4JZYA

Crystal structures of drosophila cryptochrome
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
534
structure length
534
Chain Sequence
ATRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWLADV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Circadian clock protein
molecule keywords Cryptochrome-1
total genus 197
structure length 534
sequence length 534
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4jzyA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4jzyA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4jzyA01
4ZT7A 1TQ8A 1VL2A 3CR8A 1EFVA 4YBRA 5JBNA 3HGMA 5HUHA 1O97D 3NV7A 5TEWA 4DE5A 3IVGA 4JFAA 3IOCA 1IRXA 4OUDB 1H3EA 1ZH6A 3AG6A 4MUKA 1XNHA 1QU3A 1MC1A 4R0NA 2ZP1A 1J1UA 3L92A 3OP1A 1I2DA 1H1TA 3VRHA 4JZYA 1ULHA 3CVYA 3SP1A 2DUMA 2CYBA 1JZSA 1LW7A 1O95D 4JXXA 4ZCTA 1OWLA 4AS1A 1WXEA 1O96B 2H2AA 4F4HA 3AKZA 5KCMA 3D6UA 2DPLA 4ND7A 1WZ2A 2VXOA 4MUJA 5IJXA 3FETA 4CDMA 2CUZA 1EUQA 1KAQA 3FY4A 5J58A 1O97C 4YP6A 1N2JA 4ZT3A 3SZ3A 3ZXSA 1KH3A 2HZ7A 3FG9A 2HGZA 1WKBA 4K03A 3COWA 1MBZA 4ZCRA 2A86A 1QU2A 1PFUA 4PBTA 5K0TA 1QNFA 4MAFA 3RHSA 2J4DA 2J5BA 1N2IA 3FIUA 1EXDA 2NZ2A 4DJAA 3CA8A 3A2KA 2Z09A 1KQNA 3I05A 3CLSC 2E0IA 2RE8A 1N77A 4NAHA 1WXGA 2A84A 1UFVA 2ZUFA 1T9GR 1DNPA 4Q93A 2X1MA 3ZJVA 4PBSA 3P0IA 2PZBA 4MWDA 3FDXA 4EG6A 1OWOA 1KAMA 2E21A 3COVA 4MUEA 1XNJA 3L93A 4NX2A 3H99A 1M8GA 2NSYA 3PNVA 2WSIA 1Q77A 1JIKA 1OWPA 3SZGA 4MUHA 1NUSA 4MVXA 4J75A 4XFJA 3G6KA 2JA2A 4MW4A 3GMIA 2EL7A 4MWBA 5LFAA 3CVUA 1IH8A 4UZFA 4G6ZA 3X1JA 3X1KA 1HYBA 4MW0A 1KQPA 1ZJWA 2GOYA 1R6UA 4KPUA 2AG6A 1MAUA 3CLTD 2A7XA 1WQ3A 1F7VA 3X1MA 2CFOA 1OBCA 1JEDA 3SDBA 2J07A 4BWVA 1MB9A 1NUUA 5F23A 1JEEA 4CDNA 1TEZA 3U1VA 1M8PA 5KWVA 5HUJA 5DK4A 1H3NA 3K9WA 4U63A 4XFDA 1EFVB 2OV4A 2G36A 3DPIA 3N2YA 4NZPA 4ZT5A 3P0JA 2IP1A 1JILA 1B6TA 1ILEA 4OUDA 3HV0A 3CLUC 1NSYA 2GKSA 2PXHA 3A4IA 4QRDA 1QTQA 2XRYA 3A05A 1O96A 2WQ7A 1Q11A 1U7DA 3G59A 4FZJA 2PZAA 3ZIUA 4XSVA 2X3FA 1MAWA 3IUEA 4YMIA 2DXIA 1K4MA 4MW7A 3RJZA 1N75A 2IJGX 4H3SA 4ZT6A 1VLHA 3SEZA 1N2OA 3COZA 3ZGZA 1M8FA 3H05A 3ZUGA 4DNXA 4KR6A 3LOQA 4MULA 3QE4A 4U8HA 4KR9A 1U3CA 1PFVA 2CSXA 1COZA 1VBNA 3DLAA 1N2EA 1GZUA 1F9AA 4PY2A 3UC5A 3AIIA 3IOBA 4EG3A 4WNYA 4HJRA 3LE8A 3N9IA 1EJ2A 5EKDA 4ZCSA 3AFHA 3ND7A 1WXHA 4MLPA 4DDMA 2TS1A 1J09A 1KR2A 2HMAA 1CT9A 3DV2A 3H9BA 2XRZA 1J1ZA 5IHXA 3KT0A 2VTBA 4GRIA 4EG8A 4EG5A 1PG2A 5K0SA 4ARCA 3P0HA 2J08A 1NI5A 3UK2A 4K0RA 3CLUD 3ZJTA 3RK1A 4GU5A 2QTNA 5KHAA 4P2BA 1JIIA 1PFYA 4MW9A 4U7JA 5FO0A 3NBKA 2DETA 3CVVA 1YI8A 3KT8A 2QUKA 3N05A 2C5SA 1IQ0A 3HFJA 1G8FA 1YIDA 3CLRC 1F7UA 4KPUB 2YY5A 1RQGA 1KORA 3S3TA 3D6VA 3FH0A 3IOEA 4HPWA 1N2BA 4AQ7A 1TYCA 1IFXA 4R2MA 3CVXA 1YIAA 4OJMX 4MUGA 4L2IA 3PRHA 5DEOA 3PNYA 4RPIA 3FHJA 1NZJA 4DDKA 1WY5A 1PG0A 1M83A 1NURA 1QJCA 3CLTC 3ZXIA 2V0GA 4MVWA 1K92A 1O5TA 2AKEA 4MWEA 3PXUA 5TS2A 1N2GA 1NUTA 3IMCA 1Q19A 2QJFA 3G5AA 1TYDE 1VBMA 3ZJUA 2CV0A 2D5BA 2GM3A 3MLBA 2CV2A 4S1OA 4G5FA 1O94C 3JXEA 3Q10A 3HL4A 1QRSA 3SEQA 1V47A 1OBHA 2YWBA 1O94D 1NUQA 1F4LA 1O0CA 5AHWA 1EFPB 2DEUA 4JXZA 3IMGA 3IODA 1FYDA 4NAUA 1KKUA 1M8KA 4MVCA 4KKVA 5HG0A 3IMEA 2DR2A 4MVYA 2X0KA 2QJTA 1IQRA 3HZRA 1T6XA 4I6GA 4ZT4A 1YUNA 4RUKA 2RD2A 3C8ZA 3KT6A 1N78A 5J5AA 4ZCPA 5J59A 4NATA 3A04A 3ELBA 1NUPA 3LCJA 1I6MA 1M1ZA 4EGAA 1R6XA 1N3LA 3ND5A 1J21A 1P7PA 2EJCA 1KP2A 1WOYA 3ISJA 4G5YA 4QREA 4MUIA 2A1TS 2YXNA 3H97A 3TQIA 1JIJA 3PNBA 2DLCX 1WQ4A 3TQOA 1NYLA 2VTBB 2OQ2A 3ND6A 3VGJA 1U7XA 3MUEA 1WXFA 4MUNA 4WSOA 1MOPA 5FNZA 5DASA 2X1LA 2Z08A 1MJHA 1OD6A 2CYCA 3P52A 1IVSA 1GPMA 3K32A 3VU8A 1M8JA 1G59A 4EG1A 3IH5A 1H3FA 1JECA 3AG5A 2B7LA 3GUZA 3H9CA 4EFKA 3CLRD 3OTWA 4CQNA 4MUFA 1T9GS 1GLNA 1Y42X 1D2RA 3Q12A 2A1UA 1GN8A 1S4MA 4CT0A 1G8GA 1XJQA 4Q16A 3RFFA 1J70A 2H29A 2I1LA 2DERA 4L2IB 1A8HA 5H16A 3AL0C 1YULA 2QUHA 4TS1A 2PZ8A 2CT8A 4F3RA 1I6LA 2QUIA 4MQ6A 5DB4A 3ILVA 3DO8A 3QTTA 5TGTA 3UOWA 1GTRA 1VBKA 2D13A 2O5RA 4YP7A 1U0BB 2O8VA 2CYAA 1WXIA 1O6BA 3Q4GA 4ND6A 4PBRA 3BL5A 1N2HA 1TYBE 4MW1A 3INNA 4MW6A 3COYA 4X0EA 1N1DA 2R5WA 2QTMA 3FOCA 1EFPA 1NP7A 2CV1A 4NDAA 1KH1A 3TZLA 4I6JA 3MXTA 4ZCQA 3M5WA 4EG4A 1ZUNA 1KH2A 2BYTA 1O0BA 4HK4A 1QRUA 1MRZA 1GTSA 2WB2A 1KQOA 1O95C 1ZH0A 3UY4A 4MWCA 3RK0A 4EG7A 2Z3VA 4JYZA 2E18A 2PIDA 3IUBA 1FFYA 5BNZA 3TS1A 3HMQA 3FNRA 1JGTA 2AZXA 2BTEA 4YP5A 3F3MA 1QRTA 1K4KA 1JZQA 1K97A 3FI0A 2ZUEA 3RBAA 5LM3A 1EUYA 2YWCA 3TNJA 2QUJA 1JMVA 1R6TA 2J09A 1MB2A 1OWNA 1PFWA 1X8XA 5TEVA 3NBAA 4DLPA 1V8FA 1GAXA 1TFUA 2WQ6A 1OWMA 2A4MA 1G8HA 2PFSA 4HJXA 2V0CA 3QTBA 3MLAA 4EF6A 4J76A 4ARIA 1EE1A 1Q15A 4UZEA 4E1AA 3N8HA 4ZT2A 2QTRA 1XNGA 5FO1A 3E27A 2D54A 3MMXA 4A91A 1LI7A 1I6KA 4KR7A 3CVWA 3IVXA 4DDHA 1SURA 1YUMA 5LLTA 2PG3A 2QJOA 3IDFA 3KT3A 1X6VA 3IVCA 1U3DA 2E89A 2IELA 3CLSD 2A1TR 3FWKA 1WJGA 2A88A 1KP3A 3UMVA 1IHOA 1T6ZA 1TYAE 4MW5A 3TZEA 3GLVA 4MW2A 2JANA 3SYTA 1QQTA 4R2LA 1JHDA 1T6YA 3KFLA 2A1UB 1J20A 2JAXA 4I6EA 1BS2A 5H7XA 1LI5A 4QBTA 1IQUA
chains in the Genus database with same CATH superfamily
3STUA 2BGNA 2XQKA 1WDMA 3LCCA 2QD2A 5JS6A 1EFVA 1PC2A 3CEMA 3QQ5A 1R0LA 2O1XA 5SY6A 4P5EA 1KHHA 1AC5A 2INGX 1HF3A 2C2ZA 2HMSA 1KNQA 2IY7A 1PWEA 3C5HA 3IOCA 5LP6B 2DGDA 3LLCA 1RHRA 3OD5A 5TS3A 4KV7A 2BFOA 3KQSA 2JBWA 5FWXB 2E7ZA 4DJ5X 5EINA 2XY4A 2GNAA 3BWDD 1AZTA 3VDRA 1H1TA 1UDWA 3VRHA 1P75A 1EYHA 1EP2B 1EKXA 1ZCZA 2A94A 5JNRA 4RO0A 1M34B 1R5NA 3IMKA 1YQWA 5JCZA 2H2DA 5KTKA 3CH4B 4X20A 1R0YA 4L3VA 3TD2A 4EECA 1BWQA 4C1NA 3PT5A 3T9KA 1JB1A 1GGNA 3PV0A 3JQFA 3CVPA 1X86B 2EJWA 2ZWAA 2QM0A 1DAEA 1ELRA 2XUFA 3RV4A 4RCZA 2JIOA 3UANA 1GTZA 2HA7A 4I4TA 4RNDB 1JAHA 4F9FA 3AESA 4PSVA 3CUUA 3BMQA 4Z9XA 5JYEA 1FBTA 2RFMA 8ADHA 2J9FB 3FG9A 3Q3JB 1ZOIA 3VU9B 1A9XB 2EHDA 4HDSA 4LZAA 3KFXA 4LZOA 3PNOA 2HD4A 4IHJB 4DV2B 1A1SA 1EUZA 2HR1A 4ND5A 4X9XA 3ZD7A 2J6CA 5KWDA 5CAEA 4PC7A 1QNFA 2RK4A 3KVOA 4TN5A 1JSXA 2UZ4A 1P0QA 1TN8A 1NN1A 2FETA 2HPZA 5IN5A 3VR2D 4EHAA 2WWYA 2V3CC 3OZGA 3G2MA 1CQIB 4H3HB 2VAXA 2MR5A 5A3VA 1OXUA 1Z88A 2Y92A 3HABA 3A2KA 1GUYA 1UBKS 2DC1A 3OC6A 2E0IA 5F73A 3NHPA 2EBUA 1UBFA 1YR8A 4MQBA 4JROA 3KIPA 1I14A 5ALYA 5AWFC 2WVGA 2UUOA 5BQPA 4D8VA 1EAYA 1H0SA 1I2AA 2BBTA 3NCHA 4IIFA 1FQJA 4MOWA 3LS8A 5DP1A 1TJFA 1OMOA 4L75A 5B1SA 4DLZA 3ZJVA 3WLNA 2NUPA 1E7MA 1CC1S 1YZ3A 3VZCA 4DM7A 1GSIA 2J6IA 2HADA 3COVA 4RG9A 1XZ8A 2C97A 1K5DA 3LF2A 4KHPB 2J9XB 3Q0IA 1Q77A 5EWLB 1GO2A 1T4DA 3DKVA 5T64A 4R1MA 4J75A 3QHPA 3ZU3A 2JA2A 1XTJA 5EYPB 1E1MA 2UAGA 1OAOA 2BZ1A 2VA8A 2BSQA 4B83A 2ZB7A 2XQVA 2D4AA 4YI5A 5ERGB 2E3JA 1THMA 2HRQA 3CRW1 3HO1A 4MH0R 3IR5A 1R6UA 2X8WA 1MTZA 2ZE6A 2ZK7A 1XMVA 2FCRA 5TPZA 4D9IA 1NR7A 1I80A 3ENWA 3FFLA 1YAJA 3HU2A 4WECA 5EIFA 4FLFA 1XMQB 3LWBA 1Y82A 5IH3A 3DM9B 4AN1A 2LP4Y 5HK8A 4UXJA 4MPDA 2HDHA 4HXGA 2JFBA 2L19A 4JVMA 1NG1A 2EFDB 2UVPB 2B6HA 1YB5A 4NOJA 5HMMA 5AKKA 4BQNA 3Q0EA 1O58A 1QKIA 1KTIA 3K9WA 4O6FA 3EASA 4KE7A 4O59O 4U63A 1E2KA 2FLVA 2O1WA 3AUUA 3F9RA 3RUHA 5JS2A 1XSEA 2WMOB 4NBWA 1NG9A 2D7DA 3SSNA 5DP2A 3ZHEB 2IW1A 4AXXA 5JSHA 2N0SA 5TR9A 1QBQA 2IEAA 1RC8A 1FF9A 4QXQA 1JILA 5JAQA 4GF5A 1H8ED 4OUDA 4JB0A 5CVTA 5EJ7A 4FS3A 2PBLA 3QPUA 4RH0A 2R5SA 1B74A 4JC8A 1IEQA 2OHFA 4J6FA 1UPBA 3FH7A 4V3IA 3C3EA 1WR8A 3HA7A 2HA2A 4YVFA 2O3TA 4X94A 3FMVA 3UA3A 1Z3YA 4WBNA 3T5AA 3IOYA 1IIBA 1O96A 4I5IA 3OQ6A 1WS6A 4TT3A 2WXHA 1EAMA 4B4UA 2CXSA 3RDPA 4D9FA 3V2GA 4MTCA 1OLUB 4YQEA 3JUIA 3GUYA 3NC0C 2PH7A 4H77A 1H4VB 2XT9A 1HSZA 3IUEA 1TQHA 5TGZA 2DXIA 4D4LA 5JDIC 1N75A 3M1IA 1TUGA 3T3HA 5K0EA 5HW0A 1YQ9A 1JLSA 4UD2A 4DCTA 4LF9B 5A0FA 3I1JA 5DH9A 3GZSA 2D62A 2YBDA 2FE4A 3CNOA 4WVFA 2NUTA 3SE7A 1IZZA 1E3QA 1K2WA 4I4CA 1FOEB 4IQFA 2KWIA 2QT1A 3W9BA 4PS0A 1VFPA 4BBZA 3BJMA 4OFBA 1AGNA 4AROA 1OIVA 2NZVG 4JJZA 4LSGA 3CK8A 5DPMA 3WYFA 2IH2A 1YXMA 2O2HA 5KEIA 5REQA 1EHCA 3WQQA 1FXWF 4KO8A 2BFCB 2AJCA 2GJSA 2XQFA 3EZ9A 3KSDO 2MOWA 5AVJA 1ZJYA 9ATCA 2WSMA 1OZHA 1WDLA 2GK3A 3SDZA 2VEOA 2BI7A 2HSEA 1N5LA 1ZGAA 5KAMA 1RHJA 1CT9A 2SECE 1E5LA 3OM9A 3IAM1 4GRDA 3SY8A 5FF9A 3BCHA 2FWRA 2DM6A 2JCXA 1TNUA 1EQUA 1ULSA 2WTMA 4M83A 5AHKA 1B16A 3LVRE 2D3TA 1PJ2A 5JA4D 4ZOQI 5CD9A 1EZ1A 2QW1A 5EZ5A 1N33B 3TWOA 2HFKA 2IV2X 1BDBA 2DQYA 2PRYA 4L8LA 3L6OO 4IIJB 5KVAA 2YHCA 1N6HA 1FCJA 2XGOA 3VKUA 1MJ0A 3HXFA 1NNSA 3H2KA 2W58A 1Z2CA 2W0SA 4GG1A 5EXEA 1PI3A 1URPA 2F17A 2VSFA 3DVLA 3WNZA 3LRPA 4POOA 2VPYA 1WG0A 3BEEA 1D8EA 1FCHA 1XTBA 2WF6A 4XI9A 3AI3A 5HM8A 1P3Y1 4XSGA 2V8SE 1D3AA 1M76A 4EJMA 1JIUA 1OQAA 3REQB 5LR6A 2XMPA 1SHTX 1A5BB 2X13A 4DV4B 1U5BB 1PVDA 2EWMA 1ANKA 1AXRA 5CCLA 1QMGA 3TZBA 3D4NA 3VH3A 3JASB 3K5HA 3JZDA 3HJBA 4NWIA 4K6HA 2ZI7A 3EG9A 4UNPA 4W5TA 3CVXA 4UDOA 4Z51A 1I0LA 2VAPA 3V3KA 1YIAA 2LDBA 2OMKA 2ZFUA 2PUGA 1L8AA 4JASB 3IPYA 2HPHA 5LWHA 3R7DA 4YHHB 4DV1B 1OH5A 3GRRA 5DEOA 1XKLA 1DB3A 1HYEA 3EQZA 3W5CA 3P0RA 4AYWA 3TGWA 4DMFA 2OHIA 4BJ3A 5LOVB 2O5EA 4ED9A 4X1IB 2BHRA 2OBLA 1T4GA 3FW1A 3F6RA 3TVYA 3N2LA 3H6KA 2V0GA 1B14A 4NZNA 3CH5A 4F5EA 2AKEA 4Q24A 1H2WA 3PF8A 9MHTA 2LIPA 2PXXA 3M1YA 1CJBA 1QHXA 3KV3O 5BSEA 3TJPA 1EK5A 2QJFA 4R31A 5GGXA 2BFPA 4OVUA 4ISBA 4BY6A 3OLZA 2QSYA 1R4ZA 3GW4A 3CR3A 3UKUG 2A4KA 4FNOA 5LJIA 3VNUA 3MGBA 1XVVA 4NG4A 3GVHA 2HYDA 4DLAA 1VLLA 1F4LA 1NW8A 3CEQA 3FUEA 3D7NA 3FYDA 3R7WB 1EFPB 4Q94A 4F2DA 5IN4A 4HRMB 3U1BA 5GZ1A 1L4FA 5CIWA 4Y18A 3Q9NA 1U28A 4I55B 5A9SB 5FQ8A 1Z2NX 5KKNB 5HIIA 4LY0A 4UEWA 2AF4C 3UXYA 3DULA 1BE8A 1X42A 5ADUS 3ZE1B 2OHGA 3F96A 1XEFA 2HWXA 1PQWA 3N2GB 3Q7FA 1TYEB 5FPKA 5AHOA 1SOVA 1HV8A 3H1GA 4ZZ3A 1BCRB 3IHLA 2VF8A 2G4LA 1T6XA 4BY9E 3K09C 1YE5A 2OT3B 4QOFA 3RJVA 4BGEA 4D9NA 2RG8A 4BS9A 4OHRA 4TKUB 3ZZ0A 4GSLA 1SXJC 4E5NA 4ME2A 4H6PA 2I7DA 3AF1A 3SC2A 4P0PB 3ROGA 4FTWA 3ADDA 3LBHA 1SUAA 3I3SR 4J43A 1OU0A 1DO2A 5TIIA 1N0IA 3K8QA 3ZHZA 4R0MA 1WOYA 3QBEA 5INTA 5M5BA 1T5BA 4XGQA 2YMMA 1S2NA 3GU3A 5HFNA 2EWVA 3TQIA 1UN8A 1U5CA 3PNBA 1C9YA 5D86A 1YAHA 5AUQA 4CM4A 4HKTA 4YRBA 1XTZA 3R6WA 2VGXA 3ESCA 3OJLA 4TTSA 1PR5A 5KSPA 2ZBVA 4LYFA 4RKYA 4YREA 2EFGA 2YMQA 4MRVA 1SB8A 3D7LA 3HN7A 3OOJA 1HFAA 4QQFA 4DXDA 5JQGA 5DASA 5K0GA 3I45A 3L4JA 1S2IA 1BE0A 1VIMA 1D1QA 3FSJX 4LRUA 3PNMA 3CRQA 2PGIA 5HQ3B 3NMUF 5PGMA 2NYVA 3E0QA 4OGKA 3IS3A 2WWVD 2YQ5A 4ON9A 1M74A 4YMVA 3I1YA 3ULEG 1G5QA 2W6JA 4M0EA 1SA4A 5IEJA 1Q1EA 1ZD9A 1N4RA 1ZD1A 3C3CA 4GPAA 1WLYA 2Y71A 2RHOA 3AG5A 3DMTC 1M7HA 4CM9A 1RZUA 3SE0A 3KR1A 3D6JA 4EAAA 4AX8A 4AV7A 4HUJA 3CF4G 2ZBGA 3EMKA 3OQOA 2QQGA 1N3YA 3DB2A 5C1OA 1U7UA 1YQXA 4HFNA 5A7GA 5K1ZA 3A7EA 1IKND 3RFFA 4DSUA 4ES6A 3FYCA 2O54A 5DNVA 5H16A 2AG8A 2BSXA 1YULA 1RWPA 3EXHC 3MT9A 1WV1A 1NYQA 2AG1A 1XE3A 3PQ4A 5T3YA 3V1YA 3SNXA 1HORA 1KOFA 2HZBA 3GGDA 4NNPA 1HDYA 4AZ3B 1O08A 2EQBA 5BN3B 4PWZA 2ZSBA 4KFUA 4M7CA 2NUAB 1L7PA 2H1VA 5BRNA 5AENA 1SU4A 2W2KA 1L5KA 4DZTA 1X8LA 3TINA 3UHPA 3M82A 1N8TA 3PVCA 4QBGB 2D7JA 1CF9A 1SC1A 3PZDA 3MB8A 4TZKA 1Y63A 1KU0A 3ES9A 3P2IA 4Y98A 2EEPA 4HEA6 4GMHA 2QVYX 2YV1A 3OETA 1A96A 3GP8A 3Q4GA 1O6BA 3IXLA 4NPAA 3VQTA 1MB0A 1AZWA 4PICA 3WK4A 3DAYA 1S4QA 2AEEA 2I9KA 1BHO1 2BDEA 3MBKA 1XHLA 3I37X 1H6PA 5K5EA 4BVHA 4JYAB 3KG2A 3WGLA 1P5QA 4TYWA 1CUHA 3W9SA 3B78A 4K1LA 2WFLB 3F4BA 4MLZA 2JA1A 4GEGA 1CUBA 4X93A 3SVLA 1I7QB 2IYZA 3QNKA 4B6QA 2ID9A 4TLBA 1NWCA 4TX1A 5KOIA 4CKEB 4QUEA 4TMKA 3KK0A 1XCJA 1GRRA 3BSSA 3FPFA 4HX5A 4NECA 5EEHA 4MQMA 2WTUA 1ZR2A 2JKZA 4AY2A 2ZUTA 4PSCA 3NIGB 1MPTA 4KBQA 4IJUA 2FZEA 5ENNA 1B1CA 2RH8A 5ALVA 3QOFA 1XQ9A 5JAZA 2ID4A 2C2WA 4QPJC 6NULA 1WSBA 5KYTA 1IWPB 4E30A 4AKIA 1EIZA 4EHKA 1G4AE 3FNRA 3JYSA 4HOTA 2DTXA 1X19A 3JAMA 3OJOA 2X23A 5JI3E 3OE1A 4JVLA 5LZ8A 4TTIA 4CMGA 3FZQA 2WIFA 3O7MA 4LYHA 4BECA 5AW2A 2VEDA 3KKQA 4HBZA 5MGBA 3LFUA 4BO7A 2NADA 3JQCA 5JH7A 3RVKA 5KSZA 1Y5RA 2G0NA 3FMGA 4PZEA 2J09A 3WRYC 4YQFA 3Q5DA 5L4LA 2VDLB 5AJVB 1YF3A 2RGEA 4WX2B 2AD5A 2I03A 5A4FS 2DQSA 4GLFA 4HRVA 4K6GA 3T1VA 1ND6A 1HE1C 1G8HA 2FFAA 3RVNA 4RTLA 1SVUA 3ICEA 1EVEA 1P1CA 4EL5A 2JLUA 1CKEA 2V1XA 2JH3A 1PT6A 4QSMA 4YIKA 1TF7A 1T3TA 1XNGA 3QYPA 1XTQA 1GQQA 4NQZA 2Z2JA 2F59A 2ZYIA 3I9NA 3EFOA 3OO0A 5B12A 1RZ4A 4R1TA 1WVIA 1T1SA 3CSSA 2FHSA 4MMYB 2QFCA 4PTZA 3TLZA 4EQFA 2QZAA 1J0AA 3AEKB 2AUTA 3D6TB 5LLTA 2VYFA 4R3NA 5JDCC 4BO8A 1HH8A 3RJMA 5LZ7A 1E9SA 1R18A 1ACLA 2E89A 5CA0F 3IQZA 3C3QA 5HKKA 2RHHA 2ERCA 3ZGXA 1X1TA 5A7HA 4MIEA 2BEDA 1E2UA 1RXSA 1SVWA 4OAOA 5DX8A 4GXTA 5K6TA 3FE2A 1GNQA 3HKEA 5G05C 5A1TA 1YTUA 1E0KA 1Z07A 4WWOA 2VQEB 3AKCA 2BF0X 2D59A 2W48A 1U4OA 2AI3A 3AL2A 1KS9A 4RYDA 1A88A 2ET6A 4LZPA 3B8HA 4D25A 4K5AB 3HYMB 2NOAA 2OAGA 3EHQA 5G0UA 3UCFA 5BPFA 1MH9A 3EQ7A 4AKEA 4HZIA 4PLZA 4EKDA 4BCBA 1SIOA 3O8BA 2C5AA 3MCAA 4KKXB 3CV3A 4JUAA 3PQ6A 1G4UR 5HUHA 3MC1A 1WE2A 5H1YA 3F6BX 4Z0PA 1OPRA 4C7JA 1OFTA 3NBNB 3A11A 3I3NA 3HL0A 5COBA 4CLHA 1E63A 2HBZA 2PTHA 4JEMA 4TROA 1SXPA 2CKMA 1XNHA 2JLCA 1EWYA 2PJUA 1J1UA 5LYJB 4N3CA 3LA6A 3DFUA 1Z74A 3O8OA 4PQGA 4X7PA 3PUHA 1ISJA 3QPBA 3U4IA 1D1TA 4UUPA 3TLAA 1TJ3A 3KZVA 2QI9F 2DUMA 4IDPA 1JZSA 1O95D 2ZJBA 3SP1A 4JXXA 3T7RA 4AS1A 3QVJA 1DINA 2OCPA 2JLWA 4FK8A 4CQMD 2ACKA 4WJKB 3DSXA 3RKVA 1RZ3A 1TK9A 2YHUA 1ESZA 1IHYA 2Q3LA 4TKVA 1WLSA 1MNAA 1SUPA 2CJWA 4WLEA 1BLXB 2NLOA 4UEOA 3V4FA 3TEMA 2PTGA 4EA7A 3OCXA 4PGFA 5G4LA 3EIOA 3Q4AB 3L6UA 4NURA 1XKXA 1F5NA 2RIRA 1DADA 2GEBA 2CLSA 3NDIA 3OLCX 4I1RA 5K3BA 5B6IA 2J4CA 1OCZE 1B8NA 2N3ZA 3HJAA 3ORHA 5H02A 3UK1A 3ZK8A 2Q8PA 2WM8A 4C4PA 4ZDKA 3AZQA 1YZUA 1ZH4A 2ZI4A 4M9XA 4MEAA 4UM8B 4K03A 1ODCA 5HJ5A 5BW4A 4DZZA 5JY6A 2QAIA 4TLDA 3LPMA 2I2OA 1DOAA 4YEDA 4DIDA 1HH4A 4RZHA 2AB0A 3G9ZA 3ACCA 4MVJP 4RBNA 4WL0A 4LISA 4ZAGA 1B00A 4FC8A 1EX9A 2QN3A 3R3JA 4V0ME 4JJIA 4EUKA 2XDWA 3HU5A 3FCUB 1YKGA 2BEWB 3UJCA 3TO5A 3TWVA 1JUDA 1VMEA 3PHCA 1TLTA 4LC1A 4CLEA 2C8KA 3CA8A 3U7RA 3AIMA 3G13A 1DE0A 1PR3A 2IXEA 2G6TA 1SBNE 1IY9A 2ZIFA 1A72A 1MIOB 3G5UA 4XIFA 1ZA1A 1UDAA 4O2LA 5SYAA 1X0VA 1T8RA 3TN7A 1XQYA 4H4CA 2ZUFA 4G8DA 1CJSA 1GP2A 2Y0DA 3K9GA 3OZWA 4DCSA 1Z63A 4EA9A 4OI2A 1ECCA 3KRTA 1X39A 1M66A 2QLNA 1VLMA 2E9SA 3DD1A 4UNSA 4BEVA 3NR2A 4AP5A 2A9JA 2WSSA 5EKUA 5HRCA 1XD2B 3HR4A 4CKBA 4APFA 1JFRA 3P2MA 3OMWA 4UQPA 1RC1A 2WD9A 1WU8A 1AK2A 2HHLA 4L6IA 3T41A 4C6TB 2C03A 4Z86A 1FBNA 2UXCB 3HRHA 3VAYA 1E8ZA 1QV9A 1HY3A 1OY3D 4IBOA 1M2VB 4FONA 5T3UA 2QTAA 4IOLA 2HF8A 1KSFX 2I3GA 3UQYS 3EVNA 3P9SA 1XMXA 2JI7A 4R83A 2XUZA 2FHPA 4DX2A 3AX6A 3ILSA 3ER6A 3EVEA 2VSXA 2IYWA 4K7JA 2PSJA 3C4VA 5BVHA 5I51A 3FTNA 3X1KA 2H92A 3MCTA 1E92A 3WTCA 4DANA 1NUAA 2W90A 3EQ9A 3KVNA 4L57A 4NBUA 4WXYB 4XUDA 2IV3A 1HO3A 2FF5A 4HB4A 4F71A 1MC8A 2JJ2A 1E7UA 2VKTA 1YRAA 2Y77A 1ODLA 1POXA 1VPDA 3KPWA 1T2CA 3ZWAA 2JIQA 4MLDA 1Z7BA 2BM1A 4JBXA 4ILIA 1BFUA 1PO7A 4J0EA 5JVDF 1SXIA 3DVSX 4I1UA 3VZSA 1OBVA 3IO3A 1TEZA 4HYQA 4HLCA 4BP9A 3UIEA 2XXBA 1IXVA 4AMBA 2BTDA 1UJJA 3UIOC 4BB0A 1S3FA 3UMMA 1GQYA 4HB2A 1EFVB 3FVQA 2WXKA 4O4IA 5CDSA 3V1UA 4DVGA 3E33A 1JMYA 3N2YA 4ZOEA 1ADBA 1E6WA 4IYRA 1EM8A 1VA4A 1ULZA 2Z30A 2ZB2A 3QUTA 3G2HA 3QVVA 2NUBA 4ZQCB 5CM9C 3ZI7A 1P3DA 1FVOA 3CLUC 3OOYA 3EC1A 2CNWA 4EOGA 2P9FA 1RU3A 1ZRHA 3U64A 1GN9A 4E1BA 3QPCA 4E4RA 3FVWA 3L22A 3FPGA 4OFZA 5C3MA 3CQ9A 2QR3A 3KQUA 3HSSA 1H6CA 5FNVB 3CIOA 4PZDA 4JX8A 2AXNA 4KMOA 3UGQA 1BMDA 3CZPA 3OAAA 1NBOA 2H4HA 4LMAA 1DPFA 1UDCA 4NCXA 2GVNA 3F98A 5T67A 3U3ZA 3ANXA 5IZCA 3RJZA 4CYMD 1F2VA 3U48A 4B82A 4ZVSA 1OT8A 4I4TB 4NMLA 3B3AA 5B1HA 2GVZC 3RVBA 1E6CA 4MTLA 2A5YB 2EG5A 4JOQA 4ZGGA 4MUAA 2J9FA 2PZMA 2O1EA 4KR9A 2R47A 3HBLA 1ZVJA 2VSQA 3CZQA 3AEQA 1G5PA 4N82A 1RFGE 5CAEB 3HUUA 4PTLA 1QG4A 1QGAA 2WFZA 4P22A 4RIHA 5ICSA 5T7BA 3MWDA 3PVZA 1DVRA 3MGCA 3QDNA 3BK2A 3A4LA 3C3OA 3FUFA 1KO5A 2PAFA 2W4IA 1WXXA 2AFIA 1T9ZA 2O0JA 2Q2WA 3PE6A 2FQQA 3C4JA 3L04A 5EJ8A 2CXTA 4PYIA 3T34A 1GKYA 3D9NA 1KC1A 4LAFA 1QF7A 3DE6X 5J4LA 2B1GA 2K6GA 2VSXE 3GY0A 1UZAA 3H9BA 4Q34A 3CJRA 1B1AA 3FBGA 2WBLC 3UATA 4AF7A 1XRLA 3WJ1A 2IZ1A 2D2FA 3C1UA 5FUVA 1QOZA 4DQUA 3IFSA 4G0PA 1YK0A 1OI3A 3WFJA 1C30A 1RVDA 1AQNA 4F21A 1LRJA 4ME6A 3UBTA 5FBQB 3TMAA 4BNGA 1KI6B 4IEIA 2CFUA 4LOKA 4A2WA 4S3MA 1U8AA 4GLBA 2BT4A 4XB2A 5EWLA 1E20A 1GQ2A 3MIZA 3A14A 4MR9B 2EGUA 3AFOA 2K4MA 3D8HA 2G9UA 4RIFA 2IH5A 2GWRA 2YHIA 3VYTB 2ZXFA 1QRDA 4EBAG 5BT1A 1ATZA 4GOLD 1C81A 1JHYA 2WYHA 3NBKA 2ECKA 2YNMD 1XLUA 3MAAC 4YRQA 4JOSA 5DGXA 3EAGA 4CR8A 4QQIA 3ZYCA 1G8FA 4DC0A 5B6PA 2PL5A 5L45A 2HWYA 1TMKA 3N0VA 1F7UA 1NA0A 3OE4A 2UWJG 2XYRA 3FH0A 4LDAA 4BWYA 1Z7GA 1WXDA 1LBHA 2D5LA 3ABQB 4FFBB 1N2BA 5ELXA 2ZJ0A 3DXZA 4OYRA 2OOSA 3AP1A 3B3GA 3RGWS 1P7VA 1SELA 1XYVA 3EIQA 2XOKD 5J3JA 4ZU1X 3LCVB 4O60A 3ZDZB 3EAFA 3G23A 4BCCA 1RWQA 4BO2A 3FDFA 3SJCA 4B45A 4I2VA 3PNYA 6REQB 4C20A 3FFXA 1U1IA 1XD8A 1O3YA 2M32A 4BTLA 1E2LA 4P8RA 4NR0A 5CFRA 3ZHEA 2IY9A 4N5DA 3ZW7A 4D3SA 3ENNA 1NBMD 4MVWA 4YWJA 1K92A 2Q6KA 3VKWA 4AMYA 4HVLA 5IU6A 5HKOA 3FZGA 4YRTA 3UJ9A 3J7AC 4IY1A 1UM9B 1VTKA 3HDTA 1L5QA 1LBTA 3LT0A 4M0KA 1PUIA 4B80A 3IKTA 1BDHA 3SJ7A 3BG0B 4W9RA 2OQIA 3VTYA 1MW9X 5K0CA 2ODWA 5COQA 1DLJA 3RARA 3HL4A 3C7CB 3RYTC 5FZRA 3BVPA 2QUAA 1E9EA 4EBFA 4DBLE 1L5YA 2BEVA 3IPXA 4JH0A 4JA2A 1Y6RA 5JJ6A 4NKRA 4FZVA 2XV1A 2B5WA 3OE5A 4K9OA 3ETEA 1OYVA 1TZKA 3U7HB 2PANA 4ABYA 1YMVA 3B7BA 2XVMA 2BGIA 4KSCA 3NKFA 3GDFA 3LP6A 1WRBA 2IX9A 2IV7A 5FNVF 4GI5A 4CKWB 2VDPB 5DGCA 1P8AA 3W5AA 3DXKG 3MNFA 4DCUA 3BMOA 4YK7A 1KKUA 3QI2A 5JTTA 4JI7B 4IDDA 3OLQA 1EK1A 4FE3A 5DX0A 4CM3A 3NRBA 1FDSA 2A0FA 1QFSA 5L6LB 3E8SA 1T5DX 2QJTA 2EC5A 1P4GA 1U2SA 4ARZB 3AVYA 1MW8X 2FWBA 4ZVVA 3BA6A 3WWZA 1XQVA 1LJ8A 2EKQA 4HMPA 1C3VA 1E2HA 4QOSA 3K9HA 1CQWA 1YCSB 2AK2A 3BRQA 1GPYA 1P0PA 1FQKA 5ERYA 2QNBA 4B17A 1MX9A 1SXJB 2C9CA 3SGLA 4Q3OA 2HSWA 3HHEA 3KS2A 1QH0A 4EGAA 4EZBA 1V6CA 5GJCA 1R6XA 5DE3A 1J2EA 1N3LA 4RQIA 2WHPA 1NNI1 3CBGA 1KI3A 4JWTA 5FB3A 1XCOA 2XB2A 1QGOA 1U8UA 3OEYA 1CR2A 3LUDA 3FFBA 4NBRA 1PNQA 2FPGB 5IX8A 5CCBA 3H97A 4LY9A 1TK3A 3OQIB 2DLCX 3K1YA 4KMMA 2XR1A 1CJCA 3FYUA 3I4LA 2VTBB 4PAMA 1XPUA 4X7MA 3RC1A 3ZDXB 3C48A 4QYMA 3S68A 3M8KA 4QJIA 2ZJ5A 4RF4A 2AMFA 1A2BA 1IN6A 3MEQA 3WDLA 4P83A 3ZWWA 3PH0C 2Z08A 4NACA 3D4OA 1OD6A 5JANA 1G5RA 1HRKA 1T34A 1W8DA 3M3HA 4HAIA 4X91A 3SNKA 4KFRA 4WA8A 4X7RA 4YMWA 2WNIA 5K45A 4BLQA 1D1PA 1GZVA 4YUZA 4CTOA 3CPSA 3CVQA 3GGSA 3DEHA 4Q12A 2IFUA 2IDKA 1Q3KA 1H2YA 1EGHA 3MLEA 3RQIA 2Z04A 1T5HX 1KMIY 3GQBB 3KE9A 3KPUA 2Y3AA 1JLKA 2VJMB 2P9EA 4FDTA 4UE3S 4Q1DA 3V2XA 2QG6A 2ZYHA 5G4KA 2BTQA 3EZXA 4MKHA 2IY0C 3AF5A 3O0DA 1SFRA 3U2QA 2X1HA 2C8JA 3ANMA 4GM4A 2QVCA 2GKGA 3QHAA 1UWCA 4W1QA 4IEFB 1EQAA 5BOSB 4MIYA 3ZZMA 3DDSA 3L8ZA 5JH7F 2L9BA 3Q12A 1G9TA 1MOZA 1PQUA 4MEBA 2MOKA 2WC1A 4IMJB 4AWAA 1NPTO 5T57A 4QT0A 3STTA 1KZYC 1XZHA 3H3JA 1E1QD 2CF6A 2JLBA 3NGMA 3OZ7A 3FF1A 2J0VA 3BFPA 2CSUA 4DG5A 3B1YA 3O03A 1JLLA 5LOVA 1I8TA 4RABA 2EWWA 3TBHA 2Q62A 4ZFNA 1DXYA 3LM8A 1F2UB 4QC2A 1YASA 2JFWA 2FP4A 2X5XA 1EI9A 4O4JA 1J49A 2D7CA 1TU0A 3QVXA 4AJ9A 1KI9A 4YCLA 3D3JA 3UOWA 4C6RA 2AMJA 4H7JA 4EHMA 1L4UA 4YDYA 4AJ2A 1EZ4A 1ISPA 1INZA 1XB2A 2XUJA 3L84A 3MD0A 4HSEA 3PS6A 3E0XA 2DY0A 4QTXA 3ONEA 3COSA 4GWGA 3OT4A 4RF5A 3S2GA 3T5BA 4X8HA 4YRFA 1US8B 1FVHA 3AFIA 4K6KA 3VKFA 1ZYUA 1U1EA 1Y4AE 4MW4A 5FBLB 4P58A 2Z3WA 4A0RA 3FOCA 4COKA 3SYMA 3ADBA 3SPXA 1Y3FE 4K46A 1LWNA 1I3KA 3VKHA 4DA6A 1KPIA 3ZHYA 2XCSB 3ZWQA 1P2VA 3MJVA 1A04A 1RBZA 3TG8A 3F3YA 2DECA 4X1YA 1JRLA 2ZYWX 3M5WA 4EG4A 4X85A 1D9ZA 4DPRA 1XP5A 1NVEA 3HN2A 4Q02A 4Q7EA 2PA3A 4QVKA 3W8RA 4DUGD 1PSZA 3C3PA 2WB2A 3LBNA 3ANTA 2Q1TA 2IQCA 1SK9A 2V6BA 3O21A 5EHGA 1T2FA 1GNVA 3T9CA 2X8JA 4CLRA 4Q15A 4B2PA 4WY8A 2Y8EA 1BTOA 1MHQA 4GNKA 1BCRA 1UXHA 2L0XA 4L16A 4OXKA 2RHJA 5J2UF 3KYJB 1ZUIA 2G82A 2SKEA 2YIMA 1P91A 1W0CA 2PUTA 3GWZA 4I1OA 4JUCA 4WZBB 5EVCA 3VNAA 4EX7A 3UJNA 1C4KA 4G0XA 4L8GA 3ZY4A 4P82A 1EE9A 3O4FA 4HNVA 2BTEA 3TW8A 3FVTA 1JIVA 1JZQA 1G18A 2C83A 2ZWMA 4NOMA 4PLHA 3NOXA 1P31A 1DBWA 4GTPA 1HZ4A 1E2DA 1KJWA 1RWWA 3BRSA 3L0YA 3MJEA 4NV1A 3RBAA 5KBAA 4CL8A 3G6WA 3UFXB 2AZ4A 3DZDA 1NOJA 2VBFA 2HR2A 1UMKA 2W42A 3IILA 4AJJA 5D01A 1KO4A 4X71A 1VGQA 3KEAA 1BXRA 2HBRA 1QP4A 3AMVA 1RJDA 4LG1A 5IRCD 4KPYA 1EWVA 4M0CA 2YYSA 3QVKA 5LD2C 1Q15A 3OUUA 3R0ZA 2I2DA 3F8WA 1DQRA 4I36A 5TPWB 2YBEA 4HNQA 3DD5A 3UT7A 3CIAA 2D54A 2DBQA 3FWYA 3LT5A 2R25B 5DNCA 4R7ZA 3LF1A 2XDQB 2Y68A 5EIBC 4DIUA 2AC2A 4TTPA 4M1TA 1P39A 4KR7A 3PTAA 2QD1A 3IVXA 4ND2A 4Y9RA 4CLDA 3VR0A 4ILKA 3OX2A 1DTSA 2CXOA 2OK8A 1TIPA 4GX0A 4NP6A 4X8MA 5TARA 1XZFA 2V8BA 1WA5A 4DEXA 5FH9A 2QYJA 2XDAA 2IY8A 1M6HA 3MGKA 1QRAA 5HIMA 2HQBA 4A6XA 4J9UE 1WKVA 5EHQA 3U26A 3TZEA 2EIJE 1WUYA 1QIFA 1HWYA 1IM5A 3SYKA 3HI6A 5JYCA 4KW7A 3TWWA 4U0SA 1T35A 2JANA 3LTNC 3OTIA 1BCSB 3UMRA 2J3HA 3KJNA 1NFFA 1O0SA 2GZSA 3AI2A 2X9LA 3ZKWA 3BJIC 1PR2A 1DUSA 3DPYA 4I6EA 1Y1KE 3F1LA 3LXXA 3P2KA 1UXOA 4U8GA 3NWEA 4L08A 3K2BA 4QU8A 1FLNA 5KWEA 2GEDA 4NQ0A 2P2SA 4M9SA 5JBNA 1Q21A 2FPIA 1X13A 3NDRA 2Y4TA 4PZ9A 2DYSE 1DBIA 1XCBA 1SG9A 2MMGA 4DT1A 5CCEA 1AN9A 3QKSB 5L3ZA 1C50A 1DBQA 2YV2A 1L4NA 2A9PA 2R7KA 5FFFA 1MVLA 1TKAA 2FQWA 2Q1YA 2P68A 1LTXA 4CV1A 4EA6A 3UG7A 4EUFA 2VWGA 2JC3A 5HPYB 1H3EA 3BA1A 2AEFA 2ZS7A 2CWWA 1CJMA 2A0KA 3L92A 3KB1A 4HB0A 3QJGA 4UHHA 1IWBB 2ONJA 1I4WA 5EDSA 3DPUA 3JQ9A 1NN0A 1ODIA 2DFTA 1KEEA 2D5CA 3QA3E 4BNYA 1SD5A 1K6EA 1F5SA 5EIXA 4WWHA 1FJHA 3JVUA 5FFNA 1YZYA 2QYUA 4OQDA 3RBVA 2RSLA 1A5SB 1DP4A 1GGVA 2OXCA 1FMTA 3I12A 4ARAA 4FB5A 2E48A 4CDMA 4QLBA 3VPAA 2Q0XA 4CIVA 5JQWA 2VTVA 2VT6A 2VP3A 4QUJA 5LZ2A 4A8PA 3PREA 1MPXA 2Z8YA 4QODA 1KVSA 4UD6A 5C1BA 4QD3A 5G1NA 4F46A 3K53A 1U94A 1JQLB 3Q5EA 4ND8A 5JAOA 1SZJG 3THXA 4O4IF 1WKBA 2HHHB 3AR9A 3RVLA 2Q0SA 1F4VA 1K3UB 5G02A 1I5RA 1X3LA 3TSWA 3L6CA 3A4YA 4AU1A 1UKZA 4GPZA 2G71A 1FDIA 2P35A 1YQEA 3LDUA 4ZCRA 2KBEA 1RBYA 3AB7A 4RU1A 1U80A 5CXSA 3DFZA 3N8KA 3EMBA 4DRXE 3ZTYA 1QE3A 2GEVA 4RLFA 1XZQA 1XR3A 2BSAA 3CNEA 4RDHA 1E1RA 1LQTA 2QSUA 2RDMA 3DQQA 3HHPA 4I1MA 3L43A 4MUMA 1SHJA 4TKLA 4XUCA 1FP2A 2A57A 1Q12A 3ZXYA 2ETCA 4Q03A 1IJBA 1N9ZA 4QEZA 2VWQA 5CHYA 2YY7A 1N0HA 2HNAA 3KZKA 4L5BA 3WXXA 5FX2A 1FX0B 4A0QA 1QG2A 2XQIA 3AH8A 3AU8A 3C70A 5DHAA 3M9WA 5CITA 2CNOA 3DHWC 4E31A 3CHRA 4YDOA 1M2EA 4PH4B 1SG6A 1XMIA 3KYCA 2DIWA 2FUG1 3QPDA 3CTPA 4MCIA 3NEJA 2LRHA 4DR7B 4KRFA 3BFXA 3F97A 2BHNA 2WAAA 4GP6A 5IZ4A 1TI7A 2QAJA 2PYZA 2C7QA 4FQ5A 3SZGA 3MOIA 4IZOA 3TI9A 2HRDA 2ZJ8A 4RHUA 2XCBA 4HWOA 3AEKA 3B8EA 1MX6A 3FHCB 5FBKA 3X2FA 2JEKA 4M87A 4D80A 1AN0A 1WCIB 1MG0A 5IJ0B 3WIOA 1YS7A 3CVUA 1GUBA 1TKBA 4UZSA 3FULA 5KNHD 1GTG1 2ANCA 3HY6A 4HQNA 2P6NA 4NMWA 2GRMA 3P9IA 5HJ7A 4FOLA 1WAO1 4U3JA 2FNAA 2AG6A 1Z28A 1GG8A 3WOHA 2VSYA 2YL2A 3HKEB 3N2KA 4U2CA 4NIKA 3EDTB 5J90A 1EFRD 3KYDB 3X2SA 2FW7A 3L7KA 2Y1CA 3DL0A 3D7SA 4M3NA 3OZVA 1ETHA 4HWTA 3VYSB 2XZOA 1X9HA 3DHNA 4R98A 4BMSA 2HGSA 2HJRA 4C88A 3IL2A 4TS9A 4N76A 3PE3A 3NHYA 2NX2A 4FBMA 4RPHA 4TLMB 1T4MA 3WL5A 2Y1LE 1XKTA 2P5YA 1AWCB 1QDEA 3C8UA 4YRPA 2VSOE 1MAAA 3EJNA 2WT4A 1CFZA 4K9MA 1SKMA 1I6WA 3GWGA 4RD2A 3HSYA 2JGKA 5EYLA 1ESDA 1QBGA 4OSEA 4A1SA 4WOPA 3WO1A 5GY7A 1Z5SC 3B5EA 1Y1PA 3Q40A 3VO2A 4D57A 4HB3A 2JLZA 4ZEOA 4I1PA 1NJ8A 4BAGA 3IQWA 1DCKA 3IQDB 4K9LA 4J0JA 3VR6D 5C5DA 2VBIA 3BSFA 4BRWA 1OKKA 1YV9A 1LVGA 1QQEA 1QM5A 4HH4A 1JDZA 1YZVA 1RRGA 4WTOA 4XX0A 3VPXA 1TA0A 2XHZA 3VHXB 4GXQA 1RMTA 3REGA 3E53A 2VPZA 1XLWA 1X1DA 3G59A 3KQPA 4XRRA 4CM6A 5BMVB 1VP3A 2ZSJA 2G5TA 3OECA 4WKBA 4BU1A 4D4HA 5LKRA 1V1RA 4W5WA 5J4HA 4QASA 4D8UA 3VR6H 4J0DA 1M6VA 1FYVA 3U4MA 4PYMA 1KMMA 5M04A 4WOKA 4IIVA 4R1NA 1OY1A 5GMOA 3WMXA 1J39A 3EH2A 3QNWA 3TZLA 3AUTA 1XN1A 4ZVKA 1ZGCA 2LKCA 2YY6A 1KEKA 1OA0A 2AKYA 3P1JA 1YOVA 4MYSA 5BUQA 2ODEA 3CZRA 1ZSVA 1SXHA 1FVXA 1Q0ZA 2V4UA 4WNCA 5ESWA 1JH9A 4RM2A 3P20A 1UC8A 3KZCA 4LOJA 1COZA 2ODBA 4NCJA 1J5EB 4KQJA 4WK4B 3AIIA 1NONA 4ZVPA 4ZZ0A 2BEWA 2EX1A 3FUVA 4JA9A 3AEYA 3LMKA 3RS8A 1ODFA 5DU2A 4ZCSA 4TL7A 4WJZA 5GVRA 4BZXA 1H4TA 5TX7A 4FFNA 1XTVA 4B8WA 5TB5A 3LT2A 1DFHA 4L78A 2DR0A 2HA3A 1BXZA 2Q0QA 2QX4A 2J5QA 2XDYA 3A4MA 5I9BA 2CHUA 2I3BA 2IIVA 1DGQA 4MV4A 4TWZA 3DB1A 3DV2A 4IIBA 1OCEA 3GL9A 5E2BA 4MB2A 3OH8A 4WCDA 1MRSA 4BASA 3NHZA 2GJAA 3DEOA 1WSDA 3DS8A 3ZDCA 3MJWA 2AKAB 4OAPA 4NBKA 4DLYA 5LB2A 3GG2A 4D10C 1KMNA 1TAGA 4BNDA 5KX5A 2PAAA 1IHPA 2WUGA 3RLIA 1SXQA 1JFTA 3HK2A 1M6EX 2AC4A 2RG1A 5KHAA 5CEEA 3S2YA 1CUEA 3QPVA 4KG7A 3W06A 4ABTA 1ZBQA 2WP8J 3K0AB 4BYGA 4INZA 1UBTS 4C30A 5DHRA 2G06A 4W63A 1W0JA 4BUZA 2AD1A 3C0KA 4OXNA 3I2KA 1L7EA 2IYRA 1OH8A 5LUAA 4E94A 3LYHA 3VR3A 1CJKC 3PQFA 3EPJA 3N05A 2JASA 2NC9A 4RLHA 5B1DA 1GTJ1 3ZCPA 4E2FA 1IQ0A 1R4MB 2GPJA 3DCYA 4X7BA 3KAKA 1D0IA 4Q3LA 3WNDA 2P6RA 4C7OB 3G2VA 4DQDA 4HFRA 5F3WB 2BCGY 1BHSA 4B94A 1LBSA 2R6HA 1C0KA 2XVXA 3VTKA 1REQA 1Z9BA 4DCNA 2HHAA 2ZE5A 1G6OA 1EGAA 5LCWC 1T2EA 3QPWA 3KKLA 4TV8B 3W9YA 1H9CA 3BJRA 5KJ1A 3A1TA 4Q9AA 4BX8A 4GDMA 2JGRA 2QLJA 3KVVA 4ENUA 1N7GA 3WAKA 5JCOC 3VGPA 1PV4A 5DYYA 1M7GA 3Q3GE 5F21A 4P3XA 4DV0B 2P78A 5EMNA 4WNGA 3LP5A 3A9SA 4NU5A 3OJEA 1DRUA 3UHFA 5JWRA 1YQTA 2OV8A 2J0UB 3U9WA 5KOJB 1M1UA 3HVRA 2O5VA 5C53B 1TYDE 1VBMA 1M75A 1V7PC 3U44B 3FDIA 1WKCA 3EJWA 3U4QA 3EGXB 3K4HA 1JKMA 1HGXA 4G9GA 5ED4A 1IBKB 1O6FA 3UK0A 2F48A 1E3IA 5C8ZA 2R7NA 1R3UA 3SF8A 4ALMA 2DBRA 2OO7A 3D9QX 4F72A 2DCUA 3KEQA 4TL8A 2B1QA 3FSEA 3GOQA 4YO8A 2ZU0C 1XRJA 1T9AA 3UHOA 1GGEA 3SVZA 5HI7A 4DCVA 3TTYA 2DEUA 3QWVA 3TPCA 3T7IA 2WM9A 2AC7A 3NKVA 2FVYA 3OFND 2FRDC 4L1BA 4KU4A 4ECAA 1X1RA 2HO1A 1Z7WA 3P96A 4JLJA 3ZHUA 4AMUA 2NVOA 4P31A 5HGJA 3RS4A 3DEJA 1FA9A 1C9KA 5JZ9A 2CUTA 3ITEA 2JGDB 1GA1A 5JR3A 3GEIA 3L0PA 1E8YA 1N1EA 2F9MA 3AETA 3KQOA 3PUVA 1NXXA 1X0XA 1T25A 1HG0A 1MV5A 2Z9DA 1RI2A 1V7QA 2EIXA 3O4HA 5FLXA 3ZBPA 2WD7B 1DBVO 3V7WA 4BO1A 4JOBA 2BEKA 3JYPA 4WBNF 3G0CA 4GZ5A 4XGRA 1WMAA 4YCMA 4ZHQA 3IJPA 5FUWA 1ZIXA 4S35A 2V7XA 3RSSA 1UG3A 1E18A 4N5CA 1Q7CA 3WL7A 5KTNA 1NUPA 4CZ2D 3OTHA 4U96D 4KZCA 1ISSA 2YR0A 3R6GA 4WCFC 1BH6A 1SBHA 2ZI5A 3UGTA 4DMUB 2IHVA 5IAGA 4P54A 1SQ5A 4I8XA 2VN8A 2XMRA 3GROA 4NBVA 3C97A 4DF3A 2AQ8A 2VO1A 1X9IA 1P7PA 4RVUA 5KQPA 2Q0HA 5MFPA 1LPSA 4HOYA 2QMUA 2WTXA 4X6YA 2H6IA 4ESEA 2LW7A 4LBZA 1OT5A 4CKYA 2JDIA 3QUQA 3IHTA 4RDXA 2F0YA 1T9BA 1OVGA 3BD6A 5JE8A 4IQ0A 2QRVA 3SEFA 3FTPA 2QX8A 1C30B 1VMAA 4FJYA 4NSNA 3RF6A 4I1VA 3BMCA 3WKEA 1J8VA 1DUIA 1GAEO 1QIEA 2X5JO 4DKJA 1U4NA 1E0DA 2BMEA 2EP5A 2M6LA 5GV8A 2PRKA 4N49A 4U00A 2H85A 3B1KA 4LMPA 3V6MA 1M33A 5FA5A 1NVUQ 4C0MA 2OO5C 3FIJA 3G02A 1DWUA 3VU8A 1SVLA 4HGNA 3UQ3A 2L82A 4RC9A 2YVUA 3F6CA 1UM8A 3KJGA 1OW3B 2SHKA 3KLNA 2K87A 1LSUA 5I5EA 4IDQA 3H9CA 4E14A 1KAGA 1ZUHA 3G5TA 1C29B 1TRKA 1ZGZA 4MUFA 4ZGBA 4A36A 3MW8A 3DMGA 3FUIA 4WQMA 1ZN9A 3C14C 2F1RA 4L02A 1OXTA 3A36A 2IH4A 1KO8A 1GN8A 5IUJC 1SRQA 1N25A 4DW8A 1KEWA 2F37A 5KYGA 1TD9A 3E6AA 4HHEA 3THYA 3OWXA 5JU6A 3DH0A 3SS9X 3CMMA 3C3XA 1J9GA 1NQAO 1OI2A 3PP8A 2QD3A 4OBEA 4WVLA 1PLLA 3PGA1 3SJBA 3K70C 1WM1A 1CDDA 2QL6A 3QKWA 2Z1NA 1H23A 3I5XA 4AURA 3UX4A 4MQ6A 3ILVA 3A4NA 3EZ2A 2KBXA 1BJTA 3G1TA 2Y67A 3JD3A 4HF7A 1UF9A 4DJJA 1KFBB 4NJMB 5C8YF 2BGUA 1FVFA 3Q85A 3QOWA 2KW5A 1JDSA 4LQ4A 4V02A 2FWNA 4EHBA 3OTOB 4LRYA 1OB5A 2CLCX 3KKPA 2CXPA 1TJCA 2P9NG 2Q2NA 1JQKA 2ZSEA 1ZJ6A 3M33A 2A1IA 4GGMX 4LWZA 3RTGA 5ITZA 3H4VA 5F3DA 1G3QA 3UT8A 1KJNA 1QBKC 3C3AA 1XZKA 3WBBA 1FRFS 1T2NA 4MQEA 3ZWYA 1JVNA 1U28C 4DWVA 5CLGA 3V8NA 4CRWA 1U8YA 2VHEA 1KDTA 2VH2A 2B25A 1RYBA 2Z56A 3ABSB 4FPXA 2Y93A 4KLNA 1GG5A 1O57A 3AESB 4WDRA 1GZ3A 1ITZA 2HF7A 2FF4A 1VJTA 2W0MA 4XEHA 1H19A 3BX1A 2DBAA 4BQOA 2VUHB 4B3RB 1MF7A 3T15A 1ESCA 2I6UA 3TL3A 4EG7A 4N3AA 2WWGA 8OHMA 2H63A 5LVAA 1XAIA 3CB2A 4NVRA 3C98A 3L54A 4WKOA 4IV5A 2QYHA 5HTKA 1MEJA 3TS1A 4AZVA 1N7IA 1MABA 3L7AA 4GECA 1XEWY 3GYZA 3F4KA 2G6BA 3OZUA 4NV0A 4DPLA 1A17A 4E46A 3KQKA 2H6HA 3LT4A 1JG2A 3C5WP 2RKOA 1SXJA 2GD2A 3PCRB 4LC0A 4I9CA 1OFGA 2Y3IA 2RHGB 1EUYA 3ASHA 1KMCA 5FP0A 3HY3A 1HFWA 5HF8A 3JAWA 1N7JA 4LUNU 1JFFB 1LWOA 1R15A 3EIEA 3KR0A 4IV0A 3IAS1 3R3ZA 1UBSB 4ZRDA 5KYKA 3LFHA 2JB9A 4C4AA 2GFIA 3I1FA 3QBTA 2CMHA 4F5ZA 1RQXA 4BT9A 3AS5A 2O8NA 4UBJA 5SY9A 4WNIA 4F6CA 2V0CA 2ZW9A 4DB4A 1ZMBA 3U56A 3RVMA 1T15A 1I1HA 3D3KA 3VO8A 4E51A 1Q0UA 3GD5A 3LKVA 4F6RD 3R4VA 1XZLA 3H8SA 4R84A 4ZT2A 2V65A 4IS2A 4WRRA 1ZLYA 4YAFA 3NFYA 4ZPJA 3IBSA 4OL0A 4WHMA 3TTTA 1X1SA 3TB6A 1Q0TA 2F67A 2FPUA 2OK7A 3N0RA 1IG3A 1POWA 3N39C 3FGPA 1BWPA 2XUGA 2YWDA 1VQ1A 2XNCA 3PYLA 4M8LA 4OFWA 1YUMA 4LV6A 4Y0AA 2D6FA 2WNHA 5HHTA 2J4FA 3UB2A 1GL6A 2KCLA 1ENOA 2DULA 1X5BA 2WJ3A 2P9PG 4HWGA 1UK6A 3VC2A 3W3AH 1RW4A 2CBGA 1R0CA 4YRDA 4BLVA 4C4RA 1J90A 4H4DA 1C1XB 1RWBA 3E37A 1XMSA 2CHQA 3FRJA 3ODPA 3T52A 3SI7A 4Q96A 4RMIA 1XPJA 2IPAB 1V9CA 5ILGA 3SYTA 1WD7A 4B4KA 2CLKB 3OXLA 2Q1XA 3LC1O 1DMSA 4GOJA 1HKHA 1Z16A 4LKOA 2WIJA 1QHIA 1DX6A 1H2BA 5IYZB 3EPKA 4UCQA 1J42A 1WDWB 1W94A 1SU6A 1XX6A 2GN9A 2UVPA 2W6ID 3GW8A 3QLUC 4UM5A 1G5HA 3LHFA 2BFEB 1S3SA 2XEXA 5G2OA 1UC4B 3OX3A 2GF9A 4PG7A 4ZTZB 2Q3CA 1VL5A 1QFJA 3BTVA 3E7FA 4G09A 4JBYA 1OIWA 2VYVD 3IBYA 3K9LA 4TMXA 1SJ9A 1ABBA 3KQHA 1Z08A 2V4ZA 4NCAA 1QGUA 2FP4B 4L4UA 2VNSA 1SPXA 4OUDB 5C46F 1VIVA 3ZGNA 2ZJOA 3KJFA 4QNMA 3DFFA 2Q5LA 1K5PA 4RETA 1P19A 2B30A 1TIKA 1IATA 2HQOA 3I9OA 3NJ8A 3NYIA 1J2UA 4JBGA 2AWNA 4RHTA 5FBVB 4JZYA 1HLFA 4XEIG 3FF4A 4RWZA 4DX6D 3VZQA 4G25A 1G7SA 1G8JA 1GKKA 3VHLB 2WLTA 1NI4B 1US8A 2W4MA 2WMDA 2EP7A 4A15A 4OP1A 1OLUA 3X0DA 5I7RA 3I34X 1D2EA 3NOOA 5IJXA 2OOEA 4EB8A 1FXUA 3ZXXA 4HFGA 2FMFA 3KP1A 1HXHA 3FCOA 5BWMA 3EZLA 4YP6A 3PC8C 3ZLTA 4LVCA 4Z1MA 4E6EA 4U2GA 4EMSA 4Q01A 3PLNA 1TJPB 2P9JA 2X0NA 4PYJA 2P1ZA 3ZV7A 1OFIA 4BP3A 3TBKA 4GQAA 3I72A 3AR6A 3SY2A 2FOLA 3GCXA 4DFDA 3CNHA 3THWB 3EDOA 3MTIA 3OCWA 2FZ5A 3R40A 5T4YA 3UKOA 1P72A 4HXFB 5IW8A 3WRWA 3A1DA 2VNAA 1ADGA 2QD5A 2B20A 1WQ1R 5HS4A 1HLGA 3AQIA 1U02A 1C4OA 2WPDD 3KU4A 1XJCA 4FKMA 3U4GA 1CP2A 2BFMA 2D00A 2ODNA 3ZY6A 1HX7A 3NB2A 3L3BA 2B6NA 1JAZA 1U2GA 1PJAA 2Y1FA 1EFLA 1PBTA 4HVAA 3L8EA 4PEVA 3UCXA 3LGXA 4D6XA 1VZ3A 4RL4A 3R44A 4WINA 3IERA 3ZWBA 4JA7A 1GPDG 2ZM5A 4I17A 4XM1A 1NZNA 2CG3A 3DUFA 5LP0A 1G0NA 1GXSB 1T9GR 4FDUA 1N5DA 2GYUA 4NCBA 1PRYA 5MN4A 3T1OA 1IBRA 4E5YA 3RAUA 3FLAA 3TNDA 3MS2A 4KZPA 2OHHA 1ML3A 5C4MA 3TQTA 3WGHA 2VDJA 3ORYA 3AVXA 4FMPA 1GSAA 3WG9A 2Z2ZA 1Z36A 1FSPA 3DFIA 3FUMA 2RBEA 2ZBQA 3OE7A 2L6JA 2Z0MA 1K7CA 3JARB 2XDQA 3D1VA 4Y6CA 3G6KA 4GE3A 4JEIA 1Z2PX 2W2XA 4L5CA 2HUPA 2G4VA 3I58A 4GEKA 2J33A 1TNOA 4LK2A 5K0LA 1W76A 4H3VA 4LWPA 4C0BA 3KD2A 2ZOSA 4UZFA 4NZOA 1FL9A 4G6ZA 4A2PA 2ECFA 4EI2A 3CG4A 4XR9A 2EIKE 5KWSA 1XCMA 2PRZA 3DAGA 5G41A 1JPUA 1SBZA 1TJYA 2IYYA 2X14A 1SHLA 2GOYA 3IE1A 1QAOA 4FUTA 3CLTD 3LY5A 4J9VA 5EY5B 1YH3A 2HL6A 4H7EA 2G9ZA 4HY3A 4QUGA 5G0VA 3ZYZA 5FTLA 3VJMA 5JEEA 1Q0SA 2BF4A 3RS9A 1FX1A 1CVIA 4I0WB 4QLOA 2R44A 2YDYA 4RGVA 4YRSA 3EG9B 4WACA 3AV3A 4BWVA 1ZHFA 4P4SA 5F23A 3WKDA 3HDJA 2DHQA 2OP1A 4RV9A 1ZN8A 3AEXA 1KDYA 3WYCA 4QELA 4RQUA 5LQSA 4LF8B 3DLCA 1ML4A 1SUBA 2AXPA 5E6RB 5JS7A 2M63A 4GPKA 2FSUA 2GZ1A 2JHCA 4DC9A 3V4RA 2GSWA 3EWAA 3BIOA 2VH5R 4X1IA 5H4HA 5I7SA 3PUZA 3PFBA 1DI0A 3TH5A 4LOHA 4DDUA 2BM8A 3BB3A 4LJ6A 4AN4A 1L4MA 2XZTA 2XWQA 4LDZA 3AU4A 1LTHR 1QTRA 3C45A 3QM1A 3CXRA 4G01B 3HB7A 4OY3A 2JZNA 4PX2A 2CLLB 4BVLA 4E21A 5T4EA 3FUNA 5FEMA 5AT1A 1XYYA 4QPDA 2UZ3A 4BQSA 4ZQEA 1Z4NA 1VPLA 1WUIS 1VG1A 2GZAA 2I4NA 1E1DA 1GFSA 2JI6A 2OILA 3QGMA 5C0OE 2HPAA 5J2UB 3ZU2A 3ZW9A 2B4KA 4W5JA 3ZIUA 1QSGA 4O5OA 4XYLA 1Y9ZA 2UZ1A 1T5SA 2BP7B 3K2QA 3OPXA 2AXZA 3FCXA 2KZTB 4G8CA 3PK0A 4AIRA 2JFVA 3JQ7A 4F4DA 1S1MA 1GAQA 5FQ4A 1E2NA 1LVUA 2CD9A 3EEQA 3HYNA 3HB0A 4RFLA 3FTFA 2IJGX 1YRBA 1F06A 4I81A 4ZT6A 4GGPA 2N47A 1MORA 3PVSA 2ODAA 5JWHA 3RHFA 2A33A 2PWAA 5AESA 1M8FA 4DNXA 3TWUA 3V4OA 3PNLA 4KR6A 2ZRFA 5ARBA 2VF7A 3SMQA 3HVJA 4LF4B 5AVWA 1ESMA 2YZKA 1EP9A 2Z6VA 2WVIA 3CT6A 3Q1LA 2F6RA 4Q4DA 2O6HA 4WT7A 4AM9A 4Y6WA 3VR5A 1CW2B 1AHIA 3HCDA 4FI3C 4PY2A 5AHXA 3T4PA 3NBUA 2H54A 3UC5A 4WNYA 4YCSA 1MQ8B 4PSKA 4PO8A 4R9SA 1BEZA 4JC5A 2BFAA 1EK6A 1JCSA 1JX6A 2D2IA 2H0AA 3G0IA 3K96A 3ND7A 5G3YA 3TZCA 2EYUA 1QS0B 1XKQA 4XCQA 5C1DA 3CYFA 3EY9A 3QU2A 3WB1A 4DMLA 2WLSA 2NN3C 4CGVA 4H6WA 2QTWB 2Q4TA 4WD3A 1IZ8A 4BC1A 4L50A 1JQAA 2ZSUA 5FR1A 2QT9A 1GYQA 4D9GA 2O2ZA 2IRWA 3E58A 1LTQA 4BTBA 3DMTA 4IP0A 1FX0A 1RP1A 4LZZA 3WK9A 3OEEA 3RYCA 2PS3A 2XQ0A 3PX2A 2NPFA 3KXKA 5JEDA 2P2YA 1OROA 1FFBA 1M1XB 4DQ0A 1Z4JA 3ICOA 3SX4A 1SOWA 3ZJTA 1N0QA 2IYEA 4KWEA 4ESVA 3SYNA 3NORA 3GLSA 4TSFA 3FH5A 4ZEXA 1P7YA 3PQDA 5JSQA 1A50B 2VTKA 5DW3A 2MDTA 1SU7A 4HWPA 3PGVA 2VNIA 3IJEB 1JG3A 4MUBA 4N0MA 3SBDA 2BR3A 1RCTE 1UJKA 1H2VC 1QCZA 2Y4NA 3QUSA 2DH5A 2XJ4A 2C5SA 5FHRA 1FP1D 1P5HA 2QS9A 4HFMA 4B31A 4NYIQ 1CQPA 3WMFA 2JAQA 1ZCBA 3HB9A 1EX6A 3ROPA 3WJ2A 4B7UA 5KYWB 1RYEA 1C41A 1L9XA 2YHEA 4KQ2A 4QDTA 5KYUA 1K68A 3HGTA 3BU8A 1VYHA 2I76A 1FYXA 3B82A 3IALA 3N2KB 1PU2A 4QXRA 5ALUA 1J6UA 2XAAA 2MYTA 3EXEB 4K9KA 4LPKA 2G7ZA 2R9VA 3ESXA 5CDGA 4R6WA 1JTFA 4R2MA 2A78A 3OEHA 5EZQA 3SFVA 4A63B 3DO5A 4QDJA 2LSVA 1GRCA 3ANYB 2C4WA 2XQJA 3D59A 1MAVA 3GLHB 1AZSC 4RPIA 3PZ4A 3ABOB 5AKZA 1RWVA 4M38A 4BQPA 1WY5A 4DA0A 4GMGA 1BEEA 2Q1SA 4DX1A 1ZR4A 4YO7A 5AVOA 3FPLA 5U4XA 1G6KA 3CLTC 1HL3A 2GS9A 4CUJA 2YH2A 5BN3A 2X41A 4M1SA 3R6LA 3OY2A 4P34A 3PXUA 2I65A 5TS2A 4AJKA 4IDFA 2ZUBA 1QV7A 1TW2A 4Y9UA 1NJGA 1OSNA 2G0AA 5DN6D 3HVUA 1AOXA 2EBWA 2QTZA 1GNPA 3OQ1A 3F78A 1DEXA 1VBFA 1P6UA 2X6QA 2FMUA 3A2MA 1H6BA 3SFYA 3ZJYA 4MQFB 4H7YA 1KI8A 2O20A 3FUCA 3SM9A 3VHXA 2K7ZA 2H3HA 4Y2VA 3OX4A 3WQRA 2QTLA 3WV5A 4MKTA 1B15A 1GA6A 3CX3A 4ZODA 5FI3A 5C80A 4NNJA 4L0CA 1BYIA 2HREA 4R2XA 1Y7HA 5A6SB 5LU9A 2VAVA 4FMDB 3S0JA 3UJHA 3PDJA 3QC1A 1JKIA 1TC1A 5ENTD 2WNSA 3EX7C 1IJFA 4BWFB 1Y3IA 4YRMA 4JXZA 1YBFA 2PCJA 5K3DA 1B89A 3KYBA 1SQ6A 1ISGA 3AG2E 2Y69E 3JQ8B 2LNDA 1UR5A 3MA5A 3SFXA 1GITA 3K0EA 4QPNA 1WZIA 1ADFA 3PD0A 3ZDYB 1D4OA 3SLGA 2RGUA 3T8KA 4ZIRA 4PZYA 4RZ2A 2C20A 1XYGA 1MX5A 2A58A 1UBRS 2H5LA 2QXTA 2VDQB 3OPYA 1GRQA 4MR7B 3T7SA 4D9KA 3O73A 2QROA 2PDAA 1DSSG 2FN9A 1SOUA 2EL9A 2J9GA 3WLEA 4BL5A 1XA3A 5KOHB 4U7HA 2DR2A 3G2TA 5HCIA 2EP8A 4HTFA 3PQ7A 3S29A 1EFTA 1T8YA 4QEDA 2AOVA 3EGIA 3MT0A 1N78A 3B3JA 2WZQA 4LXHA 4HMOA 4LDNA 3RU3A 1Z3XA 1NBMA 1ONOA 5FPTA 4R2KA 3TFQA 3V48A 1QZTA 1A9OA 4CIWA 1UOHA 3DPSA 1XA4A 3I2IA 1A5AB 1U90A 5EFOA 1HFEL 4LJAA 1KK0A 4UOZA 1CUUA 1N3IA 2N1BA 4CF6A 2P3OA 3PL5A 3L1KA 2FN7A 4ZOLA 3RVOA 1MHTA 1E69A 1MG5A 4PTYA 1Z13A 4WOBA 1SZ9A 3PKZA 4M0PA 3V80A 3H9EO 3MTEA 3NNNA 4Q4JB 1H4SA 3EZ7A 1E2FA 3MF4A 4IWYA 3S6JA 1KT1A 1UBGA 3H1FA 3LK6A 5EKXA 4LQCA 2OQ2A 3ENVA 3HO8A 3O83A 4ZVMA 4BQRA 2TYSB 4KQFA 3HCAA 3JVIA 4O2BA 4X1OA 5EMMA 3TLMA 1E79A 2H1CA 3ROEA 3WGVA 3N53A 3SKYA 2IXGA 1FT2A 3FR7A 5DYGA 1CY2A 4JI1B 3T3OA 3BBLA 3H87A 3LHDA 3J81k 4MITA 1OX4B 1XZDA 1E0SA 4O08A 2L69A 4R8RA 4B7ZA 1VGRA 4P92A 4TM8A 1R27A 3N2EA 4Z9FA 5K3FA 3TLEA 1OA1A 5DNYB 1BS9A 1I32A 2Q5HA 3R9XA 3K0CA 1Y5MA 3PZRA 3W2GA 1P60A 3DKRA 4N03A 4UULA 5FPHA 1R4MA 4R7TA 4ATNA 1JECA 2GBLC 3HJGA 1KO1A 1WCXA 3C5RA 1FE8A 1MO3A 1P1BA 1PCXA 1VPEA 2IEDA 4FYWA 4GI1A 4H4EA 4LKRA 5EJAA 4EFKA 4NJOA 4KB5A 3CF4A 4EUNA 3NQPA 2NU6A 1TX4B 3IIJA 2VQ3A 2NW6A 2ZKLA 1KU6A 1G7CA 1NF3A 3MBIA 1XPOA 1NY6A 2FEOA 3ENZA 4GX2A 4TRMA 2VZLA 3TEFA 5JY1A 1QC5A 3UM3A 2FEMA 2J7PD 1Z73A 3L6DA 3W7BA 4FGZA 3N3BC 4HO1X 1A5ZA 3EF3A 3HXPA 3ILXA 4EPTA 4CF5A 4ECEA 2XOEA 3CHOA 1G21E 4DJFC 1OXBB 4B48A 3DRAA 2RIPA 3W5BA 4EJSA 5A4AA 4OQZA 5ENRD 5EJIA 1UJ6A 2C3MA 2H31A 5ALOA 3I9V6 3BD7A 3RRNB 3DNFA 4PRLA 4HWSA 3AGPA 1RQLA 3L0ZA 4EI9A 3GLGE 1P7WA 3UI2A 3H5TA 2WWRA 4G4IA 4GMFA 3VNSA 1HYGA 4EGCB 2I87A 5IAJA 3C6MA 5LQCA 5CD1A 3OPVA 3GIWA 1RSZA 1RQ2A 2PUHA 2BFWA 2HJHA 3KB8A 1WXIA 3Q11A 4UVIA 4Y9TA 4X92A 2D06A 1NBWB 1YQQA 3BC1A 1XCLA 4X0EA 3OZRA 1L7OA 4RS3A 1CQXA 2GF2A 3LGAA 4XX1A 2A14A 2ZULA 4JGBA 2XWBF 2QAGC 1DEHA 2BFBA 2QTGA 1X2BA 2QJRA 3LGSA 1CRLA 4QDXA 1FFGA 1GZSA 2PX4A 2CLIB 4NU6A 2J0QA 2WU3A 3T3MB 4EO7A 3HDGA 2RMKA 4M0UA 2YWGA 1KH2A 3P2BA 1D6JA 5DNUA 1FSZA 3BXGA 2G63A 3A6HA 4IJ5A 4CG0A 2KLHA 4V2IA 1TPZA 1TZCA 4RY8A 3NHAA 2ZUCA 4O3MA 2R7LA 4U7WA 5WRFA 3B7RL 2EBFX 3B2QA 1EP3B 1Q92A 2HQSA 4URZR 2GEUA 5BYBA 2YZ7A 1UDBA 4YMHA 2XEVA 2WD7A 1TXGA 2GRJA 2NM0A 1LC0A 2HOQA 1O9HA 3OP4A 1DARA 1K97A 1GJRA 3R7FA 2REBA 3DLPX 4YLYA 4HLQB 1QWSA 1ISIA 3ZV3A 4BVEA 3QHQA 5KB3A 5CA1A 1MIOA 4L9WA 3CE9A 4U2DA 4P1ZA 4Z1OA 4UJ5A 1Q14A 4IAOA 1K27A 2NVUA 2QUJA 5AI9A 2M2IA 2C2MA 3CTMA 3RVDA 1E7QA 2A9KA 4L4YA 4TYPA 3BK1A 3QH4A 1VE3A 1R2QA 4LV5B 1QDLB 5AOVA 1N9AA 1VIAA 1JEJA 4LTDA 4CKCA 2I4LA 4NYJR 1JKJA 2ZRDA 3T1YB 1U0RA 2O8CA 2XZDG 2H4FA 2RBKA 4XAQA 4UZEA 3QEAZ 3PZBA 3PFCA 1TKCA 1XN4A 3SZRA 3I61A 1QAQA 2BMAA 5ESXA 5K0BA 3CX7A 3PR3A 1BC5A 4XVRA 3HR8A 5NULA 3RUIA 4WN9B 4K0KB 1JB9A 4Q0MA 3SHQA 3F90A 3VVCA 4JEUA 2VG8A 3B3FA 4KDCA 4KXYA 5JZSA 3WIVA 1KQFA 1DT3A 3INGA 3N75A 2JAWA 4IL5A 3TE7A 4ENRA 3V1KA 2FZCA 3ZOKA 2ZTHA 4RHCA 3WR5A 1HDEA 2PGDA 3WLOA 4KZ0A 4DLXA 4NU8X 5EMHA 2ISSD 2OLEA 4WLVA 1V1JA 2R00C 3IP1A 4FMCB 3HB1A 4ILGA 1UFRA 2CWDA 5DM70 1TDJA 2HRRA 3C3JA 4G1UC 4QUDA 3CINA 4LRTB 1WMSA 3V8VA 5AVRA 4BFTA 1M0TA 4REMA 4FT4A 4N3GA 3SSMA 2M1XA 1JYFA 1JG1A 2NV2B 2YWJA 2YZNA 4TLLB 1X77A 3HU3A 2AW5A 2NV6A 3AXSA 3PR1A 2WK1A 3JRWA 5T3RA 2YW2A 1MIHA 4OSPA 5LP1A 3CR8A 1XZEA 2D4HA 2QIPA 3UYLA 4GKAA 4NH0A 4FDVA 5IMSA 2CDCA 2I3AA 1IRXA 1I2BA 2Z4SA 2ZSFA 2X0RA 1C9NA 3FNFA 5DEIA 4GT1A 1ATIA 1QANA 3ISMC 4LE0A 3KJXA 4WZ6A 4B09A 2GLTA 5FOQA 4F92B 4FKBA 4GMRA 2VS1A 2ZP1A 2ZAIA 3CUYA 4F3TA 4LHYA 3OZDA 2B5OA 3A28A 4MWSA 4ALKA 4C0JA 4FFPA 4OI0A 2WI8A 3QK0A 2R5NA 4NFYA 4PPQA 4PX3A 3PC8A 3C41J 1A2KC 5ABPA 1A7KA 1PNOA 3KWJA 3UVEA 3E3OA 3RU2A 3J7TA 1SWWA 4RA9A 4HEQA 3NXSA 4HQLA 3M1AA 3DQZA 3H5OA 2Z57A 3IP6A 5CRVA 1NXVA 3JU3A 3O8CA 4ND7A 2C99A 1S9DA 3GZNB 4R01A 1EWRA 3DGEC 1VKNA 3QEMA 4ANUA 4KOEC 4TQGA 2CUZA 4BHTA 5I7EA 4HZUA 1YDWA 1MX2A 1IAQA 1DC5A 4FYPA 1QV6A 2V5AA 2Q2OA 5EILA 4RG6A 1HTWA 2JBAB 1EWTA 1UMCB 2JFOA 4HQ6A 4JBHA 2X15A 4MKZA 2P91A 4BLTA 2QG4A 4Z4GA 1N5KA 4ZO7A 3EW9A 5EKTA 4CV3A 1U0BB 4KPFC 5GJBA 3HS3A 5CT8A 3A10A 4NCHA 5P21A 4ARBA 3BCUA 3KQVA 3U7IA 1OX5A 5JPIA 4S04A 3ZWMA 1YJCA 4JJKA 5B1AE 1Z56C 2I5PO 2R8XA 2RC6A 4FYXA 2J3DA 4BSZB 1GGJA 3TOVA 3WOVA 1L5ZA 3UUXA 1BGWA 4JD5A 3HXBA 4MAFA 2PMCA 3OSUA 2J5BA 2ZR8A 3KTAB 4GTRA 3G2SA 4PIPA 2KATA 5LDDC 3GH1A 4C2TA 1CZKA 2ZT7A 1AX9A 5E6SB 1NJFA 4PLPA 3TDNA 3WGQA 3WVNA 3BKXA 2QPAA 4N4AA 4JHJA 4C7BA 4B89A 4I1SA 5JECA 1JE1A 2OD2A 3U7QB 3KKNA 5MGNA 3CHSA 1GPH1 4H6VA 4FHZA 1Y80A 1N2XA 4LYEA 1V43A 3LQKA 4OD0A 5KC8A 4RTSA 4KH1A 5F98A 1H2HA 3HYLA 2OXIA 2PT7A 5C52B 5ULLA 1V3VA 5EHXA 3S8EA 3FOZA 4G5QA 3P9KA 4BQQA 4H7XA 3AEZA 3AILA 1H8EA 4M60A 3UW1A 3K72B 4IVRA 2PGLA 1NMXA 3H99A 4AO8A 3GPBA 2FSVA 3CRRA 1ZW6A 2P4UA 3IIMA 3BBPA 4GTOA 1C9MA 5AW1A 1SCIA 4MR9A 4D3ZA 1PJ8A 1U04A 4KOAA 3EDRA 3D0OA 3DW3X 4O5AA 3V8EA 1J0XO 2HK6A 4QECA 1KRHA 2EL7A 3LJNA 4Q1CA 4WBXC 1IXZA 5EL0A 2PX2A 2BYTA 1KVRA 2WJPA 4MHSA 4R0VA 3QVGB 4U02A 1QH1A 4PC6A 4P5DA 3ESZA 1E3WA 5HFJA 4DB2A 3G0GA 2PX8A 4L5JA 5B53A 1CF2O 4KPUA 4LDJA 1JHAA 1O8CA 4G84A 4FJ1A 3TL2A 3TNFA 4CT4B 1YQUA 1B7GO 2R96A 4LE1A 1HG2A 4GH5A 3KDSE 1JDUA 1JHUA 3OCCA 1QZZA 4ILEA 4KPGA 3ZR4B 5BVGA 2BH9A 4HI9A 3U31A 3GP5A 1KMHB 1LLFA 3TVDA 3BB1A 4JVSA 1XL0A 1E58A 2QD4A 4HDAA 4IRMA 2FMTA 1U2PA 1AQJA 1EBFA 4HGOA 4WEOA 2WJ6A 4GLOA 1G2QA 5THXA 4AY4A 5KNDA 1AHNA 1UCFA 4XFDA 1EVLA 2I99A 3KTDA 3ZYQA 4Z4FA 2OV4A 4HEJA 1UBLS 3J5QB 3ADCA 2OSVA 2W93A 2X4GA 4K6CA 5U1PA 1AO3A 2G5CA 2EF1A 4B3XA 1YA8A 2WTNA 3WB2A 5I4KA 3GLRA 1I2MA 3UOAB 4AUKA 3AV0B 2G40A 3D81A 3KWFA 2GH1A 3HVEA 4UDXX 1ZNYA 4JDUA 1PJTA 3HVIA 3TWXA 3GYGA 3H1BA 3AR8A 1G2PA 2IEYA 2XRYA 3GPIA 3O4IA 5CXXA 4CKXA 1CB0A 5KI6A 5E4YA 2WJZB 4A92A 2L0IA 4C0QC 2PZAA 3ORQA 3FUTA 4M55A 3ZQKA 3I9LA 3LUBA 4B9AA 5BN4B 3ZJ5A 2R6FA 2AZTA 4CEIA 3BGVA 3T3IA 5DHQA 1C4WA 2NXNA 2REQA 2FPKA 3Q9NC 4J8SA 4EI7A 5TY0A 4FHCA 1CRPA 5JS1A 1PTKA 1FDOA 1NW9B 3F8SA 3RSQA 2W2QA 4C7VA 5KREA 5J23A 1UZLA 3C6QA 1PS8A 3KQTA 3LBFA 3LY9A 2PMWB 4DI4A 2R7MA 3FMPB 3HUFA 2AV6A 1LS6A 4MULA 4UBIA 1TMOA 2P4SA 4YP1A 4JJFA 1JCRA 1AKNA 1L7QA 1RLMA 5KTPA 5LDGA 4UNNA 4Y1RB 3KWMA 4PS1A 3L0DA 1ACJA 3QXXA 4IJWA 4DQVA 1SVOA 3A1EA 2R6DA 2P9BA 1NMQA 3NM5A 4BVGA 5EKDA 3ETCA 1BS1A 1YMQA 3OQVA 4DBVO 2DZOA 3FN4A 1OTXA 2HNKA 3IDAA 4Q6WA 3Q9UC 5AM2A 1ZAKA 3RSZA 5B4TA 3MBOA 2DCPA 1VE9A 2YASA 1H2EA 4PNHA 3RIHA 2O59A 4NMHA 2DFLA 1Y1LA 4ZWNA 3G2WA 5IVPA 3ZIMA 1OH7A 1PR9A 1RBMA 2FZGA 3ANSA 3DAPA 3EODA 4WXPA 3RREA 1NRIA 4DPMA 3RFXA 3UAGA 1EUDB 1QPBA 2IYXA 2QDXA 1P6XA 1DC2A 1OXKB 3ULYA 2EZ8A 4BUJA 2PZJA 3WLRA 4TRQA 1LDEA 3IRUA 1CZOA 3ON5A 1PG2A 2B4TO 3BDIA 1JWFA 1V7ZA 2ZRIA 3LNCA 4PXAA 4YT4A 2DWZA 1AK1A 3IHWA 4K0RA 3LWNA 5BQ5A 2LE0A 4ACLA 3GC6A 1XA0A 3NYQA 3JARA 5IHPA 4GI2A 1I4TD 1KYIA 3THWA 3JXJA 4B2IA 1ZM9A 3LZDA 1MJGA 1J0DA 1KARA 2WMYA 3B70A 5JPDA 4MS4A 5A5GA 3O1JC 3ZZUA 4BB6A 2CLMB 4F2GA 2HK9A 4BMYA 4DADA 3EIXA 4I9UA 1FTNA 2YC2C 4JXKA 1YIDA 5G4KB 4CCSA 5HF6A 3RK6A 3PEVB 3W6ZA 1TCBA 1WNTA 1U65A 5AXAA 2E1RA 1TVCA 4H27A 2ATXA 4ATGA 1Q0PA 2DWPA 4A27A 1U0SY 3QYFA 2YWEA 3ZV5A 3EUVA 2W6OA