3ZYKA

Structure of calm (picalm) anth domain
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
269
structure length
269
Chain Sequence
b'SAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL-BINDING CLATHRIN ASSEMBLY PROTEIN
publication title The molecular basis for the endocytosis of small R-SNAREs by the clathrin adaptor CALM.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 111
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zykA02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zykA01
3D9LA 3G2TA 1UJJA 4Q96A 3RRUA 1UJKA 4GZDA 1DVPA 1EYHA 5CMYA 1PY1A 1INZA 5J08A 4HFGA 5CMWA 3D9IA 3G2WA 1EDUA 5LOZA 3ZYMA 3LDZA 4NACA 3G2SA 2LO6A 2BF0X 3D9PA 4Q94A 1X5BA 1H0AA 1JPLA 2KM4A 2V8SE 1HF8A 3CLJA 3G2UA 1ELKA 3ONKA 2L0TB 3ZYLA 1SZ9A 3D9KA 1HG5A 1HFAA 3ONLA 4GZCA 4AVXA 1HG2A 4FLBA 1XGWA 4FU3A 3G2VA 2MOWA 1LF8A 1JWFA 1HX8A 1MHQA 3ZYQA 2L0IA 5LP0A 3D9MA 1VDYA 1JWGA 2DIWA 3D9NA 2QY7A 3D9JA 4JXTA 3ZYKA 2DCPA 3D9OA 1JUQA 1SZAA
chains in the Genus database with same CATH superfamily
4Q96A 5BV0A 3TWTA 2VKJA 2QA7A 2L3LA 2PFVA 4PJLA 1WDYA 4CZZB 4HE8A 1N4SA 3VTXA 1NA3A 1YYHA 2IOLA 2ZM8A 3JC6D 3E34A 2FF4A 4EB6E 3CX6B 4CRWA 2UUAT 5ADXL 4YVQC 2R17C 5AIJA 3UIPC 2PL2A 4HFHA 3AG2E 4E6HA 5ABHA 4TN7B 5EX0A 2XENA 4HOTA 2CFUA 4QH1A 4JI3T 2DYSE 5ENTD 1HTJF 2UXBT 1OY3D 3UM0A 3CV0A 3KEZA 4H7XA 4LF9T 5C2YA 5EZYE 3L3PA 5LGTB 1S70B 3CKBA 5EX3A 3TG5A 3GN5A 4YXDA 5CFBA 2BG9B 3CVWA 3UU6A 1IZNB 4AQFC 2WXHA 1SHZC 4GTSA 2R05A 3RRNB 4IDNA 4XKBA 4N78D 5AQGB 3CK7A 1U3DA 2FJBA 3X2QE 5FJYA 3GZSA 5FP3A 3T8KA 1UJJA 3FWVA 4U95D 5JDNA 4NQ0A 4F1PA 2CCQA 2WXNA 3L8RA 4K0RA 4N5QA 3ZRHA 4EZLA 5KDMC 3T1HT 3VRAA 1NEKA 2I1JA 1QQEA 2KCVA 3CVVA 4EBAG 2E9XA 5HXEA 1SA4A 4FI5A 4TWHA 3BUAA 3VR9A 5LBQB 3NKZA 4LNUD 2IFUA 3PVLA 4O60A 3N5LA 2L0IA 4GK0E 4KVOA 3N2GE 2E2EA 5LG4A 3ZYKA 2X68A 3CQCB 4GYWA 3RRUA 4APOA 3SFZA 4F53A 4U96D 2IOSA 4JI8T 5AQPB 1HE8A 2XPZA 5CJ5A 3OXLA 4K5AB 4X1IE 3C4WA 3ETUA 5LB7B 2V6YA 4GTOA 3Q4AB 3LG7A 1K1BA 2X3MA 3EHQA 5AQ9A 2CXFA 3ULYA 4DX2A 4GIWA 3KAEA 1BPOA 4XI9A 5ANRA 2LJLA 1KPSB 1Y6IA 1MIYA 3N9NA 3KV4A 2DCPA 1W0AA 2NWBA 2NP9A 3AXJA 4FA6A 3AEDA 3O4ZA 4LFAT 2WB2A 3SQVA 2YHCA 4JHRA 3ZPJA 2AE9A 4KBMB 5ANLA 5ENPD 3PNLB 3SFEA 1MX6A 2KC7A 3GZ2A 1A17A 2QRXA 4DUZT 1MX2A 1IQRA 5KNHD 4ILHB 4B89A 4ANWA 2XQ7A 1I6ZA 2I9CA 2PM7A 5HEGA 4CXWA 4C9BB 3Q9DA 5LXTE 4CEMA 4HS2A 2CXLA 2OVFA 2JIWA 3I1AA 4HRLA 2W62A 1QSDA 4YSXA 3Q7AA 3L09A 5L4HA 3HXFA 3PUYF 3KS2A 4QX7B 2PZIA 2R2LA 2SPCA 3SS1A 4AM9A 2H6GA 3EU9A 4BX9A 3QNKA 2FBWA 2XM1A 4B3RT 5J2TE 3S7JA 4HFVA 4F8HA 5B1AE 3NWIA 2WQYA 3AS5A 4IIJE 3UT4A 3GMIA 5JJ7A 3OJAA 3TWWA 3FUHA 5CCLA 2XY8B 1HF8A 2EINE 1OWPA 4DV4T 4U33A 2J4BA 4U0UA 4U2YA 4H9OC 4CI3B 4HOQA 1JNRA 3EHNA 2PNNA 2DWZA 3UINC 3RQUA 1HU3A 2G0UA 2QFCA 4OFZA 3AU4A 4LMJA 1WRDA 5L3BB 1MMNA 2CHWA 2YK0A 3EUVA 3RKOA 5J1GA 4HWHA 4PJNA 4KVMA 3MACA 2FJAA 3HXDA 3VRBA 4YT0A 2C0MA 2JEKA 5T8IA 1H6OA 4I50E 3FTYA 3LPZA 1BI8B 3L08A 3PNTB 5CCMA 5L3DB 1FEWA 3JXJA 4EEDA 4O4HE 5G05C 2VKHA 3FZMB 2A9UA 4X1YE 3PE0A 5KJNA 4LNGA 1T98A 3AE5A 3ASDA 4WAFA 3R84B 3OKQA 3D9NA 1L5JA 2XQ3A 3ZCIA 2E9XD 3SNXA 4TRQA 3ZXSA 3MXZA 1FCHA 4TZ4C 2D0TA 3R7RA 1MIVA 3RYIE 2OVBA 3Q5XA 1AP7A 1TR4A 4G63A 4YDOA 3B13A 4JI1T 2WXKA 3PZ4A 1E8XA 4IREA 4PS8A 4GA0A 3AAIA 3LKUA 2DLRA 2WU5A 4BJMA 4HRNA 3UUNA 2L6BA 2JMKA 2Y4UA 3UM3A 2M63A 3TWRA 1Z5SC 1T72A 2XQ6A 2V5QC 2GRLA 3AAAC 1QNFA 3NOCD 4LNBA 1FT2A 4J8FA 1EDUA 1NFIE 4PK5A 4MLKA 3C4ZA 3OXGA 3T8MA 4EIWA 2HPLA 3L22A 2XS8A 3MKQA 1KNPA 3PU8A 4EECA 3APDA 3ZN1B 3IKOB 3S7DA 4Q69A 3CHOA 4IDQA 2XEVA 1BI7B 1ELWA 4I17A 3AAEB 3HR0A 5HS0A 5L3FB 2CRBA 1DU2A 2FUPA 1QYMA 3FUMA 1FMWA 1WR0A 2IO2C 3F57A 1MX4A 1YKEB 4GTRA 3ASHA 4HOSA 4UWLA 4PFOA 3IHVA 4HWDA 4G8LA 4K5CA 4TXRA 5TAOA 3I3NA 2ZU6B 5C3JA 1SQMA 5EDSA 1WR6A 4WNKA 2P9SG 4X1KE 3AA7B 3DSUA 4HXIA 2VK9A 3HXCA 2N1GA 2XGOA 2ZISA 2EHOA 4YJ2E 2XASB 4O2AE 4FC8A 3FP3A 3PJAJ 3MGBA 3G2SA 3FUNA 1IBMT 4DR4T 4E85A 4OHFA 5F5WA 4RLYA 5CMYA 3CKCA 3CWZB 4GA2A 3HDXA 2Q9QA 2BKGA 3CEQA 3ULEG 3LK2B 3H3AA 5JRCB 2JLBA 3GA8A 4J8SA 3CVYA 4HI8A 3BK9A 2VGYA 4L23A 3ZHEB 3TGOA 4G1TA 1BR0A 4KBQA 4H63V 3AG4E 4UEMA 5AFUL 3HL6A 4ERRA 1UUSA 4U63A 4GCOA 2LSIA 2XCCA 4JEHB 2R6GF 4ATZD 3ABVA 1OEDB 1TNOA 3CVUA 1SA0E 4W9RA 4MHCA 3LJ3A 4E7SA 1IBLT 3MKQB 3ISMC 2WU2A 3DSSA 1FT1A 2ZGGA 3UQ7A 2P9NG 3TLVA 3DBSA 1LRZA 3PJAA 4GTVA 4UELA 3CIAA 4X8QA 2NR4A 3MJXA 1Y01A 1SVXA 4I2ZA 3HVEB 2KBXA 2VQET 2Y3AA 5ABFB 4A1GA 1XWMA 3SFXA 2P2CP 2VJ8A 4HOUA 3RH3A 3PZDA 3UTKA 3N9PA 2AW6A 4UI9K 5JTGA 3V31A 2LRLA 2V0PA 3ZNGA 4XKCA 4DUYT 1OCCE 3ZYLA 4EZHA 1OXZA 2K48A 4CZ2D 5EYPF 2WVIA 3AE6A 2H3RA 4UUCA 4QFVA 2GRNB 3MYVA 5AQ7A 4DR7T 3D9OA 2WCAA 2ACZA 4Q94A 2IDOB 3AE7A 3TG4A 3QB5K 3HYMB 2BKNA 4AKLA 5E76A 3CVPA 4B3TT 2R03A 1ELRA 1FMVA 1N9AA 4GKJT 2OV9A 4B6XA 1J5WA 3ONXA 4DV1T 4C0MA 5FY7A 2KWIB 3K8PC 2I0MA 2XPKA 4WZXA 3GW4A 2VL8A 2LSJA 4HQDA 1O1TA 5L2LA 3UKUG 2FJEA 2WXLA 1HZ4A 3AEBA 3NZPA 3I5PA 4I1OB 1FIOA 1IKND 2IY0C 3TWQA 1NAFA 4HFIA 3ZMTB 3ANWA 3DEOA 4LF6T 1KNRA 5FTPA 5DQVA 5IYZE 1N95A 3CLJA 2NW8A 3E4BA 1XZYA 4RVBA 3VTYA 4FHKA 1CUNA 3U3IA 2H7VC 2V7LA 3FULA 4UQXA 1HNZT 2WS3A 1VCTA 3G06A 4HWCA 5H6QB 2ES0A 4GAAA 3UU8A 4BTBA 1S64A 5LGNB 2BG9E 4YVOA 4F6RD 2NSZA 4DV6T 3RKGA 4XI0A 4ZI2C 2E5VA 4H63H 4LFBT 1B89A 1S0PA 2IMLA 2YDSA 4B8CB 2W00A 3OXFA 4FU3A 5AQVB 3ABLE 4RSYA 3SFYA 2BKKB 3ZYQA 2IIUA 2UXDT 4EZ4A 3CQGB 5KJLA 3ZEFB 3QWWA 4FLHA 1TNUA 1EF1C 1MMGA 5EK2A 5DBKA 3QDNA 5HXSA 2C5KT 5AQMB 5LNKA 3RX6A 4O1OA 2WSSV 2CLYC 4P0AA 3LBXA 3C4XA 4B8AA 1M62A 3IHRA 2WDVA 3CX7B 2F0YA 3RKVA 3FEYA 3R9AB 3E08A 3PE3A 5L4EA 5JJTA 4Z68A 2F8YA 4UQYA 4QXBB 4HORA 4ANUA 2GK9A 3ULQA 5JQGE 1JCSA 4PW8A 2VKOA 1JCRA 2XRYA 5HEOA 4GPMA 3FU0A 3ZKRA 3SBTB 3NVOA 3SBSA 5LCWC 5EIDA 4GCNA 2VL0A 3I0QA 3OAWA 2LSUA 2A4ZA 4GYOA 2XAFB 4TV8E 3J9X1 1HH8A 5JR9B 3MA9A 3QC1A 1KNZA 4K0KT 3W15B 3AS8A 1BR1A 3JC6C 1QUUA 2E5LT 4L2LA 2BVMA 4BESA 3NBNB 4EBAA 5CB4E 4J0UA 4WW0A 2DVWA 4D10C 2YDQA 3O48A 4MRUA 2V5FA 1TYQG 3DSWA 3CK8A 4O6FA 4ANVA 3CSFA 1ZOYA 4J8EA 1GW6A 3CVQA 4DMVA 2H7OA 1E7PA 4A55A 2CHNA 4UXNB 5FL0A 4DV3T 2VKDA 4DR3T 1Q2ZA 3IBEA 3ZT7A 4M1PA 2HM8A 3PS6A 3PUGA 3ZC0A 4JI0T 3GZ1A 1UX4A 3HKCE 4YTNA 3UT5E 3B5MA 1D1CA 4L7TA 4AISA 3LVRE 4B3MT 3ZSSA 3D9KA 1YQ3A 4OAUC 2VURA 2LRKA 1G8XA 5LBMA 2WP9A 1P5QA 3ZC1A 1OWAA 2WZHA 3BEEA 3EHMA 5FKYA 1KZPA 5LJMA 2P9PG 5G04C 2W0GA 3CX8B 4GTMA 1U4QA 4EYYR 5CHEE 4I2WA 3QOUA 2F4VT 1K3ZD 3IF8B 3SOLA 4TX5A 2ZM6T 4HFGA 4XZ4A 4YJ3E 3NRXA 3MK7C 3FTSA 3C5RA 4HI9A 4N2QA 5EIBE 2V5DA 4HFBA 2HN1A 2QYWA 3FTVA 2BS3A 2XQ5A 2VQ2A 4AJWA 4IYPA 1H19A 4IE6A 3KBUA 2WXPA 4J8YA 3LY9A 1X81A 4G11A 4CI2B 4PK6A 2GROB 1MJ0A 3AE3A 2NOXA 5HRYA 4U04A 4AQFA 3ZN3A 2P9LG 5ENOD 2XGSA 4L5GA 3NB2A 3URZA 3ZMSB 4UF0A 3WAJA 1SZ9A 3JXIA 4JZYA 4FP7A 1HFAA 3RAUA 4TV3A 5AJDA 1MMDA 2RPAA 2VSOE 5JDQA 3ZFWA 2XM2A 1I94T 2CWYA 4ZS3A 3DSTA 4PNIA 2OEVA 4O1PA 2ZM2A 3OYZA 2KZTA 2W4XA 1Z6TA 4LEUA 1Z3YA 2WWVA 2WMNA 3TWUA 2V4LA 4JI7T 3O4XE 2YQ8A 3FEXA 4DRXE 2KWHA 2RD0A 2VQFT 1UG3A 3TWXA 2C0SA 5FY0A 4DR6T 3BQIA 1T7SA 4DVDA 3UPVA 3CIRA 1MHQA 3RIAA 4ZEYA 2WXGA 4K03A 2ACXA 4NPPA 4KXKB 1N34T 2K9AA 5LGUB 3V2XA 5GONE 2DYRE 3EIJA 3IXEA 3P7IA 1FJGT 5CA0E 2PBIA 2X67A 3L16A 2ZXWE 4N3BA 3FB2A 5AQUB 2LO6A 2Y69E 3QWPA 3GYZA 3LVQE 5FL1A 4IDZA 1LKXA 1WYBA 4H9RC 5AQKB 3UU3A 2P58C 2XZDG 3BQOA 2JPFA 4NRHB 1BR2A 2MOZA 2Y8DA 3J7Yq 3S2AA 2DIWA 3EJNA 2FULA 2WMOA 2NXPA 3VLEA 4YHHT 3ZN0B 1DCQA 4I1AA 4ILGA 4CDNA 1KT0A 4UQZA 2DI4A 3ONLC 4PFPA 2OEWA 4G24A 2XQ4A 3AE4A 5A7DB 5L3GB 4N3CA 2H6HA 3KD7A 4N5CA 2XSAA 4UF0B 4PJMA 3DJBA 2KZ7B 2WQ7A 5KJMA 3LFMA 1WY6A 2UWJG 3V30A 4LRZA 3FTZA 4LFCT 3HIZA 3G2VA 3ZPOA 1N36T 4I6EA 2Y6XA 4GZ3A 3ZVVA 2J09A 5E0OA 3ABME 2M6BA 3DWLG 4TNWA 3GWHA 1E8ZA 3Q78A 3UUXA 2V6XA 3PEVB 4DLOA 2F37A 3SF4A 4Z90A 3GN5B 3UULA 3VKGA 3QWVA 5KCMA 2I59A 4L1BA 2V26A 3ASNE 3LS8A 5ENSD 5HKPA 3FUFA 5JVDE 4B3ST 3LK3B 4XAXB 3Q75A 4UI9C 1DC2A 5BR8T 1UW4B 3P1UA 4GMRA 4AY5A 2YU2A 2I2OA 2P9BA 2AXZA 3EIQC 3MA5A 4JD2G 4OYKA 4DLQA 3ENEA 4ZFHA 1E2AA 1OWOA 3KDSE 5FXXA 4JEUA 2IONA 2CBJA 3PUXF 4OX9T 2CEAA 4IGUA 3DSXA 4HGAA 4IT4A 2RA1A 2E9XB 1XDPA 4KMCA 3PZ1A 1D8DA 4HLEA 3I4RB 4FHJA 2V7IA 5FZQA 1D8EA 3FBZA 1OEDE 1D1BA 1D0ZA 2A5EA 2Y1LE 4JI5T 4CDRA 2I1KA 1W3BA 3FUKA 4LERA 4BJNA 4EAHA 2WM9A 3HKEE 3RIUC 3ZJ1A 2J07A 4AVXA 3N9QA 2GW1A 5T4YA 1G3NB 3I4GA 2EIME 4URKA 2NW9A 3MKDA 4IDPA 5CA1E 2PJQA 4ILUA 1NP7A 4NUUA 5HI7A 4A98A 3RGLA 2V6YB 3D9PA 3MEKA 4QQIA 5JJ6A 3ASGA 2FJDA 4AXHA 3K9IA 2CFZA 5AENA 5BMVE 3AB3B 4ABNA 3UQ4A 1OCRE 4DI4A 3AXJB 4FJYA 3DTOA 4ZZCA 5AN8A 4BETA 1KLXA 3N9OA 2HPJA 4EXTA 3D9HA 3FUIA 1YXRA 1N4PA 3L39A 1WAO1 2YHEA 5LA6E 1GQEA 3KFWX 3R9MA 2KT9A 4TUUA 1E1HB 3MJWA 4ZI3C 2L9BA 5A23A 4RG6A 2XAQB 5CGMA 1J1JA 1KK7A 2OA5A 4QHOA 4FLBA 2Y48B 2WXIA 3D3MA 4J6IA 5LMUT 2A2FX 2XPIA 4JUYA 3KBTA 2QYUA 4QX8B 3L9TA 3MZKB 3FFLA 3VR8A 4NXMT 3R6NA 4KMOA 1IJ5A 3OYXA 4E7ZA 1BD8A 4EHMA 4LF7T 4YDWA 2J8SD 4HRMB 1WLXA 4HFCA 3LCAA 4FJOA 2XAHB 3BQLA 3OBVE 1TN7A 2AXDS 3ASOE 4DI3A 4HTEA 1AWCB 1S35A 4IL9A 3RF1A 4MALA 3N9LA 4ILIA 4DBRA 3PUZF 2V1DB 2LAHA 3FTWA 1ZBPA 3PREA 1IJ6A 1HXIA 2UY1A 1HNXT 1AJ3A 1OXJA 3G2WA 5CRVA 5D66A 1N33T 5FQ4A 1X5BA 2V8SE 2KM4A 3U9WA 1TNBA 3C3OA 4YDYA 2B76A 5KJKA 1ZHCA 3PUKA 1W09A 2XQ9A 4WBOA 5HWXA 3L82A 4WWNA 3FHEA 2H88A 2KINB 5FQ7A 2LOSA 3A8YC 2LUHA 3CMLA 4ASKA 3D9LA 2VB6A 1PAQA 4IL4A 3APFA 5EN5D 4DBQA 3L13A 4ATGA 4A3TA 3SFDA 1LTXA 4QH4A 3DPDA 1OT8A 1YQ4A 4AKIA 4AKHA 4WYVA 1Z0PA 3NF1A 1S63A 3U66A 1XGWA 2JMHA 2OOEA 4EYUA 1ZKEA 3FTUA 1LVFA 4KHZF 4ILBA 4WWPA 2AWIA 2E0IA 5BUZA 2X0YA 1UCUA 2DCFA 4KYOB 4GKKT 1KZOA 3ABKE 3PUWF 1XNRT 1UN9A 5L3CB 3C98A 1MQSA 3T1YT 4A97A 4NURA 3KINB 1FVHA 3PU3A 4KP3C 4ZI7E 2WXQA 3CPZA 2D5UA 3RQWA 4QKNA 4BWRA 4IDOA 4TWFA 1OEDC 3QOFA 4ISSA 2JQQA 3ZKJA 3PRZA 3ZU7B 2CG3A 2LKGA 5L3EB 1NI1A 4HWFA 2YINA 3DXKG 3PZ3A 4ZZBA 2V8SV 3UKRG 3V2OA 2LT3A 4JL0A 4OVVA 4H9PC 1LVKA 4BT9A 1N54A 1IHBA 1NA0A 3I9YA 1V55E 2L0TB 5FY1A 4A1SA 2HYZA 2J49A 1W0BA 3AVSA 2J4GA 5ABGA 4BTAA 2W63A 3FXEB 4GYYA 3LSVA 1N32T 2JJ9A 3JCKC 1E8YA 4QH5A 1QLBA 2XGMA 4P29A 1H6PA 4YFSA 1TN8A 4C0EA 2CMRA 2NTYA 5BW8C 2WPVA 4Z8XA 5FXWA 2BBHA 2X6IA 2M6IA 4B0ZA 5KBAA 2KCKA 3Q49B 1XMOT 4LF5T 3S7FA 1N52A 5KMGP 3FU5A 2EHOB 1W9RA 3TKLB 5AQHB 3ZSTA 2X0LB 2GRPB 2MHKA 2J9QA 4P09A 2LHNA 2WB5A 4I43A 1SZAA 2Q9QB 3AJIA 2J62A 2LAIA 4YTPA 3HXEA 5AQJB 3MX3A 4ACLA 3T8OA 5CERB 2ODUA 1OWLA 4DK5A 1SE7A 4AV7A 3TJPA 2C5JA 5LMNT 4LUNU 2GRMA 3PUJA 3O1HA 2JQ9A 4I4TE 2YKSA 5BXUA 2GRQB 4ZOLE 5JDMA 3IHYA 3KVBA 4JPSA 3TWSA 4CN4A 2DZOA 4CQIA 1K1AA 3ML8A 2QC9A 3AG3E 5LCWJ 2CXDA 4AEZC 2X6KA 4GZDA 3ZW3A 4CXYA 3ZLIA 5ARFA 5FZSA 2X9WA 2N2NA 4LMLA 3KSLA 3O1JA 4TXPA 2QZAA 3PE4A 3UQ3A 4YSZA 3RLFF 2I6HA 3AE8A 4QXCB 4UWHA 4ZXLA 2WXFA 4P1NA 2RFAA 2MOWA 3QK0A 5LOVE 3AE9A 2KCLA 4DV7T 4CN6A 3RIBA 4AKRB 1U3CA 4WUYA 5G55A 3LEWA 4BY6A 1PY1A 2NTXA 4UIGA 2EHOD 3N71A 4ZS2A 4EZKA 5LOZA 2MAWA 3C3QA 5BV1A 4L9PA 2IC6A 2W66A 3V5UA 4BFRA 5FVKA 1ZP0A 2Q9QD 4U8HA 3SGHA 1RZ4A 1US7B 3F2EA 5BT1A 2ZIRA 3LK42 5G04J 3TLTA 2MPKA 4UV9B 2X9XA 2X9YA 3FXDB 3D0TA 4DIDB 2XUEA 3RRWA 2X0HA 3E22E 1KT1A 4DR1T 3RPUA 3RJVA 2X51A 1KF6A 5FQ6A 3FH5A 4WBNE 1QBQA 3EU5A 3VHLA 3EABA 5AQRB 4I9CA 4CT4A 2E2AA 1IYGA 2XRZA 3PUAA 4GK5E 4DX6D 3ANWB 1N11A 3K1SA 2QY7A 5HEHA 4J7WA 1VRBA 1ZB1A 3QARA 5JR9C 4OAVB 2RG8A 1O3XA 1DVPA 2AXUA 1IQUA 3PH0C 2GRRB 4TWDA 4PUCA 2KNDA 1NWMX 3L6AA 4TNVA 3EVYA 3TLWA 5DABA 4IE5A 5CECB 4BSXA 3SWHA 3QAQA 5KNGA 1E8WA 2ZMAA 4APFA 4U0ZA 4JC8A 4L9IA 3E0ZA 2WQ6A 2LSVA 3LYAA 4WNFA 2WY2A 5HYAA 4DX1A 4QWNB 4IRUA 5LG3A 3DPYA 4WWOA 3RHWA 1E7UA 3HA4A 5JA4D 2JQHA 2K24A 2NYJA 2P9UG 2VVSA 4NIKA 2XCBA 1U5PA 3ZMUB 1IBKT 4CI1B 1KFYA 2RKKA 4ME2A 4AOFA 5FVLA 4XE0A 5E75A 4ZHBA 3QK6A 1T8BA 4I1MA 3IEEA 3SZ7A 1Y64B 3LBXB 2H89A 4DMWA 4FJZA 5IWAT 2UUCT 3AU5A 2B0OE 2WDRA 2CHXA 4F1SA 3P50A 3NRYA 3RC3A 4ZI2D 4AP2A 3JUEA 3B7BA 2IUBA 5LYJE 2AJAA 2ETBA 5LHIB 3Q9UC 3AEFA 4TUYE 3X1DA 4J8DA 3SI5A 4A3VA 1HS6A 2J47A 4A56A 5KWDA 3ZMZB 1X9BA 2V7KA 2J4DA 2KXPB 1EZ3A 3L17A 2NW7A 5H6RB 1JWGA 4Y6WA 3HXBA 4JLEA 4F7AA 3WAKA 5LX8A 2QGSA 1FVFA 5AQBA 3EUHA 3AVRA 4U72A 3J5PA 5JDHA 3QC9A 4CDMA 5FINA 5DQWA 2VSXE 2OLTA 1ELKA 3QJZA 4HBDA 1PC2A 3Q9NC 5HEUA 1UOHA 1R8IA 5AQSB 1SW6A 3P4PA 3QB2A 4BT8A 3C3RA 4ZHQE 3TLUA 1O1SA 4H9SE 5AYWD 2DZNA 3TLSA 4BA9A 3PEUB 2BDEA 3F31A 3RSEG 3AS4A 2L8KA 1FPPA 3P4QA 2VSNA 5B1BE 5AQLB 3QNUA 4KUMB 4DNDA 3DSVA 3L54A 4U7YA 1XMQT 4HEAA 2BG9C 4LF8T 2AXVA 3B7SA 3EAMA 2BF0X 3SHFA 3PURA 2DWKA 3HI2A 1TN6A 3CHMA 1BLXB 2N9DA 4UI9J 2Q7FA 5AQNB 4BSZB 4EQFA 2CE7A 3ONLA 4EV6A 3CVLA 2IAKA 3S4UA 4I9EA 3VLFA 1L0VA 1VDYA 1BR4A 4M7CA 1UX5A 1E7VA 4OK0A 3TAXA 4IE4A 4A63B 1WFDA 3EI0A 2XQ8A 1TNYA 5CMWA 1UURA 4X64T 3ZGQA 4HNAD 1NZNA 4DPRA 3HKDE 4V1Av 3BQKA 2XPYA 2AVPA 1H2VC 2EIKE 4GB9A 4HFEA 3NZQA 3Q5EA 1D9SA 1S94A 4U8YD 2NC9A 4GTQA 2HO1A 2LM9A 4GMJA 2LNIA 2BUGA 4DR5T 5JDGA 3ZT5A 4Z91A 5BXOA 1RW2A 3CKDA 1YCSB 2IHR1 1QZ2A 2RFMA 4M3OA 3PV0F 5HXRA 1YW0A 2IQCA 2XZTG 4L2YA 1IXVA 2QVAA 2WWUA 3ML9A 2IU1A 5ARGA 4GZ6A 1WYCA 5LHHB 4JI4T 1NL4A 4UWKA 5FQ8A 1HX8A 2CWOA 5D0OD 4MBGA 1YKHB 5FZRA 4X66T 2KZTB 3QB5A 4TV9E 3D9JA 4HN9A 5CRUA 5CEAA 3P2BA 4DV2T 4A5XA 3C72A 5ABEA 2M67A 5EILA 4PH4B 3ASFA 4ACKA 3FZHB 1H6KA 4PDXA 2HN2A 3N2KE 3PZ2A 3FTXA 2PTFA 3CQXC 2A3DA 3RIUA 3UFEA 3ONKA 5G05J 1TEZA 5AQQB 5AAOA 3NZUA 5M72A 2EQXA 3JAEA 3KV6A 1LF8A 4WNDA 3Q2MA 2XQ0A 5FMNA 4LCTA 4BERA 3FH8A 2E9XC 4U2ZA 3M65A 1A5EA 4JI6T 3A7MA 2VYIA 3B7TA 5ETWA 3NZSA 3AG1E 3CK9A 4OYSA 3R7QA 4GOUA 4UVAB 1JCQA 2KMFA 5J90A 1HS7A 4HFDA 3AE2A 3RIFA 4G25A 1HCIA 4TUMA 3JADA 3RYCE 5AQOB 4K5BA 1N0RA 5C2TA 1JWFA 5IY5E 4IHJE 4XX5A 1VCSA 3AA0B 3CVXA 4KX6A 5FXVA 3FUDA 1HR0T 3LY7A 3E33A 4FADA 4LG6A 4JHKA 3B7UX 3Q15A 4YHJA 3EDUA 3PDYA 3SO8A 3EHRA 3OTNA 5CBNA 2X6HA 3FZLB 4MS6A 5EK4A 3LJNA 5AJLA 1IHGA 2CBIA 3J5QB 4O4LE 3UI2A 5EK3A 3KVAA 1Z8UA 2WXRA 2UXNB 4GYSA 3FY4A 3UIOC 4FULA 3AA1B 5LP0A 1DNPA 3TXNA 3UUXB 2VASA 3OVUA 5LHGB 5LCYA 2BKPA 1JUQA 2XZEA 3P8CD 3ESLA 4R7LA 1YA0A 4EOZB 2JABA 1DCEA 2LSGA 3WI3A 5EKQD 2R5SA 1V54E 4N39A 2IJGX 2C5IT 3ETVA 4ILCA 4JA7A 4KZCA 5JHBA 1HX1B 3UM1A 2BEDA 5ITZF 4KI0F 5C1DA 3ZT6A 5A6CA 1Y8MA 2J08A 3RK6A 2LSYA 4JEUB 4IULA 2FO1E 3KSQA 3Q73A 4U3CA 4V3IA 4PK4A 1G73A 5D2MC 5FNVE 5M4YA 3U78A 5BPPA 4MKTA 3RYHE 3BG0B 2BS4A 4P0BA 2V5CA 4MLPA 1SUMB 4AXPA 3D9IA 4PS7A 3ZYMA 3LDZA 3NOGD 2E8IA 1D1AA 4DR2T 2LM2A 1N0QA 4WNEA 2YDRA 1UN8A 2P9IG 4YSYA 2D2SA 1CHUA 5G2NA 3CVRA 4MBQA 1O5MA 2YN6A 4EEBA 3OPCA 2FBNA 3UT8A 3HKBE 5A1LA 3W9FA 2IC9A 3VKHA 3T5XA 3SY2A 2XAGB 4JXTA 2HHHT 4AY6A 4HB5A 3SRZA 3IBPA 5JDLA 3UX4A 3QUJA 4DJAA 4GMLA 5JMND 2BZBA 2C0LA 2OV8A 2W61A 2VGXA 3FH7A 3CK6A 2A72A 5HWYA 1XNFA 3KV9A 2A5UA 5T3RA 4HKAA 1H0AA 2LXLA 2VTBA 1OCZE 4N3AA 2LLYA 4G2VA 4F3VA 3JYSA 1SA5A 5JRCA 3RRCA 3P4RA 4XIFA 2WZIA 5HCJA 5FXZA 3N9MA 1XDOA 4PAGA 3ZHEA 5D0QD 2GGFA 2BBJA 4BEPA 4K0UA 2RP4A 4AI6A 4YDEA 2X9HA 3V79K 4JEHA 3W9GA 1H2UA 3Q5MA 3B57A 4MFRA 5LP6E 3FU3A 1TJFA 1KEYA 5LFAA 2WBLA 1OEDA 1D0XA 3MV2B 4KZ0A 3UM2A 3AAAB 2V7JA 2XTLA 2X66A 3U64A 3KV5A 5J0ZA 1N94A 2L6JA 4ANXA 3RC8A 5CBOA 1HO8A 4X65T 2HH7A 3NBXX 2MYSA 5JDFA 2FI7A 4U07A 3Q79A 3C64A 3P4WA 3KEAA 3O9XA 2WQHA 3HVEA 4C91A 2VGEA 3FZFB 5ABFA 4HWIB 1BU9A 1TJCA 3AEAA 4UWFA 4ZI3D 2VVNA 2MYOA 3A5XA 4U7IA 2WXMA 2WAUA 1WCRA 1LD8A 5DJQC 3AEEA 2XAJB 3U4TA 4BAYB 3CSTA 1HNWT 3CHRA 5FT9A 1ZEEA 4JW1A 4JVSA 3QKYA 3BG1B 2CA5A 2UY1B 4GZ5A 4XZCA 4U8VD 4DO0A 2VGXB 4ADZA 1WG0A 2VTBB 3LXUX 1EYHA 4GU5A 5B3SE 2MBGA 3NAWA 5FWQA 2KLQA 4XEIG 1Z3XA 4N2SA 2P9KG 4RQIA 3JQ0A 3MKRA 5BNWA 4IE7A 4DX7D 2VWAA 3DP7A 4LMKA 3UMVA 4EPZA 4CGVA 4C90A 4CXXA 4EGWA 2MRIA 2DL1A 4QXHB 3NQPA 3JUIA 1OWNA 2CG2A 3TXMA 3C51A 2D9DA 2BVLA 2LXMA 3PDNA 5ENNA 2YU1A 1TNZA 1UJKA 5FYMA 3K3OA 1E96B 2PG8A 3T9KA 1MIWA 4OYJA 5FIOA 3N2OA 4F6RC 4B93B 2EHOC 2ILRA 3BU8A 3PUQA 4G23A 3B7RL 2D0UA 2ETAA 4UV8B 3CHSA 3RI5A 3H3MA 5IHYA 2R02A 2Q9QC 2DHRA 3I9WA 2B6CA 4DUIA 2ZLYA 4DX5D 5J2UE 1E90A 4G2AA 5AQAA 4H9QC 1UGOA 4JI2T 3CGHA 3F6QA 4O8SA 1YMPA 5AQFB 1O1RA 2CM0A 3LY8A 4PJJA 3C98B 3ZMVB 4CN1A 1ZU2A 4NACA 2YNQA 3TWVA 3ZCJA 2PQNA 1ZV4X 5KXJA 3HRAA 4X5TA 4JBWF 3V5SA 1OCOE 3AECA 4JV5T 4L0RA 3P4SA 4O2BE 5ENQD 5ENRD 2R59A 2IEJA 5HEJA 3UFGA 5EYLA 1MYOA 3PUSA 4ILAA 4X62T 3ZEFA 4UWGA 3T5VA 3S7BA 2V4HC 3CVNA 2EILE 5JREA 4IN3B 4CT0A 4JYAT 3IEGA 1N4QA 4Y6CA 4ANJA 2HR2A 2IF4A 2Y0BG 3K3NA 3G2UA 2MTQA 4LSZE 2J1DG 3UUMA 3Q7FA 4GTPA 2ONDA 4GZCA 3RU0A 2F8XK 3IV0A 3FUEA 1K8KG 3PUVF 2UUBT 4DV0T 3WG7E 2B1EA 1XNQT 3E32A 3JAFA 4U7EB 2ODVA 2XEHA 2BTDA 2XEEA 5H7PA 2W2UA 4HVBA 2HE0A 2JQKA 4GPKA 3E30A 4GYRA 4U31A 2BKOA 5HXHA 2IW5B 5J08A 2LSKA 4IE0A 5DIZA 2ZGDA 1WM5A 5HQ8A 4J2CA 2WXJA 2XS1A 3APCA 2X6FA 4I6GA 3MV3B 3Q47B 1JNZA 2LKHA 3Q5DA 2YOEA 2LEHA 3AA6B 3ONJA 5JR9A 2XJ7A 4YNDA 5AQIB 2KATA 4I43B 2WXOA 2ETCA 3CHPA 2DNXA 3DRAA 4I6JA 2JRKA 3ZXPA 3DEPA 4NUVA 3M3ZB 4HLLA 2W67A 2XQAA 4O4IE 3FHNA 4O4JE 2C2LA 5JHAA 2XSBA 4I0UA 3JQ1A 4GTTA 4CGWA 3FBLA 2UXXB 2XHEA 4YTMA 5KX5E 4B94A 3ESKA 3OTOT 1OWMA 1HG2A 1OUVA 4YY3T 4U74A 1IAPA 5LJNA 3ZIMA 2OCCE 3D9MA 3RYFE 4YLHA 3UU4A 5HXCA 5AQTB 4NIQA 4AQYT 4AIFA 1H2TC 2LE8A 4UVCB 3JCFA 4RG9A 3SD5A 4JA9A 4KT6B 2Z6EA 2BS2A 4DV5T 5HCMA 2LOPA 4G26A 2L9QA 4X20E 3HHMA 1JPLA 2H6FA 1M7KA 4UVBB 3FU6A 2CLYB 1LD7A 3O1IA 3CR3A 5F8PA 2H6IA 1V9DA 4BX8A 2EIJE 5JH7E 4CYMD 3CHQA 3C50A 3VLDA 3EHZA 3G2TA 5IUXA 2YEVC 3DXMG 4KHPT 3VU7H 4PS3A 4TXQA 4NXNT 2KSRA 5L47A 4G8KA 1MNDA 1J5ET 4JB8P 1HG5A 2QYJA 1VOMA 1MZCA 3UXGA 2X6JA 3IA3A 3LJCA 3U3WA 1NENA 4H7YA 4COFA 4GA1A 2XQYA 3AEGA 3Q5WA 4OVUA 3EDTB 5CEDB 2PQRA 2CHZA 4WNGA 3EDVA 2UU9T 3UT7A 1INZA 4UR9A 2XHEB 3UUBA 2LHRA 2UXCT 5HAXA 3MZLB 2KXPC 2WDQA 2V7MA 3WXXA 4AIUA 1YD8G 3RRMB 4U0SA 1MMAA 2FO7A 3K3QC 2PM6A 3HG0D 4XBFB 3RO3A 2BG9A 1UK5A 4LF4T 3LDQB 3PTRB 4I55E 3FZKB 5AARA 5F3JA 2K5BB 2Y4TA 3B95A 1EPUA 4AQGA 2VSYA 3ZUVB 3MCXA 2DWGA 3RO2A 2CPTA 4ISTA 2CHOA 2ZM0A 3FDHA 1D0YA 2X38A 4EZJA 5C8YE 3ZJ2A 2K3WA 1H7CA 3UU5A 1U2VG 3E37A 1MNEA 2IO3C 3FUJA 3I0OA 2FEZA 4Q25A 3H37A 2DBAA 4H9NC 4C48B 3UTMA 1B7TA 3AE1A 4JHJA 4AKGA 4CCAA 1X79A 3TL5A 1N4RA
chains in the Genus database with same CATH topology
4Q96A 5BV0A 2VKJA 2QA7A 2L3LA 2PFVA 4PJLA 4CZZB 4HE8A 3VTXA 1NA3A 2IOLA 2ZM8A 3JC6D 2FF4A 4EB6E 3CX6B 4CRWA 4YVQC 5ADXL 2R17C 5AIJA 2PL2A 4E6HA 4TN7B 5EX0A 4HOTA 2CFUA 1HTJF 3CV0A 3KEZA 4H7XA 5C2YA 5EZYE 3L3PA 5LGTB 3CKBA 5EX3A 3TG5A 3GN5A 3CVWA 1IZNB 4AQFC 2WXHA 1SHZC 3RRNB 4XKBA 4N78D 3CK7A 1U3DA 5FJYA 3GZSA 5FP3A 1UJJA 3FWVA 5JDNA 4NQ0A 2CCQA 2WXNA 4K0RA 3ZRHA 4EZLA 5KDMC 2I1JA 1QQEA 2KCVA 3CVVA 4EBAG 2E9XA 5HXEA 4FI5A 5LBQB 2IFUA 3PVLA 3N5LA 2L0IA 4GK0E 4KVOA 3N2GE 2E2EA 5LG4A 3ZYKA 2X68A 3CQCB 4GYWA 3RRUA 4APOA 3SFZA 4F53A 2IOSA 1HE8A 2XPZA 3OXLA 4X1IE 3C4WA 3ETUA 3Q4AB 3LG7A 2X3MA 2CXFA 4GIWA 3KAEA 1BPOA 4XI9A 5ANRA 2LJLA 1Y6IA 1MIYA 3N9NA 3KV4A 2DCPA 2NWBA 2NP9A 4FA6A 3O4ZA 2WB2A 2YHCA 4JHRA 3ZPJA 4KBMB 5ANLA 3PNLB 2KC7A 3GZ2A 1A17A 1IQRA 4ILHB 4B89A 4ANWA 2I9CA 2PM7A 4CXWA 4C9BB 3Q9DA 5LXTE 4CEMA 4HS2A 2CXLA 2OVFA 3I1AA 2W62A 1QSDA 3L09A 3KS2A 4QX7B 2PZIA 2SPCA 3SS1A 4AM9A 4BX9A 3QNKA 5J2TE 3S7JA 4HFVA 3AS5A 4IIJE 3UT4A 3GMIA 5JJ7A 3OJAA 3FUHA 5CCLA 1HF8A 1OWPA 2J4BA 4U0UA 4H9OC 4CI3B 4HOQA 3EHNA 1HU3A 2G0UA 2QFCA 4OFZA 3AU4A 1WRDA 1MMNA 5L3BB 2CHWA 2YK0A 3RKOA 5J1GA 4PJNA 4KVMA 3MACA 2C0MA 2JEKA 5T8IA 4I50E 3FTYA 3LPZA 3L08A 3PNTB 5CCMA 5L3DB 1FEWA 4O4HE 5G05C 2VKHA 4X1YE 3PE0A 5KJNA 1T98A 3ASDA 4WAFA 3R84B 3D9NA 3OKQA 1L5JA 3ZCIA 2E9XD 3SNXA 4TRQA 3ZXSA 3MXZA 1FCHA 4TZ4C 2D0TA 3R7RA 1MIVA 3RYIE 2OVBA 3Q5XA 4G63A 3B13A 2WXKA 4PS8A 1E8XA 4GA0A 3AAIA 3LKUA 2DLRA 4BJMA 3UUNA 2JMKA 2Y4UA 2M63A 2GRLA 1QNFA 4J8FA 1EDUA 4PK5A 4MLKA 3C4ZA 3OXGA 3T8MA 4EIWA 2HPLA 3L22A 3MKQA 3PU8A 4EECA 3APDA 3ZN1B 3IKOB 3S7DA 4Q69A 3CHOA 2XEVA 1ELWA 4I17A 3AAEB 3HR0A 5L3FB 3FUMA 1FMWA 3F57A 1YKEB 3ASHA 4HOSA 4UWLA 4PFOA 3IHVA 5TAOA 3I3NA 2ZU6B 1SQMA 5EDSA 1WR6A 4WNKA 4X1KE 3AA7B 4HXIA 2VK9A 2XGOA 2N1GA 2EHOA 4YJ2E 2XASB 4O2AE 4FC8A 3FP3A 3MGBA 3G2SA 3FUNA 4E85A 4OHFA 5CMYA 3CKCA 3CWZB 4GA2A 3HDXA 2Q9QA 3CEQA 3LK2B 3H3AA 5JRCB 2JLBA 3GA8A 4J8SA 3CVYA 3BK9A 2VGYA 4L23A 3ZHEB 3TGOA 4G1TA 1BR0A 4KBQA 4H63V 4UEMA 5AFUL 3HL6A 4ERRA 4U63A 4GCOA 2LSIA 2XCCA 4JEHB 3CVUA 1SA0E 4W9RA 4MHCA 3LJ3A 4E7SA 3MKQB 3DBSA 1LRZA 4UELA 3CIAA 3MJXA 4I2ZA 3HVEB 2Y3AA 4A1GA 2VJ8A 4HOUA 3RH3A 3PZDA 3UTKA 3N9PA 2AW6A 4UI9K 2V0PA 4XKCA 3ZYLA 4EZHA 1OXZA 2K48A 2WVIA 2H3RA 4QFVA 3MYVA 3D9OA 4Q94A 3TG4A 3HYMB 4AKLA 5E76A 3CVPA 1ELRA 1FMVA 4B6XA 3ONXA 4C0MA 5FY7A 2KWIB 3K8PC 3GW4A 2VL8A 2LSJA 5L2LA 2WXLA 1HZ4A 3NZPA 3I5PA 4I1OB 1FIOA 1NAFA 3ZMTB 3ANWA 5FTPA 5DQVA 5IYZE 3CLJA 2NW8A 3E4BA 4RVBA 3VTYA 4FHKA 1CUNA 3U3IA 2H7VC 2V7LA 3FULA 4UQXA 5H6QB 2ES0A 4GAAA 4BTBA 5LGNB 4YVOA 2NSZA 4XI0A 4ZI2C 4H63H 1B89A 1S0PA 4B8CB 2W00A 3OXFA 4FU3A 4RSYA 3ZYQA 4EZ4A 3CQGB 5KJLA 3ZEFB 3QWWA 4FLHA 1EF1C 1MMGA 5EK2A 5DBKA 3QDNA 5HXSA 2C5KT 5LNKA 3RX6A 2WSSV 2CLYC 4P0AA 3LBXA 3C4XA 4B8AA 3IHRA 3CX7B 3RKVA 3FEYA 3R9AB 3E08A 3PE3A 5JJTA 4UQYA 4QXBB 4HORA 4ANUA 2GK9A 3ULQA 5JQGE 4PW8A 2VKOA 2XRYA 3FU0A 3SBTB 3SBSA 5LCWC 4GCNA 3I0QA 3OAWA 2LSUA 2A4ZA 4GYOA 2XAFB 4TV8E 3J9X1 1HH8A 5JR9B 3MA9A 3QC1A 1KNZA 3W15B 3AS8A 1BR1A 3JC6C 1QUUA 4L2LA 2BVMA 4EBAA 5CB4E 4J0UA 4WW0A 4D10C 4MRUA 3O48A 2V5FA 3CK8A 4O6FA 4ANVA 3CSFA 4J8EA 1GW6A 3CVQA 4DMVA 2H7OA 4A55A 4UXNB 2VKDA 3IBEA 4M1PA 2HM8A 3PS6A 3PUGA 3ZC0A 3GZ1A 1UX4A 3HKCE 3UT5E 1D1CA 4L7TA 3LVRE 3D9KA 5LBMA 1G8XA 1P5QA 3ZC1A 1OWAA 3BEEA 3EHMA 5LJMA 5G04C 2W0GA 3CX8B 1U4QA 4EYYR 5CHEE 4I2WA 3QOUA 3IF8B 3SOLA 4TX5A 4HFGA 4XZ4A 4YJ3E 3NRXA 3MK7C 3FTSA 4N2QA 3FTVA 2VQ2A 4AJWA 4IYPA 1H19A 4IE6A 3KBUA 2WXPA 3LY9A 4G11A 4CI2B 4PK6A 2NOXA 4U04A 4AQFA 3ZN3A 2XGSA 4L5GA 3URZA 3ZMSB 4UF0A 3WAJA 1SZ9A 4JZYA 4FP7A 1HFAA 4TV3A 5AJDA 1MMDA 2VSOE 5JDQA 3ZFWA 2CWYA 4ZS3A 4PNIA 2ZM2A 3OYZA 2KZTA 1Z6TA 4LEUA 1Z3YA 2WMNA 2V4LA 3FEXA 3O4XE 2YQ8A 2KWHA 2RD0A 1UG3A 2C0SA 5FY0A 3BQIA 4DVDA 3UPVA 1MHQA 2WXGA 4K03A 2ACXA 4KXKB 2K9AA 5LGUB 5GONE 3EIJA 3P7IA 5CA0E 2PBIA 2X67A 3L16A 4N3BA 3FB2A 2LO6A 3QWPA 3GYZA 3LVQE 4IDZA 1LKXA 1WYBA 4H9RC 2P58C 2JPFA 4NRHB 1BR2A 2MOZA 2Y8DA 3J7Yq 3S2AA 2DIWA 3EJNA 2FULA 2WMOA 2NXPA 3VLEA 4I1AA 3ZN0B 4ILGA 4CDNA 1KT0A 4UQZA 2DI4A 4PFPA 4G24A 5A7DB 5L3GB 4N3CA 3KD7A 4N5CA 4UF0B 4PJMA 3DJBA 2KZ7B 2WQ7A 5KJMA 3LFMA 1WY6A 2UWJG 4LRZA 3FTZA 3HIZA 3G2VA 3ZPOA 4I6EA 2Y6XA 4GZ3A 3ZVVA 2J09A 5E0OA 3GWHA 1E8ZA 3UUXA 3PEVB 4DLOA 3SF4A 3GN5B 3UULA 3VKGA 3QWVA 5KCMA 2I59A 4L1BA 2V26A 3LS8A 3FUFA 5JVDE 3LK3B 4XAXB 4UI9C 1UW4B 3P1UA 4AY5A 2YU2A 2I2OA 2P9BA 2AXZA 3EIQC 3MA5A 4OYKA 4DLQA 3ENEA 1OWOA 3KDSE 5FXXA 4JEUA 2IONA 2CEAA 4IGUA 4HGAA 2RA1A 2E9XB 4KMCA 4HLEA 3I4RB 4FHJA 2V7IA 5FZQA 3FBZA 1D1BA 1D0ZA 4CDRA 2I1KA 3FUKA 1W3BA 4LERA 4BJNA 4EAHA 2WM9A 3HKEE 3ZJ1A 2J07A 4AVXA 3N9QA 2GW1A 5T4YA 3I4GA 4URKA 2NW9A 3MKDA 5CA1E 2PJQA 4ILUA 1NP7A 4NUUA 5HI7A 3D9PA 3MEKA 5JJ6A 3ASGA 4AXHA 3K9IA 2CFZA 5AENA 5BMVE 3AB3B 4ABNA 4DI4A 4FJYA 3DTOA 1KLXA 3N9OA 2HPJA 4EXTA 3FUIA 1WAO1 2YHEA 5LA6E 3KFWX 2KT9A 4TUUA 1E1HB 3MJWA 4ZI3C 2L9BA 5A23A 4RG6A 2XAQB 1KK7A 2OA5A 4QHOA 4FLBA 2Y48B 2WXIA 3D3MA 4J6IA 2A2FX 2XPIA 4JUYA 3KBTA 4QX8B 3MZKB 3FFLA 3R6NA 4KMOA 1IJ5A 3OYXA 4E7ZA 1WLXA 3LCAA 4FJOA 2XAHB 3BQLA 3OBVE 4DI3A 4HTEA 1S35A 4MALA 3N9LA 4ILIA 4DBRA 2V1DB 2LAHA 3FTWA 1ZBPA 3PREA 1IJ6A 1HXIA 2UY1A 1AJ3A 3G2WA 5FQ4A 1X5BA 2V8SE 2KM4A 3U9WA 5KJKA 1ZHCA 3PUKA 4WBOA 5HWXA 4WWNA 3FHEA 2KINB 5FQ7A 2LOSA 3CMLA 4ASKA 3D9LA 2VB6A 1PAQA 3APFA 4DBQA 3L13A 4ATGA 4A3TA 3DPDA 4AKIA 4AKHA 1Z0PA 3NF1A 3U66A 1XGWA 2JMHA 2OOEA 4EYUA 1ZKEA 3FTUA 1LVFA 4WWPA 2AWIA 2E0IA 5BUZA 1UCUA 2DCFA 4KYOB 1UN9A 5L3CB 3C98A 1MQSA 4NURA 3KINB 1FVHA 3PU3A 4KP3C 4ZI7E 2WXQA 3CPZA 2D5UA 4QKNA 4BWRA 4ISSA 2JQQA 3PRZA 2CG3A 5L3EB 2YINA 2LT3A 4JL0A 4OVVA 4H9PC 1LVKA 4BT9A 1N54A 1NA0A 3I9YA 2L0TB 5FY1A 4A1SA 2HYZA 2J49A 3AVSA 4BTAA 2W63A 3FXEB 4GYYA 2JJ9A 3JCKC 1E8YA 2XGMA 4P29A 4YFSA 4C0EA 2CMRA 2NTYA 5BW8C 2WPVA 4Z8XA 5FXWA 2X6IA 4B0ZA 2KCKA 3Q49B 3S7FA 1N52A 5KMGP 3FU5A 2EHOB 3TKLB 2X0LB 2MHKA 2J9QA 4P09A 2LHNA 4I43A 1SZAA 2Q9QB 2LAIA 3MX3A 4ACLA 3T8OA 2ODUA 1OWLA 4DK5A 4AV7A 3TJPA 2C5JA 4LUNU 2GRMA 3PUJA 3O1HA 4I4TE 4ZOLE 5JDMA 3IHYA 3KVBA 4JPSA 4CQIA 3ML8A 5LCWJ 2CXDA 4AEZC 2X6KA 4GZDA 3ZW3A 4CXYA 3ZLIA 5ARFA 5FZSA 2X9WA 2N2NA 3O1JA 3PE4A 3UQ3A 2I6HA 4QXCB 4UWHA 2WXFA 2MOWA 3QK0A 5LOVE 2KCLA 3RIBA 4AKRB 1U3CA 4WUYA 5G55A 3LEWA 4BY6A 1PY1A 2NTXA 4UIGA 2EHOD 3N71A 4ZS2A 4EZKA 5LOZA 5BV1A 2IC6A 3V5UA 4BFRA 2Q9QD 4U8HA 3SGHA 1US7B 3F2EA 5BT1A 5G04J 3LK42 4UV9B 2X9XA 2X9YA 3FXDB 3D0TA 2XUEA 3RRWA 3E22E 1KT1A 3RPUA 3RJVA 2X51A 5FQ6A 3FH5A 4WBNE 3VHLA 4I9CA 4CT4A 1IYGA 2XRZA 3PUAA 4GK5E 3ANWB 2QY7A 1VRBA 3QARA 5JR9C 2RG8A 1O3XA 1DVPA 2AXUA 1IQUA 3PH0C 4PUCA 2KNDA 1NWMX 3L6AA 3EVYA 5DABA 4IE5A 4BSXA 3SWHA 3QAQA 1E8WA 2ZMAA 4APFA 4U0ZA 4JC8A 4L9IA 3E0ZA 2WQ6A 2LSVA 3LYAA 4WNFA 5HYAA 4QWNB 4IRUA 4WWOA 1E7UA 3HA4A 2K24A 2XCBA 1U5PA 3ZMUB 4CI1B 4ME2A 4AOFA 4XE0A 5E75A 3QK6A 4I1MA 3IEEA 3SZ7A 1Y64B 3LBXB 4FJZA 4DMWA 3AU5A 4F1SA 2CHXA 3NRYA 3RC3A 4ZI2D 4AP2A 5LYJE 5LHIB 4TUYE 4J8DA 3SI5A 4A3VA 1HS6A 4A56A 3ZMZB 2V7KA 2J4DA 2KXPB 1EZ3A 3L17A 2NW7A 5H6RB 1JWGA 4Y6WA 4F7AA 4JLEA 3WAKA 5LX8A 2QGSA 1FVFA 3EUHA 3AVRA 4U72A 5JDHA 3QC9A 4CDMA 5DQWA 2VSXE 3QJZA 1ELKA 1PC2A 4BT8A 3QB2A 4ZHQE 4H9SE 5AYWD 4BA9A 3PEUB 2BDEA 3F31A 3AS4A 2L8KA 2VSNA 4KUMB 4DNDA 3L54A 4HEAA 2AXVA 3B7SA 2BF0X 3SHFA 3PURA 2DWKA 3HI2A 3CHMA 2N9DA 4UI9J 2Q7FA 4EQFA 2CE7A 3ONLA 3CVLA 2IAKA 3S4UA 4I9EA 3VLFA 1VDYA 1BR4A 1UX5A 1E7VA 4OK0A 3TAXA 4IE4A 5CMWA 3ZGQA 1NZNA 4DPRA 3HKDE 4V1Av 3BQKA 2XPYA 2AVPA 1H2VC 4GB9A 3NZQA 1S94A 2NC9A 2HO1A 2LM9A 4GMJA 2LNIA 2BUGA 5JDGA 3CKDA 1QZ2A 4M3OA 5HXRA 1YW0A 2IQCA 4L2YA 2WWUA 3ML9A 2IU1A 5ARGA 4GZ6A 1WYCA 5LHHB 4UWKA 5FQ8A 1HX8A 2CWOA 5D0OD 1YKHB 5FZRA 2KZTB 4TV9E 3D9JA 4HN9A 3P2BA 2M67A 4PH4B 3ASFA 4ACKA 1H6KA 4PDXA 3N2KE 3FTXA 3CQXC 2A3DA 3UFEA 3ONKA 5G05J 1TEZA 3NZUA 5M72A 2EQXA 3KV6A 1LF8A 4WNDA 3Q2MA 2XQ0A 5FMNA 4LCTA 3FH8A 2E9XC 3M65A 2VYIA 3B7TA 5ETWA 3NZSA 4OYSA 3CK9A 3R7QA 4GOUA 4UVAB 2KMFA 5J90A 1HS7A 4G25A 1HCIA 3RYCE 1JWFA 4IHJE 4XX5A 3AA0B 3CVXA 5FXVA 3FUDA 3LY7A 4FADA 4JHKA 3B7UX 3Q15A 4YHJA 3EDUA 3PDYA 3OTNA 2X6HA 4MS6A 5EK4A 5AJLA 1IHGA 4O4LE 5EK3A 3KVAA 2WXRA 2UXNB 4GYSA 3FY4A 4FULA 3AA1B 5LP0A 1DNPA 3TXNA 3UUXB 2VASA 5LHGB 5LCYA 1JUQA 3P8CD 3ESLA 4R7LA 1YA0A 4EOZB 2LSGA 3WI3A 5EKQD 2R5SA 4N39A 2IJGX 2C5IT 3ETVA 4JA7A 4KZCA 5JHBA 5C1DA 5A6CA 1Y8MA 2J08A 3RK6A 2LSYA 4JEUB 4IULA 4V3IA 4PK4A 1G73A 5FNVE 5M4YA 3U78A 5BPPA 4MKTA 3RYHE 3BG0B 4P0BA 4MLPA 4PS7A 4AXPA 3D9IA 3ZYMA 3LDZA 2E8IA 1D1AA 4WNEA 1UN8A 2D2SA 5G2NA 3CVRA 4MBQA 2FBNA 3UT8A 3HKBE 5A1LA 2IC9A 3VKHA 3T5XA 2XAGB 4JXTA 4AY6A 3SRZA 3IBPA 5JDLA 3UX4A 3QUJA 4DJAA 4GMLA 2BZBA 2C0LA 2OV8A 2W61A 2VGXA 3FH7A 1XNFA 2A72A 5HWYA 3KV9A 2A5UA 5T3RA 4HKAA 1H0AA 2VTBA 4N3AA 4G2VA 4F3VA 3JYSA 5JRCA 3RRCA 4XIFA 5FXZA 3N9MA 4PAGA 3ZHEA 5D0QD 2GGFA 4K0UA 2RP4A 4AI6A 2X9HA 4JEHA 1H2UA 3Q5MA 3B57A 4MFRA 5LP6E 3FU3A 1TJFA 5LFAA 2WBLA 1D0XA 3MV2B 4KZ0A 3AAAB 2V7JA 2XTLA 2X66A 3U64A 3KV5A 2L6JA 4ANXA 3RC8A 1HO8A 2HH7A 3NBXX 2MYSA 5JDFA 2FI7A 4U07A 3C64A 3O9XA 2WQHA 3HVEA 4C91A 1TJCA 4UWFA 4ZI3D 3A5XA 2WXMA 2WAUA 5DJQC 2XAJB 3U4TA 4BAYB 3CSTA 3CHRA 5FT9A 1ZEEA 4JW1A 4JVSA 3QKYA 3BG1B 2CA5A 2UY1B 4GZ5A 4XZCA 4DO0A 2VGXB 4ADZA 2VTBB 3LXUX 1EYHA 4GU5A 2MBGA 5FWQA 2KLQA 1Z3XA 4N2SA 3JQ0A 3MKRA 5BNWA 4IE7A 2VWAA 3DP7A 3UMVA 4EPZA 4CGVA 4C90A 4CXXA 2MRIA 4QXHB 3NQPA 3JUIA 1OWNA 2CG2A 3TXMA 3C51A 2BVLA 3PDNA 5ENNA 2YU1A 1UJKA 5FYMA 3K3OA 1E96B 2PG8A 1MIWA 4OYJA 3N2OA 4F6RC 2EHOC 2ILRA 3PUQA 4G23A 3B7RL 2D0UA 4UV8B 3CHSA 5IHYA 2Q9QC 2DHRA 3I9WA 2ZLYA 5J2UE 1E90A 4G2AA 4H9QC 3CGHA 4O8SA 2CM0A 3LY8A 4PJJA 3C98B 3ZMVB 1ZU2A 4NACA 2YNQA 3ZCJA 2PQNA 1ZV4X 3V5SA 4L0RA 4O2BE 2R59A 3PUSA 3ZEFA 4UWGA 3T5VA 3S7BA 3CVNA 4IN3B 5JREA 4CT0A 3IEGA 4Y6CA 4ANJA 2HR2A 2IF4A 3K3NA 3G2UA 2MTQA 2J1DG 3UUMA 2ONDA 4GZCA 3RU0A 3IV0A 3FUEA 2B1EA 2ODVA 2BTDA 4HVBA 4GPKA 4GYRA 5HXHA 2IW5B 5J08A 2LSKA 4IE0A 5DIZA 1WM5A 5HQ8A 4J2CA 2WXJA 3APCA 2X6FA 4I6GA 3MV3B 3Q47B 3AA6B 2LEHA 5JR9A 4YNDA 2KATA 4I43B 2WXOA 3CHPA 2DNXA 4I6JA 2JRKA 4NUVA 4O4IE 3FHNA 4O4JE 2C2LA 5JHAA 3JQ1A 4CGWA 3FBLA 2UXXB 2XHEA 5KX5E 4B94A 3ESKA 1OWMA 1HG2A 1OUVA 4U74A 1IAPA 5LJNA 3ZIMA 3D9MA 3RYFE 4YLHA 5HXCA 4AIFA 1H2TC 2LE8A 4UVCB 4RG9A 3SD5A 4JA9A 4KT6B 2Z6EA 2LOPA 4G26A 2L9QA 4X20E 3HHMA 1JPLA 4UVBB 3FU6A 2CLYB 3O1IA 3CR3A 5F8PA 1V9DA 4BX8A 5JH7E 3CHQA 3C50A 3VLDA 3G2TA 2YEVC 3VU7H 4PS3A 1MNDA 1HG5A 1VOMA 2X6JA 3LJCA 3U3WA 4H7YA 4GA1A 2XQYA 3Q5WA 4OVUA 3EDTB 2PQRA 2CHZA 4WNGA 3EDVA 3UT7A 1INZA 2XHEB 2LHRA 5HAXA 3MZLB 2V7MA 3WXXA 1YD8G 3RRMB 4U0SA 1MMAA 2FO7A 3K3QC 2PM6A 4XBFB 3RO3A 3PTRB 4I55E 5F3JA 2K5BB 2Y4TA 1EPUA 4AQGA 2VSYA 3MCXA 2DWGA 3RO2A 4ISTA 2ZM0A 3FDHA 1D0YA 2X38A 4EZJA 5C8YE 3ZJ2A 1H7CA 1MNEA 3FUJA 3I0OA 2FEZA 3H37A 2DBAA 4H9NC 1B7TA 4CCAA 4JHJA 4AKGA 1X79A 3TL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9L A;  3G2T A;  1UJJ A;  4Q96 A;  3RRU A;  1UJK A;  4GZD A;  1DVP A;  1EYH A;  5CMY A;  1PY1 A;  1INZ A;  5J08 A;  4HFG A;  5CMW A;  3D9I A;  3G2W A;  1EDU A;  5LOZ A;  3ZYM A;  3LDZ A;  4NAC A;  3G2S A;  2LO6 A;  2BF0 X;  3D9P A;  4Q94 A;  1X5B A;  1H0A A;  1JPL A;  2KM4 A;  2V8S E;  1HF8 A;  3CLJ A;  3G2U A;  1ELK A;  3ONK A;  2L0T B;  3ZYL A;  1SZ9 A;  3D9K A;  1HG5 A;  1HFA A;  3ONL A;  4GZC A;  4AVX A;  1HG2 A;  4FLB A;  1XGW A;  4FU3 A;  3G2V A;  2MOW A;  1LF8 A;  1JWF A;  1HX8 A;  1MHQ A;  3ZYQ A;  2L0I A;  5LP0 A;  3D9M A;  1VDY A;  1JWG A;  2DIW A;  3D9N A;  2QY7 A;  3D9J A;  4JXT A;  3ZYK A;  2DCP A;  3D9O A;  1JUQ A;  1SZA A; 
#chains in the Genus database with same CATH topology
 4Q96 A;  5BV0 A;  3TWT A;  2VKJ A;  2QA7 A;  2L3L A;  2PFV A;  4PJL A;  1WDY A;  4CZZ B;  4HE8 A;  1N4S A;  3VTX A;  1NA3 A;  1YYH A;  2IOL A;  2ZM8 A;  3JC6 D;  3E34 A;  2FF4 A;  4EB6 E;  3CX6 B;  4CRW A;  2UUA T;  5ADX L;  4YVQ C;  2R17 C;  5AIJ A;  3UIP C;  2PL2 A;  4HFH A;  3AG2 E;  4E6H A;  5ABH A;  4TN7 B;  5EX0 A;  2XEN A;  4HOT A;  2CFU A;  4QH1 A;  4JI3 T;  2DYS E;  5ENT D;  1HTJ F;  2UXB T;  1OY3 D;  3UM0 A;  3CV0 A;  3KEZ A;  4H7X A;  4LF9 T;  5C2Y A;  5EZY E;  3L3P A;  5LGT B;  1S70 B;  3CKB A;  5EX3 A;  3TG5 A;  3GN5 A;  4YXD A;  5CFB A;  2BG9 B;  3CVW A;  3UU6 A;  1IZN B;  4AQF C;  2WXH A;  1SHZ C;  4GTS A;  2R05 A;  3RRN B;  4IDN A;  4XKB A;  4N78 D;  5AQG B;  3CK7 A;  1U3D A;  2FJB A;  3X2Q E;  5FJY A;  3GZS A;  5FP3 A;  3T8K A;  1UJJ A;  3FWV A;  4U95 D;  5JDN A;  4NQ0 A;  4F1P A;  2CCQ A;  2WXN A;  3L8R A;  4K0R A;  4N5Q A;  3ZRH A;  4EZL A;  5KDM C;  3T1H T;  3VRA A;  1NEK A;  2I1J A;  1QQE A;  2KCV A;  3CVV A;  4EBA G;  2E9X A;  5HXE A;  1SA4 A;  4FI5 A;  4TWH A;  3BUA A;  3VR9 A;  5LBQ B;  3NKZ A;  4LNU D;  2IFU A;  3PVL A;  4O60 A;  3N5L A;  2L0I A;  4GK0 E;  4KVO A;  3N2G E;  2E2E A;  5LG4 A;  3ZYK A;  2X68 A;  3CQC B;  4GYW A;  3RRU A;  4APO A;  3SFZ A;  4F53 A;  4U96 D;  2IOS A;  4JI8 T;  5AQP B;  1HE8 A;  2XPZ A;  5CJ5 A;  3OXL A;  4K5A B;  4X1I E;  3C4W A;  3ETU A;  5LB7 B;  2V6Y A;  4GTO A;  3Q4A B;  3LG7 A;  1K1B A;  2X3M A;  3EHQ A;  5AQ9 A;  2CXF A;  3ULY A;  4DX2 A;  4GIW A;  3KAE A;  1BPO A;  4XI9 A;  5ANR A;  2LJL A;  1KPS B;  1Y6I A;  1MIY A;  3N9N A;  3KV4 A;  2DCP A;  1W0A A;  2NWB A;  2NP9 A;  3AXJ A;  4FA6 A;  3AED A;  3O4Z A;  4LFA T;  2WB2 A;  3SQV A;  2YHC A;  4JHR A;  3ZPJ A;  2AE9 A;  4KBM B;  5ANL A;  5ENP D;  3PNL B;  3SFE A;  1MX6 A;  2KC7 A;  3GZ2 A;  1A17 A;  2QRX A;  4DUZ T;  1MX2 A;  1IQR A;  5KNH D;  4ILH B;  4B89 A;  4ANW A;  2XQ7 A;  1I6Z A;  2I9C A;  2PM7 A;  5HEG A;  4CXW A;  4C9B B;  3Q9D A;  5LXT E;  4CEM A;  4HS2 A;  2CXL A;  2OVF A;  2JIW A;  3I1A A;  4HRL A;  2W62 A;  1QSD A;  4YSX A;  3Q7A A;  3L09 A;  5L4H A;  3HXF A;  3PUY F;  3KS2 A;  4QX7 B;  2PZI A;  2R2L A;  2SPC A;  3SS1 A;  4AM9 A;  2H6G A;  3EU9 A;  4BX9 A;  3QNK A;  2FBW A;  2XM1 A;  4B3R T;  5J2T E;  3S7J A;  4HFV A;  4F8H A;  5B1A E;  3NWI A;  2WQY A;  3AS5 A;  4IIJ E;  3UT4 A;  3GMI A;  5JJ7 A;  3OJA A;  3TWW A;  3FUH A;  5CCL A;  2XY8 B;  1HF8 A;  2EIN E;  1OWP A;  4DV4 T;  4U33 A;  2J4B A;  4U0U A;  4U2Y A;  4H9O C;  4CI3 B;  4HOQ A;  1JNR A;  3EHN A;  2PNN A;  2DWZ A;  3UIN C;  3RQU A;  1HU3 A;  2G0U A;  2QFC A;  4OFZ A;  3AU4 A;  4LMJ A;  1WRD A;  5L3B B;  1MMN A;  2CHW A;  2YK0 A;  3EUV A;  3RKO A;  5J1G A;  4HWH A;  4PJN A;  4KVM A;  3MAC A;  2FJA A;  3HXD A;  3VRB A;  4YT0 A;  2C0M A;  2JEK A;  5T8I A;  1H6O A;  4I50 E;  3FTY A;  3LPZ A;  1BI8 B;  3L08 A;  3PNT B;  5CCM A;  5L3D B;  1FEW A;  3JXJ A;  4EED A;  4O4H E;  5G05 C;  2VKH A;  3FZM B;  2A9U A;  4X1Y E;  3PE0 A;  5KJN A;  4LNG A;  1T98 A;  3AE5 A;  3ASD A;  4WAF A;  3R84 B;  3OKQ A;  3D9N A;  1L5J A;  2XQ3 A;  3ZCI A;  2E9X D;  3SNX A;  4TRQ A;  3ZXS A;  3MXZ A;  1FCH A;  4TZ4 C;  2D0T A;  3R7R A;  1MIV A;  3RYI E;  2OVB A;  3Q5X A;  1AP7 A;  1TR4 A;  4G63 A;  4YDO A;  3B13 A;  4JI1 T;  2WXK A;  3PZ4 A;  1E8X A;  4IRE A;  4PS8 A;  4GA0 A;  3AAI A;  3LKU A;  2DLR A;  2WU5 A;  4BJM A;  4HRN A;  3UUN A;  2L6B A;  2JMK A;  2Y4U A;  3UM3 A;  2M63 A;  3TWR A;  1Z5S C;  1T72 A;  2XQ6 A;  2V5Q C;  2GRL A;  3AAA C;  1QNF A;  3NOC D;  4LNB A;  1FT2 A;  4J8F A;  1EDU A;  1NFI E;  4PK5 A;  4MLK A;  3C4Z A;  3OXG A;  3T8M A;  4EIW A;  2HPL A;  3L22 A;  2XS8 A;  3MKQ A;  1KNP A;  3PU8 A;  4EEC A;  3APD A;  3ZN1 B;  3IKO B;  3S7D A;  4Q69 A;  3CHO A;  4IDQ A;  2XEV A;  1BI7 B;  1ELW A;  4I17 A;  3AAE B;  3HR0 A;  5HS0 A;  5L3F B;  2CRB A;  1DU2 A;  2FUP A;  1QYM A;  3FUM A;  1FMW A;  1WR0 A;  2IO2 C;  3F57 A;  1MX4 A;  1YKE B;  4GTR A;  3ASH A;  4HOS A;  4UWL A;  4PFO A;  3IHV A;  4HWD A;  4G8L A;  4K5C A;  4TXR A;  5TAO A;  3I3N A;  2ZU6 B;  5C3J A;  1SQM A;  5EDS A;  1WR6 A;  4WNK A;  2P9S G;  4X1K E;  3AA7 B;  3DSU A;  4HXI A;  2VK9 A;  3HXC A;  2N1G A;  2XGO A;  2ZIS A;  2EHO A;  4YJ2 E;  2XAS B;  4O2A E;  4FC8 A;  3FP3 A;  3PJA J;  3MGB A;  3G2S A;  3FUN A;  1IBM T;  4DR4 T;  4E85 A;  4OHF A;  5F5W A;  4RLY A;  5CMY A;  3CKC A;  3CWZ B;  4GA2 A;  3HDX A;  2Q9Q A;  2BKG A;  3CEQ A;  3ULE G;  3LK2 B;  3H3A A;  5JRC B;  2JLB A;  3GA8 A;  4J8S A;  3CVY A;  4HI8 A;  3BK9 A;  2VGY A;  4L23 A;  3ZHE B;  3TGO A;  4G1T A;  1BR0 A;  4KBQ A;  4H63 V;  3AG4 E;  4UEM A;  5AFU L;  3HL6 A;  4ERR A;  1UUS A;  4U63 A;  4GCO A;  2LSI A;  2XCC A;  4JEH B;  2R6G F;  4ATZ D;  3ABV A;  1OED B;  1TNO A;  3CVU A;  1SA0 E;  4W9R A;  4MHC A;  3LJ3 A;  4E7S A;  1IBL T;  3MKQ B;  3ISM C;  2WU2 A;  3DSS A;  1FT1 A;  2ZGG A;  3UQ7 A;  2P9N G;  3TLV A;  3DBS A;  1LRZ A;  3PJA A;  4GTV A;  4UEL A;  3CIA A;  4X8Q A;  2NR4 A;  3MJX A;  1Y01 A;  1SVX A;  4I2Z A;  3HVE B;  2KBX A;  2VQE T;  2Y3A A;  5ABF B;  4A1G A;  1XWM A;  3SFX A;  2P2C P;  2VJ8 A;  4HOU A;  3RH3 A;  3PZD A;  3UTK A;  3N9P A;  2AW6 A;  4UI9 K;  5JTG A;  3V31 A;  2LRL A;  2V0P A;  3ZNG A;  4XKC A;  4DUY T;  1OCC E;  3ZYL A;  4EZH A;  1OXZ A;  2K48 A;  4CZ2 D;  5EYP F;  2WVI A;  3AE6 A;  2H3R A;  4UUC A;  4QFV A;  2GRN B;  3MYV A;  5AQ7 A;  4DR7 T;  3D9O A;  2WCA A;  2ACZ A;  4Q94 A;  2IDO B;  3AE7 A;  3TG4 A;  3QB5 K;  3HYM B;  2BKN A;  4AKL A;  5E76 A;  3CVP A;  4B3T T;  2R03 A;  1ELR A;  1FMV A;  1N9A A;  4GKJ T;  2OV9 A;  4B6X A;  1J5W A;  3ONX A;  4DV1 T;  4C0M A;  5FY7 A;  2KWI B;  3K8P C;  2I0M A;  2XPK A;  4WZX A;  3GW4 A;  2VL8 A;  2LSJ A;  4HQD A;  1O1T A;  5L2L A;  3UKU G;  2FJE A;  2WXL A;  1HZ4 A;  3AEB A;  3NZP A;  3I5P A;  4I1O B;  1FIO A;  1IKN D;  2IY0 C;  3TWQ A;  1NAF A;  4HFI A;  3ZMT B;  3ANW A;  3DEO A;  4LF6 T;  1KNR A;  5FTP A;  5DQV A;  5IYZ E;  1N95 A;  3CLJ A;  2NW8 A;  3E4B A;  1XZY A;  4RVB A;  3VTY A;  4FHK A;  1CUN A;  3U3I A;  2H7V C;  2V7L A;  3FUL A;  4UQX A;  1HNZ T;  2WS3 A;  1VCT A;  3G06 A;  4HWC A;  5H6Q B;  2ES0 A;  4GAA A;  3UU8 A;  4BTB A;  1S64 A;  5LGN B;  2BG9 E;  4YVO A;  4F6R D;  2NSZ A;  4DV6 T;  3RKG A;  4XI0 A;  4ZI2 C;  2E5V A;  4H63 H;  4LFB T;  1B89 A;  1S0P A;  2IML A;  2YDS A;  4B8C B;  2W00 A;  3OXF A;  4FU3 A;  5AQV B;  3ABL E;  4RSY A;  3SFY A;  2BKK B;  3ZYQ A;  2IIU A;  2UXD T;  4EZ4 A;  3CQG B;  5KJL A;  3ZEF B;  3QWW A;  4FLH A;  1TNU A;  1EF1 C;  1MMG A;  5EK2 A;  5DBK A;  3QDN A;  5HXS A;  2C5K T;  5AQM B;  5LNK A;  3RX6 A;  4O1O A;  2WSS V;  2CLY C;  4P0A A;  3LBX A;  3C4X A;  4B8A A;  1M62 A;  3IHR A;  2WDV A;  3CX7 B;  2F0Y A;  3RKV A;  3FEY A;  3R9A B;  3E08 A;  3PE3 A;  5L4E A;  5JJT A;  4Z68 A;  2F8Y A;  4UQY A;  4QXB B;  4HOR A;  4ANU A;  2GK9 A;  3ULQ A;  5JQG E;  1JCS A;  4PW8 A;  2VKO A;  1JCR A;  2XRY A;  5HEO A;  4GPM A;  3FU0 A;  3ZKR A;  3SBT B;  3NVO A;  3SBS A;  5LCW C;  5EID A;  4GCN A;  2VL0 A;  3I0Q A;  3OAW A;  2LSU A;  2A4Z A;  4GYO A;  2XAF B;  4TV8 E;  3J9X 1;  1HH8 A;  5JR9 B;  3MA9 A;  3QC1 A;  1KNZ A;  4K0K T;  3W15 B;  3AS8 A;  1BR1 A;  3JC6 C;  1QUU A;  2E5L T;  4L2L A;  2BVM A;  4BES A;  3NBN B;  4EBA A;  5CB4 E;  4J0U A;  4WW0 A;  2DVW A;  4D10 C;  2YDQ A;  3O48 A;  4MRU A;  2V5F A;  1TYQ G;  3DSW A;  3CK8 A;  4O6F A;  4ANV A;  3CSF A;  1ZOY A;  4J8E A;  1GW6 A;  3CVQ A;  4DMV A;  2H7O A;  1E7P A;  4A55 A;  2CHN A;  4UXN B;  5FL0 A;  4DV3 T;  2VKD A;  4DR3 T;  1Q2Z A;  3IBE A;  3ZT7 A;  4M1P A;  2HM8 A;  3PS6 A;  3PUG A;  3ZC0 A;  4JI0 T;  3GZ1 A;  1UX4 A;  3HKC E;  4YTN A;  3UT5 E;  3B5M A;  1D1C A;  4L7T A;  4AIS A;  3LVR E;  4B3M T;  3ZSS A;  3D9K A;  1YQ3 A;  4OAU C;  2VUR A;  2LRK A;  1G8X A;  5LBM A;  2WP9 A;  1P5Q A;  3ZC1 A;  1OWA A;  2WZH A;  3BEE A;  3EHM A;  5FKY A;  1KZP A;  5LJM A;  2P9P G;  5G04 C;  2W0G A;  3CX8 B;  4GTM A;  1U4Q A;  4EYY R;  5CHE E;  4I2W A;  3QOU A;  2F4V T;  1K3Z D;  3IF8 B;  3SOL A;  4TX5 A;  2ZM6 T;  4HFG A;  4XZ4 A;  4YJ3 E;  3NRX A;  3MK7 C;  3FTS A;  3C5R A;  4HI9 A;  4N2Q A;  5EIB E;  2V5D A;  4HFB A;  2HN1 A;  2QYW A;  3FTV A;  2BS3 A;  2XQ5 A;  2VQ2 A;  4AJW A;  4IYP A;  1H19 A;  4IE6 A;  3KBU A;  2WXP A;  4J8Y A;  3LY9 A;  1X81 A;  4G11 A;  4CI2 B;  4PK6 A;  2GRO B;  1MJ0 A;  3AE3 A;  2NOX A;  5HRY A;  4U04 A;  4AQF A;  3ZN3 A;  2P9L G;  5ENO D;  2XGS A;  4L5G A;  3NB2 A;  3URZ A;  3ZMS B;  4UF0 A;  3WAJ A;  1SZ9 A;  3JXI A;  4JZY A;  4FP7 A;  1HFA A;  3RAU A;  4TV3 A;  5AJD A;  1MMD A;  2RPA A;  2VSO E;  5JDQ A;  3ZFW A;  2XM2 A;  1I94 T;  2CWY A;  4ZS3 A;  3DST A;  4PNI A;  2OEV A;  4O1P A;  2ZM2 A;  3OYZ A;  2KZT A;  2W4X A;  1Z6T A;  4LEU A;  1Z3Y A;  2WWV A;  2WMN A;  3TWU A;  2V4L A;  4JI7 T;  3O4X E;  2YQ8 A;  3FEX A;  4DRX E;  2KWH A;  2RD0 A;  2VQF T;  1UG3 A;  3TWX A;  2C0S A;  5FY0 A;  4DR6 T;  3BQI A;  1T7S A;  4DVD A;  3UPV A;  3CIR A;  1MHQ A;  3RIA A;  4ZEY A;  2WXG A;  4K03 A;  2ACX A;  4NPP A;  4KXK B;  1N34 T;  2K9A A;  5LGU B;  3V2X A;  5GON E;  2DYR E;  3EIJ A;  3IXE A;  3P7I A;  1FJG T;  5CA0 E;  2PBI A;  2X67 A;  3L16 A;  2ZXW E;  4N3B A;  3FB2 A;  5AQU B;  2LO6 A;  2Y69 E;  3QWP A;  3GYZ A;  3LVQ E;  5FL1 A;  4IDZ A;  1LKX A;  1WYB A;  4H9R C;  5AQK B;  3UU3 A;  2P58 C;  2XZD G;  3BQO A;  2JPF A;  4NRH B;  1BR2 A;  2MOZ A;  2Y8D A;  3J7Y q;  3S2A A;  2DIW A;  3EJN A;  2FUL A;  2WMO A;  2NXP A;  3VLE A;  4YHH T;  3ZN0 B;  1DCQ A;  4I1A A;  4ILG A;  4CDN A;  1KT0 A;  4UQZ A;  2DI4 A;  3ONL C;  4PFP A;  2OEW A;  4G24 A;  2XQ4 A;  3AE4 A;  5A7D B;  5L3G B;  4N3C A;  2H6H A;  3KD7 A;  4N5C A;  2XSA A;  4UF0 B;  4PJM A;  3DJB A;  2KZ7 B;  2WQ7 A;  5KJM A;  3LFM A;  1WY6 A;  2UWJ G;  3V30 A;  4LRZ A;  3FTZ A;  4LFC T;  3HIZ A;  3G2V A;  3ZPO A;  1N36 T;  4I6E A;  2Y6X A;  4GZ3 A;  3ZVV A;  2J09 A;  5E0O A;  3ABM E;  2M6B A;  3DWL G;  4TNW A;  3GWH A;  1E8Z A;  3Q78 A;  3UUX A;  2V6X A;  3PEV B;  4DLO A;  2F37 A;  3SF4 A;  4Z90 A;  3GN5 B;  3UUL A;  3VKG A;  3QWV A;  5KCM A;  2I59 A;  4L1B A;  2V26 A;  3ASN E;  3LS8 A;  5ENS D;  5HKP A;  3FUF A;  5JVD E;  4B3S T;  3LK3 B;  4XAX B;  3Q75 A;  4UI9 C;  1DC2 A;  5BR8 T;  1UW4 B;  3P1U A;  4GMR A;  4AY5 A;  2YU2 A;  2I2O A;  2P9B A;  2AXZ A;  3EIQ C;  3MA5 A;  4JD2 G;  4OYK A;  4DLQ A;  3ENE A;  4ZFH A;  1E2A A;  1OWO A;  3KDS E;  5FXX A;  4JEU A;  2ION A;  2CBJ A;  3PUX F;  4OX9 T;  2CEA A;  4IGU A;  3DSX A;  4HGA A;  4IT4 A;  2RA1 A;  2E9X B;  1XDP A;  4KMC A;  3PZ1 A;  1D8D A;  4HLE A;  3I4R B;  4FHJ A;  2V7I A;  5FZQ A;  1D8E A;  3FBZ A;  1OED E;  1D1B A;  1D0Z A;  2A5E A;  2Y1L E;  4JI5 T;  4CDR A;  2I1K A;  1W3B A;  3FUK A;  4LER A;  4BJN A;  4EAH A;  2WM9 A;  3HKE E;  3RIU C;  3ZJ1 A;  2J07 A;  4AVX A;  3N9Q A;  2GW1 A;  5T4Y A;  1G3N B;  3I4G A;  2EIM E;  4URK A;  2NW9 A;  3MKD A;  4IDP A;  5CA1 E;  2PJQ A;  4ILU A;  1NP7 A;  4NUU A;  5HI7 A;  4A98 A;  3RGL A;  2V6Y B;  3D9P A;  3MEK A;  4QQI A;  5JJ6 A;  3ASG A;  2FJD A;  4AXH A;  3K9I A;  2CFZ A;  5AEN A;  5BMV E;  3AB3 B;  4ABN A;  3UQ4 A;  1OCR E;  4DI4 A;  3AXJ B;  4FJY A;  3DTO A;  4ZZC A;  5AN8 A;  4BET A;  1KLX A;  3N9O A;  2HPJ A;  4EXT A;  3D9H A;  3FUI A;  1YXR A;  1N4P A;  3L39 A;  1WAO 1;  2YHE A;  5LA6 E;  1GQE A;  3KFW X;  3R9M A;  2KT9 A;  4TUU A;  1E1H B;  3MJW A;  4ZI3 C;  2L9B A;  5A23 A;  4RG6 A;  2XAQ B;  5CGM A;  1J1J A;  1KK7 A;  2OA5 A;  4QHO A;  4FLB A;  2Y48 B;  2WXI A;  3D3M A;  4J6I A;  5LMU T;  2A2F X;  2XPI A;  4JUY A;  3KBT A;  2QYU A;  4QX8 B;  3L9T A;  3MZK B;  3FFL A;  3VR8 A;  4NXM T;  3R6N A;  4KMO A;  1IJ5 A;  3OYX A;  4E7Z A;  1BD8 A;  4EHM A;  4LF7 T;  4YDW A;  2J8S D;  4HRM B;  1WLX A;  4HFC A;  3LCA A;  4FJO A;  2XAH B;  3BQL A;  3OBV E;  1TN7 A;  2AXD S;  3ASO E;  4DI3 A;  4HTE A;  1AWC B;  1S35 A;  4IL9 A;  3RF1 A;  4MAL A;  3N9L A;  4ILI A;  4DBR A;  3PUZ F;  2V1D B;  2LAH A;  3FTW A;  1ZBP A;  3PRE A;  1IJ6 A;  1HXI A;  2UY1 A;  1HNX T;  1AJ3 A;  1OXJ A;  3G2W A;  5CRV A;  5D66 A;  1N33 T;  5FQ4 A;  1X5B A;  2V8S E;  2KM4 A;  3U9W A;  1TNB A;  3C3O A;  4YDY A;  2B76 A;  5KJK A;  1ZHC A;  3PUK A;  1W09 A;  2XQ9 A;  4WBO A;  5HWX A;  3L82 A;  4WWN A;  3FHE A;  2H88 A;  2KIN B;  5FQ7 A;  2LOS A;  3A8Y C;  2LUH A;  3CML A;  4ASK A;  3D9L A;  2VB6 A;  1PAQ A;  4IL4 A;  3APF A;  5EN5 D;  4DBQ A;  3L13 A;  4ATG A;  4A3T A;  3SFD A;  1LTX A;  4QH4 A;  3DPD A;  1OT8 A;  1YQ4 A;  4AKI A;  4AKH A;  4WYV A;  1Z0P A;  3NF1 A;  1S63 A;  3U66 A;  1XGW A;  2JMH A;  2OOE A;  4EYU A;  1ZKE A;  3FTU A;  1LVF A;  4KHZ F;  4ILB A;  4WWP A;  2AWI A;  2E0I A;  5BUZ A;  2X0Y A;  1UCU A;  2DCF A;  4KYO B;  4GKK T;  1KZO A;  3ABK E;  3PUW F;  1XNR T;  1UN9 A;  5L3C B;  3C98 A;  1MQS A;  3T1Y T;  4A97 A;  4NUR A;  3KIN B;  1FVH A;  3PU3 A;  4KP3 C;  4ZI7 E;  2WXQ A;  3CPZ A;  2D5U A;  3RQW A;  4QKN A;  4BWR A;  4IDO A;  4TWF A;  1OED C;  3QOF A;  4ISS A;  2JQQ A;  3ZKJ A;  3PRZ A;  3ZU7 B;  2CG3 A;  2LKG A;  5L3E B;  1NI1 A;  4HWF A;  2YIN A;  3DXK G;  3PZ3 A;  4ZZB A;  2V8S V;  3UKR G;  3V2O A;  2LT3 A;  4JL0 A;  4OVV A;  4H9P C;  1LVK A;  4BT9 A;  1N54 A;  1IHB A;  1NA0 A;  3I9Y A;  1V55 E;  2L0T B;  5FY1 A;  4A1S A;  2HYZ A;  2J49 A;  1W0B A;  3AVS A;  2J4G A;  5ABG A;  4BTA A;  2W63 A;  3FXE B;  4GYY A;  3LSV A;  1N32 T;  2JJ9 A;  3JCK C;  1E8Y A;  4QH5 A;  1QLB A;  2XGM A;  4P29 A;  1H6P A;  4YFS A;  1TN8 A;  4C0E A;  2CMR A;  2NTY A;  5BW8 C;  2WPV A;  4Z8X A;  5FXW A;  2BBH A;  2X6I A;  2M6I A;  4B0Z A;  5KBA A;  2KCK A;  3Q49 B;  1XMO T;  4LF5 T;  3S7F A;  1N52 A;  5KMG P;  3FU5 A;  2EHO B;  1W9R A;  3TKL B;  5AQH B;  3ZST A;  2X0L B;  2GRP B;  2MHK A;  2J9Q A;  4P09 A;  2LHN A;  2WB5 A;  4I43 A;  1SZA A;  2Q9Q B;  3AJI A;  2J62 A;  2LAI A;  4YTP A;  3HXE A;  5AQJ B;  3MX3 A;  4ACL A;  3T8O A;  5CER B;  2ODU A;  1OWL A;  4DK5 A;  1SE7 A;  4AV7 A;  3TJP A;  2C5J A;  5LMN T;  4LUN U;  2GRM A;  3PUJ A;  3O1H A;  2JQ9 A;  4I4T E;  2YKS A;  5BXU A;  2GRQ B;  4ZOL E;  5JDM A;  3IHY A;  3KVB A;  4JPS A;  3TWS A;  4CN4 A;  2DZO A;  4CQI A;  1K1A A;  3ML8 A;  2QC9 A;  3AG3 E;  5LCW J;  2CXD A;  4AEZ C;  2X6K A;  4GZD A;  3ZW3 A;  4CXY A;  3ZLI A;  5ARF A;  5FZS A;  2X9W A;  2N2N A;  4LML A;  3KSL A;  3O1J A;  4TXP A;  2QZA A;  3PE4 A;  3UQ3 A;  4YSZ A;  3RLF F;  2I6H A;  3AE8 A;  4QXC B;  4UWH A;  4ZXL A;  2WXF A;  4P1N A;  2RFA A;  2MOW A;  3QK0 A;  5LOV E;  3AE9 A;  2KCL A;  4DV7 T;  4CN6 A;  3RIB A;  4AKR B;  1U3C A;  4WUY A;  5G55 A;  3LEW A;  4BY6 A;  1PY1 A;  2NTX A;  4UIG A;  2EHO D;  3N71 A;  4ZS2 A;  4EZK A;  5LOZ A;  2MAW A;  3C3Q A;  5BV1 A;  4L9P A;  2IC6 A;  2W66 A;  3V5U A;  4BFR A;  5FVK A;  1ZP0 A;  2Q9Q D;  4U8H A;  3SGH A;  1RZ4 A;  1US7 B;  3F2E A;  5BT1 A;  2ZIR A;  3LK4 2;  5G04 J;  3TLT A;  2MPK A;  4UV9 B;  2X9X A;  2X9Y A;  3FXD B;  3D0T A;  4DID B;  2XUE A;  3RRW A;  2X0H A;  3E22 E;  1KT1 A;  4DR1 T;  3RPU A;  3RJV A;  2X51 A;  1KF6 A;  5FQ6 A;  3FH5 A;  4WBN E;  1QBQ A;  3EU5 A;  3VHL A;  3EAB A;  5AQR B;  4I9C A;  4CT4 A;  2E2A A;  1IYG A;  2XRZ A;  3PUA A;  4GK5 E;  4DX6 D;  3ANW B;  1N11 A;  3K1S A;  2QY7 A;  5HEH A;  4J7W A;  1VRB A;  1ZB1 A;  3QAR A;  5JR9 C;  4OAV B;  2RG8 A;  1O3X A;  1DVP A;  2AXU A;  1IQU A;  3PH0 C;  2GRR B;  4TWD A;  4PUC A;  2KND A;  1NWM X;  3L6A A;  4TNV A;  3EVY A;  3TLW A;  5DAB A;  4IE5 A;  5CEC B;  4BSX A;  3SWH A;  3QAQ A;  5KNG A;  1E8W A;  2ZMA A;  4APF A;  4U0Z A;  4JC8 A;  4L9I A;  3E0Z A;  2WQ6 A;  2LSV A;  3LYA A;  4WNF A;  2WY2 A;  5HYA A;  4DX1 A;  4QWN B;  4IRU A;  5LG3 A;  3DPY A;  4WWO A;  3RHW A;  1E7U A;  3HA4 A;  5JA4 D;  2JQH A;  2K24 A;  2NYJ A;  2P9U G;  2VVS A;  4NIK A;  2XCB A;  1U5P A;  3ZMU B;  1IBK T;  4CI1 B;  1KFY A;  2RKK A;  4ME2 A;  4AOF A;  5FVL A;  4XE0 A;  5E75 A;  4ZHB A;  3QK6 A;  1T8B A;  4I1M A;  3IEE A;  3SZ7 A;  1Y64 B;  3LBX B;  2H89 A;  4DMW A;  4FJZ A;  5IWA T;  2UUC T;  3AU5 A;  2B0O E;  2WDR A;  2CHX A;  4F1S A;  3P50 A;  3NRY A;  3RC3 A;  4ZI2 D;  4AP2 A;  3JUE A;  3B7B A;  2IUB A;  5LYJ E;  2AJA A;  2ETB A;  5LHI B;  3Q9U C;  3AEF A;  4TUY E;  3X1D A;  4J8D A;  3SI5 A;  4A3V A;  1HS6 A;  2J47 A;  4A56 A;  5KWD A;  3ZMZ B;  1X9B A;  2V7K A;  2J4D A;  2KXP B;  1EZ3 A;  3L17 A;  2NW7 A;  5H6R B;  1JWG A;  4Y6W A;  3HXB A;  4JLE A;  4F7A A;  3WAK A;  5LX8 A;  2QGS A;  1FVF A;  5AQB A;  3EUH A;  3AVR A;  4U72 A;  3J5P A;  5JDH A;  3QC9 A;  4CDM A;  5FIN A;  5DQW A;  2VSX E;  2OLT A;  1ELK A;  3QJZ A;  4HBD A;  1PC2 A;  3Q9N C;  5HEU A;  1UOH A;  1R8I A;  5AQS B;  1SW6 A;  3P4P A;  3QB2 A;  4BT8 A;  3C3R A;  4ZHQ E;  3TLU A;  1O1S A;  4H9S E;  5AYW D;  2DZN A;  3TLS A;  4BA9 A;  3PEU B;  2BDE A;  3F31 A;  3RSE G;  3AS4 A;  2L8K A;  1FPP A;  3P4Q A;  2VSN A;  5B1B E;  5AQL B;  3QNU A;  4KUM B;  4DND A;  3DSV A;  3L54 A;  4U7Y A;  1XMQ T;  4HEA A;  2BG9 C;  4LF8 T;  2AXV A;  3B7S A;  3EAM A;  2BF0 X;  3SHF A;  3PUR A;  2DWK A;  3HI2 A;  1TN6 A;  3CHM A;  1BLX B;  2N9D A;  4UI9 J;  2Q7F A;  5AQN B;  4BSZ B;  4EQF A;  2CE7 A;  3ONL A;  4EV6 A;  3CVL A;  2IAK A;  3S4U A;  4I9E A;  3VLF A;  1L0V A;  1VDY A;  1BR4 A;  4M7C A;  1UX5 A;  1E7V A;  4OK0 A;  3TAX A;  4IE4 A;  4A63 B;  1WFD A;  3EI0 A;  2XQ8 A;  1TNY A;  5CMW A;  1UUR A;  4X64 T;  3ZGQ A;  4HNA D;  1NZN A;  4DPR A;  3HKD E;  4V1A v;  3BQK A;  2XPY A;  2AVP A;  1H2V C;  2EIK E;  4GB9 A;  4HFE A;  3NZQ A;  3Q5E A;  1D9S A;  1S94 A;  4U8Y D;  2NC9 A;  4GTQ A;  2HO1 A;  2LM9 A;  4GMJ A;  2LNI A;  2BUG A;  4DR5 T;  5JDG A;  3ZT5 A;  4Z91 A;  5BXO A;  1RW2 A;  3CKD A;  1YCS B;  2IHR 1;  1QZ2 A;  2RFM A;  4M3O A;  3PV0 F;  5HXR A;  1YW0 A;  2IQC A;  2XZT G;  4L2Y A;  1IXV A;  2QVA A;  2WWU A;  3ML9 A;  2IU1 A;  5ARG A;  4GZ6 A;  1WYC A;  5LHH B;  4JI4 T;  1NL4 A;  4UWK A;  5FQ8 A;  1HX8 A;  2CWO A;  5D0O D;  4MBG A;  1YKH B;  5FZR A;  4X66 T;  2KZT B;  3QB5 A;  4TV9 E;  3D9J A;  4HN9 A;  5CRU A;  5CEA A;  3P2B A;  4DV2 T;  4A5X A;  3C72 A;  5ABE A;  2M67 A;  5EIL A;  4PH4 B;  3ASF A;  4ACK A;  3FZH B;  1H6K A;  4PDX A;  2HN2 A;  3N2K E;  3PZ2 A;  3FTX A;  2PTF A;  3CQX C;  2A3D A;  3RIU A;  3UFE A;  3ONK A;  5G05 J;  1TEZ A;  5AQQ B;  5AAO A;  3NZU A;  5M72 A;  2EQX A;  3JAE A;  3KV6 A;  1LF8 A;  4WND A;  3Q2M A;  2XQ0 A;  5FMN A;  4LCT A;  4BER A;  3FH8 A;  2E9X C;  4U2Z A;  3M65 A;  1A5E A;  4JI6 T;  3A7M A;  2VYI A;  3B7T A;  5ETW A;  3NZS A;  3AG1 E;  3CK9 A;  4OYS A;  3R7Q A;  4GOU A;  4UVA B;  1JCQ A;  2KMF A;  5J90 A;  1HS7 A;  4HFD A;  3AE2 A;  3RIF A;  4G25 A;  1HCI A;  4TUM A;  3JAD A;  3RYC E;  5AQO B;  4K5B A;  1N0R A;  5C2T A;  1JWF A;  5IY5 E;  4IHJ E;  4XX5 A;  1VCS A;  3AA0 B;  3CVX A;  4KX6 A;  5FXV A;  3FUD A;  1HR0 T;  3LY7 A;  3E33 A;  4FAD A;  4LG6 A;  4JHK A;  3B7U X;  3Q15 A;  4YHJ A;  3EDU A;  3PDY A;  3SO8 A;  3EHR A;  3OTN A;  5CBN A;  2X6H A;  3FZL B;  4MS6 A;  5EK4 A;  3LJN A;  5AJL A;  1IHG A;  2CBI A;  3J5Q B;  4O4L E;  3UI2 A;  5EK3 A;  3KVA A;  1Z8U A;  2WXR A;  2UXN B;  4GYS A;  3FY4 A;  3UIO C;  4FUL A;  3AA1 B;  5LP0 A;  1DNP A;  3TXN A;  3UUX B;  2VAS A;  3OVU A;  5LHG B;  5LCY A;  2BKP A;  1JUQ A;  2XZE A;  3P8C D;  3ESL A;  4R7L A;  1YA0 A;  4EOZ B;  2JAB A;  1DCE A;  2LSG A;  3WI3 A;  5EKQ D;  2R5S A;  1V54 E;  4N39 A;  2IJG X;  2C5I T;  3ETV A;  4ILC A;  4JA7 A;  4KZC A;  5JHB A;  1HX1 B;  3UM1 A;  2BED A;  5ITZ F;  4KI0 F;  5C1D A;  3ZT6 A;  5A6C A;  1Y8M A;  2J08 A;  3RK6 A;  2LSY A;  4JEU B;  4IUL A;  2FO1 E;  3KSQ A;  3Q73 A;  4U3C A;  4V3I A;  4PK4 A;  1G73 A;  5D2M C;  5FNV E;  5M4Y A;  3U78 A;  5BPP A;  4MKT A;  3RYH E;  3BG0 B;  2BS4 A;  4P0B A;  2V5C A;  4MLP A;  1SUM B;  4AXP A;  3D9I A;  4PS7 A;  3ZYM A;  3LDZ A;  3NOG D;  2E8I A;  1D1A A;  4DR2 T;  2LM2 A;  1N0Q A;  4WNE A;  2YDR A;  1UN8 A;  2P9I G;  4YSY A;  2D2S A;  1CHU A;  5G2N A;  3CVR A;  4MBQ A;  1O5M A;  2YN6 A;  4EEB A;  3OPC A;  2FBN A;  3UT8 A;  3HKB E;  5A1L A;  3W9F A;  2IC9 A;  3VKH A;  3T5X A;  3SY2 A;  2XAG B;  4JXT A;  2HHH T;  4AY6 A;  4HB5 A;  3SRZ A;  3IBP A;  5JDL A;  3UX4 A;  3QUJ A;  4DJA A;  4GML A;  5JMN D;  2BZB A;  2C0L A;  2OV8 A;  2W61 A;  2VGX A;  3FH7 A;  3CK6 A;  2A72 A;  5HWY A;  1XNF A;  3KV9 A;  2A5U A;  5T3R A;  4HKA A;  1H0A A;  2LXL A;  2VTB A;  1OCZ E;  4N3A A;  2LLY A;  4G2V A;  4F3V A;  3JYS A;  1SA5 A;  5JRC A;  3RRC A;  3P4R A;  4XIF A;  2WZI A;  5HCJ A;  5FXZ A;  3N9M A;  1XDO A;  4PAG A;  3ZHE A;  5D0Q D;  2GGF A;  2BBJ A;  4BEP A;  4K0U A;  2RP4 A;  4AI6 A;  4YDE A;  2X9H A;  3V79 K;  4JEH A;  3W9G A;  1H2U A;  3Q5M A;  3B57 A;  4MFR A;  5LP6 E;  3FU3 A;  1TJF A;  1KEY A;  5LFA A;  2WBL A;  1OED A;  1D0X A;  3MV2 B;  4KZ0 A;  3UM2 A;  3AAA B;  2V7J A;  2XTL A;  2X66 A;  3U64 A;  3KV5 A;  5J0Z A;  1N94 A;  2L6J A;  4ANX A;  3RC8 A;  5CBO A;  1HO8 A;  4X65 T;  2HH7 A;  3NBX X;  2MYS A;  5JDF A;  2FI7 A;  4U07 A;  3Q79 A;  3C64 A;  3P4W A;  3KEA A;  3O9X A;  2WQH A;  3HVE A;  4C91 A;  2VGE A;  3FZF B;  5ABF A;  4HWI B;  1BU9 A;  1TJC A;  3AEA A;  4UWF A;  4ZI3 D;  2VVN A;  2MYO A;  3A5X A;  4U7I A;  2WXM A;  2WAU A;  1WCR A;  1LD8 A;  5DJQ C;  3AEE A;  2XAJ B;  3U4T A;  4BAY B;  3CST A;  1HNW T;  3CHR A;  5FT9 A;  1ZEE A;  4JW1 A;  4JVS A;  3QKY A;  3BG1 B;  2CA5 A;  2UY1 B;  4GZ5 A;  4XZC A;  4U8V D;  4DO0 A;  2VGX B;  4ADZ A;  1WG0 A;  2VTB B;  3LXU X;  1EYH A;  4GU5 A;  5B3S E;  2MBG A;  3NAW A;  5FWQ A;  2KLQ A;  4XEI G;  1Z3X A;  4N2S A;  2P9K G;  4RQI A;  3JQ0 A;  3MKR A;  5BNW A;  4IE7 A;  4DX7 D;  2VWA A;  3DP7 A;  4LMK A;  3UMV A;  4EPZ A;  4CGV A;  4C90 A;  4CXX A;  4EGW A;  2MRI A;  2DL1 A;  4QXH B;  3NQP A;  3JUI A;  1OWN A;  2CG2 A;  3TXM A;  3C51 A;  2D9D A;  2BVL A;  2LXM A;  3PDN A;  5ENN A;  2YU1 A;  1TNZ A;  1UJK A;  5FYM A;  3K3O A;  1E96 B;  2PG8 A;  3T9K A;  1MIW A;  4OYJ A;  5FIO A;  3N2O A;  4F6R C;  4B93 B;  2EHO C;  2ILR A;  3BU8 A;  3PUQ A;  4G23 A;  3B7R L;  2D0U A;  2ETA A;  4UV8 B;  3CHS A;  3RI5 A;  3H3M A;  5IHY A;  2R02 A;  2Q9Q C;  2DHR A;  3I9W A;  2B6C A;  4DUI A;  2ZLY A;  4DX5 D;  5J2U E;  1E90 A;  4G2A A;  5AQA A;  4H9Q C;  1UGO A;  4JI2 T;  3CGH A;  3F6Q A;  4O8S A;  1YMP A;  5AQF B;  1O1R A;  2CM0 A;  3LY8 A;  4PJJ A;  3C98 B;  3ZMV B;  4CN1 A;  1ZU2 A;  4NAC A;  2YNQ A;  3TWV A;  3ZCJ A;  2PQN A;  1ZV4 X;  5KXJ A;  3HRA A;  4X5T A;  4JBW F;  3V5S A;  1OCO E;  3AEC A;  4JV5 T;  4L0R A;  3P4S A;  4O2B E;  5ENQ D;  5ENR D;  2R59 A;  2IEJ A;  5HEJ A;  3UFG A;  5EYL A;  1MYO A;  3PUS A;  4ILA A;  4X62 T;  3ZEF A;  4UWG A;  3T5V A;  3S7B A;  2V4H C;  3CVN A;  2EIL E;  5JRE A;  4IN3 B;  4CT0 A;  4JYA T;  3IEG A;  1N4Q A;  4Y6C A;  4ANJ A;  2HR2 A;  2IF4 A;  2Y0B G;  3K3N A;  3G2U A;  2MTQ A;  4LSZ E;  2J1D G;  3UUM A;  3Q7F A;  4GTP A;  2OND A;  4GZC A;  3RU0 A;  2F8X K;  3IV0 A;  3FUE A;  1K8K G;  3PUV F;  2UUB T;  4DV0 T;  3WG7 E;  2B1E A;  1XNQ T;  3E32 A;  3JAF A;  4U7E B;  2ODV A;  2XEH A;  2BTD A;  2XEE A;  5H7P A;  2W2U A;  4HVB A;  2HE0 A;  2JQK A;  4GPK A;  3E30 A;  4GYR A;  4U31 A;  2BKO A;  5HXH A;  2IW5 B;  5J08 A;  2LSK A;  4IE0 A;  5DIZ A;  2ZGD A;  1WM5 A;  5HQ8 A;  4J2C A;  2WXJ A;  2XS1 A;  3APC A;  2X6F A;  4I6G A;  3MV3 B;  3Q47 B;  1JNZ A;  2LKH A;  3Q5D A;  2YOE A;  2LEH A;  3AA6 B;  3ONJ A;  5JR9 A;  2XJ7 A;  4YND A;  5AQI B;  2KAT A;  4I43 B;  2WXO A;  2ETC A;  3CHP A;  2DNX A;  3DRA A;  4I6J A;  2JRK A;  3ZXP A;  3DEP A;  4NUV A;  3M3Z B;  4HLL A;  2W67 A;  2XQA A;  4O4I E;  3FHN A;  4O4J E;  2C2L A;  5JHA A;  2XSB A;  4I0U A;  3JQ1 A;  4GTT A;  4CGW A;  3FBL A;  2UXX B;  2XHE A;  4YTM A;  5KX5 E;  4B94 A;  3ESK A;  3OTO T;  1OWM A;  1HG2 A;  1OUV A;  4YY3 T;  4U74 A;  1IAP A;  5LJN A;  3ZIM A;  2OCC E;  3D9M A;  3RYF E;  4YLH A;  3UU4 A;  5HXC A;  5AQT B;  4NIQ A;  4AQY T;  4AIF A;  1H2T C;  2LE8 A;  4UVC B;  3JCF A;  4RG9 A;  3SD5 A;  4JA9 A;  4KT6 B;  2Z6E A;  2BS2 A;  4DV5 T;  5HCM A;  2LOP A;  4G26 A;  2L9Q A;  4X20 E;  3HHM A;  1JPL A;  2H6F A;  1M7K A;  4UVB B;  3FU6 A;  2CLY B;  1LD7 A;  3O1I A;  3CR3 A;  5F8P A;  2H6I A;  1V9D A;  4BX8 A;  2EIJ E;  5JH7 E;  4CYM D;  3CHQ A;  3C50 A;  3VLD A;  3EHZ A;  3G2T A;  5IUX A;  2YEV C;  3DXM G;  4KHP T;  3VU7 H;  4PS3 A;  4TXQ A;  4NXN T;  2KSR A;  5L47 A;  4G8K A;  1MND A;  1J5E T;  4JB8 P;  1HG5 A;  2QYJ A;  1VOM A;  1MZC A;  3UXG A;  2X6J A;  3IA3 A;  3LJC A;  3U3W A;  1NEN A;  4H7Y A;  4COF A;  4GA1 A;  2XQY A;  3AEG A;  3Q5W A;  4OVU A;  3EDT B;  5CED B;  2PQR A;  2CHZ A;  4WNG A;  3EDV A;  2UU9 T;  3UT7 A;  1INZ A;  4UR9 A;  2XHE B;  3UUB A;  2LHR A;  2UXC T;  5HAX A;  3MZL B;  2KXP C;  2WDQ A;  2V7M A;  3WXX A;  4AIU A;  1YD8 G;  3RRM B;  4U0S A;  1MMA A;  2FO7 A;  3K3Q C;  2PM6 A;  3HG0 D;  4XBF B;  3RO3 A;  2BG9 A;  1UK5 A;  4LF4 T;  3LDQ B;  3PTR B;  4I55 E;  3FZK B;  5AAR A;  5F3J A;  2K5B B;  2Y4T A;  3B95 A;  1EPU A;  4AQG A;  2VSY A;  3ZUV B;  3MCX A;  2DWG A;  3RO2 A;  2CPT A;  4IST A;  2CHO A;  2ZM0 A;  3FDH A;  1D0Y A;  2X38 A;  4EZJ A;  5C8Y E;  3ZJ2 A;  2K3W A;  1H7C A;  3UU5 A;  1U2V G;  3E37 A;  1MNE A;  2IO3 C;  3FUJ A;  3I0O A;  2FEZ A;  4Q25 A;  3H37 A;  2DBA A;  4H9N C;  4C48 B;  3UTM A;  1B7T A;  3AE1 A;  4JHJ A;  4AKG A;  4CCA A;  1X79 A;  3TL5 A;  1N4R A; 
#chains in the Genus database with same CATH homology
 4Q96 A;  5BV0 A;  2VKJ A;  2QA7 A;  2L3L A;  2PFV A;  4PJL A;  4CZZ B;  4HE8 A;  3VTX A;  1NA3 A;  2IOL A;  2ZM8 A;  3JC6 D;  2FF4 A;  4EB6 E;  3CX6 B;  4CRW A;  4YVQ C;  5ADX L;  2R17 C;  5AIJ A;  2PL2 A;  4E6H A;  4TN7 B;  5EX0 A;  4HOT A;  2CFU A;  1HTJ F;  3CV0 A;  3KEZ A;  4H7X A;  5C2Y A;  5EZY E;  3L3P A;  5LGT B;  3CKB A;  5EX3 A;  3TG5 A;  3GN5 A;  3CVW A;  1IZN B;  4AQF C;  2WXH A;  1SHZ C;  3RRN B;  4XKB A;  4N78 D;  3CK7 A;  1U3D A;  5FJY A;  3GZS A;  5FP3 A;  1UJJ A;  3FWV A;  5JDN A;  4NQ0 A;  2CCQ A;  2WXN A;  4K0R A;  3ZRH A;  4EZL A;  5KDM C;  2I1J A;  1QQE A;  2KCV A;  3CVV A;  4EBA G;  2E9X A;  5HXE A;  4FI5 A;  5LBQ B;  2IFU A;  3PVL A;  3N5L A;  2L0I A;  4GK0 E;  4KVO A;  3N2G E;  2E2E A;  5LG4 A;  3ZYK A;  2X68 A;  3CQC B;  4GYW A;  3RRU A;  4APO A;  3SFZ A;  4F53 A;  2IOS A;  1HE8 A;  2XPZ A;  3OXL A;  4X1I E;  3C4W A;  3ETU A;  3Q4A B;  3LG7 A;  2X3M A;  2CXF A;  4GIW A;  3KAE A;  1BPO A;  4XI9 A;  5ANR A;  2LJL A;  1Y6I A;  1MIY A;  3N9N A;  3KV4 A;  2DCP A;  2NWB A;  2NP9 A;  4FA6 A;  3O4Z A;  2WB2 A;  2YHC A;  4JHR A;  3ZPJ A;  4KBM B;  5ANL A;  3PNL B;  2KC7 A;  3GZ2 A;  1A17 A;  1IQR A;  4ILH B;  4B89 A;  4ANW A;  2I9C A;  2PM7 A;  4CXW A;  4C9B B;  3Q9D A;  5LXT E;  4CEM A;  4HS2 A;  2CXL A;  2OVF A;  3I1A A;  2W62 A;  1QSD A;  3L09 A;  3KS2 A;  4QX7 B;  2PZI A;  2SPC A;  3SS1 A;  4AM9 A;  4BX9 A;  3QNK A;  5J2T E;  3S7J A;  4HFV A;  3AS5 A;  4IIJ E;  3UT4 A;  3GMI A;  5JJ7 A;  3OJA A;  3FUH A;  5CCL A;  1HF8 A;  1OWP A;  2J4B A;  4U0U A;  4H9O C;  4CI3 B;  4HOQ A;  3EHN A;  1HU3 A;  2G0U A;  2QFC A;  4OFZ A;  3AU4 A;  1WRD A;  1MMN A;  5L3B B;  2CHW A;  2YK0 A;  3RKO A;  5J1G A;  4PJN A;  4KVM A;  3MAC A;  2C0M A;  2JEK A;  5T8I A;  4I50 E;  3FTY A;  3LPZ A;  3L08 A;  3PNT B;  5CCM A;  5L3D B;  1FEW A;  4O4H E;  5G05 C;  2VKH A;  4X1Y E;  3PE0 A;  5KJN A;  1T98 A;  3ASD A;  4WAF A;  3R84 B;  3D9N A;  3OKQ A;  1L5J A;  3ZCI A;  2E9X D;  3SNX A;  4TRQ A;  3ZXS A;  3MXZ A;  1FCH A;  4TZ4 C;  2D0T A;  3R7R A;  1MIV A;  3RYI E;  2OVB A;  3Q5X A;  4G63 A;  3B13 A;  2WXK A;  4PS8 A;  1E8X A;  4GA0 A;  3AAI A;  3LKU A;  2DLR A;  4BJM A;  3UUN A;  2JMK A;  2Y4U A;  2M63 A;  2GRL A;  1QNF A;  4J8F A;  1EDU A;  4PK5 A;  4MLK A;  3C4Z A;  3OXG A;  3T8M A;  4EIW A;  2HPL A;  3L22 A;  3MKQ A;  3PU8 A;  4EEC A;  3APD A;  3ZN1 B;  3IKO B;  3S7D A;  4Q69 A;  3CHO A;  2XEV A;  1ELW A;  4I17 A;  3AAE B;  3HR0 A;  5L3F B;  3FUM A;  1FMW A;  3F57 A;  1YKE B;  3ASH A;  4HOS A;  4UWL A;  4PFO A;  3IHV A;  5TAO A;  3I3N A;  2ZU6 B;  1SQM A;  5EDS A;  1WR6 A;  4WNK A;  4X1K E;  3AA7 B;  4HXI A;  2VK9 A;  2XGO A;  2N1G A;  2EHO A;  4YJ2 E;  2XAS B;  4O2A E;  4FC8 A;  3FP3 A;  3MGB A;  3G2S A;  3FUN A;  4E85 A;  4OHF A;  5CMY A;  3CKC A;  3CWZ B;  4GA2 A;  3HDX A;  2Q9Q A;  3CEQ A;  3LK2 B;  3H3A A;  5JRC B;  2JLB A;  3GA8 A;  4J8S A;  3CVY A;  3BK9 A;  2VGY A;  4L23 A;  3ZHE B;  3TGO A;  4G1T A;  1BR0 A;  4KBQ A;  4H63 V;  4UEM A;  5AFU L;  3HL6 A;  4ERR A;  4U63 A;  4GCO A;  2LSI A;  2XCC A;  4JEH B;  3CVU A;  1SA0 E;  4W9R A;  4MHC A;  3LJ3 A;  4E7S A;  3MKQ B;  3DBS A;  1LRZ A;  4UEL A;  3CIA A;  3MJX A;  4I2Z A;  3HVE B;  2Y3A A;  4A1G A;  2VJ8 A;  4HOU A;  3RH3 A;  3PZD A;  3UTK A;  3N9P A;  2AW6 A;  4UI9 K;  2V0P A;  4XKC A;  3ZYL A;  4EZH A;  1OXZ A;  2K48 A;  2WVI A;  2H3R A;  4QFV A;  3MYV A;  3D9O A;  4Q94 A;  3TG4 A;  3HYM B;  4AKL A;  5E76 A;  3CVP A;  1ELR A;  1FMV A;  4B6X A;  3ONX A;  4C0M A;  5FY7 A;  2KWI B;  3K8P C;  3GW4 A;  2VL8 A;  2LSJ A;  5L2L A;  2WXL A;  1HZ4 A;  3NZP A;  3I5P A;  4I1O B;  1FIO A;  1NAF A;  3ZMT B;  3ANW A;  5FTP A;  5DQV A;  5IYZ E;  3CLJ A;  2NW8 A;  3E4B A;  4RVB A;  3VTY A;  4FHK A;  1CUN A;  3U3I A;  2H7V C;  2V7L A;  3FUL A;  4UQX A;  5H6Q B;  2ES0 A;  4GAA A;  4BTB A;  5LGN B;  4YVO A;  2NSZ A;  4XI0 A;  4ZI2 C;  4H63 H;  1B89 A;  1S0P A;  4B8C B;  2W00 A;  3OXF A;  4FU3 A;  4RSY A;  3ZYQ A;  4EZ4 A;  3CQG B;  5KJL A;  3ZEF B;  3QWW A;  4FLH A;  1EF1 C;  1MMG A;  5EK2 A;  5DBK A;  3QDN A;  5HXS A;  2C5K T;  5LNK A;  3RX6 A;  2WSS V;  2CLY C;  4P0A A;  3LBX A;  3C4X A;  4B8A A;  3IHR A;  3CX7 B;  3RKV A;  3FEY A;  3R9A B;  3E08 A;  3PE3 A;  5JJT A;  4UQY A;  4QXB B;  4HOR A;  4ANU A;  2GK9 A;  3ULQ A;  5JQG E;  4PW8 A;  2VKO A;  2XRY A;  3FU0 A;  3SBT B;  3SBS A;  5LCW C;  4GCN A;  3I0Q A;  3OAW A;  2LSU A;  2A4Z A;  4GYO A;  2XAF B;  4TV8 E;  3J9X 1;  1HH8 A;  5JR9 B;  3MA9 A;  3QC1 A;  1KNZ A;  3W15 B;  3AS8 A;  1BR1 A;  3JC6 C;  1QUU A;  4L2L A;  2BVM A;  4EBA A;  5CB4 E;  4J0U A;  4WW0 A;  4D10 C;  4MRU A;  3O48 A;  2V5F A;  3CK8 A;  4O6F A;  4ANV A;  3CSF A;  4J8E A;  1GW6 A;  3CVQ A;  4DMV A;  2H7O A;  4A55 A;  4UXN B;  2VKD A;  3IBE A;  4M1P A;  2HM8 A;  3PS6 A;  3PUG A;  3ZC0 A;  3GZ1 A;  1UX4 A;  3HKC E;  3UT5 E;  1D1C A;  4L7T A;  3LVR E;  3D9K A;  5LBM A;  1G8X A;  1P5Q A;  3ZC1 A;  1OWA A;  3BEE A;  3EHM A;  5LJM A;  5G04 C;  2W0G A;  3CX8 B;  1U4Q A;  4EYY R;  5CHE E;  4I2W A;  3QOU A;  3IF8 B;  3SOL A;  4TX5 A;  4HFG A;  4XZ4 A;  4YJ3 E;  3NRX A;  3MK7 C;  3FTS A;  4N2Q A;  3FTV A;  2VQ2 A;  4AJW A;  4IYP A;  1H19 A;  4IE6 A;  3KBU A;  2WXP A;  3LY9 A;  4G11 A;  4CI2 B;  4PK6 A;  2NOX A;  4U04 A;  4AQF A;  3ZN3 A;  2XGS A;  4L5G A;  3URZ A;  3ZMS B;  4UF0 A;  3WAJ A;  1SZ9 A;  4JZY A;  4FP7 A;  1HFA A;  4TV3 A;  5AJD A;  1MMD A;  2VSO E;  5JDQ A;  3ZFW A;  2CWY A;  4ZS3 A;  4PNI A;  2ZM2 A;  3OYZ A;  2KZT A;  1Z6T A;  4LEU A;  1Z3Y A;  2WMN A;  2V4L A;  3FEX A;  3O4X E;  2YQ8 A;  2KWH A;  2RD0 A;  1UG3 A;  2C0S A;  5FY0 A;  3BQI A;  4DVD A;  3UPV A;  1MHQ A;  2WXG A;  4K03 A;  2ACX A;  4KXK B;  2K9A A;  5LGU B;  5GON E;  3EIJ A;  3P7I A;  5CA0 E;  2PBI A;  2X67 A;  3L16 A;  4N3B A;  3FB2 A;  2LO6 A;  3QWP A;  3GYZ A;  3LVQ E;  4IDZ A;  1LKX A;  1WYB A;  4H9R C;  2P58 C;  2JPF A;  4NRH B;  1BR2 A;  2MOZ A;  2Y8D A;  3J7Y q;  3S2A A;  2DIW A;  3EJN A;  2FUL A;  2WMO A;  2NXP A;  3VLE A;  4I1A A;  3ZN0 B;  4ILG A;  4CDN A;  1KT0 A;  4UQZ A;  2DI4 A;  4PFP A;  4G24 A;  5A7D B;  5L3G B;  4N3C A;  3KD7 A;  4N5C A;  4UF0 B;  4PJM A;  3DJB A;  2KZ7 B;  2WQ7 A;  5KJM A;  3LFM A;  1WY6 A;  2UWJ G;  4LRZ A;  3FTZ A;  3HIZ A;  3G2V A;  3ZPO A;  4I6E A;  2Y6X A;  4GZ3 A;  3ZVV A;  2J09 A;  5E0O A;  3GWH A;  1E8Z A;  3UUX A;  3PEV B;  4DLO A;  3SF4 A;  3GN5 B;  3UUL A;  3VKG A;  3QWV A;  5KCM A;  2I59 A;  4L1B A;  2V26 A;  3LS8 A;  3FUF A;  5JVD E;  3LK3 B;  4XAX B;  4UI9 C;  1UW4 B;  3P1U A;  4AY5 A;  2YU2 A;  2I2O A;  2P9B A;  2AXZ A;  3EIQ C;  3MA5 A;  4OYK A;  4DLQ A;  3ENE A;  1OWO A;  3KDS E;  5FXX A;  4JEU A;  2ION A;  2CEA A;  4IGU A;  4HGA A;  2RA1 A;  2E9X B;  4KMC A;  4HLE A;  3I4R B;  4FHJ A;  2V7I A;  5FZQ A;  3FBZ A;  1D1B A;  1D0Z A;  4CDR A;  2I1K A;  3FUK A;  1W3B A;  4LER A;  4BJN A;  4EAH A;  2WM9 A;  3HKE E;  3ZJ1 A;  2J07 A;  4AVX A;  3N9Q A;  2GW1 A;  5T4Y A;  3I4G A;  4URK A;  2NW9 A;  3MKD A;  5CA1 E;  2PJQ A;  4ILU A;  1NP7 A;  4NUU A;  5HI7 A;  3D9P A;  3MEK A;  5JJ6 A;  3ASG A;  4AXH A;  3K9I A;  2CFZ A;  5AEN A;  5BMV E;  3AB3 B;  4ABN A;  4DI4 A;  4FJY A;  3DTO A;  1KLX A;  3N9O A;  2HPJ A;  4EXT A;  3FUI A;  1WAO 1;  2YHE A;  5LA6 E;  3KFW X;  2KT9 A;  4TUU A;  1E1H B;  3MJW A;  4ZI3 C;  2L9B A;  5A23 A;  4RG6 A;  2XAQ B;  1KK7 A;  2OA5 A;  4QHO A;  4FLB A;  2Y48 B;  2WXI A;  3D3M A;  4J6I A;  2A2F X;  2XPI A;  4JUY A;  3KBT A;  4QX8 B;  3MZK B;  3FFL A;  3R6N A;  4KMO A;  1IJ5 A;  3OYX A;  4E7Z A;  1WLX A;  3LCA A;  4FJO A;  2XAH B;  3BQL A;  3OBV E;  4DI3 A;  4HTE A;  1S35 A;  4MAL A;  3N9L A;  4ILI A;  4DBR A;  2V1D B;  2LAH A;  3FTW A;  1ZBP A;  3PRE A;  1IJ6 A;  1HXI A;  2UY1 A;  1AJ3 A;  3G2W A;  5FQ4 A;  1X5B A;  2V8S E;  2KM4 A;  3U9W A;  5KJK A;  1ZHC A;  3PUK A;  4WBO A;  5HWX A;  4WWN A;  3FHE A;  2KIN B;  5FQ7 A;  2LOS A;  3CML A;  4ASK A;  3D9L A;  2VB6 A;  1PAQ A;  3APF A;  4DBQ A;  3L13 A;  4ATG A;  4A3T A;  3DPD A;  4AKI A;  4AKH A;  1Z0P A;  3NF1 A;  3U66 A;  1XGW A;  2JMH A;  2OOE A;  4EYU A;  1ZKE A;  3FTU A;  1LVF A;  4WWP A;  2AWI A;  2E0I A;  5BUZ A;  1UCU A;  2DCF A;  4KYO B;  1UN9 A;  5L3C B;  3C98 A;  1MQS A;  4NUR A;  3KIN B;  1FVH A;  3PU3 A;  4KP3 C;  4ZI7 E;  2WXQ A;  3CPZ A;  2D5U A;  4QKN A;  4BWR A;  4ISS A;  2JQQ A;  3PRZ A;  2CG3 A;  5L3E B;  2YIN A;  2LT3 A;  4JL0 A;  4OVV A;  4H9P C;  1LVK A;  4BT9 A;  1N54 A;  1NA0 A;  3I9Y A;  2L0T B;  5FY1 A;  4A1S A;  2HYZ A;  2J49 A;  3AVS A;  4BTA A;  2W63 A;  3FXE B;  4GYY A;  2JJ9 A;  3JCK C;  1E8Y A;  2XGM A;  4P29 A;  4YFS A;  4C0E A;  2CMR A;  2NTY A;  5BW8 C;  2WPV A;  4Z8X A;  5FXW A;  2X6I A;  4B0Z A;  2KCK A;  3Q49 B;  3S7F A;  1N52 A;  5KMG P;  3FU5 A;  2EHO B;  3TKL B;  2X0L B;  2MHK A;  2J9Q A;  4P09 A;  2LHN A;  4I43 A;  1SZA A;  2Q9Q B;  2LAI A;  3MX3 A;  4ACL A;  3T8O A;  2ODU A;  1OWL A;  4DK5 A;  4AV7 A;  3TJP A;  2C5J A;  4LUN U;  2GRM A;  3PUJ A;  3O1H A;  4I4T E;  4ZOL E;  5JDM A;  3IHY A;  3KVB A;  4JPS A;  4CQI A;  3ML8 A;  5LCW J;  2CXD A;  4AEZ C;  2X6K A;  4GZD A;  3ZW3 A;  4CXY A;  3ZLI A;  5ARF A;  5FZS A;  2X9W A;  2N2N A;  3O1J A;  3PE4 A;  3UQ3 A;  2I6H A;  4QXC B;  4UWH A;  2WXF A;  2MOW A;  3QK0 A;  5LOV E;  2KCL A;  3RIB A;  4AKR B;  1U3C A;  4WUY A;  5G55 A;  3LEW A;  4BY6 A;  1PY1 A;  2NTX A;  4UIG A;  2EHO D;  3N71 A;  4ZS2 A;  4EZK A;  5LOZ A;  5BV1 A;  2IC6 A;  3V5U A;  4BFR A;  2Q9Q D;  4U8H A;  3SGH A;  1US7 B;  3F2E A;  5BT1 A;  5G04 J;  3LK4 2;  4UV9 B;  2X9X A;  2X9Y A;  3FXD B;  3D0T A;  2XUE A;  3RRW A;  3E22 E;  1KT1 A;  3RPU A;  3RJV A;  2X51 A;  5FQ6 A;  3FH5 A;  4WBN E;  3VHL A;  4I9C A;  4CT4 A;  1IYG A;  2XRZ A;  3PUA A;  4GK5 E;  3ANW B;  2QY7 A;  1VRB A;  3QAR A;  5JR9 C;  2RG8 A;  1O3X A;  1DVP A;  2AXU A;  1IQU A;  3PH0 C;  4PUC A;  2KND A;  1NWM X;  3L6A A;  3EVY A;  5DAB A;  4IE5 A;  4BSX A;  3SWH A;  3QAQ A;  1E8W A;  2ZMA A;  4APF A;  4U0Z A;  4JC8 A;  4L9I A;  3E0Z A;  2WQ6 A;  2LSV A;  3LYA A;  4WNF A;  5HYA A;  4QWN B;  4IRU A;  4WWO A;  1E7U A;  3HA4 A;  2K24 A;  2XCB A;  1U5P A;  3ZMU B;  4CI1 B;  4ME2 A;  4AOF A;  4XE0 A;  5E75 A;  3QK6 A;  4I1M A;  3IEE A;  3SZ7 A;  1Y64 B;  3LBX B;  4FJZ A;  4DMW A;  3AU5 A;  4F1S A;  2CHX A;  3NRY A;  3RC3 A;  4ZI2 D;  4AP2 A;  5LYJ E;  5LHI B;  4TUY E;  4J8D A;  3SI5 A;  4A3V A;  1HS6 A;  4A56 A;  3ZMZ B;  2V7K A;  2J4D A;  2KXP B;  1EZ3 A;  3L17 A;  2NW7 A;  5H6R B;  1JWG A;  4Y6W A;  4F7A A;  4JLE A;  3WAK A;  5LX8 A;  2QGS A;  1FVF A;  3EUH A;  3AVR A;  4U72 A;  5JDH A;  3QC9 A;  4CDM A;  5DQW A;  2VSX E;  3QJZ A;  1ELK A;  1PC2 A;  4BT8 A;  3QB2 A;  4ZHQ E;  4H9S E;  5AYW D;  4BA9 A;  3PEU B;  2BDE A;  3F31 A;  3AS4 A;  2L8K A;  2VSN A;  4KUM B;  4DND A;  3L54 A;  4HEA A;  2AXV A;  3B7S A;  2BF0 X;  3SHF A;  3PUR A;  2DWK A;  3HI2 A;  3CHM A;  2N9D A;  4UI9 J;  2Q7F A;  4EQF A;  2CE7 A;  3ONL A;  3CVL A;  2IAK A;  3S4U A;  4I9E A;  3VLF A;  1VDY A;  1BR4 A;  1UX5 A;  1E7V A;  4OK0 A;  3TAX A;  4IE4 A;  5CMW A;  3ZGQ A;  1NZN A;  4DPR A;  3HKD E;  4V1A v;  3BQK A;  2XPY A;  2AVP A;  1H2V C;  4GB9 A;  3NZQ A;  1S94 A;  2NC9 A;  2HO1 A;  2LM9 A;  4GMJ A;  2LNI A;  2BUG A;  5JDG A;  3CKD A;  1QZ2 A;  4M3O A;  5HXR A;  1YW0 A;  2IQC A;  4L2Y A;  2WWU A;  3ML9 A;  2IU1 A;  5ARG A;  4GZ6 A;  1WYC A;  5LHH B;  4UWK A;  5FQ8 A;  1HX8 A;  2CWO A;  5D0O D;  1YKH B;  5FZR A;  2KZT B;  4TV9 E;  3D9J A;  4HN9 A;  3P2B A;  2M67 A;  4PH4 B;  3ASF A;  4ACK A;  1H6K A;  4PDX A;  3N2K E;  3FTX A;  3CQX C;  2A3D A;  3UFE A;  3ONK A;  5G05 J;  1TEZ A;  3NZU A;  5M72 A;  2EQX A;  3KV6 A;  1LF8 A;  4WND A;  3Q2M A;  2XQ0 A;  5FMN A;  4LCT A;  3FH8 A;  2E9X C;  3M65 A;  2VYI A;  3B7T A;  5ETW A;  3NZS A;  4OYS A;  3CK9 A;  3R7Q A;  4GOU A;  4UVA B;  2KMF A;  5J90 A;  1HS7 A;  4G25 A;  1HCI A;  3RYC E;  1JWF A;  4IHJ E;  4XX5 A;  3AA0 B;  3CVX A;  5FXV A;  3FUD A;  3LY7 A;  4FAD A;  4JHK A;  3B7U X;  3Q15 A;  4YHJ A;  3EDU A;  3PDY A;  3OTN A;  2X6H A;  4MS6 A;  5EK4 A;  5AJL A;  1IHG A;  4O4L E;  5EK3 A;  3KVA A;  2WXR A;  2UXN B;  4GYS A;  3FY4 A;  4FUL A;  3AA1 B;  5LP0 A;  1DNP A;  3TXN A;  3UUX B;  2VAS A;  5LHG B;  5LCY A;  1JUQ A;  3P8C D;  3ESL A;  4R7L A;  1YA0 A;  4EOZ B;  2LSG A;  3WI3 A;  5EKQ D;  2R5S A;  4N39 A;  2IJG X;  2C5I T;  3ETV A;  4JA7 A;  4KZC A;  5JHB A;  5C1D A;  5A6C A;  1Y8M A;  2J08 A;  3RK6 A;  2LSY A;  4JEU B;  4IUL A;  4V3I A;  4PK4 A;  1G73 A;  5FNV E;  5M4Y A;  3U78 A;  5BPP A;  4MKT A;  3RYH E;  3BG0 B;  4P0B A;  4MLP A;  4PS7 A;  4AXP A;  3D9I A;  3ZYM A;  3LDZ A;  2E8I A;  1D1A A;  4WNE A;  1UN8 A;  2D2S A;  5G2N A;  3CVR A;  4MBQ A;  2FBN A;  3UT8 A;  3HKB E;  5A1L A;  2IC9 A;  3VKH A;  3T5X A;  2XAG B;  4JXT A;  4AY6 A;  3SRZ A;  3IBP A;  5JDL A;  3UX4 A;  3QUJ A;  4DJA A;  4GML A;  2BZB A;  2C0L A;  2OV8 A;  2W61 A;  2VGX A;  3FH7 A;  1XNF A;  2A72 A;  5HWY A;  3KV9 A;  2A5U A;  5T3R A;  4HKA A;  1H0A A;  2VTB A;  4N3A A;  4G2V A;  4F3V A;  3JYS A;  5JRC A;  3RRC A;  4XIF A;  5FXZ A;  3N9M A;  4PAG A;  3ZHE A;  5D0Q D;  2GGF A;  4K0U A;  2RP4 A;  4AI6 A;  2X9H A;  4JEH A;  1H2U A;  3Q5M A;  3B57 A;  4MFR A;  5LP6 E;  3FU3 A;  1TJF A;  5LFA A;  2WBL A;  1D0X A;  3MV2 B;  4KZ0 A;  3AAA B;  2V7J A;  2XTL A;  2X66 A;  3U64 A;  3KV5 A;  2L6J A;  4ANX A;  3RC8 A;  1HO8 A;  2HH7 A;  3NBX X;  2MYS A;  5JDF A;  2FI7 A;  4U07 A;  3C64 A;  3O9X A;  2WQH A;  3HVE A;  4C91 A;  1TJC A;  4UWF A;  4ZI3 D;  3A5X A;  2WXM A;  2WAU A;  5DJQ C;  2XAJ B;  3U4T A;  4BAY B;  3CST A;  3CHR A;  5FT9 A;  1ZEE A;  4JW1 A;  4JVS A;  3QKY A;  3BG1 B;  2CA5 A;  2UY1 B;  4GZ5 A;  4XZC A;  4DO0 A;  2VGX B;  4ADZ A;  2VTB B;  3LXU X;  1EYH A;  4GU5 A;  2MBG A;  5FWQ A;  2KLQ A;  1Z3X A;  4N2S A;  3JQ0 A;  3MKR A;  5BNW A;  4IE7 A;  2VWA A;  3DP7 A;  3UMV A;  4EPZ A;  4CGV A;  4C90 A;  4CXX A;  2MRI A;  4QXH B;  3NQP A;  3JUI A;  1OWN A;  2CG2 A;  3TXM A;  3C51 A;  2BVL A;  3PDN A;  5ENN A;  2YU1 A;  1UJK A;  5FYM A;  3K3O A;  1E96 B;  2PG8 A;  1MIW A;  4OYJ A;  3N2O A;  4F6R C;  2EHO C;  2ILR A;  3PUQ A;  4G23 A;  3B7R L;  2D0U A;  4UV8 B;  3CHS A;  5IHY A;  2Q9Q C;  2DHR A;  3I9W A;  2ZLY A;  5J2U E;  1E90 A;  4G2A A;  4H9Q C;  3CGH A;  4O8S A;  2CM0 A;  3LY8 A;  4PJJ A;  3C98 B;  3ZMV B;  1ZU2 A;  4NAC A;  2YNQ A;  3ZCJ A;  2PQN A;  1ZV4 X;  3V5S A;  4L0R A;  4O2B E;  2R59 A;  3PUS A;  3ZEF A;  4UWG A;  3T5V A;  3S7B A;  3CVN A;  4IN3 B;  5JRE A;  4CT0 A;  3IEG A;  4Y6C A;  4ANJ A;  2HR2 A;  2IF4 A;  3K3N A;  3G2U A;  2MTQ A;  2J1D G;  3UUM A;  2OND A;  4GZC A;  3RU0 A;  3IV0 A;  3FUE A;  2B1E A;  2ODV A;  2BTD A;  4HVB A;  4GPK A;  4GYR A;  5HXH A;  2IW5 B;  5J08 A;  2LSK A;  4IE0 A;  5DIZ A;  1WM5 A;  5HQ8 A;  4J2C A;  2WXJ A;  3APC A;  2X6F A;  4I6G A;  3MV3 B;  3Q47 B;  3AA6 B;  2LEH A;  5JR9 A;  4YND A;  2KAT A;  4I43 B;  2WXO A;  3CHP A;  2DNX A;  4I6J A;  2JRK A;  4NUV A;  4O4I E;  3FHN A;  4O4J E;  2C2L A;  5JHA A;  3JQ1 A;  4CGW A;  3FBL A;  2UXX B;  2XHE A;  5KX5 E;  4B94 A;  3ESK A;  1OWM A;  1HG2 A;  1OUV A;  4U74 A;  1IAP A;  5LJN A;  3ZIM A;  3D9M A;  3RYF E;  4YLH A;  5HXC A;  4AIF A;  1H2T C;  2LE8 A;  4UVC B;  4RG9 A;  3SD5 A;  4JA9 A;  4KT6 B;  2Z6E A;  2LOP A;  4G26 A;  2L9Q A;  4X20 E;  3HHM A;  1JPL A;  4UVB B;  3FU6 A;  2CLY B;  3O1I A;  3CR3 A;  5F8P A;  1V9D A;  4BX8 A;  5JH7 E;  3CHQ A;  3C50 A;  3VLD A;  3G2T A;  2YEV C;  3VU7 H;  4PS3 A;  1MND A;  1HG5 A;  1VOM A;  2X6J A;  3LJC A;  3U3W A;  4H7Y A;  4GA1 A;  2XQY A;  3Q5W A;  4OVU A;  3EDT B;  2PQR A;  2CHZ A;  4WNG A;  3EDV A;  3UT7 A;  1INZ A;  2XHE B;  2LHR A;  5HAX A;  3MZL B;  2V7M A;  3WXX A;  1YD8 G;  3RRM B;  4U0S A;  1MMA A;  2FO7 A;  3K3Q C;  2PM6 A;  4XBF B;  3RO3 A;  3PTR B;  4I55 E;  5F3J A;  2K5B B;  2Y4T A;  1EPU A;  4AQG A;  2VSY A;  3MCX A;  2DWG A;  3RO2 A;  4IST A;  2ZM0 A;  3FDH A;  1D0Y A;  2X38 A;  4EZJ A;  5C8Y E;  3ZJ2 A;  1H7C A;  1MNE A;  3FUJ A;  3I0O A;  2FEZ A;  3H37 A;  2DBA A;  4H9N C;  1B7T A;  4CCA A;  4JHJ A;  4AKG A;  1X79 A;  3TL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...