4JZYA

Crystal structures of drosophila cryptochrome
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
534
structure length
534
Chain Sequence
ATRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWLADV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Circadian clock protein
molecule keywords Cryptochrome-1
total genus 197
structure length 534
sequence length 534
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4jzyA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4jzyA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4jzyA01
2EJCA 4PBRA 5F23A 1FYDA 1NUSA 5IJXA 5DK4A 1K4KA 2QUHA 2YY5A 4MW5A 2QUJA 4NZPA 4ZT3A 4DLPA 3SYTA 3DO8A 2QJTA 2QUKA 3KT8A 1EFPA 4DDMA 2JAXA 2QJOA 3MUEA 4PY2A 1IQRA 3RFFA 4XSVA 4MW4A 1N2GA 3FIUA 1VBMA 1Y42X 3MLAA 2X1LA 1G8GA 1NUTA 3H9BA 3NBAA 3H99A 2E89A 2A1UB 4HJXA 4EG1A 4MWEA 5J5AA 2CSXA 1UFVA 1PFWA 5DASA 4DDKA 3IVXA 1U3DA 3ND7A 2PIDA 1KKUA 2JANA 5KHAA 2QTNA 3IH5A 2PZBA 2QUIA 4MW9A 1O96B 1JZSA 3S3TA 2H2AA 5LFAA 3HV0A 3ZUGA 3TQOA 3AL0C 5KCMA 1YIDA 4BWVA 1MAUA 5HG0A 3IODA 3JXEA 2X0KA 1V8FA 1JMVA 1IHOA 2YXNA 2VTBA 3AKZA 1F7VA 1M8PA 3N2YA 3LOQA 1YI8A 1M1ZA 1T6ZA 1KH3A 1WQ4A 2I1LA 3MLBA 4EG7A 2V0CA 2AZXA 3F3MA 4JXXA 3ZIUA 3ZXSA 4KPUB 2TS1A 1JIKA 4YBRA 2ZUFA 4Q93A 2J5BA 3GLVA 1H3EA 4U8HA 2PFSA 1NYLA 3PNVA 4ZT6A 1NSYA 5H16A 1U7DA 1QU3A 1O0CA 4CDMA 5J58A 3IMCA 4Q16A 1PFUA 4ZCPA 2J4DA 1WXIA 1GLNA 4EG6A 1O0BA 3ZGZA 1OWOA 3CVVA 2PXHA 4J76A 5AHWA 3MMXA 1OWPA 3ZXIA 3L93A 1LI7A 1O96A 1H1TA 2QTMA 1G59A 1N2BA 4NAHA 4R0NA 2E21A 3P0IA 2J08A 4U63A 1D2RA 3HGMA 2C5SA 1R6TA 3MXTA 1KQOA 1XNGA 2AG6A 4YP6A 4I6GA 2J07A 1WQ3A 1B6TA 1EE1A 1PG2A 2DUMA 4MW2A 2NSYA 3SZ3A 4ARCA 3CVUA 1IFXA 3CLSD 1JILA 2G36A 3K32A 2J09A 3HL4A 4OUDB 1R6XA 1WZ2A 2WQ6A 1SURA 1NUPA 3FH0A 4EGAA 1GAXA 2AKEA 1JEDA 2CUZA 4OJMX 3SEZA 4QRDA 2JA2A 4A91A 2A1UA 4KR7A 4ZT4A 3PXUA 3HMQA 3H9CA 1O95C 3G59A 1IQ0A 4AS1A 3FY4A 2X1MA 4MQ6A 1I6MA 4ZT2A 2A1TR 2R5WA 2ZP1A 1GTSA 3CVYA 1GTRA 1XJQA 3DV2A 2DLCX 3VGJA 1I6KA 1HYBA 1ZH0A 4CT0A 2GKSA 1IH8A 1N3LA 3CR8A 2VTBB 3INNA 3CLUD 3IVGA 3QTTA 3IMEA 1TFUA 2IP1A 1N2HA 3AIIA 1OWLA 3FDXA 4I6JA 1QRUA 3H97A 3A05A 5KWVA 1Q11A 3D6UA 4EG8A 4UZFA 3TZLA 4WSOA 4OUDA 2H29A 3D6VA 1T9GR 4DDHA 1G8HA 1JIIA 3N05A 4GU5A 4MWDA 3FNRA 2A84A 2GM3A 3P52A 1O97C 1Q77A 2DPLA 3ILVA 4F4HA 3X1MA 2IELA 4TS1A 3ZJTA 1NZJA 1PG0A 3CVWA 4XFJA 3ND6A 3KT6A 4E1AA 1VBNA 2Z3VA 5H7XA 2E0IA 4S1OA 2GOYA 3CLRC 1PFYA 4NDAA 1J1UA 1N2EA 3RK1A 4MUHA 1EUYA 3A4IA 3ZJUA 1O6BA 1TYBE 4MWBA 2NZ2A 3LE8A 2CV1A 4MULA 1XNJA 4R2LA 1R6UA 3BL5A 4UZEA 2IJGX 3TNJA 4HJRA 1PFVA 2HMAA 2Z08A 2WB2A 3N8HA 1KQPA 1OWMA 1JGTA 3PNBA 3HZRA 2PG3A 4R2MA 3G5AA 1J20A 3CVXA 1YULA 3AG5A 2WQ7A 4MUNA 1EJ2A 1M8KA 2VXOA 1M8GA 5J59A 3FWKA 3L92A 3AFHA 2A1TS 1OBCA 1T9GS 1TQ8A 3FOCA 4MUEA 1Q19A 3G6KA 1MOPA 2QTRA 1EXDA 1N75A 4ZT5A 3IOEA 1H3NA 1M8FA 3CLUC 1WJGA 4EG4A 1VBKA 4K0RA 2CFOA 1GN8A 1JZQA 1WY5A 1O94C 1LI5A 1MB2A 2X3FA 4NATA 1YIAA 2QJFA 1MRZA 2CYBA 3Q12A 1LW7A 4MW1A 2D13A 3FG9A 1NUQA 4MWCA 4WNYA 3TQIA 5JBNA 2A7XA 3NV7A 1G8FA 3QTBA 3Q10A 3M5WA 4G5YA 5BNZA 1P7PA 3UK2A 1WKBA 3ISJA 2CV2A 1EUQA 1O5TA 3FI0A 4YP5A 1JHDA 4JXZA 1X6VA 2XRZA 4JFAA 3OTWA 4ZCQA 2V0GA 2DETA 1QTQA 1JECA 1WXGA 1N2IA 1O94D 3SDBA 4ARIA 1COZA 3RBAA 4EG5A 1KAMA 5HUJA 4MVCA 4MW6A 3QE4A 4AQ7A 2DXIA 3TS1A 3SZGA 4ZCSA 2XRYA 4HK4A 4RPIA 4DNXA 2A4MA 1N2OA 5TEVA 1MC1A 3CLTC 5K0SA 1TYCA 1YUMA 1A8HA 4I6EA 5TS2A 1QU2A 3FHJA 1KH2A 1WXHA 3GUZA 1K92A 1T6YA 4MLPA 1QRTA 3A04A 1OWNA 3UMVA 3U1VA 3K9WA 1KP2A 2DERA 5LM3A 3E27A 2A86A 5FO0A 2RE8A 1NUUA 4ND6A 1F9AA 4XFDA 1EFVB 1TYAE 4MUIA 4QBTA 5HUHA 4JZYA 1MBZA 2E18A 4MVWA 1NP7A 3IOBA 2YWCA 1N2JA 4MVXA 4DE5A 4KR9A 2CYCA 3COWA 5FNZA 1IRXA 5DEOA 3I05A 1N78A 1Q15A 4QREA 4KR6A 4MUKA 1ZH6A 4MUJA 1KQNA 3SP1A 2CV0A 3A2KA 1NURA 3VRHA 2D54A 3C8ZA 4MW7A 3RHSA 1NI5A 5DB4A 5FO1A 1KAQA 3UOWA 1KH1A 2Z09A 1U0BB 1J09A 2HZ7A 3CA8A 4G6ZA 4MVYA 1TEZA 2O5RA 2O8VA 3UC5A 1WOYA 1XNHA 2PZAA 2B7LA 1KP3A 2OV4A 4P2BA 4RUKA 1F7UA 4EF6A 4EG3A 2WSIA 1WXEA 3CLRD 3NBKA 1MB9A 3SEQA 3IOCA 3PNYA 1EFVA 4PBSA 2CYAA 3KT3A 1N77A 4ZT7A 1MAWA 1GPMA 3H05A 1QQTA 5EKDA 5TGTA 3KT0A 3RJZA 1IVSA 3DPIA 1DNPA 4ND7A 4JYZA 4YMIA 3P0HA 1OBHA 3P0JA 3DLAA 1GZUA 1T6XA 4CQNA 1MJHA 3IUBA 1KR2A 2BTEA 2ZUEA 1KORA 4F3RA 1ZUNA 1VL2A 1K97A 3COZA 4MAFA 3IDFA 4K03A 3UY4A 4ZCRA 2PZ8A 1QJCA 2RD2A 3CLSC 3ELBA 3OP1A 2D5BA 1M8JA 3N9IA 5IHXA 3ZJVA 4HPWA 1F4LA 1S4MA 3KFLA 4G5FA 4YP7A 4NX2A 3IMGA 2BYTA 4L2IB 1J1ZA 4EFKA 2EL7A 3AG6A 1IQUA 4NAUA 4U7JA 1TYDE 4KKVA 1O95D 1OD6A 1BS2A 5K0TA 4H3SA 4FZJA 1N1DA 3TZEA 2DEUA 4CDNA 1I2DA 1ILEA 1H3FA 3COVA 1J21A 1EFPB 3GMIA 1J70A 2HGZA 1ZJWA 4PBTA 3LCJA 3RK0A 3IVCA 4MW0A 5TEWA 1ULHA 2A88A 3IUEA 2CT8A 3CLTD 1YUNA 1RQGA 3ND5A 4KPUA 1U7XA 4GRIA 2YWBA 1JEEA 4MUGA 3VU8A 3X1JA 3X1KA 1X8XA 5LLTA 1CT9A 3COYA 1U3CA 1M83A 1O97D 2OQ2A 3FETA 4MUFA 4ZCTA 4J75A 1QRSA 1K4MA 2DR2A 3HFJA 1I6LA 1JIJA 1V47A 4L2IA 4X0EA 3Q4GA 1QNFA 1FFYA 3PRHA 1VLHA 4DJAA 1WXFA
chains in the Genus database with same CATH superfamily
3GDOA 1UEXC 4LXGA 3UMFA 1MG5A 3S8YA 4DK5A 2JI4A 4IILA 2WTBA 3THXA 3KB8A 2JG3A 3TGWA 4AP5A 3TL5A 2BZ0A 3TBHA 4DLPA 5AQ7A 1QHIA 2VTEA 1OHHA 5FTNA 4FYJA 3L9WA 3VR5H 2K7FA 1HEIA 3QI2A 5B36A 4G4JA 3OWHA 1KJ8A 5BMVB 2XMGA 4B8CB 3L7JA 5JMWA 1DL5A 1QX4A 5JXJA 1A69A 4OLJA 4F8EA 4G25A 2JH9A 2O2DA 3FWZA 4G5GA 4MW4A 4CL0A 5KNCD 4LHVA 3EVGA 4I55B 5AJTA 1M2OB 1YTLA 4O4IF 3TLJA 4DV6B 3VU3A 4MVJG 4PGFA 5JLAA 2KS6A 4BE7B 5K05A 1P91A 4WXHA 1FLDA 3NHZA 2B9VA 3E7WA 5DU2A 1VLMA 2G5TA 2LCQA 3PTZA 3KU1A 3QBEA 4BTEA 4DDKA 4UE6A 3QV2A 3DG9A 2PLRA 2O3RA 2QQ0A 3ND7A 3NM6B 2LXMA 4Q3OA 5DLQC 3IH5A 2OQVA 4FDTA 4H6VA 5TQ2A 1F14A 3B70A 1MOSA 2WYUA 5L51A 3S7FA 3I6QA 1XBTA 3ZLUA 1P2VA 4YAIA 1EFRA 4E08A 1NOJA 3IO3A 1VL5A 5A4AA 4D4IA 4BE4A 3L0CA 3IODA 2OCLA 3CRMA 2I80A 4IOJA 2YVLA 1IHOA 3AKZA 3OF2A 1JHXA 1JSCA 3GBSA 1XKQA 1NL4A 5EQJB 5BVGB 1XEWY 3Q88A 3L02A 3AM5A 1ZNYA 4POAA 4AZVA 4F12A 1JXQA 1T35A 1Z45A 2GCGA 3KVVA 5DGTA 4ZI3A 3PGKA 2JLYA 4ZRMA 2RI0A 4B6QA 4GECA 1E7MA 1QZUA 3ABME 2XRMA 2FWIA 3F3MA 3I5AA 3MRVA 1JP7A 3RR2A 3ZDEA 5BMVA 5JEEA 4LFBB 1ZJ4A 3ZH2A 4EI8A 1X8LA 2JFBA 3VOBA 3ZXSA 4PYJA 3STXA 2X1HA 3O4IA 2BFDA 2IHYA 4UQZA 1HL7A 1CTQA 2JFHA 4J1TA 4RKWA 4JIGA 3AM4A 4BKMA 4BNKA 2K7ZA 4M1QA 4ZOEA 3TKAA 3W7AA 4J1QA 4IDFA 2CUNA 2CBZA 3HP7A 3JAKB 1PGJA 4DVJA 4R7GA 1FEZA 1JUQA 3SSAA 1O0CA 1BE6A 2ZATA 1OAKA 2VH1A 4E1VA 3UT5A 3SBTB 1YB1A 4M86A 4QM7A 3MLEA 2F8LA 5ALLA 2QTBA 3ASYA 2JJMA 3MWEA 4CMGA 3U60B 1KI7A 2NVUA 2KBXA 1QP8A 1S64A 3EF1A 2WU3A 3QHAA 3ZHXA 3IUQA 2HSJA 3U39A 4B9AA 4D0RA 8ADHA 2ZRAA 2CDBA 5KPJA 4GZCA 1NKTA 3GUHA 4BVEA 3ZXUB 5PNTA 4BDSA 3DMNA 1RACA 2ESRA 1WOMA 4DCUA 5HJEA 1QIMA 2ETXA 3NX4A 3Q5MA 3DCIA 2IYVA 2XEHA 4JDPA 4LE1A 2PO7A 4Q9NA 2XT9A 3RU3A 1P75A 4OP1A 4WKBA 2SBTA 1WQ3A 1EE1A 3WG9A 4ZVPA 1RRMA 4ZQCB 3ZGQA 4TVOA 1NX6A 1TN8A 2VF7A 2WK1A 4ZTZB 2GHQA 5AKHA 3SZ3A 3R0VA 4R9NA 2YHUA 3QEJA 1KAEA 4BFUA 4BVBA 1ABFA 2ZRNA 1RLJA 1FX0A 1E4OA 3BJRA 4HDOB 1Z3YA 1Z62A 3JVUA 3H4MA 1WZ2A 3FTVA 3W5DA 4L5IA 1E1DA 4IEFB 3T35A 5D5PA 1RWKA 2E82A 4HXIA 5EEGA 3LA6A 5B2FA 4QRDA 5IMSA 4N6OA 1T3ZA 4JA9A 1EA5A 2HZBA 3SF0A 4JV5B 1CJTC 1LPOA 2A1UA 3C74A 3QIAA 2R03A 4ZO6A 2IU3A 2Z57A 3CW2A 1P0QA 4ILGA 1X7YB 2NNLD 2RKBA 4D8WA 1LS6A 4C7BA 4KBQA 5AW4A 1V5IA 5ENQD 1CIJA 3HLYA 4H77A 1D7AA 1RQLA 3G59A 3LQ4A 3WGTA 4KIWA 4B33A 2OQRA 4L8YA 1LPNA 5E7JA 3EWIA 3KYDB 1T4CB 1ZCFA 4IJWA 5HJ5A 4FFOA 1GTRA 2KLHA 5C8YF 1VCHA 4HN9A 1THGA 2I2AA 4LMPA 4Y9SA 3E7FA 3GLHA 1ZH0A 2EYUA 3GEEA 1C7RA 2XEXA 5AJHA 3RIMA 3TTTA 1Q0UA 1RM3A 2JI8A 3PU6A 2IP1A 3R6TA 1M6VA 1G42A 1OU0A 2EFEB 4B46A 5EEHA 4HAWA 4W7SA 3NNSA 1K0UA 4GP9A 2YCBA 4BLUA 2RAFA 3MCXA 3N2NA 4YT8A 5KO2A 2XUPA 3FSEA 1ZK2A 1DP4A 2BKVA 2TECE 4HX2A 2AJTA 2RK3A 2HA0A 3VA7A 4K0KB 1XMQB 3UWDA 3UPUA 5KTYA 5G3ZA 2EBUA 1LPPA 4MI1A 5A7FA 3K71B 3N05A 1MGPA 4AF7A 2M98A 3E3OA 4JSTA 4EHMA 4C7OA 1C1XA 4PSCA 2P3SA 5JCPA 3HYSA 3LD9A 1ZAKA 3K70C 1PU2A 3GXOA 4JX8A 3KXIA 1HT3A 4BO8A 2CXPA 2EBFX 2PRYA 3JASA 5LNK6 1A1SA 3OZ7A 2TMKA 3KT6A 2VQFB 1D3AA 1YQWA 2UUBB 4M49A 4JL8A 2DPMA 3GRUA 5BR8B 1N7HA 4HAYA 2UVDA 4QE3A 3H2KA 4RSGA 3IQFA 2I55A 1O08A 4QGBA 4BRZA 5AESA 2Y1KA 2PKQP 1K75A 1A7AA 4FJ2A 4HB5A 2WUFA 3JWHA 1OTHA 2C2YA 1Y4ZA 4XGQA 3U7HB 1VIDA 3D9JA 3ADPA 3ZHBA 2GO7A 3S68A 4PIPA 4A0SA 3I9NA 4LHYA 3LK6A 3AEQB 1R6UA 3ED1A 1IPHA 3H2YA 3HPQA 3MD9A 4MLZA 3ZWDA 3P7MA 2QVLA 3VLEA 1XZQA 1UP6A 3PL5A 1TUEA 3V97A 5J9FA 5IG2A 4KUHA 1EX7A 1YQEA 1F0KA 5ITZA 2AEEA 5BW6B 2DY1A 4DADA 3H9JA 4QDJA 3N0RA 4FMPA 4C9BB 2WZBA 3LOPA 4U2CA 4LPSA 2C57A 1H22A 3R9IA 2MINA 4RJTA 4EQ6A 4I9GA 3NXSA 3LYAA 1EDZA 4EP1A 1QIDA 2UV8A 1XKXA 3GJ6A 4QYXA 2Q21A 3DDNA 3ICPA 1FDOA 1HLDA 2X8BA 3A9VA 3CNQS 1LS1A 3BCUA 3PQ3A 4H1TA 4JI8B 1GRNA 4D8UA 3ESXA 3OPMA 3ZK8A 1OFHA 1TAQA 5AHRA 1OI3A 2G6TA 5JCJA 3AUFA 3WNZA 3HHMA 2QE6A 1POXA 4KQEA 3BAZA 3JD0A 4RCYA 1QKIA 3KAJA 3KVNA 1F17A 4N0MA 4R2WA 3FDHA 1HZZC 4PAQA 2Z8YA 4QICA 3TL6A 4Z1OA 3ACDA 3ZYQA 3CLUC 3PXEA 4ND5A 2P2CP 1U9IA 2XUDA 3K3PA 4IFIA 1BJTA 4X41A 4LYGA 4ML3A 4TTSA 2XXAA 1FCHA 4B0ZA 3QVTA 4BEVA 2AW6A 2PZEA 5IP5A 2YC2C 3OQJA 1EBUA 2PT6A 4U8YD 1YIAA 3RC2A 5H3LA 1T2CA 2CYBA 2QSJA 2YJNA 3KK0A 3GXBA 2VATA 3B9PA 4MB0A 4TSRA 4F93B 4JOBA 4KNYA 2LBPA 3KQUA 5C3UA 2D13A 2XR1A 3OZAA 1DUIA 1HDXA 3GEGA 3FG9A 3UXHA 1VLJA 2JVIA 2Z04A 2E9SA 4TRJA 2O5EA 4LRZA 2OHVA 2FPGB 4QBFA 3L8FA 5HKBA 3IO5A 5JBNA 4S1NA 4BXOA 2H1OA 4GDFA 3OQVA 4L27A 1TL7C 3ER9A 1SC9A 2AR0A 2CUKA 2PHZA 5FOUA 1KJIA 1U0NA 2WHXA 4FJZA 2OILA 3F6SA 4YP5A 2XUAA 3FP3A 1KPSB 4CHGA 4ER0A 2D5IA 3LFTA 4R16A 2Y67A 2VO1A 4JKYA 3VNUA 3FROA 5T5QA 4E03A 1TJYA 3RS5A 4LUCA 2W93A 2P0AA 2I7VA 3K0SA 5JWRA 3FUUA 3SVZA 5HUJA 3T4UA 2WW8A 3U7QB 4QTYA 4QOEA 3N8GA 2AXNA 3A1TA 1YZKA 4PLYA 2NZXA 4CUJA 4DIOA 2VH2A 4JBGA 3CXRA 1A4XA 3IDAA 3OWOA 3PS9A 3VPGA 3U64A 2MSWA 2D6FA 1J9EA 1RKXA 1RXUA 2QHXA 4AI6A 1K86A 2A4MA 3CWCA 1UFKA 4U8GA 1G3NB 3IVMA 4JI6B 1AKQA 3MJVA 2YINA 5CBPB 1BXKA 4F38A 1VGVA 5H4HA 3GFSA 5FLEX 4KFUA 1YZHA 2J0VA 4L0CA 4CKBB 3SJAA 1U99A 2VJKA 1QU2A 4A36A 2BT4A 2Q6LA 2JIDA 2AVPA 4M21A 2OCGA 4WZ6A 4FEGA 2CGEA 4KWTA 3BAFA 2RC5A 3P2JA 1YBHA 2RGDA 3ILYA 3DVAA 2WD7A 5H4GA 3DGEC 2A0XA 3UJBA 2NACA 5K6TA 2HCTA 1GIAA 3O2SB 1FS4A 2XVMA 3FNBA 1PX2A 2AJCA 1E9FA 3O8RA 4LJ6A 4BETA 1NX9A 4YGYA 3WC4A 4DV3B 1MBZA 2E18A 5DBOA 4B3GA 4FN4A 2E1PA 4CM7A 4C7XA 1JDSA 1UAAA 3K1AA 2B7BA 3MTAA 3LF1A 3KPUA 1WLSA 4QUBA 3DL4A 5CCDA 5JJIA 4L9PA 5AVWA 4EMBA 4LKOA 1H5NA 2Z2IA 2HFJA 2NSJA 5TPZD 1UL1X 3BS4A 2POCA 4HCJA 4L95C 3DPYA 2A92A 4IYRA 2PUDA 4D4MA 2IXGA 5I7VA 2TYSB 1W34A 2WAMA 4E4YA 4IZOA 1M0SA 4S3MA 3AVUA 4MW7A 5AR1A 2V8SE 4YUYA 3LC2O 4HADA 3UUFA 1NI5A 3OLXA 3FR8A 1A3CA 2AOTB 3GUCA 4HQOA 4TKVB 4JR0A 4WCVA 5FQ7A 1Y1PA 3GJZA 1F0NA 4KNWA 2MOKA 3MOIA 5CYPA 1SXJA 2GS9A 1HNWB 2O8VA 3OEEA 2Y99A 1WXWA 1CNEA 3DDOA 4AF8A 4TMYA 1NNI1 1CUEA 2P62A 3NEPX 2CXTA 3B5JA 5TQ0B 2FYTA 3FLMA 4X3CA 3BTSA 1NHGA 3OSZA 2OHOA 4EG3A 1VLQA 4F5DA 1ZNWA 1ODCA 1P45A 2QW1A 3U7IA 3ZC3A 3UT4A 2QMEA 5EIDA 2BBOA 3UJHA 5EZQA 1TYQG 1WTCA 3CVPA 3AKEA 4BNYA 4K5CA 1BGVA 4X1KA 2WY2D 1F1BA 1UWVA 3QMMA 3EXHA 3R8XA 1Y4SA 3TJPA 1W49A 1KPIA 1COWD 1YB6A 4HD8A 1XMPA 4LQLA 4RD3A 4RA9A 4TKUB 4RY0A 4ETMA 2Z83A 2GARA 4NZYA 3ZHTA 3P4UA 5JE8A 4ZDWA 2OGSA 4EB6A 4ZK6A 3SXUA 2Y2UA 1NQTA 1W0JD 9ATCA 3Q5GA 4PPGA 3DLAA 2ONZA 3AL3A 2E49A 2V6MA 2GF9A 1SU6A 2Z3WA 2Y68A 5KWDA 3OZEA 4YV2A 4JLAA 3QVKA 3PRKE 3GLUA 4D4LA 2PMBA 5JAUA 2IVZA 1XU7A 3L9XA 3ZLJA 4U2BA 1B43A 1YSCA 2F3PA 2OTCA 4FDVA 1CUXA 2BEVA 4M37A 5ALKA 4ADSG 4F3RA 3D0QA 4KQWA 1BMTA 3LPNA 5DP1A 5LXTF 1UPXA 2NUTA 4EARA 2GYYA 3DTVB 4R0MA 5H9WA 5ELXA 1Y7TA 5DULA 1D1SA 5JXIA 1SB9A 1K97A 4G0XA 2H59A 4LV8B 4PZ9A 4JVSA 3QK7A 3CVJA 4M0UA 4WPGA 4DIMA 2WR8A 5BT9A 3G82C 2FU5C 4JROA 2ZE7A 4XIIA 5FI1B 1VE5A 2O19A 1YR6A 5TQ0A 2ZWVA 3DDWA 4UFNA 3N0WA 3KJFA 2OO7A 3HEBA 1TKRA 4MYHA 4UHJA 3SMVA 3VKVA 4AAYA 5C35A 5IHXA 1Y5RA 3VYTB 2IYYA 4JXKA 3DBVO 2PQ0A 4IV8A 1E3QA 4PTYA 4CMIB 3OZGA 1HH8A 1C0PA 3RVDA 5KQMA 3EXHB 3AWDA 3AHJA 1KR5A 2I7CA 2YVAA 4J0DA 1M76A 5E1OA 5JSQA 1DCFA 2NUPB 3EDMA 3NEJA 2EQXA 4DC9A 4YUXA 4JB3A 1Q74A 2WAAA 3FTCA 3GA0A 1LQUA 4RJIA 3NASA 5HQ3B 3PQCA 1BS2A 1GXSB 3KTDA 4GXTA 4ZFNA 4FZJA 5CNJA 2XJ9A 4JCOA 4LRYA 1L4GA 1QHGA 3QELB 4BECA 3WS7A 3PVSA 2W5UA 3QFCA 1H3FA 2B82A 5LZ8A 2G1PA 1JE0A 4NENB 4EHLA 1L5QA 4ITUA 4YMUA 2V6GA 4NOJA 2M63A 4NCJA 4PIMA 1HDGO 2VSOE 4PBTA 7REQB 5G1OA 3ZWPA 3SZMA 1G9XA 4L4ZA 4KSBA 2CT8A 4JITA 3CS3A 3HUTA 3EK2A 1FUIA 3C2QA 5E95A 2EIKE 2AXVA 2PL2A 1S2GA 1QTIA 1JHVA 3T3MB 1OXSC 1PR0A 1U7XA 3IEIA 3LW8A 3Q6IA 3Q8XB 4GRIA 5CLIA 4ZA2A 3C7AA 3J81A 3SEAA 1GKLA 2NZVG 2P3LA 4Y6PA 5DO9A 1RNLA 3TM5A 2WBLC 2ZROA 5AW9A 3EIQA 4DDWA 2VHJA 1KP9A 1ZUHA 2QJRA 3QE0A 5KTKA 1FXUA 2FJPA 2F0YA 3HHEA 4O3MA 1J25A 3Q3HA 3NOXA 4PC2A 2XMBA 4KBFA 5AKKA 1G4AE 1SBQA 2HBRA 5FWYB 3D3NA 4X65B 1OLXB 5B4TA 3MQFA 1NG1A 5JS1A 3AEZA 1H05A 1YKSA 3I2JA 4IJVA 2DR2A 2O54A 1X80B 3ZU6A 5JYCA 2EJVA 1C4KA 2IK8A 2ZI9A 4YP0A 3R5KA 4CLHA 2OBFA 5C1IA 2ECQA 1S8NA 3HDXA 5SYMA 3EVFA 3WYAA 2YCLA 2ET6A 3D1VA 3KT8A 1AZLA 1ZN2A 4AMBA 4DDMA 1UBSB 1YTUA 3FUMA 4KQMA 2UVPB 4FD2A 3U3RA 1HT0A 3VVBA 1IM5A 1GGJA 2V5UA 3OX3A 1LD8A 3QWVA 1GY8A 4G01B 3HCOA 1YL7A 4I14A 1E1RA 1VJ0A 2DWPA 2G71A 3QELA 1CX9B 3RT1A 3ADKA 4E12A 3KQWA 3BXXA 4XM1A 4AX8A 5BWOA 4BFCA 4HTFB 4LRXA 1RI4A 3TLCA 1BSVA 3HGQA 3MWDB 4IJ6A 4F5ZA 1MJ0A 5BUCA 7REQA 5G4LA 3G0OA 3T54A 2A9VA 2X4IA 5FP0A 2OCPA 4F11A 3DMFA 3U4MA 1NW4A 3AFNA 3G2LA 2BEJA 4Q03A 4R71A 4US2R 4I81A 4TUMA 1IWPB 4HVBA 1SZJG 2JASA 4FYIA 3W6OA 1RRFA 2Q6IA 4DNQA 4GKBA 4F6LA 1CB7A 4U2GA 4MTCA 3HACA 2FKAA 1YGPA 1FFCA 4LE2A 2QTCA 5DM0A 2PZBA 2XUQA 4E5VA 2PGDA 5HVNA 1E2PA 1QQ5A 1Z3CA 1NI1A 2Y1WA 3G13A 3KYDA 3MG9A 1QHHB 2C82A 4LZZA 4BAZA 1ST2A 2I2DA 2IIQA 1SVMA 3LHSA 1XCPA 3DAOA 4AQYB 4G24A 5EKQD 3AK4A 2X6RA 2FV8A 3U9LA 2OMEA 3CSTA 3UENA 3RT9A 4AJ9A 3G5LA 4YUAA 3FSGD 5JNLA 4WNGA 3IAUA 3JQ7A 3PFFA 2QSYA 4LVOA 4RC9A 5COQA 5C4GB 3TI9A 3TM4A 4BV3A 3ML8A 4BY6A 5DXFA 3NEAA 1S9HA 3FOAA 1L7RA 5FAXA 2C2KA 5DTEA 5G3YA 4F1JA 2UXCB 1KH3A 4XTRA 2ISQA 3AHDA 3C8HA 3IMFA 3IKVA 1R6AA 5TVGA 2H8KA 1SRQA 4KRXA 2Y0BG 1PR2A 3F1LA 2XYVA 4Z0HO 2V4MA 4QQFA 1JEAA 4S2UA 2DTEA 4LFAB 1Y9AA 3KQYA 3CPEA 1N34B 1YDHA 3OESA 4OM7A 2X6QA 1EDOA 4JBXA 4HLNA 5JY6A 1ABBA 2QGFA 2ZXWE 3G68A 3RKSA 4TMZA 1FXSA 3PQ8A 3JCKC 3BE4A 3P2BA 4MQEB 5CCBA 2H85A 1F2UA 4HN2A 4YFVA 1L4KA 1SEVA 1EFUA 2ZYVX 4AY3A 3TNFA 1UZMA 2GEJA 3G88A 4KQFA 1LZLA 4GPAA 4N3BA 4B3DA 4EG6A 2D4HA 5C81A 4TLCA 4BO1A 1OWOA 2J3DA 1BH2A 3PPWA 4XLTA 1DX6A 2GBFA 3RS0A 2JL1A 2YN0A 3V8BA 1W4RA 5LXTB 4EZLA 3BU8A 1ZH8A 3VC1A 4YDYA 1T5OA 2A59A 2CVZA 4MYDA 1W29A 5IAOA 2ZBDA 2G40A 4GMKA 1V5GA 1P1BA 1VLZA 4D2IA 1CEEA 3L16A 4EUSA 1M6NA 4N7BA 5BSRA 3UATA 3FLBA 4JQZA 3NAGA 2ZJ7A 1A71A 1DC7A 2RHCA 3A26A 4MCAA 4L22A 4TSKA 5U1PA 3VUFA 3SS9X 1KWGA 3JUEA 3KOXA 5FZRA 1FNBA 1HFJA 3CUVA 1FFGA 3GA7A 3LHKA 2ZVPX 3LC1O 1TJPB 4MV1A 4NHOA 5DVZA 1VMIA 3SICE 3TOXA 4QATA 4A5SA 4F1WA 3QIVA 2D7DA 3KYCB 1VCIA 3I73A 3H8WA 3PWKA 4HGNA 3FDZA 4FHJA 1UM9A 4IX9A 3VPAA 4WD3A 1Z5UA 3HVUA 2J5QA 3N2GB 2WQ6A 4PYQA 4CR7A 1GDHA 5A5GA 5EUCA 4DA6A 5KTSA 1LDMA 3U19A 4NZOA 4GL2A 4Z4QA 5KTOA 1LZKA 5KOHB 4MQEA 3A2NA 4HGPA 2WV9A 4PTLA 4I1AA 1JJAA 4DI4A 4ND2A 4YJ2A 4EO7A 5KTRA 2HIGA 3ZEFA 1UKEA 3KCQA 4PRZA 4WZBA 3N39C 4QGHA 3PJRA 3B2QA 3ZTTA 5JTTA 3KOUA 2H9IA 4BPRA 3PNKA 1NVTA 2ZBQA 3IKTA 3RC8A 5GWXA 2HR2A 1LF5A 2QVYX 3KX2A 4REMA 2BTQA 3BFPA 3LT2A 4RD1A 3MUNA 2CHXA 3RIEA 5IVHA 4HLUC 1RHKA 3O1HB 2XNDA 3ER6A 3C3AA 1IH8A 4IV5A 5C5CA 3INNA 2QXUA 4KO2S 2QZZA 1IVYA 2J67A 5D66A 1TFUA 1BU8A 1Z25A 1E6MA 1UKCA 1A97A 4J94A 1U31A 4MKFA 4RL4A 5H0IA 1U94A 4N5MA 1VFNA 3TE7A 4V3CA 1IMOA 2VJDA 4DCPA 1SUAA 3EZGA 5EIXA 2QM0A 3OMWA 3ZVRA 1KGDA 3RV3A 4F56A 1NBWB 2QORA 1C0KA 2GRNB 1RTTA 2O7QA 2NO9A 4Q21A 3UW3A 5CA1A 2EZ9A 3HADA 3H97A 3NH6A 3EVCA 2GZSA 1KHHA 1C0IA 1EJ0A 2GRMA 4IOMA 1P4SA 2EFYA 4WSOA 5TF4A 4LNUB 5LX8A 3SQOA 1UDBA 3KEQA 3ZHEB 4BZWA 2XGSA 4I8XA 4JLOA 3N2GA 5DBFA 4JI0B 1ID8A 3ILVA 4RJJA 2HQ1A 1O3YA 2JC3A 3EEBA 4FGUA 1BXRB 2VCEA 2SKEA 3QWIA 5FWAA 4G4GA 1G4UR 1ZIOA 4QBIA 3W6PA 4EECA 1NZJA 1O54A 4DA9A 3UAXA 5EA2A 4Q3AA 3CVWA 4RTNA 2QRVA 4YXFA 5C7IO 4DR6B 3FWPA 4H7XA 3Q7AA 1QE3A 1Y6RA 2JFNA 1JB1A 3KJQA 4HPJB 3SX0A 4LZOA 4UE2A 1RR6A 3WDMA 1GUYA 1D4ZA 1U3GA 3KJXA 5E6SB 2BF7A 2B34A 2WU8A 5FLYA 4AXBA 5LCWJ 5BQ5A 3RRJA 1I4TD 2ZAMA 1U2QA 4HL6A 5B58T 2ZVQX 2HXYA 3T12A 1HU3A 1XD2A 3GEBA 4E2WA 2XCQA 4E11A 3SHFA 2VQ2A 5MGBA 2M6SA 2A7QA 4BMVA 3T61A 3ZZ0A 1GAEO 3QSYA 1IHUA 2JDIA 4IJ5A 3QUCA 2CBXA 3X2EA 1FMCA 4EEKA 2PE5A 2H1IA 4O2BB 2WAXA 1ELWA 2N3ZA 4WKOA 3AR9A 5EQDA 1JZTA 3K70D 4FHKA 1LNSA 2N1MA 3BXEA 5BR1A 3TAUA 4H7KA 3EOBI 3PNBA 4OLFA 1L9KA 3WYDA 1OFVA 4CRWA 2JFWA 3V7NA 1H4VB 1UG3A 1MA3A 2H4HA 2X41A 2FZWA 2RJNA 4LOHA 1RXIA 3UHAA 4BB0A 4UDOA 1RT9A 1P17A 2FGKA 3D3KA 4S1PA 1Z06A 2Q0XA 1YQDA 3GQVA 4C78A 1UPFA 1VP3A 2PZMA 2Y69E 1E7SA 1T29A 2Q1TA 3HP1A 2PT9A 1CDEA 3IP8A 4Y1RB 5KYUA 3IBEA 3M4ZA 4U7GA 1IRIA 1XNRB 2V8BA 2ZTMA 2GGSA 2R6R1 2R7AA 4WRRA 1W73A 3QWBA 2UXDB 1N9AA 5JA4D 1YRWA 3FOCA 1XZ8A 1XL1A 4GFDA 4X5OA 4DBVO 1DB3A 1NF3A 1SHJA 2G17A 4XSGA 4XX0B 1PY1A 4BQPA 5AUOB 2D3TA 3AB8A 4V1CI 3LJNA 1WB6A 1WG8A 5DZSA 3KIPA 6REQB 1W93A 3KVYA 4NS1A 1EVIA 3L07A 4QIHA 2YN2A 1SKBA 4YVFA 3I6YA 2FQ1A 5JS6A 4AOFA 2CD9A 3AEKA 3A25A 3NB2A 3RAPR 2XMCA 1B2LA 3T9KA 1KQ3A 4XR4A 4AEZC 1YBMA 1WAO1 3U40A 3VTZA 1WY5A 2XGJA 2GPSA 1MB2A 3B1YA 1FFWA 3IPRA 3L0OA 1EXWA 2C4HA 2ZLBA 3CZRA 4MTLA 2C58A 1Q7BA 1E7UA 4DLLA 5CEEA 1P1HA 2B4RO 2ZUUA 1XQXA 4KQKA 4LTMA 4ZAVA 5KYTA 1OUVA 4OVVA 2YJZA 3MINA 4NPAA 1NTRA 1SBIA 4X95A 4ILKA 4PX9A 2R8BA 1XMVA 2QSZA 4GC9A 4B3RB 4DRYA 1IM8A 1J56A 3KKOA 1EB9A 3VR4H 3RANA 3ZW8A 3RE1A 3SQVA 4RPKA 4D3YA 2D0DA 3M8KA 2XYHA 1IBLB 3GVIA 4ZHBA 3KJEA 1WVIA 4UEOA 2OUKA 3ZY5A 1L5OA 2COEA 3C1OA 1P7PA 2VFAA 1DKQA 5B3JC 5LMCA 4B2LA 1S2MA 5KYUB 3FTUA 3GFRA 3CKBA 1E2UA 1XZCA 4RY9A 5HRAA 5IULC 2BGUA 4UTOA 4BZQA 2X2EA 1V96A 2FUG6 5LKRA 3O31A 4EIWA 3R3YA 4DUGA 5LB2A 2H6EA 3QE3A 1A27A 3U49A 1CE8B 2R85A 3E3LA 2DBRA 2DPXA 1J0XO 3ZRHA 5FINA 1DLJA 4OF4A 4Z99A 1OAAA 1RQXA 4NBTA 4BO9A 2OFXA 1ECCA 3VHXB 2WXQA 3KOWA 3U3KA 3ZD6A 4M3NA 4EPVA 1L6RA 2C59A 4HK4A 3I2KA 4I50F 5CVUA 3AUAA 1PTKA 3GOHA 2GSWA 5DTRA 3ZD7A 1H2AS 5TMPA 1DAPA 3L0SA 4RHXA 1OASA 2VYVD 1I0ZA 3NBQA 3MYYA 3OTHA 3PX3A 4XFKA 1M74A 1B73A 2EWVA 3CNNA 2VJYA 3KL4A 5KYVA 4H1WA 3C6YA 2O8CA 1WU7A 4UBOA 1GEEA 2QVZX 2FH5B 1SJ9A 2V45A 3OJLA 2GCOB 4UFOA 5FULA 1ZC3A 2HW8A 1L5SA 1UBMS 3KSAC 3HJFA 3ZWMA 1X2BA 4DTCA 3H87A 3TNLA 4BFXA 1ZCAA 3OIYA 3IVRA 2X5XA 4PC1A 1A2OA 5JPIA 1MORA 1NJ5A 1GYRA 2OWDA 1RXWA 2HR1A 2Q3BA 4MS4B 4LJ5A 5AKGA 4U7TB 2ZWOA 1DIRA 2F1HA 2M1ZA 3B3JA 4Q82A 5H59A 2A9JA 1ML4A 5IH3A 3ZE6A 4R7LA 5CGQB 5CNMA 1KDVA 2BH2A 5FUMA 3TF5A 3SFZA 4K6FA 4JUFA 2D2FA 2XT6A 1YS1X 4JLBA 3IXLA 2NTJA 1HTTA 3TRKA 3QJZA 3NTLA 1XAIA 4QQIA 3N2IA 3IJ5A 5E4TA 4BZXA 1FSZA 2HCJB 4R81A 2CYCA 5ALYA 5LOVB 2HJRA 4HAZA 1ONOA 4FNAA 5CEFA 3KXDA 2ZM6B 1XUOA 2IEAA 4Q69A 3HUEA 4HVAA 1XMIA 3BORA 2BJHA 3C0KA 1ECLA 2QTTA 2XSZD 4MPDA 1T8TA 2PS3A 2VZ8A 4J0IA 2C7GA 3I9JA 1RPJA 4PO9A 1Z5NA 1EUDA 1JKJA 1CFJA 3JQGB 3JRNA 4K86A 1BKDR 2A30A 3VHXA 5JH7A 1Z08A 1ZSVA 1RCUA 2R47A 4LRQA 5TMEA 3T7DA 2XAAA 3NIDB 5JQGB 4C2TA 3D9PA 1JN0A 2XGGA 1GQQA 4MKIA 4QOIA 1UM8A 4AKSA 5EHXA 3R7DA 2HZ7A 1PZMA 2WJAA 5G2OA 4N6GA 1KDTA 4OOEA 1LNZA 1P80A 3FZNA 4NZNA 2AFIB 3IAFA 3X0DA 4DLSA 2CHFA 4CFZA 3PEEA 5A4KA 4HBZA 2NZJA 3FF4A 1REQA 4EZKA 1X1CA 3IA2A 1C9KA 1MRNA 3O73A 3DSVA 3E4CA 2R25B 3OU6A 1Y81A 3P9QA 2JVJA 4KJXA 4WNAA 4EKGA 4DRXB 4UM9B 1J8YF 2Y9MB 1G9SA 2PQ6A 1OLXA 2UZ1B 3DMTA 3NKVA 4GB9A 2OCKA 1T2EA 4LVNA 1UINA 1PX0A 1X80A 3KVRA 2AMJA 3F8WA 4UUOA 1HFKA 2B4YA 2YW2A 1AS0A 3SAJA 1CJMA 5LOVA 2H4JA 1QYRA 3HL0A 3LP5A 3QDNA 4PG8A 5KTTA 3L6RA 4U7HA 2RCYA 4LV5B 3TIVA 2OC9A 3PV0A 1GA6A 3W77A 2FI1A 4JJ8A 4A26A 1ECGA 1YC5A 4A8HA 3ZCUA 3S27A 3VZPA 1OLOA 1YB5A 5BWLA 5J4VA 3TWQA 1P2FA 1Q14A 4RQUA 4E21A 3JAMA 1R0SA 1AS3A 3MMZA 3AKYA 1KFJB 4N2SA 4FC7A 2F7SA 4Q18A 5A03A 1YBVA 3ZXXA 5E2IA 2DX7A 3D3JA 5EHNA 1I3CA 3E70C 3EASA 2P6OA 1DGQA 3EBOA 1ND5A 3A32A 4N82A 3IDFA 1Z5WA 1KT0A 5CXSA 3I0MA 4HH3C 5IC4A 5T6MA 4QNNA 5C4IA 1SKYE 4FYVA 2D5BA 4KUGA 1C8KA 3KG2A 2DUUA 1GPLA 5KJFA 1TVKA 3GH3A 1XPUA 5CDYA 5BSTA 1OKKA 3ZPJA 3UTMA 2O2GA 2EU8A 4KZCA 1TRKA 2B92A 3EF0A 3F96A 3KFLA 3PQ5A 2A0FA 3OH8A 3AUYA 2ZWPA 3CWQA 1XTQA 3KSUA 2YHIB 5JAQA 4E88A 5CECB 1B1AA 3E9YA 1TIPA 2CDAA 4JLJA 4WEOA 2EEPA 2EL7A 5GGXA 2B6CA 4N18A 4XQ9A 2YNQA 1MCZA 3JWGA 3H3FA 5EIFA 2VSXA 5GONF 3UB2A 4CL3A 4ZMBA 1V35A 5AH0A 4XRGA 1OD6A 3NB0A 3EH1A 5TDHA 4UQOA 3G7NA 1SY7A 2BGGA 3ONFA 2ZR9A 2DZDA 4I9UA 1QH8A 2FQYA 3OFJA 3PUYA 1DBWA 1XQYA 2FPSA 2O6LA 2OLJA 3C3DA 3KKEA 1F3LA 2IHBA 3ZLVA 5ALWA 3NIGB 1XP5A 2B83A 3P97A 3RRNB 2P75A 3UMGA 3HDVA 1XZMA 4BNUA 1SHKA 3O7MA 4L5AA 3FUKA 2EVWX 2OCAA 2VEOA 3CEPB 1RQ7A 1WRBA 3VAAA 5C8YB 2IDJA 1E1RD 3HE3A 4JUCA 4J4BA 2VAWA 3C24A 3SBEA 1KY3A 1UZLA 4AMUA 4N03A 4FX5A 4H17A 1DU4A 1G8PA 2ETCA 2BFDB 4U7PB 2G76A 3W1WA 2JIPA 5L53A 3VPHA 2BDEA 5LU8A 2BSQA 3DCNA 5KNCH 1JKXA 1U0LA 2ASEA 3OPYI 4GMFA 4B35A 4YCLA 1E92A 2FSPA 2Y05A 3P5BA 3UIOC 2ODWA 3PLRA 2FB9A 1SVLA 1DMRA 2KBFA 3JV7A 5TXGA 5F52A 4X44A 4NLLA 1IY8A 1PJAA 1SN7A 1UXJA 5D8DA 5ECYA 2ZWIA 3VISA 1O97D 4ESOA 4ZOLB 1FLAA 4IIUA 4XLLA 2PMWB 3V8EA 3TSWA 2BP7B 4XH9B 1Q21A 4DLXA 3JWEA 2FRDA 1UKYA 5HMLA 3U3OA 4HRXA 3SO8A 1E99A 5JRJA 3OPYB 1RXYA 4HC4A 2C4NA 2YXLA 3ZWQA 2AJ8A 2O52A 1UMBB 2WXOA 1ELOA 3CZMA 3E7DA 5ELMA 4AP9A 3GLIE 2P6RA 2R2AA 2NYVA 3H4TA 4TUYA 3FH5A 1YK1A 5E7QA 2H6GA 3FNFA 3JXJA 3HEAA 5DSXA 5C34B 4Y2JA 3KB6A 3FSGA 2RG1A 2ZGDA 1VPTA 3M33A 3QY9A 4ZYLA 3L77A 5F1YA 1C4WA 3D6HA 5HKKD 3H1PA 5EMLA 2AQKA 1KFEB 1Y5LA 4B4KA 3DAYA 1RRGA 1E2IA 4BQQA 4IH4A 1L7OA 4EA7A 2W6JA 1XQ1A 2A57A 1E1NA 2A0KA 1AU9A 4GR5A 1ADFA 3R7AA 4B6JA 1QG6A 5EWJA 4L8GA 4NHEA 3U4CA 4M76B 3LC7O 3LS2A 4IKPA 4TQAA 3ZS9A 4FEAA 4EG1A 2A1UB 2NN3C 3OECA 1GPDG 4K6KA 2GERA 3UK1A 2PH1A 2QMQA 3AU9A 1UFVA 2PFKA 5L8VA 3L79A 1E94E 4DS3A 2QGNA 4IXMA 1RYEA 4BQSA 2YV5A 3OO1A 3QXJA 2I3DA 2WDZA 4YWJA 1K3ZD 2IFTA 1P19A 2IXBA 3DOOA 5F5XA 1BQ4A 3PFCA 4FX2A 1CY8A 2ZM5A 5BOSB 2EFJA 1VSQA 1ZOSA 2H7VA 3S1AA 1QYMA 2BTQB 4Z86A 2YIMA 4B0PA 2MTBA 1EINA 1PJBA 1TXGA 4BNTA 5K0EA 1PT7A 2A4ZA 5D87A 2J3EA 3FTFA 3GJSA 5LP6B 4UJ5A 5GIPE 3KHKA 1DKUA 1T1RA 4YJHA 2BLLA 3CUEF 1XXHB 2C03A 4MJXA 3UXYA 3U1BA 1F7UA 4J49A 2FUEA 1HTBA 1QNLA 2FHSA 2WUEA 4F71A 1K27A 3OJCA 1I7SB 1QK3A 5DCLA 1X7XB 2AZXA 4C30A 1FPMA 3UKJA 5B1BE 1D6SA 3WLJA 4CI0B 4ZZ0A 1DXYA 4XCXA 3WXXA 4HOUA 4CKEB 1O8BA 2FQXA 3LWNA 2P5YA 3GZ2A 3COPA 1SXQA 5JDCC 2OR3A 4UDXX 3QF4A 3Q7IA 2ODAA 1U3VA 2XUHA 2Y4NA 1IIBA 2NSLA 4M8SA 2WEKA 4QXQA 5IJAA 1DOZA 1U0HC 5CA0A 2V65A 2H16A 3BL8A 3PNVA 1TW3A 4OYYA 3JZMA 4PC7A 1L9XA 1CR1A 4GTSA 2PAFA 4Q16A 3B3GA 1X1QA 1ISMA 4TV9F 1OGJA 3PQEA 5C1OA 2FEOA 4JR1A 1J0BA 1M7GA 4IZHA 4IR7A 2FEMA 2O20A 1WSAA 2RONA 4MCHA 2JNWA 2O2IA 1KZ4A 3GVCA 3F5FA 3OUZA 4B7UA 1SCQA 3T7CA 1SKQA 4OHYA 1R8SA 1GNSA 4DA8A 3BCHA 2E6KA 3D5QA 3LP8A 4FFWA 2BOVA 1CW2B 4XQEA 4LSZE 4U63A 1FTSA 5JS2A 2EZ4A 3QFRA 4XVHA 2YMMA 1O9BA 2AJAA 1G20E 2VHXA 4PZCA 4GBMA 3V8VA 4L7VA 1DKNA 1W1UA 1AN0A 1XZJA 2FZ5A 4J6EA 5KSYA 3SNKA 2WVJA 5TS3A 2OVFA 4UU1A 1E6CA 1M72A 3Q0EA 5CVVA 4G8KA 2JS7A 3OTNA 4K9RA 4HGOA 4PNHA 3RC1A 3RJMA 3K9FC 2PL9A 4ZEWA 1YYHA 1D0IA 1XTRA 4GQAA 5JJTA 1IFXA 3RRBA 3WY9A 2CJXA 2HLHA 1HYGA 3EVBA 1SXGA 5IAEA 3O4ZA 4UWFA 2IH4A 1C7JA 3WJAA 3LDFA 4Q7LA 3IQIX 4HX5A 3BWVA 1NUPA 3F6PA 3KKLA 1U3WA 1VPVA 3VYWA 3DLCA 1F5SA 3JZIA 4H7HA 5ARDA 1SQ0A 2HI0A 2VHCA 4OLBA 2ENWA 2OAGA 4Y1RA 4ETNA 1GN9A 1N6NA 2RGUA 2VKTA 1BRMA 4FE4A 4P22A 5DSZA 1IBSA 1UT6A 5JTUA 1Z8DA 4DSAA 1TN7A 3A7EA 3G2HA 3CF0A 1D8AA 1NNUA 1FMJA 2C99A 1TF7A 4HYYA 3KXKA 4MMXB 2Y71A 4UXIA 5KC8A 6REQA 4NJOA 4LCTA 1Z15A 2CVOA 2FPIA 2H92A 4A3TA 1G7TA 2RHGB 4NPHA 5F9MA 2OLEA 5IDYA 3ZGXA 3LKUA 2DQKA 1ZNQO 3WOVA 3ZCVA 1YRLA 1YQUA 3EGCA 3HGTA 1Z2OX 1N5JA 4KW7A 3L22A 1H0KA 1E3DA 4W63A 1LY1A 3PPVA 4OTZA 5KYWA 2VXYA 5E75A 5LJLA 5E4YA 2A5YB 3MQ2A 3IEUA 1Y63A 3ZX5A 4R2XA 4TLAA 1R4ZA 3EQ7A 3GNSA 3IALA 5LKAA 3D6FA 3U7RA 2D0IA 3N28A 4X7RA 4HZUB 6PFKA 1XN1A 3C5WP 3UJ9A 5C32A 2IEYA 2XCIA 3RSLA 2BWJA 3OX4A 1SXHA 4D45A 2QL5A 1I7QB 3DOUA 1Y34E 1U8CB 2C77A 1Q77A 4DLRA 1UN9A 1FTQA 4CDGA 1NTOA 1J24A 1EDBA 2AUMA 2ILTA 4Q47A 5EZYB 5AJLA 4BFZA 1MPTA 4WDRA 4C2UA 1E2NA 2EZ8A 5GM1A 3MTEA 4B3XA 4HNAB 4IXNA 1KMMA 2QXTA 5FZSA 4XAQA 4M0FA 1YR7A 1N6OA 1ONSA 4S1OA 3QMWA 2GOYA 1KK0A 2G82A 1V41E 2ZSFA 1CE8A 1N2EA 4UVDA 4W4TA 5E9JA 4TLBA 3RBZA 2EXXA 3MUFA 4O2AA 3V3KA 4L51A 2A33A 4LJRA 3MD0A 4MGIR 3DAPA 4EHAA 3IE2A 4KXYA 4MINA 1Z0SA 1N6PA 2AFHE 2G04A 3VHRA 1GW6A 3AINA 3VPFA 3HBNA 1XNJA 1C4XA 4WXPA 1ZIDA 4C0MA 2EFDB 2VF2A 4E5DA 3H4IA 1G7SA 4UATA 3QPAA 1W47A 4H0CA 2VUTA 3GJ5A 3H6HA 4ATGA 2AW5A 3IP3A 4JA7A 3IX7A 4H35A 2XADA 1D2GA 1PEAA 3FRJA 4FP9A 2O0JA 4PGHA 4RAQA 4WERA 3PC8C 4W1PA 1BU9A 1DAIA 2IYSA 5HBGA 5KX5B 4FZ3A 5M3BA 3EX7C 3DHYA 3V46A 1XFDA 3FFBA 2PG3A 4MRAA 2GO1A 1YJ5A 5KNBH 3P2KA 1RRCA 4NCNA 3LHFA 4IIYA 1YJQA 4NNOA 5H3HA 1Y4AE 2BL4A 5FTPA 1D0SA 3R4CA 4F3TA 5H70A 1DS6A 1EDEA 4MS4A 4YNBA 4RTOA 4DV4B 2X0RA 3DA8A 1HFEL 4UOZA 1FJ2A 1ZGBA 3C8UA 4P7FA 5TJHA 1T9GS 4N8SA 3I4FA 5JNWA 3D2LA 4QDTA 4BERA 1SUPA 1UOOA 1Y4DE 3PXAA 1GITA 1EFCA 1U6JA 4PAWA 2BEWB 3PXCX 3T3HA 1K3FA 3O26A 1PW7A 5GV7A 2C2GA 1WBBA 3CG0A 2BJVA 1QIIA 2QI9C 4MIYA 3ZWCA 4MA4A 3KR1A 1KBQA 5A6VA 3WL5A 4DLTA 2P9UG 1U80A 1SZPA 3I8SA 4DHWA 2J0SA 2V59A 3FTYA 1M2EA 3V1KA 2ZIVB 4NATA 3F9RA 3M0EA 3WNDA 3FCOA 2H5LA 5IS2A 1U63A 3WQRA 1CJBA 1AKYA 5J2UA 2Q5IA 4YJFA 3BB4A 2MSKA 5ENOD 1L4BA 3OA2A 3ZNQA 4C1BA 1M10A 3G9UA 1SBHA 1VCMA 4ZU3A 5EYPF 1GHTA 2P1ZA 4DLNA 4XB6B 2IE8A 2KZTA 1XTPA 1NUQA 2VQ6A 2B1JA 2WOOA 3C8DA 4MWCA 1NJ2A 3I2HA 3MERA 3ZHYA 4CNBA 3P2EA 3GRZA 1UOPA 4YN3A 3W9BA 4AXHA 4ZDKA 2COKA 4I5IA 5L3ZA 1PJSA 3SIWA 1C1XB 2YHSA 3Q10A 3TD9A 1IN4A 1DG1G 2CDRA 3GGGA 3FOEC 4ALKA 4DX2A 1R64A 3GP3A 1JBEA 2AKYA 1H2FA 3F7NA 4JHRA 4UM5A 2I67A 2QRNA 5BSMA 5LMNB 2G4VA 4M7RA 2H0AA 1C41A 2EAUA 4KH1A 3MSXA 4OU5A 2NOAA 4OI0A 4YMVA 2YRWA 3HRAA 5BN1A 3IB3A 4DNPA 4ER7A 3FTSA 5BSWA 4ZEVA 3O2NA 3LZDA 3VMFA 2QRJA 4GQIA 1CUIA 4KE8A 3R3HA 3P32A 4BX0A 2HA3A 2V6IA 4D9BA 1V11B 4EB6B 5JEDA 3D0KA 4OAVB 3ZHUA 3QE4A 1NVKA 4INJA 4ZI2A 2XZPA 1CJUC 3NBNB 3SZGA 4E51A 3CUTA 2OHHA 4DBZA 3C70A 1ZZEA 4R1PA 1OH6A 2RMKA 2VGEA 4HPXB 4I36A 4ZXPA 5TEVA 1SKMA 1TYCA 1T2FA 3IDQA 5F7JA 2HMUA 2QN6A 4OEHA 4HLUA 4CN9A 2BRUC 1FU4A 4HDSB 5IW8A 2IHVA 1Q2ZA 2KW5A 1JDZA 3UV7A 2RH8A 3NIFB 4BNJA 4Q1BA 3KSMA 4RIIA 4UDYX 3GUZA 3NAZA 1Z75A 3T7SA 3PGMA 3T4PA 1U2TA 1D4FA 3CKLA 3CO5A 2XCOA 3X43A 4WNCA 4BRSA 4UQYA 4NU5A 4MUYA 3K9WA 4BNHA 3AF3A 2JJ2A 2DRIA 2JJYA 3OX2A 3RVKA 2ZI4A 4JC8A 1JSRA 5DOZA 3ROGA 2B94A 5KU7A 2RE8A 4P93A 2JKVA 2BY4A 3HP4A 4R2HA 1T9AA 3DUWA 3E2PA 3BWDD 3I2YX 1JQ5A 3QYPA 4P84A 1TJNA 1BPOA 4NYMR 1ZIPA 2H63A 2WTUA 2YWCA 2OAEA 3A6PC 1N4PA 2BUAA 3AETB 2J9RA 3UPVA 4TXLA 7ADHA 4I4NA 2DM6A 2PWYA 3I05A 2G67A 4PXSA 1QGAA 4YLGA 4ZVVA 4QTXA 4EYGA 1GARA 1UEJA 5JVDA 1D6JA 3LUPA 1KJYA 5K2MA 4B6EA 1EIZA 3H9EO 3L1UA 1QO7A 1V3TA 1YZNA 3ZV6A 1U9JA 1AQUA 1B0PA 2UZAA 3HWRA 1G2IA 2ZUDA 1LBTA 2QZ4A 3H5AA 1LFDB 4JJAA 1A5BB 3PHIA 2ZBVA 1K6XA 3M9WA 3CE6A 4LC1A 1EVEA 1GTL1 4OHVA 1AKTA 1E1CB 1JPUA 4QFVA 3CINA 4W8GA 5IJ0A 4IQ0A 4GVPA 2FZKA 2OV8A 5HPYB 1KO8A 5DX8A 1P31A 1CCWA 1RC1A 4ZZ2A 2H1CA 3FUTA 3RFXA 5AWFC 3F8SA 2VYFA 1VXOA 3CKMA 2QZJA 2Y76A 3O2QB 3F73A 4OKSA 4EYOA 2JFVA 4E09A 5HKKA 4FD3A 4NYMQ 5CCLA 3ZE8A 1E3LA 1KT1A 2I62A 2NO7A 2IIVA 2IGTA 3IOCA 4H1UA 4YACA 3VR2A 1W5AA 4MH0R 4OGWA 5KQPA 1FA9A 1MAWA 1QQTA 1GV0A 5BN4A 4X7BA 1VMEA 5TGTA 2OZEA 4FMDB 2BKUA 4EVQA 4EG0A 4ND7A 1T8WA 3RYCB 4O8CA 4YPFA 1NVEA 2UVPA 5IN4A 3PGLA 1OPRA 1KOLA 5ICEA 3V4RA 5GTDA 3KOZA 1SA4A 2EZTA 4LBWA 5CM2Z 2QPAA 1TTHA 4O4JF 2VDWA 4BMDA 2NSDA 3ZH9B 2V55B 3V1TC 1XZHA 1UFOA 1HKUA 3EFOA 4HTFA 4ON9A 1SCBA 4UTPA 3RADC 4X7PA 1JG7A 1W75A 3BMCA 3FVQA 2WKRA 1IULA 3FMFA 3MIIA 3QBDA 2C61A 2KMLA 4ITRC 5LA6B 1OW3B 4MHOA 3UWSA 1RKBA 2AVDA 2ZSDA 4BKQA 4ZOQI 4XWKA 3U31A 3IV9A 1EKXA 1YQXA 4EGQA 4Z1MD 1E9CA 1R6DA 3BL6A 4W1QA 4OPMA 4PLTA 4OVKA 4EJSC 4MXDA 4IIGA 2IPAB 1UMCB 5BWCA 5LDDC 1U28A 2P9TA 1Y5MA 2MHCA 5EIEA 1M1YB 1AMOA 2IHZA 5IT9A 1SBNE 2Z56A 3VNBA 3ICWA 1FT1A 3E5RA 2QRUA 2BHTA 4YP7A 1DC3A 2HJWA 3I4LA 1E61A 4PS8A 1C30B 1X9GA 2D62A 5H68A 2XY4A 3WWCA 1IPEA 1I9GA 2PKXA 4CF3A 3GPLA 4CODB 5LLDA 3P1JA 3FOZA 2L6JA 1BE8A 1Y1TA 2QR2A 5TNXA 1N4AA 1JLHA 1WBDA 2O3SA 2H7CA 5JASA 2XD9A 5JHAA 4AG3A 4Q00A 1NE7A 3NG1A 3BGDA 2Z30A 4M9RA 5CCXA 3V79K 4IWXA 3NIBA 2B30A 2XWJI 4PZEA 1YZVA 1BD3A 4QAJA 1J21A 1KIFA 3DAGA 4X3PA 5JYEA 1A9PA 2CNOA 2Y1EA 3K72B 2GCPA 1XKTA 2XPZA 1TZBA 221PA 2HGZA 2VT2A 2WHYA 1H6OA 4H18A 3WGLA 4RKQA 4DM7A 2HNAA 2AOTA 4RORA 2PMEA 5M34A 3GFFA 5F76A 2EP8A 3S6JA 2PH5A 1U4SA 2RSLA 1P7CA 3UUGA 1SBZA 1JIXA 4AS3A 3AV0B 4BTVA 3T06B 1XC7A 1Q7TA 4UHCA 1RC0A 4EYEA 4MPTA 3I3OA 4MR8B 2GM9A 5EL0A 3VU8A 1JCSA 3E1SA 4FOOA 3TIGA 4QUGA 3HCRA 4YDQA 5J63A 5BWBA 2RK6A 4Z9XA 1PT8A 1V39A 3MWFA 1Z26A 2ZJ6A 1JG3A 2ZJFA 5IT0A 2I6QA 2PY6A 4JLVA 2ETVA 4M9ZA 4CUZA 4HAOA 4F3YA 3ZZMA 2C7BA 2PUWA 2V7EA 4NZZA 3WISA 4RD4A 1AO3A 1FFXA 3MCUA 3NDJA 4G0QA 4B81A 4IWYA 3EOAI 4RA9B 3K15A 3VZQA 4J8SA 4DJFC 3CUYA 5TC4A 1D9ZA 1PR9A 1SIUA 2EGHA 2BFPA 3K9CA 3OM9A 3KHUA 1IYGA 4NECA 5ICCA 3RVOA 1NUSA 5A23A 1YJXA 4U0UA 3AU8A 3PI6A 4OM8A 3CEHA 3HZHA 2IKQA 4UCWA 1KAHA 4AN4A 2HWKA 3L6CA 3MV3B 2YQ4A 4B4OA 4UWKA 1Q0RA 3MGGA 2JAXA 4NS4A 3WQHA 2HEIA 1MABB 2ATXA 1L7BA 2GEKA 2AFRA 4HATA 3A1SA 4WGFA 2HDNB 4WBNA 4HG2A 4BLVA 3H75A 4L4SA 1RQPA 1UWLA 3FH7A 4R41A 5JCZA 2GSDA 4ANWA 2F3TA 2JHAA 2V4ZA 3EU9A 3FMVA 4ZPXA 3K09C 2ECPA 1YS2X 1NF2A 1ULTA 2XF8A 3UJAA 4CMEA 3KQNA 3IXQA 2E89A 1IK6A 2Z8YM 3KOOA 4TTJA 3TUJC 1NMEA 3BB3A 3X1WA 3TQRA 5H7PA 3V80A 3L1KA 3THWA 4Z4EA 5CFPA 3L2OB 4G65A 4LFCB 1MOZA 1CZLA 1PFQA 3GJYA 3FGOA 4LX0A 5C5EA 3Q9UC 1JZSA 2YZMA 2H2AA 5ALSA 4GL4A 3PEYA 4KQ2A 1CC1S 1MO5A 4NYIQ 3UFXB 3TQOA 4JWKA 4S1TA 3WK4A 2Y77A 4LJ8A 4W5RA 5IF3A 2I4IA 1Y6JA 1TA9A 3E82A 4HI0E 2RHMA 1DV1A 1WMDA 4JI4B 1F7VA 5CMYA 3IHLA 3TMAA 4PHHA 3M1YA 3M6FA 3IPXA 3CGGA 4Y9UA 4UJ3A 5A6SB 3N2YA 4RD2A 4RJLA 3PENA 1INZA 1H2WA 1NOKA 2QPTA 4RY8A 3UKRG 1WQ4A 1WHTB 4FFRA 4IQFA 4ZYYA 3I92A 1O03A 3AI3A 3IURA 3FU5A 1TX4B 2Q1UA 3DE7X 3LQFA 3MRSA 1WF6A 4HFRA 4NBNA 2C3UA 3WLIA 2VHUA 1A5SB 5HRCA 2VQ3A 4KXMA 2JBAA 3WLQA 4Y6QA 3F2IA 1KSHA 1OLUB 1ZUIA 2I2CA 3DOHA 1NT2A 1I2MA 1EHCA 4M0MA 1DC8A 1JIKA 2A3NA 1A5AB 3ROKA 3L4EA 3IQXA 4Q93A 3F5MA 4UHHA 1NV9A 2P79A 3PR2B 4IDHA 4I3GA 4LCEA 3K9GA 3HM9A 3FPAA 5ALRA 1LDNA 5DN6D 1SXJD 1NSYA 4GSLA 1TW2A 4G5XA 4V03A 1FVHA 3WQBA 3KWJA 3BSSA 1E7YA 2XI4A 1CEYA 3HXDA 1FK8A 2BMVA 5FWYA 2AWNA 2RHWA 4KB5A 3S2EA 3TX2A 4DNOA 1O0BA 3CV3A 3MJFA 1T3LA 4RKEA 1T8YA 3DZIA 3KBOA 5BNWA 1EE2A 4CMHA 5TQ2B 4L6CA 1O96A 3CTPA 2EGGA 5P8WA 1TMGE 5CB4A 4LWPA 1PF7E 4O2AB 4R0NA 5CD9A 1H1LB 4AYXA 1NW8A 5EINA 1QV9A 2GWRA 3HGMA 3VNAA 4EUEA 3OLYA 1R6TA 3FM9A 4MR7A 4OGKA 5LP6C 3WNBA 1W8DA 3S99A 4D9GA 4LXYA 3H84A 1XTKA 4L0MA 1B42A 3QBJA 4D9MA 1FUYB 2P2SA 3G3EA 2A5EA 1GJRA 3G9TA 3DZGA 3JUIA 1TPYA 4OB7A 4FUTA 4BKRA 4U39A 1ZI8A 1ZR2A 2YVKA 2CC2A 3BJZA 4WESB 2C7VA 4F1PA 1K7EB 2WSLA 2P9NG 3H0EA 2VJNA 1MX2A 1LDEA 4AG5A 4IY1A 2CJPA 4YT5A 3M81A 3HBFA 5MN6A 2XPIA 1WTAA 4KX3A 4TLDA 4B8WA 4BFYA 2NYAA 3WAKA 1BX1A 3O8CA 5I3CA 4DTIA 3NJ8A 5TGZA 1U8EA 4ZT4A 4AJPA 2OM2A 4W8HA 3EQ2A 1ESMA 5SYAA 2JPDA 1T3HA 4GMXA 2ZRKA 5COAA 4FGJA 1SZDA 4HB0A 5I8ZA 4BGEA 2D2VA 3OAAD 4U7DA 4JL5A 5DT2A 3ZTYA 4LMBA 4CM3A 2O4UX 4ERNA 1P3Y1 5DWVA 3TZ6A 1GTSA 3AF4A 3HDJA 4XM0A 5DT9A 3ET4A 4TT8A 2EARA 2PRSA 3RHZA 3SE0A 1HC7A 3VTFA 5BSVA 3M5PA 2O2HA 4BVHA 4IRXA 4TQUS 3DEKA 4FIDA 3SJCA 3JQ7B 1SNYA 1XTSA 3CLUD 1TO2E 3NBUA 3IV6A 3QGMA 4YUZA 5AKZA 4NIMA 2HV8A 1B3RA 4M9UA 2PRJA 4LDPA 1OH5A 2PM6A 2LGJA 2OBXA 3SHOA 1N32B 4ZMRA 2O1SA 3TLZA 1UAYA 3ZY4A 2FZLA 3EUVA 1J07A 1Y8ZA 1ZU5A 4G5HA 4JJIA 1BDIA 1X39A 4OJQA 3V2OA 2KZTB 4WBSA 4UHDA 3B1FA 2O07A 3HV2A 4L16A 3ILSA 3AHGA 1WPQA 3HXCA 2QX8A 5EUQB 1FX0B 2DBVO 1GGNA 3UJDA 3ZDXB 2XSZA 3L8EA 2WWGA 4FYMA 4DIFA 4GZ6A 3A10A 1V8BA 4BFSA 2JW5A 1EU1A 5ECDA 4Y1GA 4NKRA 5HM6A 2QLMA 5BSFA 1E77A 5E9AA 1E90A 3GGOA 3ZJTA 4WFQA 1QAQA 4IYJA 3UJPA 5TSDA 3R8FA 3Q85A 4S1VA 3M83A 4NFYA 4DCMA 2CG3A 4PZ0A 5JALA 1X7YA 2P78A 3DSUA 2GRPB 2V54A 3SJUA 2ZW9A 1R66A 4C08A 2ZIZA 4F06A 1GZ7A 4UD6A 1VBNA 1NXPA 5LQAA 4OL0A 2JEYA 3RRMA 2X6HA 3UKOA 1HQDA 1A82A 3DHNA 3A6JA 4PN3A 3V2HA 4GVXA 3OEHA 3H1BA 4QJBA 2OL4A 3R7WA 3U6BA 4HNHA 3UMMA 2F62A 2CLIB 4LEUA 2QZSA 1SOWA 3GNQA 2AFVA 3N7UA 5DLPA 1ZD2P 3ABKE 5I7AA 4IO0A 4D0LB 1T2UA 2JI7A 2W0MA 1OA0A 4PLVA 4PXYA 1WD7A 4KR2A 4C4YA 1GDDA 1BI8B 1T0PA 3A1CA 3T1VA 2WB2A 1RMTA 2LDXA 4RV4A 4HDSA 2VZ0A 3VDXA 4KVOA 1NT4A 3IE0A 1IXZA 4BY9E 2R1UA 2HPHA 5F1PA 1FJXA 1GRCA 3HYCA 4M1WA 4Z0PA 3BF7A 4U04A 1XALA 4N0DA 1P0FA 1H69A 8LDHA 2C04A 2XODA 3GMSA 2VP3A 1V8ZA 1QDUA 1ZVVA 4Q4AB 3TVDA 1Z33A 1U2VG 3C14C 4FCTA 4MRPA 3T5VA 1VBFA 4X9XA 1OOEA 3GRAA 4NNPA 4KPYA 3AFHA 4I1YA 2WFLB 3V33A 2R48A 5JDCA 4WL0A 3GZNA 2WAYA 1JSZA 1JDBB 2DKNA 2F43B 2ZYDA 1ZISA 4H3HB 2LDBA 3ZHSA 2P9FA 2R5NA 3IOEA 1H3NA 3E5HA 1XTVA 3G9ZA 4A2WA 4DJ5X 3KNZA 1M6HA 3A3OA 3GFVA 3HCBA 1IZ9A 4QQRA 4UUMA 2IUYA 3TLMA 1QQEA 1OR8A 3GW8A 3UGKA 3MQ4A 4IF4A 3WK9A 3ZWOA 1GQRA 3S28A 1FFAA 1T2DA 4XCVA 3FI9A 1XWFA 1H6BA 1ACLA 5T57A 1CVIA 2CVHA 1A04A 3PZRA 3GEPA 2E5LB 2IHJA 2QTLA 2V0NA 1C81A 4CQJA 1Y8QA 1A8PA 4NCHA 5FFMA 4C20A 1M67A 3GR6A 4DMKA 3GRFA 1YDFA 1H2TC 5AJVB 1US8B 1RBYA 1O1RA 2QUBA 1QTNA 2D5LA 1G1AA 2REQB 3CK8A 2DHCA 3ASUA 3F6QA 2JFFA 3NUGA 4FXOA 4MQLA 3NJ4A 4LNUA 1U2GC 4MVJF 4Y2GA 5IK2A 4M8NE 4JQYA 2W8ZA 3L04A 3LBFA 3LUFA 5EZ5A 1OREA 4RHUA 4ENSA 3L7LA 1NW7A 5FOVA 4NARA 1PT5A 2PSDA 1NDUA 1BROA 3ISJA 2PS0A 1PLJA 1NVVR 4QVGA 2JJ1D 1YS7A 3DUFB 4J2TA 4Q4AA 3EXFB 2OAQ1 2QRVB 5C53B 5LQSA 2D1YA 3EYAA 4R83A 2AFHB 3EIWA 3H8VA 4FGWA 3H8SA 1UP7A 3SDBA 4OGLA 3ND9A 4JHKA 1R88A 2AR9A 2F9LA 3MT8A 3CLHA 4JC5A 1B16A 2OV3A 1SD2A 3LY8A 2JGRA 4RQIA 3TWUA 2OBBA 3ETEA 2FMKA 1EYHA 3I01M 3N70A 4LHEA 3CRW1 1G5RA 1ONBA 3DD1A 2J33A 2HK7A 1NBEA 1DC4A 1NFQA 2I29A 4LS3A 4DXHA 2UYCA 5B1SA 1BQEA 3TBKA 4BMYA 1ZNZA 3TRFA 4Q96A 1GFSA 1Y1RA 3OM8A 1H9BA 4DMLA 1PD0A 5JC1A 4YCBA 3GJXC 3CU5A 3SN6A 1C14A 3K9HA 1X87A 5ENPD 4H9GA 3CH5A 2BBTA 3BMCB 4PC6A 5BNTA 1A76A 3E3MA 4KQHA 5LA6A 4G8BA 1K2WA 4I6EA 4QQKA 4BMZA 1CY7A 4MHTA 1ZC4A 4M0LA 2C0LA 5NLLA 1O8CA 4LHSA 5DTMA 4DJDC 3TEMA 2ZRHA 2DFKB 3QU2A 4KL8S 1T9KA 2IW1A 4PZYA 4E1BA 1EUZA 5CDFA 1UFRA 2ZKIA 3O8QB 3PD0A 2O57A 2WWHA 4IVQA 3LL4A 1I14A 1NN3A 5E9QA 3BWXA 1M7BA 3GFGA 4ND6A 3CO0S 4XFDA 3K0EA 1EJBA 3E8MA 4AW9A 2PMKA 2WLTA 3ESYA 3UYLA 9GPBA 4JENA 1N3BA 3L01A 2NZ8A 3UIPC 3QLUA 1IPFA 4MP6A 4Q3BA 5TMBA 4HLLA 2W6JD 4EH1A 4JODA 4OHZA 1PFKA 4PQEA 4TS3A 3ZNNA 3QXCA 3WJ1A 1O2DA 3DHVA 2V0PA 4BNNA 2QRZA 3USCS 5JRDS 5F33A 3EXIB 4DZZA 3GUUA 1W9MA 3OC6A 3FKJA 3KLPX 4RH1A 3U7QA 4YRFA 4EY8A 4YV1A 4O0MA 3QU5A 4ACLA 2EG5A 3GFBA 1NMSA 3L5KA 5C7LO 4HNGA 3LTNC 1S2OA 4BKUA 5C52B 1J00A 4Y7CA 4ZVSA 3F3SA 4R1UA 3CSFA 4FYWA 4KYTA 3NHWA 2OV6A 3WZLA 2Z8ZA 2OGTA 5C8YA 1LC0A 5BY2A 3MTIA 4PLCA 5B6IA 2R02A 3BA6A 4OB6A 2ZDQA 2FR8A 5BUZA 1Z6TA 2FLWA 3RUIA 3DEPA 4HI9A 1XQWA 3FMOB 1T91A 3UFBA 3VVLA 3WXMA 4E2YA 1KE1A 1VRVA 4KPFC 4YALA 2VP5A 4KV7A 3TXYA 3FJYA 4AVXA 4DEYA 1D03A 1R2QA 3CLRD 5BYBA 5ANLA 3E5MA 4GRDA 2WVIA 4UW9A 1NXOA 1QP7A 1G0OA 1XA0A 5FZQA 1XB2A 3HN2A 3H04A 3QWAA 1M5TA 3RAJA 4CM6A 2JFXA 2JVKA 1T8UA 3E9NA 2VDOB 2ISSD 3H9QA 4WHMA 1XF1A 2NV6A 4FQ8A 4JI1B 2VAXA 4N8DA 4H7YA 4ZT7A 2NU8B 4AO6A 4JJEA 4EKNB 1LQTA 2AK2A 4PYRA 3D3EA 2PL3A 1G98A 2FPXA 4TTAA 4WXMA 2PX6A 1TIBA 1PSZA 2QD5A 5A7HA 1J5EB 2ZSBA 3RU2A 1UMBA 3GHYA 1KGSA 3ZEAA 2AG1A 1DDIA 1E9SA 1USUA 4NNJA 1ZKMA 2FWRA 5CJPA 3RUPA 3TOVA 3ECAA 4POOA 4D25A 1BCSA 3L54A 1C3JA 2JFUA 2R87A 1H0SA 3QOXA 5J4HA 4CQNA 1EWTA 3FOWA 6LDHA 5JAIA 2CL6X 1Q0SA 2FW7A 3C45A 1OXBB 1Y8CA 2HREA 4ZV9A 3RVBA 4Q3DA 3M1AA 1EZZA 1UQTA 1FW6A 3A3NA 5FDFA 3SWWA 3T5MA 3ZN3A 2UYOA 2Y0EA 3TNDA 3AHCA 4H60A 4OHXA 2WAOA 2FWJA 3H5VA 3KKZA 4D98A 1ORVA 2WJ6A 4MAFA 4K5AB 3EQ9A 2VRBA 2IVFA 4Z8XA 4C29A 1GPKA 1Z5OA 1YDGA 5K51A 2W2KB 2PUTA 3G8CA 4QTZA 2OQIA 3WHIA 3OD1A 1Q16A 3T7KA 3WB2A 4MK4A 1IHPA 4YT4A 1YHNA 1B8PA 3T5CA 4K9SA 4GUDA 2WU1A 3RROA 4BN5A 1N7IA 3QUSA 4NJEB 1Z4PX 3WI7A 1TEVA 3PYMA 3R3JA 1UK8A 3PJGA 5ALPA 3WRXC 5BPHA 1KJWA 2HTEA 2XF2A 3AF1A 3GGPA 2KI5A 4I4CA 4V39A 2JA1A 3IMKA 5AVYA 2QM3A 2JBWA 1CIVA 4HGRA 5EPUA 4ARVA 4H3SA 4I1PA 1HQCA 4BHTA 4JLKA 1Q1AA 1Y1SA 3F5DA 5LBIA 3TZEA 1FFDA 4JLSA 3UPDA 4BVAA 5CFRA 4QQNA 3KOYA 1H8HD 4RS3A 3P0RA 4XE0A 4RO0A 1U3FA 2R8PA 4KO3S 1DPFA 5AKXA 1KZHA 1IHDA 4OJTA 4Q4LA 1J8MF 1NMQA 2P9EA 3Q7EA 3JQ9C 3NVDA 3UHFA 1J42A 1ULHA 3IUYA 4E4RA 1QG0A 2WIDA 4HEHA 3DHEA 4YAGA 2P2DA 1SK9A 1XK6A 3WGMA 1RQGA 5HUQA 1DX9A 3ML1A 4KPUA 1Y0BA 4XJVA 1N57A 4QZVA 4CL2A 1ZK3A 3ORSA 2CFRA 1ZOIA 1VPEA 1UJMA 3MJEA 1E6LA 2PYIA 4JGIA 5TB5A 3AF6A 3W8DA 3D5EA 1GA4A 1BEUB 1JQ3A 1PZFA 2R9VA 3U4IA 3FPLA 2OV1A 2SKDA 3QX9A 5P21A 3UMBA 4B0OA 1WWKA 2ANBA 1HYHA 5AK4A 4XXHA 2NV2B 3PEVA 1NKVA 4FWBA 2IWHA 2GR9A 1PQPA 4FT2A 1QQ7A 1HDOA 3SDSA 1OZGA 4GA1A 1M73E 1XRQA 2JEZA 2WWTA 3CRRA 3PVCA 4ESEA 1NBIA 1FFYA 2B1GA 4E5MA 3PRHA 1RYNA 2NSZA 1BD4A 3GCWA 4GOOD 1GSAA 1AZTA 1TJ5A 1ORIA 1M0EA 4YI5A 1GU1A 5C31A 3W7BA 2OO3A 5CITA 2I3GA 2XQFA 3OCUA 2EF1A 4K9KA 3GRYA 2J3JA 1OA1A 2AZ4A 2JARA 1VJTA 3MSCA 2MRIA 1JAZA 2V4UA 1PLLA 3GAZA 4R40A 4LDZA 5TX7A 1LVGA 3SJBA 4LXTA 4AJ4A 1UKAA 3ABLE 2EG9A 2ZPTX 3MTJA 2X7HA 4YDWA 3OG9A 4LDAA 4TS9A 4WESA 3R7NA 1OU4A 3RNLA 1GDTA 3VZSA 2ZYIA 2AQIA 2DG2A 4P54A 3O3CA 3RJVA 3IR6A 5DYGA 3MNFA 5JO0A 5AM1A 4A6DA 3S8MA 1V55E 2RGRA 2XNJA 4PV7A 5EHZA 2IPMA 2WMNB 1GKUB 1MX6A 1A9ZA 2EF0A 5JXHA 4WAUA 2GLXA 4LOJA 1JR3E 4N3NA 4NE7A 5EYLA 2PIDA 4O2LA 3DT8A 1ZYUA 4OAOA 1RHRA 2J6IA 4K2HA 3SKXA 1L5MA 2YHIA 3GLHE 5LFAA 1HTWA 3TRDA 4BV2A 4Z3OA 3KDAA 4LYDA 3FHLA 5KJNA 2Y3IA 3R7QA 5ALTA 3GPIA 5BYJA 4KRYA 2JFYA 3PF8A 2VHYA 4JKOA 2ZWMA 2V7QD 3ELYA 4IXDA 2WXRA 1IXSB 2W58A 1EF1C 4XQ0A 4JUIA 3A4YA 1E89A 4WLUA 1TMOA 5K0ZA 2PWBA 1M1ZA 4HDAA 4Z4HA 4XGIA 4PFQA 5C0OE 1U1DA 3LGSA 4GTPA 2VTDA 1RJDA 4ANUA 3BRWA 3KJIA 3Q2KA 4L73A 4WJKB 3PEWA 1ZAYA 5LYYA 1UQUA 2G5PA 3AY0A 3E84A 3ZIUA 2QQGA 2H7XA 3PLNA 4FCVA 4EJMA 2OHJA 1QPBA 4FILA 1KQGA 1PDVA 2EEZA 3GLVA 5HS0A 3CB4A 4I1UA 3IAM1 1N8SA 1DDOA 1F8YA 2B99A 3H2JA 3AIOA 4IHAA 5KJLA 4TT3A 2XMDA 5DM4A 3WQQA 3LX4A 2ZJ3A 2AKAB 1OPXA 3PG5A 4TMKA 5EZYA 3UT0A 3I01A 3NXKA 3IKOB 5CT5A 3GLGB 1RJFA 3QI7A 1J2EA 2BMEA 1SB8A 4NOKA 3R20A 1V0JA 3F7OA 3BEDA 2IBTA 4L5YA 4JXTA 1JDPA 3MMXA 1VRCA 4ZOLA 2G7ZA 2YHBA 1Z39A 1LI7A 2ZR8A 4Z3DA 4BAUA 3WWOA 2QTMA 4DRXE 2QC9A 1CUVA 1Y3BE 3HLKA 2V7TA 4BQOA 4TT3D 2ZIUB 5DOVA 4ND1A 1RFGE 5U4XA 1VG8A 2ORVA 4P34A 1RP1A 1D2RA 2ABWA 4JCCA 3BUSA 5EHIA 2BI4A 4OMFG 1QV6A 3DE0X 1I6WA 4QRHA 1C7EA 3SKYA 1GO2A 1DJNA 1UQRA 2FZCA 1PZNA 1B6TA 1FXWF 4RH3A 5TV2A 4U0SA 16PKA 1Z28A 4NOLA 1Z17A 2BE9A 1KPHA 2NSYA 3A06A 3V1MA 3ZN2A 4F5YA 1IY0A 2G36A 4M1TA 4ZHSA 3KV3O 1E63A 3KEFA 4H6WA 4K8RB 3RRZA 2G9NA 2DTDA 2ZUSA 4R8RA 2NUAB 5HYVA 4DX1A 3N7TA 3L7CA 4PVDA 2PSFA 4UOQA 5TLSA 3W4KA 1I7LA 1VE3A 5G04J 1Z16A 4W9RA 3PKZA 3KPVA 4DXDA 2CWWA 1QUEA 3T5XA 5G02A 4KR7A 3FCEA 1A2KC 4A0GA 2F3SA 4RM3A 1KS2A 2WPNA 2WFLA 2Z5LA 3M6XA 4TRNA 4A7PA 5JPDA 2GZMA 1DAGA 4F8YA 2WYVA 1ODSA 3SX2A 3IUPA 5C8XA 3TK1A 3VAYA 5TPZA 1KETA 2YJ6A 1XVLA 2OV2A 5JATA 5KVCA 1NVFA 1Y7HA 4RF2A 1M1UA 5D6NA 4TZ0A 5DHRA 2OCIA 2I7TA 1CNMA 2DB3A 2VWHA 1KEUA 2CN1A 1CEXA 1XJQA 3NU1A 4LYAA 3S1AB 4KTVE 3I62A 2DLCX 2H6IA 3EPHA 4GOMD 2I6HA 1DHTA 2Q7DA 3NAWA 1PE0A 5K1ZA 2H48A 3EDTB 1RI3A 3LT4A 4HDCA 5IJ0B 3W1VA 1R37A 2O1WA 3AIIA 3CZ5A 5GJBA 4UBMA 2CLDX 2XCBA 1EWKA 4ZAZA 1LU9A 1X7XA 4PNPA 1DSSG 3HJHA 3LVFO 2FR1A 1Z4OA 1S7CA 1Q11A 2I0FA 1QVAA 4EG8A 4OQMA 2RAVA 4U5XA 5CA1F 1G8HA 5CK4A 2FRXA 2BFCA 2FG7C 3HR7A 3P52A 3BF8A 4URKA 4BFTA 3MT9A 1UBUS 3VJMA 1M2GA 1Y5IA 2XAUA 3UAWA 1R3UA 4JLPA 3CEMA 5EJAA 1S8FA 1KVRA 3WOHA 4K9DA 4Q48A 4HAVA 4EHKA 4EMUA 1KJQA 1OLSA 4LJLA 2AFHA 4OL9A 2DF8A 1TQ4A 2BSXA 2V4HC 2ZU6B 5AJDA 1U8UA 1BMDA 1ZK1A 3OHPA 4KN8A 1ZXXA 2QLNA 4YH1A 5DLEA 2BN4A 1EZ1A 4O02B 4QUJA 4NYJR 1J33A 5THXA 2QROA 4R5HA 2ZRBA 3SQLA 1DQZA 3SSNA 1SULA 1VKZA 4XGRA 3OXFA 4DPMA 1E66A 2TSYB 2XB2A 3AOEC 2OZKA 4H3VA 3ZYLA 2ZULA 2DT5A 4XYGA 5JG7A 3W9UA 4H7IA 3LE8A 4JR2A 2CV1A 2FZVA 1URPA 3EXEA 2QX4A 1T5DX 2UZ4A 1V8PA 3TTVA 1SCUB 3PUZA 3V4FA 3VM6A 3UMYA 2GTHA 1JPJA 2IT1A 5IZ4A 4PO1A 1JHUA 3NIWA 4AKHA 1JFSA 2Z0MA 4JOCA 5ENNA 3UWMA 4KIUA 2PM7A 1LBIA 5BXYA 3LC0A 2VNHA 2W22A 4QBKA 1RXSA 3E34A 4XLZA 5ILGA 1R5JA 5L3QB 3U5TA 4RTJA 4LEIA 1FSFA 3PQFA 4QODA 5ALOA 3HXBA 4CLXA 3J80A 1ENPA 1QSGA 1L2TA 2QTHA 4GS5A 4ER3A 3HUFA 2VXOA 3QB2A 3GO4A 3W3AA 2GKGA 3LBNA 3PBKA