3ZYKA

Structure of calm (picalm) anth domain
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
269
structure length
269
Chain Sequence
SAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL-BINDING CLATHRIN ASSEMBLY PROTEIN
publication title The molecular basis for the endocytosis of small R-SNAREs by the clathrin adaptor CALM.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 111
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zykA02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zykA01
4GZCA 2V8SE 1HF8A 1SZAA 2QY7A 3D9PA 3D9JA 1HG5A 1EDUA 2DIWA 2MOWA 5J08A 2DCPA 3G2TA 1JWFA 1HG2A 1X5BA 1XGWA 5CMWA 3ZYLA 5LOZA 1ELKA 4AVXA 2KM4A 1MHQA 3ONKA 1VDYA 2LO6A 3D9KA 3D9OA 1JPLA 2L0TB 3RRUA 1LF8A 1H0AA 5LP0A 4Q94A 4JXTA 1JUQA 3ZYKA 1UJKA 2L0IA 3D9NA 4Q96A 3D9IA 3G2WA 1HX8A 3CLJA 5CMYA 2BF0X 3ONLA 1JWGA 3G2VA 4NACA 1SZ9A 3G2SA 1DVPA 4FLBA 3D9LA 1PY1A 4FU3A 4GZDA 3ZYMA 1EYHA 1HFAA 1UJJA 4HFGA 1INZA 3D9MA 3G2UA 3LDZA 3ZYQA
chains in the Genus database with same CATH superfamily
4CDRA 5LCWC 2Q9QC 2DIWA 2NYJA 2YDSA 3JYSA 5T3RA 1HCIA 3ZMVB 4DR6T 2RKKA 3G06A 4JLEA 1HH8A 5L3FB 1N9AA 4A3VA 2XZEA 3QWVA 4ANJA 2C2LA 3PUGA 3F2EA 5LYJE 2VQET 2X0HA 2WQ7A 2BG9A 3AEEA 4PW8A 2CG2A 3P4WA 2VSOE 2WQYA 2YU2A 2NP9A 3WG7E 1BR0A 2WXIA 2C0LA 4CI2B 3OJAA 3EAMA 4EB6E 3UUBA 5CECB 2R02A 2VGYA 5EDSA 4CN1A 4HRMB 4URKA 4UWKA 3E4BA 4AV7A 3NRYA 3FUDA 4YTNA 4AIFA 3CMLA 3ML9A 3PDYA 1ZP0A 1NA0A 4GA2A 3VRBA 5CERB 1PY1A 4PS3A 2XAJB 4AKRB 2WXJA 2BVMA 2IF4A 4DRXE 4PJLA 1SZAA 3NBXX 1UK5A 4EYUA 4PH4B 3R7QA 3CVPA 4GTQA 2H6GA 4ILIA 1HE8A 4CDMA 3IHVA 4P1NA 3MACA 3PZ1A 4HQDA 5JHBA 3LJNA 4YY3T 1H2TC 3KEAA 2ZLYA 4JUYA 3EU5A 3QARA 4BY6A 1A5EA 4R7LA 5L4HA 4C9BB 1O5MA 4N3CA 3VTXA 3KBUA 3MJWA 4UWFA 2H89A 3HG0D 4NXNT 1WFDA 4HFBA 5LG4A 2NOXA 4EIWA 3AG3E 2OVBA 2GW1A 4GTMA 1KFYA 4BWRA 2GRLA 3PE3A 2CXLA 4NIQA 4GZ6A 2RPAA 1J5ET 3PEUB 2RP4A 4HKAA 3TL5A 1BI7B 4UI9C 5FY7A 4GMJA 1HO8A 2IJGX 4TV8E 1GW6A 5ARFA 4HVBA 1HS7A 1OCRE 2NC9A 2AWIA 4DV6T 2IOSA 1V9DA 2BS3A 3Q5XA 3AEAA 4XI9A 4GZDA 1U4QA 1WCRA 2LSVA 3NZPA 3AG4E 3BQOA 2XQ7A 5AQFB 2GRNB 4X1YE 2FJAA 4DLQA 5LA6E 5JDMA 4NRHB 2YK0A 1QYMA 4U7EB 4Q25A 4FHKA 3JCFA 4K0UA 2CEAA 3QC9A 4MBQA 1N4SA 1OUVA 5C3JA 3RKVA 4F1SA 1M7KA 3RIAA 3ZIMA 3ULEG 3L8RA 2QYUA 3PUAA 3D3MA 1IJ6A 4GKKT 4ZZBA 5BV0A 1H2VC 2DZOA 3WI3A 2H7OA 2I0MA 4KZCA 2IONA 1BI8B 3ZN3A 2EHOD 1VDYA 2WSSV 5ARGA 2XM2A 4ABNA 3UTKA 3JC6C 4DV5T 3PS6A 3HKEE 3PU3A 1KK7A 2VB6A 3ZMUB 4GA0A 2H7VC 3TGOA 2IC6A 3CHQA 4BTBA 1ZOYA 4X20E 1UCUA 3ZSTA 2VSXE 2R17C 3UMVA 3ZYQA 2OOEA 5IY5E 1US7B 3IF8B 4DIDB 1TN7A 3N2OA 4ANXA 4B8CB 3CVQA 3W9FA 2CRBA 2KM4A 2XQ0A 3Q4AB 5E76A 2L0TB 4YHHT 2IO2C 2KXPC 5HKPA 2WXHA 1ELRA 3Q78A 4PS7A 2CWOA 4LFAT 3FU5A 2WXPA 4HS2A 4PJJA 3DSTA 2R2LA 4IT4A 3PUVF 4XBFB 2V5QC 2KATA 5D2MC 2DVWA 3RIBA 1HNXT 2A5UA 2WMNA 3MKQA 4ZXLA 4U2YA 2C0MA 4H9PC 2KINB 4DV1T 2LM2A 1E7UA 3ZMTB 2CFZA 2IY0C 4M7CA 2VKOA 2P9IG 3QUJA 2VTBA 3L54A 3RHWA 3PZ4A 3C50A 5FL0A 3CIAA 3KFWX 5HEGA 5BPPA 1TEZA 4B3ST 2L3LA 3AU4A 3FFLA 2Q9QD 4G1TA 3NZQA 5AQVB 2V6YB 4IYPA 2A4ZA 3G2UA 2C5JA 4HGAA 2J4DA 2D2SA 3FZLB 3L6AA 4AISA 4FJYA 4P09A 3UKUG 5H6QB 2WDRA 3IA3A 4U74A 4GTTA 4BERA 3AVRA 3VHLA 3FTYA 3MA9A 4P29A 3Q7AA 2Y0BG 3FEYA 2MHKA 3SFZA 1OEDA 2VGXA 3KAEA 2V1DB 2YHEA 3L22A 4FU3A 2WCAA 1TNBA 4IDQA 2CLYC 5D0OD 3LDZA 2J62A 3N9PA 3M65A 5LB7B 5HI7A 5AQ9A 3UU6A 5JJ7A 4YSZA 4GB9A 3ASDA 4UI9J 3DP7A 3AAEB 3UUNA 2WQHA 4BX8A 2H3RA 5CB4E 4JXTA 5CEAA 3PDNA 3ASOE 1D0ZA 3OKQA 3OYZA 3Q9DA 2E2EA 5CBOA 3MV2B 2ZM2A 2LLYA 4APFA 2XEEA 1KZOA 3EHQA 1NZNA 3PREA 4L0RA 1XZYA 3LK2B 1IQRA 3JADA 3RPUA 5BMVE 1W0AA 2K24A 1JCSA 4CEMA 1YQ4A 4RLYA 5M4YA 5A7DB 3GWHA 2RA1A 1N95A 2VKHA 4I43A 3APDA 4QXHB 5ETWA 3O48A 4EZ4A 2HYZA 1MYOA 4EZKA 3K3NA 3E37A 4DMVA 1XNRT 3ZXPA 1O1SA 4GIWA 1S0PA 3T8MA 3F57A 3W9GA 4DR7T 2OA5A 3V5UA 4O2AE 4EPZA 1UOHA 2PBIA 2XAGB 5JR9A 3DBSA 3EHZA 5FQ7A 4LF4T 1UURA 2XS8A 3IBEA 3D9KA 4YSYA 4GYWA 4OVVA 5AJLA 4RSYA 5AQPB 3EUVA 3IEEA 3ZHEA 2LEHA 1E8ZA 3K1SA 2HR2A 2B6CA 4IE4A 4OAVB 5LBQB 3TWXA 2BKOA 4IDZA 3U78A 4K5BA 3ZN0B 3LG7A 4OFZA 1BR2A 3AXJA 4C0MA 3MJXA 4ASKA 4XKBA 2XHEB 2F8YA 2WWVA 4TRQA 1KT0A 1SQMA 3B7RL 3FU6A 2MYSA 2QC9A 2JIWA 2XS1A 1DNPA 3N9OA 3CSTA 5FJYA 3TLSA 2XQ9A 2X6JA 3PV0F 4U0UA 1KF6A 2JQHA 2WXOA 4WAFA 4HFHA 2I1KA 4ADZA 1MX4A 4ZI7E 1K8KG 5LFAA 1AP7A 5AQJB 2IAKA 3VR8A 3IHYA 4CCAA 1LRZA 3ZEFA 2IMLA 3HA4A 4AKHA 2X3MA 3AAAC 2X6HA 2X6FA 3FP3A 2KZTA 3WXXA 2X51A 3S7DA 3O1IA 4MLKA 4YJ2E 4CDNA 4Z90A 2N2NA 4H63V 1D0YA 5KNHD 2V6XA 3ZJ2A 4JHRA 3HL6A 3KV6A 1YMPA 3FU0A 2G0UA 4LMKA 4QH1A 2W62A 4AKLA 2HHHT 4IE7A 3V5SA 3AG1E 1Z8UA 2Q7FA 1W9RA 5ENPD 3RIUC 5GONE 5CMWA 1YA0A 4AP2A 2MTQA 3CWZB 3IKOB 3PE0A 4U7IA 3TG4A 3A8YC 2I9CA 2OVFA 3AA1B 2YU1A 5JDGA 1N33T 4DPRA 4I6EA 3URZA 2HM8A 5IYZE 3P4QA 2R59A 4GKJT 4AEZC 3DXKG 5HWXA 1SHZC 3LSVA 3KINB 4TN7B 5FVKA 2KBXA 3PRZA 5ENTD 2AXZA 3C98B 2XRYA 4I6GA 1TJFA 3VKGA 1OWAA 3PNLB 3KS2A 4Y6CA 5EX3A 5AYWD 3SFYA 4N2QA 1MZCA 1ZV4X 2XUEA 4PUCA 3X1DA 2LSIA 3PUWF 3Q2MA 4PNIA 3EIQC 4PFOA 3AS8A 4YFSA 5G2NA 3FTWA 4TWDA 2DI4A 5FXXA 4CXWA 1MMGA 3TXMA 2VVSA 2F4VT 1JWGA 4O4HE 2E9XB 4U3CA 1U5PA 1ZU2A 2D5UA 3PURA 5AENA 4L5GA 2BKPA 5HXSA 3U3WA 4UEMA 3FH5A 3FUNA 2LOPA 3JUIA 2WXLA 4UQZA 4XI0A 2IHR1 2FJBA 1Z0PA 3LVQE 5F5WA 2GGFA 3C64A 2OEVA 2J47A 2M63A 1HG2A 1XGWA 3KSLA 4HEAA 4UUCA 3V30A 3L9TA 5ABHA 3RH3A 4KVMA 3VLFA 4A63B 3CX6B 2WVIA 3G2WA 5ENQD 5JHAA 2XQ8A 3I0QA 2WP9A 2VL0A 1SZ9A 4A1SA 3ZT5A 5J1GA 5LMNT 1UN8A 2CFUA 1KZPA 2ACXA 3NOGD 2FJDA 4WUYA 4YVOA 3K8PC 2UUBT 4TXRA 4JI1T 2LHRA 2P9LG 3OAWA 3AG2E 4E7SA 3GMIA 3BUAA 3UQ4A 3B13A 4OHFA 3TWSA 2W67A 2H6IA 2ZM6T 3AE9A 2VKDA 3T8OA 4EZJA 3T8KA 4NACA 4OAUC 2X68A 2A3DA 4KX6A 3PE4A 1ZKEA 3UU3A 1EYHA 2DL1A 4QXBB 1YW0A 3I9WA 5BR8T 4YDOA 4EZHA 4K5AB 1FEWA 5L47A 4H9SE 2WAUA 2P9BA 2BTDA 3CPZA 4ZHQE 3ZT6A 5EYLA 2N1GA 3ZPJA 1FVHA 3QB2A 3LK42 3I3NA 3KV5A 1I94T 4G2VA 3UUMA 3ULQA 4FLBA 2XRZA 2LT3A 2WB5A 5A23A 4BESA 1IBKT 4JHJA 1J5WA 1G73A 2WXFA 3D9JA 2I2OA 2W4XA 5FNVE 1N4QA 3TJPA 2M67A 2LOSA 1ZB1A 2LSUA 1YKHB 3LXUX 2NR4A 3NVOA 3C3OA 4HWDA 5EK2A 4ATZD 5CA0E 2UUAT 4I9CA 3EHMA 3EIJA 2X9HA 2X6KA 3C5RA 2Y6XA 4F1PA 3TG5A 1H7CA 2SPCA 3RKGA 4LF5T 1CHUA 3P4PA 3FDHA 4LEUA 4TUMA 1N11A 5LBMA 2CHWA 2XEHA 4DR1T 4FP7A 4RG9A 1Z6TA 3FTXA 1EPUA 4FLHA 2V5DA 5L3DB 1S35A 4X64T 2YN6A 3C3RA 4CGVA 1O1TA 2J4BA 4HLLA 4EAHA 1EF1C 3SHFA 3FUEA 2JRKA 3CVNA 5A6CA 3H3AA 2BEDA 2ODUA 2BG9E 3LBXB 2Y1LE 3CVLA 2DWGA 3EDUA 4OYSA 3C4WA 5LJNA 4AQFC 3AS5A 4ACLA 4B8AA 4AXHA 2V0PA 3NZSA 2LAIA 4ACKA 5KJKA 4HN9A 4YSXA 3KDSE 2WXRA 4LFBT 5AQ7A 4LNUD 4QQIA 1Y01A 4B6XA 1OXJA 2XPZA 3OXLA 1FMWA 2KLQA 4K03A 1JNZA 2W66A 4YHJA 4KVOA 3D9LA 2D0TA 1CUNA 2VK9A 1UX4A 2CBIA 4P0BA 3LVRE 3KD7A 4L2LA 1WDYA 4B0ZA 2DNXA 4LCTA 3BQLA 4GPKA 2KZ7B 3VLEA 4O6FA 1MHQA 3GA8A 4ILGA 2P2CP 2EQXA 2MOZA 1X81A 4JZYA 3O9XA 3UM1A 4JI3T 1TJCA 3ML8A 1UUSA 3TKLB 1KLXA 4XEIG 2FBWA 3E30A 4L1BA 3QK0A 1RZ4A 2LNIA 2N9DA 3CKDA 2Y4TA 5ENRD 4KHPT 1N52A 1JCQA 3APFA 3AECA 4FC8A 5HEUA 1T72A 2ILRA 2YQ8A 3H3MA 2QA7A 5EN5D 2XAQB 4EV6A 4ILUA 1T8BA 4AI6A 1S94A 4MHCA 2WXGA 2HE0A 2V4LA 5FZQA 1OXZA 1AWCB 3ABVA 1PC2A 4HFVA 2W0GA 5L2LA 3ASHA 3PNTB 5J0ZA 2GRQB 3CVRA 4KMOA 3AA0B 4HFDA 4JPSA 1UN9A 5ABGA 3RGLA 1IYGA 3B7BA 2V7KA 4HFEA 1SA4A 3UFEA 3Q79A 5G05C 4HFCA 3SS1A 3SZ7A 5AN8A 2EIME 4DVDA 2WXMA 4Q96A 3O4ZA 5DIZA 3RYIE 3ZUVB 3Q47B 4I4TE 5FXZA 3PU8A 1XDPA 3G2SA 4DO0A 2B76A 1IQUA 4O4IE 3EI0A 3DSWA 4ZHBA 2CHZA 4A56A 4GZCA 1JCRA 3MKDA 1V55E 4EZLA 3ABKE 3HHMA 2ACZA 4UELA 4QXCB 2XQ3A 3UU4A 3SGHA 4DX1A 2W61A 4YVQC 4Y6WA 5T8IA 4F7AA 1MJ0A 3VU7H 3L3PA 3TWQA 3FB2A 3PUSA 4LMJA 1D8DA 2QGSA 2XAFB 4J0UA 5ANRA 2LUHA 2WZIA 4F6RD 4HFGA 5JRCB 5HS0A 4H9RC 1QUUA 5KJMA 5M72A 1EDUA 3MZLB 4TNVA 1B89A 3UT7A 2LSKA 1SVXA 2X9WA 3HYMB 3UPVA 4ATGA 4G23A 1W0BA 4ANUA 2MBGA 5EIBE 5J2TE 3UIPC 4GA1A 3FY4A 4YLHA 3U9WA 1G3NB 2CHOA 2ETAA 4O8SA 2DWZA 3JCKC 5EIDA 4CI1B 4NUVA 1UW4B 2PZIA 2EIKE 2ZM8A 2PQRA 2V7LA 4WNEA 5H6RB 1ELWA 3LFMA 3GYZA 3V2OA 3N5LA 5ITZF 4UV9B 4WNGA 2L9QA 2V4HC 2DLRA 5LOVE 4HRLA 5LGTB 5HXCA 4YDYA 4X1IE 1QZ2A 4NURA 3ZVVA 1LKXA 4JI7T 4LRZA 1Z3XA 4LG6A 4AM9A 4QX8B 3AEBA 4JA9A 5HAXA 3RO2A 3FUKA 2JQQA 4F8HA 2IIUA 3UX4A 2JJ9A 5JH7E 4GTOA 5ENNA 4JEHA 5AJDA 2BKKB 3RI5A 2XTLA 2CPTA 3ZLIA 2CXDA 1IKND 3ASFA 2Y4UA 2GROB 3QOFA 3PZ3A 4F3VA 3ZJ1A 4BEPA 3KVBA 3PJAJ 2P9PG 3S2AA 3CVUA 4GCNA 2A72A 1OEDE 5CMYA 3X2QE 2ZXWE 4TUUA 4N3AA 3O4XE 2L8KA 3LY8A 4E85A 2NW9A 2XAHB 4L23A 3P8CD 2DCFA 1TNZA 4MRUA 1VCTA 3A7MA 4U95D 5ADXL 4A3TA 4A5XA 3RKOA 4ANWA 2UXNB 3ZKJA 4X1KE 2W63A 1BR4A 3OXFA 3V79K 3SQVA 5L3BB 4GZ3A 4CT4A 2VTBB 2HN1A 1MNEA 5EYPF 4XZCA 2CHXA 4KP3C 2YEVC 1WR0A 4XE0A 1FT1A 3CQXC 5LXTE 1M62A 3RIUA 2QYJA 1NP7A 4EBAG 3Q5DA 5AQRB 2QRXA 3ZMSB 2NSZA 5AQAA 2WXQA 3ONLC 5KX5E 3AS4A 3B7SA 2BS4A 3SRZA 3UU5A 4DX6D 2XGMA 1WRDA 4ILCA 4G11A 5HEOA 4WNFA 3TLVA 5G05J 3TWTA 1HR0T 4IDPA 5AQUB 2XQ4A 3EU9A 5EKQD 4UQXA 1OEDB 1TNUA 2VGXB 1DCQA 5AQKB 4OK0A 4UWGA 1IAPA 2GRRB 3LKUA 4UR9A 5FT9A 3N9LA 2IFUA 4GU5A 3PEVB 3BQIA 1X9BA 2FBNA 3L39A 2IW5B 3FTUA 5BUZA 1IXVA 3DEPA 3AU5A 4QH5A 4ILBA 3L08A 3ZFWA 3LK3B 3PUQA 3NB2A 5CA1E 4GK5E 4IE5A 2L6BA 4JEUA 1IBLT 3HXEA 1OT8A 3S7JA 1NWMX 3FBZA 1D1CA 2CA5A 3P4RA 5E75A 5DBKA 5ABEA 2VVNA 4DR3T 1HFAA 3L16A 5FXWA 3HVEA 4IE6A 1D9SA 1V54E 3P1UA 4GTRA 2NTYA 3O1JA 1NEKA 3RRWA 5LMUT 5KCMA 3MX3A 2LRKA 1K1AA 2VSNA 3HDXA 2XQ6A 3PVLA 4X5TA 4HI9A 1OCOE 5JJTA 3GW4A 2XJ7A 2L9BA 2AE9A 5AQIB 4I43B 3HXFA 4KT6B 2M6IA 5LCYA 3EABA 2BF0X 5JDFA 4J7WA 2I1JA 2KCLA 2RFMA 3TLUA 3DSSA 3WAKA 3RYFE 3UULA 1TYQG 4D10C 2HPJA 2YINA 4TV9E 3E0ZA 3C4XA 2IUBA 2K3WA 5JR9B 3FXDB 5CHEE 4L7TA 2WXKA 4FHJA 1QQEA 1E2AA 3OPCA 3ZYLA 1N0RA 3RRNB 5AQMB 5AQLB 2H88A 4LF7T 4PS8A 3UXGA 3RRUA 4JHKA 2BBHA 4HTEA 2LSGA 1DU2A 4GPMA 3BU8A 4I2ZA 2X0YA 3UUXA 5AARA 4AJWA 3ZHEB 4L9PA 1Q2ZA 3CHMA 3LCAA 4QFVA 2XPYA 5HXHA 5EK4A 1D8EA 4G26A 5HXRA 2CMRA 3ABME 4HBDA 1GQEA 5KMGP 3RX6A 3FBLA 3QJZA 1OCCE 3HI2A 2PNNA 2DCPA 1T7SA 2KWHA 1X5BA 2WPVA 5EX0A 5LOZA 4DLOA 4B3TT 1WR6A 3TWUA 2LM9A 4LF8T 4DUZT 5IHYA 3JC6D 2GRMA 3CVXA 5L3EB 2AVPA 5AQGB 5HXEA 4HOQA 4IDNA 4MBGA 1NAFA 3N9QA 3RQUA 1L0VA 4W9RA 4NIKA 3I4GA 3TLTA 5H7PA 2EILE 2PG8A 4BJMA 3OTNA 1UJJA 5L4EA 4WW0A 2EHOB 3FUMA 4ME2A 3ZEFB 4IDOA 1S70B 4GTVA 2KZTB 5AQHB 3T5VA 3ANWA 2J08A 2FI7A 3TAXA 3Q7FA 4JI2T 4WBNE 3TXNA 3CKBA 2XSBA 4HOUA 1XDOA 2VQFT 2H6FA 1XMOT 4AKGA 2UXXB 2V5FA 4DNDA 4ZI3C 2VWAA 3UINC 4HFIA 3OBVE 3OVUA 4PK4A 1VRBA 3ONXA 4GCOA 4AY5A 2XENA 1E8XA 4MS6A 4OX9T 5FZSA 4GYSA 1ZBPA 1N4RA 3TWWA 2CHNA 3NWIA 2YOEA 2JABA 3CQCB 1J1JA 3CK8A 5BXOA 2J4GA 3F31A 1FMVA 2QVAA 4G63A 4WYVA 4LUNU 3GZSA 4AQFA 2KCVA 3UIOC 3KBTA 4X66T 2MAWA 2CM0A 4UF0B 2XCBA 3EDTB 5FIOA 4JW1A 1E7VA 2KCKA 2FO1E 4I6JA 4HWHA 1OWLA 2P9UG 2CCQA 2ETCA 3AA7B 5JDHA 2DBAA 2QYWA 5LHIB 4DV4T 4DX7D 3MA5A 4AQYT 3BK9A 4BSZB 2CWYA 2V8SV 4FJOA 1H0AA 1JUQA 3W15B 1LVFA 2Q9QB 3AEGA 3CQGB 5FXVA 3L17A 3SI5A 4FI5A 5C2YA 3KSQA 1SUMB 4KZ0A 1OWNA 4HOSA 4G8KA 4B93B 1WLXA 2NW7A 2ZMAA 3FULA 4TXQA 1YCSB 2FF4A 3PJAA 3PUYF 3Q5EA 3FZMB 1HX1B 2V26A 3QB5K 4C90A 3MK7C 2UUCT 5A1LA 3GN5B 2FJEA 3CIRA 4DBRA 4A55A 4AKIA 3DEOA 5C2TA 1MQSA 4N39A 3HXDA 3LPZA 4J6IA 4IL9A 2IEJA 3ZC1A 2VASA 4QWNB 3RC8A 4NPPA 3BQKA 4U2ZA 3ESKA 4B94A 3IEGA 4K0RA 3B7UX 2LKHA 1P5QA 3MCXA 4DX5D 1N94A 4EEBA 4CYMD 5ABFB 4EECA 3PZ2A 4Q94A 4IREA 4ILAA 3LJCA 3DTOA 4DMWA 1E96B 3V31A 2WM9A 4UWLA 3ZN1B 3FXEB 2MPKA 3T1HT 1QNFA 2XPIA 1WAO1 2E8IA 3P2BA 4EQFA 4HI8A 1D1AA 2AXUA 4LSZE 3PUKA 4U7YA 3Q73A 2DYSE 2X67A 2ONDA 4XX5A 1FIOA 2UY1A 2YDQA 2IDOB 5LNKA 3CVYA 3FZHB 4UIGA 2YDRA 4GTSA 2EHOC 3MKRA 3I5PA 3HXCA 3P7IA 4TUYE 3B7TA 5BNWA 2P9KG 4LNGA 2WDVA 3E22E 5CFBA 3Q5WA 5JREA 1WY6A 4DI4A 2JMKA 4Q69A 1NENA 2QY7A 1T98A 3CX7B 4JYAT 4UVCB 3JAFA 1BPOA 5FQ8A 2ZISA 2KNDA 3SY2A 2R5SA 4WNDA 4AXPA 1FJGT 1FVFA 3NKZA 2ES0A 3FU3A 5C8YE 4P0AA 3QWWA 5L3GB 4HORA 2R05A 3EDVA 3DWLG 3P50A 2UU9T 1OWOA 5FQ4A 1OWMA 2RG8A 3O1HA 3LBXA 4I17A 4O2BE 3ONJA 4JI4T 4DR4T 2V7MA 3S7FA 1XWMA 4JC8A 5F3JA 1BU9A 4I1MA 4BA9A 3JQ1A 2J07A 2LRLA 2E9XC 1H19A 5EK3A 2VURA 4IL4A 3UT5E 5BV1A 3ZC0A 1Z3YA 2UXCT 3Q15A 1KEYA 3ZSSA 5JDNA 1O3XA 4CZ2D 4ZEYA 2LJLA 4TV3A 3R9AB 2XEVA 4YT0A 2OEWA 2CXFA 5L3CB 4GAAA 2VSYA 3MV3B 4ISSA 2J9QA 5J2UE 5IUXA 3C3QA 2DYRE 2LSYA 3ZYMA 3RRMB 2AJAA 1E8YA 3RO3A 3JQ0A 1HF8A 3IBPA 2MOWA 5FY1A 4IE0A 4YDEA 4ANVA 2JQ9A 4O60A 1LVKA 4U33A 3QK6A 2XSAA 2XPKA 2FO7A 2E0IA 2LSJA 1L5JA 3PTRB 5HEHA 4JV5T 3DXMG 1VOMA 4DV3T 4U0SA 3SBTB 4ZI3D 3LY7A 3AAIA 2WBLA 4ZI2C 5JDQA 4J8YA 1MMAA 2WWUA 5LG3A 5CCMA 1HZ4A 2ETBA 2WY2A 2R6GF 2WMOA 2P9SG 4DBQA 3ZT7A 2MRIA 5JJ6A 3ZNGA 4TX5A 1H6PA 3RF1A 2BG9B 3T9KA 4U8YD 4RQIA 2V8SE 2KXPB 3QAQA 3GZ1A 4OVUA 1E90A 1JWFA 5C1DA 1IBMT 5F8PA 4CN4A 4GK0E 3UFGA 1H2UA 5CCLA 4EOZB 4BETA 3L82A 4JBWF 5HWYA 3CV0A 2BDEA 1ZEEA 5DJQC 5JVDE 2XGSA 4CGWA 1QSDA 3I1AA 3FTSA 3J7Yq 2LXMA 2Y69E 1KT1A 2AXVA 2V7IA 1N34T 4DK5A 1N4PA 4EGWA 3DJBA 4A98A 1TNYA 3AE5A 3OTOT 1N36T 4OYJA 5B3SE 3QOUA 3EVYA 4GMLA 3UM2A 3DSUA 4PDXA 2C5IT 3CGHA 2NTXA 3KV9A 1LTXA 2XZDG 4L9IA 1I6ZA 4M3OA 3V2XA 2ZM0A 3ONLA 3AE8A 3G2VA 3AB3B 3EJNA 4WWPA 5EILA 4BFRA 3AE7A 1N0QA 3ETVA 4MALA 4UVAB 4FADA 5LGUB 3UT4A 5KJLA 2VKJA 1S64A 4N3BA 5FINA 1PAQA 3E33A 3I0OA 3RIFA 2IO3C 1TN8A 3QC1A 1O1RA 1EZ3A 2LE8A 2Y48B 4JI8T 2XQ5A 4M1PA 2CLYB 2YKSA 2BKNA 2WZHA 2Z6EA 4WBOA 1W09A 3CLJA 1VCSA 3UU8A 4LMLA 5HYAA 5FP3A 1YYHA 3SFXA 3J5PA 1WYCA 4UV8B 5HRYA 5JRCA 4ZS3A 2IC9A 2BUGA 2WDQA 4WZXA 3BG1B 3NOCD 4PK6A 1MX6A 5JA4D 1Y64B 3ZXSA 3FUFA 2DHRA 3OYXA 4Z91A 4ZS2A 3TWVA 3SNXA 4KBQA 3QKYA 4G24A 4I1AA 5ENOD 4LF6T 2OCCE 4U0ZA 4HWFA 3CSFA 3AE1A 5ANLA 4EXTA 1R8IA 1IZNB 3HKCE 5J08A 4LERA 4TXPA 4YJ3E 2E5LT 3TLWA 4X62T 4ZZCA 3AE4A 3U3IA 4CN6A 4HOTA 3CK9A 1S63A 3SBSA 2E2AA 3CHPA 2P9NG 4CI3B 5CBNA 5CGMA 5FL1A 1MIYA 3AE3A 3BG0B 3IHRA 4E6HA 3EHNA 4O4JE 4JI0T 3ASGA 3IV0A 1MIWA 4X65T 4H9QC 2E5VA 3NAWA 3MXZA 1MMNA 1XNQT 2OV8A 4G8LA 5LCWJ 3FH8A 3RRCA 2BBJA 4DX2A 4KMCA 4UWHA 1B7TA 4DUIA 3CK6A 2X66A 4HLEA 2V7JA 3A5XA 3Q9NC 2BG9C 2KWIB 2JQKA 1YD8G 1NA3A 1KNRA 4BT8A 1Y6IA 2YHCA 4O1OA 4BSXA 1TR4A 2C0SA 5FY0A 4B89A 3R9MA 1NI1A 4GYOA 3N71A 3FZKB 1HX8A 4E7ZA 4U8VD 1WG0A 3CR3A 2PL2A 5FYMA 2BZBA 4U8HA 4TWHA 1IJ5A 3AEFA 4KUMB 4PJNA 4JEHB 2E9XD 2V6YA 5JTGA 3Q49B 4H9NC 3R6NA 2WB2A 3MKQB 3PUJA 5AQOB 4H7XA 4A97A 5LJMA 3M3ZB 1YXRA 5KXJA 5G04C 2CE7A 1FCHA 4AOFA 4BT9A 3NQPA 5KNGA 2UXBT 2KT9A 1WYBA 4N78D 3IXEA 3K9IA 4Z68A 2HPLA 5LX8A 2PM7A 1MIVA 3SF4A 4I2WA 3SWHA 2B1EA 3DPYA 3FTVA 4KYOB 3AAAB 2XZTG 4DI3A 2AXDS 1K1BA 1LD8A 4JL0A 2CG3A 4DV7T 1Y8MA 2I59A 4C0EA 4ISTA 4ERRA 3CVVA 2XM1A 4JVSA 1N54A 3HKBE 1SE7A 2VYIA 1HXIA 4XZ4A 3CK7A 3JUEA 2J8SD 3LYAA 3U66A 2FUPA 4JA7A 4ZI2D 1XMQT 3J5QB 5DQWA 3T1YT 4TNWA 2ZGGA 2V5CA 3QNKA 3VRAA 1UG3A 2PQNA 4TWFA 3FH7A 3N2GE 4A1GA 3D9MA 4DUYT 4AQGA 2J09A 3FHEA 2UXDT 5JDLA 5AQSB 3DSVA 3C4ZA 2FULA 4U63A 3FHNA 4U04A 5E0OA 3FEXA 3B95A 2XCCA 4OYKA 3VLDA 1KNPA 1JPLA 4FULA 2WQ6A 3VKHA 3VTYA 4TZ4C 3CHSA 3B57A 1D0XA 4NQ0A 2EINE 2GK9A 3FWVA 3QWPA 5AQTB 4CZZB 3RAUA 5FTPA 5FWQA 2F0YA 3FUJA 3ZRHA 5KBAA 3PZDA 1MNDA 3RLFF 3UQ3A 3LEWA 2M6BA 3RJVA 5BXUA 1HTJF 5AQBA 2WS3A 5FZRA 1AJ3A 3VR9A 1HNWT 5KDMC 4GZ5A 1E1HB 2BVLA 2DZNA 4BX9A 4JB8P 2CBJA 4JEUB 3R84B 2B0OE 3C51A 4LF9T 2L0IA 2X0LB 3D9NA 1ZHCA 1OWPA 2JMHA 5AQQB 3DRAA 4JD2G 3N9MA 4YNDA 3LS8A 2W2UA 3MEKA 2VL8A 1DVPA 3MGBA 4AY6A 2IQCA 2I6HA 1H6OA 3HVEB 4BJNA 3AEDA 4UQYA 4HWCA 3ZW3A 1HU3A 3FZFB 1H6KA 1HG5A 2A2FX 2MYOA 2XHEA 3Q75A 4AVXA 4LFCT 4QH4A 5B1BE 3FTZA 3UM3A 2XASB 5HEJA 4I50E 5DQVA 3JAEA 4FA6A 4CQIA 2RFAA 4L2YA 3B5MA 1LD7A 3E34A 1DC2A 3SD5A 5AIJA 2K5BB 2WU5A 3KV4A 4IGUA 4XAXB 3J9X1 4B3MT 4BTAA 4C48B 4CT0A 1NL4A 2PJQA 3UT8A 3KVAA 3AXJB 5BW8C 5B1AE 3MZKB 4QX7B 1K3ZD 4I9EA 4H9OC 4U07A 1G8XA 4GTPA 3S7BA 4DR5T 5G55A 4DR2T 1U3DA 3HXBA 3UUXB 3N2KE 5EZYE 3PH0C 4MLPA 4DV2T 4APOA 1QBQA 3AA6B 4YTMA 5LHGB 2Y8DA 1UX5A 3NZUA 2JEKA 4IIJE 3HRAA 3CKCA 2EHOA 1KPSB 1Z5SC 3D9HA 5FKYA 4IRUA 3CEQA 4WNKA 4MKTA 2OLTA 3AE2A 5G04J 3P4SA 3D9OA 4EBAA 3RYCE 1YQ3A 3H37A 5D66A 3UM0A 4V1Av 1QLBA 2EIJE 2ZIRA 2RD0A 3HKDE 3KEZA 3RK6A 4BAYB 4CXXA 4RG6A 3EHRA 4UXNB 1IHBA 3EUHA 1IHGA 3Q5MA 4I0UA 3ZCIA 1OEDC 5JMND 3CHOA 3C98A 3G2TA 2IU1A 4O4LE 4GYYA 4GYRA 4KI0F 4HE8A 2JPFA 2HH7A 2H6HA 4ZOLE 2UWJG 3ANWB 4EEDA 4EYYR 3HIZA 4ILHB 4G25A 3ZMZB 3HR0A 3K3QC 2QFCA 1HS6A 2D9DA 1BR1A 3RYHE 3I4RB 2E9XA 3ZKRA 4XIFA 3SFDA 4YDWA 4UF0A 3ULYA 4PK5A 3NRXA 2F8XK 5CRUA 5AFUL 3D0TA 2LAHA 4DV0T 5BT1A 2HN2A 5HCJA 3QB5A 4HWIB 2HO1A 4K5CA 3ONKA 2J49A 3TWRA 5LP0A 2KMFA 3ZYKA 3WAJA 3SOLA 5ENSD 4PJMA 4IHJE 2Q9QA 4U72A 2NXPA 4V3IA 3UKRG 3GZ2A 2AW6A 1UGOA 4LNBA 1HNZT 2ZGDA 3PUZF 3BEEA 3MYVA 4HNAD 4QKNA 2KC7A 3CX8B 5HQ8A 4UVBB 4EHMA 2GRPB 5J90A 4DJAA 1KNZA 2QZAA 4KHZF 3AE6A 4KBMB 4B3RT 3ENEA 3AJIA 3L13A 1A17A 3AVSA 3RSEG 3ZCJA 3GN5A 3Q9UC 4H7YA 1BD8A 3DSXA 3RU0A 3D9IA 5JR9C 3U4TA 1FPPA 1MX2A 2X6IA 3ZU7B 2XY8B 3FUIA 3ISMC 4ZFHA 2LKGA 3SO8A 2XQAA 2IOLA 4WWOA 1INZA 3ESLA 1D1BA 3E32A 3I9YA 1U2VG 5CRVA 3UTMA 3D9PA 2NW8A 5FVLA 4JI6T 3ETUA 4AIUA 2D0UA 4X8QA 4CRWA 1YKEB 4C91A 1OY3D 4N5CA 3JXIA 2L6JA 5ABFA 1LF8A 2F37A 2A5EA 2FEZA 3CVWA 2DWKA 5D0QD 3F6QA 1SW6A 2PTFA 4GMRA 4XKCA 3LJ3A 1W3BA 4HB5A 4COFA 3APCA 2K9AA 2VJ8A 3OXGA 1NFIE 4MFRA 3DPDA 4F6RC 3ABLE 2LXLA 3NF1A 4J8EA 1OCZE 3CHRA 3E08A 5FQ6A 2X9YA 4I55E 4CXYA 2X38A 2XQYA 1ELKA 4U31A 2C5KT 2YNQA 4HRNA 4J8DA 2VGEA 1WM5A 3FUHA 2JLBA 5TAOA 4Z8XA 5FMNA 1XNFA 2VQ2A 2WXNA 5CEDB 4NXMT 4PAGA 3SFEA 4I1OB 1TN6A 2PFVA 4O1PA 3T5XA 5KWDA 5LGNB 4JI5T 1E7PA 3ASNE 5LP6E 4NUUA 2A9UA 5JQGE 2UY1B 1U3CA 2PM6A 4FJZA 3JXJA 4G2AA 3LY9A 5AAOA 3QDNA 1MMDA 3RC3A 4IULA 5KJNA 1DCEA 1N32T 2XGOA 3LDQB 2R03A 1JNRA 1UJKA 2WU2A 2NWBA 2X9XA 3S4UA 3NBNB 4J8SA 4F53A 4QHOA 4GOUA 4KXKB 2P58C 3U64A 4N2SA 1SA5A 3L09A 4H63H 3PUXF 3QNUA 5LHHB 1FT2A 2ZU6B 5T4YA 5DABA 3K3OA 4K0KT 1TNOA 5AQNB 3N9NA 4UI9K 3RQWA 2W00A 2ODVA 5IWAT 2Y3AA 4J8FA 4U96D 2BKGA 2KSRA 2BS2A 1RW2A 2LO6A 4N5QA 3R7RA 4RVBA 4YTPA 4PFPA 3UQ7A 2J1DG 3ZGQA 3C72A 3UI2A 5CJ5A 5HCMA 4HXIA 1BLXB 2K48A 4J2CA 2OV9A 4IN3B 3ZPOA 4YXDA 1X79A 4WWNA 1SA0E 1E8WA 2LHNA
chains in the Genus database with same CATH topology
4CDRA 5LCWC 2Q9QC 2DIWA 3JYSA 5T3RA 1HCIA 3ZMVB 4JLEA 1HH8A 5L3FB 4A3VA 3QWVA 4ANJA 2C2LA 3PUGA 3F2EA 5LYJE 2WQ7A 4PW8A 2CG2A 2VSOE 2YU2A 2NP9A 1BR0A 2WXIA 2C0LA 4CI2B 3OJAA 4EB6E 2VGYA 5EDSA 4URKA 4UWKA 3E4BA 4AV7A 3NRYA 3FUDA 4AIFA 3CMLA 3ML9A 3PDYA 1NA0A 4GA2A 1PY1A 4PS3A 2XAJB 4AKRB 2WXJA 2BVMA 2IF4A 4PJLA 1SZAA 3NBXX 4EYUA 4PH4B 3R7QA 3CVPA 4ILIA 1HE8A 4CDMA 3IHVA 3MACA 5JHBA 1H2TC 2ZLYA 4JUYA 3QARA 4BY6A 4R7LA 4C9BB 4N3CA 3VTXA 3KBUA 3MJWA 4UWFA 5LG4A 2NOXA 4EIWA 2OVBA 2GW1A 4BWRA 2GRLA 3PE3A 2CXLA 4GZ6A 3PEUB 2RP4A 4HKAA 3TL5A 4UI9C 5FY7A 4GMJA 1HO8A 2IJGX 4TV8E 1GW6A 5ARFA 4HVBA 1HS7A 2NC9A 2AWIA 2IOSA 1V9DA 3Q5XA 4XI9A 4GZDA 1U4QA 2LSVA 3NZPA 4X1YE 4DLQA 5LA6E 5JDMA 4NRHB 2YK0A 4FHKA 4K0UA 2CEAA 3QC9A 4MBQA 1OUVA 3RKVA 4F1SA 3ZIMA 3PUAA 3D3MA 1IJ6A 5BV0A 1H2VC 3WI3A 2H7OA 4KZCA 2IONA 3ZN3A 2EHOD 1VDYA 2WSSV 5ARGA 4ABNA 3UTKA 3JC6C 3PS6A 3HKEE 3PU3A 1KK7A 2VB6A 3ZMUB 4GA0A 2H7VC 3TGOA 2IC6A 3CHQA 4BTBA 2VSXE 4X20E 1UCUA 3UMVA 2R17C 3ZYQA 2OOEA 1US7B 3IF8B 3N2OA 4ANXA 4B8CB 3CVQA 2KM4A 2XQ0A 3Q4AB 5E76A 2L0TB 2WXHA 1ELRA 4PS7A 2CWOA 3FU5A 2WXPA 4HS2A 4PJJA 4XBFB 2KATA 3RIBA 2A5UA 2WMNA 3MKQA 2C0MA 4H9PC 2KINB 1E7UA 3ZMTB 2CFZA 2VKOA 3QUJA 2VTBA 3L54A 3C50A 3CIAA 3KFWX 5BPPA 1TEZA 2L3LA 3AU4A 3FFLA 2Q9QD 4G1TA 3NZQA 4IYPA 2A4ZA 3G2UA 2C5JA 4HGAA 2J4DA 2D2SA 3L6AA 4FJYA 4P09A 5H6QB 4U74A 3AVRA 3VHLA 3FTYA 3MA9A 4P29A 3FEYA 2MHKA 3SFZA 2VGXA 3KAEA 2V1DB 2YHEA 3L22A 4FU3A 2CLYC 5D0OD 3LDZA 3N9PA 3M65A 5HI7A 5JJ7A 4GB9A 3ASDA 4UI9J 3DP7A 3AAEB 3UUNA 2WQHA 4BX8A 2H3RA 5CB4E 4JXTA 3PDNA 1D0ZA 3OKQA 3OYZA 3Q9DA 2E2EA 3MV2B 2ZM2A 4APFA 1NZNA 3PREA 4L0RA 3LK2B 1IQRA 3RPUA 5BMVE 2K24A 4CEMA 5M4YA 5A7DB 3GWHA 2RA1A 4I43A 2VKHA 3APDA 4QXHB 5ETWA 3O48A 4EZ4A 2HYZA 4EZKA 3K3NA 4DMVA 4GIWA 1S0PA 3T8MA 3F57A 2OA5A 3V5UA 4O2AE 4EPZA 2PBIA 2XAGB 5JR9A 3DBSA 5FQ7A 3IBEA 3D9KA 4GYWA 4OVVA 5AJLA 4RSYA 3IEEA 3ZHEA 2LEHA 1E8ZA 2HR2A 4IE4A 5LBQB 4IDZA 3U78A 3ZN0B 3LG7A 4OFZA 1BR2A 4C0MA 3MJXA 4ASKA 4XKBA 2XHEB 4TRQA 1KT0A 1SQMA 3B7RL 3FU6A 2MYSA 1DNPA 3N9OA 3CSTA 5FJYA 2X6JA 4U0UA 2WXOA 4WAFA 2I1KA 4ADZA 4ZI7E 5LFAA 2IAKA 3IHYA 4CCAA 1LRZA 3ZEFA 3HA4A 4AKHA 2X3MA 2X6HA 2X6FA 3FP3A 2KZTA 3WXXA 2X51A 3S7DA 3O1IA 4MLKA 4YJ2E 4CDNA 2N2NA 4H63V 1D0YA 3ZJ2A 4JHRA 3HL6A 3KV6A 3FU0A 2G0UA 4AKLA 2W62A 4IE7A 3V5SA 2Q7FA 5GONE 5CMWA 1YA0A 4AP2A 2MTQA 3CWZB 3IKOB 3PE0A 3TG4A 2I9CA 2OVFA 3AA1B 2YU1A 5JDGA 4DPRA 4I6EA 3URZA 2HM8A 5IYZE 2R59A 4AEZC 5HWXA 1SHZC 3KINB 4TN7B 3PRZA 2AXZA 3C98B 2XRYA 4I6GA 1TJFA 3VKGA 1OWAA 3PNLB 3KS2A 4Y6CA 5EX3A 5AYWD 4N2QA 1ZV4X 2XUEA 4PUCA 2LSIA 3Q2MA 4PNIA 3EIQC 4PFOA 3AS8A 4YFSA 5G2NA 3FTWA 2DI4A 5FXXA 4CXWA 1MMGA 3TXMA 1JWGA 4O4HE 2E9XB 1U5PA 1ZU2A 2D5UA 3PURA 5AENA 4L5GA 5HXSA 3U3WA 4UEMA 3FH5A 3FUNA 2LOPA 3JUIA 2WXLA 4UQZA 4XI0A 3LVQE 1Z0PA 2GGFA 3C64A 2M63A 1HG2A 1XGWA 4HEAA 3RH3A 4KVMA 3VLFA 3CX6B 2WVIA 3G2WA 5JHAA 3I0QA 1SZ9A 4A1SA 5J1GA 1UN8A 2CFUA 2ACXA 4WUYA 4YVOA 3K8PC 2LHRA 3OAWA 4E7SA 3GMIA 3B13A 4OHFA 2VKDA 3T8OA 4EZJA 4NACA 2X68A 2A3DA 3PE4A 1ZKEA 1EYHA 4QXBB 1YW0A 3I9WA 4EZHA 1FEWA 4H9SE 2WAUA 2P9BA 2BTDA 3CPZA 4ZHQE 2N1GA 3ZPJA 1FVHA 3QB2A 3LK42 3I3NA 3KV5A 4G2VA 3UUMA 3ULQA 4FLBA 2XRZA 2LT3A 5A23A 4JHJA 1G73A 2WXFA 3D9JA 2I2OA 5FNVE 3TJPA 2M67A 2LOSA 2LSUA 1YKHB 3LXUX 5EK2A 5CA0E 4I9CA 3EHMA 3EIJA 2X9HA 2X6KA 2Y6XA 3TG5A 1H7CA 2SPCA 3FDHA 4LEUA 5LBMA 2CHWA 4FP7A 4RG9A 1Z6TA 3FTXA 1EPUA 4FLHA 5L3DB 1S35A 4CGVA 2J4BA 4EAHA 1EF1C 3SHFA 3FUEA 2JRKA 3CVNA 5A6CA 3H3AA 2ODUA 3LBXB 3CVLA 2DWGA 3EDUA 4OYSA 3C4WA 5LJNA 4AQFC 3AS5A 4ACLA 4B8AA 4AXHA 2V0PA 3NZSA 2LAIA 4ACKA 5KJKA 4HN9A 3KDSE 2WXRA 4B6XA 2XPZA 3OXLA 1FMWA 2KLQA 4K03A 4KVOA 4YHJA 3D9LA 2D0TA 1CUNA 2VK9A 1UX4A 4P0BA 3LVRE 3KD7A 4L2LA 4B0ZA 2DNXA 4LCTA 3BQLA 4GPKA 2KZ7B 3VLEA 4O6FA 1MHQA 3GA8A 4ILGA 2EQXA 2MOZA 4JZYA 3O9XA 1TJCA 3ML8A 3TKLB 1KLXA 4L1BA 3QK0A 2LNIA 2N9DA 3CKDA 2Y4TA 1N52A 3APFA 4FC8A 2ILRA 2YQ8A 2QA7A 2XAQB 4ILUA 4AI6A 1S94A 4MHCA 2WXGA 2V4LA 5FZQA 1OXZA 1PC2A 4HFVA 2W0GA 5L2LA 3ASHA 3PNTB 3CVRA 4KMOA 3AA0B 4JPSA 1UN9A 1IYGA 2V7KA 3UFEA 5G05C 3SS1A 3SZ7A 4DVDA 2WXMA 4Q96A 3O4ZA 5DIZA 3RYIE 3Q47B 4I4TE 5FXZA 3PU8A 3G2SA 4DO0A 1IQUA 4O4IE 2CHZA 4A56A 4GZCA 3MKDA 4EZLA 3HHMA 4UELA 4QXCB 3SGHA 2W61A 4YVQC 4Y6WA 5T8IA 4F7AA 3VU7H 3L3PA 3FB2A 3PUSA 2QGSA 2XAFB 4J0UA 5ANRA 4HFGA 5JRCB 4H9RC 1QUUA 5KJMA 5M72A 1EDUA 3MZLB 1B89A 3UT7A 2LSKA 2X9WA 3HYMB 3UPVA 4ATGA 4G23A 4ANUA 2MBGA 5J2TE 4GA1A 3FY4A 4YLHA 3U9WA 4O8SA 3JCKC 4CI1B 4NUVA 2PZIA 1UW4B 2ZM8A 2PQRA 2V7LA 4WNEA 5H6RB 1ELWA 3LFMA 3GYZA 3N5LA 4UV9B 4WNGA 2L9QA 2DLRA 5LOVE 5LGTB 5HXCA 4X1IE 1QZ2A 4NURA 3ZVVA 1LKXA 4LRZA 1Z3XA 4AM9A 4QX8B 4JA9A 5HAXA 3RO2A 3FUKA 2JQQA 3UX4A 2JJ9A 5JH7E 5ENNA 4JEHA 5AJDA 2XTLA 3ZLIA 2CXDA 3ASFA 2Y4UA 4F3VA 3ZJ1A 3KVBA 3S2AA 3CVUA 4GCNA 2A72A 5CMYA 4TUUA 4N3AA 3O4XE 2L8KA 3LY8A 4E85A 2NW9A 2XAHB 4L23A 3P8CD 2DCFA 4MRUA 5ADXL 4A3TA 4ANWA 3RKOA 2UXNB 4X1KE 2W63A 1BR4A 3OXFA 4CT4A 5L3BB 4GZ3A 2VTBB 1MNEA 4XZCA 2CHXA 4KP3C 2YEVC 4XE0A 3CQXC 5LXTE 1NP7A 4EBAG 3ZMSB 2NSZA 2WXQA 5KX5E 3AS4A 3B7SA 3SRZA 2XGMA 1WRDA 4G11A 4WNFA 5G05J 5EKQD 4UQXA 2VGXB 4OK0A 4UWGA 1IAPA 3LKUA 5FT9A 3N9LA 2IFUA 4GU5A 3PEVB 3BQIA 2FBNA 2IW5B 3FTUA 5BUZA 3AU5A 3L08A 3ZFWA 3LK3B 3PUQA 5CA1E 4GK5E 4IE5A 4JEUA 3S7JA 1NWMX 3FBZA 1D1CA 2CA5A 5E75A 5DBKA 1HFAA 3L16A 5FXWA 3HVEA 4IE6A 3P1UA 2NTYA 3O1JA 3RRWA 5KCMA 3MX3A 2VSNA 3HDXA 3PVLA 5JJTA 3GW4A 2L9BA 4I43B 4KT6B 5LCYA 2BF0X 5JDFA 2I1JA 2KCLA 3WAKA 3RYFE 3UULA 4D10C 2HPJA 2YINA 4TV9E 3E0ZA 3C4XA 5JR9B 3FXDB 5CHEE 4L7TA 2WXKA 4FHJA 1QQEA 3ZYLA 3RRNB 4PS8A 3RRUA 4JHKA 4HTEA 2LSGA 4I2ZA 3UUXA 4AJWA 3ZHEB 3CHMA 3LCAA 4QFVA 2XPYA 5HXHA 5EK4A 4G26A 5HXRA 2CMRA 5KMGP 3RX6A 3FBLA 3QJZA 3HI2A 2DCPA 2KWHA 1X5BA 2WPVA 5EX0A 5LOZA 4DLOA 1WR6A 2LM9A 5IHYA 3JC6D 2GRMA 3CVXA 5L3EB 2AVPA 5HXEA 4HOQA 1NAFA 3N9QA 4W9RA 3I4GA 2PG8A 4BJMA 3OTNA 1UJJA 4WW0A 2EHOB 3FUMA 4ME2A 3ZEFB 2KZTB 3T5VA 3ANWA 2J08A 2FI7A 3TAXA 4WBNE 3TXNA 3CKBA 4HOUA 4AKGA 2UXXB 2V5FA 4ZI3C 4DNDA 2VWAA 3OBVE 4PK4A 1VRBA 3ONXA 4GCOA 4AY5A 1E8XA 4MS6A 5FZSA 4GYSA 1ZBPA 3CQCB 3CK8A 3F31A 1FMVA 4G63A 4LUNU 3GZSA 4AQFA 2KCVA 3KBTA 2CM0A 4UF0B 2XCBA 3EDTB 4JW1A 1E7VA 2KCKA 4I6JA 1OWLA 2CCQA 3AA7B 5JDHA 2DBAA 5LHIB 3MA5A 3BK9A 2CWYA 4FJOA 1H0AA 1JUQA 3W15B 1LVFA 2Q9QB 3CQGB 5FXVA 3L17A 3SI5A 4FI5A 5C2YA 4KZ0A 1OWNA 4HOSA 1WLXA 2NW7A 2ZMAA 3FULA 2FF4A 2V26A 4C90A 3MK7C 5A1LA 3GN5B 4DBRA 4A55A 4AKIA 1MQSA 4N39A 3LPZA 4J6IA 3ZC1A 2VASA 4QWNB 3RC8A 3BQKA 3ESKA 4B94A 3IEGA 4K0RA 3B7UX 1P5QA 3MCXA 4EECA 4Q94A 3LJCA 3DTOA 4DMWA 1E96B 2WM9A 4UWLA 3ZN1B 3FXEB 1QNFA 2XPIA 1WAO1 2E8IA 3P2BA 4EQFA 1D1AA 2AXUA 3PUKA 2X67A 2ONDA 4XX5A 1FIOA 2UY1A 5LNKA 3CVYA 4UIGA 2EHOC 3MKRA 3I5PA 3P7IA 4TUYE 3B7TA 5BNWA 3E22E 3Q5WA 5JREA 1WY6A 4DI4A 2JMKA 4Q69A 2QY7A 1T98A 3CX7B 4UVCB 1BPOA 5FQ8A 2KNDA 2R5SA 4WNDA 4AXPA 1FVFA 2ES0A 3FU3A 5C8YE 4P0AA 3QWWA 5L3GB 4HORA 3EDVA 1OWOA 5FQ4A 1OWMA 2RG8A 3O1HA 3LBXA 4I17A 4O2BE 2V7MA 3S7FA 4JC8A 5F3JA 4I1MA 4BA9A 3JQ1A 2J07A 2E9XC 1H19A 5EK3A 3UT5E 5BV1A 3ZC0A 1Z3YA 3Q15A 5JDNA 1O3XA 4TV3A 2LJLA 3R9AB 2XEVA 4GAAA 2CXFA 5L3CB 2VSYA 3MV3B 4ISSA 2J9QA 5J2UE 2LSYA 3ZYMA 3RRMB 1E8YA 3RO3A 3JQ0A 1HF8A 3IBPA 2MOWA 5FY1A 4IE0A 4ANVA 1LVKA 3QK6A 2FO7A 2E0IA 2LSJA 1L5JA 3PTRB 1VOMA 4U0SA 3SBTB 4ZI3D 3LY7A 3AAIA 2WBLA 4ZI2C 5JDQA 1MMAA 2WWUA 5CCMA 1HZ4A 2WMOA 4DBQA 5JJ6A 2MRIA 4TX5A 2V8SE 2KXPB 3QAQA 3GZ1A 4OVUA 1E90A 1JWFA 5C1DA 5F8PA 4GK0E 1H2UA 5CCLA 4EOZB 5HWYA 3CV0A 2BDEA 1ZEEA 5DJQC 5JVDE 2XGSA 4CGWA 1QSDA 3I1AA 3FTSA 3J7Yq 1KT1A 2AXVA 2V7IA 4DK5A 3DJBA 4OYJA 3QOUA 3EVYA 4GMLA 4PDXA 2C5IT 3CGHA 2NTXA 3KV9A 4L9IA 4M3OA 2ZM0A 3ONLA 3G2VA 3AB3B 3EJNA 4WWPA 4BFRA 3ETVA 4MALA 4UVAB 4FADA 5LGUB 3UT4A 5KJLA 2VKJA 4N3BA 1PAQA 3I0OA 3QC1A 1EZ3A 2LE8A 2Y48B 4M1PA 2CLYB 2Z6EA 4WBOA 3CLJA 5HYAA 5FP3A 1WYCA 4UV8B 5JRCA 4ZS3A 2IC9A 2BUGA 3BG1B 4PK6A 1Y64B 3ZXSA 3FUFA 2DHRA 3OYXA 4ZS2A 3SNXA 4KBQA 3QKYA 4G24A 4I1AA 4U0ZA 3CSFA 5ANLA 4EXTA 1IZNB 3HKCE 5J08A 4LERA 4YJ3E 3U3IA 4HOTA 3CK9A 3SBSA 3CHPA 4CI3B 1MIYA 3BG0B 3IHRA 4E6HA 3EHNA 4O4JE 3ASGA 3IV0A 1MIWA 4H9QC 3MXZA 1MMNA 2OV8A 5LCWJ 3FH8A 3RRCA 4KMCA 4UWHA 1B7TA 2X66A 4HLEA 2V7JA 3A5XA 2KWIB 1YD8G 1NA3A 4BT8A 1Y6IA 2YHCA 4BSXA 2C0SA 5FY0A 4B89A 4GYOA 3N71A 1HX8A 4E7ZA 3CR3A 2PL2A 5FYMA 2BZBA 4U8HA 1IJ5A 4KUMB 4PJNA 4JEHB 2E9XD 3Q49B 4H9NC 3R6NA 2WB2A 3MKQB 3PUJA 4H7XA 5LJMA 5G04C 2CE7A 1FCHA 4AOFA 4BT9A 3NQPA 2KT9A 1WYBA 4N78D 3K9IA 2HPLA 5LX8A 2PM7A 1MIVA 3SF4A 4I2WA 3SWHA 2B1EA 3FTVA 4KYOB 3AAAB 4DI3A 4JL0A 2CG3A 1Y8MA 2I59A 4C0EA 4ISTA 4ERRA 3CVVA 4JVSA 1N54A 3HKBE 2VYIA 1HXIA 4XZ4A 3CK7A 3LYAA 3U66A 4JA7A 4ZI2D 5DQWA 3QNKA 1UG3A 2PQNA 3FH7A 3N2GE 4A1GA 3D9MA 4AQGA 2J09A 3FHEA 5JDLA 3C4ZA 2FULA 4U63A 3FHNA 4U04A 5E0OA 3FEXA 2XCCA 4OYKA 3VLDA 1JPLA 4FULA 2WQ6A 3VKHA 3VTYA 4TZ4C 3CHSA 3B57A 1D0XA 4NQ0A 2GK9A 3FWVA 3QWPA 4CZZB 5FTPA 5FWQA 3FUJA 3ZRHA 3PZDA 1MNDA 3UQ3A 3LEWA 3RJVA 1HTJF 5FZRA 1AJ3A 5KDMC 4GZ5A 1E1HB 2BVLA 4BX9A 4JEUB 3R84B 3C51A 2L0IA 2X0LB 3D9NA 1ZHCA 1OWPA 2JMHA 3N9MA 4YNDA 3LS8A 3MEKA 2VL8A 1DVPA 3MGBA 4AY6A 2IQCA 2I6HA 3HVEB 4BJNA 4UQYA 3ZW3A 1HU3A 1H6KA 1HG5A 2A2FX 2XHEA 4AVXA 3FTZA 2XASB 4I50E 5DQVA 4FA6A 4CQIA 4L2YA 3SD5A 5AIJA 2K5BB 3KV4A 4IGUA 4XAXB 3J9X1 4BTAA 4CT0A 2PJQA 3UT8A 3KVAA 5BW8C 3MZKB 4QX7B 4I9EA 4H9OC 4U07A 1G8XA 3S7BA 5G55A 1U3DA 3UUXB 3N2KE 5EZYE 3PH0C 4MLPA 4APOA 3AA6B 5LHGB 2Y8DA 1UX5A 3NZUA 2JEKA 4IIJE 3CKCA 2EHOA 4IRUA 3CEQA 4WNKA 4MKTA 5G04J 3D9OA 4EBAA 3RYCE 3H37A 4V1Av 2RD0A 3HKDE 3KEZA 3RK6A 4BAYB 4CXXA 4RG6A 4UXNB 3EUHA 1IHGA 3Q5MA 3ZCIA 3CHOA 3C98A 3G2TA 2IU1A 4O4LE 4GYYA 4GYRA 4HE8A 2JPFA 2HH7A 2UWJG 4ZOLE 3ANWB 4EYYR 3HIZA 4ILHB 4G25A 3ZMZB 3HR0A 3K3QC 2QFCA 1HS6A 1BR1A 3RYHE 3I4RB 2E9XA 4XIFA 4UF0A 4PK5A 3NRXA 5AFUL 3D0TA 2LAHA 5BT1A 2HO1A 3ONKA 2J49A 5LP0A 2KMFA 3ZYKA 3WAJA 3SOLA 4PJMA 4IHJE 2Q9QA 4U72A 2NXPA 4V3IA 3GZ2A 2AW6A 3BEEA 3MYVA 4QKNA 2KC7A 3CX8B 5HQ8A 4UVBB 5J90A 4DJAA 1KNZA 4KBMB 3ENEA 3L13A 1A17A 3AVSA 3ZCJA 3GN5A 4H7YA 3RU0A 3D9IA 5JR9C 3U4TA 2X6IA 3FUIA 1INZA 2IOLA 4WWOA 3ESLA 1D1BA 3I9YA 3D9PA 2NW8A 3ETUA 2D0UA 4CRWA 1YKEB 4C91A 4N5CA 2L6JA 1LF8A 2FEZA 3CVWA 2DWKA 5D0QD 4XKCA 3LJ3A 1W3BA 3APCA 2K9AA 2VJ8A 3OXGA 3DPDA 4MFRA 4F6RC 3NF1A 4J8EA 3CHRA 3E08A 5FQ6A 2X9YA 4I55E 4CXYA 2X38A 2XQYA 1ELKA 2C5KT 2YNQA 4J8DA 1WM5A 3FUHA 2JLBA 5TAOA 4Z8XA 5FMNA 1XNFA 2VQ2A 2WXNA 4PAGA 4I1OB 2PFVA 3T5XA 5LGNB 5LP6E 4NUUA 5JQGE 2UY1B 1U3CA 2PM6A 4FJZA 4G2AA 3LY9A 3QDNA 1MMDA 3RC3A 4IULA 5KJNA 2XGOA 1UJKA 2NWBA 2X9XA 3S4UA 4J8SA 4F53A 4QHOA 4GOUA 4KXKB 2P58C 3U64A 4N2SA 3L09A 4H63H 5LHHB 2ZU6B 5T4YA 5DABA 3K3OA 3N9NA 4UI9K 4J8FA 2W00A 2ODVA 2Y3AA 3R7RA 2LO6A 4RVBA 3ZGQA 4PFPA 2J1DG 4HXIA 2K48A 4J2CA 4IN3B 3ZPOA 1X79A 4WWNA 1SA0E 1E8WA 2LHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZC A;  2V8S E;  1HF8 A;  1SZA A;  2QY7 A;  3D9P A;  3D9J A;  1HG5 A;  1EDU A;  2DIW A;  2MOW A;  5J08 A;  2DCP A;  3G2T A;  1JWF A;  1HG2 A;  1X5B A;  1XGW A;  5CMW A;  3ZYL A;  5LOZ A;  1ELK A;  4AVX A;  2KM4 A;  1MHQ A;  3ONK A;  1VDY A;  2LO6 A;  3D9K A;  3D9O A;  1JPL A;  2L0T B;  3RRU A;  1LF8 A;  1H0A A;  5LP0 A;  4Q94 A;  4JXT A;  1JUQ A;  3ZYK A;  1UJK A;  2L0I A;  3D9N A;  4Q96 A;  3D9I A;  3G2W A;  1HX8 A;  3CLJ A;  5CMY A;  2BF0 X;  3ONL A;  1JWG A;  3G2V A;  4NAC A;  1SZ9 A;  3G2S A;  1DVP A;  4FLB A;  3D9L A;  1PY1 A;  4FU3 A;  4GZD A;  3ZYM A;  1EYH A;  1HFA A;  1UJJ A;  4HFG A;  1INZ A;  3D9M A;  3G2U A;  3LDZ A;  3ZYQ A; 
#chains in the Genus database with same CATH topology
 4CDR A;  5LCW C;  2Q9Q C;  2DIW A;  2NYJ A;  2YDS A;  3JYS A;  5T3R A;  1HCI A;  3ZMV B;  4DR6 T;  2RKK A;  3G06 A;  4JLE A;  1HH8 A;  5L3F B;  1N9A A;  4A3V A;  2XZE A;  3QWV A;  4ANJ A;  2C2L A;  3PUG A;  3F2E A;  5LYJ E;  2VQE T;  2X0H A;  2WQ7 A;  2BG9 A;  3AEE A;  4PW8 A;  2CG2 A;  3P4W A;  2VSO E;  2WQY A;  2YU2 A;  2NP9 A;  3WG7 E;  1BR0 A;  2WXI A;  2C0L A;  4CI2 B;  3OJA A;  3EAM A;  4EB6 E;  3UUB A;  5CEC B;  2R02 A;  2VGY A;  5EDS A;  4CN1 A;  4HRM B;  4URK A;  4UWK A;  3E4B A;  4AV7 A;  3NRY A;  3FUD A;  4YTN A;  4AIF A;  3CML A;  3ML9 A;  3PDY A;  1ZP0 A;  1NA0 A;  4GA2 A;  3VRB A;  5CER B;  1PY1 A;  4PS3 A;  2XAJ B;  4AKR B;  2WXJ A;  2BVM A;  2IF4 A;  4DRX E;  4PJL A;  1SZA A;  3NBX X;  1UK5 A;  4EYU A;  4PH4 B;  3R7Q A;  3CVP A;  4GTQ A;  2H6G A;  4ILI A;  1HE8 A;  4CDM A;  3IHV A;  4P1N A;  3MAC A;  3PZ1 A;  4HQD A;  5JHB A;  3LJN A;  4YY3 T;  1H2T C;  3KEA A;  2ZLY A;  4JUY A;  3EU5 A;  3QAR A;  4BY6 A;  1A5E A;  4R7L A;  5L4H A;  4C9B B;  1O5M A;  4N3C A;  3VTX A;  3KBU A;  3MJW A;  4UWF A;  2H89 A;  3HG0 D;  4NXN T;  1WFD A;  4HFB A;  5LG4 A;  2NOX A;  4EIW A;  3AG3 E;  2OVB A;  2GW1 A;  4GTM A;  1KFY A;  4BWR A;  2GRL A;  3PE3 A;  2CXL A;  4NIQ A;  4GZ6 A;  2RPA A;  1J5E T;  3PEU B;  2RP4 A;  4HKA A;  3TL5 A;  1BI7 B;  4UI9 C;  5FY7 A;  4GMJ A;  1HO8 A;  2IJG X;  4TV8 E;  1GW6 A;  5ARF A;  4HVB A;  1HS7 A;  1OCR E;  2NC9 A;  2AWI A;  4DV6 T;  2IOS A;  1V9D A;  2BS3 A;  3Q5X A;  3AEA A;  4XI9 A;  4GZD A;  1U4Q A;  1WCR A;  2LSV A;  3NZP A;  3AG4 E;  3BQO A;  2XQ7 A;  5AQF B;  2GRN B;  4X1Y E;  2FJA A;  4DLQ A;  5LA6 E;  5JDM A;  4NRH B;  2YK0 A;  1QYM A;  4U7E B;  4Q25 A;  4FHK A;  3JCF A;  4K0U A;  2CEA A;  3QC9 A;  4MBQ A;  1N4S A;  1OUV A;  5C3J A;  3RKV A;  4F1S A;  1M7K A;  3RIA A;  3ZIM A;  3ULE G;  3L8R A;  2QYU A;  3PUA A;  3D3M A;  1IJ6 A;  4GKK T;  4ZZB A;  5BV0 A;  1H2V C;  2DZO A;  3WI3 A;  2H7O A;  2I0M A;  4KZC A;  2ION A;  1BI8 B;  3ZN3 A;  2EHO D;  1VDY A;  2WSS V;  5ARG A;  2XM2 A;  4ABN A;  3UTK A;  3JC6 C;  4DV5 T;  3PS6 A;  3HKE E;  3PU3 A;  1KK7 A;  2VB6 A;  3ZMU B;  4GA0 A;  2H7V C;  3TGO A;  2IC6 A;  3CHQ A;  4BTB A;  1ZOY A;  4X20 E;  1UCU A;  3ZST A;  2VSX E;  2R17 C;  3UMV A;  3ZYQ A;  2OOE A;  5IY5 E;  1US7 B;  3IF8 B;  4DID B;  1TN7 A;  3N2O A;  4ANX A;  4B8C B;  3CVQ A;  3W9F A;  2CRB A;  2KM4 A;  2XQ0 A;  3Q4A B;  5E76 A;  2L0T B;  4YHH T;  2IO2 C;  2KXP C;  5HKP A;  2WXH A;  1ELR A;  3Q78 A;  4PS7 A;  2CWO A;  4LFA T;  3FU5 A;  2WXP A;  4HS2 A;  4PJJ A;  3DST A;  2R2L A;  4IT4 A;  3PUV F;  4XBF B;  2V5Q C;  2KAT A;  5D2M C;  2DVW A;  3RIB A;  1HNX T;  2A5U A;  2WMN A;  3MKQ A;  4ZXL A;  4U2Y A;  2C0M A;  4H9P C;  2KIN B;  4DV1 T;  2LM2 A;  1E7U A;  3ZMT B;  2CFZ A;  2IY0 C;  4M7C A;  2VKO A;  2P9I G;  3QUJ A;  2VTB A;  3L54 A;  3RHW A;  3PZ4 A;  3C50 A;  5FL0 A;  3CIA A;  3KFW X;  5HEG A;  5BPP A;  1TEZ A;  4B3S T;  2L3L A;  3AU4 A;  3FFL A;  2Q9Q D;  4G1T A;  3NZQ A;  5AQV B;  2V6Y B;  4IYP A;  2A4Z A;  3G2U A;  2C5J A;  4HGA A;  2J4D A;  2D2S A;  3FZL B;  3L6A A;  4AIS A;  4FJY A;  4P09 A;  3UKU G;  5H6Q B;  2WDR A;  3IA3 A;  4U74 A;  4GTT A;  4BER A;  3AVR A;  3VHL A;  3FTY A;  3MA9 A;  4P29 A;  3Q7A A;  2Y0B G;  3FEY A;  2MHK A;  3SFZ A;  1OED A;  2VGX A;  3KAE A;  2V1D B;  2YHE A;  3L22 A;  4FU3 A;  2WCA A;  1TNB A;  4IDQ A;  2CLY C;  5D0O D;  3LDZ A;  2J62 A;  3N9P A;  3M65 A;  5LB7 B;  5HI7 A;  5AQ9 A;  3UU6 A;  5JJ7 A;  4YSZ A;  4GB9 A;  3ASD A;  4UI9 J;  3DP7 A;  3AAE B;  3UUN A;  2WQH A;  4BX8 A;  2H3R A;  5CB4 E;  4JXT A;  5CEA A;  3PDN A;  3ASO E;  1D0Z A;  3OKQ A;  3OYZ A;  3Q9D A;  2E2E A;  5CBO A;  3MV2 B;  2ZM2 A;  2LLY A;  4APF A;  2XEE A;  1KZO A;  3EHQ A;  1NZN A;  3PRE A;  4L0R A;  1XZY A;  3LK2 B;  1IQR A;  3JAD A;  3RPU A;  5BMV E;  1W0A A;  2K24 A;  1JCS A;  4CEM A;  1YQ4 A;  4RLY A;  5M4Y A;  5A7D B;  3GWH A;  2RA1 A;  1N95 A;  2VKH A;  4I43 A;  3APD A;  4QXH B;  5ETW A;  3O48 A;  4EZ4 A;  2HYZ A;  1MYO A;  4EZK A;  3K3N A;  3E37 A;  4DMV A;  1XNR T;  3ZXP A;  1O1S A;  4GIW A;  1S0P A;  3T8M A;  3F57 A;  3W9G A;  4DR7 T;  2OA5 A;  3V5U A;  4O2A E;  4EPZ A;  1UOH A;  2PBI A;  2XAG B;  5JR9 A;  3DBS A;  3EHZ A;  5FQ7 A;  4LF4 T;  1UUR A;  2XS8 A;  3IBE A;  3D9K A;  4YSY A;  4GYW A;  4OVV A;  5AJL A;  4RSY A;  5AQP B;  3EUV A;  3IEE A;  3ZHE A;  2LEH A;  1E8Z A;  3K1S A;  2HR2 A;  2B6C A;  4IE4 A;  4OAV B;  5LBQ B;  3TWX A;  2BKO A;  4IDZ A;  3U78 A;  4K5B A;  3ZN0 B;  3LG7 A;  4OFZ A;  1BR2 A;  3AXJ A;  4C0M A;  3MJX A;  4ASK A;  4XKB A;  2XHE B;  2F8Y A;  2WWV A;  4TRQ A;  1KT0 A;  1SQM A;  3B7R L;  3FU6 A;  2MYS A;  2QC9 A;  2JIW A;  2XS1 A;  1DNP A;  3N9O A;  3CST A;  5FJY A;  3TLS A;  2XQ9 A;  2X6J A;  3PV0 F;  4U0U A;  1KF6 A;  2JQH A;  2WXO A;  4WAF A;  4HFH A;  2I1K A;  4ADZ A;  1MX4 A;  4ZI7 E;  1K8K G;  5LFA A;  1AP7 A;  5AQJ B;  2IAK A;  3VR8 A;  3IHY A;  4CCA A;  1LRZ A;  3ZEF A;  2IML A;  3HA4 A;  4AKH A;  2X3M A;  3AAA C;  2X6H A;  2X6F A;  3FP3 A;  2KZT A;  3WXX A;  2X51 A;  3S7D A;  3O1I A;  4MLK A;  4YJ2 E;  4CDN A;  4Z90 A;  2N2N A;  4H63 V;  1D0Y A;  5KNH D;  2V6X A;  3ZJ2 A;  4JHR A;  3HL6 A;  3KV6 A;  1YMP A;  3FU0 A;  2G0U A;  4LMK A;  4QH1 A;  2W62 A;  4AKL A;  2HHH T;  4IE7 A;  3V5S A;  3AG1 E;  1Z8U A;  2Q7F A;  1W9R A;  5ENP D;  3RIU C;  5GON E;  5CMW A;  1YA0 A;  4AP2 A;  2MTQ A;  3CWZ B;  3IKO B;  3PE0 A;  4U7I A;  3TG4 A;  3A8Y C;  2I9C A;  2OVF A;  3AA1 B;  2YU1 A;  5JDG A;  1N33 T;  4DPR A;  4I6E A;  3URZ A;  2HM8 A;  5IYZ E;  3P4Q A;  2R59 A;  4GKJ T;  4AEZ C;  3DXK G;  5HWX A;  1SHZ C;  3LSV A;  3KIN B;  4TN7 B;  5FVK A;  2KBX A;  3PRZ A;  5ENT D;  2AXZ A;  3C98 B;  2XRY A;  4I6G A;  1TJF A;  3VKG A;  1OWA A;  3PNL B;  3KS2 A;  4Y6C A;  5EX3 A;  5AYW D;  3SFY A;  4N2Q A;  1MZC A;  1ZV4 X;  2XUE A;  4PUC A;  3X1D A;  2LSI A;  3PUW F;  3Q2M A;  4PNI A;  3EIQ C;  4PFO A;  3AS8 A;  4YFS A;  5G2N A;  3FTW A;  4TWD A;  2DI4 A;  5FXX A;  4CXW A;  1MMG A;  3TXM A;  2VVS A;  2F4V T;  1JWG A;  4O4H E;  2E9X B;  4U3C A;  1U5P A;  1ZU2 A;  2D5U A;  3PUR A;  5AEN A;  4L5G A;  2BKP A;  5HXS A;  3U3W A;  4UEM A;  3FH5 A;  3FUN A;  2LOP A;  3JUI A;  2WXL A;  4UQZ A;  4XI0 A;  2IHR 1;  2FJB A;  1Z0P A;  3LVQ E;  5F5W A;  2GGF A;  3C64 A;  2OEV A;  2J47 A;  2M63 A;  1HG2 A;  1XGW A;  3KSL A;  4HEA A;  4UUC A;  3V30 A;  3L9T A;  5ABH A;  3RH3 A;  4KVM A;  3VLF A;  4A63 B;  3CX6 B;  2WVI A;  3G2W A;  5ENQ D;  5JHA A;  2XQ8 A;  3I0Q A;  2WP9 A;  2VL0 A;  1SZ9 A;  4A1S A;  3ZT5 A;  5J1G A;  5LMN T;  1UN8 A;  2CFU A;  1KZP A;  2ACX A;  3NOG D;  2FJD A;  4WUY A;  4YVO A;  3K8P C;  2UUB T;  4TXR A;  4JI1 T;  2LHR A;  2P9L G;  3OAW A;  3AG2 E;  4E7S A;  3GMI A;  3BUA A;  3UQ4 A;  3B13 A;  4OHF A;  3TWS A;  2W67 A;  2H6I A;  2ZM6 T;  3AE9 A;  2VKD A;  3T8O A;  4EZJ A;  3T8K A;  4NAC A;  4OAU C;  2X68 A;  2A3D A;  4KX6 A;  3PE4 A;  1ZKE A;  3UU3 A;  1EYH A;  2DL1 A;  4QXB B;  1YW0 A;  3I9W A;  5BR8 T;  4YDO A;  4EZH A;  4K5A B;  1FEW A;  5L47 A;  4H9S E;  2WAU A;  2P9B A;  2BTD A;  3CPZ A;  4ZHQ E;  3ZT6 A;  5EYL A;  2N1G A;  3ZPJ A;  1FVH A;  3QB2 A;  3LK4 2;  3I3N A;  3KV5 A;  1I94 T;  4G2V A;  3UUM A;  3ULQ A;  4FLB A;  2XRZ A;  2LT3 A;  2WB5 A;  5A23 A;  4BES A;  1IBK T;  4JHJ A;  1J5W A;  1G73 A;  2WXF A;  3D9J A;  2I2O A;  2W4X A;  5FNV E;  1N4Q A;  3TJP A;  2M67 A;  2LOS A;  1ZB1 A;  2LSU A;  1YKH B;  3LXU X;  2NR4 A;  3NVO A;  3C3O A;  4HWD A;  5EK2 A;  4ATZ D;  5CA0 E;  2UUA T;  4I9C A;  3EHM A;  3EIJ A;  2X9H A;  2X6K A;  3C5R A;  2Y6X A;  4F1P A;  3TG5 A;  1H7C A;  2SPC A;  3RKG A;  4LF5 T;  1CHU A;  3P4P A;  3FDH A;  4LEU A;  4TUM A;  1N11 A;  5LBM A;  2CHW A;  2XEH A;  4DR1 T;  4FP7 A;  4RG9 A;  1Z6T A;  3FTX A;  1EPU A;  4FLH A;  2V5D A;  5L3D B;  1S35 A;  4X64 T;  2YN6 A;  3C3R A;  4CGV A;  1O1T A;  2J4B A;  4HLL A;  4EAH A;  1EF1 C;  3SHF A;  3FUE A;  2JRK A;  3CVN A;  5A6C A;  3H3A A;  2BED A;  2ODU A;  2BG9 E;  3LBX B;  2Y1L E;  3CVL A;  2DWG A;  3EDU A;  4OYS A;  3C4W A;  5LJN A;  4AQF C;  3AS5 A;  4ACL A;  4B8A A;  4AXH A;  2V0P A;  3NZS A;  2LAI A;  4ACK A;  5KJK A;  4HN9 A;  4YSX A;  3KDS E;  2WXR A;  4LFB T;  5AQ7 A;  4LNU D;  4QQI A;  1Y01 A;  4B6X A;  1OXJ A;  2XPZ A;  3OXL A;  1FMW A;  2KLQ A;  4K03 A;  1JNZ A;  2W66 A;  4YHJ A;  4KVO A;  3D9L A;  2D0T A;  1CUN A;  2VK9 A;  1UX4 A;  2CBI A;  4P0B A;  3LVR E;  3KD7 A;  4L2L A;  1WDY A;  4B0Z A;  2DNX A;  4LCT A;  3BQL A;  4GPK A;  2KZ7 B;  3VLE A;  4O6F A;  1MHQ A;  3GA8 A;  4ILG A;  2P2C P;  2EQX A;  2MOZ A;  1X81 A;  4JZY A;  3O9X A;  3UM1 A;  4JI3 T;  1TJC A;  3ML8 A;  1UUS A;  3TKL B;  1KLX A;  4XEI G;  2FBW A;  3E30 A;  4L1B A;  3QK0 A;  1RZ4 A;  2LNI A;  2N9D A;  3CKD A;  2Y4T A;  5ENR D;  4KHP T;  1N52 A;  1JCQ A;  3APF A;  3AEC A;  4FC8 A;  5HEU A;  1T72 A;  2ILR A;  2YQ8 A;  3H3M A;  2QA7 A;  5EN5 D;  2XAQ B;  4EV6 A;  4ILU A;  1T8B A;  4AI6 A;  1S94 A;  4MHC A;  2WXG A;  2HE0 A;  2V4L A;  5FZQ A;  1OXZ A;  1AWC B;  3ABV A;  1PC2 A;  4HFV A;  2W0G A;  5L2L A;  3ASH A;  3PNT B;  5J0Z A;  2GRQ B;  3CVR A;  4KMO A;  3AA0 B;  4HFD A;  4JPS A;  1UN9 A;  5ABG A;  3RGL A;  1IYG A;  3B7B A;  2V7K A;  4HFE A;  1SA4 A;  3UFE A;  3Q79 A;  5G05 C;  4HFC A;  3SS1 A;  3SZ7 A;  5AN8 A;  2EIM E;  4DVD A;  2WXM A;  4Q96 A;  3O4Z A;  5DIZ A;  3RYI E;  3ZUV B;  3Q47 B;  4I4T E;  5FXZ A;  3PU8 A;  1XDP A;  3G2S A;  4DO0 A;  2B76 A;  1IQU A;  4O4I E;  3EI0 A;  3DSW A;  4ZHB A;  2CHZ A;  4A56 A;  4GZC A;  1JCR A;  3MKD A;  1V55 E;  4EZL A;  3ABK E;  3HHM A;  2ACZ A;  4UEL A;  4QXC B;  2XQ3 A;  3UU4 A;  3SGH A;  4DX1 A;  2W61 A;  4YVQ C;  4Y6W A;  5T8I A;  4F7A A;  1MJ0 A;  3VU7 H;  3L3P A;  3TWQ A;  3FB2 A;  3PUS A;  4LMJ A;  1D8D A;  2QGS A;  2XAF B;  4J0U A;  5ANR A;  2LUH A;  2WZI A;  4F6R D;  4HFG A;  5JRC B;  5HS0 A;  4H9R C;  1QUU A;  5KJM A;  5M72 A;  1EDU A;  3MZL B;  4TNV A;  1B89 A;  3UT7 A;  2LSK A;  1SVX A;  2X9W A;  3HYM B;  3UPV A;  4ATG A;  4G23 A;  1W0B A;  4ANU A;  2MBG A;  5EIB E;  5J2T E;  3UIP C;  4GA1 A;  3FY4 A;  4YLH A;  3U9W A;  1G3N B;  2CHO A;  2ETA A;  4O8S A;  2DWZ A;  3JCK C;  5EID A;  4CI1 B;  4NUV A;  1UW4 B;  2PZI A;  2EIK E;  2ZM8 A;  2PQR A;  2V7L A;  4WNE A;  5H6R B;  1ELW A;  3LFM A;  3GYZ A;  3V2O A;  3N5L A;  5ITZ F;  4UV9 B;  4WNG A;  2L9Q A;  2V4H C;  2DLR A;  5LOV E;  4HRL A;  5LGT B;  5HXC A;  4YDY A;  4X1I E;  1QZ2 A;  4NUR A;  3ZVV A;  1LKX A;  4JI7 T;  4LRZ A;  1Z3X A;  4LG6 A;  4AM9 A;  4QX8 B;  3AEB A;  4JA9 A;  5HAX A;  3RO2 A;  3FUK A;  2JQQ A;  4F8H A;  2IIU A;  3UX4 A;  2JJ9 A;  5JH7 E;  4GTO A;  5ENN A;  4JEH A;  5AJD A;  2BKK B;  3RI5 A;  2XTL A;  2CPT A;  3ZLI A;  2CXD A;  1IKN D;  3ASF A;  2Y4U A;  2GRO B;  3QOF A;  3PZ3 A;  4F3V A;  3ZJ1 A;  4BEP A;  3KVB A;  3PJA J;  2P9P G;  3S2A A;  3CVU A;  4GCN A;  2A72 A;  1OED E;  5CMY A;  3X2Q E;  2ZXW E;  4TUU A;  4N3A A;  3O4X E;  2L8K A;  3LY8 A;  4E85 A;  2NW9 A;  2XAH B;  4L23 A;  3P8C D;  2DCF A;  1TNZ A;  4MRU A;  1VCT A;  3A7M A;  4U95 D;  5ADX L;  4A3T A;  4A5X A;  3RKO A;  4ANW A;  2UXN B;  3ZKJ A;  4X1K E;  2W63 A;  1BR4 A;  3OXF A;  3V79 K;  3SQV A;  5L3B B;  4GZ3 A;  4CT4 A;  2VTB B;  2HN1 A;  1MNE A;  5EYP F;  4XZC A;  2CHX A;  4KP3 C;  2YEV C;  1WR0 A;  4XE0 A;  1FT1 A;  3CQX C;  5LXT E;  1M62 A;  3RIU A;  2QYJ A;  1NP7 A;  4EBA G;  3Q5D A;  5AQR B;  2QRX A;  3ZMS B;  2NSZ A;  5AQA A;  2WXQ A;  3ONL C;  5KX5 E;  3AS4 A;  3B7S A;  2BS4 A;  3SRZ A;  3UU5 A;  4DX6 D;  2XGM A;  1WRD A;  4ILC A;  4G11 A;  5HEO A;  4WNF A;  3TLV A;  5G05 J;  3TWT A;  1HR0 T;  4IDP A;  5AQU B;  2XQ4 A;  3EU9 A;  5EKQ D;  4UQX A;  1OED B;  1TNU A;  2VGX B;  1DCQ A;  5AQK B;  4OK0 A;  4UWG A;  1IAP A;  2GRR B;  3LKU A;  4UR9 A;  5FT9 A;  3N9L A;  2IFU A;  4GU5 A;  3PEV B;  3BQI A;  1X9B A;  2FBN A;  3L39 A;  2IW5 B;  3FTU A;  5BUZ A;  1IXV A;  3DEP A;  3AU5 A;  4QH5 A;  4ILB A;  3L08 A;  3ZFW A;  3LK3 B;  3PUQ A;  3NB2 A;  5CA1 E;  4GK5 E;  4IE5 A;  2L6B A;  4JEU A;  1IBL T;  3HXE A;  1OT8 A;  3S7J A;  1NWM X;  3FBZ A;  1D1C A;  2CA5 A;  3P4R A;  5E75 A;  5DBK A;  5ABE A;  2VVN A;  4DR3 T;  1HFA A;  3L16 A;  5FXW A;  3HVE A;  4IE6 A;  1D9S A;  1V54 E;  3P1U A;  4GTR A;  2NTY A;  3O1J A;  1NEK A;  3RRW A;  5LMU T;  5KCM A;  3MX3 A;  2LRK A;  1K1A A;  2VSN A;  3HDX A;  2XQ6 A;  3PVL A;  4X5T A;  4HI9 A;  1OCO E;  5JJT A;  3GW4 A;  2XJ7 A;  2L9B A;  2AE9 A;  5AQI B;  4I43 B;  3HXF A;  4KT6 B;  2M6I A;  5LCY A;  3EAB A;  2BF0 X;  5JDF A;  4J7W A;  2I1J A;  2KCL A;  2RFM A;  3TLU A;  3DSS A;  3WAK A;  3RYF E;  3UUL A;  1TYQ G;  4D10 C;  2HPJ A;  2YIN A;  4TV9 E;  3E0Z A;  3C4X A;  2IUB A;  2K3W A;  5JR9 B;  3FXD B;  5CHE E;  4L7T A;  2WXK A;  4FHJ A;  1QQE A;  1E2A A;  3OPC A;  3ZYL A;  1N0R A;  3RRN B;  5AQM B;  5AQL B;  2H88 A;  4LF7 T;  4PS8 A;  3UXG A;  3RRU A;  4JHK A;  2BBH A;  4HTE A;  2LSG A;  1DU2 A;  4GPM A;  3BU8 A;  4I2Z A;  2X0Y A;  3UUX A;  5AAR A;  4AJW A;  3ZHE B;  4L9P A;  1Q2Z A;  3CHM A;  3LCA A;  4QFV A;  2XPY A;  5HXH A;  5EK4 A;  1D8E A;  4G26 A;  5HXR A;  2CMR A;  3ABM E;  4HBD A;  1GQE A;  5KMG P;  3RX6 A;  3FBL A;  3QJZ A;  1OCC E;  3HI2 A;  2PNN A;  2DCP A;  1T7S A;  2KWH A;  1X5B A;  2WPV A;  5EX0 A;  5LOZ A;  4DLO A;  4B3T T;  1WR6 A;  3TWU A;  2LM9 A;  4LF8 T;  4DUZ T;  5IHY A;  3JC6 D;  2GRM A;  3CVX A;  5L3E B;  2AVP A;  5AQG B;  5HXE A;  4HOQ A;  4IDN A;  4MBG A;  1NAF A;  3N9Q A;  3RQU A;  1L0V A;  4W9R A;  4NIK A;  3I4G A;  3TLT A;  5H7P A;  2EIL E;  2PG8 A;  4BJM A;  3OTN A;  1UJJ A;  5L4E A;  4WW0 A;  2EHO B;  3FUM A;  4ME2 A;  3ZEF B;  4IDO A;  1S70 B;  4GTV A;  2KZT B;  5AQH B;  3T5V A;  3ANW A;  2J08 A;  2FI7 A;  3TAX A;  3Q7F A;  4JI2 T;  4WBN E;  3TXN A;  3CKB A;  2XSB A;  4HOU A;  1XDO A;  2VQF T;  2H6F A;  1XMO T;  4AKG A;  2UXX B;  2V5F A;  4DND A;  4ZI3 C;  2VWA A;  3UIN C;  4HFI A;  3OBV E;  3OVU A;  4PK4 A;  1VRB A;  3ONX A;  4GCO A;  4AY5 A;  2XEN A;  1E8X A;  4MS6 A;  4OX9 T;  5FZS A;  4GYS A;  1ZBP A;  1N4R A;  3TWW A;  2CHN A;  3NWI A;  2YOE A;  2JAB A;  3CQC B;  1J1J A;  3CK8 A;  5BXO A;  2J4G A;  3F31 A;  1FMV A;  2QVA A;  4G63 A;  4WYV A;  4LUN U;  3GZS A;  4AQF A;  2KCV A;  3UIO C;  3KBT A;  4X66 T;  2MAW A;  2CM0 A;  4UF0 B;  2XCB A;  3EDT B;  5FIO A;  4JW1 A;  1E7V A;  2KCK A;  2FO1 E;  4I6J A;  4HWH A;  1OWL A;  2P9U G;  2CCQ A;  2ETC A;  3AA7 B;  5JDH A;  2DBA A;  2QYW A;  5LHI B;  4DV4 T;  4DX7 D;  3MA5 A;  4AQY T;  3BK9 A;  4BSZ B;  2CWY A;  2V8S V;  4FJO A;  1H0A A;  1JUQ A;  3W15 B;  1LVF A;  2Q9Q B;  3AEG A;  3CQG B;  5FXV A;  3L17 A;  3SI5 A;  4FI5 A;  5C2Y A;  3KSQ A;  1SUM B;  4KZ0 A;  1OWN A;  4HOS A;  4G8K A;  4B93 B;  1WLX A;  2NW7 A;  2ZMA A;  3FUL A;  4TXQ A;  1YCS B;  2FF4 A;  3PJA A;  3PUY F;  3Q5E A;  3FZM B;  1HX1 B;  2V26 A;  3QB5 K;  4C90 A;  3MK7 C;  2UUC T;  5A1L A;  3GN5 B;  2FJE A;  3CIR A;  4DBR A;  4A55 A;  4AKI A;  3DEO A;  5C2T A;  1MQS A;  4N39 A;  3HXD A;  3LPZ A;  4J6I A;  4IL9 A;  2IEJ A;  3ZC1 A;  2VAS A;  4QWN B;  3RC8 A;  4NPP A;  3BQK A;  4U2Z A;  3ESK A;  4B94 A;  3IEG A;  4K0R A;  3B7U X;  2LKH A;  1P5Q A;  3MCX A;  4DX5 D;  1N94 A;  4EEB A;  4CYM D;  5ABF B;  4EEC A;  3PZ2 A;  4Q94 A;  4IRE A;  4ILA A;  3LJC A;  3DTO A;  4DMW A;  1E96 B;  3V31 A;  2WM9 A;  4UWL A;  3ZN1 B;  3FXE B;  2MPK A;  3T1H T;  1QNF A;  2XPI A;  1WAO 1;  2E8I A;  3P2B A;  4EQF A;  4HI8 A;  1D1A A;  2AXU A;  4LSZ E;  3PUK A;  4U7Y A;  3Q73 A;  2DYS E;  2X67 A;  2OND A;  4XX5 A;  1FIO A;  2UY1 A;  2YDQ A;  2IDO B;  5LNK A;  3CVY A;  3FZH B;  4UIG A;  2YDR A;  4GTS A;  2EHO C;  3MKR A;  3I5P A;  3HXC A;  3P7I A;  4TUY E;  3B7T A;  5BNW A;  2P9K G;  4LNG A;  2WDV A;  3E22 E;  5CFB A;  3Q5W A;  5JRE A;  1WY6 A;  4DI4 A;  2JMK A;  4Q69 A;  1NEN A;  2QY7 A;  1T98 A;  3CX7 B;  4JYA T;  4UVC B;  3JAF A;  1BPO A;  5FQ8 A;  2ZIS A;  2KND A;  3SY2 A;  2R5S A;  4WND A;  4AXP A;  1FJG T;  1FVF A;  3NKZ A;  2ES0 A;  3FU3 A;  5C8Y E;  4P0A A;  3QWW A;  5L3G B;  4HOR A;  2R05 A;  3EDV A;  3DWL G;  3P50 A;  2UU9 T;  1OWO A;  5FQ4 A;  1OWM A;  2RG8 A;  3O1H A;  3LBX A;  4I17 A;  4O2B E;  3ONJ A;  4JI4 T;  4DR4 T;  2V7M A;  3S7F A;  1XWM A;  4JC8 A;  5F3J A;  1BU9 A;  4I1M A;  4BA9 A;  3JQ1 A;  2J07 A;  2LRL A;  2E9X C;  1H19 A;  5EK3 A;  2VUR A;  4IL4 A;  3UT5 E;  5BV1 A;  3ZC0 A;  1Z3Y A;  2UXC T;  3Q15 A;  1KEY A;  3ZSS A;  5JDN A;  1O3X A;  4CZ2 D;  4ZEY A;  2LJL A;  4TV3 A;  3R9A B;  2XEV A;  4YT0 A;  2OEW A;  2CXF A;  5L3C B;  4GAA A;  2VSY A;  3MV3 B;  4ISS A;  2J9Q A;  5J2U E;  5IUX A;  3C3Q A;  2DYR E;  2LSY A;  3ZYM A;  3RRM B;  2AJA A;  1E8Y A;  3RO3 A;  3JQ0 A;  1HF8 A;  3IBP A;  2MOW A;  5FY1 A;  4IE0 A;  4YDE A;  4ANV A;  2JQ9 A;  4O60 A;  1LVK A;  4U33 A;  3QK6 A;  2XSA A;  2XPK A;  2FO7 A;  2E0I A;  2LSJ A;  1L5J A;  3PTR B;  5HEH A;  4JV5 T;  3DXM G;  1VOM A;  4DV3 T;  4U0S A;  3SBT B;  4ZI3 D;  3LY7 A;  3AAI A;  2WBL A;  4ZI2 C;  5JDQ A;  4J8Y A;  1MMA A;  2WWU A;  5LG3 A;  5CCM A;  1HZ4 A;  2ETB A;  2WY2 A;  2R6G F;  2WMO A;  2P9S G;  4DBQ A;  3ZT7 A;  2MRI A;  5JJ6 A;  3ZNG A;  4TX5 A;  1H6P A;  3RF1 A;  2BG9 B;  3T9K A;  4U8Y D;  4RQI A;  2V8S E;  2KXP B;  3QAQ A;  3GZ1 A;  4OVU A;  1E90 A;  1JWF A;  5C1D A;  1IBM T;  5F8P A;  4CN4 A;  4GK0 E;  3UFG A;  1H2U A;  5CCL A;  4EOZ B;  4BET A;  3L82 A;  4JBW F;  5HWY A;  3CV0 A;  2BDE A;  1ZEE A;  5DJQ C;  5JVD E;  2XGS A;  4CGW A;  1QSD A;  3I1A A;  3FTS A;  3J7Y q;  2LXM A;  2Y69 E;  1KT1 A;  2AXV A;  2V7I A;  1N34 T;  4DK5 A;  1N4P A;  4EGW A;  3DJB A;  4A98 A;  1TNY A;  3AE5 A;  3OTO T;  1N36 T;  4OYJ A;  5B3S E;  3QOU A;  3EVY A;  4GML A;  3UM2 A;  3DSU A;  4PDX A;  2C5I T;  3CGH A;  2NTX A;  3KV9 A;  1LTX A;  2XZD G;  4L9I A;  1I6Z A;  4M3O A;  3V2X A;  2ZM0 A;  3ONL A;  3AE8 A;  3G2V A;  3AB3 B;  3EJN A;  4WWP A;  5EIL A;  4BFR A;  3AE7 A;  1N0Q A;  3ETV A;  4MAL A;  4UVA B;  4FAD A;  5LGU B;  3UT4 A;  5KJL A;  2VKJ A;  1S64 A;  4N3B A;  5FIN A;  1PAQ A;  3E33 A;  3I0O A;  3RIF A;  2IO3 C;  1TN8 A;  3QC1 A;  1O1R A;  1EZ3 A;  2LE8 A;  2Y48 B;  4JI8 T;  2XQ5 A;  4M1P A;  2CLY B;  2YKS A;  2BKN A;  2WZH A;  2Z6E A;  4WBO A;  1W09 A;  3CLJ A;  1VCS A;  3UU8 A;  4LML A;  5HYA A;  5FP3 A;  1YYH A;  3SFX A;  3J5P A;  1WYC A;  4UV8 B;  5HRY A;  5JRC A;  4ZS3 A;  2IC9 A;  2BUG A;  2WDQ A;  4WZX A;  3BG1 B;  3NOC D;  4PK6 A;  1MX6 A;  5JA4 D;  1Y64 B;  3ZXS A;  3FUF A;  2DHR A;  3OYX A;  4Z91 A;  4ZS2 A;  3TWV A;  3SNX A;  4KBQ A;  3QKY A;  4G24 A;  4I1A A;  5ENO D;  4LF6 T;  2OCC E;  4U0Z A;  4HWF A;  3CSF A;  3AE1 A;  5ANL A;  4EXT A;  1R8I A;  1IZN B;  3HKC E;  5J08 A;  4LER A;  4TXP A;  4YJ3 E;  2E5L T;  3TLW A;  4X62 T;  4ZZC A;  3AE4 A;  3U3I A;  4CN6 A;  4HOT A;  3CK9 A;  1S63 A;  3SBS A;  2E2A A;  3CHP A;  2P9N G;  4CI3 B;  5CBN A;  5CGM A;  5FL1 A;  1MIY A;  3AE3 A;  3BG0 B;  3IHR A;  4E6H A;  3EHN A;  4O4J E;  4JI0 T;  3ASG A;  3IV0 A;  1MIW A;  4X65 T;  4H9Q C;  2E5V A;  3NAW A;  3MXZ A;  1MMN A;  1XNQ T;  2OV8 A;  4G8L A;  5LCW J;  3FH8 A;  3RRC A;  2BBJ A;  4DX2 A;  4KMC A;  4UWH A;  1B7T A;  4DUI A;  3CK6 A;  2X66 A;  4HLE A;  2V7J A;  3A5X A;  3Q9N C;  2BG9 C;  2KWI B;  2JQK A;  1YD8 G;  1NA3 A;  1KNR A;  4BT8 A;  1Y6I A;  2YHC A;  4O1O A;  4BSX A;  1TR4 A;  2C0S A;  5FY0 A;  4B89 A;  3R9M A;  1NI1 A;  4GYO A;  3N71 A;  3FZK B;  1HX8 A;  4E7Z A;  4U8V D;  1WG0 A;  3CR3 A;  2PL2 A;  5FYM A;  2BZB A;  4U8H A;  4TWH A;  1IJ5 A;  3AEF A;  4KUM B;  4PJN A;  4JEH B;  2E9X D;  2V6Y A;  5JTG A;  3Q49 B;  4H9N C;  3R6N A;  2WB2 A;  3MKQ B;  3PUJ A;  5AQO B;  4H7X A;  4A97 A;  5LJM A;  3M3Z B;  1YXR A;  5KXJ A;  5G04 C;  2CE7 A;  1FCH A;  4AOF A;  4BT9 A;  3NQP A;  5KNG A;  2UXB T;  2KT9 A;  1WYB A;  4N78 D;  3IXE A;  3K9I A;  4Z68 A;  2HPL A;  5LX8 A;  2PM7 A;  1MIV A;  3SF4 A;  4I2W A;  3SWH A;  2B1E A;  3DPY A;  3FTV A;  4KYO B;  3AAA B;  2XZT G;  4DI3 A;  2AXD S;  1K1B A;  1LD8 A;  4JL0 A;  2CG3 A;  4DV7 T;  1Y8M A;  2I59 A;  4C0E A;  4IST A;  4ERR A;  3CVV A;  2XM1 A;  4JVS A;  1N54 A;  3HKB E;  1SE7 A;  2VYI A;  1HXI A;  4XZ4 A;  3CK7 A;  3JUE A;  2J8S D;  3LYA A;  3U66 A;  2FUP A;  4JA7 A;  4ZI2 D;  1XMQ T;  3J5Q B;  5DQW A;  3T1Y T;  4TNW A;  2ZGG A;  2V5C A;  3QNK A;  3VRA A;  1UG3 A;  2PQN A;  4TWF A;  3FH7 A;  3N2G E;  4A1G A;  3D9M A;  4DUY T;  4AQG A;  2J09 A;  3FHE A;  2UXD T;  5JDL A;  5AQS B;  3DSV A;  3C4Z A;  2FUL A;  4U63 A;  3FHN A;  4U04 A;  5E0O A;  3FEX A;  3B95 A;  2XCC A;  4OYK A;  3VLD A;  1KNP A;  1JPL A;  4FUL A;  2WQ6 A;  3VKH A;  3VTY A;  4TZ4 C;  3CHS A;  3B57 A;  1D0X A;  4NQ0 A;  2EIN E;  2GK9 A;  3FWV A;  3QWP A;  5AQT B;  4CZZ B;  3RAU A;  5FTP A;  5FWQ A;  2F0Y A;  3FUJ A;  3ZRH A;  5KBA A;  3PZD A;  1MND A;  3RLF F;  3UQ3 A;  3LEW A;  2M6B A;  3RJV A;  5BXU A;  1HTJ F;  5AQB A;  2WS3 A;  5FZR A;  1AJ3 A;  3VR9 A;  1HNW T;  5KDM C;  4GZ5 A;  1E1H B;  2BVL A;  2DZN A;  4BX9 A;  4JB8 P;  2CBJ A;  4JEU B;  3R84 B;  2B0O E;  3C51 A;  4LF9 T;  2L0I A;  2X0L B;  3D9N A;  1ZHC A;  1OWP A;  2JMH A;  5AQQ B;  3DRA A;  4JD2 G;  3N9M A;  4YND A;  3LS8 A;  2W2U A;  3MEK A;  2VL8 A;  1DVP A;  3MGB A;  4AY6 A;  2IQC A;  2I6H A;  1H6O A;  3HVE B;  4BJN A;  3AED A;  4UQY A;  4HWC A;  3ZW3 A;  1HU3 A;  3FZF B;  1H6K A;  1HG5 A;  2A2F X;  2MYO A;  2XHE A;  3Q75 A;  4AVX A;  4LFC T;  4QH4 A;  5B1B E;  3FTZ A;  3UM3 A;  2XAS B;  5HEJ A;  4I50 E;  5DQV A;  3JAE A;  4FA6 A;  4CQI A;  2RFA A;  4L2Y A;  3B5M A;  1LD7 A;  3E34 A;  1DC2 A;  3SD5 A;  5AIJ A;  2K5B B;  2WU5 A;  3KV4 A;  4IGU A;  4XAX B;  3J9X 1;  4B3M T;  4BTA A;  4C48 B;  4CT0 A;  1NL4 A;  2PJQ A;  3UT8 A;  3KVA A;  3AXJ B;  5BW8 C;  5B1A E;  3MZK B;  4QX7 B;  1K3Z D;  4I9E A;  4H9O C;  4U07 A;  1G8X A;  4GTP A;  3S7B A;  4DR5 T;  5G55 A;  4DR2 T;  1U3D A;  3HXB A;  3UUX B;  3N2K E;  5EZY E;  3PH0 C;  4MLP A;  4DV2 T;  4APO A;  1QBQ A;  3AA6 B;  4YTM A;  5LHG B;  2Y8D A;  1UX5 A;  3NZU A;  2JEK A;  4IIJ E;  3HRA A;  3CKC A;  2EHO A;  1KPS B;  1Z5S C;  3D9H A;  5FKY A;  4IRU A;  3CEQ A;  4WNK A;  4MKT A;  2OLT A;  3AE2 A;  5G04 J;  3P4S A;  3D9O A;  4EBA A;  3RYC E;  1YQ3 A;  3H37 A;  5D66 A;  3UM0 A;  4V1A v;  1QLB A;  2EIJ E;  2ZIR A;  2RD0 A;  3HKD E;  3KEZ A;  3RK6 A;  4BAY B;  4CXX A;  4RG6 A;  3EHR A;  4UXN B;  1IHB A;  3EUH A;  1IHG A;  3Q5M A;  4I0U A;  3ZCI A;  1OED C;  5JMN D;  3CHO A;  3C98 A;  3G2T A;  2IU1 A;  4O4L E;  4GYY A;  4GYR A;  4KI0 F;  4HE8 A;  2JPF A;  2HH7 A;  2H6H A;  4ZOL E;  2UWJ G;  3ANW B;  4EED A;  4EYY R;  3HIZ A;  4ILH B;  4G25 A;  3ZMZ B;  3HR0 A;  3K3Q C;  2QFC A;  1HS6 A;  2D9D A;  1BR1 A;  3RYH E;  3I4R B;  2E9X A;  3ZKR A;  4XIF A;  3SFD A;  4YDW A;  4UF0 A;  3ULY A;  4PK5 A;  3NRX A;  2F8X K;  5CRU A;  5AFU L;  3D0T A;  2LAH A;  4DV0 T;  5BT1 A;  2HN2 A;  5HCJ A;  3QB5 A;  4HWI B;  2HO1 A;  4K5C A;  3ONK A;  2J49 A;  3TWR A;  5LP0 A;  2KMF A;  3ZYK A;  3WAJ A;  3SOL A;  5ENS D;  4PJM A;  4IHJ E;  2Q9Q A;  4U72 A;  2NXP A;  4V3I A;  3UKR G;  3GZ2 A;  2AW6 A;  1UGO A;  4LNB A;  1HNZ T;  2ZGD A;  3PUZ F;  3BEE A;  3MYV A;  4HNA D;  4QKN A;  2KC7 A;  3CX8 B;  5HQ8 A;  4UVB B;  4EHM A;  2GRP B;  5J90 A;  4DJA A;  1KNZ A;  2QZA A;  4KHZ F;  3AE6 A;  4KBM B;  4B3R T;  3ENE A;  3AJI A;  3L13 A;  1A17 A;  3AVS A;  3RSE G;  3ZCJ A;  3GN5 A;  3Q9U C;  4H7Y A;  1BD8 A;  3DSX A;  3RU0 A;  3D9I A;  5JR9 C;  3U4T A;  1FPP A;  1MX2 A;  2X6I A;  3ZU7 B;  2XY8 B;  3FUI A;  3ISM C;  4ZFH A;  2LKG A;  3SO8 A;  2XQA A;  2IOL A;  4WWO A;  1INZ A;  3ESL A;  1D1B A;  3E32 A;  3I9Y A;  1U2V G;  5CRV A;  3UTM A;  3D9P A;  2NW8 A;  5FVL A;  4JI6 T;  3ETU A;  4AIU A;  2D0U A;  4X8Q A;  4CRW A;  1YKE B;  4C91 A;  1OY3 D;  4N5C A;  3JXI A;  2L6J A;  5ABF A;  1LF8 A;  2F37 A;  2A5E A;  2FEZ A;  3CVW A;  2DWK A;  5D0Q D;  3F6Q A;  1SW6 A;  2PTF A;  4GMR A;  4XKC A;  3LJ3 A;  1W3B A;  4HB5 A;  4COF A;  3APC A;  2K9A A;  2VJ8 A;  3OXG A;  1NFI E;  4MFR A;  3DPD A;  4F6R C;  3ABL E;  2LXL A;  3NF1 A;  4J8E A;  1OCZ E;  3CHR A;  3E08 A;  5FQ6 A;  2X9Y A;  4I55 E;  4CXY A;  2X38 A;  2XQY A;  1ELK A;  4U31 A;  2C5K T;  2YNQ A;  4HRN A;  4J8D A;  2VGE A;  1WM5 A;  3FUH A;  2JLB A;  5TAO A;  4Z8X A;  5FMN A;  1XNF A;  2VQ2 A;  2WXN A;  5CED B;  4NXM T;  4PAG A;  3SFE A;  4I1O B;  1TN6 A;  2PFV A;  4O1P A;  3T5X A;  5KWD A;  5LGN B;  4JI5 T;  1E7P A;  3ASN E;  5LP6 E;  4NUU A;  2A9U A;  5JQG E;  2UY1 B;  1U3C A;  2PM6 A;  4FJZ A;  3JXJ A;  4G2A A;  3LY9 A;  5AAO A;  3QDN A;  1MMD A;  3RC3 A;  4IUL A;  5KJN A;  1DCE A;  1N32 T;  2XGO A;  3LDQ B;  2R03 A;  1JNR A;  1UJK A;  2WU2 A;  2NWB A;  2X9X A;  3S4U A;  3NBN B;  4J8S A;  4F53 A;  4QHO A;  4GOU A;  4KXK B;  2P58 C;  3U64 A;  4N2S A;  1SA5 A;  3L09 A;  4H63 H;  3PUX F;  3QNU A;  5LHH B;  1FT2 A;  2ZU6 B;  5T4Y A;  5DAB A;  3K3O A;  4K0K T;  1TNO A;  5AQN B;  3N9N A;  4UI9 K;  3RQW A;  2W00 A;  2ODV A;  5IWA T;  2Y3A A;  4J8F A;  4U96 D;  2BKG A;  2KSR A;  2BS2 A;  1RW2 A;  2LO6 A;  4N5Q A;  3R7R A;  4RVB A;  4YTP A;  4PFP A;  3UQ7 A;  2J1D G;  3ZGQ A;  3C72 A;  3UI2 A;  5CJ5 A;  5HCM A;  4HXI A;  1BLX B;  2K48 A;  4J2C A;  2OV9 A;  4IN3 B;  3ZPO A;  4YXD A;  1X79 A;  4WWN A;  1SA0 E;  1E8W A;  2LHN A; 
#chains in the Genus database with same CATH homology
 4CDR A;  5LCW C;  2Q9Q C;  2DIW A;  3JYS A;  5T3R A;  1HCI A;  3ZMV B;  4JLE A;  1HH8 A;  5L3F B;  4A3V A;  3QWV A;  4ANJ A;  2C2L A;  3PUG A;  3F2E A;  5LYJ E;  2WQ7 A;  4PW8 A;  2CG2 A;  2VSO E;  2YU2 A;  2NP9 A;  1BR0 A;  2WXI A;  2C0L A;  4CI2 B;  3OJA A;  4EB6 E;  2VGY A;  5EDS A;  4URK A;  4UWK A;  3E4B A;  4AV7 A;  3NRY A;  3FUD A;  4AIF A;  3CML A;  3ML9 A;  3PDY A;  1NA0 A;  4GA2 A;  1PY1 A;  4PS3 A;  2XAJ B;  4AKR B;  2WXJ A;  2BVM A;  2IF4 A;  4PJL A;  1SZA A;  3NBX X;  4EYU A;  4PH4 B;  3R7Q A;  3CVP A;  4ILI A;  1HE8 A;  4CDM A;  3IHV A;  3MAC A;  5JHB A;  1H2T C;  2ZLY A;  4JUY A;  3QAR A;  4BY6 A;  4R7L A;  4C9B B;  4N3C A;  3VTX A;  3KBU A;  3MJW A;  4UWF A;  5LG4 A;  2NOX A;  4EIW A;  2OVB A;  2GW1 A;  4BWR A;  2GRL A;  3PE3 A;  2CXL A;  4GZ6 A;  3PEU B;  2RP4 A;  4HKA A;  3TL5 A;  4UI9 C;  5FY7 A;  4GMJ A;  1HO8 A;  2IJG X;  4TV8 E;  1GW6 A;  5ARF A;  4HVB A;  1HS7 A;  2NC9 A;  2AWI A;  2IOS A;  1V9D A;  3Q5X A;  4XI9 A;  4GZD A;  1U4Q A;  2LSV A;  3NZP A;  4X1Y E;  4DLQ A;  5LA6 E;  5JDM A;  4NRH B;  2YK0 A;  4FHK A;  4K0U A;  2CEA A;  3QC9 A;  4MBQ A;  1OUV A;  3RKV A;  4F1S A;  3ZIM A;  3PUA A;  3D3M A;  1IJ6 A;  5BV0 A;  1H2V C;  3WI3 A;  2H7O A;  4KZC A;  2ION A;  3ZN3 A;  2EHO D;  1VDY A;  2WSS V;  5ARG A;  4ABN A;  3UTK A;  3JC6 C;  3PS6 A;  3HKE E;  3PU3 A;  1KK7 A;  2VB6 A;  3ZMU B;  4GA0 A;  2H7V C;  3TGO A;  2IC6 A;  3CHQ A;  4BTB A;  2VSX E;  4X20 E;  1UCU A;  3UMV A;  2R17 C;  3ZYQ A;  2OOE A;  1US7 B;  3IF8 B;  3N2O A;  4ANX A;  4B8C B;  3CVQ A;  2KM4 A;  2XQ0 A;  3Q4A B;  5E76 A;  2L0T B;  2WXH A;  1ELR A;  4PS7 A;  2CWO A;  3FU5 A;  2WXP A;  4HS2 A;  4PJJ A;  4XBF B;  2KAT A;  3RIB A;  2A5U A;  2WMN A;  3MKQ A;  2C0M A;  4H9P C;  2KIN B;  1E7U A;  3ZMT B;  2CFZ A;  2VKO A;  3QUJ A;  2VTB A;  3L54 A;  3C50 A;  3CIA A;  3KFW X;  5BPP A;  1TEZ A;  2L3L A;  3AU4 A;  3FFL A;  2Q9Q D;  4G1T A;  3NZQ A;  4IYP A;  2A4Z A;  3G2U A;  2C5J A;  4HGA A;  2J4D A;  2D2S A;  3L6A A;  4FJY A;  4P09 A;  5H6Q B;  4U74 A;  3AVR A;  3VHL A;  3FTY A;  3MA9 A;  4P29 A;  3FEY A;  2MHK A;  3SFZ A;  2VGX A;  3KAE A;  2V1D B;  2YHE A;  3L22 A;  4FU3 A;  2CLY C;  5D0O D;  3LDZ A;  3N9P A;  3M65 A;  5HI7 A;  5JJ7 A;  4GB9 A;  3ASD A;  4UI9 J;  3DP7 A;  3AAE B;  3UUN A;  2WQH A;  4BX8 A;  2H3R A;  5CB4 E;  4JXT A;  3PDN A;  1D0Z A;  3OKQ A;  3OYZ A;  3Q9D A;  2E2E A;  3MV2 B;  2ZM2 A;  4APF A;  1NZN A;  3PRE A;  4L0R A;  3LK2 B;  1IQR A;  3RPU A;  5BMV E;  2K24 A;  4CEM A;  5M4Y A;  5A7D B;  3GWH A;  2RA1 A;  4I43 A;  2VKH A;  3APD A;  4QXH B;  5ETW A;  3O48 A;  4EZ4 A;  2HYZ A;  4EZK A;  3K3N A;  4DMV A;  4GIW A;  1S0P A;  3T8M A;  3F57 A;  2OA5 A;  3V5U A;  4O2A E;  4EPZ A;  2PBI A;  2XAG B;  5JR9 A;  3DBS A;  5FQ7 A;  3IBE A;  3D9K A;  4GYW A;  4OVV A;  5AJL A;  4RSY A;  3IEE A;  3ZHE A;  2LEH A;  1E8Z A;  2HR2 A;  4IE4 A;  5LBQ B;  4IDZ A;  3U78 A;  3ZN0 B;  3LG7 A;  4OFZ A;  1BR2 A;  4C0M A;  3MJX A;  4ASK A;  4XKB A;  2XHE B;  4TRQ A;  1KT0 A;  1SQM A;  3B7R L;  3FU6 A;  2MYS A;  1DNP A;  3N9O A;  3CST A;  5FJY A;  2X6J A;  4U0U A;  2WXO A;  4WAF A;  2I1K A;  4ADZ A;  4ZI7 E;  5LFA A;  2IAK A;  3IHY A;  4CCA A;  1LRZ A;  3ZEF A;  3HA4 A;  4AKH A;  2X3M A;  2X6H A;  2X6F A;  3FP3 A;  2KZT A;  3WXX A;  2X51 A;  3S7D A;  3O1I A;  4MLK A;  4YJ2 E;  4CDN A;  2N2N A;  4H63 V;  1D0Y A;  3ZJ2 A;  4JHR A;  3HL6 A;  3KV6 A;  3FU0 A;  2G0U A;  4AKL A;  2W62 A;  4IE7 A;  3V5S A;  2Q7F A;  5GON E;  5CMW A;  1YA0 A;  4AP2 A;  2MTQ A;  3CWZ B;  3IKO B;  3PE0 A;  3TG4 A;  2I9C A;  2OVF A;  3AA1 B;  2YU1 A;  5JDG A;  4DPR A;  4I6E A;  3URZ A;  2HM8 A;  5IYZ E;  2R59 A;  4AEZ C;  5HWX A;  1SHZ C;  3KIN B;  4TN7 B;  3PRZ A;  2AXZ A;  3C98 B;  2XRY A;  4I6G A;  1TJF A;  3VKG A;  1OWA A;  3PNL B;  3KS2 A;  4Y6C A;  5EX3 A;  5AYW D;  4N2Q A;  1ZV4 X;  2XUE A;  4PUC A;  2LSI A;  3Q2M A;  4PNI A;  3EIQ C;  4PFO A;  3AS8 A;  4YFS A;  5G2N A;  3FTW A;  2DI4 A;  5FXX A;  4CXW A;  1MMG A;  3TXM A;  1JWG A;  4O4H E;  2E9X B;  1U5P A;  1ZU2 A;  2D5U A;  3PUR A;  5AEN A;  4L5G A;  5HXS A;  3U3W A;  4UEM A;  3FH5 A;  3FUN A;  2LOP A;  3JUI A;  2WXL A;  4UQZ A;  4XI0 A;  3LVQ E;  1Z0P A;  2GGF A;  3C64 A;  2M63 A;  1HG2 A;  1XGW A;  4HEA A;  3RH3 A;  4KVM A;  3VLF A;  3CX6 B;  2WVI A;  3G2W A;  5JHA A;  3I0Q A;  1SZ9 A;  4A1S A;  5J1G A;  1UN8 A;  2CFU A;  2ACX A;  4WUY A;  4YVO A;  3K8P C;  2LHR A;  3OAW A;  4E7S A;  3GMI A;  3B13 A;  4OHF A;  2VKD A;  3T8O A;  4EZJ A;  4NAC A;  2X68 A;  2A3D A;  3PE4 A;  1ZKE A;  1EYH A;  4QXB B;  1YW0 A;  3I9W A;  4EZH A;  1FEW A;  4H9S E;  2WAU A;  2P9B A;  2BTD A;  3CPZ A;  4ZHQ E;  2N1G A;  3ZPJ A;  1FVH A;  3QB2 A;  3LK4 2;  3I3N A;  3KV5 A;  4G2V A;  3UUM A;  3ULQ A;  4FLB A;  2XRZ A;  2LT3 A;  5A23 A;  4JHJ A;  1G73 A;  2WXF A;  3D9J A;  2I2O A;  5FNV E;  3TJP A;  2M67 A;  2LOS A;  2LSU A;  1YKH B;  3LXU X;  5EK2 A;  5CA0 E;  4I9C A;  3EHM A;  3EIJ A;  2X9H A;  2X6K A;  2Y6X A;  3TG5 A;  1H7C A;  2SPC A;  3FDH A;  4LEU A;  5LBM A;  2CHW A;  4FP7 A;  4RG9 A;  1Z6T A;  3FTX A;  1EPU A;  4FLH A;  5L3D B;  1S35 A;  4CGV A;  2J4B A;  4EAH A;  1EF1 C;  3SHF A;  3FUE A;  2JRK A;  3CVN A;  5A6C A;  3H3A A;  2ODU A;  3LBX B;  3CVL A;  2DWG A;  3EDU A;  4OYS A;  3C4W A;  5LJN A;  4AQF C;  3AS5 A;  4ACL A;  4B8A A;  4AXH A;  2V0P A;  3NZS A;  2LAI A;  4ACK A;  5KJK A;  4HN9 A;  3KDS E;  2WXR A;  4B6X A;  2XPZ A;  3OXL A;  1FMW A;  2KLQ A;  4K03 A;  4KVO A;  4YHJ A;  3D9L A;  2D0T A;  1CUN A;  2VK9 A;  1UX4 A;  4P0B A;  3LVR E;  3KD7 A;  4L2L A;  4B0Z A;  2DNX A;  4LCT A;  3BQL A;  4GPK A;  2KZ7 B;  3VLE A;  4O6F A;  1MHQ A;  3GA8 A;  4ILG A;  2EQX A;  2MOZ A;  4JZY A;  3O9X A;  1TJC A;  3ML8 A;  3TKL B;  1KLX A;  4L1B A;  3QK0 A;  2LNI A;  2N9D A;  3CKD A;  2Y4T A;  1N52 A;  3APF A;  4FC8 A;  2ILR A;  2YQ8 A;  2QA7 A;  2XAQ B;  4ILU A;  4AI6 A;  1S94 A;  4MHC A;  2WXG A;  2V4L A;  5FZQ A;  1OXZ A;  1PC2 A;  4HFV A;  2W0G A;  5L2L A;  3ASH A;  3PNT B;  3CVR A;  4KMO A;  3AA0 B;  4JPS A;  1UN9 A;  1IYG A;  2V7K A;  3UFE A;  5G05 C;  3SS1 A;  3SZ7 A;  4DVD A;  2WXM A;  4Q96 A;  3O4Z A;  5DIZ A;  3RYI E;  3Q47 B;  4I4T E;  5FXZ A;  3PU8 A;  3G2S A;  4DO0 A;  1IQU A;  4O4I E;  2CHZ A;  4A56 A;  4GZC A;  3MKD A;  4EZL A;  3HHM A;  4UEL A;  4QXC B;  3SGH A;  2W61 A;  4YVQ C;  4Y6W A;  5T8I A;  4F7A A;  3VU7 H;  3L3P A;  3FB2 A;  3PUS A;  2QGS A;  2XAF B;  4J0U A;  5ANR A;  4HFG A;  5JRC B;  4H9R C;  1QUU A;  5KJM A;  5M72 A;  1EDU A;  3MZL B;  1B89 A;  3UT7 A;  2LSK A;  2X9W A;  3HYM B;  3UPV A;  4ATG A;  4G23 A;  4ANU A;  2MBG A;  5J2T E;  4GA1 A;  3FY4 A;  4YLH A;  3U9W A;  4O8S A;  3JCK C;  4CI1 B;  4NUV A;  2PZI A;  1UW4 B;  2ZM8 A;  2PQR A;  2V7L A;  4WNE A;  5H6R B;  1ELW A;  3LFM A;  3GYZ A;  3N5L A;  4UV9 B;  4WNG A;  2L9Q A;  2DLR A;  5LOV E;  5LGT B;  5HXC A;  4X1I E;  1QZ2 A;  4NUR A;  3ZVV A;  1LKX A;  4LRZ A;  1Z3X A;  4AM9 A;  4QX8 B;  4JA9 A;  5HAX A;  3RO2 A;  3FUK A;  2JQQ A;  3UX4 A;  2JJ9 A;  5JH7 E;  5ENN A;  4JEH A;  5AJD A;  2XTL A;  3ZLI A;  2CXD A;  3ASF A;  2Y4U A;  4F3V A;  3ZJ1 A;  3KVB A;  3S2A A;  3CVU A;  4GCN A;  2A72 A;  5CMY A;  4TUU A;  4N3A A;  3O4X E;  2L8K A;  3LY8 A;  4E85 A;  2NW9 A;  2XAH B;  4L23 A;  3P8C D;  2DCF A;  4MRU A;  5ADX L;  4A3T A;  4ANW A;  3RKO A;  2UXN B;  4X1K E;  2W63 A;  1BR4 A;  3OXF A;  4CT4 A;  5L3B B;  4GZ3 A;  2VTB B;  1MNE A;  4XZC A;  2CHX A;  4KP3 C;  2YEV C;  4XE0 A;  3CQX C;  5LXT E;  1NP7 A;  4EBA G;  3ZMS B;  2NSZ A;  2WXQ A;  5KX5 E;  3AS4 A;  3B7S A;  3SRZ A;  2XGM A;  1WRD A;  4G11 A;  4WNF A;  5G05 J;  5EKQ D;  4UQX A;  2VGX B;  4OK0 A;  4UWG A;  1IAP A;  3LKU A;  5FT9 A;  3N9L A;  2IFU A;  4GU5 A;  3PEV B;  3BQI A;  2FBN A;  2IW5 B;  3FTU A;  5BUZ A;  3AU5 A;  3L08 A;  3ZFW A;  3LK3 B;  3PUQ A;  5CA1 E;  4GK5 E;  4IE5 A;  4JEU A;  3S7J A;  1NWM X;  3FBZ A;  1D1C A;  2CA5 A;  5E75 A;  5DBK A;  1HFA A;  3L16 A;  5FXW A;  3HVE A;  4IE6 A;  3P1U A;  2NTY A;  3O1J A;  3RRW A;  5KCM A;  3MX3 A;  2VSN A;  3HDX A;  3PVL A;  5JJT A;  3GW4 A;  2L9B A;  4I43 B;  4KT6 B;  5LCY A;  2BF0 X;  5JDF A;  2I1J A;  2KCL A;  3WAK A;  3RYF E;  3UUL A;  4D10 C;  2HPJ A;  2YIN A;  4TV9 E;  3E0Z A;  3C4X A;  5JR9 B;  3FXD B;  5CHE E;  4L7T A;  2WXK A;  4FHJ A;  1QQE A;  3ZYL A;  3RRN B;  4PS8 A;  3RRU A;  4JHK A;  4HTE A;  2LSG A;  4I2Z A;  3UUX A;  4AJW A;  3ZHE B;  3CHM A;  3LCA A;  4QFV A;  2XPY A;  5HXH A;  5EK4 A;  4G26 A;  5HXR A;  2CMR A;  5KMG P;  3RX6 A;  3FBL A;  3QJZ A;  3HI2 A;  2DCP A;  2KWH A;  1X5B A;  2WPV A;  5EX0 A;  5LOZ A;  4DLO A;  1WR6 A;  2LM9 A;  5IHY A;  3JC6 D;  2GRM A;  3CVX A;  5L3E B;  2AVP A;  5HXE A;  4HOQ A;  1NAF A;  3N9Q A;  4W9R A;  3I4G A;  2PG8 A;  4BJM A;  3OTN A;  1UJJ A;  4WW0 A;  2EHO B;  3FUM A;  4ME2 A;  3ZEF B;  2KZT B;  3T5V A;  3ANW A;  2J08 A;  2FI7 A;  3TAX A;  4WBN E;  3TXN A;  3CKB A;  4HOU A;  4AKG A;  2UXX B;  2V5F A;  4ZI3 C;  4DND A;  2VWA A;  3OBV E;  4PK4 A;  1VRB A;  3ONX A;  4GCO A;  4AY5 A;  1E8X A;  4MS6 A;  5FZS A;  4GYS A;  1ZBP A;  3CQC B;  3CK8 A;  3F31 A;  1FMV A;  4G63 A;  4LUN U;  3GZS A;  4AQF A;  2KCV A;  3KBT A;  2CM0 A;  4UF0 B;  2XCB A;  3EDT B;  4JW1 A;  1E7V A;  2KCK A;  4I6J A;  1OWL A;  2CCQ A;  3AA7 B;  5JDH A;  2DBA A;  5LHI B;  3MA5 A;  3BK9 A;  2CWY A;  4FJO A;  1H0A A;  1JUQ A;  3W15 B;  1LVF A;  2Q9Q B;  3CQG B;  5FXV A;  3L17 A;  3SI5 A;  4FI5 A;  5C2Y A;  4KZ0 A;  1OWN A;  4HOS A;  1WLX A;  2NW7 A;  2ZMA A;  3FUL A;  2FF4 A;  2V26 A;  4C90 A;  3MK7 C;  5A1L A;  3GN5 B;  4DBR A;  4A55 A;  4AKI A;  1MQS A;  4N39 A;  3LPZ A;  4J6I A;  3ZC1 A;  2VAS A;  4QWN B;  3RC8 A;  3BQK A;  3ESK A;  4B94 A;  3IEG A;  4K0R A;  3B7U X;  1P5Q A;  3MCX A;  4EEC A;  4Q94 A;  3LJC A;  3DTO A;  4DMW A;  1E96 B;  2WM9 A;  4UWL A;  3ZN1 B;  3FXE B;  1QNF A;  2XPI A;  1WAO 1;  2E8I A;  3P2B A;  4EQF A;  1D1A A;  2AXU A;  3PUK A;  2X67 A;  2OND A;  4XX5 A;  1FIO A;  2UY1 A;  5LNK A;  3CVY A;  4UIG A;  2EHO C;  3MKR A;  3I5P A;  3P7I A;  4TUY E;  3B7T A;  5BNW A;  3E22 E;  3Q5W A;  5JRE A;  1WY6 A;  4DI4 A;  2JMK A;  4Q69 A;  2QY7 A;  1T98 A;  3CX7 B;  4UVC B;  1BPO A;  5FQ8 A;  2KND A;  2R5S A;  4WND A;  4AXP A;  1FVF A;  2ES0 A;  3FU3 A;  5C8Y E;  4P0A A;  3QWW A;  5L3G B;  4HOR A;  3EDV A;  1OWO A;  5FQ4 A;  1OWM A;  2RG8 A;  3O1H A;  3LBX A;  4I17 A;  4O2B E;  2V7M A;  3S7F A;  4JC8 A;  5F3J A;  4I1M A;  4BA9 A;  3JQ1 A;  2J07 A;  2E9X C;  1H19 A;  5EK3 A;  3UT5 E;  5BV1 A;  3ZC0 A;  1Z3Y A;  3Q15 A;  5JDN A;  1O3X A;  4TV3 A;  2LJL A;  3R9A B;  2XEV A;  4GAA A;  2CXF A;  5L3C B;  2VSY A;  3MV3 B;  4ISS A;  2J9Q A;  5J2U E;  2LSY A;  3ZYM A;  3RRM B;  1E8Y A;  3RO3 A;  3JQ0 A;  1HF8 A;  3IBP A;  2MOW A;  5FY1 A;  4IE0 A;  4ANV A;  1LVK A;  3QK6 A;  2FO7 A;  2E0I A;  2LSJ A;  1L5J A;  3PTR B;  1VOM A;  4U0S A;  3SBT B;  4ZI3 D;  3LY7 A;  3AAI A;  2WBL A;  4ZI2 C;  5JDQ A;  1MMA A;  2WWU A;  5CCM A;  1HZ4 A;  2WMO A;  4DBQ A;  5JJ6 A;  2MRI A;  4TX5 A;  2V8S E;  2KXP B;  3QAQ A;  3GZ1 A;  4OVU A;  1E90 A;  1JWF A;  5C1D A;  5F8P A;  4GK0 E;  1H2U A;  5CCL A;  4EOZ B;  5HWY A;  3CV0 A;  2BDE A;  1ZEE A;  5DJQ C;  5JVD E;  2XGS A;  4CGW A;  1QSD A;  3I1A A;  3FTS A;  3J7Y q;  1KT1 A;  2AXV A;  2V7I A;  4DK5 A;  3DJB A;  4OYJ A;  3QOU A;  3EVY A;  4GML A;  4PDX A;  2C5I T;  3CGH A;  2NTX A;  3KV9 A;  4L9I A;  4M3O A;  2ZM0 A;  3ONL A;  3G2V A;  3AB3 B;  3EJN A;  4WWP A;  4BFR A;  3ETV A;  4MAL A;  4UVA B;  4FAD A;  5LGU B;  3UT4 A;  5KJL A;  2VKJ A;  4N3B A;  1PAQ A;  3I0O A;  3QC1 A;  1EZ3 A;  2LE8 A;  2Y48 B;  4M1P A;  2CLY B;  2Z6E A;  4WBO A;  3CLJ A;  5HYA A;  5FP3 A;  1WYC A;  4UV8 B;  5JRC A;  4ZS3 A;  2IC9 A;  2BUG A;  3BG1 B;  4PK6 A;  1Y64 B;  3ZXS A;  3FUF A;  2DHR A;  3OYX A;  4ZS2 A;  3SNX A;  4KBQ A;  3QKY A;  4G24 A;  4I1A A;  4U0Z A;  3CSF A;  5ANL A;  4EXT A;  1IZN B;  3HKC E;  5J08 A;  4LER A;  4YJ3 E;  3U3I A;  4HOT A;  3CK9 A;  3SBS A;  3CHP A;  4CI3 B;  1MIY A;  3BG0 B;  3IHR A;  4E6H A;  3EHN A;  4O4J E;  3ASG A;  3IV0 A;  1MIW A;  4H9Q C;  3MXZ A;  1MMN A;  2OV8 A;  5LCW J;  3FH8 A;  3RRC A;  4KMC A;  4UWH A;  1B7T A;  2X66 A;  4HLE A;  2V7J A;  3A5X A;  2KWI B;  1YD8 G;  1NA3 A;  4BT8 A;  1Y6I A;  2YHC A;  4BSX A;  2C0S A;  5FY0 A;  4B89 A;  4GYO A;  3N71 A;  1HX8 A;  4E7Z A;  3CR3 A;  2PL2 A;  5FYM A;  2BZB A;  4U8H A;  1IJ5 A;  4KUM B;  4PJN A;  4JEH B;  2E9X D;  3Q49 B;  4H9N C;  3R6N A;  2WB2 A;  3MKQ B;  3PUJ A;  4H7X A;  5LJM A;  5G04 C;  2CE7 A;  1FCH A;  4AOF A;  4BT9 A;  3NQP A;  2KT9 A;  1WYB A;  4N78 D;  3K9I A;  2HPL A;  5LX8 A;  2PM7 A;  1MIV A;  3SF4 A;  4I2W A;  3SWH A;  2B1E A;  3FTV A;  4KYO B;  3AAA B;  4DI3 A;  4JL0 A;  2CG3 A;  1Y8M A;  2I59 A;  4C0E A;  4IST A;  4ERR A;  3CVV A;  4JVS A;  1N54 A;  3HKB E;  2VYI A;  1HXI A;  4XZ4 A;  3CK7 A;  3LYA A;  3U66 A;  4JA7 A;  4ZI2 D;  5DQW A;  3QNK A;  1UG3 A;  2PQN A;  3FH7 A;  3N2G E;  4A1G A;  3D9M A;  4AQG A;  2J09 A;  3FHE A;  5JDL A;  3C4Z A;  2FUL A;  4U63 A;  3FHN A;  4U04 A;  5E0O A;  3FEX A;  2XCC A;  4OYK A;  3VLD A;  1JPL A;  4FUL A;  2WQ6 A;  3VKH A;  3VTY A;  4TZ4 C;  3CHS A;  3B57 A;  1D0X A;  4NQ0 A;  2GK9 A;  3FWV A;  3QWP A;  4CZZ B;  5FTP A;  5FWQ A;  3FUJ A;  3ZRH A;  3PZD A;  1MND A;  3UQ3 A;  3LEW A;  3RJV A;  1HTJ F;  5FZR A;  1AJ3 A;  5KDM C;  4GZ5 A;  1E1H B;  2BVL A;  4BX9 A;  4JEU B;  3R84 B;  3C51 A;  2L0I A;  2X0L B;  3D9N A;  1ZHC A;  1OWP A;  2JMH A;  3N9M A;  4YND A;  3LS8 A;  3MEK A;  2VL8 A;  1DVP A;  3MGB A;  4AY6 A;  2IQC A;  2I6H A;  3HVE B;  4BJN A;  4UQY A;  3ZW3 A;  1HU3 A;  1H6K A;  1HG5 A;  2A2F X;  2XHE A;  4AVX A;  3FTZ A;  2XAS B;  4I50 E;  5DQV A;  4FA6 A;  4CQI A;  4L2Y A;  3SD5 A;  5AIJ A;  2K5B B;  3KV4 A;  4IGU A;  4XAX B;  3J9X 1;  4BTA A;  4CT0 A;  2PJQ A;  3UT8 A;  3KVA A;  5BW8 C;  3MZK B;  4QX7 B;  4I9E A;  4H9O C;  4U07 A;  1G8X A;  3S7B A;  5G55 A;  1U3D A;  3UUX B;  3N2K E;  5EZY E;  3PH0 C;  4MLP A;  4APO A;  3AA6 B;  5LHG B;  2Y8D A;  1UX5 A;  3NZU A;  2JEK A;  4IIJ E;  3CKC A;  2EHO A;  4IRU A;  3CEQ A;  4WNK A;  4MKT A;  5G04 J;  3D9O A;  4EBA A;  3RYC E;  3H37 A;  4V1A v;  2RD0 A;  3HKD E;  3KEZ A;  3RK6 A;  4BAY B;  4CXX A;  4RG6 A;  4UXN B;  3EUH A;  1IHG A;  3Q5M A;  3ZCI A;  3CHO A;  3C98 A;  3G2T A;  2IU1 A;  4O4L E;  4GYY A;  4GYR A;  4HE8 A;  2JPF A;  2HH7 A;  2UWJ G;  4ZOL E;  3ANW B;  4EYY R;  3HIZ A;  4ILH B;  4G25 A;  3ZMZ B;  3HR0 A;  3K3Q C;  2QFC A;  1HS6 A;  1BR1 A;  3RYH E;  3I4R B;  2E9X A;  4XIF A;  4UF0 A;  4PK5 A;  3NRX A;  5AFU L;  3D0T A;  2LAH A;  5BT1 A;  2HO1 A;  3ONK A;  2J49 A;  5LP0 A;  2KMF A;  3ZYK A;  3WAJ A;  3SOL A;  4PJM A;  4IHJ E;  2Q9Q A;  4U72 A;  2NXP A;  4V3I A;  3GZ2 A;  2AW6 A;  3BEE A;  3MYV A;  4QKN A;  2KC7 A;  3CX8 B;  5HQ8 A;  4UVB B;  5J90 A;  4DJA A;  1KNZ A;  4KBM B;  3ENE A;  3L13 A;  1A17 A;  3AVS A;  3ZCJ A;  3GN5 A;  4H7Y A;  3RU0 A;  3D9I A;  5JR9 C;  3U4T A;  2X6I A;  3FUI A;  1INZ A;  2IOL A;  4WWO A;  3ESL A;  1D1B A;  3I9Y A;  3D9P A;  2NW8 A;  3ETU A;  2D0U A;  4CRW A;  1YKE B;  4C91 A;  4N5C A;  2L6J A;  1LF8 A;  2FEZ A;  3CVW A;  2DWK A;  5D0Q D;  4XKC A;  3LJ3 A;  1W3B A;  3APC A;  2K9A A;  2VJ8 A;  3OXG A;  3DPD A;  4MFR A;  4F6R C;  3NF1 A;  4J8E A;  3CHR A;  3E08 A;  5FQ6 A;  2X9Y A;  4I55 E;  4CXY A;  2X38 A;  2XQY A;  1ELK A;  2C5K T;  2YNQ A;  4J8D A;  1WM5 A;  3FUH A;  2JLB A;  5TAO A;  4Z8X A;  5FMN A;  1XNF A;  2VQ2 A;  2WXN A;  4PAG A;  4I1O B;  2PFV A;  3T5X A;  5LGN B;  5LP6 E;  4NUU A;  5JQG E;  2UY1 B;  1U3C A;  2PM6 A;  4FJZ A;  4G2A A;  3LY9 A;  3QDN A;  1MMD A;  3RC3 A;  4IUL A;  5KJN A;  2XGO A;  1UJK A;  2NWB A;  2X9X A;  3S4U A;  4J8S A;  4F53 A;  4QHO A;  4GOU A;  4KXK B;  2P58 C;  3U64 A;  4N2S A;  3L09 A;  4H63 H;  5LHH B;  2ZU6 B;  5T4Y A;  5DAB A;  3K3O A;  3N9N A;  4UI9 K;  4J8F A;  2W00 A;  2ODV A;  2Y3A A;  3R7R A;  2LO6 A;  4RVB A;  3ZGQ A;  4PFP A;  2J1D G;  4HXI A;  2K48 A;  4J2C A;  4IN3 B;  3ZPO A;  1X79 A;  4WWN A;  1SA0 E;  1E8W A;  2LHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...