4JZYA

Crystal structures of drosophila cryptochrome
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
534
structure length
534
Chain Sequence
ATRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWLADV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cryptochrome-1
publication title Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Circadian clock protein
total genus 197
structure length 534
sequence length 534
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4jzyA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4jzyA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4jzyA01
1Q15A 1GN8A 2DEUA 4NATA 4P2BA 1O97D 1IH8A 3MXTA 4JYZA 1UFVA 3SEQA 1XNGA 1N2HA 1P7PA 3COWA 1O95D 1N2JA 3IVCA 4QBTA 4ZCSA 1YIAA 1A8HA 1XNJA 1N78A 4F3RA 2E21A 4MUNA 5TEVA 1NZJA 2CUZA 1WQ4A 2YY5A 4EG6A 2GOYA 5TGTA 1K97A 4YBRA 1I2DA 1LI7A 4MW0A 2CV1A 4EFKA 1M8FA 2D54A 1K92A 4MVWA 1J09A 5DB4A 2XRYA 1H3FA 2ZP1A 3FETA 2A4MA 3AFHA 1MOPA 4HPWA 4ARCA 1IHOA 1J20A 4L2IB 1Q77A 5DK4A 2CT8A 4H3SA 1F7VA 1KR2A 2J4DA 4FZJA 1I6LA 1OD6A 3GLVA 2VXOA 3VGJA 3CR8A 3RK1A 2HGZA 2YXNA 1X8XA 4MUIA 3DV2A 4CDMA 2PFSA 3NBKA 1CT9A 4QRDA 2HMAA 5AHWA 1NUTA 1JHDA 4JXZA 1ZH6A 3CLSD 2X1LA 3COVA 3UK2A 4ZT5A 4MW5A 2WQ6A 3IVXA 1KAQA 4RUKA 2O8VA 2NSYA 1TQ8A 3ND5A 2G36A 4R2MA 2OQ2A 4EF6A 4MVCA 3KT6A 2CV2A 3M5WA 3ZJUA 2IELA 4DDKA 3RBAA 1WXEA 4EG1A 3ZXSA 4MLPA 3KFLA 5FO1A 5LM3A 1F7UA 2E18A 1OWPA 1J1ZA 4CT0A 2QUKA 3L93A 1U7XA 3P0IA 3AIIA 3F3MA 4CQNA 1S4MA 1N77A 3CVWA 2TS1A 1OBCA 1O94C 3LCJA 5LFAA 2X3FA 2AKEA 2E0IA 4J76A 1N1DA 4S1OA 4PBRA 4BWVA 1TYAE 4DJAA 1QJCA 3Q10A 1T9GR 3A05A 4ZCTA 1F9AA 1T6YA 1VL2A 3MLAA 4KPUA 4CDNA 4OUDB 4MQ6A 1YIDA 1J70A 4U63A 3IH5A 1RQGA 4X0EA 1GLNA 1ZUNA 1NUQA 2VTBA 3RK0A 1H3EA 4EG4A 2I1LA 1WXGA 4ND6A 1EFVA 1JIJA 3IOBA 4AS1A 3GMIA 2A7XA 4G6ZA 1U7DA 2GKSA 2V0GA 2QUJA 3FHJA 3HGMA 1FYDA 1WZ2A 3HZRA 1KP2A 4WSOA 4DDHA 2CV0A 4EG5A 5FNZA 4R2LA 1TYCA 3N05A 1LW7A 3C8ZA 4WNYA 3A04A 4K03A 1JGTA 3S3TA 3TNJA 3SYTA 3NBAA 3UMVA 4MUHA 2J5BA 4U7JA 3ZJVA 1NI5A 1J21A 4XSVA 2DPLA 1G8HA 4KR9A 3CVUA 1KQPA 2X1MA 2CSXA 2DLCX 3FH0A 2YWCA 3Q12A 3DO8A 1MAWA 4OJMX 3A4IA 1MB9A 3ILVA 3SZGA 1D2RA 1O97C 3PNBA 1G59A 2QTNA 3MLBA 2PZ8A 2Z08A 2RD2A 2J09A 2NZ2A 3IOEA 3OTWA 1WXHA 3UOWA 3QTTA 3ND7A 1R6UA 4YP7A 3VU8A 1O95C 4MW6A 1J1UA 1O0CA 1PG2A 4YP5A 2EL7A 2J07A 1VLHA 1SURA 4EG8A 2GM3A 4EG3A 1M8JA 3CLUD 1GAXA 3LE8A 1Y42X 4MUJA 3FDXA 1YULA 3X1JA 3KT8A 3UY4A 1GPMA 4QREA 3HMQA 2A88A 2C5SA 1NUPA 1IQ0A 1JEDA 1YUMA 3FWKA 4ND7A 2AG6A 1M8KA 4L2IA 4ZT2A 1ILEA 1EUYA 1TYDE 4NX2A 1DNPA 1QRSA 4MUEA 3ZGZA 1VBMA 4MUFA 4EG7A 1MJHA 2A1UB 4KR6A 4MUGA 3PRHA 1JMVA 1R6TA 3LOQA 1V47A 2D13A 3ELBA 2DETA 3CVXA 3X1MA 2CYCA 1JILA 3MMXA 4MUKA 1N2GA 3SDBA 3FG9A 4NDAA 1G8GA 1TYBE 4JXXA 2XRZA 2H29A 1KH3A 2PXHA 3COZA 3IMCA 1WQ3A 1VBKA 3RHSA 2IJGX 3IODA 1U3DA 3IOCA 3HFJA 3CLSC 3H05A 1N2OA 1NYLA 1MB2A 3JXEA 3CLRD 5H16A 3ISJA 3E27A 2V0CA 1IQUA 4UZFA 1QU2A 3D6UA 3IDFA 1VBNA 4MW2A 5DASA 2PZBA 4A91A 1IRXA 1N2BA 4MW9A 2CYBA 1NUUA 1O5TA 5K0TA 1U0BB 4ZT7A 4MWDA 3AKZA 1YI8A 4MWEA 1TEZA 1EJ2A 3TZEA 1N2IA 3ND6A 5K0SA 1O96B 3CVYA 4NAHA 1K4MA 5DEOA 1OWMA 3N9IA 3UC5A 1OBHA 3FIUA 3H99A 3PXUA 4J75A 3ZXIA 2QJFA 3CLTD 1U3CA 3K32A 3ZUGA 1B6TA 1PFVA 4EGAA 1T6ZA 3H9BA 1KAMA 1XNHA 3FI0A 4MVXA 4YP6A 4HJRA 3OP1A 1K4KA 1O6BA 1WJGA 3AG6A 1OWOA 1KQNA 2WQ7A 1I6MA 4Q16A 5TS2A 1JZQA 1F4LA 3HV0A 4ZT3A 1EFPB 1T6XA 2Z09A 5EKDA 4MULA 2JANA 2PIDA 3P52A 1IQRA 1G8FA 2DERA 1ZJWA 4MW7A 2J08A 2ZUFA 1LI5A 3A2KA 2E89A 4U8HA 1TFUA 3U1VA 1JEEA 2Z3VA 1EXDA 1KH1A 5HUHA 3IVGA 5BNZA 1XJQA 4ZCQA 1V8FA 1Q19A 4PBTA 3CVVA 3DLAA 3G59A 3N2YA 4HK4A 3X1KA 1QRTA 3IMGA 1MAUA 3P0JA 3PNYA 4YMIA 4XFJA 2CYAA 5HUJA 1IVSA 3QE4A 4XFDA 4PY2A 3AL0C 2A1TS 2JA2A 4HJXA 2ZUEA 4JFAA 3K9WA 5IHXA 1QU3A 1ZH0A 5KHAA 4I6GA 1WY5A 4GRIA 4MWCA 2QTRA 1M83A 1JECA 2QUHA 4GU5A 1BS2A 2DUMA 2YWBA 3INNA 3SZ3A 1MBZA 2WSIA 1H3NA 4UZEA 3ZJTA 2BTEA 2CFOA 4G5FA 4ARIA 1KP3A 4AQ7A 4DNXA 4PBSA 1WXFA 3D6VA 3IMEA 1M8GA 2A86A 2O5RA 2QJTA 1KQOA 1WOYA 3CA8A 3CLUC 1PFUA 3QTBA 4ZT4A 3RJZA 4DDMA 2HZ7A 3DPIA 3TQIA 3G6KA 1GTSA 4F4HA 1OWNA 4ZT6A 4ZCPA 3ZIUA 1EUQA 2A1UA 1JIIA 2OV4A 1N2EA 3SEZA 1JIKA 4Q93A 1EE1A 1QQTA 5J59A 4DE5A 2B7LA 2QUIA 2IP1A 5JBNA 3G5AA 5FO0A 3TZLA 3GUZA 4DLPA 5KCMA 1MC1A 2X0KA 1Q11A 1M8PA 1H1TA 3IUBA 3KT3A 3H9CA 2R5WA 2A84A 5J58A 4KR7A 1O94D 1HYBA 2H2AA 3IUEA 2PG3A 4MW1A 3SP1A 5KWVA 4MAFA 3FOCA 4NAUA 3FNRA 1KH2A 4JZYA 5J5AA 1FFYA 3FY4A 4R0NA 3CLRC 2D5BA 1COZA 1PFWA 4TS1A 3H97A 4G5YA 1GTRA 2JAXA 1QNFA 1M1ZA 4NZPA 5LLTA 1NURA 4MWBA 5H7XA 4OUDA 2DR2A 3PNVA 4RPIA 3COYA 2DXIA 5TEWA 3VRHA 1O96A 1OWLA 1KKUA 1IFXA 4KPUB 1R6XA 1N75A 3NV7A 1NUSA 1YUNA 2BYTA 3TS1A 3KT0A 2PZAA 3MUEA 4I6JA 4MW4A 1O0BA 5HG0A 5F23A 2QJOA 2VTBB 2QTMA 3AG5A 3N8HA 3RFFA 4MVYA 1ULHA 1EFVB 1PG0A 2EJCA 1QRUA 3BL5A 1JZSA 3CLTC 5IJXA 1WKBA 1T9GS 1EFPA 4ZCRA 1I6KA 1NP7A 2WB2A 1GZUA 2A1TR 1MRZA 1NSYA 1WXIA 1N3LA 3HL4A 4K0RA 1X6VA 1KORA 1QTQA 2RE8A 4KKVA 3L92A 4E1AA 1PFYA 2AZXA 3Q4GA 3I05A 3P0HA 4I6EA 3TQOA
chains in the Genus database with same CATH superfamily
2CL0X 3J5PA 1YDWA 5CRIA 5DISB 4WERA 4EBAA 4QT0A 1JG1A 1Y33E 3EIEA 3HXMA 5EX3A 3TM4A 1QTRA 5CFZA 4GG1A 4IPTA 1KZ7B 1PG5A 4BJ3A 1A8SA 3U3RA 3EDTB 1GQQA 4L7VA 3T12A 2MDTA 1Q17A 1WPXA 1VKOA 3UWOA 5KYWA 5E76A 2P4HX 5CK4A 3HXCA 2Z2KA 4F11A 3FDIA 5E4YA 2A9KA 1W59A 1GSIA 2FF7A 2CK3A 3DFZA 5YASA 4X62B 5LB4A 3INRA 4UATA 3L6UA 5J2TA 4EZLA 4G36A 3IKOB 4EHDA 1DXOA 4LYAA 3VBCA 4F6RD 2Y1FA 3DZHA 5CDGA 1V2GA 3O73A 5ALDA 4QE3A 4MAMA 10MHA 3L6DA 2AN3A 2ZQ5A 5GY7A 4IQ0A 2ZB4A 1I0IA 4YS6A 1V35A 4Y6CA 1I1HA 1XMIA 2WHXA 2Q5CA 1PJZA 4GOOD 3T5AA 5TDHA 4HG2A 4LZZA 1X8LA 3RUCA 1CX9B 1Y4DE 1Z2NX 4HZUA 3PENA 1YOBA 1QQ6A 5ITSA 2DSTA 2R7AA 2E3JA 1LD7A 2EYQA 5BSEA 4F21A 1SOUA 5EWJA 3S27A 4JOBA 2B2XA 4GYKA 4ZRDA 2ATEA 4YP7A 1JSXA 3GG2A 2R62A 3MIIA 3FWZA 3UWDA 1C7EA 3RYFA 2FQYA 2V7PA 1ZC4A 3F98A 2QGZA 1PT7A 1FYVA 3VR6A 4OKIA 1P39A 1Q2UA 2XUHA 4HRXA 1L5FA 2ZJ5A 1VQ1A 4LXTA 3N71A 4HEA6 1E6CA 4UUCA 2QN8A 3Q3VA 1E64A 4ZMSA 5FA5A 3THYA 3FUWA 1CY4A 5JNTA 2A7QA 3CLRD 1Z0IA 3M3HA 2L0TB 4YCAA 5T67A 2NZ8A 4OXRA 3MQFA 4G56A 1XOIA 1SA0A 4MITA 2BM1A 1OILA 4WECA 2GBIA 4HMPA 4L4XA 1P4RA 1NMSA 1TEZA 1Y3FE 3PIRA 4BATA 1SQFA 3P9IA 3PUIA 3FR7A 3P2YA 1V3UA 5EJIA 1BVRA 2O3RA 3DSVA 3OZRA 1WJGA 3NCHA 2MMGA 3NS7A 3B9QA 1I32A 1HNXB 2OECA 3DEKA 4GSKA 1XUOA 4MCAA 4UQXA 1Y37A 1YZYA 2WSSA 4B94A 3GPLA 1PW5A 5JC1A 1F6BA 3HFSA 2IXFA 1R00A 3IAXA 4PBTA 3QEBZ 2PUCA 3C1TA 1MGOA 4GTTA 3CV3A 3VX3A 4M83A 2YHAA 3R7BA 4PTLA 1RLTA 3U7EB 3O4FA 3E5HA 4L8LA 4UVIA 3OD5A 3CEAA 3RAGA 5JALA 5I9TA 1KQOA 4LHWA 3S1AA 1Z8DA 3VOBA 4AJ1A 3RW9A 2J31A 3STTA 5ALLA 2A1UA 2V74B 5DT9A 3WLAA 2P9SG 4WN3A 4MQ4A 1YR1A 4WXHA 1E77A 4YDEA 3TCXB 2HX1A 1QG0A 5M04A 1CQWA 1M8PA 3BX1A 3DC2A 4WWHA 3U0BA 2NQ8A 3H83A 1JXMA 1KH2A 3ZY6A 4R69A 3AUAA 3NJ4A 1PZGA 1EJ6A 1OT3A 3BK7A 5J63A 4PSKA 1R18A 3NWOA 1N75A 4TRMA 2FW7A 4YLGA 5JMWA 2H3EA 4DLKA 3AESB 5FI1B 2R48A 5GM1A 4YJ2F 1GEEA 3H86A 4WUVA 2WB2A 3PNQA 5JYEA 3AI7A 5MDHA 4KHZA 4LY9A 3IAS1 3KUDA 1E59A 4HQ0A 1H0AA 1QO9A 4QXAA 4WOKA 2BUBA 4RANA 1EJ0A 3O4RA 1YGYA 1JQAA 5KYUB 3H16A 3IPLA 3PUJA 5ER9A 4EFKA 3ECSA 5F3WB 4FKMA 1QM5A 5D3ZA 2YYZA 5DT2A 5KTRA 1CZHA 2PNJA 2JFFA 5CAEA 1ZIPA 4AMVA 3FMOB 1Z5OA 2PUWA 3H1AA 3VGJA 3WO1A 3R9IA 3BQOA 1G3QA 4LDPA 3QI2A 2PXCA 4EPYA 1U8EA 1SPBS 1W5TA 2ERXA 2XCSB 3BGSA 3L0SA 3GRUA 1Q0LA 3D7MA 2WG1A 3V1YA 4F3CA 2HTFA 4OAUC 1PAUA 2DTDA 2GXUA 5EYPA 2Y4TA 3EXG2 3Q10A 1CJBA 2GZHA 3F4KA 4BB5A 3RS4A 1IN5A 1KHTA 2H92A 3UXHA 2PJZA 2XXAA 3PHIA 3BIOA 2X0RA 2PWPA 4PPFA 1N5MA 1AA6A 4P3OA 4DQKA 1AD2A 1UMBA 1LPOA 3CG0A 2O0JA 4J49A 3VU3A 2G0TA 1C1DA 4GPTA 1UZUA 1O4VA 1G55A 2RD2A 3IX7A 3IOEA 1C3XA 4OLAA 2YBDA 1SURA 2ZPAA 3DCNA 4ARBA 3ZOZA 1EX7A 2IYYA 1GKIA 2XBLA 4KUGA 1UEIA 4BFCA 1M8KA 4MLDA 4AX8A 2NO0A 4X54A 1SOAA 3QELB 1EUYA 3EZNA 5TR9A 4LG1A 4F6CA 4ANUA 1D0SA 5SZHB 3WRYC 2HJSA 1RACA 3NM4A 4L75A 1O5MA 3SDBA 5H3HA 4JOCA 3T4XA 2HYDA 1EQUA 2OV6A 2ZR7A 4BGEA 3C3OA 2VA8A 5I7HA 1RWXA 3DE5X 1M0EA 1GQ2A 4TZ0A 1K3ZD 2IYOA 4HH3C 4ZU1X 3ETGA 3R7LA 1U11A 1BMQA 2I1QA 2RHJA 2C7RA 5AIJA 2CYBA 1VE5A 3DDHA 3LFUA 4RDCA 4BEVA 5G0SA 5IAOA 1GO2A 3IULA 5BPPA 4K9OA 2UZ1B 5KWIA 1XLTA 3OIWA 2FUNB 1U2VG 4CM1A 5KSOA 5CNMA 3S7BA 2ECQA 2HIAA 2VJAA 1KEKA 5KKNB 1BU8A 3UPDA 2HLDD 1XD8A 4XM0A 5EKDA 1ZN7A 2C2XA 1ZS9A 2ZANA 1LI5A 3U7RA 3TW6A 3KS9A 1D2MA 1JPVA 3JZMA 1DC8A 1QG6A 2ZI6A 3H04A 4KDCA 3GR6A 3SQVA 5I9NA 3N2YA 2AI1A 3U4DA 1KKLA 3RVPA 3T5VA 2XMGA 2ZUUA 3KEQA 3FPJA 4MJXA 1FSFA 1YA0A 2VHUA 4ILGA 5KC9A 4YJKA 4BJ1A 2VDPB 4UXHA 3ENWA 4ARZA 4OP2A 3WXXA 3IPRA 2WJWA 3BQMB 3TLZA 3OKCA 4BKPA 3R2JA 4TN5A 1K98A 2AK2A 4F4HA 4QLAA 3UAXA 3QNMA 2JFXA 3CVJA 4N9QA 1GDHA 1GCAA 3TLGA 4Q3CA 3GIDA 2B7LA 4TV9F 1RABA 1EXMA 4JLMA 3PGJA 4PQRA 2DH6A 4KCGA 1XU4A 4FLFA 4LISA 1YMUA 4X1IA 2OVBA 2C2KA 4GXRA 2ICAA 2FUKA 3ZHYA 2CLFB 2MYOA 3TDNA 2Q5FA 2V6IA 5ALUA 1RI5A 2FSGA 1NQ5A 5KVQA 3DVRX 2Y1GA 3KWMA 4G0WA 1E92A 5MN5A 3R0VA 2AEFA 1Q7CA 1FFXB 2X9NA 5DOVA 3KXKA 4UVDA 3EWIA 2KI5A 2QZ9A 1VA4A 4DMHA 3RFFA 2JFNA 1B0UA 1QRUA 1ZRMA 3GUYA 4PX9A 3U1BA 1K08A 3WL4A 2XS1A 2AJDA 4N01A 5ERYA 4E6EA 3NC1C 3HMKA 2C7OA 4XJVA 4I6EA 4TM7A 1MHPA 1ZEMA 3VZDA 3L82A 2P3OA 4P2BA 3OQIA 1OPRA 1SFRA 5DULA 3X44A 4WFKA 4OSPA 1Z8NA 3NWPA 4H27A 2V7GA 3MMSA 1GVNB 3RFTA 5TGTA 3FTNA 3AI3A 4B84A 1BWSA 3IUPA 2ZYWX 2NX2A 2IZ7A 1DLIA 1YVPA 3BF7A 1VI6A 1KO7A 3AILA 4PLCA 2DYRE 3VA7A 1GRCA 4GUDA 1CVIA 1ZVJA 2CNKA 5AOVA 5C4GB 3PXCX 3LHIA 3TNDA 2HLPA 3EGOA 3VYSB 4WNDA 1N6RA 3CPEA 1RWWA 3MV3B 1RAFA 3V7FA 4RIGA 1HMYA 1ORVA 4C0MA 2I4MA 3DONA 3DUFA 1V7CA 5JAQA 4ZOCA 5LFAA 3M6FA 4RPGA 4JNCA 1TYAE 3E48A 4X97A 4UOQA 3RBZA 3Q11A 1ZVKA 2XNDD 5JXIA 1XJ5A 2IHJA 3IE1A 1VGRA 2WVHA 4DPMA 3HJUA 4IQGA 5IP5A 1A17A 4LHEA 1JIJA 4OXKA 5AJXA 2AMLA 4X64B 2FFJA 3ZUPA 3KE9A 1A5BB 1XSEA 4MKZA 1BD4A 4C5CA 3WIVA 2ZRJA 1VXOA 3Q7AA 1MAWA 2PH7A 4DMLA 1HORA 3DOIA 3AUYA 4KJZA 3UHFA 4XGNA 3BRSA 3RREA 1BGXT 4MW6A 3OU2A 2JVIA 1ESNA 1B76A 2QVBA 1KAHA 2WF9A 3I9OA 2Q5EA 4L3WA 5DYIA 4AVXA 2NQTA 2QLNA 4CKEB 2IEGA 1U3WA 1SQ6A 3DC7A 2UAGA 3ZC3A 4BEPA 4H6WA 4MROA 4U8GA 3D59A 1TU4A 4IIBA 1Z25A 2OORA 3GCWA 3ZI7A 1MIOB 4S1PA 3VUEA 1ID1A 3KOXA 2ZE7A 4BEBA 3KXDA 1T4BA 2G1KA 3ITDA 1H4QA 1J8VA 3TPZA 3AHCA 2GASA 3CJRA 4F3NA 2IYPA 3HG0D 2WZCA 3ZXIA 4KJXA 4KWTA 5FEMA 3BRWD 1K5PA 1G4UR 4XCVA 5AVXA 1E5XA 4ROSA 1FS5A 3RGGA 3H18A 1IEXA 4I5DA 1Q0SA 3ROZA 5HIIA 1POXA 3ZHRA 1TYZA 2W11A 3QMMA 5HYVA 3N7UA 4FU0A 4NBWA 4AZWA 4CU5A 2EC5A 3AZQA 1XMXA 1AV6A 5A7HA 5FTLA 2K2QB 1IVSA 3PJDA 3N2GA 2AJLI 2OO5A 3GJSA 2BBTA 2FN9A 1GQYA 3HB5X 2EFJA 2IPNA 2QS9A 5BSUA 4H15A 4CMEC 1LNSA 4KPEC 1SOWA 1UJ5A 3MZ0A 3NBQA 4QFBA 1N92A 2PGJA 2IW3A 4IHJA 3D9OA 4TQUS 2BKGA 3CHPA 4QO8A 4ESOA 3NHFA 3ETDA 2J3JA 1L8OA 4G23A 4EQZA 4LJ4A 2WA2A 2DHRA 3GUZA 1VI5A 4H3KB 4NNJA 5BV0A 3FUJA 3FZEA 2CUTA 3W0LB 4DAOA 2VBCA 2MSWA 1S2LA 1PN3A 3IEXA 4ITUA 3QW2A 1G7RA 4KX3A 3WGHA 3EUWA 2PMEA 3B6KA 1VPEA 1JS1X 3TZBA 3UCEA 2LSUA 1WSWA 2VRCD 1JIXA 1DCKA 2ZT8A 3KQQA 4U2KA 1GAQA 1ZNYA 2CVFA 3L04A 5TRTA 1R6XA 1U1EA 1PNQA 3MUEA 3QLEA 4MHSA 1NE7A 3ZY5A 5A9SA 2PMFA 3RO7A 4HXEB 3LYUA 1P9OA 3GBSA 1C8KA 1P7CA 3HL4A 2VUSA 3O83A 2J9GA 3IDAA 2WW8A 3TKYA 4B75A 2J7PD 2WU1A 2IU4A 4L9SA 1C9MA 5ITZA 4Y18A 2GGFA 1STOA 3TW8A 2CVQA 4BAGA 1CFJA 2WFLB 1Q2XA 1WMSA 2H4XA 3TG8A 5H8WA 3I2JA 2QTLA 2FQ1A 5JASA 3MK31 3L7KA 4Y1EA 2O14A 2PYZA 1NPYA 4YH1A 4M9QA 1Y7LA 4WKGA 4E07A 1QP4A 3NIBA 4D4GA 2GJSA 4L6CA 4W1SA 4LZLA 1KZ1A 3OQPA 2P6OA 2PGNA 1Q95A 3EDMA 1NBWB 5IPFA 5D3MA 4J0CA 2H9IA 4RS4A 3AR5A 1VIYA 3M5WA 1IC6A 3RRNA 5B1EA 3K94A 3H7IA 4B7CA 3RSSA 3BIWA 4D3DA 3FVTA 4GTVA 1GZSA 1ZUHA 1DQZA 1KP9A 3T7EA 2JARA 3CG4A 5I3ZA 3JAMA 3GJ3A 2B9VA 4HPJB 3EEIA 2H48A 3AFOA 3PS9A 4DANA 3GH1A 2X41A 4LYHA 2VYVD 5EZYB 1G5PA 1RLOA 4EPRA 2PUGA 4HUJA 4ND6A 4AUKA 2PBRA 3EAFA 2FFQA 1ACMA 2ZT6A 1M6NA 2UXCB 1LNZA 3F97A 4Y2SA 3R7WA 2YRXA 3MPUA 2CXRA 2IEAA 1K8KG 3NBAA 4HYEA 2JFZA 1JQDA 5JAPA 4RADA 3ZK8A 2AW3A 1N2ZA 2GROB 1R0XA 1WMFA 5LX8A 4TM8A 2PGAA 1SHLA 3U48A 2Q8NA 3L8DA 1THTA 3O93A 1IN7A 5EZQA 1EUCB 3OTWA 2LDXA 1JHVA 3MEKA 3EQ6A 5IW8A 3KIPA 3WWEA 4KVAA 4QODA 4RA6A 3AERB 2FSIA 3BEOA 4O8ZA 2EG5A 3GL9A 1IJEA 2WOJA 2QORA 2FW0A 2ZPUA 1JWBB 3ZHCA 4RFSB 1RCFA 2O5VA 4FBGA 2X0EA 1TKBA 1KI1A 2REBA 4TKMA 1YMQA 1C0LA 4O4JA 1ZUWA 4D9CA 2Q46A 1BA2A 1I01A 4C6HA 2AG1A 3V1MA 3TLKA 4M1EA 2HBZA 1C29B 3EFBA 3EXEA 2P9JA 3UT4A 1P91A 1YTLA 4JQSA 4NY1A 4J8YA 3DSUA 1W0JD 1IJFA 3P94A 1J0CA 3H99A 4ZAGA 4P4TA 1V9SA 3QKWA 4D25A 1MXHA 4ZTZB 4XLLA 2XZOA 1DS6A 4P38A 3KEOA 2O2ZA 4KMMA 2FEXA 1HFJA 2SCUB 1M2EA 4QZVA 4MP3A 3KAPA 4YIHA 2HGSA 2O6LA 3WYDA 4P8RA 4H35A 1P19A 2CYAA 3UJPA 4JUDX 2C4MA 4I9NA 1JPLA 2IX3A 2VT6A 4OF4A 4F1WA 3HO8A 1M83A 3AKDA 1UQRA 3VU9B 2JFYA 3E9NA 3WHLA 2P35A 4ZP1A 4P34A 2R79A 4RF4A 3UJ7A 4HYQA 4G86A 3WQSB 2Q4OA 4Q6WA 2AF3C 3ACBA 4GTSA 1RBMA 5CEJA 2PH1A 2X0IA 5IY5E 1PT9A 3IDQA 1VLJA 1A9RA 4WD3A 3BK2A 1JYEA 5KJMA 4DNQA 1SUDA 2I4RA 4LBYA 3TZLA 1N1EA 3A06A 1S2DA 1H85A 2I91A 3UM9A 3BORA 4OYYA 4LVNA 5HP4A 1OCEA 4PAMA 4R05A 2CZCA 2R96A 4A2CA 4B81A 2DR2A 2BGLA 3K6JA 1VKZA 4Q7JB 3DKVA 3DAFA 1ZSVA 3TS1A 3JR7A 1A5SB 3CRVA 4B2LA 4LTNA 5DU2A 3L5OA 4B3RB 4MV1A 4U8YD 1DJPA 5J08A 2GS9A 3LO8A 3EYWA 2MOKA 3WRVA 4UQZA 4WK4B 5EMKA 3QPBA 1DQSA 1WB4A 3K15A 3P2OA 1F2DA 2FWBA 1NHWA 1GSHA 1PVVA 3A11A 3VZRA 1HURA 3PQEA 3BE5A 1LJUA 4KNYA 1VPDA 5F1KA 4X1YB 3GHYA 3NHLA 1TVKA 4IO0A 1VSTA 3JXIA 2A9JA 3WMRA 4IKEA 4CG1A 3CEHA 4URVR 4QBIA 3VISA 1NFFA 2HSZA 5A4JA 3FKJA 2YXBA 2DVMA 1CNMA 1QHYA 5GWXA 5HCNA 4B1FA 2B0CA 4JA0A 4CYMA 1T2VA 4QFMA 3C3MA 5INTA 1QZUA 3IDSA 2FE1A 4PF1A 3T5MA 4EJ6A 2JLWA 4L78A 3WK4A 2CHWA 2HWXA 3TRIA 2II6A 1IOZA 1BNCA 4QJIA 4DBLC 2JCBA 5KIAA 4BNDB 3AJ9A 2HA0A 2IYEA 1W4LA 1DG9A 3UJAA 2P91A 2EDCA 4CQMB 3T5GA 3IOBA 4DIUA 4EEXA 4F2PA 1MOQA 2NZJA 2YXPX 3RASA 3C43A 3Q7IA 2D59A 4A92A 1B8NA 3NGXA 1UC4B 3TWRA 3A1FA 2QP3A 4TZTA 3OAAA 2XUJA 3JCKC 4B7XA 1U9IC 3PNBA 4HQRA 1TT7A 3R4CA 3D3KA 2IZ0A 3ADDA 4QTYA 5IDYA 2J0SA 2Z4RA 1Q12A 2JIRA 3GEPA 2ZWMA 4HPXB 3RRZA 2NTVA 3QJGA 5JXWA 2WNSA 4PFJA 3K0CC 3SKVA 5KNDH 2G5PA 2O48X 1T26A 4GA0A 4UXIA 4L2IA 5EHIA 4N0MA 4X95A 3PIIA 3R6LA 2COKA 3HTXA 4O1PA 2Q41A 5HS6A 2HQSA 4LXXA 2HM8A 1SUSA 3A7DA 1LTXA 1O6GA 2JL1A 2D3TA 4UNIA 2ZQYA 3AETA 4I2ZA 2NTYC 1H2VC 3PNLA 2NXNA 5JDIC 1P17A 2G07A 3FYHA 4EBBA 4QPCA 3THXA 1IK6A 2E55A 3DV0A 5CBPA 4IOLA 3GH3A 4KYOB 1KMNA 2QN3A 4ZMBA 2CBXA 1HG2A 2ID4A 2CW5A 5DYYA 3RLIA 4G8CA 4C4ZA 4RK1A 4TLBA 1EHCA 4Z9FA 1JR2A 3ET4A 5AVVA 4EGAA 1VMDA 2B4TO 2W4MA 4N2SA 3L8MA 5LZ2A 3AG6A 1NFIE 1N6PA 1H6BA 4X3OA 5D85A 4KR2A 4GRAA 1TM7E 4H17A 3EBLA 1IQRA 5HA5A 4N8SA 1CW2B 4F7DA 1K7YA 3KYCB 5JFOA 1ZD5A 3A1TA 1OH8A 3DNMA 3L13A 1YGPA 1OX6A 2EBFX 3FTXA 4X92A 4FX2A 3PX7A 1NX9A 5I01A 1EGQA 3MTJA 3ZWOA 3RUHA 4HS4A 3FUEA 4J07A 2GWRA 4WKPA 2F1KA 5M7EA 4JYMA 3QWBA 3D6VA 5EP3A 5KU7A 5CBKA 3TQIA 2QLJA 4DQ0A 4YRJA 4G4GA 3N7AA 2H4ZA 2ZCVA 2J3LA 2FCRA 1UBMS 1HL7A 2ECPA 1PQ4A 3P0EA 4ETNA 3TGPA 4I8DA 1NY5A 1C9YA 1VIAA 3HUEA 3NTRA 3B3FA 1GSAA 5F2KA 1Z38A 2GHTA 2AF4C 3OU6A 1ADGA 1Z45A 4Y67A 4GOKA 1R3UA 1Z0UA 3OI7A 4A1SA 2E4AA 3NB0A 4ER7A 4TS1A 4JC0A 1G5IA 4Q3KA 3I5MA 1UC9A 4ND3A 1FMLA 2XOXA 3U60B 5DSXA 1X7YB 4S12A 1KL7A 3GNTA 1PUJA 1YQGA 5K3OA 5DHSA 3NEJA 2R11A 2GN4A 1GXSB 3CNBA 4ESVA 1VIVA 3MTEA 5CU7A 2OFXA 4PC2A 3RDPA 1JA1A 4GPEA 4DEXA 1GR1A 5BT1A 2Z5GA 4LHZA 4G41A 3VZBA 4RTOA 5LKRA 2RI0A 1RHJA 1SW6A 1PJ2A 4MVJE 5A06A 4BFLA 3JQ1A 2DUNA 1P6UA 3VZCA 2VSXE 3MKQB 2DT5A 4OMCA 4YQFA 4RBNA 2CEAA 2XGOA 4HRVA 3BVPA 4MYTA 1OBFO 3HNOA 1U2SA 2OGTA 2Q8QA 1DQRA 5KTPA 2A0YA 1LQUA 4MRPA 3A3YA 2V9CA 3EDOA 4B6PA 5EINA 1I6LA 3UJ8A 1ARZA 2D7DA 4MUIA 3ISMC 3DLPX 3MUOA 2CXXA 4JEUA 2EQAA 4UXJA 4ZOEA 3SX2A 1ODKA 5F64A 4XWKA 1QKIA 1RBQA 1X1DA 2CV2A 3NP9A 3SZ7A 3ADOA 5KVVA 2D5AA 1GGVA 2VUTA 2POCA 4YNBA 2QZPA 4OA8A 2X8AA 1KU0A 2AKEA 1C50A 1ETUA 3ZCPA 3D4PA 4RS3A 5LWQA 4CIBA 2EFHB 5CH5A 2GM4A 2F1IA 1G20A 2AG5A 1A9OA 3U37A 3ETCA 3VH2A 3V1UA 2F48A 4LQLA 4JKIA 3V2HA 1VDYA 1TEHA 3BAFA 4OVUA 4P29A 4AV7A 4U07A 1EWYA 1S4QA 3PLNA 3LY8A 4JUCA 2FFRA 1CUBA 4DLWA 3OM1A 1WDWB 3I52A 3WGUA 1ILWA 1NX6A 3LQYA 1VHJA 3CVUA 3EW9A 4CKXA 1QHGA 4J8FA 1A96A 4CPDA 2V7VA 4ZCMA 3NMUF 2IZOA 1V9LA 4H16A 4GOND 3E22B 1AQUA 3F9CA 3X2FA 4ZC1A 2HJWA 1HE4A 4HRNA 2KB0A 2JAUA 3RS0A 2V59A 3EVCA 2D4HA 4D9KA 2HSGA 1T13A 4HDSB 1Q0UA 4M8SA 2V3VA 5JAMA 1C4XA 2E2EA 2YRFA 2UXDB 2XNJA 2R751 4EHIA 5L7WA 4JB3A 2PGXA 2GF9A 3KB2A 4ZALA 3HU3A 3FDHA 2A0WA 2P9BA 3FDJA 1NJ6A 4KZPA 4LE0A 3OOHA 4PUCA 3HDXA 2IKQA 4D10C 2HNKA 4WBNB 2R6JA 3N74A 1P6XA 4Z53A 4JD5A 1NMZA 2C82A 1GTZA 3UC5A 1I7LA 1YSCA 4QVKA 2ZIAA 2NZWA 4EZJA 3CN9A 1N2CA 4YRFA 3THWA 2IDKA 4DLVA 4MR7B 4MW7A 2CNBA 1NMYA 4IWYA 3GA0A 4AYWA 2WRZA 3DL0A 4J0QA 4RMGA 4WNAA 2QGFA 2ZSIA 3PB3A 3OEED 2ZUSA 3GEHA 4PRLA 2WWYA 5JE8A 3KTAB 3LY5A 3RC7A 5HS4A 1ZOPA 1TC2A 1G8SA 4NFHA 4AUMA 5LOVB 3S5UA 1FL9A 4HH0A 4DA6A 1PYGA 2Q4EA 4DSNA 1N25A 4IM7A 5KNCD 2NIPA 2YBEA 3X43A 2I3BA 3KOZA 3JQFC 3A3OA 4EATA 1J0AA 2IOLA 1DFGA 2Q21A 4IOJA 4D9GA 3KJIA 1L3CA 2AUMA 3A4VA 3WHIA 4BV2A 1BMTA 2G5GX 1AZLA 2R6HA 3IA2A 1TZJA 4ZV4A 4GMXA 5IKMA 1U90A 5AW2A 3KEZA 1MAHA 1UM8A 3Q8KA 4BTVA 1ZD9A 4IFTA 2PL1A 2ZCUA 1WXWA 4MVJP 1GG5A 4R2HA 3QYJA 3GGJA 4E03A 1KZYC 1L4FA 5EN5D 2AD1A 1YC5A 5LLTA 4V0RA 1GU7A 3P2JA 4DT1B 1E7VA 3O3OB 1UBUS 1YR3A 2PZAA 2X2EA 2RJNA 1Y9JA 1TM1E 2J6BA 2D5IA 1JZSA 4V3BA 5BMVF 2GN1A 3QPVA 1KSFX 5TQVA 2IUEA 3UNXA 5KOHA 5ALZA 4D2IA 1NKSA 1I51A 3KEMA 2EKPA 3QSGA 2NU6A 3PJGA 1XNGA 1VDMA 3NRJA 5AXAA 4WXPA 3Q6MA 5BNFA 4I4TA 2KZTB 5UKDA 2EGHA 5AW4A 1QNLA 1Z8FA 1OH5A 1RXUA 1E3WA 2V3CC 1U7HA 3PFCA 2R00C 1H9AA 1Z18A 3J81A 3FTDA 3C3CA 1T36A 1BJKA 3S44A 2WIJA 4X00A 1U7PA 3DXKG 2G28A 2KM4A 2ZQZA 1B93A 1NULA 1U1FA 2ZWPA 4R2MA 4PYJA 2JZCA 4I19A 5JBIA 3AUXA 2R97A 1FLNA 1KVUA 4UBIA 4HYYA 1B7GO 1EP1B 1QO0A 3QWAA 2WT9A 3BTVA 2VDOB 4ZDWA 1K8YB 2FLKA 4QLOA 3T9DA 3T34A 1SQ5A 1Q20A 1DU4A 1NNI1 1WSAA 1DAMA 2Q0HA 1VL2A 2ANCA 2ISCA 4GWGA 4BKRA 1II9A 4N3BA 2VZLA 2HE0A 4LCBA 5FULA 3JATB 2P3SA 3EY9A 1EFHA 4CM9D 3K0EA 2AFIA 4M87A 3ZGVA 1X1RA 2IOYA 3CGWA 4QPPA 5ARDA 5DNAA 4RE5A 3QA3E 3O0DA 2PFKA 2LAIA 3RAUA 5DI3A 1NF8A 1OX4A 2UY1A 3Q40A 3PD7A 4CV3A 4FXOA 4ZQCB 2DPLA 2AEJA 2NT4A 1HYHA 1UMCA 2Y4UA 5GMOA 1KZOA 1NVDA 4DSZA 2PANA 3UMMA 2XMQA 1ZGHA 4HDNB 5CXXA 3PLAE 5LQKA 1G21A 1JEYB 1PD0A 3JR3A 3SF8B 3HDYA 3TJRA 1DWUA 3DNFA 4F56A 1E2PA 4WK0B 1E0DA 4H31A 2FSHA 3RU2A 2O8DA 1SCUB 2C7GA 2I5PO 3G2HA 4RSGA 1KEZA 4YI5A 1J2JA 1KDVA 1RE1A 4POOA 2HM7A 2RIRA 3QK7A 3AU8A 2FPMA 1JNXX 3B6JA 3L5KA 3BMCB 4MR9A 4AJ2A 3K6KA 4Q9JA 3R09A 3VAYA 3VM6A 4FULA 1YOVB 2XPCA 3VC2A 3B7GA 4D46A 2OYCA 2WUFA 2IOHA 2IXDA 3E34A 1RXCA 4GMRA 2PSDA 4O63O 2WWFA 5K0SA 3E0QA 4RVBA 2O1XA 1UFOA 2ZRCA 2VL7A 2Q1SA 4NJMA 3OFND 4A9AA 2VVTA 3RUPA 4ANWA 1YE8A 4CIVA 1PNVA 1YQ9A 5JANA 4GTOA 3C1OA 1K88A 1UXHA 2G8LA 3PDIA 5BRNA 3AEYA 3CW2A 2VYQA 1HL3A 5JJLA 2OXTA 5BSKA 4N39A 3BKWA 3BGWA 4RPCA 2X4DA 4OPMA 3LUHA 4P86A 1SB8A 2PT9A 1W36B 3KSZO 3SQOA 4DUGA 1G9XA 2OUKA 5CA0B 5JFTA 2IP4A 3AUKA 4V0MA 3K35A 3IAAA 3OOYA 3WY9A 3QKSA 1PFGA 2FP4A 1Z15A 4FYKA 1BS2A 1T10A 2BDUA 1X7XA 3EUVA 3DLHA 1XFDA 1EGMB 2FUG1 5FPTA 5G05C 5D8DA 1OWNA 3GLIA 1N2EA 2VWGA 2IUSA 4MKTA 3Q9LA 4K05A 3PDHA 1GUZA 1W44A 2QR3A 4WVLA 3KSUA 3EIOA 3I6YA 3GAMA 1CB0A 4E2WA 2JK1A 4KE6A 5BVGB 2ZT7A 4PS3A 3A7EA 3JV7A 3UH1A 1PJ8A 1B00A 3PUHA 5C8YF 1O96A 3M5DA 1CEEA 4ZYTA 2C9CA 1K06A 5D86A 4EFNA 1QCCA 4XIGS 3GT4A 1VJDA 1AKVA 5BQXA 1JZTA 3OLCX 3ZU3A 4MYSA 4P3XA 4RXUA 2BP7B 2KPOA 1HNZB 5IMSA 4Q6BA 1F2TA 2BRUA 1OKKD 4L0CA 1FDOA 1SHTX 1QE3A 1NVVQ 1L7OA 5E75A 3DFKA 2GI4A 3CX4A 1YO6A 1FMCA 2RHTA 1FDIA 1LF0A 1LTKA 4B87A 1ODJA 1UAGA 2PQ6A 5AKGA 4IZ6A 3G2KA 3DMTA 3SBSA 3GPCA 4P6VF 1GPUA 2QAGA 5GAJA 4YGYA 3DOJA 2EJWA 5E9JA 5FWYA 4JLNA 2I7DA 3MJHA 1SOMA 2XSZA 5B58T 4D9JA 1V7QA 3Q6NA 3W9GA 1WMAA 3RK1A 3SS7X 1QGAA 2OHIA 1QIHA 4FOOA 4DR3B 4YAUA 3D6NB 1PO7A 5KYXA 4B6OA 5LQMA 1ORHA 1HLPA 3QV2A 1G6Q1 1W0KD 2LGJA 3KJNA 4XX0B 4UOZA 4QT4A 2MU1A 4FS8A 3PICA 4MDFA 4R98A 3W5SA 1R88A 5DMXA 1U28A 4HQOA 5DYNA 5ICCA 2HMYB 3QKIA 3FIJA 3T3MB 2J48A 3E61A 5I45A 1ZN9A 3I4LA 1OJLA 4NFSA 2CY0A 4YRTA 1NIJA 2EKZA 1J4AA 1CK4A 3SBTB 2I6UA 2V58A 2OOEA 1TTQB 4B3BA 1KMHB 4QOJA 2V0PA 1GLGA 3MMNA 4B3DA 5J4VA 4BT9A 3BG0B 1FMFA 1NI5A 1OCZE 3DWGA 2H1HA 4KR9A 4QG3A 1ZA1A 1TM3E 4N7MA 4L5YA 3D5QA 2C9ZA 1MEOA 3QQPA 3OT5A 4GSYA 2BKEA 5E1MA 1CZKA 3UG7A 2PJRA 1DTWB 2QRJA 5JS1A 4GYJA 4EG8A 5A3SA 3FWVA 3KBOA 3E9EA 2IBSA 5DLQC 1DKLA 4BJ6A 2RSLA 4L6AA 4NX2A 2Q2VA 4MUFA 5JVDF 3LMKA 4LTDA 2F4NA 3WFJA 2J5QA 1NDUA 4JBIA 1Y6IA 4MXDA 1SZDA 3U6KA 1EFAA 5JHBA 2QRKA 1LPNA 4BN5A 4PO9A 1KI2A 1L7RA 5B30A 4P58A 2Y66A 1Z0AA 2KM1A 4UNPA 4KH0A 3SCZA 1G6HA 5D1HA 1YFZA 4XB2A 3M5PA 1Q6ZA 1E79D 3D6UA 1NNUA 4D6PA 4TROA 1GUBA 5CMYA 2YW2A 3R3HA 3EH2A 4Y1FA 4QYMA 1SVMA 2RI6A 5G05J 3PEVA 3UICA 1MTZA 2OEVA 4P4UA 3Q2OA 2ENUA 1V16A 1NE2A 3SNXA 1RAEA 2YY6A 4OK5A 1KTIA 5BSVA 3HBLA 2FOIA 3B2QA 1L4GA 1SH7A 2JANA 1HMPA 4LNHA 4PLGA 3CB4A 4DC9A 3NTXA 2OVFA 2ODQA 3W9UA 4R51A 3ESYA 3C3KA 3CW9A 3IAEA 2QVCA 3CZQA 4PXYA 3LY7A 1TO1E 3ZD8A 4TTSA 2WXRA 4RSMA 1XIVA 3HXKA 3TWSA 2WE8A 1Y5IA 4KGVA 4IINA 4AJKA 2CJPA 3B48A 2CF6A 3SLGA 4PX3A 3QOFA 1H8HD 4II3A 5CEAA 4YFYA 1M1NA 4XXHA 3G6KA 2JNWA 3DZJA 3UMRA 1UBHS 2YIVX 3WFIA 1Y6RA 4HNAD 5DTRA 1WZUA 2G09A 3ML9A 4N5CA 2RAFA 1U2DC 3ZV7A 3SD5A 4HVAA 4RM3A 4G8DA 5FQOA 5LVAA 3ZGNA 2FX3A 4DG9A 1QC5B 3SY8A 3PUKA 4M55A 1PHPA 4GUAA 5E9AA 2F3SA 1UKAA 3DVAA 3FUNA 2XVMA 1I10A 2YICA 3LTEA 4DCGA 3IPCA 2ISSD 2DFVA 5KREA 4V3IA 1B1AA 4OB6A 2YH2A 2CFIA 3S2GA 1YA8A 4LC0A 1EXWA 2WD7B 1T2NA 4MB6A 2VQDA 3ZCXA 5C8XA 3O2JA 1PG0A 2O0KA 1MRSA 3ZE6A 2XMBA 1TK2A 2PYDA 1X6VA 2FMTA 2EAUA 2DFKB 2QTVB 3KU4A 5DNDA 1M10A 2SICE 1XNJA 4BX8A 5L3VA 4YRNA 4OQQA 5TX7A 3UCFA 2JW5A 2OB1A 2R1TA 2EIHA 4UNQA 1GNSA 1E8WA 4IGAA 2VTVA 2ZP1A 5I48A 4DR1B 4HN4B 1U3VA 4HRAA 2PE5A 2HN9A 4Z49A 1OFTA 1USUA 2EZ9A 3DNPA 2CL7X 1U4NA 3BFXA 1JJBA 2PYIA 5ALPA 4JHRA 4IYRA 4ALIA 5K6TA 1BDHA 1AKMA 3O3CA 3NM5A 3NHPA 3TB6A 3DTYA 3CUUA 3T1NA 2Q5HA 3FU3A 1AK2A 4RZXA 2I22A 4I9EA 1HTWA 1R0RE 2XAUA 3A05A 4QXOA 3KPUA 4ZCTA 5EE0A 5FFNA 1KE1A 3UM1A 4A8JC 1PP4A 3BWCA 3AMVA 3DVQX 1WHTB 4MGKR 2GRPB 4OUKX 4QO7A 4DZZA 2R8YA 1HC7A 1KJ9A 1J06A 4TWZA 3GT7A 2XJ4A 1PHRA 1XGKA 2J3MA 2FYTA 1I4TD 2GJKA 1ENYA 1Z4OA 2JCGA 5AARA 1ZG3A 2Q4DA 1JT9A 3WGGA 5HKAA 3VR4H 4D82A 1TQDA 3PRZA 3QAQA 3NONA 2X5JO 2YWCA 1TAQA 1YTUA 5EXDA 2GRMA 3F8TA 1PWXA 3TLAA 4BP8A 1BLXB 3VU8A 5HJ7A 2QT9A 3G2UA 3EPLA 4NJEB 4FU3A 3FSGA 1UBRS 1B73A 5J2UA 5AFSA 5EE9A 1NW9B 5HKKD 3X1JA 3ZU7B 2JKVA 4P35A 3IMFA 3TMYA 4HUQB 2AG6A 2W43A 1R4NA 2IX9A 2ETBA 1TF5A 4MQFA 3ZEAA 2HFJA 1J7KA 2OO3A 3BIJA 1PV4A 1VYUA 4TYYA 3R7RA 2P0YA 4DIBA 4C5AA 2YV2A 3AU9A 2Q5JA 1E3LA 3WLNA 4JXKA 1TYBE 4JXXA 3NNDA 1CY0A 4TQGA 3V6MA 4MS1A 4JC5A 5EJEA 1XROA 1YS1X 3R24A 2CG3A 2RBEA 2BM9A 1CUVA 3VJKA 1UWCA 3KDSE 5FHRA 2ACKA 3JQ7B 4JT9A 1RWVA 3VDQA 2DZOA 1WG8A 1FK8A 1Z8HA 2CJWB 4U7FA 3TEMA 2FP3A 4MKIA 2VBFA 4XZ4A 1FX0B 1Z9BA 4WN9A 1B6TA 5CERB 5AW1A 4D4MA 3ASUA 2V7BA 2IE0A 2I3ZA 5J4KA 4FLHA 2J45A 1CG6A 1Z56C 5F3RA 1T0HB 1FRVA 1J0EA 2HU5A 3EJ6A 5LQSA 3USES 4MWOA 4DGSA 4D57A 1GPDG 3S70A 4CIXA 1EDUA 4DCMA 2JI7A 2ZZKA 4KIGA 5BYBA 4FE7A 4QECA 4YA6A 3N8NA 4ARAA 1J5PA 3K9WA 3OQOA 3PDWA 4MWCA 3F6PA 1CRZA 2IXGA 1HE3A 3C3RA 4MDHA 4YTEA 3G0HA 1G5FA 1VKRA 1KJNA 1F2UB 3PGXA 1E6EA 1Q0QA 3L6CA 2W0SA 3MN1A 3LVQE 4L15A 4YP0A 3B5JA 1PKXA 5DKFA 5A7DB 1OJ7A 2NSJA 4ZPJA 2TMGA 2QA5A 4ZZ3A 1XXHA 2Z57A 3VKGA 2YHEA 3Q9UC 4AI6A 1M54A 3C15C 3VC3A 4EY7A 2F00A 4NAUA 3ZHXA 3A70A 2QLTA 2YIMA 5COBA 4IIHA 5ULLA 1Q6YA 4RIIA 4R1NA 3CM0A 4P4SB 1T3HA 2VTBB 4P80A 4H7HA 2QQFA 5HSGA 3W2HA 4B43A 1SKQA 1QMPA 2NUPA 5EC8A 2X7JA 4JL5A 4WAUA 5FJJA 2NW6A 1UBSB 5FR2A 3EGWA 1FS4A 4H9GA 2J5XA 2DEUA 3ZY3A 1VRVA 3LS2A 3W2GA 3ZWPA 4KAJA 4GOMD 1C9JA 2DM6A 1KVQA 4CZ2A 3KS2A 1DTEA 1DRUA 3UYKA 3BUSA 4M1TA 2WWGA 3OZDA 1GFWA 4GPBA 2VHVA 3BU8A 2FPPB 2VJCA 2EHDA 4N5HX 4OIMA 1V25A 4APFA 1H05A 5CDFA 1RCTE 4FPXA 5IUKC 3TXMA 2ZRIA 4LX8A 5COQA 1SVKA 4TUYA 4M36A 1T3GA 5BN5A 4G0VA 3BWEA 1K8ZB 3SJAA 3QBDA 3EIJA 2HIGA 5CD9A 3E18A 4PWYA 2P6UA 1FJHA 5K0FA 1OXTA 5TF0A 1JSZA 1LU9A 4MQEA 2VF2A 5AJHA 1P0CA 4JJIA 4MICA 1U4OA 4J76A 3A6EA 1QJCA 3E84A 1SRRA 4BO0A 2EWMA 4KBYA 3SQDA 2WHPB 3T8MA 1OY3D 1G8MA 4PYRA 3W5IA 2YHIB 3FKQA 1QVRA 3LDGA 1Q1QA 1LK7A 3D8TA 3W90A 1IHXA 4FMBB 1XALA 1RW4A 4GI2A 4JIGA 1X87A 3JARA 1EB9A 4FP7A 5EILA 1UPUA 3TZKA 3T3HA 3FLMA 2F8MA 2H07A 4FNOA 2HA2A 2FHSA 8LDHA 4JC8A 1R4ZA 3R6DA 3SDZA 5HQTA 5JS8A 1H9BA 4U7EB 2VYND 3H6GA 4TQ9A 3DHEA 3IQGX 1R64A 4GR9A 4DCUA 2Z3ZA 4UM7A 2YMQA 2J09A 3UENA 1MCZA 4J0KA 4HOUA 3BGDA 4YAKA 3DBHB 2JFHA 3FUUA 4X20B 3OSZA 2QSJA 4FWBA 1U0RA 3ZJYA 1BEZA 4PRKA 2HA4A 4DJ5X 4H77A 2BFCB 3N39C 1Z6ZA 5CLFA 3E8SA 3C5CA 4YLYA 2GCOA 1R5BA 1OU4A 3ETHA 5JSUA 4MUKA 4G9BA 1K2WA 3URKA 1Y8AA 4WT7A 2UXBB 5BN4B 3CX7A 3C8UA 1SU7A 2ZBDA 1GZ4A 1AN0A 5EPUA 5CLHA 4E5NA 4B46A 3GZTB 2GBLC 2JFGA 5AUOB 2XCUA 4EHFA 3V2OA 4U2FA 1U3FA 2JAQA 5CVDA 1UDBA 3BRCA 3CF2A 3GJQA 1U81A 3PXUA 4C43A 4EI2A 1C1YA 4D8TA 4NV1A 1YKGA 3KKKA 1KVTA 4LWQA 1FQJA 4LI0A 1IIBA 3B53X 5TMDA 2XWPA 4PIMA 3OHSX 3UMYA 3HWSA 5I6DA 1DTSA 4E7PA 4K3UA 1G8PA 2A0FA 2OP0A 5HILA 1XZIA 3IPYA 5E9WA 1XJQA 1D5CA 3QE4A 4BYMA 1G17A 1DIBA 3F9IA 1L3BA 2JH8A 3LLVA 2AKAB 2I66A 1VHLA 2WUGA 3ZJTA 1QYDA 3GRKA 1Q3KA 1YZKA 1CQIB 2NNWB 5FQ6A 3QKUA 2Y05A 3B6IA 1DAIA 5FWQA 5KI6A 2HZ7A 3G9UA 5FLEX 3RHZA 3ZW8A 1CVLA 2NZVG 1ZONA 3L3BA 3LK7A 3QRWA 4GPIB 1OIVA 4CV1A 2OHGA 4NWIA 1IG3A 5FLYA 1CUUA 2X0KA 4FC6A 5EIHA 2VAXA 3B3JA 3WC4A 2BZ1A 1I4WA 2JABA 3CVQA 3L1UA 1EMDA 1A82A 1IBKB 3GZJA 4A16A 2FVXA 4X44A 4MS6A 2DXIA 7ADHA 2PQ2A 2YWFA 2OKCA 4RG9A 2P4UA 1T9BA 1N1GA 1QGUA 2BZ0A 4GYWA 1EFVB 5JSHA 1EUDA 2XUDA 1Y1SA 3IP3A 4K0RA 1P77A 3APDA 4A6XA 4Q4JA 4BSXA 2NMVA 3I05A 4U4AA 3OZIA 1KEPA 3QE3A 1PS9A 1IH8A 2V45A 3EXHB 5DHPA 4EK9A 2QE7D 3KELA 1YU6A 1WBDA 4F4DA 4TL6A 4Z9YA 5C7YA 3RIHA 4H4CA 4WE3A 4K6CA 5CFPA 2B8TA 3WGQA 3KR2A 1BRMA 2HHAA 2CNWD 1U65A 4U6SA 3KLPX 4UU0A 2RHDA 2EJVA 3SQNA 2CT8A 1XN4A 5DH9A 2AA3A 3EHRA 5FRDA 3N6VA 5AUQA 4TWRA 4MOWA 4AULA 2R85A 3T0GA 3NEPX 3OPNA 1MABB 1M1YB 1NVMB 2QT0A 2ORIA 9ABPA 3AONB 3F3MA 3SJZA 4F9TA 5E6RB 4ZPXA 3HI6A 1AGNA 5FPHA 1TD1A 2NO4A 2CLCX 1OHHA 4TLLB 1IWBB 1KF0A 1RYYA 1YB1A 3KVRA 3D9LA 4LV8B 3NJ8A 1Z68A 3IHWA 3U9SA 1COWD 4EEKA 3ZIAD 1BJTA 2ZYAA 4KZKA 4LF5B 1CUAA 1GZ3A 3GMIA 3BDIA 2OBMA 3BFVA 4FEEA 3IHLA 4KP7A 2GPWA 3L9WA 3NHMA 4RY0A 2P9ZA 1NMXA 2P5TB 4R8MA 1RXWA 5GQSA 2NV2B 1EK2A 1NYRA 3FH0A 2BUAA 1OIXA 1K7FB 1TR4A 4CNQA 5MF6A 3BCRA 1GRVA 5FI5A 1QPGA 2OXRA 3MQ4A 4E1VA 1OIWA 1AP7A 4O2AF 2W00A 2KBXA 2XQ0A 2EF0A 3K9NA 3MGGA 4UEKA 4IIGA 2VSOA 2MSCB 4Y2XA 1GTL1 3TOZA 4UAGA 5TLSA 2BKKB 2OM2A 3C7CB 6NULA 2IH2A 2YUTA 3T7TA 1WPGA 3ZGLA 3OOEA 5ELMA 3C4JA 2AR9A 1P2BA 1SVWA 1UADA 2OR3A 2P58C 2IS1A 2PXHA 4DOMA 2W70A 2WP0A 3ZE1B 4ALKA 1M1YE 1ZNQO 3VDNB 3X2EA 4UHEA 1C8BA 1P4HA 2FY8A 4CF4A 1XA0A 2YJ6A 2PZBA 4D9HA 5AK3A 2I3DA 3REOA 5HM6A 1T9KA 2VOEA 4PX2A 5J4HA 2DC1A 4PLPA 4EKGA 5LQJA 3ND6A 3OJFA 2C3MA 4B34A 1OXJA 4UUNA 1T6ZA 3SVZA 3R3WA 3H9QA 3GT0A 2EKDA 1JZQA 4CEJA 5KYNA 3E15A 4L27A 3PQ7A 3RTBA 4H7PA 2JJ2D 3EXAA 3U7FB 2Q7DA 3SMVA 4UJ3A 1KO8A 1DRJA 1KOLA 4OM7A 3BS4A 2AH5A 3BTUA 3BULA 2XYVA 4LKRA 1RWNA 1BX1A 1WY5A 3WK7A 3DOEA 5KJ6A 4G0UA 1MX6A 4C2UA 4NYIR 2QSZA 5HDBB 4PS0A 1HYQA 3Q87B 3CMCO 4TMZA 2WIAA 2FWNA 1H0RA 4E2YA 2PL2A 4GMLA 4HFGA 1Z75A 3RU9A 2EBWA 3V8PA 2IYXA 2WOOA 3B7SA 5B1IA 4HF7A 1OYYA 4J0FA 4KR3A 2CZGA 2ZTSA 2CHXA 4Y6SA 5ABPA 3H1TA 1FX1A 1X7WA 5ESWA 3N8IA 1PJRA 4CRWA 2R5WA 3NHWA 4UMDA 4ZOLB 4P36A 1SA4A 4D41A 1L3IA 1UQUA 3TNLA 4ZKDA 1GTRA 3TBKA 2ECOA 2GN8A 4TXPA 3U4QA 4RTRA 3L0CA 1TA9A 4LWPA 4NBTA 3BMNB 4JQZA 2HHHB 3EOBI 4LF6B 1ULAA 2VLIA 2DPMA 4AJLA 3AAAC 5B4TA 3QEOA 4ME6A 4OFBA 3OPQA 1SBTA 4WWPA 4DYDA 2X19A 4E08A 3ZN3A 2GKGA 4FFRA 4ACBA 1K6JA 3KHTA 3F1KA 4NMMA 4Q3LA 5LUAA 1D07A 5JAOA 4H7XA 2OCIA 3FBGA 1E0JA 4V1CA 2IEZA 4G97A 2ZCJA 3G8DA 5U4XA 3V2GA 2GO1A 4ID3A 3MB8A 3ICQB 1PZNA 3U40A 3SHTA 3UC9A 4U3JB 3D64A 2W58A 5DB4A 4UUAA 4R81A 3E3NA 5L53A 3ACDA 1NVWQ 2DWQA 3FCOA 1C3OA 1KR2A 4ZJZA 1JEAA 4JKOA 4B2YA 3T4PA 5ADVA 2KATA 3I6ZA 2I7XA 5CGZA 4OJNA 1A7AA 3WB9A 2V4UA 2AQKA 3JQ9A 3BXGA 4X63A 3ZXYA 4IGEA 1ISPA 5KDDA 4QGFA 3LFTA 3P9RA 4DTIA 5J3JA 1Q91A 5EZ6B 2ZPTX 2Q3LA 3RV4A 4C14A 3KKNA 4M98A 3IXMA 4BWVA 3G8AA 4UQOA 3COPA 2FO7A 3FNFA 2VJMB 4ZFNA 1RMYA 4WJLA 1SIUA 4TYQA 1S3IA 2FQWA 2P9PG 1QK4A 2WTNA 3WK9A 1KMIY 2HRRA 1KDTA 2Q3HA 3DEHA 4ATGA 3PR2B 2UYHA 1VG8A 4FJZA 3CF4G 3U9LA 3FUVA 2QYOA 3HVEA 3TNJA 3LRPA 4WY2A 1KI4A 4FFLA 5EJMA 4L0DA 1QX4A 3RRXA 3KEAA 4CGVA 1V8ZA 3WAGA 1E8YA 2JJ1D 5BW8C 3PV0A 3BB4A 5T6MA 3DE3X 3IP6A 2Q3DA 4WKOA 4ENSA 1X3SA 4ERXA 3GQBB 1UJ2A 3VTXA 1XCPA 1CQXA 2R17C 4TLAA 3WIOA 4AK9A 1OFVA 3RSCA 3BIFA 4TV8A 3C6BA 4ZICA 1WUIS 4EF4A 3OE7D 1TDJA 2YV4A 3ZGOA 1NBME 2ORVA 4IH9A 4AROA 3CK8A 1WDLA 4AT1A 1BCSA 4MWGA 4RW0A 3RWMB 1FJ2A 3O0TA 2NO9A 1UC8A 1B16A 2PEYA 1GIAA 4DDWA 3AR4A 2J32A 1UKCA 1M7BA 1F4VA 3L0IB 2UZ4A 1EJ2A 4JVLA 2QX6A 1LPBB 2DFNA 1KYVA 3S2YA 4QEZA 1LLQA 4LF7B 3MFYA 5ES3A 2PUDA 1LTQA 3TB4A 4UVEA 3PEUB 3B1WA 2Q2WA 1QZ3A 1HQYE 2VJPA 1IXYA 3E9RA 2YNMC 1MW9X 1PTJA 2SKDA 1XQ9A 4ZC8A 2C9DA 3O5AA 4IOKA 1EU1A 3G2OA 5CVUA 3LQFA 2NUBA 5C9ZA 1JUDA 3T1YB 1L5NA 4YONB 4PINA 3AP2A 5A02A 3OJXA 2D1RA 2ETVA 3CKLA 2PZKA 5KTKA 1RWQA 2L69A 4N6GA 3INNA 2W5UA 4GI7A 1EM8B 3QMWA 1W34A 5K6AA 4N0DA 4DQLA 3BJRA 3GK3A 5FV7A 4RQAA 3LL4A 4JU8A 3ZDXB 4FIZA 4JI8B 5G2OA 3ZE0B 4NYJR 4AZSA 5T8KA 2ZYRA 1E9RA 2VRBA 3IRVA 4ZI7B 3BXHA 4JBLA 5JIBA 1BHQ1 2W6PA 4O4IF 2OCDA 1ZIXA 1JWLA 4P22A 3HRKA 4M38A 4Q3DA 3CLKA 3LX4A 2WHYA 2FSPA 4A82A 3PWTA 1E7RA 1PFWA 1ZQ9A 3UW1A 4D43A 1CUXA 2DBAA 3PNVA 4B8YA 5ENQD 3NV7A 1JHOA 4M0DA 5CYPA 5CX1B 5HCUA 2O0LA 4RF2A 2GD6A 5K09A 2X86A 2N46A 5J5CA 4YJ3F 1UWKA 2EJCA 5LDGA 2KWIA 1JDBB 4F5DA 3KSAC 2B4AA 2PU7A 1UIRA 4DPKA 4YRMA 4GVPA 3O8OB 3RYIA 4HNQA 2HF7A 3KB1A 4UMEA 1DGQA 5JCZA 2OV2A 3PWKA 2VJLA 4PTZA 1P5RA 4JVSB 4ZAVA 4J3JA 4Z4FA 4IHAA 3LY9A 2ZRDA 4MCIA 4E32A 4C7OA 1IKND 5DGIA 3OM8A 4L4YA 2OC4A 1Y6ZA 1ZGBA 4TYNA 5JZMA 2P4EA 2BISA 4C1BA 2E1PA 4B2PA 4W5QA 4NARA 4C30A 3CR8A 4IIJA 3CLHA 1BXZA 5CA1A 2GAFA 3RVOA 3HUUA 1XU9A 1NWCA 3QLVC 4C07A 4ZT5A 2P9TA 4Z8YA 1SG9A 2G36A 3K2BA 4R71A 5C18A 1D1PA 4XEUA 4DX1A 1ZMTA 1MA0A 2FB9A 2XNCA 3HIZA 4NCAA 1E99A 4ZTUB 4ZGGA 2DWCA 3MVEA 4DA9A 4YUXA 1QVWA 3H11B 1CPYA 3NANA 5SV2A 4BQIA 3C7DB 4C6TA 1UOPA 2CXSA 2YNMD 3AOEC 4Z9BA 2OE2A 3AEUB 4JFRA 1VBFA 4AMZA 1X7DA 3BSSA 1RRVA 5KTMA 3PNPA 2ZM6B 1ZGAA 1QH8B 3KKOA 4QHYA 5DTJA 1LW7A 4R1MA 3L1IA 4LERA 3QE0A 1NVBA 1VJTA 2WYUA 1Z4NA 4L57A 2IY7A 1UXKA 5B1BE 5LYJB 4QJ5A 5I4CA 1TEVA 2E4ZA 1XL1A 3HYMB 2Q2OA 1J1UA 3ED5A 3I04A 4BZPA 3U3WA 2V7UA 1IHDA 2X6IA 4L4RA 3I83A 3R0ZA 5SY4A 1QWSA 4ER5A 1E5TA 4LYJA 3SSNA 2AMJA 3KR0A 4RSRA 1A9YA 4L16A 1DBQA 1A5TA 3CKKA 3P4YA 1FNBA 4YAEA 3GMDA 3LKVA 1B26A 4HUTA 2CXOA 2EGGA 4R5HA 5CEEA 2DETA 4ZDIA 1FRQA 1MR3F 1C3EA 3AM1A 5FT9A 4P98A 4YREA 3HYRA 1GYPA 4KQIA 4I7EA 4U02A 5ISMA 3IOCA 3T9CA 4M4SA 4TXQA 4N48A 4PRYA 3K92A 3Q79A 1T2AA 4J0IA 3A9CA 3I0MA 4V24A 3MELA 4A91A 2QVYX 2WJ6A 5LQAA 4EOGA 3KZNA 2GXQA 2C0LA 4TYWA 1F8FA 4Q96A 2AOUB 1U3CA 4RPLA 1RYZA 3D3WA 6LDHA 4ZT3A 3P52A 2H2GA 3AW8A 2YJ5A 1HU3A 5IKOA 3T3NA 1EZ1A 3KPYA 1N94A 1V6CA 3FPEA 3FYCA 2I7CA 5L51A 2XZDG 4BNXA 5FOVA 5ARFA 3KR1A 1KZPA 2QD1A 3GDGA 4G1EB 4RZSA 4MS3A 3NI2A 3GN2A 1QWOA 4D8XA 1JWGA 3U4CA 1DDOA 1XR3A 1M8GA 4W5TA 3VNRA 1IB6A 4C0XA 3SBDA 2K7ZA 5DYGA 3R5FA 1EDDA 4FB4A 3JWIA 2R8BA 4HRYA 1F1JA 2O8NA 5BV1A 5I7UA 5AW5A 2QUIA 4A8HA 1DRVA 1YRWA 1O1YA 4JJKA 2IIPA 4NEGA 3DULA 4ZDJA 3R40A 3L07A 1SBQA 4R7TA 4YRKA 4WLOA 4F91B 4DPRA 4Z8XA 4X6UA 5H3CA 2P9NG 1I33A 4PNEA 3RTEA 5K20A 2WHQA 4OQMA 3TG4A 4OKNA 4KWHA 2QJOA 4RZHA 4YRCA 4AZ3B 5TF4A 5JJKA 1CR6A 2IHNA 1D5WA 1YL6A 1HE1C 4QXPA 5AENA 1G1AA 4XR9A 4X84A 1QF7A 2JKYA 2A9OA 2GW1A 1C0EA 2XYGA 2GMWA 1T91A 1OB2A 4HZUB 3ILSA 5KNLA 1HDCA 2CB9A 2V5UA 1ES9A 4ZTBA 4Q4CA 1FE8A 3P2IA 5ERXA 2R6FA 2ZJ3A 1XN1A 1H93A 5EWJB 4ZHQF 1OA0A 1S8AA 3JQGA 4FE3A 4FN4A 3MWGA 4OV6B 2ZSEA 3AG2E 3LQRA 4LEIA 4J4TA 4GZ6A 5AW0A 1N5KA 1RKQA 5DI9A 4ZK2A 3X1YA 2YUIA 4KO3S 3CO5A 2XGJA 4RPHA 2J3QA 2C2YA 2TMYA 2W7TA 5FPQA 4Q7LA 4YJ2A 3K6SA 2GNPA 3U3JA 5K4HA 2Z4SA 1XZNA 3HVJA 1XL0A 3THYB 4PG4A 4DDKA 1W25A 4NFLA 1OWPA 4PYMA 4QAQA 1S4MA 1SA0B 3X1XA 2FK7A 3W5VA 2PKCA 4KAFA 2H57A 2CXNA 5JRJA 3P71T 4G3XA 1TO6A 3UJBA 4CM5A 3KQVA 4YCMA 3FDZA 5J23A 4IIUA 2WIKA 1VE7A 1CQJA 2CZQA 1SC6A 2G67A 5AMXA 4MPJA 1G8YA 1KMMA 3LO5A 3MOIA 2QN9A 4YN3A 2V9ZA 4RL4A 2DJ5A 3S68A 4AUEA 3WX0A 3W8EA 3OZVA 1IPHA 5DX0A 4PYLA 3W8RA 1Z4KA 3Q8MA 2WYVA 3CIAA 4YP5A 4AWBA 1R9NA 4N0EA 4ZYZA 3Q0EA 3W8FA 2KLHA 3S1AB 1EGVB 4HTFB 5EP1A 1N0UA 5LBUA 4ZZIA 3CPSA 3F7TA 1QRSA 2QTFA 5SY6A 3A6DA 1WUHS 2A1UB 2O2EA 3AR6A 5I8ZA 1LFDB 4IJMA 3MYYA 2BJHA 4JVMA 4RJTA 4O3MA 1YD7A 2DH5A 1O5OA 4M86A 4W8GA 4DVJA 4DQUA 1T2FA 1SM4A 2H0RA 4XVCA 1H8EA 2H1FA 4RY9A 5LJIA 2HMVA 1NUUA 4DNOA 4I9FA 3AKZA 3MCTA 3AS8A 1N0IA 2JIBA 1O9BA 1DWQA 2VG8A 3VYWA 1GLVA 3PQ4A 4QGHA 5LP6C 4KXNA 4RG6A 5IH3A 1Z74A 4GMHA 1A7KA 1MX3A 3ONVA 1W9HA 4BFYA 2VT7A 4REMA 1RC0A 2ZBFA 2NC9A 2DWPA 4FADA 3CKCA 3AVVA 4TRJA 4C3OB 3MTDA 4IJKA 2BPOA 1I0LA 4ZCQA 1Z7YA 1XCGB 1LSSA 2ZB2A 2KCLA 3GYBA 1GV1A 4BP9A 2F3QA 3O1LA 2HREA 4Q48A 5D84A 4DYVA 1OYOA 3T1OA 1W48A 2DUMA 5FTMA 1DINA 3TJZA 1MB3A 5IMBA 1REQA 4BNVA 3V46A 4WZZA 1LCIA 2R7LA 3NPAA 1FP2A 3AZOA 5JDCC 5JHGB 4E2XA 1FJXA 3GDOA 1IL0A 4K5QA 4MTCA 5FO0A 3PS6A 2AI3A 4EBFA 1UAAA 2V4ZA 2J5RA 3VHLB 3TFWA 3F8SA 1S02A 4AIRA 4R7ZA 1P0FA 1T1EA 3PJRA 1XQ1A 1IBLB 4QOEA 1NW5A 3TN7A 2GN6A 4D4IA 3B85A 4QBKA 3ROQA 5DF1A 1ANKA 3VKHA 4YXWD 4PU0A 2XXAB 3R5JA 2GEKA 1CV2A 3L46A 2ZTMA 1XD2B 3HO1A 5SZIA 2VZ8A 1WE2A 2ACEA 3IP8A 3WSVA 3E3LA 1P5HA 2HA5A 1K1AA 3FNBA 3RYCB 1ISSA 3W2EA 4D42A 4Y2YA 4QU8A 1M74A 1OE0A 1X7HA 3L16A 2IDZA 3FYUA 1C1DB 3QENA 4TV9A 3MCZA 4HDCA 1V8BA 3N1UA 2WINI 4S05A 1R3DA 2QHXA 3T1VA 2WA1A 2YXEA 1MV8A 4DJEC 1ODTC 2F9MA 2JGDA 5EJ9A 4PYOA 5KQMA 4HY3A 3C2QA 4YX9A 2Q9UA 5I7VA 2QN7A 2XNKA 4OH7A 721PA 4DC0A 3GBPA 1LBQA 1P6QA 5IXJA 5DDIP 4JWTA 2PJUA 2V3WA 3GVPA 3D5TA 1OOEA 2HPAA 3K53A 3KV3O 1K3UB 3ESDA 1IEQA 4R54A 3UAVA 3JY6A 2G9UA 2NZYA 1NC1A 2Q1TA 2EQXA 1ZH6A 3FNEA 1WA5A 3QYAA 3ABIA 3HJRA 2B98A 2P9EA 2ARKA 1D8AA 4S04A 1TTHA 3PXXA 5KCZA 5FWXA 5JJIA 3EB9A 3RBVA 1O94C 2WM3A 3QX3A 3AB3A 3NKLA 4NOKA 4O4HF 1JPNA 2O7NA 1J2YA 2FXIA 2BONA 4KYVA 4FDAA 2M1XA 3OEYA 3N3AC 1H6OA 4K9KA 2HTEA 2DTEA 3FTVA 4X61A 3GXBA 4P54A 2Q7XA 2LUOA 4MGZR 4PH4B 4KLCA 3KJXA 3VVBA 3HLTA 1SKYB 4Z4IA 2P9KG 4OMDA 4NE2A 2WB4A 3A1VA 2ANBA 4XKBA 2IXAA 2TMKA 3QSYA 1HY3A 3I9KA 4AY4A 3ZWMA 3O7WA 4IGFA 4DSOA 1WZCA 4UNRA 3IBYA 2BEVA 1QLHA 4OEHA 4ARZB 3QEMA 1P62B 3LUFA 3KWJA 1PK8A 4BZXA 2QN1A 4BC1A 1IQ0A 3FGOA 2IONA 5JD5A 3E9MA 2P40A 2Z6QA 3JZDA 2O57A 4G1VA 4O5OA 3QVLA 1WW2A 4LDAA 4S1TA 4FTWA 2G88A 2JIDA 5JO9A 1WUKS 4GC9A 4DREA 5HMLA 3VPFA 2JAPA 1FYEA 5FD8A 1NBOA 4I3GA 3HJAA 3RSHA 5EOVA 4EPVA 4X1IB 1FXWF 3NKVA 4PG7A 1AUOA 4W6ZA 2P11A 1N2IA 1T2DA 3G82C 5LSAA 3H5NA 2DTXA 4CI9A 2XE7A 3ZR4B 1LDNA 3GV0A 3I92A 4YK7A 5FP0A 4R2XA 1U2QA 2HRBA 3WP1B 1SKYE 2YFKA 5CFLA 5B3AA 2BTQB 4LOIA 1EWKA 2PRSA 2Y4OA 2AVPA 3NQPA 1M2HA 1EXDA 1QQEA 3MKRA 2HA7A 3L82B 3OQIB 2RGYA 4GZLA 1C14A 4RULA 2FPLA 3PNYA 4BU1A 1D7OA 5FAKA 3MW8A 5HEKA 4KIWA 3A6HA 5C35A 2X38A 3SX4A 2D3WA 5KNBA 2GK6A 1WDTA 2ZWOA 4EPXA 2LNIA 1MF7A 1RZRD 2Z9CA 2PM7A 1N9ZA 1BGVA 2AUTA 1G38A 1QXSA 3TK1A 1P5JA 2F67A 5TS3A 1JQEA 1JH8A 3IXEA 2R68A 4F7WA 4O6VA 5IM4A 3H9CA 3GJRA 1O94D 2CJXA 2WKPA 4JI3B 4UPDA 3ABRB 3M49A 3DUFB 4JD2G 3JYNA 2EQ5A 4TTIA 3F6EX 2VAVA 1B23P 4D6XA 3RKUA 2OD7A 4BX3A 4RPIA 4LRSB 1PL0A 4RK0A 4ZQHA 1IFXA 5P21A 2VHTA 2XY4A 1XTJA 3TW0A 1SVSA 3O1JC 3S40A 1PZEA 2OKGA 4N6OA 5CFQA 3EC7A 3DEFA 4YRRA 5G0VA 3S1LA 2VHCA 1G64A 2WF6A 2J6CA 2I4LA 3G13A 4EY4A 2A67A 4FIDA 1SN7A 3W3AA 1E3JA 4D8YA 1E1LA 2Q50A 3M82A 4PAGA 3G7UA 4OI4A 5CNJA 2O0MA 3IV7A 3PFNA 1P2DA 4YRAA 4Q4HA 1OR8A 3R6WA 1X1SA 1B89A 3C3WA 3CNEA 1M8FA 1GITA 2J87A 4V0OA 3RM3A 2V4HC 2Z2IA 3PNOA 2W8BA 5IHPA 3UIEA 3LBYA 2Q6TA 4RV9A 3I62A 1L5WA 5EX0A 3OTHA 4A23A 1YDHA 1JIQA 3WMXA 4HVTA 5AHWA 4IS2A 4N3CA 1NOIA 3GLSA 5IC4A 1FSSA 4YQZA 3T7SA 1WZEA 2ZE8A 4ZO8A 1TJNA 4EG1A 4FW8A 3I0ZA 2MCFA 5FHQA 3KP1A 1N77A 4BGVA 2GXSA 4XSHA 2XRFA 2F64A 3P4XA 3I9FA 2RMKA 2W22A 3B38A 5LN1A 3KV1A 4BIIA 2ZUCA 3QBVA 2QK4A 2IT1A 4PZ9A 1JJAA 2FJPA 2QTGA 5GPBA 1A50B 1EX9A 4ZAWA 5AW9A 3ADCA 1K5GA 3FEYA 4J0DA 2OFPA 4NG4A 1PS8A 4C4PA 4XIYA 3FCUB 1QQ5A 1G3MA 1P5ZB 3N2GB 1VECA 3RVDA 4J0UA 1Y8ZA 4W5HA 5ENNA 4C88A 1U7OA 3A6FA 4QFDA 3OA2A 3LXRA 1SAYA 4ZZ2A 3W4JA 1AIPA 5DTIA 4QQFA 3R3SA 4NNOA 3HACA 1MB0A 4M9RA 1MFPA 4L5IA 3URZA 4C9BA 2AC7A 3B5EA 4IMIB 5COAA 3DFIA 1VE6A 4PX5A 1Q0TA 1NL3A 1HFWA 5ALWA 4AZVA 2FR1A 4H7EA 3W34A 4C04A 1RXIA 1USIA 1VSVA 1QJ4A 1CC1S 5JAUA 3VR3A 4ENWA 3HPQA 1SIWA 2FUEA 5CLIA 1IIRA 3EEYA 3NYRA 3CZ9A 1R8XA 5IT5A 4X1KA 1U2GC 3IODA 4UEWA 1D4AA 2A5FA 3H5IA 5KQLA 2XIJA 3SK0A 3CE6A 4DR2B 4JC4A 5BOSA 4X90A 2PM6A 4ADSG 2EX1A 1JQBA 3OCUA 5DM60 1X1CA 2YN4A 4OAVB 2DKFA 4MNTA 1GA1A 1P72A 4BKOA 3I6BA 4GZCA 1Z62A 3NX4A 4YP6A 2VH2A 2V9PA 4U0KA 5G0TA 1DO8A 1X74A 3CEJA 1G3IA 1OI2A 4Y0NA 4YPFA 3ZZ1A 4ZOAA 1E2HA 5A2GA 2FETA 3M6XA 4DRZA 4H0NA 1DBWA 4NU5A 4OXQA 5CCMA 1HE8A 1IRIA 2G6TA 2YWHA 3OT4A 1ID8A 2GBGA 3TSCA 3FZGA 5ITZB 5K8TA 3TW8B 2X15A 3WMEA 2B30A 4Q82A 1WCIA 4R6WA 3UA4A 3K4QA 2DUWA 3CH5A 1ULZA 3AP1A 3GLQA 1IYZA 4G5FA 1WU7A 3OZWA 3LS8A 3MA5A 4LOLA 2FO1E 1XLWA 1D9ZA 2ZI7A 3AZPA 5CVVA 5CK5A 4EABA 3RUIA 2YYYA 1P0MA 1C0KA 1E5VA 4LMBA 2DZNA 1ZJ6A 1KDZA 3AVXA 4TT3A 2WSYB 4BFVA 3LIPA 5IVPA 4LRYA 5HRUA 4UWFA 4HI0E 2WAMA 5DM4A 2H3HA 3KT3A 5AK5A 2O7QA 1JHRA 2GRQB 1YUBA 1HSOA 3AUJB 3RT1A 2DY0A 4OBEA 2DCPA 4UWLA 2Q4BA 4B3IA 1N5IA 3LV8A 1YV9A 1CDDA 1UF9A 3SC6A 3FX2A 5CDUA 1XPJA 5JEEA 3IAM1 3R9XB 5EIBC 4LVUA 2B2CA 4HFNA 3OX3A 5KOYA 2OLJA 3R7WB 3ITEA 4JHJA 2ZIVB 4E88A 1GRNA 3FNGA 5H83A 1XEWY 2E4VA 1R0CA 4JYZA 1Y4ZA 4RTKA 8ABPA 1N2HA 5TIIA 4EF5A 1NWHA 2WLSA 1F3LA 1R0KA 2G71A 4BE4A 3ZLJA 4ABTA 1QP8A 2GOYA 1JG2A 1MD9A 2FU5C 4Y2HA 5BN3A 1FVXA 1Q1GA 1SD2A 4C7JA 3UX4A 1LVHA 1K27A 3CUYA 1P4JA 3H0KA 2V1XA 1RM5A 2BFFA 5ENPD 3EVEA 1RCUA 1IN8A 3I1FA 3V8MA 5BSFA 4PO3X 2P9YA 4PN3A 1J8DA 2VHEA 4MI3A 4IAOA 4O4JB 4Y2RA 1TUBA 4O3FA 1QAOA 4R3UC 4ZWNA 2BEWA 4BVJA 1CYEA 1T8YA 4BTAA 1NQOA 4JDPA 4CCAA 5FO1A 5AVUA 1TPZA 2XCBA 1VMAA 1NR7A 3JYQA 1TMGE 4UAUA 5T5QA 4QGSA 4X66B 4YP9A 1P9NA 3LW8A 5AWFC 3FLBA 3RS9A 4WLEA 2ETCA 3Q4AB 3OUZA 1IY0A 1MG0A 5A5FA 2HEGA 3SBXA 4OX9Y 5EMHA 2XUOA 3DTVA 3ETEA 1NG9A 4ABYA 4LYEA 1YS4A 5EG5A 3T4EA 4EHNA 3H13A 5KX5F 2IYVA 1R8SA 3N28A 3DT9A 4I36A 1SR8A 4AQYB 1W75A 2C4NA 3HKEA 2AX4A 4PGFA 1T6NA 4QUHA 1G9SA 2D2VA 2PA0A 2JHAA 3ILVA 2F9LA 3V7YA 1QP7A 3WIUA 3KKLA 2PTGA 3I6IA 1XXLA 4A4DA 2NUAA 3HXDA 5DN6A 4QUIA 1GPMA 1GCIA 4QUKA 1Z29A 1SUCA 1J90A 3SNKA 3K3PA 3KL4A 4ZT2A 3T52A 4K5CA 2WXQA 3KQWA 4I5GA 2B1IA 2O7RA 3KKMA 4Y8VA 2RARA 3ZEFA 3AF4A 3ORQA 3ANXA 4IV8A 2GCGA 2H1CA 5D6OA 2IE8A 4OXNA 3V80A 2FW9A 2XRZA 4RTJA 1CJCA 4Z4GA 1GKUB 2FG7C 1GGHA 2NU9A 2XA1A 1N8NA 4X3CA 3PNMA 3JXEA 5D7NA 4HVLA 1IQUA 4MUYA 2BHLA 5FI0B 5DIZA 1SCNE 1F20A 3TNYA 1IUKA 2YS7A 3SZMA 1OTXA 4UBLA 1H4TA 3EQ9A 1MHQA 1RYDA 4JB2A 5B57C 3OM0A 2HDHA 5EIBD 3UKUG 4Q16A 1T6XA 1MTOA 3IBFA 1E58A 1Y4UA 1T9CA 2GYWA 3WJ1A 3PX3A 2CE2X 1VYVA 2RDMA 3P9CA 4X7PA 2DHDA 2BSXA 2B7CA 1CUFA 4RESA 4AM9A 3BXOA 3LC1O 1T25A 3A2NA 4DILA 1ZKDA 1DPGA 2ZIUB 1TVKB 4W7SA 4YAGA 4WKBA 4LRTB 1DG3A 1SZ9A 2XPZA 2QYTA 4P2GA 5IBQA 1FSPA 4IUCS 1L5OA 2ZIXB 2NV0A 5B64A 4N5NA 2PMDA 4GP9A 3AR9A 2HIHA 4B0ZA 4ZT6A 1EUQA 3OTOB 3IEMA 1UBCA 2OCXA 2ZRKA 3K8ZA 1ZESA 1OY1A 4JJAA 5CJPA 3H2KA 5GOTA 1NOJA 3GGGA 1HDZA 1NT4A 2NPOA 4V0KA 4HX9A 1T5LA 4MS4A 4PSCA 2FPRA 4R8LA 2AOXA 5FORA 1OT8A 4KMOA 1H19A 2I6SA 1CDEA 4DXHA 4AN0A 2O3JA 3IPXA 1OYWA 3UGJA 1L5LA 2BY4A 1FP6A 1ZW1A 2O3QA 2O59A 3DDUA 1XQVA 2VF4X 1O8BA 4XLZA 1YQXA 4NATA 3R7NA 3Q0IA 5TT0A 2ZLBA 2IITA 2L0IA 5B4UA 3COWA 1L5GB 2IYWA 3H3FA 4N49A 4OBWA 3EPHA 1MPTA 2AIRA 2HCJB 1O1TA 4QEDA 5K8CA 2NSHA 4QYTA 3F9RA 1KJZA 1ZK0A 5CBOA 4JSYA 3DAHA 4MZXA 3WLEA 5AIAA 3RJVA 2PX8A 4C2BA 4Y6OA 4L2IB 2IXEA 3OPVA 3J80A 5HFAA 2ZEJA 4YROA 1QIEA 3HCFA 4J7XA 4HWOA 4RIEA 3HBFA 3R8FA 4BQRA 1GD1O 1M2NA 3A8TA 8ADHA 2WMDA 5KQRA 4X94A 1MLDA 5LNK6 4PXAA 2ZS8A 1XNFA 1BSVA 2D1YA 3PNLB 1UDAA 2OXCA 5DEIA 4YRLA 1M6HA 4C03A 4U2EA 1JLKA 4PAQA 1U9YA 5LM3A 2QAJA 3S99A 1AB6A 3FZNA 3LHSA 3THXB 1SBNE 1R9MA 1E1RA 1Y1LA 5EJFA 3WP0A 2C0PA 2EJBA 4K87A 5JHAA 3DV0B 4UHCA 5CBPB 4L8WB 1OUMA 4CWAA 2HWWA 1QDLB 4BCBA 3ZKWA 4MPRA 1Z73A 4TT8A 3KQUA 1E60A 3L8EA 4G2VA 2X6KA 3DZBA 4CNBA 4YCCA 2CG2A 3CSUA 1SCJA 1W1IA 4J1SA 1MX2A 4DMMA 1NM5A 3PC8A 1XF9A 3AKEA 2Q27A 1SPXA 4KODA 3OFKA 1B3RA 3G1TA 3KQYA 1T0BA 1HG0A 2W2KB 3BDAA 2AN9A 1C7F