4JHRA

An auto-inhibited conformation of lgn reveals a distinct interaction mode between goloco motifs and tpr motifs
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
305
structure length
290
Chain Sequence
NFDEAIVCCQRHLDISRELNDKVGEARALYNLGNVYHAKGKSEDVRNALQAAVDLYEENLSLVTALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELKDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGDLEVLFPPDEDFFDILVKCQGSRLDDQRCAPPSAATKGPTVPDEDFFSLILRSQAKRMDEQRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G-protein-signaling modulator 2
publication title An autoinhibited conformation of LGN reveals a distinct interaction mode between GoLoco motifs and TPR motifs
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 119
structure length 290
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02188 GoLoco GoLoco motif
A PF13176 TPR_7 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4jhrA00
4RG9A 3S7FA 3Q5MA 5JJTA 2UY1A 4AY5A 3K9IA 2ONDA 1HZ4A 1ZBPA 3FP3A 3ASHA 4WUYA 2IFUA 3VTYA 1HH8A 5FJYA 4AY6A 4G1TA 1OUVA 1KT0A 3N71A 3S7JA 3RJVA 4GCOA 4H7XA 3NF1A 4CDRA 5FZSA 4A1SA 2V5FA 3MKRA 4N3AA 1NA3A 3PE4A 2FEZA 4Y6CA 1TJCA 1QZ2A 2FF4A 2UY1B 5CCMA 4APOA 4N3BA 2Y4UA 4YVOA 4U07A 5ARFA 5ARGA 4JA9A 5FT9A 2BUGA 3RU0A 4G25A 4UQYA 4BT8A 1KT1A 4RG6A 2C0MA 2LSVA 3RO2A 4WNDA 5JJ6A 2LSUA 5D0OD 4G26A 2PQRA 3U4TA 3QDNA 3ZPJA 2XGOA 3URZA 3GZ2A 4U0UA 4O6FA 2FI7A 2KATA 2KCVA 3U3WA 3CV0A 4I2ZA 4N39A 4BWRA 2JLBA 2Q7FA 4J8EA 4U0SA 5FTPA 2KC7A 4NRHB 1PC2A 4XIFA 4G2VA 1NZNA 2PL2A 4N2QA 2GW1A 3FWVA 4I1AA 2WPVA 5DIZA 5KJLA 3KAEA 4GA1A 4HOQA 4WNGA 1W3BA 4HOSA 3CVPA 4GYWA 1FCHA 3OXFA 3OXGA 4ABNA 2VSNA 1KLXA 5KJKA 5D0QD 3PDNA 5JJ7A 2XGSA 4J8DA 4N2SA 2LNIA 3SF4A 2XEVA 2OOEA 4GYYA 3RO3A 3ZGQA 4KXKB 4F3VA 4GPKA 4LEUA 3CVLA 2QFCA 3ASFA 4NQ0A 3S7DA 2VGXB 3JYSA 3ASDA 4BTAA 3KS2A 5BW8C 5BNWA 4J8FA 4W9RA 4YVQC 3O48A 4GZ3A 4KBQA 4I9EA 4JA7A 4WNFA 1IHGA 3GW4A 4IN3B 4HORA 4U0ZA 2R5SA 3TAXA 3Q47B 3WXXA 3UQ3A 3CEQA 3LY8A 3VTXA 2KCLA 5A7DB 5EKQD 1WM5A 2YHCA 3MEKA 5AYWD 5LCWJ 3QOUA 3Q15A 4AM9A 3RIBA 3CK7A 2NC9A 2L6JA 3CK8A 2XCBA 4ME2A 4BT9A 3ZFWA 5A6CA 3CVQA 5CCLA 2J9QA 3EDTB 3CKCA 5LCWC 3BEEA 5CHEE 2PZIA 1P5QA 2VGXA 1A17A 2FO7A 3MV3B 1WAO1 3LKUA 2VYIA 3HYMB 3R9AB 3AS5A 4B94A 3QKYA 3LYAA 1QQEA 5G04J 1B89A 3S7BA 3LPZA 2I6HA 5M72A 3ZN3A 3ULQA 3CKBA 3UUXA 3QWPA 5FZRA 4N5CA 4GA0A 5EX0A 1Y8MA 4J0UA 4I9CA 2WQHA 4G24A 3PE3A 5KJMA 5G04C 4CGWA 3OXLA 5DBKA 3ZHEB 2HO1A 3AS4A 3SZ7A 4YNDA 3ESKA 2KCKA 1ELRA 5BT1A 4UI9J 4HOTA 3AS8A 2VGYA 4GZ6A 2AVPA 5HQ8A 2Y4TA 1XNFA 4H7YA 3LY7A 1E96B 2HR2A 3QWVA 2IF4A 5C1DA 2C2LA 4BTBA 4UI9C 3LCAA 2P58C 1YA0A 2XCCA 4UQZA 3QWWA 3Q4AB 2HYZA 4Y6WA 1ELWA 1NA0A 5G05J 4N3CA 4JL0A 4XI9A 3CK9A 4GA2A 4WNEA 3GZ1A 4CGVA 2UWJG 3RKVA 3ASGA 3MA5A 3Q49B 4UI9K 1ZU2A 4U04A 5KJNA 4GZ5A 3TG4A 4GYOA 3CVNA 5G05C 4AIFA 5FZQA 3GYZA 3LY9A 3FFLA 3ZHEA 4HOUA 2DBAA 2FBNA 4XI0A 4JHRA 2XPIA 4I17A 2YQ8A 3UPVA 2C0LA 4G23A 4I2WA 3E4BA 3MV2B 3KD7A 1HXIA 4KYOB 4GCNA 2PQNA 2E2EA 2VQ2A 3TGOA 1IYGA 5HI7A 3IEGA 2XGMA 2VSYA 4EQFA 4UQXA 3TG5A 2MHKA 5EX3A
chains in the Genus database with same CATH superfamily
1ELKA 5JJTA 2NYJA 3PZ1A 2UY1A 4UUCA 2WVIA 2IONA 5CBNA 3ONLA 4E6HA 3EU9A 3EHMA 3LVQE 2XRYA 3TL5A 2CHZA 1N0QA 3ASHA 4WUYA 2LXMA 2IFUA 3R7QA 1HH8A 4AJWA 2XZTG 2I9CA 4J6IA 3RJVA 3V31A 2WXKA 1BI7B 3ZVVA 1MZCA 3NF1A 3CQCB 4M7CA 3APDA 1KZPA 3S2AA 4A1SA 5KNHD 3HDXA 2FF4A 3P1UA 3ZYQA 1IKND 2ZXWE 1BI8B 4APOA 3TWSA 1Z5SC 3MGBA 4YVOA 5D66A 4DX5D 4G25A 2R05A 3WG7E 4CT0A 3B7SA 3RO2A 3L17A 4BFRA 1WDYA 2LSUA 4G26A 3QB2A 2PQRA 4HS2A 3SBTB 2J09A 3ZPJA 1OWMA 1PY1A 4GU5A 2KATA 2KCVA 3L22A 1UJKA 1OWPA 3U3WA 4I2ZA 2OEWA 4N39A 4JPSA 2R02A 3MKQA 5HKPA 2ZIRA 3LJ3A 3EJNA 5ANLA 4DX2A 3ZYKA 4AV7A 5T4YA 1N4QA 3EIJA 3E37A 3U66A 2EIKE 4WWOA 4OVVA 4YDYA 4XIFA 2A5UA 1Z3YA 2ZGDA 2GW1A 3JXIA 4I1AA 3V2OA 1WG0A 4HOQA 3FH5A 2XPYA 3UM0A 1GW6A 4X8QA 2ETBA 1DCQA 2IEJA 1FCHA 3JUEA 3V30A 2L9BA 2V0PA 1N95A 4WWNA 3PDNA 5EN5D 4O1OA 5FIOA 3SF4A 2OOEA 4P29A 2XPZA 3DSXA 3RO3A 3ZGQA 4AP2A 3RK6A 1E7UA 5KWDA 1OCOE 3CVLA 2QFCA 5ENQD 3UM1A 3ASDA 5B3SE 4MRUA 4HRMB 3ISMC 1N4SA 3PUKA 4LUNU 4J8FA 2DZNA 1QYMA 3HG0D 4PS3A 4KBQA 4I9EA 4JA7A 4IN3B 4ATGA 3AG2E 3FDHA 3MZLB 3WXXA 2X6HA 4YDEA 1H6OA 3IXEA 5A7DB 5CMYA 4I6EA 1N54A 2XHEA 5CECB 4AXHA 3KSLA 4FJZA 4G11A 2KZTA 3Q7FA 2BF0X 3T5XA 1N94A 4EPZA 3Q15A 4KT6B 5FQ7A 4AM9A 1G3NB 3O4ZA 1V54E 1U2VG 4CDMA 4ME2A 4BT9A 3D9HA 3D9JA 3AG3E 4CCAA 3AJIA 5CHEE 2AXUA 1UOHA 3MV3B 1TJFA 3C3OA 1K1AA 3L08A 4HQDA 3HYMB 4GMJA 2J07A 1MX6A 3LYAA 1B89A 5B1AE 2I6HA 5M72A 1E8XA 4A55A 3E33A 3DEOA 5T3RA 2R2LA 3CVUA 3UUXA 1HU3A 2WXJA 5J90A 2QC9A 1NL4A 4GA0A 3ULYA 4J0UA 2KBXA 3ZRHA 2X6FA 4CGWA 3OXLA 3FUDA 3ZHEB 2HO1A 3SZ7A 4YNDA 3GZSA 4BY6A 1EDUA 4HOTA 1Y6IA 3FU6A 4RQIA 2XQ0A 4Q69A 3ZKJA 3EHNA 2AVPA 4NIKA 4PDXA 4YDWA 5AJLA 5HQ8A 2Y4TA 2A5EA 2IF4A 1SA5A 5C1DA 2ILRA 3LCAA 2XRZA 4GAAA 1LTXA 4A3VA 5KCMA 3TXNA 4UQZA 3FHEA 1IHBA 3QWWA 5AIJA 3CVVA 4JVSA 3JQ1A 2P9KG 3SGHA 1NA0A 2X6IA 3E34A 3CVYA 4WNEA 2L6BA 4HXIA 1TNUA 2JABA 1H2UA 4LRZA 2UWJG 3MA5A 3JUIA 3UM2A 2CFZA 4GZ5A 2H6GA 3QARA 3L16A 4BSZB 2DYSE 2V4HC 4BESA 4ZHBA 3DPYA 4C48B 3IHYA 3QAQA 5FZQA 3LEWA 2DWZA 4UWLA 2XEHA 1S0PA 1FPPA 2XPIA 3UPVA 3T8MA 2AXZA 2EILE 5EYLA 4FHJA 4G8LA 4KYOB 2E2EA 4JW1A 4EQFA 2EIME 3TG5A 2MHKA 5E75A 3CHRA 3S7FA 2Y3AA 1RW2A 1E8ZA 3PZ4A 4IRUA 4GZCA 1HZ4A 4HVBA 3FP3A 2WXNA 3FTSA 3E32A 2DVWA 1FVFA 2KXPC 2HE0A 3R7RA 4G1TA 3FUIA 5ENOD 1KT0A 2WXGA 3BUAA 1UW4B 4J7WA 3D9LA 4GCOA 4JHJA 1MX4A 3FU3A 3SBSA 2J4DA 3RRUA 2A4ZA 3FH7A 3BQOA 1NA3A 1O1TA 4DK5A 2FEZA 3FU5A 3PREA 2IOSA 2Y69E 4HRNA 1X81A 2OVBA 3UIOC 2VTBB 4U07A 5ARFA 1X5BA 1EYHA 4XEIG 4TRQA 3RU0A 4DUIA 1KT1A 4BETA 3CHPA 1S63A 2NXPA 5JJ6A 4EZJA 3U4TA 2E0IA 2B6CA 3CGHA 3IKOB 1OT8A 4FC8A 1LF8A 1PAQA 3LXUX 1HS6A 4BERA 5A23A 3URZA 1OWNA 1SVXA 3ZEFA 1SZ9A 4F1PA 3CV0A 3SO8A 3HXDA 2JLBA 3FEYA 4J8EA 4JEHA 4U0SA 2DZOA 5FTPA 2IOLA 3HVEB 2QYUA 3OTNA 4HB5A 1JPLA 1YYHA 5ANRA 3G2VA 3R9MA 5DIZA 5KJLA 4GA1A 5CBOA 3UM3A 4A1GA 5CERB 3FUNA 1O5MA 3PZ3A 4FHKA 1N4PA 3OXFA 4J8YA 5BV0A 5CRUA 4C0EA 1UG3A 2H6FA 2CG3A 2FO1E 4N2SA 2LNIA 3B95A 3FUKA 2AJAA 2CG2A 5JA4D 2EQXA 3CLJA 2RFMA 2P2CP 4V3IA 3S7DA 2PNNA 1HO8A 3JYSA 2WMNA 4BTAA 3KS2A 3RRNB 4I6GA 5BW8C 1BD8A 1SQMA 3JQ0A 1O1RA 1K8KG 2I2OA 4MS6A 1O1SA 5BNWA 4OYSA 3KSQA 3DXKG 4W9RA 4YVQC 5LX8A 3O48A 4GZ3A 1N11A 2J08A 4WNFA 1IHGA 3DSWA 3GW4A 4GTOA 2R5SA 5HRYA 3TAXA 4Q94A 3AU4A 2OEVA 3LY8A 1HFAA 3VLDA 2LAHA 2R17C 1H6PA 5EKQD 3SNXA 2DYRE 2YHCA 3MEKA 5H7PA 5LCWJ 1RZ4A 3TWWA 5J08A 5ENTD 4UWFA 4JHKA 2Y0BG 3PZDA 2I1KA 2L6JA 3FTVA 5A6CA 3UMVA 3CHMA 3QK0A 5CCLA 1SW6A 3CKCA 1YCSB 2ETCA 4ZFHA 4E85A 3ESLA 1P5QA 2RD0A 3DSSA 2VGXA 1A17A 2MOWA 2FO7A 1WAO1 3D9NA 4I1OB 3FTYA 3AAAC 4R7LA 4B94A 1L5JA 3QKYA 5IY5E 5G04J 4B93B 3B13A 5BPPA 3KEAA 5LOZA 1EF1C 4EZKA 2X6JA 3ULQA 3FUHA 4ILHB 3QWPA 3AU5A 3W9GA 1EPUA 1Y8MA 3B7UX 5HS0A 4DX6D 5KJMA 2LO6A 3APFA 5DBKA 5BXOA 1HF8A 3AS4A 5CMWA 2KCKA 1ELRA 2R59A 2QY7A 2IO2C 2XS8A 4F1SA 3Q75A 3FUEA 1Z3XA 1E90A 4FU3A 2J8SD 2IJGX 3ZXPA 4JB8P 1XNFA 3QWVA 2YNQA 2F0YA 2JEKA 2C2LA 1H19A 1Z6TA 2X6KA 3HIZA 2WXHA 1OWLA 3PRZA 3Q4AB 2WQ6A 4L2LA 4C0MA 4GMRA 2HYZA 4Y6WA 3HHMA 1DCEA 2OV8A 5G05J 5FQ4A 3J5QB 4XI9A 3CK9A 1OWOA 4DI4A 3B7BA 1K3ZD 3GZ1A 4KZ0A 2WXRA 4CGVA 3RKVA 3TWRA 2X38A 3ASGA 4QQIA 2LXLA 4U04A 4XE0A 3FU0A 4B8AA 4B89A 2XENA 3ZIMA 2MRIA 3ML8A 4HOUA 1INZA 2DBAA 4XI0A 2YQ8A 5BV1A 4L2YA 2EIJE 3ENEA 4JC8A 4GTSA 4GCNA 2VQ2A 1IYGA 2NSZA 4IYPA 5ITZF 4EZLA 3IEGA 2XGMA 4PS8A 4K03A 3FH8A 3FTZA 4U8HA 2WXMA 4RG9A 2WXPA 5AQAA 3AG4E 1OCCE 4AY5A 1DNPA 2X3MA 2GGFA 2VTBA 5G2NA 1HE8A 1MX2A 5FQ6A 4BSXA 3UTMA 4HLEA 1MJ0A 2DCPA 4L7TA 2QZAA 3UT8A 3ULEG 3VTYA 5BUZA 4TV3A 5BXUA 4AY6A 1HG2A 1OUVA 4RLYA 4N5QA 3S7JA 4LCTA 3FTXA 4H7XA 1N0RA 1H2TC 1LD8A 3MKQB 2B0OE 4CYMD 3PNTB 5ENNA 3EU5A 2V5FA 3UT4A 2I1JA 4M3OA 5LP0A 3ABKE 1NI1A 5JHBA 2KM4A 4Y6CA 3DSVA 1QZ2A 5ENRD 4GPMA 4ANUA 4XKCA 5AN8A 4N3BA 3C5RA 3V79K 3IV0A 4JA9A 5FT9A 4UQYA 4BT8A 3HVEA 3VLFA 4RG6A 2C0MA 3Q78A 2LSVA 4WNDA 4FP7A 4URKA 3LS8A 1WY6A 4U8VD 5D0OD 4FJYA 4J8SA 2RKKA 3APCA 3CHSA 2BKGA 4RVBA 4TXPA 4O60A 3HRAA 4EBAA 2GROB 4D10C 4U0UA 3L6AA 4O6FA 3TWUA 2FI7A 2P9LG 3Q73A 3C98A 3CHOA 3ZUVB 4ANWA 4DLOA 3G2WA 3NAWA 3C3QA 2YINA 2Q7FA 4CEMA 3C3RA 3D9IA 4B8CB 3NBNB 3NB2A 4GZDA 5D2MC 4K5CA 1KPSB 4L1BA 3L9TA 3F6QA 3SFZA 2YHEA 4G2VA 1TN7A 1NZNA 3UX4A 1JWFA 3KAEA 4U96D 1FT1A 2MYOA 2WQ7A 3J5PA 2V8SE 4GYWA 3FTWA 4NURA 4KMOA 4LNUD 1KLXA 1Q2ZA 5D0QD 2XEEA 2BEDA 5JJ7A 3LVRE 3RRMB 3EIQC 3CVXA 4J8DA 4GTVA 5CEDB 2XEVA 4CDNA 4GYYA 1JCQA 4KXKB 4F3VA 4TXRA 4LEUA 3SY2A 3SFXA 3ASFA 4HI9A 4PH4B 3MYVA 4NQ0A 4UWKA 3NZSA 1QBQA 3HXFA 3TJPA 3ZXSA 3HXCA 3Q79A 4MLPA 4TUMA 2WB2A 4L23A 3PEUB 4HORA 4K5AB 2LAIA 3LJNA 3PH0C 4BX8A 3VTXA 2KCLA 1TYQG 4GB9A 5AQBA 4DRXE 3CR3A 1S70B 2H6HA 3L13A 5AYWD 3ASNE 2J49A 3QNKA 3I4GA 1UN8A 3PS6A 3CK7A 2NC9A 3CK8A 3DRAA 1AP7A 3ZFWA 4I1MA 4LNGA 3CVQA 1ZB1A 3JCKC 3EDTB 3PUJA 3PEVB 3FUJA 5LCWC 3UIPC 2GRLA 3UKRG 3BEEA 2P9UG 4G8KA 3LKUA 3CSTA 3EHQA 3R9AB 3X2QE 3G2TA 5AAOA 1QQEA 2ZISA 3S7BA 3LPZA 1TR4A 4U95D 2QYJA 4BEPA 4MBGA 1BU9A 1A5EA 3L82A 2F8XK 3AG1E 3G2SA 3ASOE 3CKBA 5AQ9A 2DIWA 5FZRA 4ACLA 3FUMA 1K1BA 1E8YA 2BKKB 4I9CA 4G24A 3PE3A 5G04C 3KEZA 1U3DA 2Y1LE 1E8WA 4DPRA 1DVPA 4UI9J 4K0RA 2CFUA 5EYPF 4I6JA 4Z68A 3D9KA 4AEZC 2VGYA 4A63B 4GTTA 4H7YA 4WWPA 1DC2A 3LY7A 3ABLE 2HR2A 3Q7AA 5CRVA 3QC1A 2CHXA 3ML9A 3QJZA 3DBSA 2P58C 1YA0A 4HRLA 5AJDA 2AWIA 1ELWA 5JHAA 4N3CA 5EILA 4GA2A 3DPDA 3ONKA 2M63A 3UI2A 4F7AA 3ZU7B 3C72A 3CIAA 3ZW3A 1IXVA 3Q49B 3T9KA 3DSUA 5EIDA 3D9PA 4UI9K 5KJNA 3TG4A 4GYOA 4CZ2D 3CVNA 4ILIA 5G05C 4DX1A 4AIFA 2OCCE 3CQGB 3LY9A 1HG5A 3ZHEA 4AVXA 4JHRA 4I17A 2C0LA 4I2WA 3E4BA 1SA4A 2FULA 1H0AA 5KNGA 4EHMA 3KD7A 1AWCB 2VSOE 3SQVA 1JWGA 4UQXA 3D9MA 2R03A 1OCZE 4GTPA 3CVWA 3DXMG 3Q5MA 3ZYMA 4F6RD 2J4BA 3UT7A 3K9IA 2ONDA 3P2BA 1ZBPA 3FY4A 3I5PA 4IULA 1IQRA 2IU1A 3ZNGA 3L54A 4FLBA 1U3CA 4WAFA 5FJYA 2P9SG 2IQCA 3N71A 3T5VA 3MCXA 4PS7A 3D9OA 3T8KA 1V55E 4CDRA 5FZSA 2L0IA 4HFGA 2WXOA 3MKRA 5KBAA 2BTDA 4N3AA 4FULA 3PE4A 4JD2G 1TJCA 2UY1B 5CCMA 4AOFA 3BG0B 2XZDG 2Y4UA 4U63A 3FEXA 3I3NA 3CHQA 4NACA 5ARGA 1OXJA 1KZOA 3IBEA 2BUGA 1S64A 3HXBA 3EUVA 4CRWA 2V4LA 4APFA 3PZ2A 3ABME 1HX8A 1TNZA 3Q9NC 3QDNA 3OAWA 4JXTA 4BX9A 2XGOA 4L9PA 3VLEA 2ZU6B 3GZ2A 4HBDA 5AENA 3D3MA 3SD5A 5T8IA 4XZ4A 4QFVA 4BWRA 4DX7D 2AXVA 4DLQA 2V5QC 4OAUC 5FWQA 2KC7A 3G2UA 3NOGD 4GTRA 4U8YD 4NRHB 1PC2A 2WXFA 2VSXE 3NZUA 4Q96A 2PL2A 4N2QA 3FWVA 4KVMA 2WPVA 1H6KA 2GRQB 1BPOA 4WNGA 4KZCA 1W3BA 2LUHA 4HOSA 3CVPA 1TEZA 3OXGA 4GTMA 4B0ZA 4ABNA 2VSNA 5KJKA 4XX5A 3NOCD 2XGSA 2PM6A 4DI3A 2IO3C 1TNYA 1XGWA 1N4RA 3DEPA 5ENPD 3LDZA 4LNBA 4GPKA 4OAVB 3I4RB 4OVUA 4FA6A 4K5BA 3BU8A 2VGXB 1IQUA 5EIBE 3SI5A 4A3TA 3MJWA 1JUQA 3SFYA 1UN9A 4DJAA 4C9BB 1NFIE 1MQSA 2RFAA 4U0ZA 4HNAD 3V2XA 3Q47B 4ACKA 1D8DA 1BLXB 3UQ3A 2AW6A 2OVFA 3CEQA 3E30A 3SHFA 1LD7A 4EBAG 4JZYA 2GRMA 2HM8A 5B1BE 4XKBA 5ENSD 3MX3A 1WM5A 5FINA 4UWHA 5LFAA 5JMND 4HI8A 3QOUA 5G55A 1MYOA 3RIBA 3JXJA 2XCBA 3U9WA 3NQPA 4LERA 2P9IG 2J9QA 4LG6A 2F8YA 3IHVA 3B7TA 1FT2A 1D9SA 1YMPA 4RSYA 2PZIA 3B7RL 3TWTA 1D8EA 4O1PA 2VYIA 1QNFA 4GMLA 3PVLA 3AS5A 2ZGGA 1TN6A 5CEAA 2GRNB 4U7EB 3TXMA 1H2VC 1OCRE 3FTUA 3UKUG 2WXIA 4EECA 2KZTB 3ZN3A 1N52A 1E7VA 3DWLG 1NP7A 4N5CA 2EINE 4I43A 5EX0A 2XS1A 3ZYLA 2WQHA 2IY0C 1JCSA 4FLHA 2P9PG 3UINC 2F37A 2VJ8A 2WMOA 1TNOA 3ESKA 3TWVA 4GTQA 2GRRB 1OY3D 5BT1A 4LSZE 3RSEG 3TWXA 1TNBA 3PNLB 3AS8A 2PM7A 4F53A 3FULA 1SZAA 4JEUA 3FUFA 3HXEA 2WXQA 3BG1B 2WXLA 4GZ6A 4UWGA 4ILGA 1E96B 4YDOA 4CT4A 4BTBA 4UI9C 2RG8A 2XCCA 4ATZD 5FQ8A 5E76A 1VDYA 1MHQA 3RAUA 5C2YA 4ANVA 4KVOA 4JL0A 4ANXA 2GRPB 1FVHA 1UJJA 4TUUA 2WM9A 2ETAA 2H6IA 1ZU2A 3W9FA 2VGEA 1TN8A 3GYZA 3FFLA 3Q9UC 1N9AA 3TWQA 2FBNA 3DSTA 3EHRA 5EDSA 4PUCA 4G23A 5AQ7A 4TXQA 5AARA 3UXGA 4HLLA 3MV2B 1HXIA 3U64A 2CHWA 2PQNA 2P9NG 3TGOA 3CSFA 4FADA 5HI7A 2VSYA 2L0TB 1JCRA 4MKTA 5EX3A
chains in the Genus database with same CATH topology
3FTZA 4U8HA 5E75A 3CVWA 1ELKA 2WXMA 4RG9A 3CHRA 3Q5MA 3S7FA 3ZYMA 2WXPA 5JJTA 2Y3AA 2UY1A 1E8ZA 2J4BA 2WVIA 3UT7A 4AY5A 2IONA 3K9IA 1DNPA 4IRUA 2ONDA 2X3MA 2GGFA 2VTBA 5G2NA 1HE8A 3ONLA 1HZ4A 3P2BA 4GZCA 5FQ6A 4E6HA 4HVBA 1ZBPA 3EHMA 3FP3A 3FY4A 3I5PA 3LVQE 2WXNA 1IQRA 3FTSA 2XRYA 4IULA 4BSXA 2IU1A 3TL5A 2CHZA 4HLEA 2DCPA 1FVFA 3L54A 4FLBA 4L7TA 3ASHA 4WUYA 2IFUA 3R7QA 3UT8A 3VTYA 1U3CA 4WAFA 5BUZA 3R7RA 1HH8A 4TV3A 5FJYA 4AY6A 4G1TA 1HG2A 1OUVA 3FUIA 4AJWA 2IQCA 1KT0A 2WXGA 3N71A 3T5VA 2I9CA 3S7JA 1UW4B 4J6IA 4LCTA 3FTXA 3D9LA 3RJVA 4GCOA 3MCXA 4H7XA 4JHJA 2WXKA 4PS7A 3FU3A 1H2TC 3ZVVA 3D9OA 3NF1A 3CQCB 3SBSA 2J4DA 3MKQB 4CDRA 3APDA 5FZSA 2L0IA 3S2AA 4A1SA 3PNTB 4HFGA 3RRUA 2WXOA 5ENNA 2A4ZA 2V5FA 3FH7A 3MKRA 2BTDA 4N3AA 2I1JA 3UT4A 1NA3A 4FULA 3PE4A 4M3OA 4DK5A 5LP0A 5JHBA 2FEZA 2KM4A 4Y6CA 1TJCA 1QZ2A 3FU5A 3HDXA 2FF4A 2UY1B 3P1UA 5CCMA 3PREA 3ZYQA 4AOFA 4ANUA 3BG0B 4XKCA 2IOSA 4APOA 4N3BA 2Y4UA 3MGBA 2OVBA 4U63A 4YVOA 3FEXA 4U07A 2VTBB 3I3NA 5ARFA 3CHQA 4NACA 1X5BA 5ARGA 1EYHA 3IV0A 4JA9A 3IBEA 5FT9A 2BUGA 4TRQA 3RU0A 4G25A 4UQYA 4BT8A 3HVEA 1KT1A 4CRWA 3VLFA 4CT0A 2V4LA 4RG6A 3B7SA 2C0MA 3CHPA 4APFA 2LSVA 3RO2A 3L17A 2NXPA 1HX8A 4WNDA 4FP7A 4BFRA 5JJ6A 4URKA 3LS8A 1WY6A 2LSUA 5D0OD 4FJYA 4J8SA 4G26A 3QB2A 2PQRA 3APCA 4EZJA 3U4TA 2E0IA 3CHSA 3SD5A 3CGHA 3IKOB 4HS2A 3QDNA 3SBTB 4FC8A 4RVBA 2J09A 1LF8A 3OAWA 1PAQA 3ZPJA 3LXUX 4JXTA 4BX9A 4EBAA 2XGOA 1HS6A 5A23A 3URZA 1OWNA 1OWMA 4D10C 3VLEA 2ZU6B 3GZ2A 1PY1A 4GU5A 3ZEFA 4U0UA 3L6AA 4O6FA 5AENA 3D3MA 1SZ9A 2FI7A 2KATA 2KCVA 3C98A 3CHOA 1UJKA 3L22A 1OWPA 4XZ4A 5T8IA 3G2WA 4ANWA 4DLOA 3U3WA 3CV0A 2YINA 4I2ZA 4N39A 4QFVA 4BWRA 2JLBA 2Q7FA 4CEMA 4JPSA 2AXVA 3D9IA 3MKQA 4B8CB 3FEYA 4DLQA 3LJ3A 3EJNA 4J8EA 5ANLA 4JEHA 4U0SA 5FWQA 3ZYKA 4GZDA 5FTPA 4AV7A 2KC7A 2IOLA 5T4YA 4L1BA 3G2UA 3HVEB 3EIJA 3U66A 3SFZA 4WWOA 4NRHB 1PC2A 4OVVA 2WXFA 3OTNA 2VSXE 3NZUA 4XIFA 2YHEA 4Q96A 2A5UA 4G2VA 1NZNA 2PL2A 1Z3YA 1JPLA 4N2QA 2GW1A 3FWVA 4KVMA 3UX4A 4I1AA 5ANRA 3G2VA 2WPVA 1JWFA 5DIZA 5KJLA 3KAEA 1H6KA 4GA1A 1BPOA 4HOQA 4A1GA 2WQ7A 4WNGA 3FH5A 4KZCA 1W3BA 2XPYA 3FUNA 4HOSA 1GW6A 3CVPA 2V8SE 4FHKA 1FCHA 4GYWA 1TEZA 3FTWA 3OXFA 3OXGA 4NURA 4B0ZA 5BV0A 4KMOA 4ABNA 2L9BA 2V0PA 2VSNA 4C0EA 1KLXA 1UG3A 4WWNA 5KJKA 5D0QD 3PDNA 4XX5A 5JJ7A 3LVRE 2XGSA 3RRMB 3EIQC 2CG3A 3CVXA 4J8DA 4N2SA 2LNIA 2PM6A 3SF4A 4DI3A 2XEVA 2OOEA 4P29A 3FUKA 2XPZA 4CDNA 4GYYA 3RO3A 2CG2A 3ZGQA 1XGWA 4AP2A 4KXKB 4F3VA 2EQXA 3RK6A 3LDZA 1E7UA 4GPKA 3I4RB 4LEUA 3CLJA 4OVUA 3CVLA 4FA6A 2QFCA 3ASFA 4PH4B 4V3IA 3MYVA 4NQ0A 2VGXB 3S7DA 1IQUA 3NZSA 4UWKA 1HO8A 3JYSA 2WMNA 3ASDA 4BTAA 3KS2A 3SI5A 3RRNB 4MRUA 4I6GA 5BW8C 4A3TA 1SQMA 3JQ0A 3TJPA 3ZXSA 2I2OA 4MS6A 4MLPA 3PUKA 4LUNU 5BNWA 4OYSA 4J8FA 2WB2A 4W9RA 4YVQC 3MJWA 5LX8A 3O48A 4GZ3A 4PS3A 4KBQA 4I9EA 1JUQA 4L23A 1UN9A 4DJAA 4C9BB 2J08A 4JA7A 3PEUB 4WNFA 1IHGA 1MQSA 3GW4A 4IN3B 4HORA 4ATGA 4U0ZA 2R5SA 2LAIA 3TAXA 4Q94A 3Q47B 3FDHA 4ACKA 3MZLB 3PH0C 3WXXA 3AU4A 2X6HA 3UQ3A 2AW6A 2OVFA 3CEQA 4BX8A 3LY8A 1HFAA 3VTXA 3SHFA 2KCLA 3VLDA 2LAHA 4GB9A 2R17C 4EBAG 4JZYA 5A7DB 3CR3A 5EKQD 2GRMA 2HM8A 5CMYA 4I6EA 3L13A 3SNXA 1N54A 4XKBA 2XHEA 3MX3A 1WM5A 2YHCA 3MEKA 4UWHA 5AYWD 4AXHA 5LCWJ 4FJZA 4G11A 5LFAA 2KZTA 3QOUA 2BF0X 3T5XA 2J49A 3QNKA 4EPZA 3I4GA 5G55A 5J08A 3Q15A 4KT6B 5FQ7A 4AM9A 1UN8A 3PS6A 3RIBA 4UWFA 4JHKA 3CK7A 3PZDA 2I1KA 3O4ZA 2NC9A 4CDMA 2L6JA 3CK8A 2XCBA 3FTVA 3U9WA 4ME2A 3NQPA 4LERA 4BT9A 3ZFWA 4I1MA 3UMVA 3CHMA 3CVQA 3D9JA 5A6CA 3QK0A 5CCLA 2J9QA 3JCKC 3EDTB 3PUJA 3CKCA 3PEVB 3FUJA 5LCWC 4E85A 3IHVA 4CCAA 3B7TA 2GRLA 4RSYA 3BEEA 5CHEE 2PZIA 1P5QA 2AXUA 2RD0A 3B7RL 2VGXA 3ESLA 1A17A 2MOWA 2FO7A 3MV3B 1TJFA 1WAO1 3D9NA 3LKUA 4I1OB 3FTYA 2VYIA 3L08A 1QNFA 3CSTA 3HYMB 4GMLA 4R7LA 3PVLA 3R9AB 4GMJA 2J07A 3AS5A 4B94A 1L5JA 3QKYA 3G2TA 3LYAA 1QQEA 5G04J 1B89A 3S7BA 3B13A 3LPZA 3TXMA 5BPPA 1H2VC 3FTUA 5LOZA 1EF1C 2WXIA 2I6HA 4EECA 5M72A 4EZKA 2KZTB 3ZN3A 2X6JA 1E8XA 3ULQA 4A55A 3FUHA 1N52A 4ILHB 5T3RA 3G2SA 3CVUA 3CKBA 3UUXA 1E7VA 2DIWA 3QWPA 1HU3A 2WXJA 5FZRA 4ACLA 3FUMA 1NP7A 3AU5A 4N5CA 5J90A 4GA0A 4I43A 5EX0A 1EPUA 1E8YA 1Y8MA 3B7UX 4J0UA 4I9CA 3ZYLA 2WQHA 4G24A 3PE3A 5KJMA 4FLHA 5G04C 2LO6A 3KEZA 3APFA 2X6FA 3ZRHA 4CGWA 3OXLA 5DBKA 1U3DA 1HF8A 2VJ8A 3FUDA 2WMOA 1E8WA 2HO1A 3AS4A 3SZ7A 3ZHEB 5CMWA 4DPRA 4YNDA 3ESKA 1DVPA 3GZSA 2KCKA 4BY6A 1ELRA 2R59A 2QY7A 5BT1A 4UI9J 1EDUA 4K0RA 2CFUA 4HOTA 1Y6IA 3FU6A 4I6JA 4F1SA 3PNLB 3D9KA 3AS8A 2PM7A 4F53A 3FULA 3FUEA 1SZAA 1Z3XA 4JEUA 1E90A 2XQ0A 4AEZC 4Q69A 3FUFA 4FU3A 2VGYA 2IJGX 2WXQA 3BG1B 2WXLA 3EHNA 4GZ6A 2AVPA 4PDXA 5AJLA 5HQ8A 4UWGA 2Y4TA 1XNFA 4H7YA 4WWPA 4ILGA 3LY7A 1E96B 2HR2A 3QWVA 2IF4A 2YNQA 3QC1A 2JEKA 4CT4A 5C1DA 2CHXA 2C2LA 3ML9A 1H19A 2ILRA 3QJZA 4BTBA 3DBSA 1Z6TA 4UI9C 3LCAA 2RG8A 2P58C 4GAAA 2XRZA 2X6KA 4A3VA 5KCMA 3HIZA 1YA0A 3TXNA 2XCCA 4UQZA 2WXHA 3FHEA 1OWLA 3PRZA 3QWWA 5AIJA 3Q4AB 5FQ8A 2WQ6A 5E76A 1VDYA 1MHQA 4L2LA 5AJDA 4C0MA 4JVSA 3JQ1A 3CVVA 2HYZA 2AWIA 4Y6WA 3HHMA 1ELWA 3SGHA 1NA0A 5JHAA 2OV8A 2X6IA 4N3CA 5G05J 5C2YA 3CVYA 5FQ4A 4ANVA 4KVOA 4JL0A 4XI9A 4ANXA 3CK9A 4GA2A 4WNEA 1OWOA 4DI4A 4HXIA 3GZ1A 4KZ0A 3DPDA 2WXRA 4CGVA 4LRZA 1H2UA 2M63A 3ONKA 1FVHA 4F7AA 1UJJA 2UWJG 3RKVA 3CIAA 3ZW3A 2X38A 3ASGA 3MA5A 3Q49B 3JUIA 4TUUA 2WM9A 3D9PA 2CFZA 4UI9K 1ZU2A 4U04A 5KJNA 4GZ5A 4XE0A 3QARA 3TG4A 4GYOA 3FU0A 3L16A 4B8AA 3CVNA 4ILIA 5G05C 4B89A 4AIFA 3IHYA 3QAQA 3ZIMA 5FZQA 3CQGB 3LEWA 3GYZA 3LY9A 1HG5A 2MRIA 3FFLA 3ML8A 4UWLA 3ZHEA 4HOUA 1INZA 2DBAA 4AVXA 2FBNA 4XI0A 4JHRA 1S0PA 2XPIA 5EDSA 4I17A 2YQ8A 4PUCA 5BV1A 3UPVA 4L2YA 2C0LA 4G23A 4I2WA 3T8MA 3E4BA 3ENEA 2AXZA 2FULA 1H0AA 4JC8A 3MV2B 3KD7A 4FHJA 2VSOE 1HXIA 3U64A 4KYOB 2CHWA 4GCNA 2PQNA 1JWGA 2E2EA 2VQ2A 3TGOA 3CSFA 1IYGA 4FADA 4JW1A 2NSZA 4IYPA 5HI7A 4EZLA 3IEGA 2XGMA 2VSYA 4EQFA 4UQXA 4PS8A 2L0TB 3TG5A 4K03A 3D9MA 4MKTA 2MHKA 3FH8A 5EX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RG9 A;  3S7F A;  3Q5M A;  5JJT A;  2UY1 A;  4AY5 A;  3K9I A;  2OND A;  1HZ4 A;  1ZBP A;  3FP3 A;  3ASH A;  4WUY A;  2IFU A;  3VTY A;  1HH8 A;  5FJY A;  4AY6 A;  4G1T A;  1OUV A;  1KT0 A;  3N71 A;  3S7J A;  3RJV A;  4GCO A;  4H7X A;  3NF1 A;  4CDR A;  5FZS A;  4A1S A;  2V5F A;  3MKR A;  4N3A A;  1NA3 A;  3PE4 A;  2FEZ A;  4Y6C A;  1TJC A;  1QZ2 A;  2FF4 A;  2UY1 B;  5CCM A;  4APO A;  4N3B A;  2Y4U A;  4YVO A;  4U07 A;  5ARF A;  5ARG A;  4JA9 A;  5FT9 A;  2BUG A;  3RU0 A;  4G25 A;  4UQY A;  4BT8 A;  1KT1 A;  4RG6 A;  2C0M A;  2LSV A;  3RO2 A;  4WND A;  5JJ6 A;  2LSU A;  5D0O D;  4G26 A;  2PQR A;  3U4T A;  3QDN A;  3ZPJ A;  2XGO A;  3URZ A;  3GZ2 A;  4U0U A;  4O6F A;  2FI7 A;  2KAT A;  2KCV A;  3U3W A;  3CV0 A;  4I2Z A;  4N39 A;  4BWR A;  2JLB A;  2Q7F A;  4J8E A;  4U0S A;  5FTP A;  2KC7 A;  4NRH B;  1PC2 A;  4XIF A;  4G2V A;  1NZN A;  2PL2 A;  4N2Q A;  2GW1 A;  3FWV A;  4I1A A;  2WPV A;  5DIZ A;  5KJL A;  3KAE A;  4GA1 A;  4HOQ A;  4WNG A;  1W3B A;  4HOS A;  3CVP A;  4GYW A;  1FCH A;  3OXF A;  3OXG A;  4ABN A;  2VSN A;  1KLX A;  5KJK A;  5D0Q D;  3PDN A;  5JJ7 A;  2XGS A;  4J8D A;  4N2S A;  2LNI A;  3SF4 A;  2XEV A;  2OOE A;  4GYY A;  3RO3 A;  3ZGQ A;  4KXK B;  4F3V A;  4GPK A;  4LEU A;  3CVL A;  2QFC A;  3ASF A;  4NQ0 A;  3S7D A;  2VGX B;  3JYS A;  3ASD A;  4BTA A;  3KS2 A;  5BW8 C;  5BNW A;  4J8F A;  4W9R A;  4YVQ C;  3O48 A;  4GZ3 A;  4KBQ A;  4I9E A;  4JA7 A;  4WNF A;  1IHG A;  3GW4 A;  4IN3 B;  4HOR A;  4U0Z A;  2R5S A;  3TAX A;  3Q47 B;  3WXX A;  3UQ3 A;  3CEQ A;  3LY8 A;  3VTX A;  2KCL A;  5A7D B;  5EKQ D;  1WM5 A;  2YHC A;  3MEK A;  5AYW D;  5LCW J;  3QOU A;  3Q15 A;  4AM9 A;  3RIB A;  3CK7 A;  2NC9 A;  2L6J A;  3CK8 A;  2XCB A;  4ME2 A;  4BT9 A;  3ZFW A;  5A6C A;  3CVQ A;  5CCL A;  2J9Q A;  3EDT B;  3CKC A;  5LCW C;  3BEE A;  5CHE E;  2PZI A;  1P5Q A;  2VGX A;  1A17 A;  2FO7 A;  3MV3 B;  1WAO 1;  3LKU A;  2VYI A;  3HYM B;  3R9A B;  3AS5 A;  4B94 A;  3QKY A;  3LYA A;  1QQE A;  5G04 J;  1B89 A;  3S7B A;  3LPZ A;  2I6H A;  5M72 A;  3ZN3 A;  3ULQ A;  3CKB A;  3UUX A;  3QWP A;  5FZR A;  4N5C A;  4GA0 A;  5EX0 A;  1Y8M A;  4J0U A;  4I9C A;  2WQH A;  4G24 A;  3PE3 A;  5KJM A;  5G04 C;  4CGW A;  3OXL A;  5DBK A;  3ZHE B;  2HO1 A;  3AS4 A;  3SZ7 A;  4YND A;  3ESK A;  2KCK A;  1ELR A;  5BT1 A;  4UI9 J;  4HOT A;  3AS8 A;  2VGY A;  4GZ6 A;  2AVP A;  5HQ8 A;  2Y4T A;  1XNF A;  4H7Y A;  3LY7 A;  1E96 B;  2HR2 A;  3QWV A;  2IF4 A;  5C1D A;  2C2L A;  4BTB A;  4UI9 C;  3LCA A;  2P58 C;  1YA0 A;  2XCC A;  4UQZ A;  3QWW A;  3Q4A B;  2HYZ A;  4Y6W A;  1ELW A;  1NA0 A;  5G05 J;  4N3C A;  4JL0 A;  4XI9 A;  3CK9 A;  4GA2 A;  4WNE A;  3GZ1 A;  4CGV A;  2UWJ G;  3RKV A;  3ASG A;  3MA5 A;  3Q49 B;  4UI9 K;  1ZU2 A;  4U04 A;  5KJN A;  4GZ5 A;  3TG4 A;  4GYO A;  3CVN A;  5G05 C;  4AIF A;  5FZQ A;  3GYZ A;  3LY9 A;  3FFL A;  3ZHE A;  4HOU A;  2DBA A;  2FBN A;  4XI0 A;  4JHR A;  2XPI A;  4I17 A;  2YQ8 A;  3UPV A;  2C0L A;  4G23 A;  4I2W A;  3E4B A;  3MV2 B;  3KD7 A;  1HXI A;  4KYO B;  4GCN A;  2PQN A;  2E2E A;  2VQ2 A;  3TGO A;  1IYG A;  5HI7 A;  3IEG A;  2XGM A;  2VSY A;  4EQF A;  4UQX A;  3TG5 A;  2MHK A;  5EX3 A; 
#chains in the Genus database with same CATH topology
 1ELK A;  5JJT A;  2NYJ A;  3PZ1 A;  2UY1 A;  4UUC A;  2WVI A;  2ION A;  5CBN A;  3ONL A;  4E6H A;  3EU9 A;  3EHM A;  3LVQ E;  2XRY A;  3TL5 A;  2CHZ A;  1N0Q A;  3ASH A;  4WUY A;  2LXM A;  2IFU A;  3R7Q A;  1HH8 A;  4AJW A;  2XZT G;  2I9C A;  4J6I A;  3RJV A;  3V31 A;  2WXK A;  1BI7 B;  3ZVV A;  1MZC A;  3NF1 A;  3CQC B;  4M7C A;  3APD A;  1KZP A;  3S2A A;  4A1S A;  5KNH D;  3HDX A;  2FF4 A;  3P1U A;  3ZYQ A;  1IKN D;  2ZXW E;  1BI8 B;  4APO A;  3TWS A;  1Z5S C;  3MGB A;  4YVO A;  5D66 A;  4DX5 D;  4G25 A;  2R05 A;  3WG7 E;  4CT0 A;  3B7S A;  3RO2 A;  3L17 A;  4BFR A;  1WDY A;  2LSU A;  4G26 A;  3QB2 A;  2PQR A;  4HS2 A;  3SBT B;  2J09 A;  3ZPJ A;  1OWM A;  1PY1 A;  4GU5 A;  2KAT A;  2KCV A;  3L22 A;  1UJK A;  1OWP A;  3U3W A;  4I2Z A;  2OEW A;  4N39 A;  4JPS A;  2R02 A;  3MKQ A;  5HKP A;  2ZIR A;  3LJ3 A;  3EJN A;  5ANL A;  4DX2 A;  3ZYK A;  4AV7 A;  5T4Y A;  1N4Q A;  3EIJ A;  3E37 A;  3U66 A;  2EIK E;  4WWO A;  4OVV A;  4YDY A;  4XIF A;  2A5U A;  1Z3Y A;  2ZGD A;  2GW1 A;  3JXI A;  4I1A A;  3V2O A;  1WG0 A;  4HOQ A;  3FH5 A;  2XPY A;  3UM0 A;  1GW6 A;  4X8Q A;  2ETB A;  1DCQ A;  2IEJ A;  1FCH A;  3JUE A;  3V30 A;  2L9B A;  2V0P A;  1N95 A;  4WWN A;  3PDN A;  5EN5 D;  4O1O A;  5FIO A;  3SF4 A;  2OOE A;  4P29 A;  2XPZ A;  3DSX A;  3RO3 A;  3ZGQ A;  4AP2 A;  3RK6 A;  1E7U A;  5KWD A;  1OCO E;  3CVL A;  2QFC A;  5ENQ D;  3UM1 A;  3ASD A;  5B3S E;  4MRU A;  4HRM B;  3ISM C;  1N4S A;  3PUK A;  4LUN U;  4J8F A;  2DZN A;  1QYM A;  3HG0 D;  4PS3 A;  4KBQ A;  4I9E A;  4JA7 A;  4IN3 B;  4ATG A;  3AG2 E;  3FDH A;  3MZL B;  3WXX A;  2X6H A;  4YDE A;  1H6O A;  3IXE A;  5A7D B;  5CMY A;  4I6E A;  1N54 A;  2XHE A;  5CEC B;  4AXH A;  3KSL A;  4FJZ A;  4G11 A;  2KZT A;  3Q7F A;  2BF0 X;  3T5X A;  1N94 A;  4EPZ A;  3Q15 A;  4KT6 B;  5FQ7 A;  4AM9 A;  1G3N B;  3O4Z A;  1V54 E;  1U2V G;  4CDM A;  4ME2 A;  4BT9 A;  3D9H A;  3D9J A;  3AG3 E;  4CCA A;  3AJI A;  5CHE E;  2AXU A;  1UOH A;  3MV3 B;  1TJF A;  3C3O A;  1K1A A;  3L08 A;  4HQD A;  3HYM B;  4GMJ A;  2J07 A;  1MX6 A;  3LYA A;  1B89 A;  5B1A E;  2I6H A;  5M72 A;  1E8X A;  4A55 A;  3E33 A;  3DEO A;  5T3R A;  2R2L A;  3CVU A;  3UUX A;  1HU3 A;  2WXJ A;  5J90 A;  2QC9 A;  1NL4 A;  4GA0 A;  3ULY A;  4J0U A;  2KBX A;  3ZRH A;  2X6F A;  4CGW A;  3OXL A;  3FUD A;  3ZHE B;  2HO1 A;  3SZ7 A;  4YND A;  3GZS A;  4BY6 A;  1EDU A;  4HOT A;  1Y6I A;  3FU6 A;  4RQI A;  2XQ0 A;  4Q69 A;  3ZKJ A;  3EHN A;  2AVP A;  4NIK A;  4PDX A;  4YDW A;  5AJL A;  5HQ8 A;  2Y4T A;  2A5E A;  2IF4 A;  1SA5 A;  5C1D A;  2ILR A;  3LCA A;  2XRZ A;  4GAA A;  1LTX A;  4A3V A;  5KCM A;  3TXN A;  4UQZ A;  3FHE A;  1IHB A;  3QWW A;  5AIJ A;  3CVV A;  4JVS A;  3JQ1 A;  2P9K G;  3SGH A;  1NA0 A;  2X6I A;  3E34 A;  3CVY A;  4WNE A;  2L6B A;  4HXI A;  1TNU A;  2JAB A;  1H2U A;  4LRZ A;  2UWJ G;  3MA5 A;  3JUI A;  3UM2 A;  2CFZ A;  4GZ5 A;  2H6G A;  3QAR A;  3L16 A;  4BSZ B;  2DYS E;  2V4H C;  4BES A;  4ZHB A;  3DPY A;  4C48 B;  3IHY A;  3QAQ A;  5FZQ A;  3LEW A;  2DWZ A;  4UWL A;  2XEH A;  1S0P A;  1FPP A;  2XPI A;  3UPV A;  3T8M A;  2AXZ A;  2EIL E;  5EYL A;  4FHJ A;  4G8L A;  4KYO B;  2E2E A;  4JW1 A;  4EQF A;  2EIM E;  3TG5 A;  2MHK A;  5E75 A;  3CHR A;  3S7F A;  2Y3A A;  1RW2 A;  1E8Z A;  3PZ4 A;  4IRU A;  4GZC A;  1HZ4 A;  4HVB A;  3FP3 A;  2WXN A;  3FTS A;  3E32 A;  2DVW A;  1FVF A;  2KXP C;  2HE0 A;  3R7R A;  4G1T A;  3FUI A;  5ENO D;  1KT0 A;  2WXG A;  3BUA A;  1UW4 B;  4J7W A;  3D9L A;  4GCO A;  4JHJ A;  1MX4 A;  3FU3 A;  3SBS A;  2J4D A;  3RRU A;  2A4Z A;  3FH7 A;  3BQO A;  1NA3 A;  1O1T A;  4DK5 A;  2FEZ A;  3FU5 A;  3PRE A;  2IOS A;  2Y69 E;  4HRN A;  1X81 A;  2OVB A;  3UIO C;  2VTB B;  4U07 A;  5ARF A;  1X5B A;  1EYH A;  4XEI G;  4TRQ A;  3RU0 A;  4DUI A;  1KT1 A;  4BET A;  3CHP A;  1S63 A;  2NXP A;  5JJ6 A;  4EZJ A;  3U4T A;  2E0I A;  2B6C A;  3CGH A;  3IKO B;  1OT8 A;  4FC8 A;  1LF8 A;  1PAQ A;  3LXU X;  1HS6 A;  4BER A;  5A23 A;  3URZ A;  1OWN A;  1SVX A;  3ZEF A;  1SZ9 A;  4F1P A;  3CV0 A;  3SO8 A;  3HXD A;  2JLB A;  3FEY A;  4J8E A;  4JEH A;  4U0S A;  2DZO A;  5FTP A;  2IOL A;  3HVE B;  2QYU A;  3OTN A;  4HB5 A;  1JPL A;  1YYH A;  5ANR A;  3G2V A;  3R9M A;  5DIZ A;  5KJL A;  4GA1 A;  5CBO A;  3UM3 A;  4A1G A;  5CER B;  3FUN A;  1O5M A;  3PZ3 A;  4FHK A;  1N4P A;  3OXF A;  4J8Y A;  5BV0 A;  5CRU A;  4C0E A;  1UG3 A;  2H6F A;  2CG3 A;  2FO1 E;  4N2S A;  2LNI A;  3B95 A;  3FUK A;  2AJA A;  2CG2 A;  5JA4 D;  2EQX A;  3CLJ A;  2RFM A;  2P2C P;  4V3I A;  3S7D A;  2PNN A;  1HO8 A;  3JYS A;  2WMN A;  4BTA A;  3KS2 A;  3RRN B;  4I6G A;  5BW8 C;  1BD8 A;  1SQM A;  3JQ0 A;  1O1R A;  1K8K G;  2I2O A;  4MS6 A;  1O1S A;  5BNW A;  4OYS A;  3KSQ A;  3DXK G;  4W9R A;  4YVQ C;  5LX8 A;  3O48 A;  4GZ3 A;  1N11 A;  2J08 A;  4WNF A;  1IHG A;  3DSW A;  3GW4 A;  4GTO A;  2R5S A;  5HRY A;  3TAX A;  4Q94 A;  3AU4 A;  2OEV A;  3LY8 A;  1HFA A;  3VLD A;  2LAH A;  2R17 C;  1H6P A;  5EKQ D;  3SNX A;  2DYR E;  2YHC A;  3MEK A;  5H7P A;  5LCW J;  1RZ4 A;  3TWW A;  5J08 A;  5ENT D;  4UWF A;  4JHK A;  2Y0B G;  3PZD A;  2I1K A;  2L6J A;  3FTV A;  5A6C A;  3UMV A;  3CHM A;  3QK0 A;  5CCL A;  1SW6 A;  3CKC A;  1YCS B;  2ETC A;  4ZFH A;  4E85 A;  3ESL A;  1P5Q A;  2RD0 A;  3DSS A;  2VGX A;  1A17 A;  2MOW A;  2FO7 A;  1WAO 1;  3D9N A;  4I1O B;  3FTY A;  3AAA C;  4R7L A;  4B94 A;  1L5J A;  3QKY A;  5IY5 E;  5G04 J;  4B93 B;  3B13 A;  5BPP A;  3KEA A;  5LOZ A;  1EF1 C;  4EZK A;  2X6J A;  3ULQ A;  3FUH A;  4ILH B;  3QWP A;  3AU5 A;  3W9G A;  1EPU A;  1Y8M A;  3B7U X;  5HS0 A;  4DX6 D;  5KJM A;  2LO6 A;  3APF A;  5DBK A;  5BXO A;  1HF8 A;  3AS4 A;  5CMW A;  2KCK A;  1ELR A;  2R59 A;  2QY7 A;  2IO2 C;  2XS8 A;  4F1S A;  3Q75 A;  3FUE A;  1Z3X A;  1E90 A;  4FU3 A;  2J8S D;  2IJG X;  3ZXP A;  4JB8 P;  1XNF A;  3QWV A;  2YNQ A;  2F0Y A;  2JEK A;  2C2L A;  1H19 A;  1Z6T A;  2X6K A;  3HIZ A;  2WXH A;  1OWL A;  3PRZ A;  3Q4A B;  2WQ6 A;  4L2L A;  4C0M A;  4GMR A;  2HYZ A;  4Y6W A;  3HHM A;  1DCE A;  2OV8 A;  5G05 J;  5FQ4 A;  3J5Q B;  4XI9 A;  3CK9 A;  1OWO A;  4DI4 A;  3B7B A;  1K3Z D;  3GZ1 A;  4KZ0 A;  2WXR A;  4CGV A;  3RKV A;  3TWR A;  2X38 A;  3ASG A;  4QQI A;  2LXL A;  4U04 A;  4XE0 A;  3FU0 A;  4B8A A;  4B89 A;  2XEN A;  3ZIM A;  2MRI A;  3ML8 A;  4HOU A;  1INZ A;  2DBA A;  4XI0 A;  2YQ8 A;  5BV1 A;  4L2Y A;  2EIJ E;  3ENE A;  4JC8 A;  4GTS A;  4GCN A;  2VQ2 A;  1IYG A;  2NSZ A;  4IYP A;  5ITZ F;  4EZL A;  3IEG A;  2XGM A;  4PS8 A;  4K03 A;  3FH8 A;  3FTZ A;  4U8H A;  2WXM A;  4RG9 A;  2WXP A;  5AQA A;  3AG4 E;  1OCC E;  4AY5 A;  1DNP A;  2X3M A;  2GGF A;  2VTB A;  5G2N A;  1HE8 A;  1MX2 A;  5FQ6 A;  4BSX A;  3UTM A;  4HLE A;  1MJ0 A;  2DCP A;  4L7T A;  2QZA A;  3UT8 A;  3ULE G;  3VTY A;  5BUZ A;  4TV3 A;  5BXU A;  4AY6 A;  1HG2 A;  1OUV A;  4RLY A;  4N5Q A;  3S7J A;  4LCT A;  3FTX A;  4H7X A;  1N0R A;  1H2T C;  1LD8 A;  3MKQ B;  2B0O E;  4CYM D;  3PNT B;  5ENN A;  3EU5 A;  2V5F A;  3UT4 A;  2I1J A;  4M3O A;  5LP0 A;  3ABK E;  1NI1 A;  5JHB A;  2KM4 A;  4Y6C A;  3DSV A;  1QZ2 A;  5ENR D;  4GPM A;  4ANU A;  4XKC A;  5AN8 A;  4N3B A;  3C5R A;  3V79 K;  3IV0 A;  4JA9 A;  5FT9 A;  4UQY A;  4BT8 A;  3HVE A;  3VLF A;  4RG6 A;  2C0M A;  3Q78 A;  2LSV A;  4WND A;  4FP7 A;  4URK A;  3LS8 A;  1WY6 A;  4U8V D;  5D0O D;  4FJY A;  4J8S A;  2RKK A;  3APC A;  3CHS A;  2BKG A;  4RVB A;  4TXP A;  4O60 A;  3HRA A;  4EBA A;  2GRO B;  4D10 C;  4U0U A;  3L6A A;  4O6F A;  3TWU A;  2FI7 A;  2P9L G;  3Q73 A;  3C98 A;  3CHO A;  3ZUV B;  4ANW A;  4DLO A;  3G2W A;  3NAW A;  3C3Q A;  2YIN A;  2Q7F A;  4CEM A;  3C3R A;  3D9I A;  4B8C B;  3NBN B;  3NB2 A;  4GZD A;  5D2M C;  4K5C A;  1KPS B;  4L1B A;  3L9T A;  3F6Q A;  3SFZ A;  2YHE A;  4G2V A;  1TN7 A;  1NZN A;  3UX4 A;  1JWF A;  3KAE A;  4U96 D;  1FT1 A;  2MYO A;  2WQ7 A;  3J5P A;  2V8S E;  4GYW A;  3FTW A;  4NUR A;  4KMO A;  4LNU D;  1KLX A;  1Q2Z A;  5D0Q D;  2XEE A;  2BED A;  5JJ7 A;  3LVR E;  3RRM B;  3EIQ C;  3CVX A;  4J8D A;  4GTV A;  5CED B;  2XEV A;  4CDN A;  4GYY A;  1JCQ A;  4KXK B;  4F3V A;  4TXR A;  4LEU A;  3SY2 A;  3SFX A;  3ASF A;  4HI9 A;  4PH4 B;  3MYV A;  4NQ0 A;  4UWK A;  3NZS A;  1QBQ A;  3HXF A;  3TJP A;  3ZXS A;  3HXC A;  3Q79 A;  4MLP A;  4TUM A;  2WB2 A;  4L23 A;  3PEU B;  4HOR A;  4K5A B;  2LAI A;  3LJN A;  3PH0 C;  4BX8 A;  3VTX A;  2KCL A;  1TYQ G;  4GB9 A;  5AQB A;  4DRX E;  3CR3 A;  1S70 B;  2H6H A;  3L13 A;  5AYW D;  3ASN E;  2J49 A;  3QNK A;  3I4G A;  1UN8 A;  3PS6 A;  3CK7 A;  2NC9 A;  3CK8 A;  3DRA A;  1AP7 A;  3ZFW A;  4I1M A;  4LNG A;  3CVQ A;  1ZB1 A;  3JCK C;  3EDT B;  3PUJ A;  3PEV B;  3FUJ A;  5LCW C;  3UIP C;  2GRL A;  3UKR G;  3BEE A;  2P9U G;  4G8K A;  3LKU A;  3CST A;  3EHQ A;  3R9A B;  3X2Q E;  3G2T A;  5AAO A;  1QQE A;  2ZIS A;  3S7B A;  3LPZ A;  1TR4 A;  4U95 D;  2QYJ A;  4BEP A;  4MBG A;  1BU9 A;  1A5E A;  3L82 A;  2F8X K;  3AG1 E;  3G2S A;  3ASO E;  3CKB A;  5AQ9 A;  2DIW A;  5FZR A;  4ACL A;  3FUM A;  1K1B A;  1E8Y A;  2BKK B;  4I9C A;  4G24 A;  3PE3 A;  5G04 C;  3KEZ A;  1U3D A;  2Y1L E;  1E8W A;  4DPR A;  1DVP A;  4UI9 J;  4K0R A;  2CFU A;  5EYP F;  4I6J A;  4Z68 A;  3D9K A;  4AEZ C;  2VGY A;  4A63 B;  4GTT A;  4H7Y A;  4WWP A;  1DC2 A;  3LY7 A;  3ABL E;  2HR2 A;  3Q7A A;  5CRV A;  3QC1 A;  2CHX A;  3ML9 A;  3QJZ A;  3DBS A;  2P58 C;  1YA0 A;  4HRL A;  5AJD A;  2AWI A;  1ELW A;  5JHA A;  4N3C A;  5EIL A;  4GA2 A;  3DPD A;  3ONK A;  2M63 A;  3UI2 A;  4F7A A;  3ZU7 B;  3C72 A;  3CIA A;  3ZW3 A;  1IXV A;  3Q49 B;  3T9K A;  3DSU A;  5EID A;  3D9P A;  4UI9 K;  5KJN A;  3TG4 A;  4GYO A;  4CZ2 D;  3CVN A;  4ILI A;  5G05 C;  4DX1 A;  4AIF A;  2OCC E;  3CQG B;  3LY9 A;  1HG5 A;  3ZHE A;  4AVX A;  4JHR A;  4I17 A;  2C0L A;  4I2W A;  3E4B A;  1SA4 A;  2FUL A;  1H0A A;  5KNG A;  4EHM A;  3KD7 A;  1AWC B;  2VSO E;  3SQV A;  1JWG A;  4UQX A;  3D9M A;  2R03 A;  1OCZ E;  4GTP A;  3CVW A;  3DXM G;  3Q5M A;  3ZYM A;  4F6R D;  2J4B A;  3UT7 A;  3K9I A;  2OND A;  3P2B A;  1ZBP A;  3FY4 A;  3I5P A;  4IUL A;  1IQR A;  2IU1 A;  3ZNG A;  3L54 A;  4FLB A;  1U3C A;  4WAF A;  5FJY A;  2P9S G;  2IQC A;  3N71 A;  3T5V A;  3MCX A;  4PS7 A;  3D9O A;  3T8K A;  1V55 E;  4CDR A;  5FZS A;  2L0I A;  4HFG A;  2WXO A;  3MKR A;  5KBA A;  2BTD A;  4N3A A;  4FUL A;  3PE4 A;  4JD2 G;  1TJC A;  2UY1 B;  5CCM A;  4AOF A;  3BG0 B;  2XZD G;  2Y4U A;  4U63 A;  3FEX A;  3I3N A;  3CHQ A;  4NAC A;  5ARG A;  1OXJ A;  1KZO A;  3IBE A;  2BUG A;  1S64 A;  3HXB A;  3EUV A;  4CRW A;  2V4L A;  4APF A;  3PZ2 A;  3ABM E;  1HX8 A;  1TNZ A;  3Q9N C;  3QDN A;  3OAW A;  4JXT A;  4BX9 A;  2XGO A;  4L9P A;  3VLE A;  2ZU6 B;  3GZ2 A;  4HBD A;  5AEN A;  3D3M A;  3SD5 A;  5T8I A;  4XZ4 A;  4QFV A;  4BWR A;  4DX7 D;  2AXV A;  4DLQ A;  2V5Q C;  4OAU C;  5FWQ A;  2KC7 A;  3G2U A;  3NOG D;  4GTR A;  4U8Y D;  4NRH B;  1PC2 A;  2WXF A;  2VSX E;  3NZU A;  4Q96 A;  2PL2 A;  4N2Q A;  3FWV A;  4KVM A;  2WPV A;  1H6K A;  2GRQ B;  1BPO A;  4WNG A;  4KZC A;  1W3B A;  2LUH A;  4HOS A;  3CVP A;  1TEZ A;  3OXG A;  4GTM A;  4B0Z A;  4ABN A;  2VSN A;  5KJK A;  4XX5 A;  3NOC D;  2XGS A;  2PM6 A;  4DI3 A;  2IO3 C;  1TNY A;  1XGW A;  1N4R A;  3DEP A;  5ENP D;  3LDZ A;  4LNB A;  4GPK A;  4OAV B;  3I4R B;  4OVU A;  4FA6 A;  4K5B A;  3BU8 A;  2VGX B;  1IQU A;  5EIB E;  3SI5 A;  4A3T A;  3MJW A;  1JUQ A;  3SFY A;  1UN9 A;  4DJA A;  4C9B B;  1NFI E;  1MQS A;  2RFA A;  4U0Z A;  4HNA D;  3V2X A;  3Q47 B;  4ACK A;  1D8D A;  1BLX B;  3UQ3 A;  2AW6 A;  2OVF A;  3CEQ A;  3E30 A;  3SHF A;  1LD7 A;  4EBA G;  4JZY A;  2GRM A;  2HM8 A;  5B1B E;  4XKB A;  5ENS D;  3MX3 A;  1WM5 A;  5FIN A;  4UWH A;  5LFA A;  5JMN D;  4HI8 A;  3QOU A;  5G55 A;  1MYO A;  3RIB A;  3JXJ A;  2XCB A;  3U9W A;  3NQP A;  4LER A;  2P9I G;  2J9Q A;  4LG6 A;  2F8Y A;  3IHV A;  3B7T A;  1FT2 A;  1D9S A;  1YMP A;  4RSY A;  2PZI A;  3B7R L;  3TWT A;  1D8E A;  4O1P A;  2VYI A;  1QNF A;  4GML A;  3PVL A;  3AS5 A;  2ZGG A;  1TN6 A;  5CEA A;  2GRN B;  4U7E B;  3TXM A;  1H2V C;  1OCR E;  3FTU A;  3UKU G;  2WXI A;  4EEC A;  2KZT B;  3ZN3 A;  1N52 A;  1E7V A;  3DWL G;  1NP7 A;  4N5C A;  2EIN E;  4I43 A;  5EX0 A;  2XS1 A;  3ZYL A;  2WQH A;  2IY0 C;  1JCS A;  4FLH A;  2P9P G;  3UIN C;  2F37 A;  2VJ8 A;  2WMO A;  1TNO A;  3ESK A;  3TWV A;  4GTQ A;  2GRR B;  1OY3 D;  5BT1 A;  4LSZ E;  3RSE G;  3TWX A;  1TNB A;  3PNL B;  3AS8 A;  2PM7 A;  4F53 A;  3FUL A;  1SZA A;  4JEU A;  3FUF A;  3HXE A;  2WXQ A;  3BG1 B;  2WXL A;  4GZ6 A;  4UWG A;  4ILG A;  1E96 B;  4YDO A;  4CT4 A;  4BTB A;  4UI9 C;  2RG8 A;  2XCC A;  4ATZ D;  5FQ8 A;  5E76 A;  1VDY A;  1MHQ A;  3RAU A;  5C2Y A;  4ANV A;  4KVO A;  4JL0 A;  4ANX A;  2GRP B;  1FVH A;  1UJJ A;  4TUU A;  2WM9 A;  2ETA A;  2H6I A;  1ZU2 A;  3W9F A;  2VGE A;  1TN8 A;  3GYZ A;  3FFL A;  3Q9U C;  1N9A A;  3TWQ A;  2FBN A;  3DST A;  3EHR A;  5EDS A;  4PUC A;  4G23 A;  5AQ7 A;  4TXQ A;  5AAR A;  3UXG A;  4HLL A;  3MV2 B;  1HXI A;  3U64 A;  2CHW A;  2PQN A;  2P9N G;  3TGO A;  3CSF A;  4FAD A;  5HI7 A;  2VSY A;  2L0T B;  1JCR A;  4MKT A;  5EX3 A; 
#chains in the Genus database with same CATH homology
 3FTZ A;  4U8H A;  5E75 A;  3CVW A;  1ELK A;  2WXM A;  4RG9 A;  3CHR A;  3Q5M A;  3S7F A;  3ZYM A;  2WXP A;  5JJT A;  2Y3A A;  2UY1 A;  1E8Z A;  2J4B A;  2WVI A;  3UT7 A;  4AY5 A;  2ION A;  3K9I A;  1DNP A;  4IRU A;  2OND A;  2X3M A;  2GGF A;  2VTB A;  5G2N A;  1HE8 A;  3ONL A;  1HZ4 A;  3P2B A;  4GZC A;  5FQ6 A;  4E6H A;  4HVB A;  1ZBP A;  3EHM A;  3FP3 A;  3FY4 A;  3I5P A;  3LVQ E;  2WXN A;  1IQR A;  3FTS A;  2XRY A;  4IUL A;  4BSX A;  2IU1 A;  3TL5 A;  2CHZ A;  4HLE A;  2DCP A;  1FVF A;  3L54 A;  4FLB A;  4L7T A;  3ASH A;  4WUY A;  2IFU A;  3R7Q A;  3UT8 A;  3VTY A;  1U3C A;  4WAF A;  5BUZ A;  3R7R A;  1HH8 A;  4TV3 A;  5FJY A;  4AY6 A;  4G1T A;  1HG2 A;  1OUV A;  3FUI A;  4AJW A;  2IQC A;  1KT0 A;  2WXG A;  3N71 A;  3T5V A;  2I9C A;  3S7J A;  1UW4 B;  4J6I A;  4LCT A;  3FTX A;  3D9L A;  3RJV A;  4GCO A;  3MCX A;  4H7X A;  4JHJ A;  2WXK A;  4PS7 A;  3FU3 A;  1H2T C;  3ZVV A;  3D9O A;  3NF1 A;  3CQC B;  3SBS A;  2J4D A;  3MKQ B;  4CDR A;  3APD A;  5FZS A;  2L0I A;  3S2A A;  4A1S A;  3PNT B;  4HFG A;  3RRU A;  2WXO A;  5ENN A;  2A4Z A;  2V5F A;  3FH7 A;  3MKR A;  2BTD A;  4N3A A;  2I1J A;  3UT4 A;  1NA3 A;  4FUL A;  3PE4 A;  4M3O A;  4DK5 A;  5LP0 A;  5JHB A;  2FEZ A;  2KM4 A;  4Y6C A;  1TJC A;  1QZ2 A;  3FU5 A;  3HDX A;  2FF4 A;  2UY1 B;  3P1U A;  5CCM A;  3PRE A;  3ZYQ A;  4AOF A;  4ANU A;  3BG0 B;  4XKC A;  2IOS A;  4APO A;  4N3B A;  2Y4U A;  3MGB A;  2OVB A;  4U63 A;  4YVO A;  3FEX A;  4U07 A;  2VTB B;  3I3N A;  5ARF A;  3CHQ A;  4NAC A;  1X5B A;  5ARG A;  1EYH A;  3IV0 A;  4JA9 A;  3IBE A;  5FT9 A;  2BUG A;  4TRQ A;  3RU0 A;  4G25 A;  4UQY A;  4BT8 A;  3HVE A;  1KT1 A;  4CRW A;  3VLF A;  4CT0 A;  2V4L A;  4RG6 A;  3B7S A;  2C0M A;  3CHP A;  4APF A;  2LSV A;  3RO2 A;  3L17 A;  2NXP A;  1HX8 A;  4WND A;  4FP7 A;  4BFR A;  5JJ6 A;  4URK A;  3LS8 A;  1WY6 A;  2LSU A;  5D0O D;  4FJY A;  4J8S A;  4G26 A;  3QB2 A;  2PQR A;  3APC A;  4EZJ A;  3U4T A;  2E0I A;  3CHS A;  3SD5 A;  3CGH A;  3IKO B;  4HS2 A;  3QDN A;  3SBT B;  4FC8 A;  4RVB A;  2J09 A;  1LF8 A;  3OAW A;  1PAQ A;  3ZPJ A;  3LXU X;  4JXT A;  4BX9 A;  4EBA A;  2XGO A;  1HS6 A;  5A23 A;  3URZ A;  1OWN A;  1OWM A;  4D10 C;  3VLE A;  2ZU6 B;  3GZ2 A;  1PY1 A;  4GU5 A;  3ZEF A;  4U0U A;  3L6A A;  4O6F A;  5AEN A;  3D3M A;  1SZ9 A;  2FI7 A;  2KAT A;  2KCV A;  3C98 A;  3CHO A;  1UJK A;  3L22 A;  1OWP A;  4XZ4 A;  5T8I A;  3G2W A;  4ANW A;  4DLO A;  3U3W A;  3CV0 A;  2YIN A;  4I2Z A;  4N39 A;  4QFV A;  4BWR A;  2JLB A;  2Q7F A;  4CEM A;  4JPS A;  2AXV A;  3D9I A;  3MKQ A;  4B8C B;  3FEY A;  4DLQ A;  3LJ3 A;  3EJN A;  4J8E A;  5ANL A;  4JEH A;  4U0S A;  5FWQ A;  3ZYK A;  4GZD A;  5FTP A;  4AV7 A;  2KC7 A;  2IOL A;  5T4Y A;  4L1B A;  3G2U A;  3HVE B;  3EIJ A;  3U66 A;  3SFZ A;  4WWO A;  4NRH B;  1PC2 A;  4OVV A;  2WXF A;  3OTN A;  2VSX E;  3NZU A;  4XIF A;  2YHE A;  4Q96 A;  2A5U A;  4G2V A;  1NZN A;  2PL2 A;  1Z3Y A;  1JPL A;  4N2Q A;  2GW1 A;  3FWV A;  4KVM A;  3UX4 A;  4I1A A;  5ANR A;  3G2V A;  2WPV A;  1JWF A;  5DIZ A;  5KJL A;  3KAE A;  1H6K A;  4GA1 A;  1BPO A;  4HOQ A;  4A1G A;  2WQ7 A;  4WNG A;  3FH5 A;  4KZC A;  1W3B A;  2XPY A;  3FUN A;  4HOS A;  1GW6 A;  3CVP A;  2V8S E;  4FHK A;  1FCH A;  4GYW A;  1TEZ A;  3FTW A;  3OXF A;  3OXG A;  4NUR A;  4B0Z A;  5BV0 A;  4KMO A;  4ABN A;  2L9B A;  2V0P A;  2VSN A;  4C0E A;  1KLX A;  1UG3 A;  4WWN A;  5KJK A;  5D0Q D;  3PDN A;  4XX5 A;  5JJ7 A;  3LVR E;  2XGS A;  3RRM B;  3EIQ C;  2CG3 A;  3CVX A;  4J8D A;  4N2S A;  2LNI A;  2PM6 A;  3SF4 A;  4DI3 A;  2XEV A;  2OOE A;  4P29 A;  3FUK A;  2XPZ A;  4CDN A;  4GYY A;  3RO3 A;  2CG2 A;  3ZGQ A;  1XGW A;  4AP2 A;  4KXK B;  4F3V A;  2EQX A;  3RK6 A;  3LDZ A;  1E7U A;  4GPK A;  3I4R B;  4LEU A;  3CLJ A;  4OVU A;  3CVL A;  4FA6 A;  2QFC A;  3ASF A;  4PH4 B;  4V3I A;  3MYV A;  4NQ0 A;  2VGX B;  3S7D A;  1IQU A;  3NZS A;  4UWK A;  1HO8 A;  3JYS A;  2WMN A;  3ASD A;  4BTA A;  3KS2 A;  3SI5 A;  3RRN B;  4MRU A;  4I6G A;  5BW8 C;  4A3T A;  1SQM A;  3JQ0 A;  3TJP A;  3ZXS A;  2I2O A;  4MS6 A;  4MLP A;  3PUK A;  4LUN U;  5BNW A;  4OYS A;  4J8F A;  2WB2 A;  4W9R A;  4YVQ C;  3MJW A;  5LX8 A;  3O48 A;  4GZ3 A;  4PS3 A;  4KBQ A;  4I9E A;  1JUQ A;  4L23 A;  1UN9 A;  4DJA A;  4C9B B;  2J08 A;  4JA7 A;  3PEU B;  4WNF A;  1IHG A;  1MQS A;  3GW4 A;  4IN3 B;  4HOR A;  4ATG A;  4U0Z A;  2R5S A;  2LAI A;  3TAX A;  4Q94 A;  3Q47 B;  3FDH A;  4ACK A;  3MZL B;  3PH0 C;  3WXX A;  3AU4 A;  2X6H A;  3UQ3 A;  2AW6 A;  2OVF A;  3CEQ A;  4BX8 A;  3LY8 A;  1HFA A;  3VTX A;  3SHF A;  2KCL A;  3VLD A;  2LAH A;  4GB9 A;  2R17 C;  4EBA G;  4JZY A;  5A7D B;  3CR3 A;  5EKQ D;  2GRM A;  2HM8 A;  5CMY A;  4I6E A;  3L13 A;  3SNX A;  1N54 A;  4XKB A;  2XHE A;  3MX3 A;  1WM5 A;  2YHC A;  3MEK A;  4UWH A;  5AYW D;  4AXH A;  5LCW J;  4FJZ A;  4G11 A;  5LFA A;  2KZT A;  3QOU A;  2BF0 X;  3T5X A;  2J49 A;  3QNK A;  4EPZ A;  3I4G A;  5G55 A;  5J08 A;  3Q15 A;  4KT6 B;  5FQ7 A;  4AM9 A;  1UN8 A;  3PS6 A;  3RIB A;  4UWF A;  4JHK A;  3CK7 A;  3PZD A;  2I1K A;  3O4Z A;  2NC9 A;  4CDM A;  2L6J A;  3CK8 A;  2XCB A;  3FTV A;  3U9W A;  4ME2 A;  3NQP A;  4LER A;  4BT9 A;  3ZFW A;  4I1M A;  3UMV A;  3CHM A;  3CVQ A;  3D9J A;  5A6C A;  3QK0 A;  5CCL A;  2J9Q A;  3JCK C;  3EDT B;  3PUJ A;  3CKC A;  3PEV B;  3FUJ A;  5LCW C;  4E85 A;  3IHV A;  4CCA A;  3B7T A;  2GRL A;  4RSY A;  3BEE A;  5CHE E;  2PZI A;  1P5Q A;  2AXU A;  2RD0 A;  3B7R L;  2VGX A;  3ESL A;  1A17 A;  2MOW A;  2FO7 A;  3MV3 B;  1TJF A;  1WAO 1;  3D9N A;  3LKU A;  4I1O B;  3FTY A;  2VYI A;  3L08 A;  1QNF A;  3CST A;  3HYM B;  4GML A;  4R7L A;  3PVL A;  3R9A B;  4GMJ A;  2J07 A;  3AS5 A;  4B94 A;  1L5J A;  3QKY A;  3G2T A;  3LYA A;  1QQE A;  5G04 J;  1B89 A;  3S7B A;  3B13 A;  3LPZ A;  3TXM A;  5BPP A;  1H2V C;  3FTU A;  5LOZ A;  1EF1 C;  2WXI A;  2I6H A;  4EEC A;  5M72 A;  4EZK A;  2KZT B;  3ZN3 A;  2X6J A;  1E8X A;  3ULQ A;  4A55 A;  3FUH A;  1N52 A;  4ILH B;  5T3R A;  3G2S A;  3CVU A;  3CKB A;  3UUX A;  1E7V A;  2DIW A;  3QWP A;  1HU3 A;  2WXJ A;  5FZR A;  4ACL A;  3FUM A;  1NP7 A;  3AU5 A;  4N5C A;  5J90 A;  4GA0 A;  4I43 A;  5EX0 A;  1EPU A;  1E8Y A;  1Y8M A;  3B7U X;  4J0U A;  4I9C A;  3ZYL A;  2WQH A;  4G24 A;  3PE3 A;  5KJM A;  4FLH A;  5G04 C;  2LO6 A;  3KEZ A;  3APF A;  2X6F A;  3ZRH A;  4CGW A;  3OXL A;  5DBK A;  1U3D A;  1HF8 A;  2VJ8 A;  3FUD A;  2WMO A;  1E8W A;  2HO1 A;  3AS4 A;  3SZ7 A;  3ZHE B;  5CMW A;  4DPR A;  4YND A;  3ESK A;  1DVP A;  3GZS A;  2KCK A;  4BY6 A;  1ELR A;  2R59 A;  2QY7 A;  5BT1 A;  4UI9 J;  1EDU A;  4K0R A;  2CFU A;  4HOT A;  1Y6I A;  3FU6 A;  4I6J A;  4F1S A;  3PNL B;  3D9K A;  3AS8 A;  2PM7 A;  4F53 A;  3FUL A;  3FUE A;  1SZA A;  1Z3X A;  4JEU A;  1E90 A;  2XQ0 A;  4AEZ C;  4Q69 A;  3FUF A;  4FU3 A;  2VGY A;  2IJG X;  2WXQ A;  3BG1 B;  2WXL A;  3EHN A;  4GZ6 A;  2AVP A;  4PDX A;  5AJL A;  5HQ8 A;  4UWG A;  2Y4T A;  1XNF A;  4H7Y A;  4WWP A;  4ILG A;  3LY7 A;  1E96 B;  2HR2 A;  3QWV A;  2IF4 A;  2YNQ A;  3QC1 A;  2JEK A;  4CT4 A;  5C1D A;  2CHX A;  2C2L A;  3ML9 A;  1H19 A;  2ILR A;  3QJZ A;  4BTB A;  3DBS A;  1Z6T A;  4UI9 C;  3LCA A;  2RG8 A;  2P58 C;  4GAA A;  2XRZ A;  2X6K A;  4A3V A;  5KCM A;  3HIZ A;  1YA0 A;  3TXN A;  2XCC A;  4UQZ A;  2WXH A;  3FHE A;  1OWL A;  3PRZ A;  3QWW A;  5AIJ A;  3Q4A B;  5FQ8 A;  2WQ6 A;  5E76 A;  1VDY A;  1MHQ A;  4L2L A;  5AJD A;  4C0M A;  4JVS A;  3JQ1 A;  3CVV A;  2HYZ A;  2AWI A;  4Y6W A;  3HHM A;  1ELW A;  3SGH A;  1NA0 A;  5JHA A;  2OV8 A;  2X6I A;  4N3C A;  5G05 J;  5C2Y A;  3CVY A;  5FQ4 A;  4ANV A;  4KVO A;  4JL0 A;  4XI9 A;  4ANX A;  3CK9 A;  4GA2 A;  4WNE A;  1OWO A;  4DI4 A;  4HXI A;  3GZ1 A;  4KZ0 A;  3DPD A;  2WXR A;  4CGV A;  4LRZ A;  1H2U A;  2M63 A;  3ONK A;  1FVH A;  4F7A A;  1UJJ A;  2UWJ G;  3RKV A;  3CIA A;  3ZW3 A;  2X38 A;  3ASG A;  3MA5 A;  3Q49 B;  3JUI A;  4TUU A;  2WM9 A;  3D9P A;  2CFZ A;  4UI9 K;  1ZU2 A;  4U04 A;  5KJN A;  4GZ5 A;  4XE0 A;  3QAR A;  3TG4 A;  4GYO A;  3FU0 A;  3L16 A;  4B8A A;  3CVN A;  4ILI A;  5G05 C;  4B89 A;  4AIF A;  3IHY A;  3QAQ A;  3ZIM A;  5FZQ A;  3CQG B;  3LEW A;  3GYZ A;  3LY9 A;  1HG5 A;  2MRI A;  3FFL A;  3ML8 A;  4UWL A;  3ZHE A;  4HOU A;  1INZ A;  2DBA A;  4AVX A;  2FBN A;  4XI0 A;  4JHR A;  1S0P A;  2XPI A;  5EDS A;  4I17 A;  2YQ8 A;  4PUC A;  5BV1 A;  3UPV A;  4L2Y A;  2C0L A;  4G23 A;  4I2W A;  3T8M A;  3E4B A;  3ENE A;  2AXZ A;  2FUL A;  1H0A A;  4JC8 A;  3MV2 B;  3KD7 A;  4FHJ A;  2VSO E;  1HXI A;  3U64 A;  4KYO B;  2CHW A;  4GCN A;  2PQN A;  1JWG A;  2E2E A;  2VQ2 A;  3TGO A;  3CSF A;  1IYG A;  4FAD A;  4JW1 A;  2NSZ A;  4IYP A;  5HI7 A;  4EZL A;  3IEG A;  2XGM A;  2VSY A;  4EQF A;  4UQX A;  4PS8 A;  2L0T B;  3TG5 A;  4K03 A;  3D9M A;  4MKT A;  2MHK A;  3FH8 A;  5EX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...