4JZYA

Crystal structures of drosophila cryptochrome
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
534
structure length
534
Chain Sequence
ATRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWLADV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Circadian clock protein
molecule keywords Cryptochrome-1
publication title Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 197
structure length 534
sequence length 534
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4jzyA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4jzyA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4jzyA01
4EG6A 3QE4A 1N78A 4FZJA 2PG3A 1Q19A 2DUMA 2AG6A 3UY4A 1O97D 2H2AA 1MJHA 1X6VA 2QTNA 3HMQA 5H7XA 1KQPA 5TEVA 2XRZA 5H16A 4JYZA 1B6TA 4DDMA 1O0BA 1ZUNA 1KP2A 1EUYA 1I6MA 2CFOA 3AKZA 1KKUA 3H9BA 1S4MA 4QREA 1NI5A 1WXGA 4G5FA 1J1ZA 1KP3A 2DEUA 2A1UB 1TYCA 5HUJA 2DPLA 2HMAA 3CLTD 4ARIA 3CLRC 1MC1A 4R0NA 1J20A 1KAQA 4KR7A 1YULA 1OWNA 3P0HA 1QRUA 1ZJWA 2VXOA 1GAXA 1VBKA 2DR2A 1I6KA 3Q4GA 3TNJA 2A1UA 2VTBB 2Z08A 3MLBA 1NYLA 3LE8A 3ZJVA 3QTTA 2H29A 2QTRA 2ZUFA 1O96A 4JZYA 4HK4A 4S1OA 3A04A 3ELBA 1J21A 1JIJA 2YXNA 4K03A 4XFJA 2PZBA 2X0KA 2VTBA 5LM3A 1VLHA 4CDNA 2CSXA 2CV0A 2V0GA 1OWMA 3IVGA 4UZFA 1GN8A 4EGAA 3COZA 4NZPA 4ZT4A 4ZCRA 5JBNA 4P2BA 1KORA 2WSIA 4MUFA 2IJGX 1JMVA 1EUQA 3VU8A 4ZCPA 4A91A 3NBAA 1ILEA 5IHXA 1O5TA 4RUKA 2QUHA 1IQUA 3PRHA 1KQNA 2Z3VA 3DLAA 1ZH0A 1J1UA 4MWDA 4YP7A 4CT0A 1IFXA 2A1TS 1NUTA 3PXUA 1MOPA 1BS2A 2O8VA 2AKEA 4F3RA 1Q15A 5DB4A 2HGZA 4CDMA 2CUZA 1I2DA 4MUGA 4CQNA 3IOCA 1KR2A 1NURA 3H99A 4DNXA 1K92A 1N2JA 2CYCA 4J76A 1EFVB 1QNFA 3FWKA 3X1KA 3HGMA 2DERA 4JXXA 3ZXSA 4R2LA 2EJCA 2CV2A 3KT6A 3FH0A 1P7PA 3K9WA 2CT8A 1YI8A 4HJXA 1WXHA 2E21A 1MRZA 3M5WA 2OV4A 4KR6A 1VBMA 4YP6A 1U3DA 1EFVA 1JHDA 4JXZA 2CYBA 1WXIA 4AQ7A 1OWOA 3ZJUA 2WQ7A 1NSYA 1O0CA 2A7XA 1J09A 2A86A 3RBAA 5IJXA 3HV0A 1IH8A 1TQ8A 3U1VA 1O94C 3I05A 3RFFA 2GKSA 1EFPA 1JZSA 3ISJA 1U0BB 2BTEA 1YIAA 1F7VA 3IH5A 1NP7A 2X1LA 5EKDA 3TZEA 3E27A 4EFKA 4MW4A 3SDBA 4MW5A 3RJZA 1ULHA 1WQ3A 3FIUA 3N9IA 3ILVA 4XSVA 5DASA 3CVYA 1K4MA 3CLUC 1R6XA 3GMIA 5HG0A 5J59A 4GU5A 4I6GA 2J09A 3AFHA 1YIDA 3Q12A 3AL0C 1U7XA 3BL5A 3L93A 1I6LA 1IRXA 5K0SA 3NV7A 2ZP1A 2ZUEA 3ZUGA 1WY5A 1U3CA 2QJOA 3N05A 3CR8A 4HPWA 4L2IA 1QJCA 3RK0A 1EJ2A 3AIIA 4EG1A 3DO8A 3CVXA 1FFYA 4I6EA 3MLAA 1N2EA 5TGTA 1JZQA 1N2GA 1F9AA 4PY2A 4MVYA 3FNRA 3SZ3A 1O97C 3IODA 2A84A 1QU3A 2WB2A 1XNGA 1M8KA 2XRYA 1N2BA 4NAHA 4PBRA 1T9GR 4ZT5A 1M8PA 3H97A 1IQRA 1OWLA 3INNA 4MULA 1V47A 3IOBA 1WXEA 4DJAA 1G59A 1GTRA 1H3EA 3CLTC 4EG7A 4ZT7A 1PG0A 2D13A 2BYTA 4MWCA 1XNHA 2A88A 1GTSA 3KFLA 4KPUB 3ZIUA 4NATA 1NUUA 1M83A 1G8HA 3CLSD 4WNYA 3KT0A 1OWPA 1QTQA 1JGTA 4MLPA 2C5SA 3LOQA 2QJFA 4ND6A 3PNVA 3MUEA 2X3FA 4AS1A 2PZAA 4MUJA 2AZXA 1R6UA 2OQ2A 2QUKA 3ZGZA 3P0IA 3SZGA 3UC5A 3FETA 1JECA 1IHOA 3QTBA 3CLSC 5TS2A 5HUHA 4NDAA 1QU2A 5K0TA 2NSYA 4MW9A 4NX2A 3TQOA 5KCMA 4G6ZA 1IQ0A 2EL7A 2DLCX 2D5BA 1K97A 4KR9A 4X0EA 2Z09A 2V0CA 1J70A 4MW1A 2IP1A 4KKVA 1N3LA 1OBCA 4MW2A 3X1MA 5LLTA 1N2OA 4RPIA 1UFVA 1K4KA 2NZ2A 1Y42X 1JILA 3KT8A 3IMCA 3AG6A 4U63A 4ZCSA 3NBKA 1RQGA 1WJGA 4PBTA 3Q10A 3UK2A 1JIKA 1MAUA 1YUNA 3P52A 4OUDB 2J4DA 1X8XA 1OD6A 1G8GA 1GZUA 4R2MA 3A2KA 3FG9A 3IVXA 1T6XA 2J08A 4U7JA 3IUEA 1KH3A 3H9CA 1R6TA 4MVCA 4ND7A 4OJMX 3TS1A 1JIIA 1JEDA 3CVVA 2RD2A 1O95D 1KH1A 1LW7A 3IVCA 4H3SA 1F7UA 2DXIA 3IOEA 1A8HA 2YY5A 3RK1A 1WZ2A 2B7LA 2PXHA 3HZRA 4MUHA 2CV1A 1PG2A 2RE8A 3IDFA 2DETA 2QUIA 5DEOA 1N2IA 4MUKA 4TS1A 4WSOA 4DE5A 4EG5A 1N77A 2J07A 1D2RA 1M8FA 3DPIA 4K0RA 4MW0A 1PFYA 4EG8A 1GPMA 1LI5A 3ND5A 2J5BA 1TFUA 2X1MA 1M8JA 1QQTA 2JAXA 1XNJA 3SEZA 1JEEA 2E89A 5KHAA 1T9GS 1XJQA 1PFVA 4MUIA 1T6ZA 2TS1A 4DDHA 2A4MA 4EF6A 1TYBE 3IUBA 1FYDA 3CLRD 1Q11A 1NUPA 2QTMA 3DV2A 3CVWA 4I6JA 3G59A 3A4IA 3GUZA 3OTWA 1VBNA 3FI0A 2WQ6A 1SURA 1OBHA 2JANA 1QRTA 2YWCA 4MW7A 3N2YA 3HFJA 4YMIA 5FO0A 1MBZA 3VRHA 4GRIA 3CVUA 1F4LA 4MWEA 4UZEA 4QBTA 3CA8A 1VL2A 3COVA 1WKBA 4U8HA 3F3MA 1NUQA 2HZ7A 1O96B 1WQ4A 4QRDA 3LCJA 1DNPA 4BWVA 4F4HA 2G36A 1KQOA 4JFAA 1WXFA 2JA2A 4EG4A 1COZA 1KAMA 3COWA 2PZ8A 3S3TA 3IMEA 3HL4A 1YUMA 4KPUA 2PFSA 4ZCQA 2D54A 5DK4A 1H3FA 4MQ6A 3UOWA 1M8GA 1MB2A 3GLVA 4G5YA 1GLNA 4YBRA 3KT3A 5AHWA 4ZT6A 4MAFA 4J75A 1V8FA 3A05A 3TZLA 1TEZA 3ND7A 1TYAE 1KH2A 2QUJA 3N8HA 1O6BA 5J58A 1CT9A 3P0JA 3ZXIA 1H3NA 1N2HA 2GM3A 3ZJTA 1T6YA 1N75A 1TYDE 1Q77A 3FHJA 1ZH6A 2O5RA 2R5WA 4MVXA 5F23A 3MXTA 4Q93A 3SEQA 4DDKA 3G5AA 3SYTA 1U7DA 5FNZA 1HYBA 4XFDA 5BNZA 3UMVA 4HJRA 4ZT3A 1QRSA 4ARCA 2PIDA 3X1JA 3FOCA 1EXDA 5FO1A 3ND6A 4YP5A 2QJTA 1PFUA 3K32A 1O94D 1NUSA 4MW6A 2A1TR 3SP1A 3PNBA 4MVWA 2E18A 3TQIA 2CYAA 1EE1A 2I1LA 4OUDA 3PNYA 1EFPB 3G6KA 4Q16A 3L92A 1G8FA 4MUNA 5KWVA 1MAWA 3JXEA 3H05A 4L2IB 1WOYA 5LFAA 3C8ZA 3CLUD 1MB9A 4ZT2A 1M1ZA 4NAUA 5TEWA 3VGJA 1N1DA 4ZCTA 1LI7A 2E0IA 3OP1A 4DLPA 5J5AA 2GOYA 3AG5A 3D6UA 3IMGA 3MMXA 4MWBA 3FY4A 1NZJA 1H1TA 2IELA 3COYA 3RHSA 4MUEA 4EG3A 1O95C 4E1AA 4PBSA 1PFWA 2YWBA 1IVSA 3D6VA 3FDXA
chains in the Genus database with same CATH superfamily
2OLEA 3QUQA 4ZMBA 1ND6A 1IDOA 2I7CA 3IPLA 1X7XB 3PRJA 5M04A 4F04A 3AKZA 1NYTA 4ZZ0A 4AP6A 4JYAB 3LWBA 4OXXA 2REBA 5JVDF 1DWQA 4PF1A 4O0LA 5AKLA 5J2UB 5REQB 5IAEA 4Y6SA 3IHVA 2C29D 2GBCA 4K03A 4DMKA 4L4SA 3EXHC 3SZ7A 4MIOA 2QQ5A 3KD2A 1N3BA 3ZBPA 2FVYA 2C82A 1KAOA 3EC1A 1R12A 2P9ZA 2ECFA 3L7LA 4J3JA 1QC5A 2QVYX 2G9ZA 3HSYA 2EEPA 1XMOB 1C9DB 3GGGA 4HDNB 2PA0A 5BVHB 2SNIE 5SZJA 4DIEA 3N0VA 2WT9A 1GVNB 4IG9A 2QY7A 4LCTA 3ZGOA 1EK2A 5TT0A 2ZATA 4POOA 3S7FA 1OH7A 1U2DC 5EHGA 3RRBA 2L18A 1Z6TA 4BTVA 1NXOA 3TXXA 1JHDA 3K6KA 1DO0A 2X9LA 1MCZA 5EINA 1XZPA 1DZ3A 2F67A 3MQ2A 3IEXA 2CNOA 2CWWA 3G9QA 1BHJA 4KVFA 3LDFA 4HWGA 2W00A 4LHSA 1JDNA 1OA0A 3Q9NC 3DO5A 3NHMA 2AG8A 4EX6A 5TPZA 1DRWA 3ZHXA 4EUKA 3H5NA 5F5LA 4LE2A 3Q9SA 4D9JA 3VOTA 4D97A 1LVGA 3N05A 3HO6A 4HPWA 3OT1A 3CLHA 3RSEG 4EZEA 1MX5A 2GSWA 3WOHA 1UEXC 3PJFA 5IPFA 4DV7B 1IY2A 2QD1A 1FDVA 1UZLA 5KOJA 4U6NA 3UUXA 1QU3A 3LTEA 1VMKA 3ORHA 4CG0A 2QLTA 5AKEA 4ZQGA 1QOPB 4I4TB 2R66A 1GTRA 4FOTA 1OY1A 4ZV9A 2BN4A 2BKKB 4R1QA 4MR7B 4DA4A 1JGTA 4UOZA 4K05A 3ZE1B 3R8CA 4YCLA 3EX7C 3S2FA 2EILE 3GLFB 5KYXA 1KZ4A 3CLSC 7ADHA 4JA9A 3O21A 4IRXA 4TVBA 1WAO1 4L4RA 2KYRA 1KBOA 4DI3A 3V8BA 2ZRIA 1XU7A 4GLLA 2YHIB 4PHCA 4F12A 5F73A 1ZLYA 2H08A 2F3PA 2QYTA 1X3LA 4U0KA 4J07A 2VJMB 3G2LA 1ECGA 1QK3A 4JBGA 1TTPB 3WMFA 5DNAA 4F45A 2EFJA 4E3WA 5IG2A 1H2TC 4JSRA 5LMZA 4MP3A 2OCAA 3IB3A 2DKOA 4PZAA 1KYVA 4HDQB 4ND7A 5EJAA 4M7WA 4GZMA 1A9XA 1PL0A 4J6EA 3L4BA 4PLPA 1JG3A 3CMCO 3AETB 3AY3A 3PICA 1CFZA 4K0RA 2R8PA 3FB4A 3O31A 4LWOA 1M8JA 4TGLA 3TWSA 3FWYA 2WMOA 4E13A 2NWQA 3MJHA 3R9MA 3OHPA 1C3EA 1OXSC 5EPUA 2ZIAA 3HPQA 3DMFA 4MA4A 2FX3A 1BI8B 4RYLA 1ZWKA 3V2OA 1CJTC 3TO5A 4ZGBA 3O8DA 4RMIA 6REQA 1V39A 4ZVTA 1SCJA 1WKBA 4LXHA 1DEKA 3R3ZA 5K3BA 4LFCB 2P4UA 3RTGA 1KWKA 3D4IA 3RVLA 4L15A 2F1IA 1PQYA 1OTYA 6CHYA 2CE7A 5TRTA 2RHJA 2SCUA 2W4MA 3AHCA 2B69A 3PUXA 4DR1B 3KKMA 3HG0D 2JB9A 1MO5A 1L4BA 3RRFA 5A9SB 5FUWA 1HH8A 1MV8A 3ERCA 4OHBA 1N4DA 4OQMA 4Q3CA 4TTAA 2L0TB 4OQDA 4RVSA 4CRWA 2A9PA 2Q41A 3G89A 3FOCA 2C7GA 1G0NA 1DG3A 2IPAB 2P62A 5FCDA 2QI9C 1QO0A 1D8TA 3P4UA 3VYSB 1PNTA 4RESA 2FO7A 1V4VA 2MOKA 5DHUA 4L73A 4IKEA 2B36A 4JC5A 4ZT2A 3OMXA 1HT2E 1CQZA 4JUFA 5LCWC 1U2GC 2JFQA 5EUCA 3HWRA 3CF6R 2OUIA 4MV9A 2WWTA 3V4SA 2RK4A 1KQPA 2VJNA 4FFRA 4BB6A 4EW1A 1B8VA 1E2FA 1Z4PX 1D6NA 3I32A 3PPWA 2BEVB 2FLWA 3KLMX 3DE2X 3LM8A 1SGWA 3BL6A 3UXMA 3OCXA 4XQGA 4B73A 2AW3A 2ZYHA 2A1UA 3H8WA 5CBPB 3D3QA 2WP8J 3Q2OA 4D4KA 1XZMA 1E20A 3R6LA 3OQ6A 5IM5A 1VCMA 2VTVA 1EH5A 3H2ZA 4A91A 1WZNA 4NJMA 3KZOA 4NQZA 4GYOA 1I3KA 1W59A 3KJQA 1WUJS 1BPOA 1JYSA 3IDQA 2G3YA 2EKZA 1G20B 4B5KA 1BVRA 3QLUA 5C8ZA 4YVQC 3R23A 2HXSA 1MD9A 1WD7A 4B43A 1MQ9A 3OE4A 3EGOA 1CDEA 2C0PA 1KDYA 4G8CA 3DGFC 4JBXA 4FHEA 1BE0A 3TWXA 1GYRA 2G5PA 3R77A 3D8BA 1CUHA 3IEVA 4X65B 3GGOA 1JB1A 2VNIA 1VOTA 2WK1A 4AEZC 3L17A 3BDAA 3FXAA 3U4TA 2IS4A 3LT5A 4Y1FA 4C0AC 2V7PA 4G0XA 4YPVA 4PZCA 1YC5A 3TG5A 1Q1NA 1CY0A 4LBVA 1E9AA 4C0KA 2O2IA 1BGXT 1LBHA 5HJ5A 4ZT5A 1H6CA 1QHGA 3L0BA 5I3ZA 2P69A 4JR0A 3RO7A 3GAFA 5EMJA 5J47A 4MV7A 2CW5A 1HEUA 4CQJA 3PXCX 2NT4A 5LQMA 3HR7A 4EPRA 3DBRB 3SF8B 5KOIA 1M6YA 3K8YA 1I4DD 1E3EA 4QOHA 3FBGA 3WLKX 3EPPA 4IHJB 2JA1A 1VECA 4ZQEA 4H7IA 5B3AA 2Q5QA 3AZQA 3EIJA 4PBTA 5AXAA 1YS6A 4EEXA 2ZE8A 2BD0A 3ODGA 4C6SA 4U7JA 5AXDA 4K5BA 4ARZB 1QDEA 3ZI4A 3UWSA 3UQYS 4BJ5A 4N2SA 3SFTA 4C2UA 2H7CA 4PNPA 5FQ8A 2C4WA 2W6MA 4EHMA 3W8FA 1A5TA 2ZZMA 3HVEA 4G0NA 2FBNA 5CG2A 4KGVA 3IE1A 5TJHA 5EFOA 1WXDA 5KVVA 4ZOEA 3URMA 4NVRA 3SPXA 5JZMA 4KO2S 3GYBA 3RC2A 1I32A 4W8GA 3TOZA 1PK8A 3HZZA 1HG0A 1KT0A 1UP4A 2WHXA 3Q7EA 1NA0A 1NBOA 1UBOS 3QMPA 3EXIB 4YMLA 3EU9A 4WBNF 1B16A 5KQRA 1O96B 2IVZA 1PR4A 4F60A 1G2QA 5SY9A 1VPEA 1I2BA 2PV0A 3B6KA 3MRTA 1Y5NA 3S3TA 4YUWA 2ZYSA 3CGHA 1PUXA 4P53A 3CH6A 3QBVA 3DMHA 1ZFNA 1V8FA 4Z1MD 3GR6A 1PQ4A 5HIKA 1ZSNA 4GX1A 2WOJA 1N92A 2ETBA 2Z83A 3LHSA 4CM8A 5E3JA 3G5MA 3K70B 1ZH6A 3GNQA 4MV0A 3G6WA 2OM2A 3LDZA 2R1UA 1GL6A 3QPBA 4GEKA 4X7RA 1FW8A 4F2HA 3ZWAA 1KSHA 4ALKA 2C2BA 4AW9A 5B53A 5LXTB 2GD0A 4WY8A 3FCXA 3QUTA 3RBZA 3UXYA 4WA7A 1VDZA 3ZW7A 3TRFA 1L5QA 4C4TA 2AOWA 1EX1A 4FPXA 1NNUA 3AS4A 4JI1B 2AFIE 3G2PA 1I9CA 3HHPA 4CT5A 3R6WA 4HDMB 4JEMA 1SIWA 1PFWA 2DEUA 3KQMA 4NE9A 2EDAA 2FZLA 4D4HA 2HCTA 1RW4A 1GSHA 3D9KA 3G8CA 4DTCA 2BGWA 5BT8A 3AU4A 3D0KA 3RYHB 5HQ8A 1T35A 3O7MA 1QFMA 3I2HA 4TTJA 5H59A 4BCCA 1C7JA 2CZCA 3TNYA 4K9DA 1O6ZA 1IBKB 4BLSA 2FMIA 4CODB 1I6KA 2ZTSA 1FDWA 3QKSA 1UAGA 2MYOA 4V03A 3VDRA 5AIBA 1B41A 3DOIA 1E4VA 1XRRA 4U3JB 2DBVO 2UVPA 4C0QC 1Y7HA 3TOXA 1Q7GA 2X9QA 2IE0A 3MSCA 2JKZA 1ZLXA 4OAVB 1QIMA 2EATA 2AOUA 3RDPA 3HJRA 1DJNA 4MV4A 3CEJA 2VGXA 2AOVA 2D5CA 2D5IA 1NURA 4G4GA 4PSDA 1L2TA 4LMRA 2O2DA 1OF1A 2CV2A 1IAVA 2HT1A 5B3KA 1ZCZA 2R1TB 4GMGA 5KYUB 4I46A 3QEAZ 2G70A 4EECA 3II6X 1O3YA 2AQ8A 3FBTA 2RGCA 4PGAA 1FDSA 1QIGA 2XIQA 3K09A 2ESRA 4LHEA 1SUAA 3B70A 3QBTA 1LDNA 3KSAC 4ZI2A 3E27A 1WQ3A 3ABQB 3ZH2A 2Y6VA 4A3TA 1ZO8A 2XDQA 4RPLA 3BFVA 1CHDA 2HDNB 4FNOA 4HTAA 3VAYA 4U7FA 4EHJA 3B2QA 3V1YA 5JY1A 1YQ9A 4AQDA 3KUCA 3EBPA 4IRMA 3LBIA 5JOQA 4OHYA 3CUYA 4LXQA 5T64A 2IEDA 3FMPB 2G8LA 1IC6A 1VHWA 1UPTA 5FEUA 4D3ZA 2BFNA 4IOKA 3C72A 4ZHQF 4B32A 5DTEA 2FG7C 2UXDB 3ZKJA 3O8QB 1ZD4A 2ZBPA 3GDOA 2CFCA 2MT9A 4NATA 4G5RA 3UAGA 2ATEA 1NV9A 3RADC 2R17C 3V2UA 4GLBA 4YI5A 2Q3HA 4DLRA 3SQXA 3O1IC 4TUYA 3B82A 3OFND 3BXPA 4LSZA 4FB4A 1IQ0A 1TMGE 3K1TA 3W2FA 1RZ4A 2WKQA 1ZVMA 3D6FA 1T2EA 4L8YA 1WMEA 4Q3EA 1UFVA 4PQGA 1LDYA 2XYGA 2HIHA 3I6BA 3RIGA 3I9V1 3D4OA 1EWYA 5KTTA 4PAGA 4IPTA 3IEGA 3B13B 3PNPA 4EPTA 2P7HA 1Q2UA 1JEDA 1ZK1A 1Y9JA 5EEGA 1ZI6A 3Q47B 2GXQA 3LQ1A 2QL7A 3BT7A 2EGGA 2JVKA 4DLUA 4NDZA 1R2QA 3OF5A 1ZGZA 3RANA 3LT4A 4U7TB 2H8GA 4EY7A 4UHEA 1LWNA 1TFUA 3EFBA 3OUZA 5I7VA 1RJ9A 4DDHA 3OM1A 2C4MA 1CZKA 3CVWA 1VHTA 5GJVC 1DARA 4ARUA 5EYPF 1U4OA 1MJNA 3KHTA 3IPYA 2YXBA 4BERA 4GRIA 1PO7A 4J9UE 4MWEA 3I5PA 2YUIA 4HRVA 2X6FA 1GCUA 1VL2A 4G0QA 2HLDA 5EUBA 3GAMA 2QL9A 3J7TA 2BWJA 3U3RA 5A9RA 5HMMA 1G3QA 1B1AA 3IT3A 4JJ4A 3OEHD 5FUVA 1ZD3A 3IQHX 2JVJA 1R5OA 1NIPA 4BNJA 3MZ0A 3T5AA 4FYXA 1KH2A 4KXMA 3MTQA 4DSZA 1M7GA 2P3OA 4HR7A 2JDID 5FPYA 3QVJA 1QRSA 2ZAGA 4J0IA 2XSZD 3R7WA 1SK9A 1OCZE 2HYZA 1CF2O 4ND1A 2ZGGA 2C78A 2CFIA 3IURA 2WJGA 4DIFA 1C0PA 3PEUB 3H05A 2XMGA 3PR1A 4QFVA 1TNOA 2NT3A 2XPIA 4PSKA 5FNVB 1UFOA 2CMFA 4WNCA 1HM5A 1JQAA 5G53C 4L5YA 4BAUA 4AC9A 4FXOA 4PBSA 1X7GA 2R5NA 2ADOA 4HATA 4LNUB 3PDCA 3HV2A 1M2HA 2LSUA 1BWSA 5H16A 2Q4TA 3L6DA 2AUTA 2YDXA 2FPRA 1YR2A 1EWTA 4K6FA 3FRJA 1W46A 4QFMA 2Q9AA 2YASA 2V5VA 3S2EA 1VE5A 5EIWA 4WPGA 5COQA 1JJBA 1GRNA 5ICEA 2R2LA 2FG6C 3HIZA 2XZDA 4PZ0A 3TLMA 2JHCA 3EHQA 2QLNA 4P58A 1I01A 5BORA 2NNWB 2WVHA 4YIKA 4B3BA 5E6SB 5H70A 3FFLA 1BEEA 4ALMA 4P2BA 3CN7A 2ZYGA 5H0IA 1BCSA 3EDRA 4J8EA 4XEUA 1XRLA 2A1TS 1DEHA 1Q0PA 4ZK2A 3CNHA 2H6IA 3IV9A 4PNHA 4WCFB 5JISA 5F3RA 3P5SA 2IH2A 1O77A 4D7AA 1IHYA 1E3QA 3FYSA 2ZRDA 1CUUA 1ZGBA 3ZHSA 3VTYA 3O1JC 4JNCA 4BLTA 4IMJB 1REQB 1LF8A 2JFZA 2VSOA 2F48A 4RW0A 2UZIR 4C7VA 3RLIA 3D7NA 1SVXA 2DG2A 1GG2A 2GETA 2DLNA 2J5QA 3IP1A 3TLGA 4EG1A 4E30A 3D4LA 1H6PA 4FM9A 1P2UA 1HE2A 4OXIA 1QYWA 1C2YA 3NYIA 4GXTA 3QWIA 3UTCA 3F6YA 2BHLA 4PLTA 4KDEA 2MR5A 2NXNA 1L4LA 2PH7A 1WXEA 1AA9A 4B8WA 1KVRA 3N8DA 2GH1A 1H3EA 4ESOA 4URFA 2C99A 2CDNA 2ZISA 2FWNA 2X8AA 2A5UA 1RKVA 2ZIEA 5JJTA 2ODEA 1YFJA 3DQPA 3NC1C 3NTRA 3HCRA 4UQZA 4E31A 4NBSA 5DX8A 1WABA 4RD4A 4ZQCB 2NSYA 1T13A 3GRKA 1GGEA 4FBMA 3HY4A 1JHVA 1JR4A 1MQAA 1WSDA 4XUCA 2NTNA 1KSJA 2QX7A 3EG9A 2ZLBA 3MWLA 4CEIB 1XZQA 4E21A 2G1KA 2V4HC 1MXFA 3ROQA 1DX6A 2OZPA 1R18A 3FVVA 2OA0A 4R2MA 1I2AA 2WXFA 1T6XA 3E9CA 4AO8A 2MSNA 1M7HA 4FFBA 3TS1A 1GUFA 3QU9A 1DMSA 1CY4A 2ODWA 4UEWA 2QGNA 4Z5XA 1R4NB 2ZTUA 4LF6B 2X8WA 2H2IA 2FPPB 1F2UA 4BFUA 2IX9A 5K4AA 3UTMA 1Z6QA 4EFDA 3MWEA 4HQ0A 2Z6UA 3KHUA 4BKUA 4DSTA 4RY9A 3MV3B 3QNWA 4TZTA 1SWVA 5HF6A 4OMFG 4CLDA 2VZLA 3HVHA 4DIOA 1SOVA 3GVHA 3I3NA 4ZK6A 4DREA 5EJ5A 3L0PA 3ZJYA 3KKLA 3TTXA 1YQGA 2JA2A 1M0SA 1F17A 3GU3A 1B0UA 3V8RA 3CVQA 3Q9UC 1ESEA 2JGMA 4IQ4A 3VH4A 4XX1A 4IBOA 3I72A 4W8HA 1I0IA 2NVOA 3OA2A 1I4TD 3CVOA 5TPZD 3CQ9A 1D09A 4KTVE 3D43A 1Y3FE 3DONA 4C7KA 1OFIA 1GGNA 5K6RA 4JOSA 3UGJA 5EWJB 3LKVA 1L3BA 5BQ3A 4WGFA 5CD1A 2IYYA 2ACVA 1KDOA 4YJHA 3WWPA 3EUWA 4LY3A 4N6GA 3B5EA 4GZ6A 3ED5A 2YJ5A 3EBLA 3PVLA 5IT9A 2VATA 4G9EA 3V31A 3BREA 5IMBA 4TLDA 5LBIA 2FMXA 2X3UA 1N78A 1Q19A 3BWDD 4FEEA 3PHJA 4OP1A 1ETUA 1V8PA 3E32A 3W6ZA 2ACEA 4I1VA 4NICA 3V00A 1NIJA 5JU6A 5CHEA 1P9RA 2J3JA 5EHNA 3W3AD 1Z3YA 3FMGA 3NOQA 4TM7A 4WN3A 1YFLA 1RE1A 2O05A 4M87A 4R0NA 3DEOA 4EY6A 2AI3A 1R00A 5NLLA 1JHPA 1HE8B 4CMEC 3QARA 3WRYA 3UF0A 1ZGAA 4XXHA 1VA5A 1CDOA 1FNCA 1RWVA 2JFVA 5FH9A 3FWVA 5E76A 1C1YA 1KRXA 2WJWA 4KT6B 1KZGB 1MOPA 4DPLA 1OI4A 1FSSA 1JALA 2P27A 3BKWA 2UYGA 4MPJA 1VJCA 1LPBB 4GE3A 1QNFA 1PNVA 3HGMA 4XIFA 5CBOA 2Y1DA 3D64A 3O4GA 4ND2A 1SULA 3WWEA 2QY6A 1E6LA 5LOVF 3QENA 2A7XA 4J0GA 2O6LA 4K87A 2A57A 5LQRA 1QX3A 4GD3Q 3RFFA 3VPHA 1XX6A 1KLXA 1UC4B 2J67A 2H1WA 4Y18A 4Q96A 1QRRA 3L6EA 5HCNA 4TTTS 4U5XA 5TGZA 4NBNA 4AZ0B 4BO0A 5M72A 1JYFA 3WB9A 4NCIA 3HB1A 5A1JA 4I6GA 5FPQA 3WLQA 8AT1A 3MTJA 3PKIA 2YZMA 2YY7A 1FVXA 5HZHA 1FPQA 1ORVA 1AWCB 5B3LA 2B3TA 3IODA 2O0MA 4X95A 4D9EA 2ZBUA 3JQBC 1IYZA 3L05A 2JCBA 3SBDA 1J2JA 1ISIA 4JUDX 4GKVA 3KSBC 3GPCA 2ZS7A 1D2AA 2Y92A 1QO0D 1XFAA 1M2KA 4WKPA 1ZUHA 4NC9A 3T3GA 1VMEA 1S8FA 8OHMA 3SX0A 1BVYF 2WD7A 3SJZA 2D2XA 4WN9A 5IKEA 2X3YA 4KR9A 1Y6QA 4DR4B 3IP3A 1PTKA 1WSWA 1DTSA 4PN3A 4C06A 3ZQ4A 4B3MB 5J40A 3S2UA 5FR2A 2PL2A 4NXMB 4Y6QA 5AN8A 5CUQA 4XWAA 1QONA 3H65A 4KWCA 1HBJA 1OLOA 5BWBA 1KJNA 3MNFA 4H31A 5JZSA 3DR5A 3F7TA 2P9HA 2IS6A 3PZRA 4M1OA 1RYBA 4PQRA 4ZREA 4CR7A 1PE0A 2J07A 2BM9A 1MF7A 4Z7OB 1GQFA 3DZIA 3MEKA 2NUPA 5LYYA 1XCJA 1PT6A 5JMPA 2J31A 2EJVA 4Q5IA 3QXJA 3F7MA 3FWZA 2NVBA 4P2GA 1JN0A 4KQIA 4CEJA 2EIHA 3CLJA 1XD2B 4UDOA 3JD4A 1CZOA 3O90A 2RHCA 1GKKA 3N58A 2IODA 4WOKA 2ID4A 5LDHA 5CECB 1LV7A 4PXAA 1KOFA 4L6AA 2GHTA 3VU1A 3HCAA 1O5MA 4P22A 2QLMA 1TKCA 5C1PA 5IWCA 10MHA 4DILA 1ZOPA 3ZS8A 4YFYA 1PRYA 4G0YA 3HN7A 2ATIA 3GJSA 4JI4B 1SBQA 5JMWA 1Q1QA 3QOXA 3PUIA 3ZXUB 3F6QA 3D5EA 1NMSA 5K3FA 3KYCA 3STTA 1P91A 3VU9A 5CNJA 4QOSA 3DXFA 1RRGA 3H3FA 1KFKB 3ZJ5A 3V33A 4M1SA 1PT7A 2EYUA 1H1TA 4N9WA 1TW3A 1LK7A 2JEYA 3RHSA 3HGQA 4JJ8A 2RC6A 4G1VA 4RHXA 4XX0A 2FVXA 3HMQA 4C0BA 4RXTA 4MROA 1LLUA 5CVTA 3H9BA 4HWSA 3ESQA 2Y66A 1F0PA 2EP7A 1HYEA 2L19A 3PFWO 5HIMA 1U8TA 2R0QC 4CQMB 1F0NA 4W1RA 2HCRA 1AIPA 1U2QA 3K9BA 4G36A 2ZJ1A 4EHBA 1UM9B 3JAKB 1NJ8A 3M5CA 2ZUFA 1EU1A 2XE4A 4OQLA 4Q3DA 2O2ZA 2XZDG 2C7VA 1GDTA 4WXRA 5HI7A 4EELA 2CSXA 3Q7TA 4HS2A 3NRJA 2CLCX 1E5DA 4WV3A 3WE7A 3UMCA 4A7PA 4HBZA 5B2FA 3ZY5A 1D2EA 3F3KA 5JDCC 3TSWA 3OI7A 2FQWA 1PD0A 3WVNA 2E2WA 2VYVD 5ICMA 2YVUA 2JASA 4HYYA 4U6QA 5D8DA 3S2SA 3BULA 1GRQA 5F2NA 5B58T 4YJ3A 1XZBA 4JXZA 4G5SA 1NASA 3GMDA 1CUDA 1SWWA 4JVOA 1IH8A 2OGWA 3DLIA 4W9RA 4UFPA 1UPCA 3N74A 3MWJA 1IY0A 5ITZA 4ZYTA 1K3FA 3HYMB 2LPMA 3CRMA 3B3QA 4FHKA 3QFCA 3GFSA 2C7OA 4TRMA 3KEFA 4DUZB 1C5KA 3Q12A 3BGWA 1OCOE 2QAJA 1YJ8A 5CVCA 1Z62A 3E7DA 4H27A 3VC3A 4F86A 4QBKA 2XB9A 3RRZA 1U4NA 2IQCA 1UPXA 1KA9H 1X1SA 2P4EA 4OBXA 2B2CA 4DV0B 5LP6F 4B3TB 3U80A 1YD7A 2M1ZA 2VO1A 3CN9A 4EG7A 4LA4A 3B5IA 1C7ZA 5GGXA 2J8ZA 3BIXA 1EIZA 5A3VA 4LJSA 3M2PA 2RJNA 3MRXA 2J0EA 2XR1A 2ZE6A 1K4YA 3C7CB 4BY6A 1EINA 4COOA 5KYVA 2F00A 5K6TA 2QNRA 1P7WA 2HX1A 5IXSA 3WK8A 4MMXB 1I2MA 2WVJA 5T8KC 1GT6A 5KQPA 3LVQE 2CNKA 2BMAA 3CEPB 3IQWA 1UC9A 4BB5A 4MP8A 2J4DA 4UWHA 3GEMA 5T3YA 1FUUA 3Q0TA 1VB3A 2P7IA 1A9RA 3QU7A 1BNCA 2YZNA 2WHQA 2WHEA 3PJGA 4EG5A 3U4QB 3RC9A 2JIBA 4RXMA 1G3NB 2ORIA 1OUMA 4LEIA 3WY9A 1Y3DE 1W35A 2W6NA 6AT1A 2TS1A 4B17A 2XH8A 4HQLA 1Q7EA 3GLRA 1Y8QA 3JQGA 4L51A 2P2SA 1ISRA 1FSZA 2I2XB 1CUEA 1UG3A 4KHPB 3HZHA 1BHO1 4BE7B 2VUTA 5CA1B 2OXFA 2I87A 2R00C 3CH5A 1B89A 1X74A 1DNPA 1VPWA 2JIZA 3HCDA 1M73E 2Q4RA 4KPUA 3UOWA 1OV4A 1KDRA 2N9UA 2YYZA 3TMYA 5FIOA 2O2SA 2Q6OA 3R3HA 2VHQA 3MBOA 4MCAA 4KNYA 3HJGA 5ENRD 3ORFA 1QCZA 3MXTA 1VP3A 2GVZC 2V4ZA 1U7DA 4PXYA 5DP1A 3DSWA 4CEHA 2PJZA 3P2KA 4ZOLB 4TVOA 1K2VN 1A5BB 5BRJA 3AI3A 4FHJA 1P45A 3P5BA 2I5PO 2OUKA 4B3RB 3OPYA 4FI3C 2G5CA 5CMLA 4DB4A 3F6PA 1D2NA 3JQFA 1MABB 3H11B 1MB9A 1OZAA 4N6NA 4NAUA 4A8HA 5TEWA 4JGGA 4YN3A 5G05J 3COYA 4R4JA 3UV6A 4EG6A 5HFNA 1R7RA 3AX6A 4E51A 4Y9TA 3LS8A 3NNDA 5AVZA 4IEEA 2QKYA 1GN9A 1PIWA 3AOGA 4MVJE 4HLQB 2WT4A 4RWEA 2X5NA 1KIMA 4YNBA 4Z4CA 2ILRA 5C8DA 1GU1A 1DIAA 1Z16A 4YJ2B 1KAEA 1O95A 1LLDA 1RI2A 2A33A 3LHKA 4WECA 3H7AA 4CFSA 4PLFA 2XQIA 5DW0A 2H5EA 1MU0A 4R7LA 4MKRA 1SA5A 3CKMA 5JC1A 1E4OA 3UV3A 3X1YA 2ZYTX 2MIIA 1WL8A 1A8UA 3VX3A 4IW3B 1KY2A 2J33A 3STWA 1ISGA 1QIKA 4OOFA 1PGJA 1KEZA 3PXUA 4LSMA 5G1PA 3K9LA 3OCYA 1GPYA 3IP7A 2GRLA 1J97A 1Z35A 1OI3A 1JWGA 4FMDB 4EDFA 1MTZA 5IH3A 3PNKA 4J0EA 5I3CA 1R0BA 5LZ9A 2OEVA 1K7YA 1H1LA 4JI3B 4FGZA 2O8FA 1EP9A 4V0QA 1LW6E 2QRUA 1JLHA 4EHLA 1FLVA 2AFVA 3DEYX 3DD5A 1JQEA 3I2KA 2HLDD 2FKNA 4BV8A 4TL7A 4A9AA 2X1LA 2DH6A 1E2LA 4Y2QA 4OLBA 4XSVA 1PR5A 1ZIOA 3H84A 3VHRA 3ZHEB 3L9WA 5AYVA 1FA9A 3LXMA 2WAXA 2CD7A 4OH1A 1GCAA 3RASA 1LBEA 5FYQA 5CDUA 4OP2A 1QP8A 3PUWA 3EVZA 3P9QA 2FW6A 3PHIA 2PUAA 2PJRA 2J45A 5E9AA 3KBBA 2GO1A 2R84A 4KJXA 5JH7B 9ABPA 1S3IA 1SUCA 2RBEA 5AVVA 5C52B 3RAEC 5B6PA 4C4OA 3PJDA 4EHHA 3HP7A 4XWWA 1QX4A 1Z8NA 4OP3A 1B15A 2PZAA 3WGKA 4QD3A 3VZDA 2MHCA 1MPXA 3CYFA 2DR0A 1ECLA 3QPCA 2V7VA 3UJPA 4NDAA 1K3UB 1QRAA 3M6LA 1XZGA 5JCJA 1TX4B 4ZVVA 2OSVA 3JQ7A 5H1YA 1A5AB 1NC1A 1NW6A 2G28A 1CR1A 1E9BA 3N3BC 4A0FA 5MN5A 1N7IA 4AWXA 4NZYA 4RTOA 1VKZA 2PM8A 2A5GA 1UMKA 2I7XA 1N8NA 3IVCA 2QN1A 2DUUA 5GJCA 2EVWX 2H9IA 3VUEA 2QYSA 5BUQA 5G0SA 1SELA 4XFKA 2DWUA 4GM4A 5DTJA 1GV0A 3ABZA 2YBEA 1ZVKA 2O8CB 4N3AA 3F6RA 4J4BA 2ZRLA 3KG2A 2DFTA 4BN0A 3W5BA 3CEQA 3AKYA 1GZ6A 1W581 3IP9A 1N2ZA 5GV7A 2ZB7A 2BGRA 2A0UA 2WABA 3TWRA 3LOUA 1DQSA 4E4RA 3IMEA 1GPWB 2Q6VA 5DK4A 3H19A 5HUQA 1FCHA 4BP3A 1W4ZA 2WHRA 4DA7A 4BAZA 4B0ZA 3NOVA 4FHCA 5KTSA 1KI9A 1F8UA 4HAZA 2NYJA 1GFZA 4JFRA 4IY1A 4UOQA 2XQGA 2OZKA 1G64A 1B8NA 4RXUA 2RHOA 3TKAA 3BE8A 1EFPB 1L1QA 2UYQA 2DWPA 1S8OA 1N5OX 1X7WA 4MUNA 2VG8A 3GBSA 1UAAA 3KAEA 2QR5A 1D0IA 1ZX1A 2P9KG 1JMYA 3DUWA 2P3SA 3IHLA 4RKEA 2ZI7A 4KX5A 4KQMA 4LRYA 4XAQA 3SC3A 3LX8A 2Z3ZA 4KVMA 3HBJA 3F2VA 3O8BA 3EU5A 1QIIA 1L9XA 4TXMA 1H6KA 1IULA 3OX1A 3HG7A 4OXYA 2VP4A 2XBMA 5B1DA 5H7XA 2HO5A 4K9OA 4UEQA 4B46A 3LT0A 3HGTA 4HRNA 1NI5A 4WTOA 3TWVA 1UJ4A 4CV1A 2QRZA 2ETVA 1CYEA 4AJ4A 3DFZA 4GX2A 1OLUB 5LX8A 1CVLA 4K3VA 2PKYX 3JD1A 1XHFA 4OJYA 3I28A 3VBCA 4OQYA 4WBNA 4UZFA 1GILA 5B1SA 5GWXA 5BQFA 2XE8A 5FTKA 2B4QA 3F3YA 3B1JA 2IPLA 4NARA 4YVOA 1WCIB 1ZZEA 5T3UA 1N6KA 1OBVA 2XCOA 3W3AA 2CEKA 3V4PB 2RSLA 4ZAWA 5K45A 4MICA 4MUXA 3OQPA 3ILXA 3MW8A 5TVGA 3WB2A 2ILTA 2XS8A 4U2GA 2EV9A 5ELXA 1MRZA 4WNFA 2GXSA 3A6JA 3CSSA 3NW9A 3OLWA 5H80A 2QRQA 2IBSA 3SG0A 2VPQA 2K7ZA 3S7ZA 4L0MA 2R8BA 5IKOA 2WY2D 4A3SA 3PREA 3HRKA 5TR9A 4ZYXA 5J59A 4EA7A 4LYFA 2QA5A 4NWIA 2IVFA 4FC7A 3D6TB 4U9HS 4MQMA 5T4HA 4U00A 3E8SA 2GF0A 1VPLA 3JQDA 3VLEA 2MU1A 1QF6A 5DM1A 4HRMB 2GW1A 3TKYA 1XHEA 4NIKA 1TUBB 1D0SA 2NNLD 2PH5A 4L1KA 3DKRA 2Z95A 5B7GA 4M0FA 4L76A 4A55A 2YWJA 4DPMA 2GPTA 1M5UA 2I6XA 5AVWA 5DNEA 2DPGA 4S35A 2V9CA 2F3RA 2Z8ZA 3RROA 3M1IA 3P1JA 1IN4A 4LJ6A 4UEJA 2IF4A 1XKQA 4YRLA 5DRTA 2R03A 4A92A 3ENEA 3J7AC 1C4XA 5KJEA 4LKOA 4D2IA 4LFBB 3GLUA 1CY2A 2AXVA 4TTIA 3KKPA 2IEBA 3C0KA 4JODA 3AXTA 1VJDA 2ZJ3A 4FULA 4EO7A 3F6BX 2SKCA 3H6GA 4HFRA 1C9YA 2IPOA 3SBSA 1JLLA 3NGLA 2I2DA 4D44A 4OQZA 4UUBA 5DIFA 1N4AA 2YJTD 5K8UA 1G5PA 2VVTA 3WQQA 4K81B 2XMQA 1D2RA 2Q6LA 2PUBA 3CZMA 4RGYA 1WUHS 1YKGA 3HUEA 2F64A 5E7QA 4MRMB 3OHMA 2PO5A 4CUKA 2WJZB 4BBJA 4US0R 3FSJX 1LBTA 1G19A 4GYYA 3NQPA 2AWNA 3DSSA 3HU1A 4Y1RB 1GGHA 4YHBA 2F7SA 4L9WA 3SS7X 5IM4F 4RABA 2W6QA 4MIEA 4C1NA 4DLWA 2AZ4A 2RARA 1JMKC 3BMQA 4MO9A 2O06A 2W2VA 2CVFA 4ZHQA 4DX5D 5HKAA 2XHZA 2AXQA 4BB9A 3LSTA 4QGFA 4C5CA 1QPBA 3G0IA 3DP7A 4E5KA 3ZXIA 5HPYB 3QFFA 4J0UA 5KBYA 1CY7A 3ZE9A 2ID8A 4ETNA 3OSZA 2Z43A 1EFRA 3WIUA 1JG6A 2GESA 1PZEA 1WB9A 4D4MA 3M2TA 4DZRA 3L0YA 3EQ8A 1SHJA 4WOJA 4Q9LA 3K0SA 4NYIR 2AVPA 2HIAA 1SIOA 2C59A 4UUOA 1TCVA 3KKKA 1BQ4A 3OJLA 5BV1A 4TMXA 5M7EA 3TOSA 2Q8PA 4M3OA 5TLSA 3DUFA 1T34A 1F0KA 4UUQA 3ESCA 3RU9A 2PZMA 3UY4A 4O60A 1CQXA 5IF3A 3NBUA 2PM6A 2YHEA 2CJYA 3KUXA 4HNVA 5I9IA 3FKSA 1RACA 3DH0A 1G8SA 2VKQA 4BUJA 5KC8A 4FQ5A 1NNLA 4NQ0A 2XXAB 1OC4A 5EYPA 2PKXA 1ZBPA 5EJEA 5DLPA 4AYWA 1XA3A 1MJGA 4HSEA 1HQKA 3P2JA 3AR3A 4LHYA 3LC2O 3O94A 1ELRA 1G9TA 1C0EA 2DQZA 2JLXA 1ESCA 4AI6A 3W5JA 2IOFA 3TF5A 3HBLA 4AP2A 4FP7A 3HZOA 2RHDA 2R6GA 4JP2A 3KXLA 4GE0A 1Z7EA 2OLJA 3I09A 5BO5A 4HFJA 4QE3A 4HUQB 4QJIA 4M54A 3OTNA 1IONA 3LIIA 1EFVA 3DBIA 1YOVA 2ZI5A 3HDYA 1HFAA 1DX9A 5KYKA 1V6AA 4WOCA 1NHWA 2IHTA 3Q0EA 2BCEA 5ADUS 1EZ1A 4G5XA 3BBPA 5ALWA 5HE8A 5AW4A 1OKKA 3ZLVA 3AJ9A 5AK3A 3AESA 4R71A 1EJ2A 1NPYA 2I80A 2VYVA 1L7XA 3S2GA 2OSBA 1Z0ZA 4GT1A 3WWYA 2AE1A 1MJFA 4L72A 5D7BA 1QBQA 2ISSD 1M6VA 3IQGX 4MULA 1SQGA 5EE1A 4OH7A 1BMQA 1P0CA 5AICA 1NI4B 4EBAA 2R68A 4U7PB 5JAZA 5A6SB 1GUBA 1QQ7A 3EEOA 3IXLA 3VDXA 1CF4A 3IKOB 2R7MA 1HX8A 2FFRA 3OIGA 3R3WA 3LGAA 1OI2A 4FC6A 1IHOA 1I2CA 4NV1A 5AW5A 1WSAA 5FD8A 2DHEA 3FJOA 4X6XA 1SUBA 5BR7A 3ZU7B 4I8IA 3AW9A 1FFGA 2L6JA 5HZKA 4I43A 4CLOB 4DFDA 4Y2TA 4Z4IA 4QGSA 3D9PA 1Z2AA 5P21A 3IR6A 3UJBA 3Q10A 3WLHA 2CNBA 4QPPA 3ROFA 4BMYA 4KDCA 3BVPA 4P29A 1ZA2A 3ONLA 2VBFA 2YY5A 1JH8A 1XAJA 3NBMA 1PG2A 1GQ2A 3IBFA 1XCBA 3ES9A 1PI3A 2I2FA 4N82A 5KO2A 1IXKA 4RDCA 2QG9A 3IUBA 1KI6B 4DR6B 4FMPA 2FU5C 2G1AA 4C0WA 4X8OA 3ZKWB 1QRTA 2NX2A 2VTEA 2PKCA 1VXOA 2Q5FA 5TQ0A 4WFIA 4RY8A 2VDOB 3H7IA 5CB6A 1K66A 2BLNA 1BMFA 1PSWA 4GOXA 4G26A 3Q7IA 3HJAA 3ZVRA 3I1JA 5AHWA 5AJTA 3NHRA 2XB2A 1MYOA 3MINA 5HIJA 4N8DA 1HT1E 1J1IA 4LOHA 3OECA 4H1UA 3SI7A 2IXDA 1GR1A 2X0DA 3TQCA 3EZXA 1VKOA 3PNLB 3ZVNA 3IAHA 1UPUA 1T36A 4J49A 5EUMA 1LA2A 1HNNA 4QVIA 4Y6CA 4GXQA 4UE2A 5HBGA 2QN6A 3A6ZA 2BI7A 4U5QA 2X6IA 2VDNB 3VVBA 2O2GA 3TLCA 4R01A 2ZJBA 1J8VA 3I9FA 2YINC 2R6JA 4KQ9A 1UWCA 5FBVB 3ANSA 2C0CA 1EWQA 1T3HA 1DEOA 3TKLA 1WZEA 2WM3A 3GFFA 3EWSA 5FTNA 2HPVA 2Q9CA 2WFAA 2DYSE 2ID7A 3DQQA 1CR4A 4M8NE 4V3BA 1PU2A 4R3NA 2A92A 1ZESA 1L6RA 2QAGC 5LYJF 3Q73A 2VAVA 1S9DA 3OOEA 4NYMR 4HDOB 1RRCA 3ZJVA 1KY5A 4XM2A 1I24A 2VC2B 1XG5A 3UMFA 1GKUB 4A5OA 3RSGA 4BWFB 2R87A 2BFFA 3EGIA 1IVYA 2WOOA 3AF1A 3EDYA 1OY3D 1XXHA 3USES 4JB3A 2GBIA 1ST2A 1QYMA 2DUNA 4CYMA 3OMLA 3U17A 3ZHQA 3JALA 3B60A 2RDMA 2X5OA 1POXA 3VSBA 3PC6A 1I3CA 4KAXA 1M1YB 3ROTA 1PZHA 1SKAA 3ZVKA 3B1FA 2FEOA 4J0CA 2JABA 4B3FX 4E88A 1Z3CA 1GXSB 1NKSA 4JYMA 3ZW9A 1U0BB 3UGQA 2PYZA 3KTOA 2ZUCA 2XCUA 3T34A 4UBLA 1TJ4A 4JYCA 5LMNB 3K1YA 2ZRFA 5C8XA 2JIZD 2VDMB 4GTOA 1V55E 4X8LA 3NV7A 4CETA 5E7MA 2P9GA 3OHSX 3GL9A 3OIDA 2OGZA 4EY4A 5K4HA 4JX8A 3JPYA 3W1VA 4EPXA 4BVKA 3D1VA 4S1VA 4MLCA 2HO4A 3ELUA 2PGLA 3NUQA 4FYMA 3KV1A 2KCKA 4FW9A 4E94A 1E64A 1HLGA 4ZT7A 4X00A 7REQA 1RM5A 5ENNA 4XGNA 1FTYA 1ZOLA 5TMPA 3GT7A 2GAIA 2C5SA 3MUEA 2JEZA 3WC4A 4NK4A 1WV1A 3NOOA 2YDYA 2C8KA 4L85A 1OR8A 4PO3X 4A36A 4UNRA 1WO8A 4D43A 1QIJA 3KEGA 4MW1A 4E6HA 1K6JA 4A1GA 4KHZA 3ZDZB 2NZ2A 2GPSA 3HBNA 2X7JA 4EJSC 1YJQA 3G2KA 3TTUA 1G4UR 3BMNA 3JZIA 4TSKA 4RFSB 3A2KA 4WBXC 2N1MA 4UE3S 3M4YA 2ZIXA 1O95D 3I30X 3ZY2A 3C39A 1AD2A 3N5KA 3NBNB 5LOVA 2DETA 5DEOA 2AI1A 3NXKA 3WAJA 4GOKA 4PM4A 2IQIA 3IUSA 4E08A 1OREA 3FU5A 4PQFA 4DLYA 4WWPA 3ENWA 1QFYA 3PFCA 4IS3A 1Z68A 3R6GA 3FNBA 5IJ9A 3RR2A 1U0LA 4GW3A 1LF5A 1DAEA 5BSRA 3JXJA 1USWA 4NZMA 4ZODA 3WZLA 1BA2A 4JC4A 4KWEA 3HNPA 1M34B 1SG0A 1Y6JA 1L8OA 4YTEA 4BVLA 2CVZA 4EDHA 3MHPA 4XVCA 5EEHA 3AY0A 3F97A 1II9A 3U60B 4JL6A 1JJ7A 13PKA 1PL8A 2Y6UA 3M3DA 4P31A 3AINA 4HC4A 3FNFA 2QUJA 3N8HA 2IP2A 1LQTA 4M1QA 4YGXB 5A2GA 1TYDE 5AO9A 1XROA 4JB8P 3RC3A 1EZZA 3EUEA 2JGLA 4OKSA 4RH1A 3ZWPA 3GVCA 2Q2VA 4BCBA 4ER3A 2RD0A 1RRMA 1ULSA 1Y81A 5YASA 4KPYA 3LGSA 2BP7B 4YRNA 3NHLA 1DBRA 4H3HB 1TZKA 4FIDA 1H0KA 5TQ2B 4P7BA 4CW7A 3BTSA 3WZMA 4GIBA 1HL3A 4QDZA 4J7WA 5F78A 2ZRCA 1ORHA 4E5YA 2D1YA 2IUSA 2AW5A 2ETAA 3RKSA 3H8VA 3HL0A 4OEHA 5LJLA 3E5HA 4RORA 5TT1A 5BN4A 2I8LA 4DLLA 1IN8A 5AVJA 3ZOKA 4YC7A 3NDRA 5AW6A 1UJ2A 2NO1A 1K89A 4RV4A 3U26A 1FYWA 4GBED 5JCJD 3HABA 2BMEA 1C81A 4BX8A 2HAEA 3OIYA 2FB9A 2JFNA 4UMEA 4AY6A 3ELBA 5CD9A 1D3AA 3SMVA 4F93B 4CG1A 2AKAB 1JFFA 3UNXA 5AKJA 5ENZA 1VLZA 1XCGB 3C6XA 4QECA 3UHOA 2EX4A 1CEQA 4AXHA 5ESXA 3O75A 4D98A 4ZC8A 5IMSA 1U3WA 4Q6BA 4X24A 4BTEA 3HMKA 1E2IA 4H16A 1QP0A 1OLSB 4B93B 2X8JA 2PBRA 4MH0R 2P3LA 3QOYA 1K0UA 4Q7JB 2QJRA 5JCOC 1YI8A 1EUDA 4M9CA 3TDNA 3IQXA 1TM5E 5DLDA 4ALLA 2EYQA 4FWIB 2QW1A 3CEHA 5ITSA 1UK9A 4WINA 5FDFA 2XZLA 1SXJB 2PUGA 4G97A 2VRCA 3GLHB 4WZBA 2XRMA 3ASOE 1T1RA 3C1TA 1MJ0A 1J7KA 3ZIAA 3GMIA 3L08A 2W22A 3H1GA 1FP4A 4O8ZA 5E95A 1I6LA 4U6SA 3ZUVB 4DCOA 4ZMRA 3EEIA 4JLUA 4PS8A 4NHOA 3OY2A 3ZR4B 3SZ3A 2L82A 4X64B 3IOYA 2W71A 2NZ8A 4YREA 2WYIA 4LQDA 1L4NA 4MKHA 4WLEA 4BLQA 4NKRA 3EEFA 3VU3A 5CVDA 1Z88A 3EUVA 3Q3EA 2XI4A 2RHMA 1UOPA 3DJFA 1Z13A 5K3EA 3ZRHA 2FSSA 1JTFA 5SV2A 3QDNA 3FVWA 5KTKA 2B25A 3OD1A 4K5QA 1GNLA 4WZAB 1WM1A 2AXUA 3UKJA 1RQ2A 1ITZA 4KE7A 2BFDB 2YOHA 4EBAG 4UPDA 4ND6A 2DIWA 2PM7A 3HUTA 4K1XA 2JARA 4RA6A 1Q91A 2WNIA 3F1KA 3A58B 1JBKA 4H0NA 1YRLA 4ZTUB 1UKZA 4BFXA 3DCIA 4Q37A 3AEXA 1J6UA 4N5HX 4LDNA 2RHHA 1A9QA 4YQZA 3GZ2A 3U3XA 2QT9A 1TAQA 5EIBE 1K4KA 2BZGA 1T5LA 3PL5A 1DXHA 2WU1A 4CIBA 2HH9A 1S2DA 5NULA 1DO8A 2Y1LE 4REOA 4EUFA 4YJFB 2HSWA 3PBKA 3BGVA 1UIRA 4OHWA 1XP8A 1Q3KA 2FK7A 4YYEA 4HT3B 4O5OA 3A70A 2VP5A 1KI4A 1H2VC 5LQCA 1RZ3A 3OXGA 2V54A 3SFYA 3CONA 5DM4A 5JASA 4ME2A 4HDCA 2VGEA 4DNQA 1HTWA 3V30A 4BO4A 1IIBA 2G77B 2B1QA 1E58A 4ZVRA 2XDWA 4J16C 2BEJA 3PENA 1PSZA 5TV2A 4GTPA 4Q9HA 5IJ0A 1Z17A 3D0OA 1KJYA 3KWMA 3QLVC 1SVNA 3FVTA 4TV9B 4BMVA 1Y48E 1C29B 4PH4B 4PG8A 4PLHA 2V0PA 5LP6A 3B1YA 4ACLA 3JYQA 2C9OA 1G4AE 1KYIA 5BSGA 4BZWA 4INPA 1E5TA 3QEBZ 1NP3A 1RS0A 1FFAA 1ZINA 3OKCA 2WP0A 3MJRA 5C7OO 1KZPA 3HJBA 1T6YA 4GI7A 4JJ6A 3KJZA 3PUKA 3R75A 2VHCA 4NJOA 3WDMA 1Z28A 1DPFA 5TIIA 2CLDX 3O7WA 1TYEB 4XFDA 3V8PA 1YNOA 3UI2A 3BMCB 1RI1A 3N0RA 4FE3A 3ZVLA 5LCXA 3U3OA 3AEKA 6LDHA 4DA6A 1JEOA 1LH0A 5F5XA 3LRPA 4BFCA 4XWKA 5K9ZA 2A94A 1FTSA 3EXEB 3JYHA 4YX9A 1D5CA 1WUYA 2Q62A 3IMGA 5KX5B 1R6DA 3R20A 2V7BA 1CQPA 3T3MB 5MN4A 2OZEA 3EAFA 3B8EA 4A8JA 3WRXA 2M6KA 1XTIA 5T5QA 1LRKA 4H7PA 4RZHA 4LVNA 3GRPA 3W4IA 1N52A 1NP6A 2FPMA 4QRIA 2Z58A 1R37A 3LGXA 1UZUA 3AHDA 2NU8B 2DR2A 4PQYA 1JNXX 2J5KA 2R8RA 2J59A 5H02A 2W6JD 4K5AB 3MCUA 5J2TF 3X1DA 3ASDA 1XMJA 2B92A 3UM2A 2ZUWA 5AESA 3WICA 3U4IA 1VDMA 4QXRA 3KB8A 4G8DA 3TQRA 2ST1A 2C0MA 1QPZA 2JFHA 3HXKA 3ONNA 1E0JA 3L7NA 4XEIG 1US8B 3DMTC 1J1UA 2NO0A 4RF2A 2N75A 3E3AA 2H7VA 4HCJA 3IBCA 1TA0A 2QJWA 3BK2A 3FGZA 5CDFE 2H0QA 2ZWAA 1KYQA 4OVVA 1VI2A 1PGQA 2YOGA 4LZZA 5CVEA 4CR6A 5LPNA 3HRIA 2PS0A 1E6CA 2CVHA 1VPDA 4X45A 3A4NA 5AVRA 1LD7A 2ZRKA 1B23P 8LDHA 1CUVA 2OCCE 2NUAB 5CVUA 1YB5A 2CXQA 4G01B 3F73A 2X6TA 1DAMA 4L2IA 1DRKA 1NLFA 2OEPA 5BPPA 1S1CA 1AUXA 4KQ1A 1N2GA 3E4CA 2W4QA 2Y93A 3NORA 4YAOA 2CL7X 1UDWA 3QGMA 1Y9EA 1H0SA 2XRYA 1JG4A 4RZUA 1JSXA 1EFRD 2R9VA 5DM2A 3A10A 4DGQA 2VZ0A 4QKQA 1RWMA 2PFKA 8MHTA 3D0QA 1AGRA 2CXSA 4V0OA 4YCDA 1GQYA 1LEHA 2DBRA 3RUAA 4EABA 2C4TA 5EZ5A 4OAUC 2QBYA 3I45A 1GAJA 4ZYUA 3AI2A 2ZG6A 1I4LD 2ID9A 4YEDA 2HIGA 4UTXA 4KQHA 3GYZA 3ACBA 2M9MA 2ZYAA 3E1KA 2QLFA 4H6VA 3EODA 4CHTA 4MO2A 3NOGD 4EL0A 3AEUB 4EGJA 5JC8A 3RSLA 1SHKA 2PGDA 2B78A 2C9YA 5ALOA 4X62B 1WY7A 2QM3A 3FKSD 5CP8A 2C4HA 5LU8A 4DLKA 4F21A 3AIKA 3BS4A 5CB4B 3VFDA 2P67A 4WFJA 1N8KA 3KFXA 1TU0A 3I9OA 4RLQA 3F2IA 2Q3MA 4ZHSA 2BUGA 2PL1A 4ZARA 3Q8LA 1B6SA 1K8XB 1Z6PA 1DVPA 5F1PA 2EJBA 1S3FA 4UHBA 2B7LA 2FQ1A 4FSDA 4A2WA 1W88B 4JI5B 3HCOA 5K3CA 1LI5A 1DC7A 1NWHA 5JSKA 3VPDA 2V5QC 3L5OA 5I6DA 1IVNA 3SHQA 4KR0A 5JO9A 2V5UA 3RKUA 3DLPX 3KS9A 5JI2E 1NPDA 3FROA 2OCKA 4IRUB 4Z2YA 4WLUA 5E38A 4GDFA 3SLRA 3ILSA 3QC1A 4E22A 1N1MA 3PHCA 4QJ5A 2FEAA 1YRAA 3CTMA 1N3IA 4D96A 3UK0A 4LF7B 3O84A 4F71A 2BEKA 2NSLA 1VJTA 1S2LA 3VPSA 5D0OD 3FCAA 3AP3A 2IHNA 1SPBS 1E8NA 3Q78A 3VI4B 3UMBA 1OKKD 3QVUA 3C7AA 4RNDB 1NN3A 3LF2A 2PMEA 1ZCJA 4H7YA 2GPBA 4MKXA 4MPDA 2ZETA 1U7HA 2IDKA 1T9AA 4FSXA 4BFRA 1T2VA 4RH0A 3T9CA 3N28A 2XXBA 3N5CA 2IBTA 4M9ZA 1P81A 1HTTA 3C6QA 3IO5A 4JL8A 4TL9A 5C1OA 3R9KA 1UDBA 2QTVB 4B87A 4DBLE 4IYRA 4ETIA 2C92A 3MAJA 4Q94A 4FZ3A 1M2GA 4BNLA 1YGPA 3EFOA 3PQ2A 3ORQA 3GH3A 3E53A 3PWZA 4Z7QB 2BFBB 3GJZA 1XK6A 5C5DA 4DRXA 4UFNA 4H60A 3S7TA 3QSYA 1XU9A 3GRRA 4LZJA 4KCGA 3CLRC 2KI5A 4EQ6B 1JWAB 5JY6A 4KK3A 4MQEB 4L0DA 2KBFA 3RYFA 4BLVA 1NYQA 5E9QA 3W9UA 1TECE 3OLCX 2OK8A 4KBGA 1O4VA 2BFOA 2GAJA 3CLKA 4MV6A 3O3MB 5JVDA 3C4QA 1N0UA 1KZ6A 4ME6A 3DEPA 1TIKA 1FSPA 5K6AC 4FU3A 4L50A 4RAQA 4ZYLA 3TLBA 1C8VB 5IHXA 1N5MA 3V8EA 2Y99A 1O1RA 3BCHA 4REQA 2CDBA 2HHCA 4FS8A 4WEQA 3C3OA 1USVA 3UINC 3RIHA 2BE9A 4BNMA 3K6JA 4C30A 2B98A 4JXXA 1E1CA 2OWDA 2Z30A 3L1HA 2BMWA 1U3DA 7YASA 2XA2A 2A58A 4RDXA 3QX7A 2NAPA 5DI3B 3MM4A 1V1RB 3GA0A 1MG0A 4Y2SA 4PLGA 4B6SA 3R3SA 4AZ3A 4D6PA 4HNUA 1JFLA 2JGEA 1RI4A 1BMFD 2OCDA 2XWBF 1U7XA 5K0SA 4C4YA 4BP1A 2II6A 2RHTA 4Q7MB 3O4RA 4I5EA 4DADA 2M2IA 5LCWJ 2GFHA 1Z8HA 4M0MA 5KMGA 4KQEA 3P0RA 5CYOA 4K0KB 5HKKA 1AF7A 1XZAA 4HNSA 3INNA 3M81A 4UDNA 2XS1A 4EIWA 2ATVA 1V3VA 3HTXA 5A4IS 5HDBB 4CHGA 4WNAB 4C21A 4Y7DA 5FUBA 3NIDB 4QQFA 4FQ8A 2QOEA 4QUJA 1PR2A 3JQ8A 5CT9A 2XQ0A 3BB1A 3TB6A 5TQJA 1YRBA 3DMRA 3T9FA 2ETCA 3EEYA 2C31A 3REGA 4ZCLA 4AICA 3WNZA 4XOUA 3R9XB 3LJNA 2QLJA 4KW7A 4QAJA 4WT7A 2V0CA 5KBAA 3SVLA 1JHOA 2H2HA 1TM7E 4AX8A 3GRYA 2IHYA 3W2IA 3IALA 1U28A 3P52A 1RQ7A 4L95C 5EWLA 1NHGA 2EXXA 1FTNA 3DEZA 5H81A 4TTVA 5BSHA 4FU0A 2J4FA 2QVGA 4UI9K 3QKYA 4GUDA 2XB8A 1XB2A 2H59A 3VR2A 3E6AA 4INJA 3ZY3A 3ZD8A 2ZJ0A 5ANRA 1ORWA 1S1MA 5LB4A 4R3WA 3Q4AB 1M2JA 2O1WA 2O3QA 4G3XA 3P2BA 4MQUA 1VLMA 4D9HA 4CYMD 2I6HA 1Y8RA 3VRHA 1BGWA 4YJGB 3FZEA 4BN4A 2G7MC 4U8HA 1LDEA 5AVSA 4MCHA 1I8TA 1YJCA 5T8IA 4NACA 1Z6AA 5CDTA 2GZHA 3WMEA 5ALFA 1WRBA 5AKKA 2CLFB 1IBLB 1TEZA 3CH4B 1U65A 3ZY6A 3GZ1A 1QTNA 4TTQA 5J58A 1H42A 5BV8A 4R2JA 3IILA 3HB5X 3C97A 4KXQA 1V5WA 3DB1A 1E69A 4F8EA 3WXMA 3H1BA 5A03A 5DNVA 4FFVA 1IOLA 5DHFA 4G81A 2MYNA 3W2GA 1VE7A 4DKJA 1EFLA 2OYCA 1UOQA 2B4YA 1ZH8A 3FAKA 3WHPA 3ZI0A 2E4VA 4ENWA 1E8YA 4Q1BA 1X7ZA 4QTTB 4B6GA 1YA6A 3WWOA 3PWSA 2PWZA 2V1UA 4KSCA 2ONYA 1EF1C 2GLTA 1VG8A 1I1HA 4R81A 4XSHA 3HUFA 2GVNA 1YDWA 2X9VA 4J8YA 2QV0A 3UICA 1VPTA 2ISQA 1ADYA 5AUPB 5IN5A 3WFJA 3QPDA 4CU5A 1F1BA 4M22A 1VBKA 4LDQA 1GNVA 4IWXA 2JH3A 4II2A 5E4FA 3OF2A 4F9TA 3OWXA 4S1OA 2GGFA 4J3FA 3TLEA 5MDHA 4FMCB 4WXYB 1SAYA 1P4RA 1QC5B 4GVLA 4CIYA 3PGLA 3MBIA 5EQDA 4RYDA 3M82A 4AS3A 1OFUA 2VK2A 2C58A 4QAQA 1E1NA 3IPCA 2AR9A 3TOCA 1N9GA 1YQQA 3A11A 3LI2A 3VPCA 2ATCA 4C0MA 1YSCA 1BXGA 5JAUA 1XOIA 4CMIB 2P6UA 1HV8A 1WXHA 3S5JA 5F7JA 2J3LA 1V8OA 1FU8A 1RM4A 5H4GA 4DX6D 2X1HA 1P7ZA 2IW3A 2AIRA 3QPAA 4IJ5A 2L42A 4PFQA 4QYWA 2PX6A 3ZBUA 3ZEFA 1UFKA 4WUVA 2BFPA 2I65A 3IHKA 4BL5A 3I04M 1CTQA 1U0OC 2IGTA 4DL9A 1JZTA 5KOJB 3AHFA 2OCYC 4KN9S 5FB3A 1G6OA 4F7AA 4G5OA 1EBFA 1X8LA 4TXQA 1AQ6A 4G07A 4IUCS 4M0UA 2ZSBA 2ZRNA 3ZWYA 2G72A 4E11A 3H2YA 4X44A 3RABA 2ZYIA 4B3DA 5SY4A 3N6XA 4QYSA 4RX1A 3TD2A 2BDEA 3FCEA 4EKNB 3A1CA 3DVAA 4L8FA 1IRIA 1OWPA 4ABNA 3MQFA 3UIOC 1ZOOA 1KARA 1R6UA 1UANA 1HEIA 4ER7A 3MT7A 3HB4X 2ZULA 3RSCA 1LPAB 5DDIP 3SX2A 4Y2GA 4KE9A 3WBKA 1A9ZA 4Q47A 1IXYA 3MUOA 3IAXA 3W7BA 1B4DA 3SCZA 4F5WA 1XRSB 3T1NA 3TXAA 4M8LA 4ZZ2A 1ORDA 3OTIA 2VUUA 4R1PA 3IVXA 1UBGA 2ABWA 3A9UA 2UY1A 3PFHA 2YVKA 1AQJA 1JIQA 2QI9F 4HI0E 3NTQA 1BC5A 1DG1G 3PGVA 5IBPA 4NZNA 1XTRA 1IBCA 2WMOB 3P97A 2UVQA 4ZU3A 2I6SA 1GUYA 2IYXA 2OO3A 3NLLA 4M8IA 2EQXA 1XMQB 5CMYA 4L75A 1WNFA 4BT9A 2EGUA 1X70A 3G59A 2UZ0A 5DTIA 2JJYA 4YV2A 2GZDA 4U95D 2BIFA 2FY8A 2Q3JA 1T3ZA 1EA5A 4Y98A 2OZLA 4ZOCA 2NQ2C 3F47A 2A78A 3DAPA 3KWFA 4G4JA 3HKBA 1E0AA 2IHZA 2OBFA 1CC1S 2YCLA 4LNAA 4IILA 1VCHA 3OP4A 5T41A 4XJVA 4EK9A 1OX4B 4KRYA 3KT3A 2VRCD 4P9NA 3VDNB 3ZIAD 4I9HA 5B2EA 3R74A 1SU4A 3EIHA 1T5SA 3U4MA 4GBJA 3I1FA 4AKEA 5TJ9A 5JATA 4G0UA 1ANKA 4HVAA 1BCRB 1EXDA 5KVCA 2PS1A 2O1SA 5IABA 3AF5A 2OFPA 1OYYA 3GLFE 3ZU2A 3H9GA 2P65A 3TW8A 2HA0A 3UFXB 3HACA 1JH9A 1PVVA 1OTHA 3FWHA 5K0LA 1U8XX 2NU9A 4RMHA 2C5FA 4X7PA 3OSUA 4ZC1A 4II7A 2CF6A 2PKWA 4YV0A 3QE4A 3KVNA 1ZM7A 4CF5A 2VNAA 2FMHA 4IO1A 2OHIA 3L40A 1GNSA 1O0BA 2QT0A 1I6MA 3A9VA 2E82A 1M33A 1D6SA 1P1FA 1XEXB 2A1UB 2HMAA 3CLTD 2GHQA 3B12A 4FR0A 1XVTA 1NLYA 3QMWA 4Z99A 1EHIA 4EY8A 2A9RA 3WZ2A 1IUPA 1MHQA 1O58A 4ENTA 4F3CA 2IJGX 4KQFA 1ZBQA 3INTA 3QUAA 3JXIA 4LISA 2AYXA 4D81A 2Z9CA 4F7WA 3DSXA 1W36B 2HTEA 3I2JA 3LOPA 4ZFHA 4KDRA 4ETWA 5JROA 1DP4A 4HH3C 4CKBA 4YRTA 3H99A 3THYB 2VBGA 1P44A 1E77A 3R09A 2W6JA 3ETNA 2NTEA 3E4BA 1IZYA 4PHTA 4QHSA 3A1DA 2O7RA 1VI6A 4DSUA 1VSTA 2FWJA 3HLTA 1JAHA 4DLSA 1SG9A 1MFPA 3AP1A 2CL0X 4JLNA 3WTCA 2Q8NA 2RBGA 1YOBA 1R27A 1RHRA 2W2LD 1KMHA 2QUAA 3EIQC 3AL0C 5AQ1A 4E12A 1H2XA 3WIBA 1JQBA 3PDHA 3MCVA 4WESA 4TRQA 4RTKA 3TE6A 2EKQA 4G23A 2R96A 2PT7A 3FD8A 1FQOA 3KQPA 4G1TA 4OHOA 5KSZA 3Q7SA 2H18A 3AHJA 3AMVA 3QELA 2Y1FA 4DAEA 4DCSA 3D9NA 1PX2A 2EZTA 3E9NA 4W9NC 4JLOA 5D3KA 3MYVA 1VCIA 2I1JA 4JW1A 5LYJA 4A23A 3L0DA 1G18A 3HBAA 3K9CA 3MIIA 1M54A 3Q9LA 2GZSA 1VGQA 3ZDRA 4W5HA 5EWMA 2WICA 1QZUA 2WB4A 4E5VA 2WXKA 1UDXA 3TSZA 5G55A 3DMYA 3L2OB 5D1HA 1RP7A 1WDKA 1K0FA 1U9IA 1MX3A 2JFFA 3AS8A 3RS2A 5C8YF 1DCTA 2SECE 3RT9A 1TM1E 1ZAYA 1Y42X 1XVAA 3M6VA 1S2NA 3DF7A 2CCJA 3NBZC 4U4AA 4AV7A 4CKYA 3TBHA 2OD7A 3SBOA 4HBGA 1ONNA 4NAVA 3RE1A 4IJVA 4OLFA 1UMBA 3KXDA 1DL5A 3VHLB 1G20E 2ZTHA 3TW0A 2H4FA 1Z29A 1NMXA 1UXIA 3VSDA 9LDBA 1Y6GA 3OO1A 3AV0B 1X9GA 1KHTA 1KYXA 2VOJA 2W37A 3GUZA 4LJ8A 2WWHA 4BC0A 1GPJA 5FO0A 5IKMA 3TLZA 2E5WA 2SBTA 4M2LA 4JC8A 1NNI1 1M1NA 1O57A 2VNSA 3LSYA 2P9CA 1WTAA 4R6WA 3NIBA 2PH3A 1BN7A 3TL6A 2CXUA 1Y8ZA 2JIDA 1ACMA 2PVPA 3H75A 2ONDA 3DZ8A 2IIVA 4LZOA 4IVPA 2HHHB 5J9FA 3CPEA 1Y4SA 2PSSA 2Q2QA 1UWKA 3FTUA 2AFHE 3JQ9A 1WHSA 1B76A 3PFFA 4G1FA 3BFPA 5BNZA 4RQIA 4ZT3A 4ID9A 1H65A 4LXTA 5I7WA 2GGSA 3SJUA 4DGSA 1R0RE 3PNBA 4HG2A 4ZPXA 4AVYA 5J3JA 3RF7A 4GH5A 3FMIA 3TZCA 3D6NB 3PNYA 4RC9A 3MT8A 2I6FA 4GCOA 1RNLA 3TG4A 1LPPA 3UK7A 2YV2A 3NBFA 4QSMA 1HR0B 3R5KA 1E61A 5BRNA 3AG5A 2XT9A 3TYXA 3PKJA 4WNDA 2WSYB 4JXTA 4CCAA 3I42A 5C0OE 4O4IF 3MMZA 4O4HF 2UUOA 3SOPA 3W0LB 3WNBA 1QAQA 1GQSA 4TSRA 1LLCA 3I34X 2GEFA 4A3VA 1WMDA 2CXRA 2AX3A 5C7YA 4P93A 3NIGB 5ARDA 2VDRB 1IZ0A 4HH1A 4EFLA 4KLAA 5D2CA 3SYLA 2VAXA 5DOZA 2I4MA 5EE0A 2H48A 4XJTA 4JI8B 4ITVA 1D8AA 4DW8A 2KWIA 3QSGA 3G68A 1E7VA 3WJ1A 4N54A 4C9BA 4JASB 3NXSA 2ZRHA 1NLZA 2CG3A 3NP9A 1TT5A 4H9GA 1R5NA 4I1YA 3DLAA 2EJTA 3AR4A 4CT0A 4MQFA 2IEJA 4ZEOA 4MQLA 4XTRA 4U0SA 5TGDA 1D1QA 4DQUA 4EKDA 5U4XA 4GVXA 3FH0A 2GLXA 2IL1A 1JU4A 3C6MA 4N0MA 3LS2A 5MGBA 2B6NA 2PMWB 1ZK4A 1SVSA 5IJXA 1CVIA 3MX3A 1RYFA 3U1VA 4JWKA 1E6UA 3FPLA 3QBEA 3PUJA 2GCNA 1N2CA 2XDQB 5B12A 2AVDA 1JLMA 4V0LA 3ICVA 1WG8A 3BWBA 3TB4A 1II0A 2VK1A 4PCAA 4OKIA 4BWRA 1I7PA 2YC4C 4DWVA 4RTLA 1WD5A 4UBNA 4ONEA 4YROA 2XKBA 3FUCA 4M6WA 2PMCA 4GPMA 4TROA 3DWIA 4L8WB 1M8KA 2IV3A 1F4VA 3RRNA 3UT7A 4R1NA 3OZIA 5BXOA 1ZIPA 4WKOA 4I9FA 3MKQB 4ZMSA 1PG0A 2BYTA 1ZXBA 2OTCA 3WIEA 4KQXA 4G84A 3B6JA 3CLSD 1SA4A 1RI3A 3MTEA 3BTOA 2YWFA 4YB8A 2OXTA 1Z5GA 4F3YA 3WIOA 3LHIA 3FETA 4DT1A 3BWEA 5JQGF 1ZPDA 3DW3X 4ZI5A 3WYGA 3CT6A 4A8PA 3DE4X 4CMJA 2COKA 4YACA 3PE6A 5HW0A 3NHBA 3EEQA 4LRWA 4PR3A 4TLEA 4I66A 3S1SA 3T4EA 4OQ4A 1B2LA 2H07A 5FHQA 4C43A 4JLJA 1OAOA 5EPEA 4DJEC 3MCWA 3VO1A 2OHOA 4LC1A 4TL8A 3UHFA 3OOSA 4P4SA 3AR6A 2ZSFA 2O0LA 1MN6A 4QU5A 5CU7A 4DQVA 3HUDA 1R5BA 4WIAA 1TTHA 3FA2A 1PR0A 2IO3C 1A8HA 4RAOA 1YB4A 4YCBA 3CF0A 1MDFA 5JDIA 2R1ZA 3ZV6A 1W4BA 4FK8A 5JD3A 1YCDA 1SK8A 5FUQA 2ORED 2ZT7A 4IOLA 1KNXA 3SSMA 4F72A 3SZOA 1WUIS 4JV5B 3A4IA 1UP7A 4DA0A 1E9SA 2Z2YA 1GZ5A 1Y4UA 5COBA 3JUIA 2GM4A 1NFQA 4KTTE 4R8MA 1X81A 2CBGA 3LPLA 2WWXA 3IMFA 1VCOA 4OK3A 1ZRHA 3FNEA 4O3FA 3LDHA 4MPTA 1H9AA 4PSVA 1TAHA 3EQ6A 4CG2A 2WXPA 2ZI3A 4XYMA 2ZT6A 4Q82A 2B99A 3EA5A 1JDTA 5AQEA 4YNDA 2ZYUX 1Z36A 2Z8YA 2PUTA 1MC5A 1MEEA 5F7XA 4MI1A 2Y1OA 3MYRA 3B3FA 3F3SA 3WP1B 4E85A 4JI7B 2INGX 3K5HA 3C24A 4DCCA 2FO1E 2P6PA 3U0VA 1PZFA 4LERA 1O87A 4TWJA 4C3VA 4TSFA 5HKKD 4CV0A 1YQWA 1XVUA 1BQ3A 4IIVA 3EHDA 5JHGB 3QX9A 4P4UA 2HOQA 3IR7A 3PDUA 1D04A 4B3CA 3UMRA 5DWVA 3UMYA 1GADO 4RSHA 1U9ZA 4TLBA 1QVVA 4MYDA 4D74A 1CS0A 1LI4A 1LRLA 1NZFA 4EB6B 3PFNA 4ISCA 3L6UA 3EVBA 1E3JA 5F3WB 1KP3A 5JLJA 3GLIB 4BX2A 3K1AA 3FMFA 3VJKA 2FZKA 2WYUA 2GPWA 3GRVA 3SXUA 5I51A 4MYUA 4C05A 1KE1A 5DBFA 3FBWA 2GI4A 4EGAA 2VP2A 3U3JA 3IEKA 4XYEA 5ELLA 1S7GA 3FUVA 3IDSA 3VR2D 4TMFA 2I99A 3ZX5A 4CM7A 4NR0A 4JNKA 3H2SA 3N2GA 1Q15A 4L7TA 2EJWA 2ZXWE 4BEWA 4CQNA 1C41A 4TXJA 2GFIA 4OSEA 2J9ZB 4YAKA 5EMNA 1QJ4A 1SMKA 1Y1SA 3OQVA 5BUCA 3LC7O 3UUGA 3EGDA 3G9TA 3VV2A 1TQ8A 1MX4A 4KUEA 1JJVA 2G0NA 3EVCA 3KKEA 2C7BA 1JZSA 2IHVA 3OM8A 1EPUA 2C3PA 1U02A 2H2GA 5JHAA 3C8DA 3TWQA 4HVBA 2RGWA 1ZU5A 5HJ7A 3SVTA 1TF2A 2J3HA 2FPUA 1RC8A 1G21B 2VT2A 1LBIA 1Y7TA 4KQWA 3QWAA 4XI9A 2Q49A 4U7WA 3S2ZA 2NV2B 4NPAA 1K75A 4RU1A 3G3EA 3D8RA 4YCCA 5F35A 2DQYA 2A84A 3KOMA 1E6WA 3PUYA 2NO5A 3LZ6A 4J2HA 1EGVB 1TN7A 4ATZD 5JSUA 4RJIA 3NH6A 1W9HA 1XCLA 2CB0A 4L8VA 1ODLA 2VQSA 3FYUC 4IDCA 3CJTA 3ENKA 1WNTA 2GZRA 2PLFA 2QRVA 3QVXA 1GPNA 2P40A 5J5CA 2GO7A 2FX5A 2XCSB 3REQA 4FHGA 3ENVA 1EB8A 4Q9IA 2YFYA 1UK6A 5CDGA 5FPSA 5J2TA 2JG3A 3JYPA 5FL7A 1F14A 3L8YA 2NXWA 1G8MA 1TQHA 3FLEA 3R0XA 4YMSA 5K0CA 4NXNB 2PYDA 2GD6A 1R4MA 1H6OA 4E2XA 3JQAA 4UTOA 1AT1A 2B6HA 3S1AB 4URWR 4PCLA 5DHTA 4DI4A 1XNRB 3RW9A 5EIAA 4D6YA 4JROA 1NSTA 2VFAA 3ZWDA 2J08A 3PSHA 5G0TA 4U04A 4MVCA 3I76A 1DJQA 4BUZA 4QIHA 1YGYA 1BKYA 1NJFA 1QP4A 3B3AA 4V24A 2VQ3A 1CDDA 4ANVA 2AC4A 3EPKA 2D7CA 1V3QE 4B82A 4X8QA 3I9JA 1OZHA 1T1IA 4X9XA 3PT9A 2ON6A 5EIBC 2BI4A 3F74A 2VF2A 2ZRBA 5BWOA 5AOBA 3L0ZA 3OTWA 1PZMA 4BE9A 1QHIA 5CHYA 4LZLA 2GCGA 1K5PA 1NF2A 2C3MA 1G38A 5I4KA 3PH0C 2RKOA 3EY9A 3RJVA 1OU4A 1PWZA 2NVUB 1S64A 1JXOA 5GONF 2FZVA 3E9EA 2PXXA 3D7LA 5HF9A 1Q17A 1Z06A 2JW5A 3AI7A 4W4TA 1GYQA 4OXKA 2C5BA 2C04A 1NE7A 2D8MA 2BKAA 4UVEA 3DVLA 1ZD2P 3HYLA 3L4KA 4BX9A 3UG6A 2XOKA 4BU1A 5FOXA 4L7VA 1QQAA 1U4SA 4RM2A 1MC4A 4D9FA 2A5FA 4R1SA 1R0ZA 1BMTA 1P3JA 3IMKA 1QS0A 2BBWA 1YFKA 3OQNA 5C37A 2BI8A 4EATA 4HB5A 1RBZA 4KVGA 2QZZA 3ZWXA 3UUEA 3LLCA 4WDQA 3B7BA 3BWMA 2R25B 1GOTA 2R6R1 2VR1A 3H87A 2AR0A 4XIGS 3ENZA 5SZIA 3B7TA 2GJ8A 1JHZA 1J5EB 5FI0B 4E5SA 2DULA 4MRAA 2IO2C 4S05A 1VPVA 3VPBA 3VC2A 4GPAA 3SIXA 2B4TO 3VH1A 3MB8A 3OA0A 3V4LA 2Q1XA 1U9JA 3D5QA 3TAHA 1GVHA 3IIMA 2VJOA 4IVRA 4H7EA 4K86A 3Q7QA 4DJDC 1PEYA 4G25A 2OKCA 2OBNA 2OHXA 2OHHA 3COZA 1FB5A 2XTMA 2FPIA 4MR9A 3OC0A 3TK1A 2I9CA 4DYVA 2JFXA 4ZV7A 4A6XA 3ZNGA 5DNCA 1VGVA 5DYNA 3X1ZA 3ANMA 1ZN2A 3WGLA 1GTZA 4TTRA 2P30A 3WL3A 4Y2YA 5DBEX 3NM6B 5ECGC 5B3JA 4CI9A 4OAOA 2VHXA 4ZI7F 2H1CA 3IQZA 3UK1A 3TTSA 5B5SA 2XCQA 1T4BA 4X1KA 3UBTA 1HDZA 1HFJA 4QXOA 2PIAA 4Z68A 3E9DA 4F38A 5DASA 1UBJS 4F96A 1GGFA 1VA4A 3WGHA 3K53A 1KOLA 1L8LA 3BK7A 1JSRA 1PFGA 3ZV5A 4QATA 2RG8A 1G6Q1 2W0MA 1IWOA 1O97C 3B36A 3DEIA 4G4SO 2ZSUA 3U0BA 5JRJA 4LI0A 3PEVA 1F6DA 2CLEB 4GX0A 3RRXA 4XPZA 3MS7A 2LXMA 1KVQA 2PKQP 1VYUA 4CTMA 2VQ2A 1QTQA 4E0BA 2WUFA 3SX4A 3UPUA 2W2LA 3L8EA 1DKUA 1F8YA 2P0AA 4O6FA 4XRRA 5L7YA 1A97A 3PD1A 4G8LA 3FNIA 3LT2A 1EP3B 2VXBA 1IU9A 1GL9B 2VDJA 4DCNA 1N0HA 4LIPD 3K7EA 4QICA 4UWKA 2UZ1A 1E7MA 1LSJA 4XQ0A 5A06A 2G88A 2Q6KA 1QK4A 4MINA 1WXXA 3U37A 3JR3A 4XLZA 4J7CA 4ROTA 1P2TA 2ZDHA 2HMTA 3B78A 1EHYA 3INGA 3DDHA 1P2VA 1XXLA 3A6GA 2QUIA 1YRQA 3BX1A 2PZEA 4CN8A 3W5DA 1NF8A 5CEJA 3U44A 1Z5OA 4XPIA 5FEMA 3TW4A 1JKIA 3ZYLA 4TWBA 4URKA