN3B 1PAQA 4N3BA 3UUXA 2VTBA 3L17A 4NRHB 2KCLA 4DI3A 1ELRA 2CHWA 2MHKA 2FEZA 1IQRA 2XGOA 3UT4A 3ZPJA 4A3VA 4U0ZA 1IYGA 5AYWD 4HOUA 1XNFA 5EX0A 4AY5A 2LAHA 1KT0A 3IBEA 2A4ZA 4NQ0A 5JJTA 5LFAA 4CDMA 2PM7A 2GW1A 4HXIA 3ZN3A 4EZLA 3LPZA 4C9BB 4O6FA 3PE3A 3FUNA 3ASGA 4PS7A 2JEKA 4A1GA 3QOUA 3ZXSA 1UN9A 3CR3A 4GZCA 4XIFA 5E76A 5KCMA 4G2VA 3UX4A 5AIJA 3SBTB 5A6CA 4XZ4A 2GRMA 3FTZA 4I43A 4N2SA 3APDA 5AJLA 1JWGA 4NACA 4JC8A 4GA1A 3IKOB 2XRZA 1Z6TA 4MS6A 5ARFA 2FF4A 3SBSA 1FCHA 4I2ZA 4UI9K 4KXKB 2FO7A 3ASHA 3MYVA 1H2VC 3HDXA 3NZSA 4TV3A 4B89A 3PREA 5KJKA 5ENNA 1OWMA 4KYOB 3U3WA 2NC9A 4IRUA 4LCTA 4GU5A 2AXZA 4ILGA 4PH4B 4QFVA 4AIFA 4GB9A 3T8MA 3U64A 3R7QA 4UQXA 4JHKA 1E96B 4I9EA 4GMJA 1JWFA 3CVLA 3Q47B 2X3MA 3ASDA 3FP3A 3ZGQA 3FY4A 3ZIMA 4N3CA 3CVVA 4KZCA 4FP7A 4U0SA 3OAWA 1NZNA 4WNFA 4I17A 3AU4A 4KVOA 3PE4A 4CT0A 1XGWA 3CHQA 3CVQA 3APFA 3APCA 3FH7A 4IYPA 4Y6WA 3FUKA 5G2NA 1TEZA 1B89A 4U8HA 2OVFA 4JEUA 4LEUA 4B0ZA 2WQ7A 1WM5A 3FTWA 5T3RA 1MHQA 3ZEFA 2VGXB 3NF1A 3CQCB 5BPPA 4Q94A 3QWWA 1INZA 5C1DA 4E6HA 5T4YA 2J08A 3D9OA 3QB2A 2XCCA 4G25A 3LKUA 2WVIA 3JYSA 3MZLB 4F53A 4PS8A 3SHFA 4F3VA 1HO8A 2X6JA 4B8CB 2C2LA 3ZYQA 5FT9A 1IHGA 4U07A 3U9WA 1WY6A 3RU0A 2DBAA 1Y6IA 1TJCA 1H2UA 2J4BA 3GZSA 2PL2A 3IV0A 3HVEB 4RG9A 3N71A 2P58C 3B7TA 4UWKA 3G2VA 4BX9A 4GZ6A 4DLOA 4JA7A 4BSXA 3G2UA 2VQ2A 5DIZA 3LY7A 2IOLA 4ACLA 3TXMA 2XRYA 3ESLA 4AJWA 5JJ6A 3FDHA 3PUKA 4E85A 5A23A 3MKQB 3PZDA 4L2YA 2LSVA 2OV8A 1EYHA 3G2WA 4WAFA 5BNWA 4WNDA 4HORA 4RSYA 3DPDA 1FVHA 4LUNU 3D9KA 4FU3A 2VSNA 4MLPA 1S0PA 4DK5A 3JQ0A 4CRWA 1HZ4A 2XHEA 2X6FA 1WAO1 2KM4A 4P29A 4A1SA 3ENEA 3LS8A 3PNLB 3CSFA 1LF8A 4J8DA 2YHCA 4DJAA 3FTYA 3L13A 5BT1A 4XX5A 2PM6A 3RK6A 3VLDA 3RKVA 2XGSA 2WPVA 3ONKA 4FULA 4WWPA 3KS2A 3ZYKA 3JQ1A 4N3AA 4J8FA 3T5VA 4JPSA 2V5FA 4G11A 3CGHA 2I1KA 3HIZA 1L5JA 3FUIA 3RRMB 4ATGA 3QWVA 1OWPA 4UQYA 1E8ZA 4JA9A 4XI9A 1U3CA 5BW8C 1X5BA 4HOTA 3UQ3A 3QC1A 3D9IA 4EZKA 2L0TB 2VGXA 1HE8A 3AS5A 2WXGA 3MJWA 4D10C 3GYZA 4V3IA 5JHAA 5AJDA 3EDTB 4EZJA 3CVPA 2WXLA 1OUVA 3LVRE 3MEKA 3ZHEB 1HF8A 2VSXE 3TAXA 3P1UA 3S2AA 1TJFA 3CIAA 2V4LA 2RG8A 4FJYA 2R17C 3RIBA 3ZYLA 2J07A 2AXVA 3FU0A 4AP2A 3CEQA 4JEHA 4HVBA 5ANRA 5G55A 2XEVA 5C2YA 3QWPA 2J4DA 2WXFA 4UWHA 3S7BA 3IHVA 2YNQA 4CDRA 4LERA 2GRLA 1KLXA 3GZ2A 3HVEA 4DPRA 5CCMA 3Q4AB 3Q5MA 3BG0B 3FTXA 5J08A 2XPIA 4KZ0A 1BPOA 3LY9A 3D9PA 5EDSA 5FZRA 2KCKA 3CKCA 3OXLA 1QNFA 4GPKA 4GYOA 2WQ6A 2OOEA 4J0UA 3MKQA 4HFGA 4K0RA 4UI9C 3L08A 4AEZC 3CVYA 2ZU6B 4WNEA 4LRZA 3L54A 4AVXA 1EDUA 5A7DB 4CCAA 2IF4A 3CHOA 2AXUA 3LEWA 5JJ7A 2V8SE 3RJVA 5EX3A 5FQ4A 5D0QD 4HS2A 3UT8A 4J8SA 3SNXA 4RG6A 3PEVB 1SQMA 1N54A 5G04C 3CQGB 4UI9J 4ANVA 2E0IA 2WQHA 4YVQC 2YINA 1HS6A 4GYWA 4FA6A 1UN8A 2HYZA 4JHJA 5KJNA 3FEYA 4GCOA 2FI7A 4GAAA 3FU6A 3VTXA 3FH5A 4JVSA 5LOZA 2MOWA 3D9LA 1VDYA 3MKRA 3LCAA 4G26A 2CG2A 1P5QA 2WXNA 3FU3A 4EBAA 4WWOA 3TG5A 5G04J 3U4TA 1UG3A 2RD0A 3LYAA 3S7FA 3SFZA 2IONA 2YHEA 2IFUA 3UPVA 1ELKA 3D3MA 2CHZA 4ANXA 3C98A 5EKQD 5JHBA 3MA5A 4YNDA 4GMLA 1Z3YA 1PY1A 2WXJA 4U04A 4FLBA 1N52A 2LAIA 4PS3A 3NQPA 4WUYA 3ZHEA 2A5UA 1E7UA 2AW6A 3FWVA 3L22A 2WXHA 2QFCA 3EIJA 4EBAG 1E90A 4I6EA 1HXIA 3I4GA 5AENA 4C0MA 3FTVA 3CHSA 2WXIA 5FQ7A 2R5SA 2BF0X 2FBNA 5LX8A 2IOSA 2V0PA 3URZA 3PH0C 5CHEE 3AU5A 3CHMA 4PDXA 4WNGA 3PNTB 4PUCA 3FFLA 1NA0A 4M3OA 3RRUA 1HX8A 3JCKC 1QZ2A 3QJZA 1E8XA 4K03A 3VLFA 4CGVA 4WWNA 1HG5A 4BT8A 3VTYA 3KAEA 4H7YA 3SI5A 4FADA 1HFAA 4N2QA 3T5XA 4C0EA 3OXFA 5M72A 3HYMB 4BWRA 4MKTA 2VYIA 3ESKA 1UJJA 4KMOA 4AV7A 4YVOA 3EJNA 2GGFA 2WM9A 1QQEA 2VSOE 3ONLA 1ELWA 4U63A 5FZQA 3FUMA 3TL5A 4KT6B 2L0IA 2VGYA 3FUJA 4AOFA 5CMWA 1E7VA 3FHEA 3VLEA 4GZ3A 4ACKA 5HQ8A 2CG3A 4XKCA 1UJKA 2LO6A 4DLQA 3R7RA 4F7AA 4GZDA 2PQNA 3P2BA 3D9JA 3QK0A 4OVUA 4G23A 3GZ1A 4L7TA 4Y6CA 2XCBA 3B13A 4AM9A 3FTUA 2DCPA 3WXXA 4N39A 3HHMA 2KZTA 2E2EA 4IULA 4XE0A 3QAQA 1JUQA 4UQZA 4H7XA 1Y8MA 5CMYA 2ILRA 5HI7A 3E4BA 4B8AA 2OVBA 1SZ9A 4JW1A 3SZ7A 4JL0A 2MRIA 3CKBA 5E75A 5LCWC 4NURA 2CFZA 4KBQA 1DVPA 4ILIA 3QNKA 4UWGA 2WXKA 1A17A 3U66A 3B7RL 3ZW3A 5J90A 2XPZA 3G2TA 4I6GA 1HG2A 2Y4TA 4I9CA 3ZYMA 3CLJA 2I9CA 4BTBA 3RO2A 4A3TA 2XGMA 4CT4A 3PDNA 3QDNA 3PS6A 4G1TA 5LCWJ 3EHMA 5BV0A 3KEZA 3LDZA 4GA2A 1E8YA 3R9AB 3D9MA 3FULA 4G24A 2AWIA 4I1AA 3ASFA 4ANWA 4UWFA 3ZRHA 1OWLA 2LNIA 3CK9A 4TRQA 2R59A 2BUGA 2IQCA 5BV1A 1SZAA 4J6IA 5DBKA 4Q96A 5FQ6A 4OYSA 3NZUA 4BY6A 5KJLA 3AS4A 3CVNA 4I6JA 2NXPA 1EF1C 2ONDA 2YQ8A 3G2SA 3I5PA 3ML9A 4FJZA 4GYYA 2XQ0A 1H0AA 4JZYA 4W9RA 3RO3A 2J49A 2L6JA 2XPYA 3O4ZA 3ZFWA 4JXTA 2I1JA 2X38A 3OTNA 2WXPA 3RRNB 3FEXA 5FJYA 2EQXA 3SD5A 3FUHA 3AS8A 3OXGA 5FZSA 5ARGA 3UMVA 4XKBA 3ML8A 3FUEA 3I4RB 4I1OB 1ZBPA 2KZTB 3B7UX 4U0UA 1Z3XA 2WMOA 3LJ3A 3FUDA 5FWQA 2IJGX 2J09A 4HLEA 2UY1B 3CVXA 4L2LA 3Q49B 1NA3A 3SGHA 4GCNA 1DNPA 4FHJA 4ILHB 3CK8A 3CHPA 4CDNA 3FH8A 1U3DA 2AVPA 2L9BA 2X6KA 3EIQC 3LXUX 2C0MA 3PEUB 4J8EA 2PZIA 3K9IA 5KJMA 3ULQA 2NSZA 1PC2A 2VTBB 2J9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4APO A;  2KC7 A;  4ABN A;  3MV2 B;  3S7J A;  2PQR A;  4GZ5 A;  3GW4 A;  3TGO A;  4XI0 A;  1ZU2 A;  2KAT A;  4GA0 A;  1HH8 A;  3MV3 B;  2C0L A;  1W3B A;  5G05 C;  4CGW A;  4HOS A;  3O48 A;  4ME2 A;  2KCV A;  4HOQ A;  3CK7 A;  2Q7F A;  2VSY A;  4AY6 A;  2HR2 A;  3KD7 A;  3S7D A;  5G05 J;  2Y4U A;  4JHR A;  4BT9 A;  3IEG A;  5CCL A;  3QKY A;  3TG4 A;  2HO1 A;  4B94 A;  5D0O D;  3SF4 A;  4EQF A;  5FTP A;  2LSU A;  1KT1 A;  3Q15 A;  3BEE A;  2JLB A;  2UY1 A;  3CV0 A;  2UWJ G;  4I2W A;  2I6H A;  1YA0 A;  4BTA A;  3LY8 A;  4N5C A;  3UUX A;  4IN3 B;  4N3B A;  4NRH B;  2KCL A;  1ELR A;  2MHK A;  3ZPJ A;  2FEZ A;  2XGO A;  4U0Z A;  1IYG A;  5AYW D;  4HOU A;  1XNF A;  5EX0 A;  4AY5 A;  4NQ0 A;  1KT0 A;  5JJT A;  2GW1 A;  3ZN3 A;  3LPZ A;  4O6F A;  3PE3 A;  3ASG A;  3QOU A;  4XIF A;  4G2V A;  5A6C A;  4N2S A;  4GA1 A;  5ARF A;  2FF4 A;  1FCH A;  4I2Z A;  4UI9 K;  4KXK B;  2FO7 A;  3ASH A;  5KJK A;  4KYO B;  3U3W A;  2NC9 A;  4AIF A;  4UQX A;  1E96 B;  4I9E A;  3CVL A;  3Q47 B;  3ASD A;  3FP3 A;  3ZGQ A;  4N3C A;  4U0S A;  1NZN A;  4WNF A;  4I17 A;  3PE4 A;  3CVQ A;  4Y6W A;  1B89 A;  4LEU A;  1WM5 A;  2VGX B;  3NF1 A;  3QWW A;  5C1D A;  2XCC A;  4G25 A;  3LKU A;  3JYS A;  4F3V A;  2C2L A;  5FT9 A;  1IHG A;  4U07 A;  3RU0 A;  2DBA A;  1TJC A;  2PL2 A;  4RG9 A;  3N71 A;  2P58 C;  4GZ6 A;  4JA7 A;  2VQ2 A;  5DIZ A;  3LY7 A;  5JJ6 A;  2LSV A;  5BNW A;  4WND A;  4HOR A;  2VSN A;  1HZ4 A;  1WAO 1;  4A1S A;  4J8D A;  2YHC A;  5BT1 A;  3RKV A;  2XGS A;  2WPV A;  3KS2 A;  4N3A A;  4J8F A;  2V5F A;  3QWV A;  4UQY A;  4JA9 A;  4XI9 A;  5BW8 C;  4HOT A;  3UQ3 A;  2VGX A;  3AS5 A;  3GYZ A;  3EDT B;  3CVP A;  1OUV A;  3MEK A;  3ZHE B;  3TAX A;  3RIB A;  3CEQ A;  2XEV A;  3QWP A;  3S7B A;  4CDR A;  5CCM A;  1KLX A;  3GZ2 A;  3Q4A B;  3Q5M A;  2XPI A;  3LY9 A;  5FZR A;  2KCK A;  3CKC A;  3OXL A;  4GPK A;  4GYO A;  2OOE A;  4J0U A;  4UI9 C;  4WNE A;  5A7D B;  2IF4 A;  5JJ7 A;  3RJV A;  5EX3 A;  5D0Q D;  4RG6 A;  5G04 C;  4UI9 J;  2WQH A;  4YVQ C;  4GYW A;  2HYZ A;  5KJN A;  4GCO A;  2FI7 A;  3VTX A;  3MKR A;  4G26 A;  3LCA A;  1P5Q A;  3TG5 A;  5G04 J;  3U4T A;  3LYA A;  3S7F A;  2IFU A;  3UPV A;  5EKQ D;  3MA5 A;  4YND A;  4U04 A;  4WUY A;  3ZHE A;  3FWV A;  2QFC A;  1HXI A;  2R5S A;  2FBN A;  3URZ A;  5CHE E;  4WNG A;  3FFL A;  1NA0 A;  1QZ2 A;  4CGV A;  4BT8 A;  3VTY A;  3KAE A;  4H7Y A;  4N2Q A;  3OXF A;  5M72 A;  3HYM B;  4BWR A;  2VYI A;  3ESK A;  4YVO A;  1QQE A;  1ELW A;  5FZQ A;  2VGY A;  5HQ8 A;  4GZ3 A;  2PQN A;  4G23 A;  3GZ1 A;  4Y6C A;  2XCB A;  4AM9 A;  3WXX A;  4N39 A;  2E2E A;  4UQZ A;  4H7X A;  1Y8M A;  5HI7 A;  3E4B A;  3SZ7 A;  4JL0 A;  3CKB A;  5LCW C;  4KBQ A;  1A17 A;  2Y4T A;  4I9C A;  4BTB A;  3RO2 A;  2XGM A;  3PDN A;  3QDN A;  4G1T A;  5LCW J;  4GA2 A;  3R9A B;  4G24 A;  4I1A A;  3ASF A;  3CK9 A;  2LNI A;  2BUG A;  5DBK A;  5KJL A;  3AS4 A;  3CVN A;  2OND A;  4GYY A;  2YQ8 A;  4W9R A;  3RO3 A;  2L6J A;  3ZFW A;  5FJY A;  3AS8 A;  3OXG A;  5FZS A;  5ARG A;  1ZBP A;  4U0U A;  2UY1 B;  3Q49 B;  1NA3 A;  4GCN A;  3CK8 A;  2AVP A;  2C0M A;  4J8E A;  2PZI A;  3K9I A;  5KJM A;  3ULQ A;  1PC2 A;  2J9Q A; 
#chains in the Genus database with same CATH topology
 3X2Q E;  1UOH A;  1WDY A;  4FC8 A;  5EYP F;  3FU5 A;  1HH8 A;  4CGW A;  5CED B;  2WB2 A;  4ME2 A;  2KCV A;  3Q73 A;  2KXP C;  1YMP A;  3KD7 A;  4APF A;  5G05 J;  4BX8 A;  4Q69 A;  3TXN A;  4JHR A;  3RAU A;  2P9L G;  1S64 A;  5CCL A;  4OAV B;  4B94 A;  3IHY A;  3SF4 A;  2LSU A;  3L6A A;  3PUJ A;  4I1M A;  3SFX A;  5AQ9 A;  2UY1 A;  2WXM A;  3CV0 A;  4I2W A;  2I6H A;  2F8Y A;  1BI8 B;  1YA0 A;  4OVV A;  4L23 A;  2LUH A;  3ZVV A;  3LY8 A;  3JUI A;  4FHK A;  2Y69 E;  3E33 A;  3UUX A;  1OXJ A;  2VTB A;  4NRH B;  3IXE A;  4DI3 A;  2MHK A;  1IQR A;  2XGO A;  3HXF A;  4HOU A;  2LAH A;  5LFA A;  2GW1 A;  4HXI A;  3LPZ A;  4YDE A;  4C9B B;  3PE3 A;  1IHB A;  4GTQ A;  3QOU A;  4GTO A;  5B3S E;  3CR3 A;  4XIF A;  2GRM A;  2IEJ A;  4NAC A;  4MS6 A;  2FF4 A;  4EHM A;  2ETA A;  4KXK B;  2FO7 A;  4TV3 A;  5KJK A;  1H6O A;  2NC9 A;  4IRU A;  4LCT A;  4GU5 A;  1TNY A;  1AWC B;  4LSZ E;  1MJ0 A;  5ENP D;  3C3O A;  2V4H C;  2X3M A;  3ASD A;  2ETC A;  3ZIM A;  3NBN B;  4U0S A;  3OAW A;  1NZN A;  4HB5 A;  3APC A;  4IYP A;  5G2N A;  2DZN A;  1B89 A;  2WQ7 A;  1WM5 A;  4CZ2 D;  1MHQ A;  3ZEF A;  3NF1 A;  1INZ A;  4RQI A;  4E6H A;  2DVW A;  2XCC A;  4G25 A;  1YYH A;  4Z68 A;  2RFM A;  2GRO B;  3Q7F A;  3UI2 A;  3SHF A;  2C2L A;  2R2L A;  1IHG A;  4U07 A;  3RU0 A;  2H6F A;  1H2U A;  1H6P A;  3HVE B;  3AG1 E;  4O60 A;  4BSX A;  3W9G A;  5DIZ A;  1YCS B;  2IOL A;  4JB8 P;  3ZXP A;  4E85 A;  5A23 A;  3G2W A;  4U8Y D;  4WND A;  3DPD A;  1TN6 A;  4DK5 A;  1HZ4 A;  2KM4 A;  1N0Q A;  3LS8 A;  3UM1 A;  2YHC A;  4DJA A;  3RK6 A;  3RKV A;  1IKN D;  1NFI E;  4J7W A;  3C3R A;  3PZ3 A;  1TNZ A;  3QWV A;  1OWP A;  3KEA A;  3UXG A;  4HOT A;  3UQ3 A;  3UKU G;  1OCC E;  3D9I A;  1HE8 A;  3MJW A;  4V3I A;  5B1B E;  3AG3 E;  1N11 A;  2V4L A;  2R17 C;  2J07 A;  3FU0 A;  3CEQ A;  5ENS D;  5G55 A;  2XEV A;  5C2Y A;  3QWP A;  3Q9N C;  1KLX A;  3HVE A;  3Q4A B;  2MYO A;  5ENO D;  3BG0 B;  3J5Q B;  5EDS A;  5FZR A;  3OXL A;  1LTX A;  1QNF A;  2OOE A;  3UM2 A;  4J0U A;  3EU9 A;  3L08 A;  3CVY A;  2ZU6 B;  3L9T A;  4BEP A;  5A7D B;  5JJ7 A;  2V8S E;  5D0Q D;  4HS2 A;  1K1B A;  1KZO A;  5HS0 A;  1HS6 A;  4FA6 A;  2FI7 A;  4JVS A;  3D9L A;  3LCA A;  1OCZ E;  2DZO A;  3UIP C;  2IFU A;  4ANX A;  4GML A;  1N52 A;  4WUY A;  2AW6 A;  3FWV A;  4B93 B;  3EIJ A;  4I6E A;  3I4G A;  4BER A;  3FTV A;  3CHS A;  2WXI A;  5FQ7 A;  2R5S A;  2JAB A;  5AQB A;  5CHE E;  3CHM A;  1S63 A;  5HKP A;  3DRA A;  4M3O A;  1HX8 A;  3QJZ A;  3SO8 A;  1E8X A;  3VLF A;  4CGV A;  1HFA A;  4N2Q A;  4C0E A;  5M72 A;  3HYM B;  4MKT A;  4HLL A;  4YVO A;  1QQE A;  1RW2 A;  3TL5 A;  4HQD A;  2L0I A;  3LJN A;  2LO6 A;  2RKK A;  2BKK B;  4L7T A;  2XCB A;  3WXX A;  4HRM B;  2KZT A;  4K5C A;  1K3Z D;  4HI9 A;  3DEP A;  2OVB A;  3CKB A;  4NUR A;  4KBQ A;  4ILI A;  2QYJ A;  2R03 A;  4I6G A;  1HG2 A;  1QBQ A;  3ZYM A;  5B1A E;  2XGM A;  5AQ7 A;  3PDN A;  3PS6 A;  2QZA A;  3R9A B;  4G24 A;  1V55 E;  2J8S D;  4HRL A;  5KJL A;  3AS4 A;  3CVN A;  2OND A;  3SBT B;  3G2S A;  4FJZ A;  2XQ0 A;  4JZY A;  3RO3 A;  2I1J A;  2X38 A;  2V5Q C;  3OTN A;  3FUH A;  5FZS A;  1N4R A;  3FUE A;  5CEA A;  2GRP B;  4I1O B;  3SFY A;  1ZBP A;  4U0U A;  4GTS A;  5AAR A;  3CVX A;  1QYM A;  3C5R A;  4FHJ A;  4ILH B;  4CDN A;  3FH8 A;  3LXU X;  2X6K A;  2PZI A;  3K9I A;  2RFA A;  2NSZ A;  3DWL G;  4APO A;  2KC7 A;  1NI1 A;  2PQR A;  3ZKJ A;  4GZ5 A;  3GW4 A;  3TGO A;  4MRU A;  3B7S A;  3CVU A;  5G05 C;  2WMN A;  3CK7 A;  3ASN E;  5T8I A;  2Q7F A;  4AY6 A;  2HM8 A;  4RVB A;  3TWU A;  2M63 A;  2Y4U A;  3L16 A;  5ITZ F;  1JPL A;  4ATZ D;  1E8W A;  3BQO A;  3IEG A;  3PZ2 A;  3Q75 A;  2KBX A;  1TN7 A;  2Y0B G;  5BUZ A;  2X6H A;  2XEH A;  3FUF A;  3QAR A;  5FTP A;  3ULE G;  4A55 A;  4LNG A;  4MBG A;  3Q15 A;  2WXQ A;  2AJA A;  4ANU A;  3PRZ A;  4FLH A;  3AG4 E;  1EPU A;  4EEC A;  3EUV A;  3DPY A;  4UWL A;  4BTA A;  4YDO A;  3MGB A;  2IU1 A;  1TNU A;  4R7L A;  5FQ8 A;  1K1A A;  2Y3A A;  4N3B A;  3L17 A;  2CHW A;  4A3V A;  3F6Q A;  1IYG A;  4AY5 A;  2A4Z A;  4O6F A;  3ASG A;  2JEK A;  1UN9 A;  1MX4 A;  5CRU A;  4GMR A;  4G2V A;  4NIK A;  5A6C A;  4N2S A;  3APD A;  2DYR E;  3DEO A;  3IKO B;  2XZD G;  5ARF A;  3SBS A;  3DST A;  4I2Z A;  3ASH A;  1MYO A;  3NZS A;  3PRE A;  3TWX A;  5ENN A;  4KYO B;  4QFV A;  4AIF A;  3V31 A;  1MX6 A;  4I9E A;  2OEV A;  3Q47 B;  3NAW A;  3FY4 A;  4N3C A;  4WNF A;  3AU4 A;  2HE0 A;  4KVO A;  4JD2 G;  3PE4 A;  4CT0 A;  4TXQ A;  2LXL A;  3FUK A;  2OVF A;  4JEU A;  4B0Z A;  2GRN B;  4QQI A;  3FTW A;  4TUM A;  2VGX B;  3QWW A;  5JA4 D;  5T4Y A;  2J08 A;  3QB2 A;  1SA4 A;  2XS1 A;  5D66 A;  4DUI A;  2DBA A;  5JMN D;  2PL2 A;  2L6B A;  2P9K G;  4DLO A;  4JA7 A;  3HXE A;  2VQ2 A;  4ACL A;  5BXO A;  2XRY A;  1N94 A;  3PZD A;  1LD7 A;  4WAF A;  4U96 D;  1KPS B;  3UIO C;  4LUN U;  4MLP A;  3ZNG A;  3PNL B;  3SQV A;  3VLD A;  4WWP A;  3KS2 A;  4J8F A;  4JPS A;  2V5F A;  2I1K A;  1E8Z A;  4XI9 A;  3QC1 A;  2VGX A;  3AS5 A;  2WXL A;  1X81 A;  3ZHE B;  2DWZ A;  1HF8 A;  3S2A A;  2RG8 A;  3TWT A;  3ZYL A;  3R9M A;  1AP7 A;  1DC2 A;  3IHV A;  2YNQ A;  4LER A;  3Q5M A;  3FTX A;  2Y1L E;  2KCK A;  3CKC A;  4GYO A;  5CRV A;  3V30 A;  4HFG A;  4LRZ A;  4AVX A;  3DSV A;  1G3N B;  5EX3 A;  5FQ4 A;  4RLY A;  3SNX A;  4RG6 A;  1SQM A;  4UI9 J;  4YVQ C;  2YIN A;  1UN8 A;  4JHJ A;  4GCO A;  3FU6 A;  5LOZ A;  2MOW A;  3TWQ A;  5AAO A;  2CG2 A;  3FU3 A;  5G04 J;  1BI7 B;  3SFZ A;  2PNN A;  2CHZ A;  3C98 A;  1S70 B;  1Z3Y A;  4PS3 A;  3NQP A;  3ULY A;  3ZHE A;  1E7U A;  4DX5 D;  2R02 A;  5EIL A;  2BED A;  3URZ A;  4PDX A;  3PNT B;  1K8K G;  3FFL A;  1NA0 A;  2OEW A;  1HG5 A;  4BT8 A;  1U2V G;  3KAE A;  2VYI A;  3EJN A;  5ENT D;  2WM9 A;  5FZQ A;  5HQ8 A;  3VLE A;  1SVX A;  4F7A A;  4GZD A;  3B13 A;  3JXJ A;  3FTU A;  2DCP A;  5H7P A;  4UQZ A;  4H7X A;  5CMY A;  5HI7 A;  3SZ7 A;  5CER B;  2XZT G;  2CFZ A;  4UWG A;  3B7R L;  3ZW3 A;  2B0O E;  3HRA A;  3CLJ A;  4BTB A;  3QDN A;  5KBA A;  5LCW J;  3LDZ A;  4GA2 A;  1DCE A;  3D9M A;  3FUL A;  4ANW A;  4UWF A;  1OWL A;  3CK9 A;  2R59 A;  5BV1 A;  1SZA A;  4M7C A;  5DBK A;  5FQ6 A;  3V2O A;  4I6J A;  4GYY A;  2NXP A;  2YQ8 A;  3I5P A;  4W9R A;  1RZ4 A;  2L6J A;  4OAU C;  3W9F A;  3ISM C;  3SD5 A;  3UMV A;  4TXR A;  5KNH D;  2KZT B;  3FUD A;  3KSL A;  2IJG X;  2J09 A;  5FIO A;  3SGH A;  3CK8 A;  2AVP A;  2C0M A;  2ZIR A;  3ULQ A;  4ZHB A;  4ABN A;  3MV2 B;  3JXI A;  2QY7 A;  2EIL E;  1OWO A;  3MV3 B;  4HOS A;  3O48 A;  1H19 A;  1LD8 A;  3FTS A;  2EIN E;  2I2O A;  2X6I A;  3D9N A;  4KVM A;  4DI4 A;  3UM3 A;  3BG1 B;  3RSE G;  4HI8 A;  3MCX A;  2XS8 A;  2IO2 C;  3LVQ E;  1FPP A;  2BKG A;  3MX3 A;  2WXO A;  4URK A;  1HU3 A;  3QKY A;  5ENR D;  2GRQ B;  4EQF A;  1FVF A;  2F37 A;  4DX1 A;  1KT1 A;  2FUL A;  2JLB A;  2UWJ G;  4GTP A;  3UT7 A;  4F1S A;  4N5C A;  2P9U G;  2FEZ A;  4U0Z A;  1XNF A;  5EX0 A;  4NQ0 A;  1KT0 A;  3IBE A;  2PM7 A;  3ZN3 A;  4UUC A;  3ZXS A;  3PZ4 A;  5AIJ A;  5KCM A;  4I43 A;  5AJL A;  5EIB E;  1JWG A;  4JC8 A;  4GA1 A;  1Z6T A;  3EU5 A;  3MYV A;  1H2V C;  4B89 A;  2ZIS A;  2ZGD A;  2EIK E;  4GB9 A;  3U64 A;  4JHK A;  1E96 B;  4U95 D;  3ZGQ A;  3C3Q A;  4FP7 A;  5KWD A;  5EN5 D;  3JUE A;  3CVQ A;  3APF A;  3E37 A;  4Y6W A;  3FH7 A;  1DCQ A;  1TEZ A;  4U8H A;  4LEU A;  4CYM D;  5BPP A;  4Q94 A;  3Q9U C;  5CBO A;  3D9O A;  3LKU A;  2WVI A;  3JYS A;  3MZL B;  4F53 A;  4F3V A;  1HO8 A;  2X6J A;  4B8C B;  5FT9 A;  3ZU7 B;  4DRX E;  2J4B A;  2P9P G;  3GZS A;  1JCQ A;  3IV0 A;  1KZP A;  3N71 A;  4UWK A;  5ENQ D;  3G2U A;  2QYU A;  2A5E A;  1D8E A;  3FDH A;  4U8V D;  2LSV A;  1EYH A;  4RSY A;  1FVH A;  1N0R A;  4FU3 A;  2VSN A;  1S0P A;  4CRW A;  4BET A;  1WAO 1;  3HXD A;  4P29 A;  4A1S A;  1LF8 A;  3FTY A;  3L13 A;  5BT1 A;  4XX5 A;  2PM6 A;  5KNG A;  2WPV A;  3ONK A;  3ZYK A;  2P9N G;  3T5V A;  4G11 A;  3CGH A;  3HIZ A;  1L5J A;  3FUI A;  4ATG A;  4UQY A;  4JA9 A;  1U3C A;  4C48 B;  2L0T B;  4D10 C;  3GYZ A;  4DX6 D;  5AJD A;  4EZJ A;  3LVR E;  3MEK A;  4U7E B;  2VSX E;  4YDY A;  1V54 E;  3P1U A;  1TJF A;  5BXU A;  3RIB A;  4ZFH A;  2AXV A;  4JEH A;  5ANR A;  1BLX B;  2J4D A;  2WXF A;  2P2C P;  4UWH A;  4CDR A;  4DPR A;  1O1R A;  2GRL A;  3GZ2 A;  3SY2 A;  5J08 A;  4KZ0 A;  3LY9 A;  1MX2 A;  2WQ6 A;  2IY0 C;  1N4P A;  4K0R A;  4UI9 C;  4AEZ C;  4WNE A;  1EDU A;  4CCA A;  3EHQ A;  3CHO A;  3LEW A;  4GTV A;  3ABM E;  1N54 A;  5G04 C;  1TN8 A;  2WQH A;  1O1T A;  4J8Y A;  2HYZ A;  5KJN A;  3L82 A;  3FEY A;  4GAA A;  3VTX A;  3FH5 A;  3NOC D;  1VDY A;  3MKR A;  4L9P A;  2WXN A;  4EBA A;  4WWO A;  3TG5 A;  1UG3 A;  2RD0 A;  2XEN A;  4XEI G;  3S7F A;  3UPV A;  3D3M A;  3UKR G;  1BD8 A;  5JHB A;  3HXB A;  4TXP A;  2WXJ A;  4FLB A;  2LAI A;  2A5U A;  3E34 A;  2QFC A;  1HXI A;  5AEN A;  4C0M A;  3BUA A;  2FBN A;  5LX8 A;  3AU5 A;  4WNG A;  1N95 A;  3DSW A;  4WWN A;  4DX7 D;  3VTY A;  4H7Y A;  3SI5 A;  4FAD A;  3T5X A;  4F6R D;  4BWR A;  3ESK A;  1UJJ A;  4KMO A;  4AV7 A;  2GGF A;  1WG0 A;  2ETB A;  3FUJ A;  4GZ3 A;  4XKC A;  1UJK A;  3R7R A;  4OVU A;  3GZ1 A;  1TYQ G;  4Y6C A;  4N39 A;  4IUL A;  4XE0 A;  2P9S G;  3Q78 A;  1Y8M A;  2ILR A;  2EIM E;  3DSS A;  4JL0 A;  5LCW C;  2WXK A;  1N4Q A;  2OCC E;  4I9C A;  2I9C A;  4K5B A;  3EHM A;  5BV0 A;  2AWI A;  4I1A A;  3ASF A;  1O1S A;  2LNI A;  3ZUV B;  4OYS A;  2R05 A;  4BY6 A;  1D9S A;  1N9A A;  3HXC A;  1EF1 C;  3ML9 A;  3O4Z A;  2LXM A;  4JXT A;  1A5E A;  2WXP A;  3RRN B;  3FEX A;  3AS8 A;  3OXG A;  2B6C A;  2H6G A;  4XKB A;  3D9H A;  3B7U X;  1BU9 A;  1Z3X A;  1OCO E;  3LJ3 A;  3ABK E;  4L2L A;  1NA3 A;  3UIN C;  1FT2 A;  3CHP A;  2L9B A;  5KJM A;  2J9Q A;  2BTD A;  3S7J A;  3V2X A;  1TNO A;  4BFR A;  4XI0 A;  1ZU2 A;  1NL4 A;  3E32 A;  2KAT A;  4GA0 A;  4GTT A;  5D2M C;  2VGE A;  3DXM G;  2C0L A;  1W3B A;  4G8K A;  3DBS A;  1H6K A;  3CVW A;  3CST A;  4HRN A;  3CHR A;  4HOQ A;  2VSY A;  2HR2 A;  1MQS A;  5ANL A;  4L1B A;  1H2T C;  2VJ8 A;  3S7D A;  1GW6 A;  4BT9 A;  2DIW A;  4CEM A;  4LNB A;  4EPZ A;  4GTM A;  5LP0 A;  4A63 B;  4AXH A;  3EHR A;  2CFU A;  1UW4 B;  3TG4 A;  4O1O A;  2HO1 A;  3EHN A;  5D0O D;  5EID A;  3TJP A;  1JCR A;  1IQU A;  3V79 K;  1TR4 A;  4K5A B;  1OWN A;  3I3N A;  4X8Q A;  3BEE A;  1N4S A;  3PVL A;  2CHX A;  3DSX A;  2WXR A;  4TUU A;  1NP7 A;  4IN3 B;  1PAQ A;  3HG0 D;  2ZGG A;  2KCL A;  1ELR A;  3ZPJ A;  3UT4 A;  3TWS A;  4GPM A;  5AYW D;  5JJT A;  4CDM A;  2ZXW E;  4EZL A;  3FUN A;  4PS7 A;  4A1G A;  5FIN A;  3Q79 A;  4GZC A;  5E76 A;  3UX4 A;  4XZ4 A;  3FTZ A;  2XRZ A;  2IO3 C;  1FCH A;  4LG6 A;  4UI9 K;  2GRR B;  3HDX A;  3NB2 A;  1OWM A;  3U3W A;  2AXZ A;  4ILG A;  4PH4 B;  3T8M A;  3R7Q A;  2EIJ E;  4UQX A;  2H6I A;  4GMJ A;  1JWF A;  3CVL A;  3FP3 A;  3CVV A;  4KZC A;  2XEE A;  4I17 A;  1JCS A;  3NOG D;  1XGW A;  3CHQ A;  5HRY A;  3TWV A;  5T3R A;  3B95 A;  3CQC B;  4G8L A;  5C1D A;  4YDW A;  4GTR A;  4BSZ B;  1MZC A;  4PS8 A;  3ZYQ A;  3U9W A;  1WY6 A;  1D8D A;  1Y6I A;  1TJC A;  3J5P A;  4RG9 A;  2P58 C;  3B7T A;  3G2V A;  4BX9 A;  4GZ6 A;  4O1P A;  2FO1 E;  3LY7 A;  3UM0 A;  3TXM A;  3ESL A;  4AJW A;  5JJ6 A;  3T9K A;  3PUK A;  3MKQ B;  4L2Y A;  2OV8 A;  5BNW A;  4DX2 A;  5AN8 A;  4HOR A;  3ASO E;  3D9K A;  3JQ0 A;  2H6H A;  2XHE A;  2X6F A;  1O5M A;  3ENE A;  3CSF A;  4J8D A;  2XGS A;  4FUL A;  3JQ1 A;  4N3A A;  3RRM B;  3AG2 E;  3E30 A;  5BW8 C;  1X5B A;  3C72 A;  4EZK A;  2WXG A;  5JHA A;  3EDT B;  3CVP A;  1OUV A;  3TAX A;  2QC9 A;  3CIA A;  4FJY A;  4HVB A;  4AP2 A;  1OY3 D;  2NYJ A;  3S7B A;  5CCM A;  2XPI A;  1BPO A;  3D9P A;  5EYL A;  1Z5S C;  5AQA A;  4GPK A;  2F0Y A;  3MKQ A;  3L54 A;  2IF4 A;  2AXU A;  3RJV A;  3UT8 A;  4J8S A;  3T8K A;  3PEV B;  3CQG B;  4ANV A;  3KSQ A;  2E0I A;  4GYW A;  4G26 A;  3B7B A;  1P5Q A;  3U4T A;  3LYA A;  3TWR A;  2ION A;  2YHE A;  3WG7 E;  1ELK A;  5EKQ D;  3MA5 A;  4YND A;  1PY1 A;  4U04 A;  2DYS E;  1SA5 A;  3Q7A A;  1Q2Z A;  3L22 A;  2WXH A;  4EBA G;  1E90 A;  3UTM A;  3PZ1 A;  2BF0 X;  3ABL E;  2IOS A;  2V0P A;  4F1P A;  3PH0 C;  4PUC A;  1ZB1 A;  3RRU A;  3JCK C;  1QZ2 A;  5CEC B;  4K03 A;  3DXK G;  3OXF A;  4HBD A;  3TWW A;  3DSU A;  2VSO E;  3ONL A;  1ELW A;  4U63 A;  3FUM A;  4KT6 B;  2VGY A;  4AOF A;  5CMW A;  4N5Q A;  1TNB A;  1E7V A;  3FHE A;  4ACK A;  2CG3 A;  4DLQ A;  2PQN A;  3P2B A;  3D9J A;  3QK0 A;  4G23 A;  3BU8 A;  5IY5 E;  4AM9 A;  3HHM A;  2E2E A;  3QAQ A;  1JUQ A;  3E4B A;  4B8A A;  1SZ9 A;  4JW1 A;  2MRI A;  5E75 A;  5CBN A;  1DVP A;  3QNK A;  1A17 A;  3U66 A;  5J90 A;  2XPZ A;  3G2T A;  2Y4T A;  2F8X K;  3RO2 A;  4A3T A;  4CT4 A;  4G1T A;  3KEZ A;  1E8Y A;  3ZRH A;  4TRQ A;  2BUG A;  2IQC A;  4J6I A;  4Q96 A;  3NZU A;  4LNU D;  1IXV A;  1H0A A;  2J49 A;  3AJI A;  2XPY A;  3ZFW A;  3AAA C;  4HNA D;  5FJY A;  2EQX A;  5ARG A;  3ML8 A;  1FT1 A;  3I4R B;  2WMO A;  5FWQ A;  4HLE A;  2UY1 B;  1OT8 A;  3Q49 B;  4GCN A;  1DNP A;  4BES A;  1U3D A;  3EIQ C;  1OCR E;  3PEU B;  4J8E A;  2P9I G;  2VTB B;  1PC2 A;  1SW6 A; 
#chains in the Genus database with same CATH homology
 4APO A;  2BTD A;  2KC7 A;  4ABN A;  3MV2 B;  3S7J A;  2PQR A;  4FC8 A;  3GW4 A;  4GZ5 A;  4BFR A;  3TGO A;  4MRU A;  4XI0 A;  1ZU2 A;  2KAT A;  2QY7 A;  1HH8 A;  3B7S A;  3FU5 A;  4GA0 A;  1OWO A;  3MV3 B;  3CVU A;  2C0L A;  1W3B A;  5G05 C;  4CGW A;  4HOS A;  3DBS A;  1H6K A;  3CVW A;  2WB2 A;  3CST A;  3O48 A;  2WMN A;  3CHR A;  4ME2 A;  1H19 A;  2KCV A;  4HOQ A;  3FTS A;  3CK7 A;  5T8I A;  2I2O A;  2Q7F A;  2VSY A;  2X6I A;  2HR2 A;  4AY6 A;  2HM8 A;  1MQS A;  3D9N A;  4RVB A;  5ANL A;  3KD7 A;  4KVM A;  4L1B A;  1H2T C;  4DI4 A;  2VJ8 A;  3S7D A;  3BG1 B;  4APF A;  5G05 J;  4BX8 A;  4Q69 A;  1GW6 A;  2M63 A;  3TXN A;  2Y4U A;  4JHR A;  3L16 A;  4BT9 A;  3MCX A;  1JPL A;  2DIW A;  4CEM A;  1E8W A;  3LVQ E;  4EPZ A;  3IEG A;  5LP0 A;  3MX3 A;  2WXO A;  5CCL A;  4URK A;  1HU3 A;  3QKY A;  4AXH A;  2CFU A;  5BUZ A;  1UW4 B;  3TG4 A;  2X6H A;  2HO1 A;  4B94 A;  3IHY A;  3EHN A;  5D0O D;  3TJP A;  3SF4 A;  4EQF A;  3FUF A;  3QAR A;  1IQU A;  5FTP A;  2LSU A;  1FVF A;  3L6A A;  4A55 A;  1KT1 A;  3PUJ A;  4I1M A;  3Q15 A;  2WXQ A;  1OWN A;  3I3N A;  2FUL A;  3BEE A;  2JLB A;  4ANU A;  3PRZ A;  2UY1 A;  4FLH A;  2WXM A;  1EPU A;  4EEC A;  3CV0 A;  2UWJ G;  4I2W A;  2I6H A;  3PVL A;  2CHX A;  4UWL A;  1YA0 A;  4OVV A;  4L23 A;  3ZVV A;  4BTA A;  3MGB A;  2IU1 A;  3UT7 A;  5FQ8 A;  3LY8 A;  3JUI A;  4FHK A;  4R7L A;  4F1S A;  2WXR A;  2Y3A A;  4N5C A;  4TUU A;  1NP7 A;  4IN3 B;  1PAQ A;  4N3B A;  3UUX A;  2VTB A;  3L17 A;  4NRH B;  2KCL A;  4DI3 A;  1ELR A;  2CHW A;  2MHK A;  2FEZ A;  1IQR A;  2XGO A;  3UT4 A;  3ZPJ A;  4A3V A;  4U0Z A;  1IYG A;  5AYW D;  4HOU A;  1XNF A;  5EX0 A;  4AY5 A;  2LAH A;  1KT0 A;  3IBE A;  2A4Z A;  4NQ0 A;  5JJT A;  5LFA A;  4CDM A;  2PM7 A;  2GW1 A;  4HXI A;  3ZN3 A;  4EZL A;  3LPZ A;  4C9B B;  4O6F A;  3PE3 A;  3FUN A;  3ASG A;  4PS7 A;  2JEK A;  4A1G A;  3QOU A;  3ZXS A;  1UN9 A;  3CR3 A;  4GZC A;  4XIF A;  5E76 A;  5KCM A;  4G2V A;  3UX4 A;  5AIJ A;  3SBT B;  5A6C A;  4XZ4 A;  2GRM A;  3FTZ A;  4I43 A;  4N2S A;  3APD A;  5AJL A;  1JWG A;  4NAC A;  4JC8 A;  4GA1 A;  3IKO B;  2XRZ A;  1Z6T A;  4MS6 A;  5ARF A;  2FF4 A;  3SBS A;  1FCH A;  4I2Z A;  4UI9 K;  4KXK B;  2FO7 A;  3ASH A;  3MYV A;  1H2V C;  3HDX A;  3NZS A;  4TV3 A;  4B89 A;  3PRE A;  5KJK A;  5ENN A;  1OWM A;  4KYO B;  3U3W A;  2NC9 A;  4IRU A;  4LCT A;  4GU5 A;  2AXZ A;  4ILG A;  4PH4 B;  4QFV A;  4AIF A;  4GB9 A;  3T8M A;  3U64 A;  3R7Q A;  4UQX A;  4JHK A;  1E96 B;  4I9E A;  4GMJ A;  1JWF A;  3CVL A;  3Q47 B;  2X3M A;  3ASD A;  3FP3 A;  3ZGQ A;  3FY4 A;  3ZIM A;  4N3C A;  3CVV A;  4KZC A;  4FP7 A;  4U0S A;  3OAW A;  1NZN A;  4WNF A;  4I17 A;  3AU4 A;  4KVO A;  3PE4 A;  4CT0 A;  1XGW A;  3CHQ A;  3CVQ A;  3APF A;  3APC A;  3FH7 A;  4IYP A;  4Y6W A;  3FUK A;  5G2N A;  1TEZ A;  1B89 A;  4U8H A;  2OVF A;  4JEU A;  4LEU A;  4B0Z A;  2WQ7 A;  1WM5 A;  3FTW A;  5T3R A;  1MHQ A;  3ZEF A;  2VGX B;  3NF1 A;  3CQC B;  5BPP A;  4Q94 A;  3QWW A;  1INZ A;  5C1D A;  4E6H A;  5T4Y A;  2J08 A;  3D9O A;  3QB2 A;  2XCC A;  4G25 A;  3LKU A;  2WVI A;  3JYS A;  3MZL B;  4F53 A;  4PS8 A;  3SHF A;  4F3V A;  1HO8 A;  2X6J A;  4B8C B;  2C2L A;  3ZYQ A;  5FT9 A;  1IHG A;  4U07 A;  3U9W A;  1WY6 A;  3RU0 A;  2DBA A;  1Y6I A;  1TJC A;  1H2U A;  2J4B A;  3GZS A;  2PL2 A;  3IV0 A;  3HVE B;  4RG9 A;  3N71 A;  2P58 C;  3B7T A;  4UWK A;  3G2V A;  4BX9 A;  4GZ6 A;  4DLO A;  4JA7 A;  4BSX A;  3G2U A;  2VQ2 A;  5DIZ A;  3LY7 A;  2IOL A;  4ACL A;  3TXM A;  2XRY A;  3ESL A;  4AJW A;  5JJ6 A;  3FDH A;  3PUK A;  4E85 A;  5A23 A;  3MKQ B;  3PZD A;  4L2Y A;  2LSV A;  2OV8 A;  1EYH A;  3G2W A;  4WAF A;  5BNW A;  4WND A;  4HOR A;  4RSY A;  3DPD A;  1FVH A;  4LUN U;  3D9K A;  4FU3 A;  2VSN A;  4MLP A;  1S0P A;  4DK5 A;  3JQ0 A;  4CRW A;  1HZ4 A;  2XHE A;  2X6F A;  1WAO 1;  2KM4 A;  4P29 A;  4A1S A;  3ENE A;  3LS8 A;  3PNL B;  3CSF A;  1LF8 A;  4J8D A;  2YHC A;  4DJA A;  3FTY A;  3L13 A;  5BT1 A;  4XX5 A;  2PM6 A;  3RK6 A;  3VLD A;  3RKV A;  2XGS A;  2WPV A;  3ONK A;  4FUL A;  4WWP A;  3KS2 A;  3ZYK A;  3JQ1 A;  4N3A A;  4J8F A;  3T5V A;  4JPS A;  2V5F A;  4G11 A;  3CGH A;  2I1K A;  3HIZ A;  1L5J A;  3FUI A;  3RRM B;  4ATG A;  3QWV A;  1OWP A;  4UQY A;  1E8Z A;  4JA9 A;  4XI9 A;  1U3C A;  5BW8 C;  1X5B A;  4HOT A;  3UQ3 A;  3QC1 A;  3D9I A;  4EZK A;  2L0T B;  2VGX A;  1HE8 A;  3AS5 A;  2WXG A;  3MJW A;  4D10 C;  3GYZ A;  4V3I A;  5JHA A;  5AJD A;  3EDT B;  4EZJ A;  3CVP A;  2WXL A;  1OUV A;  3LVR E;  3MEK A;  3ZHE B;  1HF8 A;  2VSX E;  3TAX A;  3P1U A;  3S2A A;  1TJF A;  3CIA A;  2V4L A;  2RG8 A;  4FJY A;  2R17 C;  3RIB A;  3ZYL A;  2J07 A;  2AXV A;  3FU0 A;  4AP2 A;  3CEQ A;  4JEH A;  4HVB A;  5ANR A;  5G55 A;  2XEV A;  5C2Y A;  3QWP A;  2J4D A;  2WXF A;  4UWH A;  3S7B A;  3IHV A;  2YNQ A;  4CDR A;  4LER A;  2GRL A;  1KLX A;  3GZ2 A;  3HVE A;  4DPR A;  5CCM A;  3Q4A B;  3Q5M A;  3BG0 B;  3FTX A;  5J08 A;  2XPI A;  4KZ0 A;  1BPO A;  3LY9 A;  3D9P A;  5EDS A;  5FZR A;  2KCK A;  3CKC A;  3OXL A;  1QNF A;  4GPK A;  4GYO A;  2WQ6 A;  2OOE A;  4J0U A;  3MKQ A;  4HFG A;  4K0R A;  4UI9 C;  3L08 A;  4AEZ C;  3CVY A;  2ZU6 B;  4WNE A;  4LRZ A;  3L54 A;  4AVX A;  1EDU A;  5A7D B;  4CCA A;  2IF4 A;  3CHO A;  2AXU A;  3LEW A;  5JJ7 A;  2V8S E;  3RJV A;  5EX3 A;  5FQ4 A;  5D0Q D;  4HS2 A;  3UT8 A;  4J8S A;  3SNX A;  4RG6 A;  3PEV B;  1SQM A;  1N54 A;  5G04 C;  3CQG B;  4UI9 J;  4ANV A;  2E0I A;  2WQH A;  4YVQ C;  2YIN A;  1HS6 A;  4GYW A;  4FA6 A;  1UN8 A;  2HYZ A;  4JHJ A;  5KJN A;  3FEY A;  4GCO A;  2FI7 A;  4GAA A;  3FU6 A;  3VTX A;  3FH5 A;  4JVS A;  5LOZ A;  2MOW A;  3D9L A;  1VDY A;  3MKR A;  3LCA A;  4G26 A;  2CG2 A;  1P5Q A;  2WXN A;  3FU3 A;  4EBA A;  4WWO A;  3TG5 A;  5G04 J;  3U4T A;  1UG3 A;  2RD0 A;  3LYA A;  3S7F A;  3SFZ A;  2ION A;  2YHE A;  2IFU A;  3UPV A;  1ELK A;  3D3M A;  2CHZ A;  4ANX A;  3C98 A;  5EKQ D;  5JHB A;  3MA5 A;  4YND A;  4GML A;  1Z3Y A;  1PY1 A;  2WXJ A;  4U04 A;  4FLB A;  1N52 A;  2LAI A;  4PS3 A;  3NQP A;  4WUY A;  3ZHE A;  2A5U A;  1E7U A;  2AW6 A;  3FWV A;  3L22 A;  2WXH A;  2QFC A;  3EIJ A;  4EBA G;  1E90 A;  4I6E A;  1HXI A;  3I4G A;  5AEN A;  4C0M A;  3FTV A;  3CHS A;  2WXI A;  5FQ7 A;  2R5S A;  2BF0 X;  2FBN A;  5LX8 A;  2IOS A;  2V0P A;  3URZ A;  3PH0 C;  5CHE E;  3AU5 A;  3CHM A;  4PDX A;  4WNG A;  3PNT B;  4PUC A;  3FFL A;  1NA0 A;  4M3O A;  3RRU A;  1HX8 A;  3JCK C;  1QZ2 A;  3QJZ A;  1E8X A;  4K03 A;  3VLF A;  4CGV A;  4WWN A;  1HG5 A;  4BT8 A;  3VTY A;  3KAE A;  4H7Y A;  3SI5 A;  4FAD A;  1HFA A;  4N2Q A;  3T5X A;  4C0E A;  3OXF A;  5M72 A;  3HYM B;  4BWR A;  4MKT A;  2VYI A;  3ESK A;  1UJJ A;  4KMO A;  4AV7 A;  4YVO A;  3EJN A;  2GGF A;  2WM9 A;  1QQE A;  2VSO E;  3ONL A;  1ELW A;  4U63 A;  5FZQ A;  3FUM A;  3TL5 A;  4KT6 B;  2L0I A;  2VGY A;  3FUJ A;  4AOF A;  5CMW A;  1E7V A;  3FHE A;  3VLE A;  4GZ3 A;  4ACK A;  5HQ8 A;  2CG3 A;  4XKC A;  1UJK A;  2LO6 A;  4DLQ A;  3R7R A;  4F7A A;  4GZD A;  2PQN A;  3P2B A;  3D9J A;  3QK0 A;  4OVU A;  4G23 A;  3GZ1 A;  4L7T A;  4Y6C A;  2XCB A;  3B13 A;  4AM9 A;  3FTU A;  2DCP A;  3WXX A;  4N39 A;  3HHM A;  2KZT A;  2E2E A;  4IUL A;  4XE0 A;  3QAQ A;  1JUQ A;  4UQZ A;  4H7X A;  1Y8M A;  5CMY A;  2ILR A;  5HI7 A;  3E4B A;  4B8A A;  2OVB A;  1SZ9 A;  4JW1 A;  3SZ7 A;  4JL0 A;  2MRI A;  3CKB A;  5E75 A;  5LCW C;  4NUR A;  2CFZ A;  4KBQ A;  1DVP A;  4ILI A;  3QNK A;  4UWG A;  2WXK A;  1A17 A;  3U66 A;  3B7R L;  3ZW3 A;  5J90 A;  2XPZ A;  3G2T A;  4I6G A;  1HG2 A;  2Y4T A;  4I9C A;  3ZYM A;  3CLJ A;  2I9C A;  4BTB A;  3RO2 A;  4A3T A;  2XGM A;  4CT4 A;  3PDN A;  3QDN A;  3PS6 A;  4G1T A;  5LCW J;  3EHM A;  5BV0 A;  3KEZ A;  3LDZ A;  4GA2 A;  1E8Y A;  3R9A B;  3D9M A;  3FUL A;  4G24 A;  2AWI A;  4I1A A;  3ASF A;  4ANW A;  4UWF A;  3ZRH A;  1OWL A;  2LNI A;  3CK9 A;  4TRQ A;  2R59 A;  2BUG A;  2IQC A;  5BV1 A;  1SZA A;  4J6I A;  5DBK A;  4Q96 A;  5FQ6 A;  4OYS A;  3NZU A;  4BY6 A;  5KJL A;  3AS4 A;  3CVN A;  4I6J A;  2NXP A;  1EF1 C;  2OND A;  2YQ8 A;  3G2S A;  3I5P A;  3ML9 A;  4FJZ A;  4GYY A;  2XQ0 A;  1H0A A;  4JZY A;  4W9R A;  3RO3 A;  2J49 A;  2L6J A;  2XPY A;  3O4Z A;  3ZFW A;  4JXT A;  2I1J A;  2X38 A;  3OTN A;  2WXP A;  3RRN B;  3FEX A;  5FJY A;  2EQX A;  3SD5 A;  3FUH A;  3AS8 A;  3OXG A;  5FZS A;  5ARG A;  3UMV A;  4XKB A;  3ML8 A;  3FUE A;  3I4R B;  4I1O B;  1ZBP A;  2KZT B;  3B7U X;  4U0U A;  1Z3X A;  2WMO A;  3LJ3 A;  3FUD A;  5FWQ A;  2IJG X;  2J09 A;  4HLE A;  2UY1 B;  3CVX A;  4L2L A;  3Q49 B;  1NA3 A;  3SGH A;  4GCN A;  1DNP A;  4FHJ A;  4ILH B;  3CK8 A;  3CHP A;  4CDN A;  3FH8 A;  1U3D A;  2AVP A;  2L9B A;  2X6K A;  3EIQ C;  3LXU X;  2C0M A;  3PEU B;  4J8E A;  2PZI A;  3K9I A;  5KJM A;  3ULQ A;  2NSZ A;  1PC2 A;  2VTB B;  2J9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...