4JZYA

Crystal structures of drosophila cryptochrome
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
534
structure length
534
Chain Sequence
ATRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWLADV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cryptochrome-1
publication title Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Circadian clock protein
total genus 197
structure length 534
sequence length 534
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4jzyA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4jzyA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4jzyA01
1WQ3A 1NSYA 3CVWA 1WXHA 1KQNA 1U7XA 1Y42X 2H2AA 5DK4A 3KT6A 4RPIA 3IUBA 1MAUA 4OUDA 2B7LA 3JXEA 2QJOA 4MWCA 3MXTA 3NBKA 1S4MA 3N9IA 1J20A 4MQ6A 1KAQA 4MLPA 1J70A 2Z08A 4ZT2A 1QQTA 2CFOA 2D5BA 4AS1A 1O97C 3IOBA 1IVSA 2A1TS 4R2MA 3FWKA 3LCJA 4H3SA 4NATA 3S3TA 1JILA 4TS1A 1KH2A 4MW0A 1WXFA 3SZGA 1DNPA 3D6UA 2YXNA 1N77A 3UOWA 1O97D 3IDFA 4XFDA 1M83A 4ZCSA 5TGTA 2D54A 2QTRA 1U3DA 2O8VA 4MUJA 2GKSA 2VTBA 4QREA 4PY2A 2Z3VA 1VBNA 1YULA 1JGTA 2AKEA 1I6KA 4YP5A 4ND7A 2A4MA 1J1ZA 3X1MA 1WQ4A 5FO0A 2E89A 4MW9A 4YMIA 3ZUGA 2A84A 2J4DA 1VL2A 1H1TA 3LE8A 4Q93A 2R5WA 2DERA 2E0IA 1LW7A 2ZUEA 1T6ZA 3AG5A 1N78A 1R6UA 3TQOA 2WSIA 4EF6A 2J07A 3FETA 4MW6A 2V0CA 1EFPA 1I2DA 1NYLA 5J5AA 1VBKA 2HZ7A 2JA2A 1MJHA 1MOPA 3FI0A 3H9CA 1TYBE 1SURA 3E27A 4MUNA 5KWVA 2DR2A 2XRZA 1KP3A 1N2EA 2PIDA 3A4IA 4MUIA 4HPWA 1N2OA 4OJMX 3ZXIA 2CYCA 2CV1A 4ARCA 4K0RA 1R6TA 3MMXA 3RFFA 1XNHA 4ZT3A 4I6GA 3NV7A 3FNRA 5DASA 1NUQA 4MVYA 2VXOA 1NI5A 2AG6A 1COZA 3HFJA 3AKZA 1FFYA 4ZCPA 2V0GA 3TS1A 1Q15A 2DLCX 4HJXA 2CV0A 1OWPA 3P0JA 3H9BA 1RQGA 1F7UA 1QU3A 4P2BA 3ZJTA 1I6MA 4QBTA 4ZT5A 3UK2A 2QTMA 1JEDA 3X1KA 3TQIA 1KAMA 4OUDB 5TEVA 1KR2A 2QUKA 3PXUA 2DXIA 1K4MA 1TYDE 3PNBA 2HMAA 2XRYA 3IVGA 1GAXA 2WQ7A 2X1LA 4ZCRA 4AQ7A 3FHJA 1FYDA 3LOQA 4ARIA 3SP1A 4K03A 2CT8A 5AHWA 3A05A 1EUQA 1KP2A 4JXZA 4G6ZA 3ILVA 2E21A 3SEZA 4ZCTA 1O95C 2A86A 3COVA 3COZA 3SYTA 4KR6A 1OBHA 1OWNA 3FDXA 3BL5A 3OP1A 4MW4A 5IHXA 1O95D 1N2BA 1LI5A 2EJCA 2VTBB 4EG3A 5J58A 1K97A 2DUMA 3QTBA 1QRSA 1T9GR 4U63A 4MUHA 4DJAA 1KQPA 3L93A 4X0EA 4XFJA 2X1MA 1IHOA 4HK4A 3A2KA 1XNJA 1QU2A 2PXHA 4XSVA 3IUEA 1M8FA 5J59A 3ZIUA 1NUSA 2PG3A 3CLUC 1ILEA 3GLVA 5DB4A 5EKDA 2QJFA 3IOEA 1QTQA 3IOCA 2JAXA 3RK0A 1N2HA 1EFPB 2YWBA 4E1AA 1PFVA 1NP7A 4NAUA 5HG0A 4WSOA 1QNFA 1J09A 1D2RA 3N8HA 2A1UA 3CLUD 4MVXA 2X3FA 4KR7A 4MWBA 4I6JA 1LI7A 4BWVA 1M8KA 3A04A 2CSXA 1PG2A 4L2IA 4MUEA 4ZT4A 4HJRA 4U7JA 4DDKA 4NAHA 5HUJA 4R2LA 1OD6A 3AG6A 4DDMA 1GPMA 5FO1A 3FY4A 1EFVA 4DLPA 2PZAA 4MW5A 3IMEA 3F3MA 3IVXA 5HUHA 3COWA 1N2IA 2CYBA 5BNZA 3TZLA 3VGJA 4JXXA 1N2GA 1F7VA 1N75A 5TEWA 1KQOA 1B6TA 3N05A 4MULA 1QRUA 1GTRA 2PFSA 4F3RA 1ZUNA 3U1VA 1YIDA 1U7DA 2GM3A 4Q16A 2X0KA 1O0BA 1NUTA 3UMVA 4EG7A 5F23A 4MUKA 3P52A 1O96A 1WKBA 4NDAA 5H7XA 1H3NA 3H99A 2GOYA 3K9WA 1M8JA 3VRHA 1GN8A 1P7PA 3IMGA 3D6VA 1O0CA 3FIUA 4EGAA 4PBRA 1V47A 3HZRA 2CUZA 3DLAA 1BS2A 2D13A 1N3LA 1KH1A 1YI8A 1JEEA 3HL4A 3PNVA 1KKUA 1GZUA 2RD2A 1VBMA 3HMQA 2H29A 5H16A 4QRDA 2JANA 3KT0A 3KFLA 1J21A 3DO8A 5KCMA 1O5TA 3COYA 1Q19A 2TS1A 3ZXSA 5DEOA 3SZ3A 2RE8A 4MW7A 2IJGX 4CDNA 1WXEA 3RBAA 3QTTA 3PNYA 5LM3A 4A91A 3VU8A 1NZJA 3CLTC 5JBNA 3ZJVA 1KORA 2NZ2A 1WJGA 3G59A 3GUZA 3NBAA 4EG5A 2A7XA 3KT3A 2A1UB 3Q4GA 3N2YA 2QUHA 2AZXA 3CLTD 1T9GS 3GMIA 1O94D 1NUUA 3ELBA 2WQ6A 4KPUA 4L2IB 1JIIA 5TS2A 3RHSA 3CLRC 3X1JA 2WB2A 4KKVA 2J09A 1TEZA 1NUPA 1NURA 1HYBA 4U8HA 3I05A 4ZCQA 2EL7A 1F4LA 2IELA 1PFWA 1TFUA 3CLRD 1EFVB 2PZBA 1MB9A 2HGZA 4CDMA 4CT0A 1JECA 4MUGA 3SDBA 2YWCA 3CR8A 1X6VA 1YIAA 2E18A 3MLAA 4FZJA 3G6KA 2CYAA 1IQ0A 1PG0A 3H97A 4YBRA 1GLNA 1WZ2A 1QJCA 1G59A 3RK1A 1WOYA 4MWEA 3OTWA 3FG9A 1J1UA 4UZEA 1PFYA 2QJTA 2CV2A 1UFVA 2O5RA 3M5WA 4EG6A 1O96B 3FH0A 3UY4A 1OWMA 1X8XA 4I6EA 1VLHA 1ULHA 3ND7A 2PZ8A 2G36A 3AIIA 3MLBA 1V8FA 4NZPA 1N1DA 4YP7A 4EG4A 1JIKA 2Z09A 3HGMA 1MAWA 4NX2A 2A88A 2BTEA 2J08A 1CT9A 1H3FA 4GU5A 1I6LA 1OWLA 1A8HA 3FOCA 4MUFA 1YUNA 2QTNA 2DPLA 3DV2A 5IJXA 1Q77A 4EG1A 3CVXA 1R6XA 1IRXA 1TQ8A 1ZJWA 2A1TR 2NSYA 1K92A 4EG8A 2J5BA 3IH5A 3INNA 4DNXA 3IVCA 1WY5A 2OV4A 1EUYA 1T6YA 1JZSA 3QE4A 1EXDA 1G8FA 4UZFA 3K32A 1G8GA 3CLSC 1T6XA 2ZUFA 3CA8A 1EJ2A 4MAFA 3C8ZA 4CQNA 3ZJUA 1MRZA 1OBCA 4PBTA 1M8PA 1QRTA 3CLSD 1IFXA 4MW2A 1K4KA 2YY5A 4S1OA 4ZT6A 3SEQA 3TNJA 4KPUB 4ZT7A 1JZQA 1WXGA 3CVVA 4RUKA 3L92A 1XJQA 3DPIA 1JMVA 4JFAA 3AFHA 3H05A 4G5FA 3ISJA 3G5AA 4EFKA 1PFUA 4GRIA 4F4HA 1JHDA 1U0BB 1N2JA 2DEUA 1Q11A 3ND5A 3ZGZA 2QUIA 1MBZA 5LFAA 2ZP1A 1H3EA 3CVYA 1G8HA 4MVWA 3AL0C 1JIJA 5K0SA 4KR9A 4JZYA 1O94C 1M1ZA 5KHAA 4J75A 1TYAE 1EE1A 3RJZA 4MWDA 2C5SA 4WNYA 3UC5A 1MC1A 3TZEA 2I1LA 4JYZA 1IQUA 4DE5A 1IQRA 1GTSA 1ZH6A 3P0IA 3P0HA 1OWOA 2OQ2A 3ND6A 3HV0A 4J76A 4ND6A 1YUMA 3MUEA 3IODA 2IP1A 3PRHA 1U3CA 3CVUA 3KT8A 5K0TA 1IH8A 1TYCA 4DDHA 1MB2A 3Q10A 4PBSA 4MVCA 5FNZA 2DETA 1XNGA 2QUJA 2BYTA 1F9AA 3IMCA 4MW1A 1KH3A 1ZH0A 1O6BA 1M8GA 1WXIA 3Q12A 4R0NA 5LLTA 4YP6A 4G5YA
chains in the Genus database with same CATH superfamily
3EIJA 4R1MA 3JD0A 4UREA 4WMLA 2R25B 2YZMA 1R88A 3MXTA 1OT5A 4I4CA 1GL3A 1F60A 2R6AA 2OOEA 5CFLA 1JXOA 5IJ0B 1N11A 2A5FA 1GZ7A 3ASVA 2GTPA 2QEQA 1EWYA 1F12A 1CY2A 3X1YA 4BXOA 5AI8A 1RI4A 4Z0HO 4M0EA 3CNLA 1EG7A 2OD7A 2AMVA 3QW4B 3VKVA 1V37A 4DSNA 5AM3A 5K3DA 4I50F 1W581 4MUIA 3IR6A 2GZDA 1JJIA 1WSAA 5TLSA 2QLLA 4MKXA 3RS5A 3HYSA 2Y1CA 1YB4A 2WEKA 1Z0ZA 3I9OA 3FSRA 1E20A 4M89A 4XDZA 4QULA 1DIRA 1RQGA 2XJ4A 3ZGLA 2GXAA 1HOTA 4QBTA 3CVQA 2PUDA 1OLSA 1HC7A 1ZJJA 4OUDB 2VSOE 1Q83A 4OMCA 3JCKC 3IVGA 5BUSA 2VPTA 3QYFA 2OKCA 1ZI9A 4DX7D 5LQAA 4OHRA 3G2WA 1Y1LA 2OGWA 4LPKA 3QE2A 3HCNA 2RGBA 5JC1A 1OWNA 1QAOA 4GCNA 5KNHD 1FBTA 3QWWA 1PNQA 3NTOA 3FF4A 2ZFUA 3B6ZA 3I3SR 4BTAA 2B0JA 3DG9A 3STHA 1WUTA 5LLDA 3JALB 2BGIA 3A1TA 3IQXA 2YXBA 1FRNA 1A9SA 4PLPA 2IUYA 5A4FS 1BRTA 3ZFWA 2NUAB 3GHYA 2PL2A 5KOHB 1FS4A 2PUFA 3VDNB 3JYOA 4PQFA 2VPZA 3ZLJA 2B6HA 1P31A 1LF8A 1NE2A 1V2GA 5KJMA 3RWOA 4XLTA 1KYTA 4URVR 2R5FA 2BGGA 2PKEA 3QELA 1EXNA 3JQPA 4Z1OA 2WXLA 2WT9A 1K5GA 3ABOB 2H4JA 1DBRA 3DT6A 2WWVD 2VRCD 4AN0A 1O9BA 3AR3A 4GMLA 4YRNA 3BUSA 4PQEA 3BZBA 3R75A 1E2QA 1SIBE 2ZU6B 2FFAA 3ETJA 1X1RA 2VBGA 1ONOA 1H8HD 1IHYA 3ZXSA 3RS9A 2H1OA 2X6HA 4U9HS 3SMVA 1RJ9A 1KK2A 5U9CA 1ZQ1A 2PV0A 2REQB 5CMWA 2DCUA 2X1HA 1TEZA 1RCFA 3KEMA 1QG2A 1NMQA 1XAIA 3FIJA 4GPD1 3L2OB 2DZNA 1SEPA 1GTMA 2CVZA 4JROA 5CNJA 5BUZA 2PRKA 3H8VA 3L8DA 3PQ4A 1LX6A 2Y69E 4BNDA 2N3ZA 5BSRA 3ORRA 2BBTA 3SD5A 4IDCA 4CMGA 4G0VA 5ITZF 2XBUA 3OIWA 2Q0XA 3ORQA 4FOOA 2ORIA 5IFKA 4JJFA 4M2LA 4P80A 4WERA 2R0QC 4E88A 4C4RA 4ZCMA 3D0OA 1X92A 3HKDB 1T6XA 1JPUA 4GICA 4L2YA 2QGFA 1TADA 3D5EA 4LUNU 3L05A 3DPYA 3IEVA 2WNSA 3ZLUA 4J1TC 1V7QA 4AICA 1Q84A 5FA5A 1RBQA 4ZC8A 1HRDA 4I81A 2ESRA 1LDGA 3UPUA 1QK4A 3THOA 2RAUA 4ZOLF 3AIKA 1FY2A 3ROTA 1TJ3A 4A1GA 4FCCA 1VM6A 3O2QB 4Q24A 3R9XB 4JUBA 3O26A 5TF0A 3TW8A 4IGFA 4Z7QB 3TSAA 3ZNOA 5EHQA 3DOUA 4MV1A 4ZO7A 2RGNA 3L0ZA 5EIFA 3I0NA 1FYFA 3G17A 4BVGA 4ENPA 1O03A 1FVHA 2E6UX 1BEEA 4J1QA 4Z4QA 1AA9A 4YB8A 2QD3A 2VT6A 4C0SA 4MS1B 4KBQA 3TSOA 1E77A 3IILA 1Z07A 3TNDA 2JGFA 2VZEA 4ES6A 2R02A 4TMXA 4CL3A 2HN9A 1IRIA 1PZEA 5AM2A 4XX0A 4YLEA 2WB4A 3BMOA 1KSGA 5JOQA 3H65A 1TR4A 3F1KA 4ENWA 1OXBB 4MW9A 4A8HA 2HAEA 1GQYA 5B3SE 4JVSB 4YDYA 1XK7A 1IOVA 4D9BA 2F1HA 2HRRA 3LPMA 3E70C 3OOWA 5DNEA 5LMZA 4GOJA 2QTCA 1UJNA 3QSYA 2GROB 2GN8A 3GJSA 5IC6A 1XZPA 2NU8B 3DAOA 3CUUA 3BT7A 3OZSA 1UUFA 3MWEA 5GJWC 4NULA 1OKKA 5D6NA 1J90A 1GNTA 4Q4DA 4V0NA 3WA6A 3DOEA 3BEDA 3SP1A 5HIAA 4ZN6A 3FYUA 3DOJA 2ZYUX 4CCYB 4UVHA 3BRQA 4MGHA 5DHAA 2GWHA 3FPEA 4P3PA 4H18A 4YP9A 2BGTA 1PDOA 2P9YA 2DBQA 4GLOA 1YH3A 2OPHA 2X5OA 4KU4A 2H7CA 4RHFA 5DXAA 3PHHA 1SWWA 4BPRA 4EFNA 4X91A 4M9ZA 4MWBA 5LCWC 4F8EA 1L4LA 1YB1A 4IDHA 4V0KA 1EP1B 4NAHA 3A2MA 1UKEA 1QQ6A 5FJJA 2QAGA 1NJ6A 2E55A 2VP0A 1M1NB 1OASA 2I7DA 4PAOA 2GASA 4A6PA 1X3SA 1PQUA 3P4XA 1AUQA 2WWIA 5B1EA 3MCAA 3A6LA 2XKBA 1P1BA 3ADPA 4W9MC 4ZOBA 4N7BA 1REQB 2HOQA 2ZUDA 2H18A 1IXZA 3H9UA 4WJLA 1K7EB 3O2NA 2CXPA 4O4LA 2VHZA 5BQ5A 1EFLA 1L5NA 2H9IA 1JFRA 1QOPB 2Z8ZA 2QL6A 3R4CA 3B13B 3CQGB 1U8EA 1EAYA 3LUAA 1K0FA 2FEKA 3I1YA 5ALSA 2EX1A 2R4TA 2AZXA 5FULA 4DDVA 4NNJA 1I7LA 2V8SE 1V3TA 1G38A 2VA9A 1YS9A 1Y6GA 4K6MA 4CEMA 4M76B 4U8HA 1ZESA 3SQWA 1IMOA 4XDHA 1COWA 5B36A 4HOSA 2RB5A 5B57C 3MTDA 2AX4A 1NRIA 3PCTA 4MSUA 4GRAA 1HG5A 3DMPA 1G55A 3VI4B 3EXFB 2L0XA 1A4XA 1DO8A 1JQKA 1N8KA 4FMCB 5TB5A 2YHAA 4CN8A 4L07A 4HVLA 4XI0A 4KQFA 2CJXA 5KDDA 2EGHA 1KEUA 2WWFA 4B2IA 3OQBA 4KWTA 5FNVF 4O2BB 4XJVA 1QS0B 1QFXA 3NCHA 2RSLA 2GVNA 4R9NA 1NA0A 1P17A 3DZ8A 3L16A 1IIBA 3W7VA 2GEVA 4RTLA 4TL9A 4B73A 1PUIA 3RLFA 3DBIA 1QO9A 2H3HA 1BCSA 2RGWA 3N2KA 4XE5A 4QEZA 1RVDA 1MDBA 5EJGA 5DTQA 4Q3LA 1YMVA 3C72A 3U6KA 2GRLA 1V4BA 3GDGA 1R7RA 4YJ2A 1QH1A 3QXCA 1UJ6A 1NE7A 2OGZA 2J4BA 4OKSA 3VLFA 1O9GA 3D8TA 5CT8A 4ER3A 1N7JA 1G19A 2G04A 3AL0C 2F9MA 4Q6BA 3RSEG 3ABIA 2XBLA 2WG0A 1SZAA 4RFVA 4Z7NB 3SVLA 5FOUA 2IPMA 2XUZA 1C7RA 3GG9A 4I2WA 2OQ2A 4R8KA 4J0UA 2MOWA 5REQA 2PT6A 3CNOA 1U7OA 4BFUA 4AY6A 3CT6A 4RZUA 5EJ2A 5FTMA 2R6ZA 2WAAA 1A98A 2RAPA 3JQ8A 3KWFA 5D5PA 4AZVA 3UXEA 3DDWA 4D4LA 3LDZA 5CJPA 2A9OA 2J7KA 1HLPA 1PZXA 1Y1RA 1IXVA 4GTQA 2ZJ2A 2PWPA 1Z56C 4NSNA 3F8WA 1K7YA 1MNAA 3QUQA 3H83A 2D59A 2GRUA 3RSZA 4DLUA 1EUCA 2EX0A 2FY8A 5HWSA 4LKRA 2R1ZA 3TUZC 3P9PA 2DB3A 2MMCA 3D8BA 4BWFB 4X1KA 4FXOA 3EWIA 4ZVVA 2UYGA 1G2IA 1NW8A 1TOAA 1VG9B 3FBGA 3HCOA 5HIMA 2A9PA 1DDOA 5JYDA 4J0IA 2H57A 1MH1A 3GFVA 1T3GA 3RHTA 1VKNA 3GJ8A 3QOFA 4UMVA 2QU7A 5LP6F 1MTOA 1VCIA 4ZODA 1LFAA 4QXOA 1QV6A 2XUHA 2FSIA 4BEPA 1U80A 3NDPA 5F5NA 1E1CA 1KI4A 3VNQA 3VZRA 3PNPA 5AMXA 1NL4A 1D2MA 1W52X 1E9BA 2BMAA 1BNCA 2J1LA 2RH9B 4DQDA 4MQEB 2QT9A 3L8FA 2AEMA 3IVMA 1X3LA 1JB9A 4KE8A 4DXHA 3BX1A 3SJZA 3PUKA 2VLIA 3WHLA 1NP7A 1A7KA 1FL9A 4BO2A 5DNUA 2RAFA 1G3UA 5A9RA 3CUSA 3WY9A 3IAXA 1R8SA 2MYNA 5FA8A 4G63A 1IEQA 4YS6A 1EFVA 2VHWA 4NMXB 2AFIA 2M63A 5KTPA 4K26A 4EGSA 3SS7X 1QVVA 1PBNA 2ZQZA 1BH2A 1NQXA 1P2TA 1QCDA 2V8BA 3LV8A 3O8RA 4XQ9A 4LOHA 3G79A 5AQ9A 2WWWA 3DKIA 4OB7A 4PE5B 3APFA 1VSBA 5REQB 3DEKA 3U9TA 2YQ8A 2UZAA 3A14A 3TJRA 3E81A 1S2DA 3W7AA 5FBQB 4EPYA 3F0TA 4IJQA 3F6QA 2BJVA 1P6QA 3IP8A 4FLFA 5BWBA 4AO6A 1EJ6A 1FUUA 5ESWA 5LOVF 4OI0A 3R2JA 1XK6A 2C2ZA 4JLNA 3AVWA 5JBNA 4I8XA 4A0SA 3TMKA 1MJ5A 1A5TA 4XQGA 5HE8A 2CJYA 2XZOA 1DRKA 5A23A 2GI4A 3K0HA 2HIGA 4BY9E 4RM2A 1L5YA 2EEPA 4DYDA 3VSDA 1G64A 4YCJA 4MUBA 3WLPA 3EPLA 4M87A 1AKYA 2W22A 1NFFA 2BCEA 4QU5A 1ZB1A 4ZVTA 4YMVA 5JECA 3ABKE 3A9UA 1RZ3A 3UT5A 1WZNA 3AYZB 3EQ6A 4GYJA 5EJFA 3QVXA 5ANRA 5KVQA 1GAJA 3K09C 5LA6B 1XZ8A 2G3YA 2Y99A 2X41A 3ZV7A 2R1TA 4A63B 2XYQA 5JMPA 3RTBA 2Q62A 3VVMA 2C29D 4FJ2A 1TM1E 3RYIB 4DMMA 2WDZA 3RS0A 4E33A 5CB4F 2WBLC 4QYTA 3KEAA 4PYQA 3LL4A 3EF1A 3CNHA 3NMUF 4NIMA 2QZPA 3SY8A 1KXZA 2XVXA 3V1KA 1KJQA 2HBRA 1H8EA 4HWKA 1VL0A 4X60A 1ZA2A 4Y6SA 3CRMA 3B60A 2DHDA 2VHCA 3HGTA 2ZSBA 1XT6A 4LG1A 5SICE 5D51S 1PEDA 3KKOA 3FXAA 4I99A 1JDSA 1LRJA 1C7QA 4RTKA 2NO1A 3EEOA 1M6HA 1PZGA 1K3UB 2Q07A 4CF6A 3ESAA 4CLOA 5MN6A 1MXHA 2IIVA 4BU0A 5H68A 4BE9A 3ZQUA 1T26A 1OH7A 3Q0EA 3T8YA 5IX8A 3ZHTA 1ZSNA 5I7VA 3CINA 3DVQX 5FLXA 1YS4A 4MH0R 2P4EA 5I3ZA 5AXCA 1M1UA 3ZNPA 3TOZA 2C3OA 3VR5H 3IDQA 2ZGGA 3V97A 4EZEA 4WWPA 1C7JA 4M60A 4RCZA 3MEKA 2QX6A 3GFRA 1ESMA 1OA0A 5KAMA 1L8LA 3ZBTA 1HZJA 1M0WA 2XOEA 4QUHA 1BHJA 2HZ7A 3D1VA 3T0GA 4FIZA 1E7YA 1TPYA 2LGJA 3UB2A 2NO9A 4GPMA 3C8UA 4BV2A 1E4YA 2C31A 3RYCB 4WX2B 3ACCA 4YEDA 4DLVA 3FUMA 3CXRA 1KPHA 4BIMA 3TW4A 4N03A 3AHEA 5T8KC 3TMAA 3UT5B 1CHDA 3PXUA 4GDFA 1W34A 2EJTA 1M9NA 3T7TA 3V1UA 2D6FA 1IJFA 2PZJA 4ZCTA 5E1DA 3N2GB 2JLZA 4ND3A 1V2HE 2REXB 3IV7A 2YNMA 3ZE7A 2CW5A 4DLLA 4R16A 2VXCA 3ROQA 2J46A 3GJ5A 3OFJA 3SYKA 4UNSA 3OJXA 4Q12A 2I4TA 2O3JA 1GNVA 3R40A 4WSOA 4RMJA 3UK6A 1LLDA 2F48A 3VR5D 1EVZA 3U7QA 3F7MA 2HMWA 4ZU6X 4BMVA 1YNSA 1JQAA 4CPDA 1X9HA 4D8TA 2F3TA 3BIXA 3ESYA 5FRDA 2O7RA 2WD7A 2B83A 1EFRD 2R05A 2WQZA 1D2GA 3TPFA 2C96A 2OG2A 1JDBC 1C3LA 4EHJA 4ARZB 4JBHA 5JD3A 4EA7A 5ICEA 3MCUA 2XZTA 2ZWMA 1QP8A 3G8BA 4KE9A 4R3UC 1TIBA 3SHQA 5CBPA 4PVCA 5FUBA 2I1VB 4G0XA 1NXTA 4LJ5A 4ITUA 4L27A 4MP3A 3EXAA 1IM5A 5BWMA 3AVOA 1EX6A 3JYSA 4IXWA 1TVKA 3P0RA 1J8VA 3Q1LA 4DLZA 4AS2A 3H9EO 3QIVA 2Y67A 3MUNA 1U6KA 4FYJA 2BY4A 5AVWA 3KQVA 4ND2A 3G2TA 2QUHA 2ZB2A 4WHMA 3CN9A 4GPZA 1TM7E 3TLGA 3DV9A 4C7VA 5CMYA 4L4UA 2FZKA 1JA9A 2Q49A 3LP5A 3I05A 3RU7A 5B3JC 3INGA 1YCHA 4BLOA 4QPDA 2FG7C 4ZOEA 2JRCA 2HMTA 3FNQA 4LXQA 3TWOA 1U7ZA 3CHQA 2C78A 3CF2A 1ZUNB 3N8DA 2PWBA 3VKFA 5AVUA 1K8YB 3QFTA 1WDWB 4FEEA 3BWCA 2V7QA 3F5QA 4LCTA 2JHPA 3VTYA 2DWCA 3GZNB 1YDMA 1TMGE 1SXHA 3L01A 1EPUA 3Q9NC 4RA6A 3GLRA 3WL6A 1KWKA 5A5GA 3TFQA 1KZ9A 3DZDA 2H00A 3T4PA 4ILHB 5EMJA 4F12A 2IU3A 5EJMA 4J0GA 2VJDA 4RQBA 1OKKD 1B8OA 2DSNA 2OO5C 5JNUA 1OROA 1Z3YA 4WGGA 2O8CB 1G5TA 1UT8A 1QG0A 1XDUA 2CG3A 3GLIA 2PLAA 2WDPA 2NVUA 5MFZA 2RJ3A 4QX6A 3ND5A 3L40A 4B8YA 3KEQA 1G8HA 1Q0HA 1TKAA 2WXQA 4WKOA 3L0CA 3RRFA 3MSXA 1YJBA 3VSCA 1IQRA 1B74A 3NQ41 3MQ4A 7AT1A 3IBYA 5HTOA 1ZK3A 1ZAKA 1YYHA 4BGEA 3I5XA 2P9BA 4JLMA 2OORA 2UKDA 2YRXA 2JGDB 3WHPA 4LJ8A 4XA8A 1PL7A 1WXHA 1K27A 1VJCA 4BETA 2G70A 3R7NA 3PENA 2AFHA 1HFWA 5EIBD 1Y3DE 3E9QA 3QB2A 3QSGA 4OFXA 3RYHA 1EWQA 3UVEA 2OFFA 4X9XA 3UPVA 1T0PA 4B32A 3DBHA 4BO8A 2PJZA 2JNWA 1GPJA 3MT7A 1YMQA 3L22A 5G53C 1N5RA 1JAYA 3DWIA 4N54A 4Q93A 4Q4AA 2BI7A 1YKFA 3PR2B 1M7GA 2WUEA 3JVEA 1LK7A 3CK8A 3G2QA 2Y93A 1Z4PX 3AS8A 2CYCA 2ASEA 4OFZA 1Z4JA 5CH3A 4UASA 3MYVA 3H6HA 3PGXA 5DYGA 1A1SA 4K6CA 3KO8A 1VHTA 2P8SA 3DL2A 1IOZA 5PGMA 1COWD 5LQCA 1O1SA 1D6NA 1LBIA 4HMOA 5FUWA 4N8SA 2CT8A 5L8VA 4HDSA 5AI9A 4BGVA 1NTOA 4LHXA 4ZYXA 4HCJA 1Z4LA 3W5AA 4W9RA 3GEPA 4IIYA 2DUMA 4YT4A 4DWOA 1VHDA 4WW0A 3HLKA 2AJCA 2VDWB 1RAFA 4ESHA 3RUPA 1QFMA 1I24A 3EXIA 3EG9B 3GAFA 1E9RA 2D3TA 4E30A 4JVMA 5GV8A 3ROGA 4HS9A 2KW5A 4MVXA 5CK4A 3VXKA 4L3OA 4RF2A 5BNTA 3K5WA 1R0ZA 3S2SA 4CKZA 4PFJA 3WBBA 3A32A 3EHDA 3TO5A 4RJKA 5TIIA 5BW8C 3L9XA 5CDHA 3L0OA 4US0R 2ZRPA 3BM5A 2H1SA 1SXQA 3VZQA 2I1KA 4AL4A 2XVAA 3TJMA 3M5CA 4O59O 1EKXA 5A2GA 1DO2A 3OM8A 1F2UB 2CVQA 3DMRA 1H69A 4H6WA 5AUOB 3KJHA 5LPNA 4AXBA 3AFIA 3FHTA 4I5FA 4YLYA 4Q7LA 2BE9A 2G0NA 5HRCA 4LE0A 3SFYA 2W7TA 2W2KA 1NFIE 1D5WA 2AD1A 1OUMA 2UXBB 3K0BA 4NPAA 5CT5A 1RU3A 4D9NA 3GXBA 3S68A 4CDNA 2IU6A 4OQ4A 3SCZA 4B4OA 5JVDF 4P7JA 2GPBA 1EXVA 1WHTB 3S40A 3U49A 4YV0A 1J56A 1BHSA 1S4QA 3RHSA 1Z6YA 5AKJA 1ISPA 1XTQA 3Q6IA 3KS2A 1LW6E 1M2VB 7REQA 1TT5B 3AP1A 1PWEA 4PZPA 4LF6B 2YHBA 1C9EA 3WO0A 2RKOA 3V31A 1THZA 4DCPA 4HVBA 1AU9A 3ZI7A 3RWBA 3OFNA 4FR2A 2A33A 4FP9A 5IN4A 1UDAA 1A27A 2G36A 3AIIA 1D2AA 1RAAA 4GA2A 1QNLA 1NY6A 3K6KA 1RAEA 2EGGA 1KPIA 4IF4A 1C1HA 1SPXA 1ZD8A 4UCQA 2GO7A 4Z1MA 1PLJA 2EINE 3K8YA 3EBLA 1TMOA 1NMZA 4C7BA 1YBMA 4BMNA 3IP1A 5K0CA 4GOOD 1B0UA 2OCXA 3DTYA 3C8HA 4JLBA 3L8MA 2QTWB 3WI7A 4K5AB 3MZLB 1OBCA 4M9CA 4GGPA 4KDCA 4MRNA 3HJAA 5J3JA 1UINA 1SVWA 3CKCA 4GXTA 1E6WA 4J9VA 3H05A 4JLKA 4GRIA 1W5SA 1OPRA 4I66A 1Q11A 3TEJA 1JIVA 5CH5A 4MDEA 1KEWA 1VRCA 3NTQA 1Q16A 3ROMA 4KZCA 4NWIA 3L9WA 4EQ6A 1N52A 4JKYA 2ZJ8A 4QJ3A 4Z53A 5DXJA 4IXDA 1DQSA 3BL6A 5EQJB 4RV9A 4WZ6A 4Y2RA 2GFHA 3OTIA 3TRHA 3EVFA 2WXHA 2ZU0C 3QDNA 3U61B 4LHVA 3U9WA 4OLHA 4XVUA 4G1TA 4FOSA 1ZU5A 2AZ4A 1Z63A 1SUWA 4RHEA 1TJ4A 4R2HA 3DMTC 1X1QA 2ZZKA 3AVPA 2AC4A 5FLEX 2DF8A 4KUGA 2V6FA 5G0SA 3VKWA 3AOEC 1GM5A 1I6KA 4TQ9A 5JO9A 4NCJA 4KOEC 4R7LA 2JI7A 3IEMA 2Q6KA 3TXMA 1RXYA 2OYRA 1ZJZA 4QD3A 3MTGA 3GLUA 3RBXA 4TLMB 3LT4A 2ACKA 3K1YA 4OK5A 4ALJA 3FLBA 4DZRA 4GO1A 3LRTA 4K0RA 3C1AA 3QVMA 4PS0A 3QFRA 3TD6A 2DU8A 2VG8A 1WPXA 4U6QA 3A26A 3DEYX 4AVYA 2WM8A 1YXMA 2WAXA 1QU3A 2G0AA 5JG7A 1RM4A 4L73A 3DD1A 2BELA 3BXXA 4D4GA 4G01B 1LU9A 5E3HA 5AW3A 3MWDA 1GAQA 2BFEB 2X1LA 3V2IA 2HC9A 3CU5A 3HVEA 2Q21A 5JRJA 3ZOKA 1JYEA 3PCRB 4DLKA 4RX1A 3ANMA 4HAVA 3PVZA 5JPDA 3OIGA 2X0NA 1QFSA 3E2MA 5K6AA 4IYPA 2IF0A 2ZI6A 4GI5A 2EJVA 3SNKA 4OL9A 3HKBB 1HKUA 2VSYA 3L1IA 3SFTA 1EFPB 2XA2A 3GCGA 3KVYA 2H4ZA 1OPXA 2XCRB 1K7FB 5E3JA 1GTZA 1Y1SA 4UFOA 2ZWVA 3A11A 1Q22A 4AG6A 4JU9A 2J30A 9MHTA 2X4IA 1W2GA 4D74A 3A6HA 3G68A 1S3IA 3P4UA 1XLWA 1E79A 3D54D 1L5OA 4E5KA 1F4PA 1NKTA 3D3QA 3ASDA 3CZAA 1KZ4A 1WTAA 1RLOA 4U0SA 1Z2CA 4QHTA 2EATA 1QYDA 4OHYA 1U7PA 1H8ED 4EAQA 3M81A 4CEIB 4OFBA 1O6CA 4OQXA 1QGZA 4FB5A 2GO1A 2YBDA 1K9SA 1BXKA 5DLQC 3DO8A 2J9FB 1R2QA 3BWVA 3GNSA 1LBTA 2EZTA 2H2HA 2FFRA 1JG3A 3ER6A 3P5SA 4Y2JA 3MG9A 2Y6VA 4BVLA 1GGNA 1XMJA 4EHAA 2XR1A 4KO2S 2A7XA 2HEIA 3HWRA 1FEZA 3SJCA 5EMMA 2D5IA 4N48A 3GZ1A 5IAAA 1FRZA 1H4QA 1VCOA 3ZKWA 1KT0A 3CUTA 5LMCA 2WE7A 2YWDA 1YIAA 4FLEA 3IUMA 3TGOA 3EUEA 3A3KA 3JZIA 4KE7A 1XCJA 1TF5A 4BO5A 2JD1A 1FNMA 1VI5A 4ETMA 1LGYA 1I2BA 5JNLA 1ZWLA 2NV6A 2R7MA 1I3KA 3LW8A 4JCCA 1PGPA 4CV0A 3ASOE 4Q9DA 1BKSB 5KJ6A 2P6RA 5K3FB 2IU0A 3EXHB 3PWTA 3NP7A 1ORTA 3IPRA 2GJ9A 3TQFA 2P6NA 5JRZA 3OCCA 4ZRNA 5LYJA 3ZU6A 2CY0A 1MIOB 3PUXA 3MMNA 3GZ2A 3DSVA 3UXHA 3BE5A 1YL6A 5HF9A 2C7QA 4E5SA 3MUOA 3WGQA 1RXVA 3EZLA 3OU6A 3WWCA 1DJPA 3TIGA 4OXXA 3U60B 3MIZA 3CGHA 5EUBA 5FZQA 1J0DA 1GQRA 3DMFA 4IIXA 2JCVA 4XUGB 2YC2C 4G1CA 4PLZA 3RU2A 2YNMD 1L8QA 3GVCA 2I6HA 1GPH1 4QQFA 3BE4A 4WDQA 4U8YD 4BHTA 2BD0A 2BONA 4RIEA 2XAAA 5IBRA 3ZUVB 1Z0AA 2BFNA 4AKGA 3JAWB 2IEIA 1TM2A 4H6PA 1F9AA 1GNRA 4QGSA 1P3DA 1B6GA 1T3HA 2XI4A 4ZHSA 3IUBA 3B6IA 5CM2Z 3UT7A 2Z08A 2Y1WA 6LDHA 2IY7A 1BDBA 2XCSB 3SFZA 1JHPA 1LNSA 4TS1A 1XLVA 4ENTA 1J2YA 4C2TA 3H87A 1MVOA 4EZJA 1P2VA 4XB1A 3LCRA 2Y05A 9ATCA 1GADO 2D2EA 1EP9A 4H59A 1XTRA 5AP9A 2J4DA 4NCKA 4B0OA 1U5AA 2GRAA 2CHUA 2Q2NA 1CZUA 5F73A 1LZLA 2AOUB 1A8IA 1VG1A 3QHQA 3UOAB 4LWQA 7ADHA 2XOXA 1UWKA 4ER7A 3U0BA 3REGA 4OD0A 5A06A 2C4WA 4OVUA 4QU9A 2X77A 3HPQA 3V9PA 5I7WA 5A6SB 1IK4A 3O38A 1YJ8A 2JJ2A 2PZLA 4BP1A 1HNNA 4JPSA 5JI2E 7GPBA 1ZBDA 2J31A 5E4FA 3EIEA 3K71B 1JEQB 1WG0A 4MRUA 2G4VA 4ZALA 1FFXA 3AUUA 4CBVA 3HJRA 3E7PA 2YXDA 2NT4A 3DEAA 1G42A 3BD6A 1NC3A 1CJCA 2Z9DA 3I8OA 3W7BA 2V7QD 4MYUA 4D98A 4I1MA 4NCBA 3E0XA 1K97A 3UXYA 1CP3A 1UJCA 1W36C 1A9YA 2ABWA 2ETVA 1K4YA 2BCGY 1Z5ZA 3JVDA 5L4NA 3G2HA 4X95A 4QJIA 4CDGA 3RKRA 3USES 3I4RB 2ZIXA 1UT5A 2YZNA 1CUCA 3FTYA 3KJGA 3DSUA 2APJA 4BP3A 1GUYA 4DWJA 1UFRA 2XD4A 1HEYA 2RBEA 4L5JA 5LQMA 4KQMA 4BJ3A 4OYRA 2Q4TA 3TRDA 3USCS 1Y63A 4YRLA 3T9CA 2KC7A 3M34A 1R50A 4ABTA 5F21A 1UFOA 3BGIA 4MUKA 3HBAA 5ICSA 3U48A 3JR3A 3TWXA 5M7EA 2P2DA 4Q3AA 3HNRA 4FULA 621PA 2NUPB 5CB0A 2V8OA 1KDPA 4K6KA 2GBFA 4DLTA 4X41A 1CZOA 1ZU4A 3M83A 1L7EA 2AK2A 4BJHB 1NZJA 3WWOA 1BFUA 4YJ3B 3V3KA 1V3VA 4ZTZB 3GPCA 5KX5F 1MP0A 3ULQA 4JX9A 4TKVB 2VQSA 1Y7LA 5JE8A 3L9TA 1K3TA 4DMKA 4E07A 3QU7A 1CRQA 3LS2A 3JRXA 3RI3A 1GZSA 1IY9A 4F4JA 2HXGA 1HGXA 5A3JA 3BWDD 1WOYA 2YHIB 4BMOB 3V4ZA 2IPOA 4HZIA 2HWKA 1GFWA 1BTOA 2JFZA 3CH6A 3JASB 4NZPA 5DRTA 3EXG2 3T5PA 1NLFA 2XQVA 3FULA 4J4TA 3ABME 5JASA 1HL3A 1OWLA 2X3UA 1TM5E 1V16B 3C8DA 1QGUB 4KR0A 3W5DA 1Y6FA 1KO1A 1F0KA 4ISBA 5JDIC 2DSTA 4H7EA 4ZIRA 1EXDA 1UXGA 4LC0A 2G8NA 3D8HA 2WC1A 1DAPA 3KZNA 5AOBA 3COJA 1RXUA 3HKEA 4UTOA 3PHLA 3N7AA 5G2OA 3KHTA 1HWYA 2C9OA 3T9FA 3QP9A 4F3NA 3GGDA 1SHJA 1J8FA 5F1YA 1DBVO 1NBMA 3IR5A 2P69A 3ZCXA 2VDOB 3C3PA 3ZW3A 2PR7A 1CUGA 2QY6A 1W0JA 1A17A 3NM4A 4I08A 1H4TA 4BV3A 3NAGA 1K9VF 4ANVA 2XUPA 5HXAA 5EJ8A 4R69A 3NTRA 1EBFA 2KXPC 1CJSA 4L5YA 2CXNA 1V35A 2ONYA 2PSJA 2R85A 3K4PA 3EIUA 1P7WA 1MVNA 4NAVA 1SRQA 4JDPA 3CRW1 3G0GA 4HDQB 1I1QB 5JZ9A 5ALDA 4P3KA 3C6KA 3KVVA 2WJHA 4YRZA 2ZQYA 2P9CA 4IH4A 4EVIA 3CC8A 1PJ3A 4B6GA 2EHJA 3R3SA 5D86A 3M1YA 2W2PA 2ZSIA 1O5IA 2GQ0A 3TEMA 1E7WA 5LXTF 3DZCA 1ZNYA 2FULA 3X1MA 1RQ7A 3I6QA 3T0IA 2O50A 4IEFB 4LJ4A 3CCCA 1OFGA 3F5SA 1R6UA 4A23A 5DX1A 3UFXB 3FNEA 1IYGA 3I5MA 1M1YA 3JQ7B 4LUCA 3RIXA 3D4LA 4N5LA 4H1WA 2XIJA 3OJFA 2WKRA 2QB5A 4KLCA 2GW1A 2V1UA 2GJSA 2XCCA 4IY1A 5AHRA 2PUCA 4F9GA 3NW9A 4XUDA 4BTBA 4HBZA 4TRQA 4QSMA 1WEKA 2QUKA 4FSXA 1PI3A 1E2KA 1K3FA 5EJIA 2XEXA 2HLNA 1NXVA 3WJ1A 3OFND 3DW1X 2ILVA 5JDCC 1DARA 4AURA 2O3QA 4EHIA 4WV3A 4OBEA 4BXOB 3OCWA 1P29A 3M9LA 1KIFA 2VTDA 4DCVA 4DL9A 1VB3A 3JQQA 3SC4A 4KYOB 2NO7A 1ZO8A 5M3BA 4Z1MD 2H8KA 3PTZA 2AHOA 4ZAVA 3BILA 1O4VA 3KKZA 2Q5JA 3CYFA 4IAOA 2ZTVA 3JQRA 3TE6A 1PZHA 2PR2A 1Z5NA 3I1IA 1OD6A 2FEWB 4Y2GA 4YVOA 1RRCA 1J24A 4MITA 3NJ8A 1S3GA 2B61A 2DWPA 4L0QA 2KS6A 1Q0RA 3O3MB 1KQOA 1KZOA 4CQMA 5FOQA 3U1VA 1OLSB 1ZD3A 3PSAA 2VEOA 3WLIA 3TTWA 1KBZA 4B9EA 1DG9A 4MPRA 4MROA 2HQSA 3BULA 1IAVA 1XMOB 5FOSA 5C8XA 3W4JA 2FLKA 4F1SA 3IT0A 1JEAA 3IQDB 5ETJA 5JA4D 2P9EA 3RBAA 1C4OA 1HTBA 1WPQA 3UKUG 3GB9A 2FQYA 4LEUA 3JUIA 4Q9NA 4AYWA 1O0SA 2XXJA 1UC9A 4KXQA 2J09A 3QITA 1YVUA 4J0EA 2X9QA 1S2NA 2JDIA 1RE1A 1ODSA 1GEEA 5ES3A 4OLJA 3G23A 2SBTA 4FZJA 5FBRB 3I37X 3QELB 1BD4A 3TW6A 2QSJA 4XGQA 2F59A 3FGZA 5J43A 3FNGA 2IZ6A 1V9SA 3O8QA 3GT3A 3SJUA 3TBKA 1G1MA 2VKQA 1DBIA 1LPPA 4CU5A 4N12A 2WFAA 4XLLA 1GVHA 1YA0A 3DV2A 2OM6A 1J8MF 3OSZA 2QWXA 3VDQA 1OX5A 3ZU4A 1BVYF 4DNXA 1G291 1RSZA 1I2ZA 3K92A 3C6BA 3E5RA 4URXR 1SQFA 1RJ9B 4IL5A 4RELA 4OF4A 4KQWA 4B5KA 5KUTA 1GCIA 1W59A 1OY1A 4K2HA 1WCV1 1FCJA 2P2YA 2VYFA 4ITVA 4WFQA 1Y7IA 3K2IA 1QRDA 1UPXA 3HEMA 3VI3B 3PQ3A 4A4DA 1PV4A 1D1QA 3TNFA 4IIGA 3TX2A 3F9CA 5G55A 2XYPA 1ACLA 3DR3A 3S2FA 4MQ4A 4EL5A 4BNDB 4G2VA 5JNRA 3ASGA 4HXFB 5G0VA 5IBQA 2IHBA 5EZYF 1HT3A 1VIAA 2OXCA 3NP9A 2ZCJA 3UH0A 5G05C 3W79A 2NNLD 4CQMB 1KMQA 1EEHA 1XP8A 4I3GA 4QTYA 4JL6A 4AUMA 2FMHA 4DRZA 5ALRA 3E03A 2BEUA 3K15A 1MKYA 1M7HA 1Q57A 3C45A 3RRMA 5CYGA 1I3LA 2A0XA 5I48A 1E79D 2NO5A 3CWQA 2C0LA 3TB6A 1KAGA 2ZT8A 2J9GA 3FPBA 2H59A 4UQOA 1NSFA 4Z8YA 5JTTA 3RSFA 2Q9BA 3U7EB 3BBLA 4NOLA 4A7PA 3WP1B 1NPTO 2ZLBA 3SSMA 1ZH2A 4GOND 1U28C 1YU9A 1GA4A 3ESBA 2AOTA 2XYHA 1HNXB 2HA4A 4A2QA 2R3SA 4NABA 3LJ3A 1CNFA 3TW8B 4C01A 4JCOA 5ENQD 2NYUA 2FCRA 3RU9A 2B99A 1BIFA 2CZGA 4TLLB 4QDKA 3P0FA 4IINA 4KGVA 3ZCTA 1C2TA 3VPAA 3L3BA 1XXHA 5DSTA 3HFJA 3AKZA 1PJSA 1PL8A 1GNLA 4NZMA 3C3QA 4EKGA 2FZGA 4FE4A 1NR5A 4BRUA 3LQ2A 1R66A 4HQFA 1F1JA 5B55A 3H86A 2ZE7A 4CLXA 1JDVA 1Y8RA 1AVTA 1XCOA 4QFCA 4RVUA 2BPOA 1XYYA 3D4OA 1O95C 3ESXA 3CHRA 3CNEA 1GG9A 4XX0B 3GMTA 1BD8A 3BMOB 3EZ9A 2PL1A 2CFTA 3L93A 2Q5OA 3RSGA 4BVBA 1C7IA 3SOZA 1RI3A 4WAFA 1EMDA 1TL7C 3EDOA 4QTTB 5AKXA 4IXNA 1NJ1A 2A9VA 3PWZA 4RQAA 2IUUA 3RRZA 1CNEA 4N5IX 2HRDA 2I6TA 1GU7A 5FTLA 4PRKA 2G9ZA 3NDBB 1QV9A 3VAZA 3W2FA 5ED4A 3IVXA 5EQTA 3FMGA 4NQZA 3MWEB 4P4UA 3G2SA 2OECA 3HB1A 2LCQA 2ZIRA 1O0BA 3ZDZB 3P52A 3PRKE 2HQ1A 2QS9A 1V48A 3GFQA 2ZROA 4LMBA 4RSYA 3C74A 3CVOA 3FYUB 3KG2A 4FYVA 5D1HA 5IDVA 5K20A 4W4TA 4IP0A 1FTGA 1KZHA 3VOSA 4B43A 3UCXA 5GJCA 3SZ3A 4IX1A 4BN5A 1MG5A 3QTTA 2O8EA 3MCZA 3U26A 2NZ2A 4YT2A 1J7KA 5BSKA 1LK5A 1MX9A 3Q7RA 2EZ8A 1NW5A 1FYXA 2P35A 3SYNA 3CLRC 1RWNA 1RD4A 1D8EA 3LWNA 2QAGB 2IF2A 3GJTA 3EZFA 1LD8A 1QB8A 3IOMA 3GT7A 3H5AA 4FPXA 1LFDB 2FLVA 2G40A 1QHHA 4RF5A 1OY3D 3ISTA 4U2BA 2GZMA 5AJTA 3RK1A 2F1OA 2YIJA 2D5AA 1GKKA 3FZYA 5FIUA 3PPYA 3NHFA 2J5XA 2MU1A 3PQ8A 3UKOA 4MQUA 4KXXA 4X3PA 2ZJ0A 3ZWBA 4O4LB 4C07A 3NYRA 3R9AB 5EIBE 2M32A 3F90A 4PYMA 1XDSA 1BE1A 4MMXB 3UXGA 3CS3A 3FCUB 3DBRA 2ZE5A 1L5QA 2JJ2D 2LUHA 1MO3A 2I54A 1C81A 4TUYF 4OOFA 1KTIA 4IM7A 1DIAA 3EOZA 4WLNA 3GUCA 1V43A 1DU4A 1K1EA 2R00C 3FNIA 3WYBA 1H9BA 5F52A 4XI9A 2BM1A 3ECAA 4WXEA 4LNGA 3Q85A 4N9WA 3TQSA 1KETA 4GCOA 1BXRA 1JIJA 3AJ9A 1SCDA 2BFBA 4E2FA 4GZ3A 1S01A 3D6JA 3H1GA 1GP2A 2NXPA 1CJMA 1V5GA 4WWHA 3BJMA 1KJ9A 4KO8A 3STXA 3NWBA 2GB4A 2V5AA 3ZWXA 3GQVA 3DUFA 3HM9A 2ZDHA 3G7SA 1E89A 2G0TA 2X8AA 4GX1A 1AQUA 5EG5A 4HYYA 4EPZA 4NS4A 3W9YA 1KYZA 1NVVQ 2OCDA 3URZA 3NZSA 1MHTA 4DR4B 1AQLA 3OZDA 2XT0A 3QX9A 1BCSB 3N2KB 1S7CA 2MHKA 3LYAA 5P21A 5FUMA 4YJ2B 1QH1B 3UICA 1HDGO 4QO8A 2YL2A 5HE9A 4B4UA 5AN8A 3M9XA 3KVNA 3CEJA 3M6VA 3AU5A 2A0UA 4Y6CA 4WZBA 4FFLA 5IEJA 4ROTA 3UM0A 4PSKA 3B20A 5B1SA 2CV1A 2AWIA 2F62A 3ZTTA 4I6GA 4HD8A 3WHIA 2HU5A 4JUDX 2CL0X 3AJ8A 3PIDA 4MWZA 2ZRMA 3QKIA 4RK5A 4RXTA 1MTZA 3JQ8B 3OICA 1JSXA 1D8AA 2EP8A 1KL7A 4TXPA 4U1RA 2JS7A 1KR2A 4EJ2A 3H5LA 4H9GA 2RGUA 2QJRA 4H7JA 4LTMA 4H08A 3WGGA 1L1RA 5FWDA 3UK0A 3BCUA 2LV8A 3VO8A 4X7BA 4DUZB 2W70A 1N9AA 1EUCB 4KXKB 4G1UC 1B8PA 5TQJA 2XEDA 2HIHA 3ANLA 4IKEA 4POAA 4FBGA 2VP6A 4DR1B 3ZIUA 2SKCA 3BF8A 2CBGA 3W34A 5CCEA 5HG0A 4E1VA 4X1KB 2QVBA 3UUGA 1PJRA 1T4GA 1FF9A 1JPLA 1KYQA 3WMFA 5KYVA 3CUYA 3K9HA 3UJ3X 1HM5A 2QHXA 2ODBA 2B1GA 2E2EA 4MWSA 2DKOA 4NJOA 1W6RA 4ID3A 4K28A 3ONDA 2HJHA 2O7SA 4XYBA 2QLNA 2R5NA 1FVXA 4NZNA 3QXXA 2PL5A 1BEZA 4L7QA 4PZZA 3ITEA 1NBMD 5A7HA 3KKMA 2C7OA 2V6GA 2RI6A 1E1CB 4C0HA 2TMKA 5AD1A 1W0JD 3KUKA 4KQXA 2ZRGA 4ZEXA 4F86A 4ADSG 4CDRA 1Z5OA 3GLFA 3PNSA 5J2UF 3A9SA 5JIBA 2GYUA 1HDCA 1ES9A 4WH0A 5KEIA 1GYQA 1NQUA 4OY3A 5CBOA 5EKUA 4XB6B 2V0PA 2DECA 2IJGX 4BU1A 2PX5A 4WBXC 1O5MA 3HYLA 1VPEA 4ZFHA 3T7AA 1E69A 3LYLA 3U16A 5E6RA 3KP1A 1W7AA 2FDCA 1A88A 2BISA 2JD0A 3ANYB 3H0CA 5E4JA 1X0XA 4JEMA 2D7JA 2QX4A 4LJKA 1EFVB 2AFIB 3AF5A 3IPCA 2F90A 1M5UA 4HLUC 1GO2A 1DAFA 4FJYA 1NBEA 4MHTA 5TT0A 1T0JB 1QPGA 1XRLA 2FEAA 1QONA 1VHWA 4X65B 1BYIA 3UNXA 2Y0EA 4DA9A 1QH9A 2GWRA 1EH5A 3SBOA 4RTSA 1XQ6A 1X7WA 2Y77A 1MW9X 1I3MA 1HBJA 2PUHA 2AFIE 4OKIA 2CXRA 3MTAA 1W1IA 3PLRA 2WTEA 3T3MB 3NTVA 4PN7A 3DLCA 1RRFA 1HG2A 5K8VA 2W71A 3T4EA 5DBFA 1UQTA 4TV3A 2BFAA 1CQJA 1R3UA 1AUXA 4BBJA 4DPKA 1N5LA 2WMOA 1QBQA 3GJ3A 5IJAA 5DGDA 1WS6A 2HJSA 4KZKA 2WNHA 4IKOA 4QOGA 5ELLA 1X8KA 4PO1A 1B3BA 2BF4A 4AWXA 2D06A 3T12A 4I3HA 3D4BA 4HDCA 2A4ZA 2W6ZA 4HWPA 4X44A 3PXEA 2X8WA 4OHBA 1LJLA 4DPLA 5ANRB 4N1AA 4ECAA 1YZTA 5BV1A 2I2AA 1YQWA 1IY0A 3U6BA 1Q2XA 3B89A 4B3HA 3U3OA 1NVUQ 1WQ3A 4U7EB 5LJIA 2R1TB 1FUEA 1XNFA 4ZO6A 4KOAA 4MKZA 3ETCA 5EE1A 1S8NA 4RZXA 3FTFA 3EZNA 1SW6A 4CQMD 4OHFA 3UHPA 5FQNA 2A1TS 1YA8A 3MRVA 1KYWA 4H60A 4MW0A 1ICIA 1CEQA 3LQ4A 3R3HA 2YWJA 3ZKAA 4JJAA 1P7ZA 1VLZA 4GYOA 2JEOA 1NSTA 5G0UA 1V3UA 2DERA 4H1UA 1ZK2A 4R41A 2R5SA 5ADWA 1SKQA 5EE9A 2RFLA 4EGQA 2BFFA 2EKBA 2Q5EA 4IQ0A 4L5BA 1KZYC 1U2SA 3S70A 1BG6A 1VCHA 4TN5A 3K1TA 2G5CA 5JXJA 4CLOB 4LVUA 3QPCA 4ZI7F 4UATA 1IMJA 2ZBRA 2JDID 6GPBA 4PCVA 3AL2A 2C1ZA 3JQDA 3G2IA 3K2EA 4Z3OA 4EKDA 1S7GA 1CR1A 2Q0QA 1KEKA 1MDFA 3HN6A 5CECB 2F2TA 4AP9A 2J7PA 1KOFA 1F6DA 4I1YA 1LI5A 3DFUA 1GTL1 5CYPA 2BRUC 5JAQA 3UAWA 1U0TA 3AEYA 4UVEA 3C48A 3IA2A 4XVRA 1VE6A 4PV7A 1B6SA 4OU4A 1L7DA 2I8AA 1SUIA 2C07A 5JMND 3H2JA 4DIEA 2XUOA 2IFTA 2CHFA 2BTQA 1EUDA 2Q1XA 3QG1A 3QPVA 3R6TA 4RK1A 2O54A 1Q12A 3L07A 1UJMA 4FX2A 4DDMA 3L0YA 5A3SA 5C18A 3QE9Y 5KQRA 4W8GA 4KMOA 1CRLA 4OMDA 2C61A 4CTKA 3L8HA 5DI9A 2I66A 2DBZA 4BX2A 1CR2A 3KU1A 3OMLA 2X1VA 4M3OA 4X92A 3VTXA 2Y76A 2IPLA 1VP3A 2XA9A 3QUCA 1EDBA 1YR9A 5JYEA 2OEPA 4TRMA 4OEHA 3HJFA 4H31A 1UJBA 1KWGA 1ZVVA 2I78A 3AUSA 2XNDA 1JIQA 1UP4A 1H6DA 1JVBA 4KSYA 4TTSA 5HDQA 3K0CC 2ZSUA 3G7NA 3OTQA 5KTTA 2NYRA 5HKBA 3G5MA 1XQYA 2BSQA 1WW3A 4IULA 1T9GS 1RS0A 1XN1A 3ROPA 3U7QB 1NUAA 2ZJ7A 3VSAA 1M54A 3LBNA 4DI3A 2WD7B 5CXSA 1NNEA 3AG4E 2DWOA 1CNMA 2P5UA 2OZKA 1VA5A 3F5MA 1Z2EA 2AC2A 3MX3A 3KHSA 2YXPX 1L5MA 1XCPA 3DE1X 5FOVA 5CBPB 4KVMA 4OP3A 1GIAA 2ZOSA 2IYUA 4K40A 1D3AA 4M49A 2RGAA 2EBFX 4GMJA 1Z26A 1ISRA 1RKUA 3L6BA 2WYWA 3KXLA 1DC6A 2CBXA 1XZMA 1BX0A 2X0IA 1TVKB 1RZUA 2PXCA 3K2QA 2PGJA 4V0RA 3NH6A 3D3EA 4X20A 2KE5A 3UOGA 4CLHA 1HKHA 2X5NA 4N8DA 3A0RB 3TLGB 1M0TA 3MC1A 1JZQA 3CZPA 2H48A 3G9XA 3A9RA 4U02A 4US2R 1RAGA 2WHRA 2HW8A 4QG3A 1SXPA 5JCZA 1EJ0A 5IF3A 1U2QA 4D0GA 1AMNA 1GCUA 4Z9AA 4ENUA 3C3JA 3EC1A 1LRKA 3LWZA 3I72A 1PWZA 4OQDA 2UUBB 1J99A 4FSHA 4LJ6A 4TYWA 2JFBA 4LGMA 2I7XA 1ZSVA 5JO0A 5HK9A 3QLUC 1UZMA 3LT0A 1UN9A 4ERNA 3ELUA 1YDFA 3E7FA 1TYCA 4IDGA 3C1UA 4RA6B 2DFDA 4FHFA 4C0MA 2AFRA 3BQNB 1E1DA 1DC2A 3K70C 1LDNA 3ICQB 2YOGA 5F33A 1AV6A 1JHMA 2ETBA 2Q8QA 3FPKA 4NLLA 4KPEC 4D44A 1V1MA 2A9QA 3PVCA 5T4YA 4FCVA 3GLIB 2NVUB 1JSZA 5CXUA 4JBLA 4DMLA 2P8JA 5CCLA 1C0EA 4MW6A 2F1JA 1TW2A 4IG9A 3FTVA 3OE5A 5IWAB 1X42A 1CUFA 5E8JA 2GARA 4QGGA 3QFCA 3PXGA 4EX6A 1R6TA 3AFMA 3MOGA 1OHHA 2YXLA 1W73A 2WOOA 1AO3A 3NAWA 4WNCA 3A6ZA 3GLIE 4ZPJA 1NMXA 2PRIA 4UMFA 4G1EB 1SR8A 3FFLA 1GUBA 5FI1B 2YY6A 2O2EA 5C1BA 3UUFA 1JCRA 1BJTA 2FEZA 4YREA 2DLDA 4BFYA 4PX3A 5FBHA 2AFHB 2PBZA 1PV1A 3L7JA 5C7YA 4Z4FA 1XL0A 5C35A 3C97A 3DXKG 2HMYB 1LY1A 2JI9A 3GDFA 4HYQA 3RYHB 2EFGA 4B7XA 4YJGA 3IGFA 4CI0B 3COZA 1E6CA 3DBHB 2HDWA 3V2XA 1QR2A 4JHXA 1ZBPA 4FC7A 4WIAA 5HMMA 5K2MA 4U63A 1TAGA 2ZSEA 4HAOA 5AW4A 1O94A 2VUIB 3E22A 2J9YB 3ZGVA 3MT8A 2HY7A 4J3JA 1X2BA 4Q4AB 4BEVA 2IXBA 1GGJA 1YCSB 2AFHE 4LQCA 2QTGA 3QNMA 4BKPA 2ZYDA 3A58B 4QFBA 2PVPA 1U2VG 3GP3A 2HWXA 4R1PA 1CQWA 4JEIA 4C2AA 3W5IA 4MI9A 3HXPA 3ZYQA 4YPOA 1HK7A 2QMOA 3L7KA 4FXPA 3PRJA 1TRKA 1W4LA 4Q16A 2IWHA 3W3ZB 4UJ5A 5HSGA 2EZ9A 2IHTA 3UT0A 4Q4CA 2VYCA 1OVGA 5KTSA 3VRHA 4V2UA 4HDSB 4NFLA 3VNBA 4BJ5A 2CUZA 2V0NA 4RE6A 5HHTA 3UX4A 1P91A 2FQ1A 3IKVA 1GZUA 1T0HB 4AI6A 4FOPA 3MTBA 2XYVA 1CB7A 4PX5A 3EU5A 5CRUA 4AFNA 2Z1NA 3QEMA 2IO3C 2F67A 4LX0A 4D42A 5DHFA 4JJKA 3EXIB 3LKZA 4C08A 2YKGA 3HB4X 3KEGA 2ZISA 5IUKC 4AEZC 4D96A 1MJGA 4PGFA 1JI0A 3AHIA 1EK0A 4RXMA 1O6GA 5AQ7A 1E3EA 1PAUA 5EP4A 3RC7A 1MLDA 2IHUA 3V4SA 1YGYA 2QRJA 1Q0QA 5F2OA 3CZRA 2EVWX 1G59A 3B78A 3DEPA 4YQEA 2VJOA 4LWZA 3IC5A 4TV9F 4AJWA 2ECFA 2J08A 4PLHA 3L6AA 1CQPA 2XX3A 4LCBA 5BV0A 2W2KB 1ZI6A 4EY6A 4GF5A 1FP1D 3DQQA 1TNZA 1N4DA 3FBWA 1T6YA 2P9IG 4O2AF 4XDYA 4Y6OA 2ZPTX 2E6KA 2ZSFA 1TK9A 2WV7A 1SVSA 1EWKA 1V5WA 3RHZA 1I3CA 2OXEA 5CA0A 3OQVA 4EB6A 2I8LA 3VR4A 4B82A 7REQB 3JYQA 4G41A 5IZ4A 2V7XA 2QORA 3U40A 2WWHA 3AR4A 4KLRA 4P5EA 2R6R1 3MWJA 3D7LA 3JAMA 4DV5B 4IQ4A 1DS6A 3SDSA 2CLCX 1MC1A 4B4VA 3KZCA 2EFEB 1NJFA 4BX3A 2LD4A 2XZDA 3BH7A 1FNSA 2X6TA 5AI0A 1XE3A 2GTIA 5HZGA 3LRXA 4IOJA 2ZYVX 3GHHA 1WLYA 1QGAA 2HA7A 2XMGA 2JLBA 1NOIA 3X2SA 1HDYA 4RVSA 5EIOA 4WADA 2XNHA 4NXMB 3NBKA 5CM9C 4LNUA 4AMUA 1W29A 1GT6A 3A1SA 2EQAA 3L7NA 3P26A 3GLKA 3ORYA 4DWVA 5AM4A 1LSOA 2QLMA 3NT4A 4W99A 3V7YA 2YIVX 4QODA 2VQ6A 4G26A 2A4MA 3T9KA 1CUVA 5E9QA 3PKZA 2GN9A 3ZDYB 3A4TA 3KOYA 4EQ6B 1JQJC 4PZDA 3CGWA 1FMJA 3RHFA 2JI4A 3QBEA 3UTMA 2VJQA 4PLFA 3QE3A 5IZCA 3VJMA 5IH7A 4HMQA 3AR6A 2GK7A 1GFIA 4XGRA 1RYNA 3AILA 3G5TA 2WI8A 4C7OA 1H94A 1MO2A 2PSDA 5EXSA 4KUHA 3MGBA 4KWCA 3LCVB 5A9TA 2N46A 4D57A 4U8VD 1AWCB 3IMFA 2OEWA 1B3RA 3CLJA 4IVQA 4BRSA 5AKKA 3HN2A 3DWFA 2Y0CA 1JF8A 2NSJA 3N76A 3GZ4A 2PVCA 2NSLA 4JNCA 4ZDJA 2BFDA 4GPIB 3K05A 3E1GA 5K0NA 1A9PA 2V6BA 3R76A 4HB2A 4BKRA 1KEPA 1JAZA 1DTSA 4JKOA 3QNUA 5ITSA 3AUJB 1T36A 1WPGA 2WJ3A 4JHRA 3B9PA 1SUEA 4FEGA 2I6GA 3IS3A 4JI2B 5FBWB 4J1NA 3MYYA 4NHOA 3GELA 4UEKA 3CX3A 4K05A 4E3WA 2GM3A 3RJ5A 2XT9A 3MWDB 3B1JA 2EEZA 3KD7A 2W5UA 3RS8A 3HYMB 3EIHA 4BKQA 3QM1A 4QL3A 4UEJA 3HVEB 2PEYA 3FDZA 2BIFA 1JEEA 2W6PA 3UW3A 4GMXA 1N8NA 3LDUA 3LK6A 2JIOA 3WKDA 2F1KA 1LBSA 1O5TA 5JRDS 3AJRA 3WL5A 4L7TA 2ZYIA 3C3MA 3OMXA 4UUOA 4BO9A 1GZDA 5BQFA 3FTWA 2MJLA 1QO7A 4N7JA 4CIVA 4YAWA 4Z4IA 4E13A 1UZAA 4E46A 2RFMA 2WB2A 1RWWA 1AE1A 1QGOA 2BKVA 3SQDA 3SIWA 4BO1A 5D6OA 4B89A 4ZAFA 3KQHA 2VHUA 3DVLA 3ZPXA 4OGGA 5B4TA 4DGSA 4NU0A 3G2UA 3Q5MA 1GZ6A 1MHPA 3K94A 4BNTA 3HDGA 1OYVA 5HJ5A 4OAVB 3HSSA 2ZGDA 1U7HA 1RM0A 2C2LA 5ALHA 1CT9A 4A1SA 3C8MA 2Q6TA 5F3RA 3H1AA 4EYKA 5BOVA 4OVVA 4IZOA 2H7XA 4DILA 2J5RA 1TQ8A 2PQ2A 1WDYA 2E7ZA 2BEVA 3PGJA 3V2UA 5DYWA 1SIUA 2XDWA 2J3IA 4YASA 1Z74A 3RIHA 3LBAA 4QXMA 3S8EA 1SCQA 2BZGA 1CETA 2GBGA 2B5OA 2X2FA 1U8CB 2WA1A 4BVAA 3C6YA 3QXHA 3TTVA 3ZNGA 3GJXC 5F64A 3ZKWB 3QRWA 1TNYA 1R6AA 5HK8A 1UIMA 3LX6A 3U7IA 2A9FA 3SC3A 3CMMA 5ALOA 1AKTA 4HH1A 3KXDA 1NV9A 3NUGA 3BICA 4DCJA 1ISHA 4BUZA 5TMPA 2YJTD 3GYGA 3BWYA 4IHJA 3P0IA 5CFOA 1U98A 2GN4A 5AKYA 3F4KA 5FCDA 1TZMA 3WL4A 4EKEA 2YICA 4W5QA 4KODA 3DZKA 3VYTB 3WNQA 2W4QA 4DX2A 1SVIA 1AOXA 1E8NA 3VUEA 3M4ZA 5LYJB 2JW5A 4A8JA 4P2GA 4P7BA 3K20A 1U3UA 2WUVA 1Z3CA 5G4KA 2TECE 1OI2A 3LLMA 4UM7A 3X44A 1GPUA 5FL7A 3SZGA 4CLRA 2RGXA 3IIIA 4AN1A 2CNKA 4LS3A 4OSEA 4GSYA 1FSFA 2AKAB 3AGQA 3VOAA 1DJNA 3VH3A 1LS1A 1N78A 1Z6ZA 4G5GA 2OLKA 3QFFA 3R0VA 2XNDD 4MDHA 4YC7A 1ZXLA 5L40A 4JBIA 4DLYA 3GAMA 5BWOA 4JBNA 1JJAA 1JN0A 3ZCQA 3R09A 3EDTB 5LQKA 3KTDA 2ZXWE 2M6LA 4MP6A 4TS3A 5ARCA 3EARA 1T8SA 3COSA 2Q28A 3ZI0A 5A4JA 1L4MA 2WFLA 1YGPA 1RP1A 1UPAA 1KR5A 4ONEA 3NGLA 3C3CA 4I1AA 1EUQA 1T0UA 3TRKA 1QWOA 2SCUA 2MYTA 3TL6A 2EQBA 2G5TA 3TTUA 1OVMA 4J0CA 1M75A 4BECA 1ACJA 3HLTA 1NIJA 1N2BA 3A1CA 2RD0A 4Q34A 3VR1A 2PZFA 3Q3EA 4ZAZA 1O5OA 2P68A 4AWBA 5IXYA 2P9FA 2JAXA 4C6SA 4F11A 2RMKA 4K9SA 5T41A 1T5TA 4EOGA 3U4AA 2AC7A 4JP5A 4HS2A 3PNQA 4FE7A 4B9AA 3BOSA 1DRUA 2J45A 3W9UA 2QRPA 3U1TA 2OTCA 5KTRA 2PJDA 3NKVA 3ZCUA 3FYHA 3JQEA 4CL0A 3FMFA 3WLLA 2JIRA 1ZUD1 5PNTA 4GZCA 1UAYA 2R9VA 3ZY6A 3IELA 3C3DA 3H84A 4PHTA 5ENPD 1NXPA 2GZAA 4FVTA 1FFXB 1SUBA 4FMPA 3QBDA 4NCAA 3P9YA 4B44A 3FB1A 1C50A 4U4AA 2G83A 1HSZA 1XVAA 4MPJA 1U3GA 1DRWA 1DG1G 4R8LA 1OAOA 3V8MA 1U2ZA 1SBIA 1D8TA 2V6JA 4MXDA 2QG4A 2ZIXB 3WAGA 4F1PA 3ELBA 2P9HA 4JIMA 4JJIA 1D2CA 4LFCB 2E1PA 3UYKA 4QDXA 3A6PC 1T5LA 3MLAA 4XCQA 2L6BA 4KYVA 3ID6C 2H4YA 1THGA 3KWLA 1PC2A 2RK4A 1IHGA 3ZDRA 3I1FA 2JRLA 4MR9A 4QOSA 3FH0A 2DR0A 5ALJA 2WJVA 3MLBA 4HAYA 3KKEA 5EXTA 2BGJA 3J81A 1M67A 1A50B 4DIMA 3CZQA 2OY0A 1T9HA 5ES4B 3KFVA 4CXMA 2O3RA 1SO8A 2ZJZA 2UYHA 1OHHD 2XYGA 1YZKA 4DX5D 3R3VA 5LP6C 3OESA 1H5UA 4RAOA 4TT8A 2I34A 1WLSA 1VG8A 4MKIA 3G9TA 1M72A 2P9JA 5EQFA 5C2YA 3NX4A 2SCUB 3LXMA 1N0IA 4IIUA 2NG1A 2JIDA 4IHQA 4MP8A 2H9YA 3T7CA 4IDAA 2OBXA 5I9BA 1JCQA 4BWRA 2YIDA 4GTPA 4FEYA 3ZQ4A 5C5EA 4ND5A 3GEDA 2PZIA 4PYNA 2JFOA 1WE2A 1JA0A 4N3NA 4S1TA 4PLGA 4J8SA 3NWPA 1Z0SA 3HCWA 3OJCA 5JCJA 1RWBA 3D6TB 2OR3A 4H1TA 3WK7A 4K9OA 5AJLA 2WAMA 1YQGA 5I9NA 1EA7A 3QX3A 4LZOA 3A36A 3W1VA 4EHMA 3S8MA 2WZDA 1U94A 4OGKA 3MUFA 5DBOA 2JGEA 2ZSAA 1BEUB 4JA2A 1IBMB 1RC1A 4AOFA 4JJ4A 4ZIRB 3W90A 3N8GA 2JA1A 3P9NA 3DOOA 4MWCA 3LFTA 5CA1F 5AW9A 3KB8A 4GEKA 3PFWO 1DSSG 1J70A 3OI7A 4QQRA 3CUKA 1ZMBA 5KHLB 2X22A 3HKEB 1IVSA 4R2MA 1W49A 4NJEA 3O7MA 1H2UA 1VGQA 3FUTA 3OU7A 4DPMA 1CDZA 4OFWA 3EXEA 1SBCA 3N8NA 3NLLA 4R5MA 3FPSA 1BOFA 1YSCA 1VHJA 2Q0SA 3H4MA 2K6GA 2NADA 1GNSA 3UWSA 2HM7A 4DV4B 3JVIA 4YAKA 3EFHA 2PIDA 3ADBA 5H9WA 3TG8A 3CUEF 1DAKA 2HRBA 1OLOA 3MCTA 2F8MA 4C7MA 1PS8A 1XPOA 1YS2X 3NRJA 4PG6A 5K2OA 4NH4A 4TRJA 1ZW6A 1NBME 1R9MA 2B37A 4X84A 2O14A 4GKKB 3I9MA 4KQHA 4TYNA 3FAZA 3ZWQA 3T5CA 1YQTA 1Q92A 3VA7A 4ARBA 1XFAA 3GEBA 1VLVA 3LLSA 4UQLA 2GR9A 4GR5A 5HI7A 3DE3X 2XF8A 1LTQA 4F5ZA 3HIZA 5C1PA 2A9KA 3CXUA 1P9LA 2FUCA 5T6MA 3HSKA 4E1AA 1UDCA 2AW3A 1BO6A 1ZCAA 1M1YB 1WXQA 2R84A 5CLQA 5T8IA 2J3JA 3OZGA 1G18A 3OIDA 3WC4A 3GQBA 2WYHA 4CF5A 2P5SA 5CW2A 1I3NA 5AQBA 4I1OA 5CVDA 3RRJA 2XT6A 3FFXA 4FMBB 3GBSA 5CVCA 3MMZA 3P2MA 4DSAA 2HIAA 1BA3A 3JAKA 4ND8A 1U3WA 2Y2UA 1E8YA 3E48A 2FMUA 2BMVA 4TV8F 5AVOA 3QKWA 3UMGA 5F78A 3CKYA 3Q15C 4B6FA 1L4NA 4RPKA 1BS9A 4WEOA 4GTSA 5LM3A 4DIOA 1OH5A 4B3DA 1R6DA 3GO4A 1RAIA 1KF0A 3OPVA 2JFXA 1BAPA 4FM9A 1TZ2A 5GM2A 2ZVJA 3PI6A 4AJOA 4CFZA 3BJRA 4LNUD 1I1OA 3R5SA 1MB9A 4Q0MA 10MHA 5ALLA 4LY6A 4GIBA 1O9HA 3H5RA 3E5NA 3ZK8A 4KXUA 1N3IA 4NBWA 1FP4A 4RSHA 5AKLA 5F9FA 2OFXA 3GRPA 1KFBB 4R3NA 1UH5A 2HA2A 4QDJA 5JI3E 4KITB 1JQ3A 2BFOA 3B3JA 3P32A 4GU5A 3T3EA 1C80A 1XZHA 2R79A 1NNLA 5KJ1A 4CCWA 1UZNA 1DKNA 2DLNA 3WBKA 2P40A 1S02A 3RWMB 3LI2A 3R8CA 1ZSYA 5FPPA 1S64A 1YFJA 4HGYA 3LIPA 3U44A 2AI2A 4XPIA 4UVIA 5EJAA 2FSFA 4E6HA 2O48X 4YCDA 4ZT7A 4C6TA 3D7RA 2AEJA 3B48A 4ZPXA 3Q40A 3MTIA 3FPFA 4P08A 4RPLA 3KTAA 2ISCA 4UHHA 2MSNA 5GAJA 2WFMA 2BH2A 2AV6A 1WOMA 1PKEA 3O8QB 1H2AS 3PRHA 3GQBB 1IH8A 1H4SA 5AOAA 3O8OA 3LP8A 4DBLE 1OYYA 4FQ5A 1RZ4A 3A37A 3BTUA 2ZRAA 3Q5GA 3U9LA 4I9HA 3USZA 2WWTA 5JQGF 2QXTA 3R0XA 4D3YA 3RE1A 2I2WA 2D5BA 3KXPA 4O3MA 3KIPA 3ZN3A 4ZEMA 2Z9CA 4ENSA 4DLBA 2IYFA 5K01A 3RH0A 2GM4A 1PWXA 1DJMA 3DAYA 4EJ6A 1H05A 2ZJ5A 2P9TA 2FZ5A 2BHNA 4PF1A 1OA1A 1W4AA 2ZYRA 1U6IA 1VECA 1HORA 3B6MA 1V54E 2BUGA 5CYOA 2HMSA 5DBHX 1Z2NX 4PZCA 1US8A 3KJZA 3EOAI 3FTNA 1E3JA 4UWFA 2MINA 4DQLA 3PHCA 2CLHB 3PZ4A 2YOHA 1WVGA 4U2GA 4FBMA 3FA2A 2VXOA 5SY4A 2JC3A 4BVEA 1W5FA 1SY7A 4KKXB 3ZJTA 2W42A 2N42A 5AUNB 2DWZA 5F5XA 3TLCA 3ULKA 3WISA 2P91A 2BEUB 3KR0A 3RRMB 3P27A 4WL0A 4AQ7A 3VHRA 1IHBA 1AQJA 3GF4A 5D5HA 4ALLA 1YRQA 2VT7A 2VCYA 4WVFA 4KE6A 5TJHA 2QM3A 4RWZA 4NMLA 2C2BA 3EX7C 1WRBA 4I4TF 1J2EA 4CVNA 4GLLA 3RK6A 4KLAA 4HNSA 4E31A 3HG0D 1A5SB 4B3TB 2AOTB 1PW5A 1SZ9A 3U44B 2IZOA 3R77A 1D2RA 2A1UA 5E6UA 4I1SA 4I6JA 1FK8A 3W8NA 5DK6A 5DT2A 3JQ9C 5BPHA 4QEKA 3BQMB 4Z0PA 3ZK7A 3IE2A 4I9GA 1YFLA 4PC3A 1HQCA 2I8CA 1JKIA 1CY7A 2A2ZA 1XXHB 2XPIA 3KUXA 1II8A 4TTIA 3INYA 1RR6A 2QLFA 1H6BA 1VLMA 3UJ7A 2QD2A 4DCCA 2GGFA 3NQPA 5HIKA 3PE6A 4CWAA 1YR8A 1V8OA 2CFSA 1P62B 1Y8RB 1E63A 1M74A 1Y3BE 3SX4A 1WAO1 3ZU2A 2JBWA 4HYEA 3INTA 5H81A 3WTCA 4EFDA 2VDNB 3ZY4A 5FWNA 3P19A 4HOTA 1GG2A 1XXHE 1GKUB 3U3DA 4ZCLA 1MJGM 3IPAA 5KNLA 2XTNA 5DTJA 2X6RA 4QUBA 2PKYX 1ABFA 4O4IF 1RYZA 1QIFA 1G1AA 2JCYA 3OZBA 2JIBA 2PH1A 4E85A 2WF7A 1TUEA 1P5QA 3BSFA 2ZBGA 4RMGA 1Q1QA 1K7CA 3P1JA 3G3EA 1SU7A 2YRWA 1KIMA 1JRLA 1X6VA 5FL7D 5CLGA 4OA8A 4LC9A 2ZB4A 1T24A 2X6QA 1U0FA 1CUEA 2JG3A 5BSUA 1M2OA 4URHA 4FK8A 5CCXA 3ND7A 1EFHA 4K9QA 2BKEA 2R8ZA 4F4FA 5E7JA 3T9DA 1QIJA 1A8HA 3AT1A 1T8PA 4QXAA 3PICA 5EFOA 4C6HA 1RI1A 1SU6A 3TQRA 4QPPA 4GE3A 4I9FA 4KYIB 1QP4A 1M76A 3ABZA 3W8FA 5JJBA 3ZHXA 5EJ6A 1Z5GA 3QHAA 1YU6A 2O8EB 2ZYTX 4L8LA 1V7PC 1G7CA 4Q9IA 3AUFA 3M6AA 1C30A 3CSFA 2JVIA 2GLXA 4DG8A 2FSVC 3JRWA 3OXLA 4ETNA 3UAXA 1DIOB 5IM4A 2J6CA 4RH3A 2VH5R 1QHHB 3DR5A 1OCZE 3LCUA 5KHAA 3QEOA 1B41A 4QATA 3G8CA 2V6IA 4Y2PA 4OI4A 1WA5A 3P9QA 4KUEA 3HXTA 1YRLA 1O1YA 1ZK4A 2I76A 1FXUA 4GD3Q 5BXUA 1OCCE 3GJ4A 3MF4A 3LXUX 1K68A 2DFPA 4PGHA 4BB0A 4QU8A 1B0PA 3T3PB 1EB9A 1YFKA 4CCAA 3JWEA 3I76A 4QKQA 3DBRB 1J0BA 3FPJA 1XG5A 3BIOA 3VR0A 3HXLA 1QB7A 3WV4A 2PTGA 1J1IA 4GKBA 4J8YA 8ADHA 4GL2A 1UW4B 1KY4A 4R01A 1FMCA 2ZUUA 2PYIA 4ZMRA 1CULC 3ZE1B 4YRKA 4WPGA 3WDLA 4C0QC 1Y48E 1BXRB 2PAFA 5AOCA 1U65A 2BFBB 3O95A 3KPUA 1JAXA 2DYKA 1I32A 3AHCA 3EAGA 4XE0A 1Z2OX 4IQ8A 4R8MA 1K8RA 2V4UA 5JXHA 1K08A 5JPCA 2BR4A 2VQDA 1JQDA 2QRGA 4EHDA 3T8MA 2ZYSA 2EKZA 5A3QA 1ZUHA 3DUFB 3U2QA 1JQ5A 3AR9A 2ODNA 1JR6A 3UM9A 2IGTA 5FQOA 5F7JA 4HB0A 1X7YA 1EUZA 3PL5A 2XCIA 3GBVA 2DIWA 3KQMA 1F0YA 3PYXA 2R6JA 3R3YA 3LZCA 4TLCA 1N4RA 1NF3A 5GONA 5FZSA 2JLVA 2Q27A 1V6SA 2GBIA 2H1WA 3SBXA 2Y3AA 2XBMA 3RBZA 4A0FA 3MTQA 2QXYA 2V7TA 2PD3A 1EGAA 2CNOA 3ZCVA 3C15C 3U3KA 3W6OA 3N6RA 1G4AE 1QAQA 1JH8A 5KVSA 4FHGA 4DR3B 1LSSA 1PFVA 2I4OA 4WZBB 3TQHA 2ZJAA 2I6XA 4F2PA 1IWPB 4CMEA 3CR7A 4MLDA 1OFTA 2YY7A 2IUFA 3E37A 1BVUA 3HRIA 1F8UA 4ISCA 4KIGA 4TLDA 1QHXA 3H2SA 1PYDA 2HYDA 3RT1A 4EEKA 2ZEJA 1B43A 3RVKA 2I3BA 1T10A 3P2YA 3BG5A 4IVNA 5JJIA 3WMXA 5JCJD 3IMGA 2XYRA 1L8AA 3N2ZB 1N94A 4DMCA 4YXFA 1Y9ZA 2JZOA 5CR9A 5JH7A 1VKOA 3T1VA 3D0QA 5B7NA 2FZLA 3KYCA 2FG6C 1QPZA 4YUWA 3FLEA 5CHEA 2YWGA 4DHEA 4K46A 1I6WA 3NC4A 2YRFA 2IF4A 4QBFA 1PVOA 4D0NA 2QNRA 5EYPF 5HS4A 3I39X 4HDRA 1TC1A 2PPVA 1Z4KA 3M8KA 1L4KA 5HFAA 1E1LA 3BORA 1IBLB 3O4FA 2QAIA 4GVLA 3FH8A 2H2GA 1F06A 4J4BA 5HGXA 2VJMA 3PFKA 1PV2A 3KETA 2D8AA 4G84A 5FWAA 1DIBA 4EKIA 2XXAA 3SR4A 4EVRA 4DIUA 3B1VA 1VG0B 3Q7AA 2I6FA 2PNJA 2A0WA 2R2GA 3GLFB 4DMHA 3B7PA 5C3UA 5HGJA 2OT3B 3EF0A 1QWSA 1C0KA 2NO4A 1YA4A 1DBSA 3PQFA 2EW1A 5EHZA 2IDJA 4NG5A 1ZGGA 3WDKA 2QL5A 1RTKA 5F98A 5COQA 4PNEA 5E6RB 4U0ZA 5EILA 2W6IA 4OQPA 4PZAA 2GM5A 1SXGA 2BLNA 3GLFE 3M82A 4UM8B 3L02A 1Z0JA 1T2AA 5CFMA 2EXXA 3NAZA 2JGLA 5JJCA 2DEUA 1J8YF 3PZDA 4FX5A 2IDMA 3OC6A 4GAAA 5JFGA 3SBSA 4EUKA 1GU1A 2GPWA 3OCZA 4FCTA 3DJFA 3EVTA 4BBZA 1BU8A 3HYRA 1AN0A 2YUTA 3IJ5A 4FKBA 4EJMA 1X7WB 1DX9A 4B2LA 2ZCVA 4D9GA 1ZG3A 1LK0A 4QOFA 4JUFA 3EXG1 4OJNA 1P7VA 3ROKA 5D85A 2FG5A 1P8JA 3G2KA 2ZR9A 3ZVMA 3KZ1E 2ONDA 2ZUTA 1TZJA 1DGQA 3I2YX 4IWXA 1UMBA 3PKJA 2JIPA 4YT5A 4RPCA 4RETA 2I55A 1CQJB 4HYTA 5JALA 3UKRG 2RHBA 3MIIA 1ENZA 4MVJA 1B76A 5HYVA 3OWHA 2WMOB 3H17A 3RAJA 1DG3A 1I10A 3FFWA 5EWLA 4FWTA 3E9NA 3I1JA 3GGGA 2YOFA 3JTEA 2C8LA 4ILKA 1HT1E 4JI6B 3NAQA 4H7IA 1Z36A 3WSVA 3GUYA 1B8VA 3WGJA 4M0DA 1FXWA 2IYRA 5I4CA 2I3AA 3MWYW 4GA1A 4Q3DA 5IKMA 4BNJA 1GTG1 2FYTA 2OCIA 4KFSA 5HR5A 3S0JA 3P2KA 4JHKA 1I6MA 1WMSA 1ZC4A 5IFLA 2DT8A 5J1SB 2Q6LA 1PZMA 5K3BA 2CC2A 4DDTA 3SZUA 1PGQA 4DWWA 3S8YA 4CT4A 1H2VC 2UYQA 1RI2A 3CHOA 1OBHA 5CU7A 1CZNA 4B6PA 2VGXA 2Q4DA 4GP7A 5BSWA 1SQGA 1U8ZA 3PBKA 4EP1A 4GTTA 3P9ZA 3MERA 4FGLA 2DY0A 3VX3A 1YAJA 2Y1KA 4P3OA 1TJCA 1OBVA 3IQZA 2BFFB 4IIDA 1LI7A 3ILHA 2OVFA 3F67A 2YS6A 1G16A 2ISSD 4IICA 1WULS 4HEJA 2IOFK 3IMEA 4ALKA 1YDWA 4IDEA 4ZANA 3FEYA 3HBNA 1QCCA 4M9QA 5GTDA 1GQFA 2P77A 4C0BA 4N5QA 4CLDA 5JY6A 2DPXA 1Z88A 2DPYA 4DA8A 1AUOA 4LBZA 1WU8A 3UQZA 2R8PA 2YQZA 4Q3NA 3VVLA 2O8FA 2V5VA 4EATA 4WBNA 1CY1A 1T0IA 1MENA 5KO2A 4D9HA 1UCFA 2QD4A 4G2NA 4TN1A 4QC2A 4DCUA 2W2OA 1N25A 1GSAA 1DJOA 1WXEA 2B4KA 3KJNA 2PH7A 3UCEA 4O63O 1HR0B 3ACDA 2AGVA 2P6UA 3AXTA 3NRCA 2VDPB 3TG5A 3DHNA 4BNG