3ZYKA

Structure of calm (picalm) anth domain
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
269
structure length
269
Chain Sequence
SAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis for the endocytosis of small R-SNAREs by the clathrin adaptor CALM.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
molecule keywords PHOSPHATIDYLINOSITOL-BINDING CLATHRIN ASSEMBLY PROTEIN
total genus 111
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zykA02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zykA01
1HF8A 1UJJA 1EDUA 1DVPA 1XGWA 1H0AA 2L0IA 1X5BA 2L0TB 3D9LA 1HFAA 2MOWA 3LDZA 1ELKA 1JWFA 1HX8A 3G2TA 3ONKA 4FU3A 3D9KA 1LF8A 3ONLA 4Q96A 3G2UA 3ZYLA 1SZ9A 5CMWA 4GZDA 3D9OA 4Q94A 2DIWA 5CMYA 4AVXA 3ZYQA 1HG5A 2BF0X 4JXTA 2LO6A 3RRUA 1HG2A 1INZA 3ZYMA 1MHQA 2KM4A 3D9IA 1VDYA 4GZCA 5J08A 1SZAA 1UJKA 4HFGA 3D9MA 3D9NA 4NACA 1JUQA 1EYHA 5LOZA 1JWGA 3CLJA 2QY7A 3D9PA 2V8SE 4FLBA 3G2SA 5LP0A 2DCPA 3D9JA 3G2WA 3G2VA 1JPLA 3ZYKA 1PY1A
chains in the Genus database with same CATH superfamily
5KXJA 5AQFB 2YDRA 3SZ7A 3VKGA 2H3RA 3MV2B 2CHZA 1OUVA 3JADA 5HEUA 3LKUA 2YQ8A 4J0UA 3AXJA 2D0UA 2XAJB 1NA0A 2BEDA 2IF4A 4G11A 2ZGDA 4LEUA 3RSEG 2KINB 4YJ3E 2WQYA 4GMRA 2PZIA 3JCKC 3RRCA 4DX6D 1VRBA 4N39A 2BG9A 4GPMA 2OOEA 3I9YA 2D5UA 5C3JA 5GONE 1CHUA 5CBOA 5HWYA 4BJNA 3C4WA 4PNIA 2JQHA 2WDRA 2MRIA 1IHGA 5M4YA 1HTJF 3JCFA 5FQ8A 2ACXA 3MKQA 4MLPA 1IQUA 4JA7A 2J4DA 3ZYMA 2XRYA 1ZU2A 2X0HA 5LOZA 4HLEA 5JDGA 1TNBA 4LCTA 4G1TA 3D9JA 2YKSA 1YKEB 4U8VD 3AAAC 1DC2A 1KK7A 2K3WA 3CGHA 3HXFA 4A1GA 3ZN3A 5JDLA 4PJNA 3DSSA 3D3MA 5BUZA 4W9RA 3G2UA 3RIAA 1NI1A 3PZDA 4GAAA 4J8SA 4XI0A 4Q94A 4A63B 4LF4T 1HG5A 4JEHB 3U4TA 4U7IA 2FJDA 3W9GA 3ZUVB 1E7VA 3UTMA 5HS0A 5AQOB 2X6IA 2LRKA 4H9OC 1YA0A 4FP7A 3CVYA 3AECA 3BUAA 2QYJA 2LM2A 3AB3B 2CBIA 2J08A 2UY1B 4O4JE 5AQUB 3PU8A 5FY1A 2WS3A 1S64A 4B89A 3LJCA 4DV1T 1OT8A 2L6JA 3OTNA 3R7RA 2YN6A 3FXEB 4GKJT 4IT4A 2VTBB 4JI3T 4JI5T 2EINE 2R17C 4KI0F 2WCAA 3PEVB 1Y64B 3NAWA 2CWOA 2KCKA 4I9CA 4IL9A 5HQ8A 3RPUA 4AKIA 2X6KA 1HS6A 3SBTB 3ZMVB 1OWAA 1O3XA 3AG1E 2D0TA 2EHOA 1U3CA 2PQRA 1WR0A 3IV0A 5L3GB 5BXOA 3LK2B 5F8PA 1BI7B 3UQ3A 4CGWA 4A97A 1O5MA 4CQIA 4DV6T 3FEXA 2J4GA 3PREA 4CN6A 2XAFB 4DLQA 5HEOA 1HO8A 4Z68A 2EIJE 2Q9QA 3O9XA 3J5PA 2LM9A 4K0RA 3ZN1B 2PTFA 2R6GF 2VL0A 3HVEA 4WNGA 4PDXA 4UIGA 5HAXA 3EIJA 2P9NG 3PZ4A 3IEEA 2IOLA 3BQIA 4TV8E 1OWLA 2QFCA 2LHNA 2BBJA 3N9PA 4JI2T 3OXFA 4PFOA 1JUQA 3DXMG 3UFEA 3DPYA 4EGWA 4MKTA 4OYKA 4E6HA 2XQAA 4FHKA 3CVNA 3S4UA 2XEVA 1B89A 1ZOYA 1D0YA 2LSIA 4GPKA 3QOFA 4U2ZA 2WXJA 1X9BA 4MFRA 3L22A 4LUNU 2L3LA 4HWFA 3UUBA 4F1SA 5CA0E 4GK5E 1NFIE 3DSTA 5CMYA 5LBQB 1OCRE 2EQXA 3AAEB 5LJMA 1FVHA 3C4ZA 2IEJA 2BS2A 4CXYA 3R9AB 3UU8A 4AY6A 3K9IA 1N34T 3SRZA 4X5TA 1LD7A 1Z3XA 2UUBT 3TLUA 2DL1A 2LOSA 4QH5A 4DX1A 3ESKA 4UVCB 3PE4A 2J9QA 2E9XC 2NTYA 4QXCB 5A23A 3IBEA 2WXMA 4Q69A 3GZ2A 3WXXA 3EABA 3ULYA 2J8SD 4EPZA 2OCCE 3EHQA 5EILA 2YNQA 3ULQA 3ZPOA 2AJAA 5JHBA 3TLWA 4CI2B 3LBXB 5LP6E 5CA1E 5C1DA 4MBQA 3RO2A 5G04C 4CI1B 5AJDA 4UVBB 4DBRA 1J5WA 1OWPA 2W62A 1SW6A 3BG0B 3ZEFA 4ZHBA 3CHRA 2HN1A 4DUZT 2OV8A 3DTOA 1NEKA 3SOLA 4I4TE 4CN1A 5AQLB 1MX4A 2NWBA 2NYJA 2BTDA 5LOVE 2IU1A 5CFBA 5EX0A 5AFUL 1HNXT 1SZAA 1UN8A 5LXTE 2LLYA 2YDQA 4F6RC 1TJFA 3PH0C 1YQ3A 4HFVA 5HYAA 3RC8A 4MLKA 2I2OA 1IBKT 4ILHB 3MXZA 2PQNA 4N5CA 1H2TC 4G2AA 2BVLA 5IYZE 2FEZA 2WXFA 3B57A 3ABME 3RKVA 1N0QA 4X20E 3AEEA 2V0PA 3U9WA 4JEHA 5T3RA 3HKDE 4PW8A 1HCIA 3P7IA 4H9PC 2G0UA 2A4ZA 5LMUT 3C5RA 2KM4A 4WNFA 4H9RC 1VDYA 2F8YA 3J5QB 2XJ7A 2P2CP 4YDWA 4I1AA 5HEJA 4WBOA 3EHMA 1N4SA 5AENA 4P29A 4YT0A 5AYWD 3UM1A 2YHEA 3KFWX 3FXDB 3CV0A 4X64T 3DSUA 1UJJA 5CGMA 1TR4A 3QWVA 2L0TB 1HZ4A 2XEHA 3FEYA 1OY3D 2Y6XA 3L54A 3APFA 1OWNA 5ENSD 3SO8A 5AARA 1EZ3A 4B8AA 2VGXA 2WXKA 1W09A 1XNQT 4ZI3C 4V3IA 3HA4A 4TNVA 2IFUA 3KBUA 5KJLA 1O1TA 3V5SA 3N9NA 2MAWA 3HL6A 1W0BA 5L3FB 2C0LA 2ACZA 3JQ1A 4CRWA 2BS3A 4ZS2A 1MIVA 2MOZA 3K3NA 4YTMA 4JI7T 4ZXLA 3D9HA 3AXJB 4OAUC 4GU5A 1LF8A 3ZLIA 2FO7A 4LERA 4ISTA 4F53A 4JBWF 4LFAT 3UM3A 2VSYA 2HH7A 3L9TA 3OBVE 2UXDT 1MIWA 4JEUB 3CVXA 1V54E 4DMVA 3APCA 2ETAA 3E22E 3QOUA 4N3BA 2BKPA 3KV6A 5AQMB 3AG4E 2KWHA 4GZ5A 3VLDA 5E76A 5D0QD 1ELKA 2H6HA 4KX6A 1YQ4A 3CQXC 2XCBA 4U7EB 2E5VA 2ODUA 1FT1A 4AVXA 4JL0A 3ZYQA 1T7SA 4AI6A 3Q5WA 4QX8B 4LNUD 2VB6A 5LB7B 4JI4T 5FXWA 3UKUG 2OA5A 4YLHA 2DWZA 3GN5B 3KDSE 3L13A 4ZHQE 2QY7A 3UU3A 3G2SA 4BY6A 4A3TA 2KATA 3M3ZB 3MACA 3U78A 3PUKA 4N5QA 4AJWA 5LFAA 1I6ZA 2CHXA 5BV0A 3RKOA 4JUYA 5AQ7A 4JHRA 3DSVA 3QAQA 3X2QE 1WAO1 2J47A 4OX9T 5JVDE 3KSLA 3P50A 2NC9A 4NXMT 2VSOE 3CHOA 5KJNA 1SQMA 2DIWA 5HXRA 3JAEA 4X8QA 5G04J 3UI2A 3LG7A 4GZCA 5BMVE 2C2LA 4Z8XA 3PUYF 2HN2A 4UV9B 3GA8A 5ABFA 3E0ZA 5CJ5A 4X1YE 4AM9A 4YY3T 4XKBA 1UGOA 3PZ1A 4UI9K 3PUSA 3S7JA 3TWXA 5FIOA 5L4EA 2V5CA 1SZ9A 3E32A 4ABNA 2CFUA 2WY2A 3NKZA 3NZUA 5DQVA 4QH1A 3MZLB 4XIFA 2XQ5A 1HR0T 3CEQA 2BBHA 3Q5MA 4M7CA 5HXCA 2Y0BG 1K1AA 3HI2A 4IE4A 5EK2A 2HYZA 3R84B 1KNZA 3BQKA 4N3AA 4RG6A 2V6YA 3FH5A 2MYOA 2HM8A 1XZYA 2XQ8A 1X81A 3FTYA 4C0MA 1HX1B 4WW0A 4G26A 5CCMA 1JNRA 5HXEA 1KLXA 2YHCA 2X6FA 3ZSTA 1G3NB 4ZZBA 3Q5EA 2P9SG 3MV3B 3ZEFB 3ENEA 4U31A 2ZM2A 3KV5A 1OEDC 4O8SA 1TNYA 2DBAA 2FI7A 3LPZA 4O60A 1AP7A 3RH3A 2D9DA 3T5XA 3Q5XA 4CXWA 4AKHA 2H6GA 4GIWA 4IIJE 4HKAA 2KCVA 5CCLA 1NP7A 3W9FA 2N1GA 4LSZE 5ENPD 5LHGB 3WI3A 1D8DA 3WAKA 4EIWA 2NP9A 2C5IT 2WXNA 1H6OA 2KWIB 3EVYA 2QC9A 2JQ9A 4GYRA 4HTEA 3JXIA 4K5BA 3EHNA 4ANUA 3CSFA 4GTRA 2MOWA 1YW0A 2LNIA 1N94A 3LY9A 3MGBA 3CVUA 5ENRD 2YEVC 3ZFWA 5EKQD 3E08A 2RA1A 1QBQA 2EHOB 3HYMB 3Q4AB 4B8CB 1NA3A 5EDSA 3SBSA 3P4PA 4AQYT 3AA7B 5FY7A 3G2VA 1TN7A 4O4HE 3ANWB 3JYSA 1OWMA 5KBAA 5IHYA 2CCQA 4HI8A 3ZGQA 1IXVA 4UI9J 3RC3A 4HWIB 1FPPA 3V2OA 3KEAA 2AVPA 3UU4A 3A7MA 2Y4TA 2V5DA 1IKND 5HXHA 2FF4A 3U64A 2JQQA 4IDNA 2VQ2A 3PDYA 3VHLA 5CRVA 3R7QA 3TGOA 2R2LA 2E9XB 1LVFA 3O1JA 4HGAA 2BKNA 4H7XA 3AAIA 5JREA 1U3DA 4GTTA 1BR1A 4HOTA 2V8SE 2WU5A 2WM9A 3NF1A 5BXUA 2VGYA 3RIBA 3WAJA 3QJZA 3NRYA 2ZMAA 4JHKA 5HXSA 3T9KA 3ZT6A 3IHVA 4GA2A 4PAGA 1HX8A 4PH4B 4WYVA 4BAYB 4AQFA 4LF6T 1N4RA 3AEGA 3LY7A 4TX5A 2A2FX 2W4XA 3RF1A 5EZYE 3TWWA 4X1KE 1INZA 4ZS3A 2KLQA 1E8WA 5J1GA 4QHOA 3LVQE 5CEAA 2RP4A 5L3BB 3FUJA 3VTYA 4MS6A 1FCHA 5ANRA 1T72A 3V2XA 1B7TA 2FJAA 4FA6A 5DQWA 4K03A 3NZPA 4GCOA 1N95A 3L8RA 3DSXA 2GRQB 4J7WA 2KZTB 1G8XA 2UXNB 4KT6B 2X66A 2J4BA 2AE9A 3HKEE 5DABA 4AKRB 3PUAA 4JI8T 3PS6A 3IKOB 2BF0X 2X3MA 4GK0E 4I1OB 5FQ7A 4HOSA 2F37A 5AQKB 4G8KA 3HKBE 5JTGA 1WFDA 2PJQA 3R9MA 3KVBA 3PV0F 3ZIMA 4DUYT 2H6IA 2WXHA 5B1BE 3VLFA 1VCSA 5ABFB 4I1MA 4A1SA 4I2WA 4GMLA 4FI5A 4PK4A 3CVQA 2CA5A 4XZCA 4O2AE 4NIQA 2CFZA 3TAXA 1O1RA 3VLEA 2ONDA 2JEKA 4IREA 2WXOA 3H37A 3UUXB 4UVAB 4JYAT 1TEZA 4HOUA 4GTMA 2IC6A 3PNLB 3QK0A 4EAHA 2M6BA 3FBLA 4YSZA 4CI3B 3PEUB 3PNTB 3NVOA 4XZ4A 4Q25A 2OV9A 1IQRA 4RSYA 3RU0A 4EHMA 2KXPB 3ZCJA 4A98A 2V7MA 4P0AA 3E4BA 5TAOA 4L2YA 2KCLA 4C0EA 3ZJ2A 2DVWA 4PFPA 1MHQA 1JCSA 2UUCT 2DCFA 3UU5A 3UMVA 4XBFB 5AQTB 1BR4A 5AQBA 3Q75A 2BKKB 4BSXA 4L5GA 3QB5A 4AKLA 1YYHA 4Y6WA 1X79A 4LMKA 1TNZA 2V26A 4TZ4C 3CVLA 4ZEYA 4PJLA 3ZMTB 3L08A 2IO2C 3LYAA 4QKNA 4U63A 2WU2A 4B3RT 3AA1B 3VTXA 1JNZA 3AE5A 5EK4A 4ZI3D 4CN4A 2H7VC 2IW5B 1HG2A 1N52A 4J8FA 2IONA 3ASHA 4GTVA 5ENQD 3E37A 5HKPA 3Q15A 2A5EA 3CVPA 3KAEA 3AEBA 4TNWA 1KZOA 2V7LA 3OVUA 3T8KA 2PM7A 1ZB1A 2ZM8A 4ANWA 1O1SA 4GMJA 3SFDA 3K3OA 1BI8B 3UQ4A 1TJCA 3ONXA 2XAGB 4ME2A 1UG3A 2EILE 4H9SE 4HFCA 4CZZB 4HWHA 1D9SA 2NOXA 3OPCA 4HFIA 4YHHT 2VGXB 3JXJA 2LKGA 3RKGA 2X38A 4CXXA 2WB2A 1N33T 4YSXA 2MPKA 3ZJ1A 2ETCA 3FUHA 3PDNA 5LGNB 5J08A 3DBSA 2BG9E 1EYHA 4MBGA 5ABHA 2XS8A 2W2UA 4ANXA 3IHYA 3EHRA 3FTXA 4YDEA 3UX4A 4PK6A 4HRNA 4FADA 2XZDG 1VCTA 4ZI2D 3AS5A 3LY8A 5JDNA 3CVVA 1QSDA 1T8BA 3OJAA 4GTQA 1FMVA 2WP9A 4AY5A 1W3BA 4N78D 4L23A 4DR6T 1Z5SC 4QXBB 4E7SA 3MYVA 3RYHE 5JDHA 2V8SV 2W61A 2SPCA 4WNDA 3NWIA 4CDMA 3RYCE 2WSSV 3ZPJA 4TWDA 3OTOT 3ZW3A 2I9CA 3I4GA 3F6QA 4CDRA 2GROB 4EV6A 2XENA 2MHKA 4C90A 4FC8A 5LG3A 4ILGA 4U0SA 1DCEA 1H6PA 1N4PA 2LEHA 4JB8P 2A72A 4HNAD 3I5PA 3ZHEA 1E90A 4DV4T 5LGTB 5JDMA 2UUAT 1N32T 2ZM6T 2HR2A 1MIYA 3N2OA 1WRDA 4EBAG 4IHJE 4HFEA 4GA0A 3TWVA 3N2GE 4QWNB 4Z90A 3BEEA 2YU1A 3P4WA 1N0RA 4B3MT 3L3PA 3ABLE 1U5PA 1S70B 2NW8A 4FJOA 1NAFA 4MALA 3UU6A 5CEDB 2VVNA 5L3EB 1SUMB 2LUHA 3QC1A 3ISMC 3QDNA 2P9IG 3CK7A 3L09A 4DV0T 2JABA 1ZBPA 3QNUA 1KZPA 2LT3A 4OHFA 4TWHA 4UR9A 3OXLA 3MKDA 4U2YA 5KJMA 3C50A 4EEDA 4TRQA 3GYZA 5DJQC 2Y4UA 3HDXA 4KYOB 4UWGA 4F6RD 3UM2A 3FHNA 4E7ZA 2XGOA 1QQEA 3V30A 2F4VT 4I43B 3P1UA 4AP2A 4CYMD 4ERRA 5C8YE 1H6KA 2VVSA 3ETUA 1JWFA 3AE2A 1H19A 4G23A 2W66A 3AE4A 2I1KA 5FNVE 3J7Yq 2KT9A 5EIBE 5HCMA 3EAMA 3GW4A 1K1BA 2ZLYA 3AA6B 4NACA 3FH8A 5ARGA 4B3TT 2I0MA 5BV1A 3CWZB 3FZMB 3JAFA 4AEZC 4EZ4A 4UF0B 1U4QA 3LK3B 3HR0A 4WNKA 1KPSB 1R8IA 3Q78A 2A3DA 4I0UA 4B93B 2H88A 2CXFA 4I43A 3DEPA 2EHOC 3FUNA 3TWQA 3ZYLA 1LTXA 3L16A 4J8DA 2XY8B 2E0IA 3B95A 5JJTA 3ULEG 4ATGA 1KFYA 4I50E 1QLBA 5CERB 3O4ZA 3VRBA 2K5BB 3ZMUB 3M65A 3GWHA 5LX8A 1WYCA 2NR4A 3FP3A 4U0ZA 3QK6A 2ZGGA 5DBKA 3RRMB 3OYXA 2CPTA 3A8YC 3G2TA 3LCAA 2NW9A 4KMCA 1GQEA 4EXTA 2OLTA 4JI6T 5KJKA 1FMWA 2ZM0A 4JEUA 1W9RA 2E2EA 4CT4A 2KSRA 4J8EA 4JD2G 5FINA 3PUZF 3CX8B 3U66A 5ENTD 1Z6TA 4BTBA 4I6JA 4DX7D 1D1AA 5D0OD 3LSVA 3FUFA 4U74A 3UUMA 3CQGB 4NUVA 4A5XA 4BX9A 3ETVA 5AIJA 5JR9A 2B6CA 5BNWA 4O6FA 5FY0A 2MYSA 3SWHA 3GZ1A 2XUEA 4HEAA 3TG5A 3NOGD 3AE1A 2K9AA 3I3NA 4GYOA 4UQXA 4ILAA 1WCRA 3TWUA 2XQ6A 4HE8A 4UF0A 5E0OA 1XMOT 1I94T 4U0UA 5AQPB 3CIAA 4AXHA 4ILBA 5FXXA 1E8XA 1D1CA 3GMIA 3T8MA 1U2VG 3BQOA 2JRKA 3AU5A 3ZXSA 2M6IA 4FULA 5FJYA 2KXPC 2YDSA 1UOHA 4BA9A 4A55A 2DHRA 3F31A 2HE0A 1UK5A 2L9BA 5D2MC 3PZ3A 3PUGA 4L9IA 4P09A 3ASDA 5FXVA 3E33A 1EPUA 2FBNA 2AXVA 2LAIA 5CBNA 1NENA 2QGSA 3VU7H 3QUJA 3RYFE 3D9NA 1EF1C 4JHJA 5D66A 3CLJA 1HXIA 4HFBA 4DK5A 2DWGA 3G2WA 3EDUA 2NXPA 1KT1A 4DPRA 1HF8A 4JZYA 3KVAA 4NXNT 4F7AA 3K8PC 4LFCT 5JDFA 4ATZD 5FZSA 2DYRE 3JC6D 1SVXA 3Q79A 3SS1A 2ETBA 3TWSA 3C98B 1WM5A 3BU8A 3NOCD 5A6CA 4ISSA 4BERA 5AQRB 1MNEA 2IOSA 4G63A 4G8LA 2X9YA 3FZFB 3LVRE 3AE9A 4HXIA 3A5XA 5AQSB 4EECA 2LSGA 3BK9A 4X65T 2CG2A 3CKBA 5LG4A 3ZYKA 1K3ZD 5A1LA 1ELWA 2J49A 4IDPA 1TNOA 2A9UA 3JQ0A 1WLXA 4OVUA 1MMDA 4NURA 4Z91A 1Q2ZA 4DVDA 2LXMA 4URKA 5JHAA 2QYWA 2JQKA 3CK6A 3VRAA 1PC2A 4WUYA 2RPAA 2V7JA 2WPVA 2LOPA 1IBLT 4HFGA 4ACKA 2IO3C 5FQ4A 4YTPA 4EZJA 3RIFA 3T1YT 4HOQA 2XHEB 4QQIA 5M72A 3ASFA 5LJNA 4ILCA 2R03A 4OYSA 5J0ZA 2CHWA 2LE8A 2ILRA 1UCUA 2BZBA 2I1JA 1CUNA 4KZCA 3S7FA 4NQ0A 3JUEA 4KVMA 3UTKA 1BU9A 3ZT5A 2BG9C 4U95D 3PUVF 4WWNA 2GRLA 4L1BA 1IYGA 3E30A 3RLFF 2X6JA 4IDZA 1E7PA 4LF9T 3CKCA 3QB5K 5G2NA 3V79K 5LGUB 5IWAT 5G55A 2DI4A 4D10C 4DI4A 4ILIA 1OXJA 2KZ7B 3S7BA 3TKLB 1HFAA 2WXQA 1QUUA 2WDQA 1MYOA 3FWVA 1YXRA 4DO0A 2JJ9A 2DNXA 5AQIB 3RX6A 3ZU7B 4RQIA 3ABVA 4DV3T 5FWQA 3F2EA 4BJMA 2JLBA 3SFEA 2VQET 1WYBA 3PE0A 1MX2A 2DLRA 1S63A 2XSAA 1ZP0A 5LMNT 3WG7E 3O1IA 1OCCE 3P4RA 5FL0A 3ASGA 3TWRA 2L8KA 1MJ0A 4DR5T 5LYJE 3ZKJA 1UX5A 2QVAA 3CPZA 1IBMT 4KMOA 2C5JA 3T8OA 3CIRA 2GRNB 2H6FA 2AXUA 3V5UA 3VR8A 3QARA 4RVBA 5L4HA 3LBXA 3MK7C 2DWKA 5C2TA 2CWYA 2CLYB 2W63A 1YCSB 2UWJG 1D0XA 5ARFA 2E9XD 3CX7B 3ANWA 5AQQB 4XX5A 3UIPC 5H6QB 4DV5T 4COFA 2X51A 2C0SA 3VR9A 1OWOA 5ETWA 3SFXA 4DX2A 5JQGE 3NB2A 2GRPB 2XGSA 2WZIA 3D9KA 3FFLA 2BVMA 5EN5D 1SE7A 3MEKA 4CEMA 3LJNA 3CSTA 3IHRA 2J62A 3F57A 3E34A 2NSZA 5CRUA 2CXDA 3AE6A 4TWFA 4HRMB 5JR9B 3FTUA 4EZLA 2VWAA 4CDNA 2P9LG 4JA9A 4ZZCA 4IE6A 2LHRA 3UKRG 3FZKB 4HRLA 3RAUA 3UPVA 3ASNE 4G2VA 3TXMA 4BTAA 2YU2A 1K8KG 4U8YD 3PTRB 2MBGA 2YINA 2XHEA 2WXIA 1PY1A 3IEGA 4WBNE 3MZKB 1GW6A 2XSBA 4K0UA 3L6AA 1N9AA 2H89A 3NRXA 4AKGA 3EHZA 1RZ4A 2WQ6A 4LNBA 4YNDA 4L0RA 4BETA 3LXUX 4OAVB 4V1Av 1ZEEA 5FZQA 1XWMA 1HU3A 2WMNA 4I9EA 3IBPA 1IHBA 3I4RB 2Y8DA 3Q47B 4GCNA 4GZ3A 2AXZA 3X1DA 5FVKA 1SA5A 3AG2E 2VQFT 2W00A 5KNGA 4FJZA 5FZRA 3K3QC 4HN9A 4ACLA 4HLLA 2N9DA 3UT4A 3KBTA 3N9MA 3ZCIA 5ADXL 3ML8A 4HQDA 5AAOA 5FVLA 4FLHA 1S94A 3LJ3A 4DNDA 2XRZA 2J1DG 4GTSA 3KEZA 3HXEA 3AE3A 1YD8G 3L17A 4F3VA 1S35A 4I2ZA 2PL2A 4XI9A 1HNZT 3FU6A 5FP3A 1FJGT 4B3ST 1JPLA 1LVKA 3MJXA 2HO1A 4LG6A 4X1IE 4YXDA 2OEWA 5AQAA 1D0ZA 3V31A 3I1AA 1UW4B 4TUYE 4DX5D 2WMOA 5FL1A 4GTPA 3P4QA 1UURA 4EOZB 1KT0A 2QZAA 2E9XA 4TXQA 4EB6E 1TYQG 3B7SA 4WWPA 1XDPA 1XMQT 4BX8A 4DR2T 3TJPA 3MKRA 3CHMA 5EIDA 4DMWA 4U33A 2XCCA 3ONLC 2WAUA 1MX6A 4UWFA 3UXGA 4QFVA 2XQ3A 1MQSA 2LKHA 3B13A 2XASB 5HWXA 3UT8A 1NZNA 4KP3C 2VKDA 3O4XE 3PU3A 4K0KT 1E96B 2A5UA 4LRZA 3Q49B 3RQWA 5J2UE 1JWGA 3QNKA 3J9X1 2IQCA 3FBZA 3Q7AA 3LS8A 1UN9A 2JPFA 2WDVA 4GKKT 4C9BB 4U3CA 3D9LA 1H2VC 2Q7FA 5EYPF 2EIME 2EHOD 3NZQA 4DLOA 3ZMSB 3ZHEB 3OYZA 1JCQA 3PURA 2I59A 3T5VA 2WXRA 3CHPA 5LHHB 5JJ6A 4N2QA 3L39A 1N36T 3D0TA 2NW7A 5B3SE 1MMAA 3NBXX 2WWVA 2LSVA 1LD8A 3DEOA 4QXHB 3TL5A 3ABKE 2WWUA 3HG0D 3HRAA 4AQGA 3EI0A 3G06A 2XM1A 3IXEA 4HBDA 3FULA 3LDZA 4C91A 4IE7A 2UU9T 5KX5E 5HRYA 5G05C 2VKOA 3AJIA 4TUUA 2FULA 3W15B 3EUHA 3IF8B 4YJ2E 4TV3A 3ZN0B 3L82A 4JW1A 2D2SA 3S2AA 2PG8A 2XAQB 4DR4T 3H3AA 5LHIB 1V55E 3SGHA 2KNDA 4IL4A 2BKGA 4YVOA 2PNNA 4TXPA 3N9QA 4YDYA 4BWRA 4NUUA 1L5JA 3SF4A 1A5EA 3UQ7A 3K1SA 3SD5A 5B1AE 5F3JA 5BPPA 3FUKA 2R59A 3Q5DA 2E2AA 1H0AA 2XS1A 3VKHA 1MNDA 4B6XA 4DR3T 1V9DA 4I17A 2AWIA 3KINB 1M62A 1DNPA 2XGMA 2VKHA 3HXBA 1OEDA 4YVQC 4X62T 5ENOD 3RIUC 2XTLA 4UQZA 4YTNA 4HFHA 3N5LA 4O4LE 4CT0A 2LXLA 2HHHT 1RW2A 1FT2A 3EJNA 5G05J 5L3DB 2LSUA 4HWDA 3S7DA 5CB4E 1SA0E 2V6XA 2M63A 4L9PA 2RKKA 4EZHA 3LK42 3MA5A 2V1DB 4U04A 2GK9A 5J90A 1H7CA 1BPOA 1OCZE 3DWLG 3ZNGA 5LCWC 4LMLA 5JDQA 4EZKA 3OKQA 2GRMA 3UT7A 3AVSA 3APDA 2X68A 2XAHB 1ELRA 2FJBA 1SA4A 2XEEA 4AIFA 2VGEA 5JJ7A 3I0QA 3HKCE 1OXZA 4GZDA 1D1BA 2UY1A 3JC6C 2ODVA 2XPIA 2XM2A 4OK0A 1Y6IA 4PUCA 1L0VA 3D9PA 3CK9A 4C48B 1T98A 2X67A 2XQ7A 3B7TA 3Q9UC 2VYIA 3PE3A 2GGFA 1KEYA 2FO1E 3HHMA 4MRUA 5BR8T 4A56A 1N54A 4LFBT 1DVPA 1XGWA 4U72A 3RIUA 2XPYA 3ZT7A 1QZ2A 3ONKA 4DI3A 3EU5A 3LDQB 3Q73A 4APOA 5BT1A 1J5ET 5IY5E 4ZFHA 2X0YA 1UX4A 4DR1T 4J8YA 2Y69E 3N2KE 3B5MA 1Y01A 3RQUA 1JCRA 1D8EA 3SFZA 5JRCB 4RG9A 4UUCA 5J2TE 4DIDB 2OEVA 3FTSA 4FLBA 4AQFC 1MZCA 2N2NA 5ENNA 2Q9QD 4XAXB 2CM0A 4UXNB 2V4LA 5KNHD 3OXGA 3AG3E 3RYIE 5AQ9A 5FT9A 2ES0A 3RI5A 4JVSA 3AEFA 4APFA 3ONLA 4UWHA 2W67A 1W0AA 2XQYA 4BT9A 3D9OA 2Y48B 2IY0C 2Y1LE 3SQVA 2OVBA 2CEAA 2P9BA 1BR2A 4H9NC 2DZNA 3RHWA 4ZI2C 1MMGA 4B0ZA 4KBMB 2DCPA 2E5LT 3CK8A 3FUMA 4WZXA 4IDOA 3U3IA 3MX3A 2CXLA 2WZHA 2E8IA 4KHPT 4O4IE 4TUMA 2Y3AA 4BESA 1YKHB 1HH8A 2I6HA 1BLXB 4U7YA 1YMPA 3UUNA 1FVFA 2RG8A 4UWLA 4XEIG 4UQYA 4EQFA 5ABGA 2OVFA 5E75A 3TG4A 4Y6CA 3N71A 4LMJA 3ZMZB 2J09A 4X66T 1E8ZA 2L9QA 4IULA 4M3OA 3P2BA 2F0YA 4YSYA 3KD7A 4HS2A 3SNXA 1WR6A 3H3MA 4ZI7E 4PS7A 3UUXA 1HE8A 1TN6A 4JXTA 1HNWT 4TXRA 5AJLA 1UUSA 1XNRT 3FUDA 4GYYA 3B7RL 1XDOA 2J07A 4HI9A 3RJVA 1E1HB 4ILUA 4ANVA 1US7B 2BDEA 2LJLA 2IDOB 5LP0A 4OYJA 3PUXF 3C3OA 4UI9C 3Q2MA 1EDUA 3FHEA 2QA7A 3AEAA 2VJ8A 1A17A 2P9PG 3O48A 4DRXE 1N4QA 5ABEA 3FU5A 2VSXE 3PUJA 3O1HA 3DRAA 5FQ6A 1S0PA 3UINC 3CR3A 4J6IA 4K5CA 5ANLA 5L2LA 1UJKA 5LNKA 5HEHA 4HB5A 4M1PA 2Z6EA 3LEWA 4AISA 2WXGA 5L3CB 5C2YA 4GB9A 4HWCA 2P58C 2VL8A 2P9UG 2ZIRA 4DV2T 5ITZF 3C98A 3ZC0A 3AEDA 2EIKE 4GZ6A 1QNFA 2CBJA 4JI0T 4I55E 4DR7T 5T4YA 4EBAA 2IJGX 4KHZF 1Z0PA 4U8HA 2XPKA 4CCAA 4DBQA 5CMWA 5FMNA 2WB5A 3FB2A 4YHJA 3RGLA 4KBQA 3B7UX 5KMGP 3EIQC 2X9HA 3URZA 3NQPA 3KV4A 2B0OE 3FUIA 2XQ9A 1SHZC 1N11A 2YOEA 1WG0A 1WY6A 3LFMA 3FU0A 3ZRHA 3UFGA 1IJ6A 5KCMA 4UWKA 4AV7A 3KS2A 4PS3A 2WXPA 2BS4A 2KMFA 4TV9E 2P9KG 2XPZA 3MKQB 4WAFA 3FDHA 3PZ2A 2UXCT 2X9XA 3RRWA 4L7TA 2FUPA 3AE7A 3QKYA 4RLYA 4IN3B 4GTOA 2AXDS 2V7KA 5AQHB 4GYSA 4XE0A 1G73A 5AQNB 3C64A 4K5AB 3FTZA 2FBWA 3CMLA 3ZKRA 3DP7A 3EUVA 4F1PA 3EU9A 1FEWA 3CQCB 3DXKG 3I0OA 2HPJA 1M7KA 4BT8A 4UEMA 3N9LA 4F8HA 4A3VA 2KZTA 2VKJA 5LCYA 3ASOE 4LF8T 2XZEA 3C3RA 3CHQA 4I6GA 4BSZB 2X9WA 2X6HA 3TXNA 1J1JA 3QB2A 1HS7A 1MMNA 3JUIA 3RO3A 1X5BA 3U3WA 2ZU6B 3IA3A 5JRCA 3DPDA 4YDOA 3SHFA 1IAPA 4PS8A 4Q96A 2ZXWE 2PFVA 3AU4A 5BW8C 4JV5T 5H7PA 5AQVB 4H9QC 5FKYA 3SI5A 4HVBA 3RRUA 4H63H 2X0LB 3FZLB 4GOUA 3QWPA 4UV8B 1WDYA 3SY2A 4H7YA 5F5WA 3UM0A 1IJ5A 4LNGA 2R05A 2B1EA 5AQJB 4IRUA 4GYWA 3AVRA 5EX3A 2C0MA 2M67A 4UELA 3C51A 4FU3A 3MA9A 3NBNB 1ZKEA 4P1NA 3FU3A 4AOFA 1E8YA 1OCOE 5LCWJ 3UT5E 2VURA 2R02A 2R5SA 3B7BA 3BG1B 4HFDA 2CMRA 4WNEA 3ONJA 4HORA 2V4HC 2WQ7A 3Q7FA 3ZVVA 2V6YB 3MCXA 5HEGA 4EYYR 4J2CA 2NTXA 3TWTA 3DSWA 4N2SA 4KXKB 3ML9A 4EYUA 2UXXB 1TNUA 4PJJA 3PJAA 4CGVA 4U96D 5AN8A 3UULA 3FTVA 3BQLA 2IAKA 3P8CD 3FTWA 4B94A 2Q9QB 1ZV4X 5L47A 5JH7E 2KC7A 2LSJA 5CHEE 4LF7T 5DIZA 3HXCA 3NZSA 4ASKA 2V5QC 4JC8A 4FHJA 3PUQA 4NRHB 2YK0A 4BFRA 4P0BA 1LRZA 2LAHA 3RK6A 5KWDA 4N3CA 1TN8A 3FY4A 3HXDA 3Q9NC 1BD8A 3Q9DA 2IHR1 2VTBA 4H63V 1OEDB 2DZOA 2QYUA 4JI1T 2AW6A 3R6NA 3DJBA 2JMKA 3CX6B 3FZHB 4QH4A 1E7UA 1BR0A 2GW1A 3C3QA 4ZOLE 2WVIA 4O2BE 4DV7T 4BEPA 3PUWF 2CRBA 3N9OA 3OAWA 2IMLA 2MTQA 4YFSA 4AXPA 5FYMA 2C5KT 3FH7A 4DUIA 1DCQA 4L2LA 2IIUA 4LF5T 3UIOC 5LBMA 1P5QA 2CHNA 4TN7B 4IE5A 2ZISA 4I6EA 4IYPA 4PJMA 4R7LA 5JR9C 1FIOA 4O1OA 2WQHA 3D9IA 5EYLA 2LRLA 3ZXPA 2CE7A 3RRNB 4EEBA 2LSYA 2XQ4A 5FTPA 3PVLA 4OVVA 3C72A 1AWCB 2RFAA 5H6RB 3QWWA 2VK9A 2K48A 2K24A 2IUBA 3HIZA 1ZHCA 4NIKA 5JMND 1KNPA 1PAQA 3GZSA 4XKCA 3EDTB 3ZSSA 4FJYA 4CZ2D 2CHOA 3KSQA 3PRZA 4O1PA 3SFYA 1LKXA 5EK3A 2LSKA 4IE0A 4OFZA 3ZC1A 2Q9QC 3EDVA 4AIUA 4IGUA 5CECB 4DJAA 4JLEA 3T1HT 2FJEA 2IC9A 3AS8A 4KVOA 4WWOA 4QX7B 2V5FA 3FUEA 5KDMC 1IZNB 2H7OA 1DU2A 3HVEB 5FXZA 2DYSE 3AA0B 2CG3A 3ESLA 3AAAB 3P4SA 4PK5A 2W0GA 3CHSA 3MJWA 1VOMA 3TLTA 2RFMA 3D9MA 1QYMA 2F8XK 3C4XA 1NL4A 2XQ0A 3GN5A 3CKDA 2BUGA 4IDQA 2WXLA 2WBLA 2JMHA 1E2AA 1H2UA 4NPPA 3CVWA 5AQGB 2BKOA 2L6BA 5JA4D 4MHCA 3TLSA 2L0IA 4G24A 3KV9A 4U07A 2V7IA 3AS4A 1Z8UA 2HPLA 4G25A 2PBIA 3CVRA 1NWMX 3TLVA 1KF6A 3QC9A 5HI7A 2XZTG 1OEDE 2JIWA 4ADZA 5T8IA 2LO6A 3I9WA 3PJAJ 2B76A 2VASA 1Z3YA 1KNRA 5A7DB 4E85A 4KUMB 4ANJA 5LA6E 2CLYC 2UXBT 2RD0A 2KBXA 1AJ3A 2BG9B 2GRRB 2PM6A 2VSNA 4JPSA 1XNFA 2QRXA 5IUXA 3AE8A 5HCJA 4GA1A 1Y8MA 4KZ0A
chains in the Genus database with same CATH topology
3SZ7A 3VKGA 2H3RA 3MV2B 2CHZA 1OUVA 3LKUA 2YQ8A 4J0UA 2D0UA 2XAJB 1NA0A 2IF4A 4G11A 4LEUA 2KINB 4YJ3E 2PZIA 3JCKC 3RRCA 1VRBA 4N39A 2OOEA 3I9YA 2D5UA 5GONE 5HWYA 4BJNA 3C4WA 4PNIA 2MRIA 1IHGA 5M4YA 1HTJF 5FQ8A 2ACXA 3MKQA 4MLPA 1IQUA 4JA7A 2J4DA 3ZYMA 2XRYA 1ZU2A 5LOZA 4HLEA 5JDGA 4LCTA 4G1TA 3D9JA 1YKEB 1KK7A 3CGHA 4A1GA 3ZN3A 5JDLA 4PJNA 3D3MA 5BUZA 4W9RA 3G2UA 3PZDA 4GAAA 4J8SA 4XI0A 4Q94A 1HG5A 4JEHB 3U4TA 1E7VA 2X6IA 4H9OC 1YA0A 4FP7A 3CVYA 3AB3B 2J08A 2UY1B 4O4JE 3PU8A 5FY1A 4B89A 3LJCA 2L6JA 3OTNA 3R7RA 3FXEB 2VTBB 2R17C 3PEVB 1Y64B 2CWOA 2KCKA 4I9CA 5HQ8A 3RPUA 4AKIA 2X6KA 1HS6A 3SBTB 3ZMVB 1OWAA 1O3XA 2D0TA 2EHOA 1U3CA 2PQRA 3IV0A 5L3GB 3LK2B 5F8PA 3UQ3A 4CGWA 4CQIA 3FEXA 3PREA 2XAFB 4DLQA 1HO8A 2Q9QA 3O9XA 2LM9A 4K0RA 3ZN1B 3HVEA 4WNGA 4PDXA 4UIGA 5HAXA 3EIJA 3IEEA 2IOLA 3BQIA 4TV8E 1OWLA 2QFCA 2LHNA 3N9PA 3OXFA 4PFOA 1JUQA 3UFEA 4MKTA 4OYKA 4E6HA 4FHKA 3CVNA 3S4UA 2XEVA 1B89A 1D0YA 2LSIA 4GPKA 2WXJA 4MFRA 3L22A 4LUNU 2L3LA 4F1SA 5CA0E 4GK5E 5CMYA 5LBQB 2EQXA 3AAEB 5LJMA 1FVHA 3C4ZA 4CXYA 3R9AB 4AY6A 3K9IA 3SRZA 1Z3XA 2LOSA 3ESKA 4UVCB 3PE4A 2J9QA 2E9XC 2NTYA 4QXCB 5A23A 3IBEA 2WXMA 4Q69A 3GZ2A 3WXXA 4EPZA 2YNQA 3ULQA 3ZPOA 5JHBA 4CI2B 3LBXB 5LP6E 5CA1E 5C1DA 4MBQA 3RO2A 5G04C 4CI1B 5AJDA 4UVBB 4DBRA 1OWPA 2W62A 3BG0B 3ZEFA 3CHRA 2OV8A 3DTOA 3SOLA 4I4TE 2NWBA 2BTDA 5LOVE 2IU1A 5EX0A 5AFUL 1SZAA 1UN8A 5LXTE 1TJFA 4F6RC 3PH0C 4HFVA 5HYAA 3RC8A 4MLKA 2I2OA 4ILHB 3MXZA 2PQNA 4N5CA 1H2TC 4G2AA 2BVLA 5IYZE 2FEZA 2WXFA 3B57A 3RKVA 4X20E 2V0PA 3U9WA 4JEHA 5T3RA 3HKDE 4PW8A 1HCIA 3P7IA 4H9PC 2G0UA 2A4ZA 4WNFA 2KM4A 4H9RC 1VDYA 4I1AA 4WBOA 3EHMA 5AENA 4P29A 5AYWD 2YHEA 3KFWX 3FXDB 3CV0A 1UJJA 3QWVA 2L0TB 1HZ4A 3FEYA 2Y6XA 3L54A 3APFA 1OWNA 1EZ3A 4B8AA 2VGXA 2WXKA 4ZI3C 4V3IA 3HA4A 2IFUA 3KBUA 5KJLA 3V5SA 3N9NA 3HL6A 5L3FB 2C0LA 3JQ1A 4CRWA 4ZS2A 1MIVA 2MOZA 3K3NA 4GU5A 1LF8A 3ZLIA 2FO7A 4LERA 4ISTA 4F53A 2VSYA 2HH7A 3OBVE 1MIWA 4JEUB 3CVXA 4DMVA 3APCA 3E22E 3QOUA 4N3BA 3KV6A 2KWHA 4GZ5A 3VLDA 5E76A 5D0QD 1ELKA 3CQXC 2XCBA 2ODUA 4AVXA 4JL0A 3ZYQA 4AI6A 3Q5WA 4QX8B 2VB6A 5FXWA 2OA5A 4YLHA 3GN5B 3KDSE 3L13A 4ZHQE 2QY7A 3G2SA 4BY6A 4A3TA 2KATA 3MACA 3U78A 3PUKA 5LFAA 4AJWA 2CHXA 5BV0A 3RKOA 4JUYA 4JHRA 3QAQA 1WAO1 5JVDE 2NC9A 2VSOE 3CHOA 5KJNA 1SQMA 2DIWA 5HXRA 5G04J 3LG7A 4GZCA 5BMVE 2C2LA 4Z8XA 4UV9B 3GA8A 3E0ZA 4X1YE 4AM9A 4XKBA 4UI9K 3PUSA 3S7JA 1SZ9A 4ABNA 2CFUA 3NZUA 5DQVA 3MZLB 4XIFA 3CEQA 3Q5MA 5HXCA 3HI2A 4IE4A 5EK2A 2HYZA 3R84B 1KNZA 3BQKA 4N3AA 4RG6A 3FH5A 2HM8A 4C0MA 3FTYA 4WW0A 4G26A 5CCMA 5HXEA 1KLXA 2YHCA 2X6FA 3MV3B 3ZEFB 3ENEA 2ZM2A 3KV5A 4O8SA 2DBAA 2FI7A 3LPZA 3RH3A 3T5XA 3Q5XA 4CXWA 4AKHA 4GIWA 4IIJE 4HKAA 2KCVA 5CCLA 1NP7A 2N1GA 5LHGB 3WI3A 3WAKA 4EIWA 2NP9A 2C5IT 2WXNA 2KWIB 3EVYA 4GYRA 4HTEA 3EHNA 4ANUA 3CSFA 2MOWA 1YW0A 2LNIA 3LY9A 3MGBA 3CVUA 2YEVC 3ZFWA 5EKQD 3E08A 2RA1A 2EHOB 3HYMB 3Q4AB 4B8CB 1NA3A 5EDSA 3SBSA 3AA7B 5FY7A 3G2VA 4O4HE 3ANWB 3JYSA 1OWMA 5IHYA 2CCQA 3ZGQA 4UI9J 3RC3A 2AVPA 2Y4TA 5HXHA 2FF4A 3U64A 2JQQA 2VQ2A 3PDYA 3VHLA 3R7QA 3TGOA 2E9XB 1LVFA 3O1JA 4HGAA 4H7XA 3AAIA 5JREA 1U3DA 1BR1A 4HOTA 2V8SE 2WM9A 3NF1A 2VGYA 3RIBA 3WAJA 3QJZA 3NRYA 2ZMAA 4JHKA 5HXSA 3IHVA 4GA2A 4PAGA 1HX8A 4PH4B 4BAYB 4AQFA 3LY7A 4TX5A 2A2FX 5EZYE 4X1KE 1INZA 4ZS3A 2KLQA 1E8WA 5J1GA 4QHOA 3LVQE 2RP4A 5L3BB 3FUJA 3VTYA 4MS6A 1FCHA 5ANRA 1B7TA 4FA6A 5DQWA 4K03A 3NZPA 4GCOA 2KZTB 1G8XA 2UXNB 4KT6B 2X66A 2J4BA 3HKEE 5DABA 4AKRB 3PS6A 3PUAA 3IKOB 2BF0X 2X3MA 4GK0E 4I1OB 5FQ7A 4HOSA 3HKBE 2PJQA 3KVBA 3ZIMA 2WXHA 3VLFA 4I1MA 4A1SA 4I2WA 4GMLA 4FI5A 4PK4A 3CVQA 2CA5A 4XZCA 4O2AE 2CFZA 3TAXA 3VLEA 2ONDA 2JEKA 2WXOA 3H37A 3UUXB 4UVAB 1TEZA 4HOUA 2IC6A 3PNLB 3QK0A 4EAHA 3FBLA 4CI3B 3PEUB 3PNTB 4XZ4A 1IQRA 4RSYA 3RU0A 2KXPB 3ZCJA 2V7MA 4P0AA 3E4BA 5TAOA 4L2YA 2KCLA 4C0EA 3ZJ2A 4PFPA 1MHQA 2DCFA 3UMVA 4XBFB 1BR4A 4BSXA 4L5GA 4AKLA 4Y6WA 1X79A 2V26A 4TZ4C 3CVLA 4PJLA 3ZMTB 3L08A 3LYAA 4QKNA 4U63A 3AA1B 3VTXA 5EK4A 4ZI3D 2H7VC 2IW5B 1HG2A 1N52A 4J8FA 2IONA 3ASHA 3Q15A 3CVPA 3KAEA 2V7LA 2PM7A 2ZM8A 4ANWA 4GMJA 3K3OA 1TJCA 3ONXA 2XAGB 4ME2A 1UG3A 4H9SE 4CZZB 2NOXA 2VGXB 2X38A 4CXXA 2WB2A 3PDNA 3ZJ1A 3FUHA 5J08A 5LGNB 3DBSA 1EYHA 4ANXA 3IHYA 3FTXA 3UX4A 4PK6A 4FADA 4ZI2D 3AS5A 3LY8A 5JDNA 3CVVA 1QSDA 3OJAA 1FMVA 4AY5A 1W3BA 4N78D 4L23A 4QXBB 4E7SA 3MYVA 3RYHE 5JDHA 2W61A 2SPCA 4WNDA 4CDMA 3RYCE 2WSSV 3ZPJA 3ZW3A 2I9CA 3I4GA 4CDRA 2MHKA 4C90A 4FC8A 4ILGA 4U0SA 2LEHA 2A72A 3I5PA 3ZHEA 1E90A 5LGTB 5JDMA 2HR2A 1MIYA 3N2OA 1WRDA 4EBAG 4IHJE 4GA0A 3N2GE 4QWNB 3BEEA 2YU1A 3L3PA 1U5PA 2NW8A 4FJOA 1NAFA 4MALA 5L3EB 3QC1A 3QDNA 3CK7A 3L09A 1ZBPA 2LT3A 4OHFA 3OXLA 3MKDA 5KJMA 3C50A 4TRQA 3GYZA 5DJQC 2Y4UA 3HDXA 4KYOB 4UWGA 3FHNA 4E7ZA 2XGOA 1QQEA 4I43B 3P1UA 4AP2A 4ERRA 5C8YE 3ETUA 1H6KA 1JWFA 1H19A 4G23A 2I1KA 5FNVE 3J7Yq 2KT9A 3GW4A 2ZLYA 3AA6B 4NACA 3FH8A 5ARGA 5BV1A 3CWZB 4AEZC 4EZ4A 4UF0B 1U4QA 3LK3B 3HR0A 4WNKA 2A3DA 2CXFA 4I43A 2EHOC 3FUNA 3ZYLA 3L16A 4J8DA 2E0IA 5JJTA 4ATGA 4I50E 3O4ZA 2K5BB 3ZMUB 3M65A 3GWHA 5LX8A 1WYCA 3FP3A 4U0ZA 3QK6A 5DBKA 3RRMB 3OYXA 3G2TA 3LCAA 2NW9A 4KMCA 4EXTA 5KJKA 1FMWA 2ZM0A 4JEUA 2E2EA 4CT4A 4J8EA 3U66A 3CX8B 4BTBA 1Z6TA 4I6JA 1D1AA 5D0OD 3FUFA 4U74A 3UUMA 3CQGB 4NUVA 4BX9A 3ETVA 5AIJA 5JR9A 5BNWA 4O6FA 5FY0A 2MYSA 3SWHA 3GZ1A 2XUEA 4HEAA 3TG5A 2K9AA 3I3NA 4GYOA 4UQXA 4HE8A 4UF0A 5E0OA 4U0UA 4AXHA 3CIAA 5FXXA 1E8XA 1D1CA 3GMIA 3T8MA 2JRKA 3AU5A 3ZXSA 4FULA 5FJYA 4BA9A 4A55A 2DHRA 3F31A 2L9BA 3PUGA 4L9IA 4P09A 3ASDA 5FXVA 1EPUA 2FBNA 2AXVA 2LAIA 2QGSA 3VU7H 3QUJA 3RYFE 3D9NA 1EF1C 4JHJA 3CLJA 1HXIA 4DK5A 2DWGA 3G2WA 3EDUA 2NXPA 1KT1A 4DPRA 1HF8A 4JZYA 3KVAA 4F7AA 3K8PC 5JDFA 5FZSA 3JC6D 3SS1A 3C98B 1WM5A 5A6CA 4ISSA 2IOSA 1MNEA 4G63A 2X9YA 3LVRE 4HXIA 3A5XA 4EECA 2LSGA 3BK9A 2CG2A 3CKBA 5LG4A 3ZYKA 5A1LA 1ELWA 2J49A 3JQ0A 1WLXA 4OVUA 1MMDA 4NURA 5JHAA 4DVDA 4URKA 1PC2A 4WUYA 2V7JA 2WPVA 2LOPA 4ACKA 4HFGA 5FQ4A 4EZJA 4HOQA 2XHEB 5M72A 3ASFA 5LJNA 4OYSA 2CHWA 2LE8A 2ILRA 1UCUA 2BZBA 2I1JA 1CUNA 4KZCA 3S7FA 4NQ0A 4KVMA 3UTKA 4WWNA 2GRLA 4L1BA 1IYGA 2X6JA 4IDZA 3CKCA 5G2NA 5LGUB 4DI4A 5G55A 2DI4A 4D10C 4ILIA 3S7BA 2KZ7B 3TKLB 1HFAA 2WXQA 1QUUA 3FWVA 4DO0A 2JJ9A 2DNXA 3RX6A 5FWQA 3F2EA 4BJMA 2JLBA 1WYBA 3PE0A 2DLRA 3O1IA 3ASGA 2L8KA 5LYJE 1UX5A 3CPZA 4KMOA 2C5JA 3T8OA 2AXUA 3V5UA 3QARA 4RVBA 3LBXA 3MK7C 2DWKA 2CWYA 2CLYB 2W63A 2UWJG 1D0XA 5ARFA 2E9XD 3CX7B 3ANWA 4XX5A 5H6QB 2X51A 2C0SA 1OWOA 5ETWA 5JQGE 2XGSA 3D9KA 3FFLA 2BVMA 3MEKA 4CEMA 3CSTA 3IHRA 3F57A 2NSZA 2CXDA 5JR9B 3FTUA 4EZLA 2VWAA 4CDNA 4JA9A 4IE6A 2LHRA 3UPVA 4G2VA 3TXMA 4BTAA 2YU2A 3PTRB 2MBGA 2YINA 2XHEA 2WXIA 1PY1A 3IEGA 4WBNE 3MZKB 1GW6A 4K0UA 3L6AA 3NRXA 4AKGA 2WQ6A 4YNDA 4L0RA 3LXUX 4V1Av 1ZEEA 5FZQA 1HU3A 2WMNA 4I9EA 3IBPA 3I4RB 2Y8DA 3Q47B 4GCNA 4GZ3A 2AXZA 2W00A 4FJZA 5FZRA 3K3QC 4HN9A 4ACLA 2N9DA 3UT4A 3KBTA 3N9MA 3ZCIA 3ML8A 5ADXL 4FLHA 1S94A 3LJ3A 4DNDA 2XRZA 2J1DG 3KEZA 1YD8G 3L17A 4F3VA 1S35A 4I2ZA 2PL2A 4XI9A 3FU6A 5FP3A 1JPLA 1LVKA 3MJXA 2HO1A 4X1IE 1D0ZA 3I1AA 1UW4B 4TUYE 2WMOA 4EOZB 1KT0A 2E9XA 4EB6E 3B7SA 4WWPA 4BX8A 3TJPA 3MKRA 3CHMA 4DMWA 2XCCA 2WAUA 4UWFA 4QFVA 1MQSA 3B13A 2XASB 5HWXA 3UT8A 1NZNA 4KP3C 2VKDA 3O4XE 3PU3A 4LRZA 1E96B 2A5UA 3Q49B 5J2UE 1JWGA 3QNKA 3J9X1 2IQCA 3FBZA 3LS8A 1UN9A 2JPFA 4C9BB 3D9LA 1H2VC 2Q7FA 2EHOD 3NZQA 4DLOA 3ZMSB 3ZHEB 3OYZA 3PURA 2I59A 3T5VA 2WXRA 3CHPA 5LHHB 5JJ6A 4N2QA 3D0TA 2NW7A 1MMAA 3NBXX 2LSVA 4QXHB 3TL5A 2WWUA 4AQGA 3FULA 3LDZA 4C91A 4IE7A 5KX5E 5G05C 2VKOA 4TUUA 2FULA 3W15B 3EUHA 3IF8B 4YJ2E 4TV3A 3ZN0B 4JW1A 2D2SA 3S2AA 2PG8A 2XAQB 3H3AA 5LHIB 3SGHA 2KNDA 4YVOA 3N9QA 4BWRA 4NUUA 1L5JA 3SF4A 3SD5A 5F3JA 5BPPA 3FUKA 2R59A 1H0AA 3VKHA 1MNDA 4B6XA 4I17A 1V9DA 2AWIA 3KINB 1DNPA 2XGMA 2VKHA 4YVQC 2XTLA 4UQZA 3N5LA 4O4LE 4CT0A 3EJNA 5G05J 5L3DB 2LSUA 3S7DA 5CB4E 1SA0E 2M63A 4EZHA 3LK42 3MA5A 2V1DB 4U04A 2GK9A 5J90A 1H7CA 1BPOA 5LCWC 5JDQA 4EZKA 3OKQA 2GRMA 3UT7A 3AVSA 3APDA 2X68A 2XAHB 1ELRA 4AIFA 5JJ7A 3I0QA 3HKCE 1OXZA 4GZDA 1D1BA 2UY1A 3JC6C 2ODVA 2XPIA 4OK0A 1Y6IA 4PUCA 3D9PA 3CK9A 1T98A 3B7TA 2X67A 2VYIA 3PE3A 2GGFA 3HHMA 4MRUA 1N54A 4A56A 1DVPA 1XGWA 4U72A 2XPYA 1QZ2A 3ONKA 4DI3A 4APOA 5BT1A 1UX4A 3N2KE 3SFZA 5JRCB 4RG9A 5J2TE 3FTSA 4FLBA 4AQFC 2N2NA 5ENNA 2Q9QD 4XAXB 2CM0A 4UXNB 2V4LA 3OXGA 3RYIE 5FT9A 2ES0A 4JVSA 4APFA 3ONLA 4UWHA 2XQYA 4BT9A 3D9OA 2Y48B 2OVBA 2CEAA 2P9BA 1BR2A 4H9NC 4ZI2C 1MMGA 4B0ZA 4KBMB 2DCPA 3CK8A 3FUMA 3U3IA 3MX3A 2CXLA 2E8IA 4O4IE 2Y3AA 1YKHB 1HH8A 2I6HA 3UUNA 1FVFA 2RG8A 4UWLA 4EQFA 4UQYA 2OVFA 5E75A 3TG4A 4Y6CA 3N71A 3ZMZB 2J09A 1E8ZA 2L9QA 4IULA 4M3OA 3P2BA 3KD7A 4HS2A 3SNXA 1WR6A 4ZI7E 4PS7A 3UUXA 1HE8A 4JXTA 5AJLA 3FUDA 4GYYA 3B7RL 3RJVA 2J07A 1E1HB 4ILUA 4ANVA 1US7B 2BDEA 2LJLA 5LP0A 4OYJA 4UI9C 3Q2MA 1EDUA 3FHEA 2QA7A 2VJ8A 1A17A 3O48A 3FU5A 3PUJA 2VSXE 3O1HA 5FQ6A 1S0PA 3CR3A 4J6IA 5ANLA 5L2LA 1UJKA 5LNKA 4M1PA 2Z6EA 3LEWA 2WXGA 5L3CB 5C2YA 4GB9A 2P58C 2VL8A 3C98A 3ZC0A 4GZ6A 1QNFA 4EBAA 4I55E 5T4YA 2IJGX 1Z0PA 4U8HA 4CCAA 4DBQA 5CMWA 5FMNA 3FB2A 4YHJA 4KBQA 3B7UX 5KMGP 3EIQC 2X9HA 3URZA 3NQPA 3KV4A 3FUIA 1SHZC 1WY6A 3LFMA 3FU0A 3ZRHA 1IJ6A 5KCMA 4UWKA 4AV7A 3KS2A 4PS3A 2WXPA 2KMFA 4TV9E 2XPZA 3MKQB 4WAFA 3FDHA 2X9XA 3RRWA 4L7TA 3QKYA 4IN3B 2V7KA 4GYSA 4XE0A 1G73A 3C64A 3FTZA 3CMLA 3DP7A 1FEWA 3CQCB 3I0OA 2HPJA 4BT8A 4UEMA 3N9LA 4A3VA 2KZTA 2VKJA 5LCYA 3CHQA 4I6GA 2X9WA 2X6HA 3TXNA 3QB2A 1HS7A 1MMNA 3JUIA 3RO3A 1X5BA 3U3WA 2ZU6B 5JRCA 3DPDA 3SHFA 1IAPA 4PS8A 4Q96A 2PFVA 3AU4A 5BW8C 4H9QC 4HVBA 3SI5A 3RRUA 4H63H 2X0LB 3QWPA 4GOUA 4UV8B 4H7YA 1IJ5A 2B1EA 4IRUA 4GYWA 3AVRA 5EX3A 2C0MA 2M67A 4UELA 3C51A 4FU3A 3MA9A 1ZKEA 3FU3A 4AOFA 1E8YA 5LCWJ 3UT5E 2R5SA 3BG1B 2CMRA 4WNEA 4HORA 2WQ7A 3ZVVA 3MCXA 4EYYR 4J2CA 2NTXA 4N2SA 4KXKB 3ML9A 4EYUA 2UXXB 4PJJA 4CGVA 3UULA 3FTVA 3BQLA 2IAKA 3P8CD 3FTWA 4B94A 2Q9QB 1ZV4X 5JH7E 2KC7A 2LSJA 5CHEE 5DIZA 3NZSA 4ASKA 4JC8A 4FHJA 3PUQA 4NRHB 2YK0A 4BFRA 4P0BA 1LRZA 2LAHA 3RK6A 4N3CA 3FY4A 3Q9DA 2VTBA 4H63V 2AW6A 3R6NA 3DJBA 2JMKA 3CX6B 1E7UA 1BR0A 2GW1A 4ZOLE 2WVIA 4O2BE 3N9OA 3OAWA 2MTQA 4YFSA 4AXPA 5FYMA 2C5KT 3FH7A 4L2LA 5LBMA 1P5QA 4TN7B 4IE5A 4I6EA 4IYPA 4PJMA 4R7LA 5JR9C 1FIOA 2WQHA 3D9IA 2CE7A 3RRNB 2LSYA 5FTPA 3PVLA 4OVVA 5H6RB 3QWWA 2VK9A 2K48A 2K24A 3HIZA 1ZHCA 1PAQA 3GZSA 4XKCA 3EDTB 4FJYA 3PRZA 1LKXA 5EK3A 2LSKA 4IE0A 4OFZA 3ZC1A 2Q9QC 3EDVA 4IGUA 4DJAA 4JLEA 2IC9A 3AS8A 4KVOA 4WWOA 4QX7B 2V5FA 3FUEA 5KDMC 1IZNB 2H7OA 3HVEB 5FXZA 3AA0B 2CG3A 3ESLA 3AAAB 4PK5A 2W0GA 3CHSA 3MJWA 1VOMA 3D9MA 3C4XA 2XQ0A 3GN5A 3CKDA 2BUGA 2WXLA 2WBLA 2JMHA 1H2UA 3CVWA 4MHCA 2L0IA 4G24A 3KV9A 4U07A 2V7IA 3AS4A 2HPLA 4G25A 2PBIA 3CVRA 1NWMX 3QC9A 5HI7A 4ADZA 5T8IA 2LO6A 3I9WA 5A7DB 2VASA 1Z3YA 4E85A 4KUMB 4ANJA 5LA6E 2CLYC 2RD0A 1AJ3A 2PM6A 2VSNA 4JPSA 1XNFA 4GA1A 1Y8MA 4KZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HF8 A;  1UJJ A;  1EDU A;  1DVP A;  1XGW A;  1H0A A;  2L0I A;  1X5B A;  2L0T B;  3D9L A;  1HFA A;  2MOW A;  3LDZ A;  1ELK A;  1JWF A;  1HX8 A;  3G2T A;  3ONK A;  4FU3 A;  3D9K A;  1LF8 A;  3ONL A;  4Q96 A;  3G2U A;  3ZYL A;  1SZ9 A;  5CMW A;  4GZD A;  3D9O A;  4Q94 A;  2DIW A;  5CMY A;  4AVX A;  3ZYQ A;  1HG5 A;  2BF0 X;  4JXT A;  2LO6 A;  3RRU A;  1HG2 A;  1INZ A;  3ZYM A;  1MHQ A;  2KM4 A;  3D9I A;  1VDY A;  4GZC A;  5J08 A;  1SZA A;  1UJK A;  4HFG A;  3D9M A;  3D9N A;  4NAC A;  1JUQ A;  1EYH A;  5LOZ A;  1JWG A;  3CLJ A;  2QY7 A;  3D9P A;  2V8S E;  4FLB A;  3G2S A;  5LP0 A;  2DCP A;  3D9J A;  3G2W A;  3G2V A;  1JPL A;  3ZYK A;  1PY1 A; 
#chains in the Genus database with same CATH topology
 5KXJ A;  5AQF B;  2YDR A;  3SZ7 A;  3VKG A;  2H3R A;  3MV2 B;  2CHZ A;  1OUV A;  3JAD A;  5HEU A;  3LKU A;  2YQ8 A;  4J0U A;  3AXJ A;  2D0U A;  2XAJ B;  1NA0 A;  2BED A;  2IF4 A;  4G11 A;  2ZGD A;  4LEU A;  3RSE G;  2KIN B;  4YJ3 E;  2WQY A;  4GMR A;  2PZI A;  3JCK C;  3RRC A;  4DX6 D;  1VRB A;  4N39 A;  2BG9 A;  4GPM A;  2OOE A;  3I9Y A;  2D5U A;  5C3J A;  5GON E;  1CHU A;  5CBO A;  5HWY A;  4BJN A;  3C4W A;  4PNI A;  2JQH A;  2WDR A;  2MRI A;  1IHG A;  5M4Y A;  1HTJ F;  3JCF A;  5FQ8 A;  2ACX A;  3MKQ A;  4MLP A;  1IQU A;  4JA7 A;  2J4D A;  3ZYM A;  2XRY A;  1ZU2 A;  2X0H A;  5LOZ A;  4HLE A;  5JDG A;  1TNB A;  4LCT A;  4G1T A;  3D9J A;  2YKS A;  1YKE B;  4U8V D;  3AAA C;  1DC2 A;  1KK7 A;  2K3W A;  3CGH A;  3HXF A;  4A1G A;  3ZN3 A;  5JDL A;  4PJN A;  3DSS A;  3D3M A;  5BUZ A;  4W9R A;  3G2U A;  3RIA A;  1NI1 A;  3PZD A;  4GAA A;  4J8S A;  4XI0 A;  4Q94 A;  4A63 B;  4LF4 T;  1HG5 A;  4JEH B;  3U4T A;  4U7I A;  2FJD A;  3W9G A;  3ZUV B;  1E7V A;  3UTM A;  5HS0 A;  5AQO B;  2X6I A;  2LRK A;  4H9O C;  1YA0 A;  4FP7 A;  3CVY A;  3AEC A;  3BUA A;  2QYJ A;  2LM2 A;  3AB3 B;  2CBI A;  2J08 A;  2UY1 B;  4O4J E;  5AQU B;  3PU8 A;  5FY1 A;  2WS3 A;  1S64 A;  4B89 A;  3LJC A;  4DV1 T;  1OT8 A;  2L6J A;  3OTN A;  3R7R A;  2YN6 A;  3FXE B;  4GKJ T;  4IT4 A;  2VTB B;  4JI3 T;  4JI5 T;  2EIN E;  2R17 C;  4KI0 F;  2WCA A;  3PEV B;  1Y64 B;  3NAW A;  2CWO A;  2KCK A;  4I9C A;  4IL9 A;  5HQ8 A;  3RPU A;  4AKI A;  2X6K A;  1HS6 A;  3SBT B;  3ZMV B;  1OWA A;  1O3X A;  3AG1 E;  2D0T A;  2EHO A;  1U3C A;  2PQR A;  1WR0 A;  3IV0 A;  5L3G B;  5BXO A;  3LK2 B;  5F8P A;  1BI7 B;  3UQ3 A;  4CGW A;  4A97 A;  1O5M A;  4CQI A;  4DV6 T;  3FEX A;  2J4G A;  3PRE A;  4CN6 A;  2XAF B;  4DLQ A;  5HEO A;  1HO8 A;  4Z68 A;  2EIJ E;  2Q9Q A;  3O9X A;  3J5P A;  2LM9 A;  4K0R A;  3ZN1 B;  2PTF A;  2R6G F;  2VL0 A;  3HVE A;  4WNG A;  4PDX A;  4UIG A;  5HAX A;  3EIJ A;  2P9N G;  3PZ4 A;  3IEE A;  2IOL A;  3BQI A;  4TV8 E;  1OWL A;  2QFC A;  2LHN A;  2BBJ A;  3N9P A;  4JI2 T;  3OXF A;  4PFO A;  1JUQ A;  3DXM G;  3UFE A;  3DPY A;  4EGW A;  4MKT A;  4OYK A;  4E6H A;  2XQA A;  4FHK A;  3CVN A;  3S4U A;  2XEV A;  1B89 A;  1ZOY A;  1D0Y A;  2LSI A;  4GPK A;  3QOF A;  4U2Z A;  2WXJ A;  1X9B A;  4MFR A;  3L22 A;  4LUN U;  2L3L A;  4HWF A;  3UUB A;  4F1S A;  5CA0 E;  4GK5 E;  1NFI E;  3DST A;  5CMY A;  5LBQ B;  1OCR E;  2EQX A;  3AAE B;  5LJM A;  1FVH A;  3C4Z A;  2IEJ A;  2BS2 A;  4CXY A;  3R9A B;  3UU8 A;  4AY6 A;  3K9I A;  1N34 T;  3SRZ A;  4X5T A;  1LD7 A;  1Z3X A;  2UUB T;  3TLU A;  2DL1 A;  2LOS A;  4QH5 A;  4DX1 A;  3ESK A;  4UVC B;  3PE4 A;  2J9Q A;  2E9X C;  2NTY A;  4QXC B;  5A23 A;  3IBE A;  2WXM A;  4Q69 A;  3GZ2 A;  3WXX A;  3EAB A;  3ULY A;  2J8S D;  4EPZ A;  2OCC E;  3EHQ A;  5EIL A;  2YNQ A;  3ULQ A;  3ZPO A;  2AJA A;  5JHB A;  3TLW A;  4CI2 B;  3LBX B;  5LP6 E;  5CA1 E;  5C1D A;  4MBQ A;  3RO2 A;  5G04 C;  4CI1 B;  5AJD A;  4UVB B;  4DBR A;  1J5W A;  1OWP A;  2W62 A;  1SW6 A;  3BG0 B;  3ZEF A;  4ZHB A;  3CHR A;  2HN1 A;  4DUZ T;  2OV8 A;  3DTO A;  1NEK A;  3SOL A;  4I4T E;  4CN1 A;  5AQL B;  1MX4 A;  2NWB A;  2NYJ A;  2BTD A;  5LOV E;  2IU1 A;  5CFB A;  5EX0 A;  5AFU L;  1HNX T;  1SZA A;  1UN8 A;  5LXT E;  2LLY A;  2YDQ A;  4F6R C;  1TJF A;  3PH0 C;  1YQ3 A;  4HFV A;  5HYA A;  3RC8 A;  4MLK A;  2I2O A;  1IBK T;  4ILH B;  3MXZ A;  2PQN A;  4N5C A;  1H2T C;  4G2A A;  2BVL A;  5IYZ E;  2FEZ A;  2WXF A;  3B57 A;  3ABM E;  3RKV A;  1N0Q A;  4X20 E;  3AEE A;  2V0P A;  3U9W A;  4JEH A;  5T3R A;  3HKD E;  4PW8 A;  1HCI A;  3P7I A;  4H9P C;  2G0U A;  2A4Z A;  5LMU T;  3C5R A;  2KM4 A;  4WNF A;  4H9R C;  1VDY A;  2F8Y A;  3J5Q B;  2XJ7 A;  2P2C P;  4YDW A;  4I1A A;  5HEJ A;  4WBO A;  3EHM A;  1N4S A;  5AEN A;  4P29 A;  4YT0 A;  5AYW D;  3UM1 A;  2YHE A;  3KFW X;  3FXD B;  3CV0 A;  4X64 T;  3DSU A;  1UJJ A;  5CGM A;  1TR4 A;  3QWV A;  2L0T B;  1HZ4 A;  2XEH A;  3FEY A;  1OY3 D;  2Y6X A;  3L54 A;  3APF A;  1OWN A;  5ENS D;  3SO8 A;  5AAR A;  1EZ3 A;  4B8A A;  2VGX A;  2WXK A;  1W09 A;  1XNQ T;  4ZI3 C;  4V3I A;  3HA4 A;  4TNV A;  2IFU A;  3KBU A;  5KJL A;  1O1T A;  3V5S A;  3N9N A;  2MAW A;  3HL6 A;  1W0B A;  5L3F B;  2C0L A;  2ACZ A;  3JQ1 A;  4CRW A;  2BS3 A;  4ZS2 A;  1MIV A;  2MOZ A;  3K3N A;  4YTM A;  4JI7 T;  4ZXL A;  3D9H A;  3AXJ B;  4OAU C;  4GU5 A;  1LF8 A;  3ZLI A;  2FO7 A;  4LER A;  4IST A;  4F53 A;  4JBW F;  4LFA T;  3UM3 A;  2VSY A;  2HH7 A;  3L9T A;  3OBV E;  2UXD T;  1MIW A;  4JEU B;  3CVX A;  1V54 E;  4DMV A;  3APC A;  2ETA A;  3E22 E;  3QOU A;  4N3B A;  2BKP A;  3KV6 A;  5AQM B;  3AG4 E;  2KWH A;  4GZ5 A;  3VLD A;  5E76 A;  5D0Q D;  1ELK A;  2H6H A;  4KX6 A;  1YQ4 A;  3CQX C;  2XCB A;  4U7E B;  2E5V A;  2ODU A;  1FT1 A;  4AVX A;  4JL0 A;  3ZYQ A;  1T7S A;  4AI6 A;  3Q5W A;  4QX8 B;  4LNU D;  2VB6 A;  5LB7 B;  4JI4 T;  5FXW A;  3UKU G;  2OA5 A;  4YLH A;  2DWZ A;  3GN5 B;  3KDS E;  3L13 A;  4ZHQ E;  2QY7 A;  3UU3 A;  3G2S A;  4BY6 A;  4A3T A;  2KAT A;  3M3Z B;  3MAC A;  3U78 A;  3PUK A;  4N5Q A;  4AJW A;  5LFA A;  1I6Z A;  2CHX A;  5BV0 A;  3RKO A;  4JUY A;  5AQ7 A;  4JHR A;  3DSV A;  3QAQ A;  3X2Q E;  1WAO 1;  2J47 A;  4OX9 T;  5JVD E;  3KSL A;  3P50 A;  2NC9 A;  4NXM T;  2VSO E;  3CHO A;  5KJN A;  1SQM A;  2DIW A;  5HXR A;  3JAE A;  4X8Q A;  5G04 J;  3UI2 A;  3LG7 A;  4GZC A;  5BMV E;  2C2L A;  4Z8X A;  3PUY F;  2HN2 A;  4UV9 B;  3GA8 A;  5ABF A;  3E0Z A;  5CJ5 A;  4X1Y E;  4AM9 A;  4YY3 T;  4XKB A;  1UGO A;  3PZ1 A;  4UI9 K;  3PUS A;  3S7J A;  3TWX A;  5FIO A;  5L4E A;  2V5C A;  1SZ9 A;  3E32 A;  4ABN A;  2CFU A;  2WY2 A;  3NKZ A;  3NZU A;  5DQV A;  4QH1 A;  3MZL B;  4XIF A;  2XQ5 A;  1HR0 T;  3CEQ A;  2BBH A;  3Q5M A;  4M7C A;  5HXC A;  2Y0B G;  1K1A A;  3HI2 A;  4IE4 A;  5EK2 A;  2HYZ A;  3R84 B;  1KNZ A;  3BQK A;  4N3A A;  4RG6 A;  2V6Y A;  3FH5 A;  2MYO A;  2HM8 A;  1XZY A;  2XQ8 A;  1X81 A;  3FTY A;  4C0M A;  1HX1 B;  4WW0 A;  4G26 A;  5CCM A;  1JNR A;  5HXE A;  1KLX A;  2YHC A;  2X6F A;  3ZST A;  1G3N B;  4ZZB A;  3Q5E A;  2P9S G;  3MV3 B;  3ZEF B;  3ENE A;  4U31 A;  2ZM2 A;  3KV5 A;  1OED C;  4O8S A;  1TNY A;  2DBA A;  2FI7 A;  3LPZ A;  4O60 A;  1AP7 A;  3RH3 A;  2D9D A;  3T5X A;  3Q5X A;  4CXW A;  4AKH A;  2H6G A;  4GIW A;  4IIJ E;  4HKA A;  2KCV A;  5CCL A;  1NP7 A;  3W9F A;  2N1G A;  4LSZ E;  5ENP D;  5LHG B;  3WI3 A;  1D8D A;  3WAK A;  4EIW A;  2NP9 A;  2C5I T;  2WXN A;  1H6O A;  2KWI B;  3EVY A;  2QC9 A;  2JQ9 A;  4GYR A;  4HTE A;  3JXI A;  4K5B A;  3EHN A;  4ANU A;  3CSF A;  4GTR A;  2MOW A;  1YW0 A;  2LNI A;  1N94 A;  3LY9 A;  3MGB A;  3CVU A;  5ENR D;  2YEV C;  3ZFW A;  5EKQ D;  3E08 A;  2RA1 A;  1QBQ A;  2EHO B;  3HYM B;  3Q4A B;  4B8C B;  1NA3 A;  5EDS A;  3SBS A;  3P4P A;  4AQY T;  3AA7 B;  5FY7 A;  3G2V A;  1TN7 A;  4O4H E;  3ANW B;  3JYS A;  1OWM A;  5KBA A;  5IHY A;  2CCQ A;  4HI8 A;  3ZGQ A;  1IXV A;  4UI9 J;  3RC3 A;  4HWI B;  1FPP A;  3V2O A;  3KEA A;  2AVP A;  3UU4 A;  3A7M A;  2Y4T A;  2V5D A;  1IKN D;  5HXH A;  2FF4 A;  3U64 A;  2JQQ A;  4IDN A;  2VQ2 A;  3PDY A;  3VHL A;  5CRV A;  3R7Q A;  3TGO A;  2R2L A;  2E9X B;  1LVF A;  3O1J A;  4HGA A;  2BKN A;  4H7X A;  3AAI A;  5JRE A;  1U3D A;  4GTT A;  1BR1 A;  4HOT A;  2V8S E;  2WU5 A;  2WM9 A;  3NF1 A;  5BXU A;  2VGY A;  3RIB A;  3WAJ A;  3QJZ A;  3NRY A;  2ZMA A;  4JHK A;  5HXS A;  3T9K A;  3ZT6 A;  3IHV A;  4GA2 A;  4PAG A;  1HX8 A;  4PH4 B;  4WYV A;  4BAY B;  4AQF A;  4LF6 T;  1N4R A;  3AEG A;  3LY7 A;  4TX5 A;  2A2F X;  2W4X A;  3RF1 A;  5EZY E;  3TWW A;  4X1K E;  1INZ A;  4ZS3 A;  2KLQ A;  1E8W A;  5J1G A;  4QHO A;  3LVQ E;  5CEA A;  2RP4 A;  5L3B B;  3FUJ A;  3VTY A;  4MS6 A;  1FCH A;  5ANR A;  1T72 A;  3V2X A;  1B7T A;  2FJA A;  4FA6 A;  5DQW A;  4K03 A;  3NZP A;  4GCO A;  1N95 A;  3L8R A;  3DSX A;  2GRQ B;  4J7W A;  2KZT B;  1G8X A;  2UXN B;  4KT6 B;  2X66 A;  2J4B A;  2AE9 A;  3HKE E;  5DAB A;  4AKR B;  3PUA A;  4JI8 T;  3PS6 A;  3IKO B;  2BF0 X;  2X3M A;  4GK0 E;  4I1O B;  5FQ7 A;  4HOS A;  2F37 A;  5AQK B;  4G8K A;  3HKB E;  5JTG A;  1WFD A;  2PJQ A;  3R9M A;  3KVB A;  3PV0 F;  3ZIM A;  4DUY T;  2H6I A;  2WXH A;  5B1B E;  3VLF A;  1VCS A;  5ABF B;  4I1M A;  4A1S A;  4I2W A;  4GML A;  4FI5 A;  4PK4 A;  3CVQ A;  2CA5 A;  4XZC A;  4O2A E;  4NIQ A;  2CFZ A;  3TAX A;  1O1R A;  3VLE A;  2OND A;  2JEK A;  4IRE A;  2WXO A;  3H37 A;  3UUX B;  4UVA B;  4JYA T;  1TEZ A;  4HOU A;  4GTM A;  2IC6 A;  3PNL B;  3QK0 A;  4EAH A;  2M6B A;  3FBL A;  4YSZ A;  4CI3 B;  3PEU B;  3PNT B;  3NVO A;  4XZ4 A;  4Q25 A;  2OV9 A;  1IQR A;  4RSY A;  3RU0 A;  4EHM A;  2KXP B;  3ZCJ A;  4A98 A;  2V7M A;  4P0A A;  3E4B A;  5TAO A;  4L2Y A;  2KCL A;  4C0E A;  3ZJ2 A;  2DVW A;  4PFP A;  1MHQ A;  1JCS A;  2UUC T;  2DCF A;  3UU5 A;  3UMV A;  4XBF B;  5AQT B;  1BR4 A;  5AQB A;  3Q75 A;  2BKK B;  4BSX A;  4L5G A;  3QB5 A;  4AKL A;  1YYH A;  4Y6W A;  1X79 A;  4LMK A;  1TNZ A;  2V26 A;  4TZ4 C;  3CVL A;  4ZEY A;  4PJL A;  3ZMT B;  3L08 A;  2IO2 C;  3LYA A;  4QKN A;  4U63 A;  2WU2 A;  4B3R T;  3AA1 B;  3VTX A;  1JNZ A;  3AE5 A;  5EK4 A;  4ZI3 D;  4CN4 A;  2H7V C;  2IW5 B;  1HG2 A;  1N52 A;  4J8F A;  2ION A;  3ASH A;  4GTV A;  5ENQ D;  3E37 A;  5HKP A;  3Q15 A;  2A5E A;  3CVP A;  3KAE A;  3AEB A;  4TNW A;  1KZO A;  2V7L A;  3OVU A;  3T8K A;  2PM7 A;  1ZB1 A;  2ZM8 A;  4ANW A;  1O1S A;  4GMJ A;  3SFD A;  3K3O A;  1BI8 B;  3UQ4 A;  1TJC A;  3ONX A;  2XAG B;  4ME2 A;  1UG3 A;  2EIL E;  4H9S E;  4HFC A;  4CZZ B;  4HWH A;  1D9S A;  2NOX A;  3OPC A;  4HFI A;  4YHH T;  2VGX B;  3JXJ A;  2LKG A;  3RKG A;  2X38 A;  4CXX A;  2WB2 A;  1N33 T;  4YSX A;  2MPK A;  3ZJ1 A;  2ETC A;  3FUH A;  3PDN A;  5LGN B;  5J08 A;  3DBS A;  2BG9 E;  1EYH A;  4MBG A;  5ABH A;  2XS8 A;  2W2U A;  4ANX A;  3IHY A;  3EHR A;  3FTX A;  4YDE A;  3UX4 A;  4PK6 A;  4HRN A;  4FAD A;  2XZD G;  1VCT A;  4ZI2 D;  3AS5 A;  3LY8 A;  5JDN A;  3CVV A;  1QSD A;  1T8B A;  3OJA A;  4GTQ A;  1FMV A;  2WP9 A;  4AY5 A;  1W3B A;  4N78 D;  4L23 A;  4DR6 T;  1Z5S C;  4QXB B;  4E7S A;  3MYV A;  3RYH E;  5JDH A;  2V8S V;  2W61 A;  2SPC A;  4WND A;  3NWI A;  4CDM A;  3RYC E;  2WSS V;  3ZPJ A;  4TWD A;  3OTO T;  3ZW3 A;  2I9C A;  3I4G A;  3F6Q A;  4CDR A;  2GRO B;  4EV6 A;  2XEN A;  2MHK A;  4C90 A;  4FC8 A;  5LG3 A;  4ILG A;  4U0S A;  1DCE A;  1H6P A;  1N4P A;  2LEH A;  4JB8 P;  2A72 A;  4HNA D;  3I5P A;  3ZHE A;  1E90 A;  4DV4 T;  5LGT B;  5JDM A;  2UUA T;  1N32 T;  2ZM6 T;  2HR2 A;  1MIY A;  3N2O A;  1WRD A;  4EBA G;  4IHJ E;  4HFE A;  4GA0 A;  3TWV A;  3N2G E;  4QWN B;  4Z90 A;  3BEE A;  2YU1 A;  3P4W A;  1N0R A;  4B3M T;  3L3P A;  3ABL E;  1U5P A;  1S70 B;  2NW8 A;  4FJO A;  1NAF A;  4MAL A;  3UU6 A;  5CED B;  2VVN A;  5L3E B;  1SUM B;  2LUH A;  3QC1 A;  3ISM C;  3QDN A;  2P9I G;  3CK7 A;  3L09 A;  4DV0 T;  2JAB A;  1ZBP A;  3QNU A;  1KZP A;  2LT3 A;  4OHF A;  4TWH A;  4UR9 A;  3OXL A;  3MKD A;  4U2Y A;  5KJM A;  3C50 A;  4EED A;  4TRQ A;  3GYZ A;  5DJQ C;  2Y4U A;  3HDX A;  4KYO B;  4UWG A;  4F6R D;  3UM2 A;  3FHN A;  4E7Z A;  2XGO A;  1QQE A;  3V30 A;  2F4V T;  4I43 B;  3P1U A;  4AP2 A;  4CYM D;  4ERR A;  5C8Y E;  1H6K A;  2VVS A;  3ETU A;  1JWF A;  3AE2 A;  1H19 A;  4G23 A;  2W66 A;  3AE4 A;  2I1K A;  5FNV E;  3J7Y q;  2KT9 A;  5EIB E;  5HCM A;  3EAM A;  3GW4 A;  1K1B A;  2ZLY A;  3AA6 B;  4NAC A;  3FH8 A;  5ARG A;  4B3T T;  2I0M A;  5BV1 A;  3CWZ B;  3FZM B;  3JAF A;  4AEZ C;  4EZ4 A;  4UF0 B;  1U4Q A;  3LK3 B;  3HR0 A;  4WNK A;  1KPS B;  1R8I A;  3Q78 A;  2A3D A;  4I0U A;  4B93 B;  2H88 A;  2CXF A;  4I43 A;  3DEP A;  2EHO C;  3FUN A;  3TWQ A;  3ZYL A;  1LTX A;  3L16 A;  4J8D A;  2XY8 B;  2E0I A;  3B95 A;  5JJT A;  3ULE G;  4ATG A;  1KFY A;  4I50 E;  1QLB A;  5CER B;  3O4Z A;  3VRB A;  2K5B B;  3ZMU B;  3M65 A;  3GWH A;  5LX8 A;  1WYC A;  2NR4 A;  3FP3 A;  4U0Z A;  3QK6 A;  2ZGG A;  5DBK A;  3RRM B;  3OYX A;  2CPT A;  3A8Y C;  3G2T A;  3LCA A;  2NW9 A;  4KMC A;  1GQE A;  4EXT A;  2OLT A;  4JI6 T;  5KJK A;  1FMW A;  2ZM0 A;  4JEU A;  1W9R A;  2E2E A;  4CT4 A;  2KSR A;  4J8E A;  4JD2 G;  5FIN A;  3PUZ F;  3CX8 B;  3U66 A;  5ENT D;  1Z6T A;  4BTB A;  4I6J A;  4DX7 D;  1D1A A;  5D0O D;  3LSV A;  3FUF A;  4U74 A;  3UUM A;  3CQG B;  4NUV A;  4A5X A;  4BX9 A;  3ETV A;  5AIJ A;  5JR9 A;  2B6C A;  5BNW A;  4O6F A;  5FY0 A;  2MYS A;  3SWH A;  3GZ1 A;  2XUE A;  4HEA A;  3TG5 A;  3NOG D;  3AE1 A;  2K9A A;  3I3N A;  4GYO A;  4UQX A;  4ILA A;  1WCR A;  3TWU A;  2XQ6 A;  4HE8 A;  4UF0 A;  5E0O A;  1XMO T;  1I94 T;  4U0U A;  5AQP B;  3CIA A;  4AXH A;  4ILB A;  5FXX A;  1E8X A;  1D1C A;  3GMI A;  3T8M A;  1U2V G;  3BQO A;  2JRK A;  3AU5 A;  3ZXS A;  2M6I A;  4FUL A;  5FJY A;  2KXP C;  2YDS A;  1UOH A;  4BA9 A;  4A55 A;  2DHR A;  3F31 A;  2HE0 A;  1UK5 A;  2L9B A;  5D2M C;  3PZ3 A;  3PUG A;  4L9I A;  4P09 A;  3ASD A;  5FXV A;  3E33 A;  1EPU A;  2FBN A;  2AXV A;  2LAI A;  5CBN A;  1NEN A;  2QGS A;  3VU7 H;  3QUJ A;  3RYF E;  3D9N A;  1EF1 C;  4JHJ A;  5D66 A;  3CLJ A;  1HXI A;  4HFB A;  4DK5 A;  2DWG A;  3G2W A;  3EDU A;  2NXP A;  1KT1 A;  4DPR A;  1HF8 A;  4JZY A;  3KVA A;  4NXN T;  4F7A A;  3K8P C;  4LFC T;  5JDF A;  4ATZ D;  5FZS A;  2DYR E;  3JC6 D;  1SVX A;  3Q79 A;  3SS1 A;  2ETB A;  3TWS A;  3C98 B;  1WM5 A;  3BU8 A;  3NOC D;  5A6C A;  4ISS A;  4BER A;  5AQR B;  1MNE A;  2IOS A;  4G63 A;  4G8L A;  2X9Y A;  3FZF B;  3LVR E;  3AE9 A;  4HXI A;  3A5X A;  5AQS B;  4EEC A;  2LSG A;  3BK9 A;  4X65 T;  2CG2 A;  3CKB A;  5LG4 A;  3ZYK A;  1K3Z D;  5A1L A;  1ELW A;  2J49 A;  4IDP A;  1TNO A;  2A9U A;  3JQ0 A;  1WLX A;  4OVU A;  1MMD A;  4NUR A;  4Z91 A;  1Q2Z A;  4DVD A;  2LXM A;  4URK A;  5JHA A;  2QYW A;  2JQK A;  3CK6 A;  3VRA A;  1PC2 A;  4WUY A;  2RPA A;  2V7J A;  2WPV A;  2LOP A;  1IBL T;  4HFG A;  4ACK A;  2IO3 C;  5FQ4 A;  4YTP A;  4EZJ A;  3RIF A;  3T1Y T;  4HOQ A;  2XHE B;  4QQI A;  5M72 A;  3ASF A;  5LJN A;  4ILC A;  2R03 A;  4OYS A;  5J0Z A;  2CHW A;  2LE8 A;  2ILR A;  1UCU A;  2BZB A;  2I1J A;  1CUN A;  4KZC A;  3S7F A;  4NQ0 A;  3JUE A;  4KVM A;  3UTK A;  1BU9 A;  3ZT5 A;  2BG9 C;  4U95 D;  3PUV F;  4WWN A;  2GRL A;  4L1B A;  1IYG A;  3E30 A;  3RLF F;  2X6J A;  4IDZ A;  1E7P A;  4LF9 T;  3CKC A;  3QB5 K;  5G2N A;  3V79 K;  5LGU B;  5IWA T;  5G55 A;  2DI4 A;  4D10 C;  4DI4 A;  4ILI A;  1OXJ A;  2KZ7 B;  3S7B A;  3TKL B;  1HFA A;  2WXQ A;  1QUU A;  2WDQ A;  1MYO A;  3FWV A;  1YXR A;  4DO0 A;  2JJ9 A;  2DNX A;  5AQI B;  3RX6 A;  3ZU7 B;  4RQI A;  3ABV A;  4DV3 T;  5FWQ A;  3F2E A;  4BJM A;  2JLB A;  3SFE A;  2VQE T;  1WYB A;  3PE0 A;  1MX2 A;  2DLR A;  1S63 A;  2XSA A;  1ZP0 A;  5LMN T;  3WG7 E;  3O1I A;  1OCC E;  3P4R A;  5FL0 A;  3ASG A;  3TWR A;  2L8K A;  1MJ0 A;  4DR5 T;  5LYJ E;  3ZKJ A;  1UX5 A;  2QVA A;  3CPZ A;  1IBM T;  4KMO A;  2C5J A;  3T8O A;  3CIR A;  2GRN B;  2H6F A;  2AXU A;  3V5U A;  3VR8 A;  3QAR A;  4RVB A;  5L4H A;  3LBX A;  3MK7 C;  2DWK A;  5C2T A;  2CWY A;  2CLY B;  2W63 A;  1YCS B;  2UWJ G;  1D0X A;  5ARF A;  2E9X D;  3CX7 B;  3ANW A;  5AQQ B;  4XX5 A;  3UIP C;  5H6Q B;  4DV5 T;  4COF A;  2X51 A;  2C0S A;  3VR9 A;  1OWO A;  5ETW A;  3SFX A;  4DX2 A;  5JQG E;  3NB2 A;  2GRP B;  2XGS A;  2WZI A;  3D9K A;  3FFL A;  2BVM A;  5EN5 D;  1SE7 A;  3MEK A;  4CEM A;  3LJN A;  3CST A;  3IHR A;  2J62 A;  3F57 A;  3E34 A;  2NSZ A;  5CRU A;  2CXD A;  3AE6 A;  4TWF A;  4HRM B;  5JR9 B;  3FTU A;  4EZL A;  2VWA A;  4CDN A;  2P9L G;  4JA9 A;  4ZZC A;  4IE6 A;  2LHR A;  3UKR G;  3FZK B;  4HRL A;  3RAU A;  3UPV A;  3ASN E;  4G2V A;  3TXM A;  4BTA A;  2YU2 A;  1K8K G;  4U8Y D;  3PTR B;  2MBG A;  2YIN A;  2XHE A;  2WXI A;  1PY1 A;  3IEG A;  4WBN E;  3MZK B;  1GW6 A;  2XSB A;  4K0U A;  3L6A A;  1N9A A;  2H89 A;  3NRX A;  4AKG A;  3EHZ A;  1RZ4 A;  2WQ6 A;  4LNB A;  4YND A;  4L0R A;  4BET A;  3LXU X;  4OAV B;  4V1A v;  1ZEE A;  5FZQ A;  1XWM A;  1HU3 A;  2WMN A;  4I9E A;  3IBP A;  1IHB A;  3I4R B;  2Y8D A;  3Q47 B;  4GCN A;  4GZ3 A;  2AXZ A;  3X1D A;  5FVK A;  1SA5 A;  3AG2 E;  2VQF T;  2W00 A;  5KNG A;  4FJZ A;  5FZR A;  3K3Q C;  4HN9 A;  4ACL A;  4HLL A;  2N9D A;  3UT4 A;  3KBT A;  3N9M A;  3ZCI A;  5ADX L;  3ML8 A;  4HQD A;  5AAO A;  5FVL A;  4FLH A;  1S94 A;  3LJ3 A;  4DND A;  2XRZ A;  2J1D G;  4GTS A;  3KEZ A;  3HXE A;  3AE3 A;  1YD8 G;  3L17 A;  4F3V A;  1S35 A;  4I2Z A;  2PL2 A;  4XI9 A;  1HNZ T;  3FU6 A;  5FP3 A;  1FJG T;  4B3S T;  1JPL A;  1LVK A;  3MJX A;  2HO1 A;  4LG6 A;  4X1I E;  4YXD A;  2OEW A;  5AQA A;  1D0Z A;  3V31 A;  3I1A A;  1UW4 B;  4TUY E;  4DX5 D;  2WMO A;  5FL1 A;  4GTP A;  3P4Q A;  1UUR A;  4EOZ B;  1KT0 A;  2QZA A;  2E9X A;  4TXQ A;  4EB6 E;  1TYQ G;  3B7S A;  4WWP A;  1XDP A;  1XMQ T;  4BX8 A;  4DR2 T;  3TJP A;  3MKR A;  3CHM A;  5EID A;  4DMW A;  4U33 A;  2XCC A;  3ONL C;  2WAU A;  1MX6 A;  4UWF A;  3UXG A;  4QFV A;  2XQ3 A;  1MQS A;  2LKH A;  3B13 A;  2XAS B;  5HWX A;  3UT8 A;  1NZN A;  4KP3 C;  2VKD A;  3O4X E;  3PU3 A;  4K0K T;  1E96 B;  2A5U A;  4LRZ A;  3Q49 B;  3RQW A;  5J2U E;  1JWG A;  3QNK A;  3J9X 1;  2IQC A;  3FBZ A;  3Q7A A;  3LS8 A;  1UN9 A;  2JPF A;  2WDV A;  4GKK T;  4C9B B;  4U3C A;  3D9L A;  1H2V C;  2Q7F A;  5EYP F;  2EIM E;  2EHO D;  3NZQ A;  4DLO A;  3ZMS B;  3ZHE B;  3OYZ A;  1JCQ A;  3PUR A;  2I59 A;  3T5V A;  2WXR A;  3CHP A;  5LHH B;  5JJ6 A;  4N2Q A;  3L39 A;  1N36 T;  3D0T A;  2NW7 A;  5B3S E;  1MMA A;  3NBX X;  2WWV A;  2LSV A;  1LD8 A;  3DEO A;  4QXH B;  3TL5 A;  3ABK E;  2WWU A;  3HG0 D;  3HRA A;  4AQG A;  3EI0 A;  3G06 A;  2XM1 A;  3IXE A;  4HBD A;  3FUL A;  3LDZ A;  4C91 A;  4IE7 A;  2UU9 T;  5KX5 E;  5HRY A;  5G05 C;  2VKO A;  3AJI A;  4TUU A;  2FUL A;  3W15 B;  3EUH A;  3IF8 B;  4YJ2 E;  4TV3 A;  3ZN0 B;  3L82 A;  4JW1 A;  2D2S A;  3S2A A;  2PG8 A;  2XAQ B;  4DR4 T;  3H3A A;  5LHI B;  1V55 E;  3SGH A;  2KND A;  4IL4 A;  2BKG A;  4YVO A;  2PNN A;  4TXP A;  3N9Q A;  4YDY A;  4BWR A;  4NUU A;  1L5J A;  3SF4 A;  1A5E A;  3UQ7 A;  3K1S A;  3SD5 A;  5B1A E;  5F3J A;  5BPP A;  3FUK A;  2R59 A;  3Q5D A;  2E2A A;  1H0A A;  2XS1 A;  3VKH A;  1MND A;  4B6X A;  4DR3 T;  1V9D A;  4I17 A;  2AWI A;  3KIN B;  1M62 A;  1DNP A;  2XGM A;  2VKH A;  3HXB A;  1OED A;  4YVQ C;  4X62 T;  5ENO D;  3RIU C;  2XTL A;  4UQZ A;  4YTN A;  4HFH A;  3N5L A;  4O4L E;  4CT0 A;  2LXL A;  2HHH T;  1RW2 A;  1FT2 A;  3EJN A;  5G05 J;  5L3D B;  2LSU A;  4HWD A;  3S7D A;  5CB4 E;  1SA0 E;  2V6X A;  2M63 A;  4L9P A;  2RKK A;  4EZH A;  3LK4 2;  3MA5 A;  2V1D B;  4U04 A;  2GK9 A;  5J90 A;  1H7C A;  1BPO A;  1OCZ E;  3DWL G;  3ZNG A;  5LCW C;  4LML A;  5JDQ A;  4EZK A;  3OKQ A;  2GRM A;  3UT7 A;  3AVS A;  3APD A;  2X68 A;  2XAH B;  1ELR A;  2FJB A;  1SA4 A;  2XEE A;  4AIF A;  2VGE A;  5JJ7 A;  3I0Q A;  3HKC E;  1OXZ A;  4GZD A;  1D1B A;  2UY1 A;  3JC6 C;  2ODV A;  2XPI A;  2XM2 A;  4OK0 A;  1Y6I A;  4PUC A;  1L0V A;  3D9P A;  3CK9 A;  4C48 B;  1T98 A;  2X67 A;  2XQ7 A;  3B7T A;  3Q9U C;  2VYI A;  3PE3 A;  2GGF A;  1KEY A;  2FO1 E;  3HHM A;  4MRU A;  5BR8 T;  4A56 A;  1N54 A;  4LFB T;  1DVP A;  1XGW A;  4U72 A;  3RIU A;  2XPY A;  3ZT7 A;  1QZ2 A;  3ONK A;  4DI3 A;  3EU5 A;  3LDQ B;  3Q73 A;  4APO A;  5BT1 A;  1J5E T;  5IY5 E;  4ZFH A;  2X0Y A;  1UX4 A;  4DR1 T;  4J8Y A;  2Y69 E;  3N2K E;  3B5M A;  1Y01 A;  3RQU A;  1JCR A;  1D8E A;  3SFZ A;  5JRC B;  4RG9 A;  4UUC A;  5J2T E;  4DID B;  2OEV A;  3FTS A;  4FLB A;  4AQF C;  1MZC A;  2N2N A;  5ENN A;  2Q9Q D;  4XAX B;  2CM0 A;  4UXN B;  2V4L A;  5KNH D;  3OXG A;  3AG3 E;  3RYI E;  5AQ9 A;  5FT9 A;  2ES0 A;  3RI5 A;  4JVS A;  3AEF A;  4APF A;  3ONL A;  4UWH A;  2W67 A;  1W0A A;  2XQY A;  4BT9 A;  3D9O A;  2Y48 B;  2IY0 C;  2Y1L E;  3SQV A;  2OVB A;  2CEA A;  2P9B A;  1BR2 A;  4H9N C;  2DZN A;  3RHW A;  4ZI2 C;  1MMG A;  4B0Z A;  4KBM B;  2DCP A;  2E5L T;  3CK8 A;  3FUM A;  4WZX A;  4IDO A;  3U3I A;  3MX3 A;  2CXL A;  2WZH A;  2E8I A;  4KHP T;  4O4I E;  4TUM A;  2Y3A A;  4BES A;  1YKH B;  1HH8 A;  2I6H A;  1BLX B;  4U7Y A;  1YMP A;  3UUN A;  1FVF A;  2RG8 A;  4UWL A;  4XEI G;  4UQY A;  4EQF A;  5ABG A;  2OVF A;  5E75 A;  3TG4 A;  4Y6C A;  3N71 A;  4LMJ A;  3ZMZ B;  2J09 A;  4X66 T;  1E8Z A;  2L9Q A;  4IUL A;  4M3O A;  3P2B A;  2F0Y A;  4YSY A;  3KD7 A;  4HS2 A;  3SNX A;  1WR6 A;  3H3M A;  4ZI7 E;  4PS7 A;  3UUX A;  1HE8 A;  1TN6 A;  4JXT A;  1HNW T;  4TXR A;  5AJL A;  1UUS A;  1XNR T;  3FUD A;  4GYY A;  3B7R L;  1XDO A;  2J07 A;  4HI9 A;  3RJV A;  1E1H B;  4ILU A;  4ANV A;  1US7 B;  2BDE A;  2LJL A;  2IDO B;  5LP0 A;  4OYJ A;  3PUX F;  3C3O A;  4UI9 C;  3Q2M A;  1EDU A;  3FHE A;  2QA7 A;  3AEA A;  2VJ8 A;  1A17 A;  2P9P G;  3O48 A;  4DRX E;  1N4Q A;  5ABE A;  3FU5 A;  2VSX E;  3PUJ A;  3O1H A;  3DRA A;  5FQ6 A;  1S0P A;  3UIN C;  3CR3 A;  4J6I A;  4K5C A;  5ANL A;  5L2L A;  1UJK A;  5LNK A;  5HEH A;  4HB5 A;  4M1P A;  2Z6E A;  3LEW A;  4AIS A;  2WXG A;  5L3C B;  5C2Y A;  4GB9 A;  4HWC A;  2P58 C;  2VL8 A;  2P9U G;  2ZIR A;  4DV2 T;  5ITZ F;  3C98 A;  3ZC0 A;  3AED A;  2EIK E;  4GZ6 A;  1QNF A;  2CBJ A;  4JI0 T;  4I55 E;  4DR7 T;  5T4Y A;  4EBA A;  2IJG X;  4KHZ F;  1Z0P A;  4U8H A;  2XPK A;  4CCA A;  4DBQ A;  5CMW A;  5FMN A;  2WB5 A;  3FB2 A;  4YHJ A;  3RGL A;  4KBQ A;  3B7U X;  5KMG P;  3EIQ C;  2X9H A;  3URZ A;  3NQP A;  3KV4 A;  2B0O E;  3FUI A;  2XQ9 A;  1SHZ C;  1N11 A;  2YOE A;  1WG0 A;  1WY6 A;  3LFM A;  3FU0 A;  3ZRH A;  3UFG A;  1IJ6 A;  5KCM A;  4UWK A;  4AV7 A;  3KS2 A;  4PS3 A;  2WXP A;  2BS4 A;  2KMF A;  4TV9 E;  2P9K G;  2XPZ A;  3MKQ B;  4WAF A;  3FDH A;  3PZ2 A;  2UXC T;  2X9X A;  3RRW A;  4L7T A;  2FUP A;  3AE7 A;  3QKY A;  4RLY A;  4IN3 B;  4GTO A;  2AXD S;  2V7K A;  5AQH B;  4GYS A;  4XE0 A;  1G73 A;  5AQN B;  3C64 A;  4K5A B;  3FTZ A;  2FBW A;  3CML A;  3ZKR A;  3DP7 A;  3EUV A;  4F1P A;  3EU9 A;  1FEW A;  3CQC B;  3DXK G;  3I0O A;  2HPJ A;  1M7K A;  4BT8 A;  4UEM A;  3N9L A;  4F8H A;  4A3V A;  2KZT A;  2VKJ A;  5LCY A;  3ASO E;  4LF8 T;  2XZE A;  3C3R A;  3CHQ A;  4I6G A;  4BSZ B;  2X9W A;  2X6H A;  3TXN A;  1J1J A;  3QB2 A;  1HS7 A;  1MMN A;  3JUI A;  3RO3 A;  1X5B A;  3U3W A;  2ZU6 B;  3IA3 A;  5JRC A;  3DPD A;  4YDO A;  3SHF A;  1IAP A;  4PS8 A;  4Q96 A;  2ZXW E;  2PFV A;  3AU4 A;  5BW8 C;  4JV5 T;  5H7P A;  5AQV B;  4H9Q C;  5FKY A;  3SI5 A;  4HVB A;  3RRU A;  4H63 H;  2X0L B;  3FZL B;  4GOU A;  3QWP A;  4UV8 B;  1WDY A;  3SY2 A;  4H7Y A;  5F5W A;  3UM0 A;  1IJ5 A;  4LNG A;  2R05 A;  2B1E A;  5AQJ B;  4IRU A;  4GYW A;  3AVR A;  5EX3 A;  2C0M A;  2M67 A;  4UEL A;  3C51 A;  4FU3 A;  3MA9 A;  3NBN B;  1ZKE A;  4P1N A;  3FU3 A;  4AOF A;  1E8Y A;  1OCO E;  5LCW J;  3UT5 E;  2VUR A;  2R02 A;  2R5S A;  3B7B A;  3BG1 B;  4HFD A;  2CMR A;  4WNE A;  3ONJ A;  4HOR A;  2V4H C;  2WQ7 A;  3Q7F A;  3ZVV A;  2V6Y B;  3MCX A;  5HEG A;  4EYY R;  4J2C A;  2NTX A;  3TWT A;  3DSW A;  4N2S A;  4KXK B;  3ML9 A;  4EYU A;  2UXX B;  1TNU A;  4PJJ A;  3PJA A;  4CGV A;  4U96 D;  5AN8 A;  3UUL A;  3FTV A;  3BQL A;  2IAK A;  3P8C D;  3FTW A;  4B94 A;  2Q9Q B;  1ZV4 X;  5L47 A;  5JH7 E;  2KC7 A;  2LSJ A;  5CHE E;  4LF7 T;  5DIZ A;  3HXC A;  3NZS A;  4ASK A;  2V5Q C;  4JC8 A;  4FHJ A;  3PUQ A;  4NRH B;  2YK0 A;  4BFR A;  4P0B A;  1LRZ A;  2LAH A;  3RK6 A;  5KWD A;  4N3C A;  1TN8 A;  3FY4 A;  3HXD A;  3Q9N C;  1BD8 A;  3Q9D A;  2IHR 1;  2VTB A;  4H63 V;  1OED B;  2DZO A;  2QYU A;  4JI1 T;  2AW6 A;  3R6N A;  3DJB A;  2JMK A;  3CX6 B;  3FZH B;  4QH4 A;  1E7U A;  1BR0 A;  2GW1 A;  3C3Q A;  4ZOL E;  2WVI A;  4O2B E;  4DV7 T;  4BEP A;  3PUW F;  2CRB A;  3N9O A;  3OAW A;  2IML A;  2MTQ A;  4YFS A;  4AXP A;  5FYM A;  2C5K T;  3FH7 A;  4DUI A;  1DCQ A;  4L2L A;  2IIU A;  4LF5 T;  3UIO C;  5LBM A;  1P5Q A;  2CHN A;  4TN7 B;  4IE5 A;  2ZIS A;  4I6E A;  4IYP A;  4PJM A;  4R7L A;  5JR9 C;  1FIO A;  4O1O A;  2WQH A;  3D9I A;  5EYL A;  2LRL A;  3ZXP A;  2CE7 A;  3RRN B;  4EEB A;  2LSY A;  2XQ4 A;  5FTP A;  3PVL A;  4OVV A;  3C72 A;  1AWC B;  2RFA A;  5H6R B;  3QWW A;  2VK9 A;  2K48 A;  2K24 A;  2IUB A;  3HIZ A;  1ZHC A;  4NIK A;  5JMN D;  1KNP A;  1PAQ A;  3GZS A;  4XKC A;  3EDT B;  3ZSS A;  4FJY A;  4CZ2 D;  2CHO A;  3KSQ A;  3PRZ A;  4O1P A;  3SFY A;  1LKX A;  5EK3 A;  2LSK A;  4IE0 A;  4OFZ A;  3ZC1 A;  2Q9Q C;  3EDV A;  4AIU A;  4IGU A;  5CEC B;  4DJA A;  4JLE A;  3T1H T;  2FJE A;  2IC9 A;  3AS8 A;  4KVO A;  4WWO A;  4QX7 B;  2V5F A;  3FUE A;  5KDM C;  1IZN B;  2H7O A;  1DU2 A;  3HVE B;  5FXZ A;  2DYS E;  3AA0 B;  2CG3 A;  3ESL A;  3AAA B;  3P4S A;  4PK5 A;  2W0G A;  3CHS A;  3MJW A;  1VOM A;  3TLT A;  2RFM A;  3D9M A;  1QYM A;  2F8X K;  3C4X A;  1NL4 A;  2XQ0 A;  3GN5 A;  3CKD A;  2BUG A;  4IDQ A;  2WXL A;  2WBL A;  2JMH A;  1E2A A;  1H2U A;  4NPP A;  3CVW A;  5AQG B;  2BKO A;  2L6B A;  5JA4 D;  4MHC A;  3TLS A;  2L0I A;  4G24 A;  3KV9 A;  4U07 A;  2V7I A;  3AS4 A;  1Z8U A;  2HPL A;  4G25 A;  2PBI A;  3CVR A;  1NWM X;  3TLV A;  1KF6 A;  3QC9 A;  5HI7 A;  2XZT G;  1OED E;  2JIW A;  4ADZ A;  5T8I A;  2LO6 A;  3I9W A;  3PJA J;  2B76 A;  2VAS A;  1Z3Y A;  1KNR A;  5A7D B;  4E85 A;  4KUM B;  4ANJ A;  5LA6 E;  2CLY C;  2UXB T;  2RD0 A;  2KBX A;  1AJ3 A;  2BG9 B;  2GRR B;  2PM6 A;  2VSN A;  4JPS A;  1XNF A;  2QRX A;  5IUX A;  3AE8 A;  5HCJ A;  4GA1 A;  1Y8M A;  4KZ0 A; 
#chains in the Genus database with same CATH homology
 3SZ7 A;  3VKG A;  2H3R A;  3MV2 B;  2CHZ A;  1OUV A;  3LKU A;  2YQ8 A;  4J0U A;  2D0U A;  2XAJ B;  1NA0 A;  2IF4 A;  4G11 A;  4LEU A;  2KIN B;  4YJ3 E;  2PZI A;  3JCK C;  3RRC A;  1VRB A;  4N39 A;  2OOE A;  3I9Y A;  2D5U A;  5GON E;  5HWY A;  4BJN A;  3C4W A;  4PNI A;  2MRI A;  1IHG A;  5M4Y A;  1HTJ F;  5FQ8 A;  2ACX A;  3MKQ A;  4MLP A;  1IQU A;  4JA7 A;  2J4D A;  3ZYM A;  2XRY A;  1ZU2 A;  5LOZ A;  4HLE A;  5JDG A;  4LCT A;  4G1T A;  3D9J A;  1YKE B;  1KK7 A;  3CGH A;  4A1G A;  3ZN3 A;  5JDL A;  4PJN A;  3D3M A;  5BUZ A;  4W9R A;  3G2U A;  3PZD A;  4GAA A;  4J8S A;  4XI0 A;  4Q94 A;  1HG5 A;  4JEH B;  3U4T A;  1E7V A;  2X6I A;  4H9O C;  1YA0 A;  4FP7 A;  3CVY A;  3AB3 B;  2J08 A;  2UY1 B;  4O4J E;  3PU8 A;  5FY1 A;  4B89 A;  3LJC A;  2L6J A;  3OTN A;  3R7R A;  3FXE B;  2VTB B;  2R17 C;  3PEV B;  1Y64 B;  2CWO A;  2KCK A;  4I9C A;  5HQ8 A;  3RPU A;  4AKI A;  2X6K A;  1HS6 A;  3SBT B;  3ZMV B;  1OWA A;  1O3X A;  2D0T A;  2EHO A;  1U3C A;  2PQR A;  3IV0 A;  5L3G B;  3LK2 B;  5F8P A;  3UQ3 A;  4CGW A;  4CQI A;  3FEX A;  3PRE A;  2XAF B;  4DLQ A;  1HO8 A;  2Q9Q A;  3O9X A;  2LM9 A;  4K0R A;  3ZN1 B;  3HVE A;  4WNG A;  4PDX A;  4UIG A;  5HAX A;  3EIJ A;  3IEE A;  2IOL A;  3BQI A;  4TV8 E;  1OWL A;  2QFC A;  2LHN A;  3N9P A;  3OXF A;  4PFO A;  1JUQ A;  3UFE A;  4MKT A;  4OYK A;  4E6H A;  4FHK A;  3CVN A;  3S4U A;  2XEV A;  1B89 A;  1D0Y A;  2LSI A;  4GPK A;  2WXJ A;  4MFR A;  3L22 A;  4LUN U;  2L3L A;  4F1S A;  5CA0 E;  4GK5 E;  5CMY A;  5LBQ B;  2EQX A;  3AAE B;  5LJM A;  1FVH A;  3C4Z A;  4CXY A;  3R9A B;  4AY6 A;  3K9I A;  3SRZ A;  1Z3X A;  2LOS A;  3ESK A;  4UVC B;  3PE4 A;  2J9Q A;  2E9X C;  2NTY A;  4QXC B;  5A23 A;  3IBE A;  2WXM A;  4Q69 A;  3GZ2 A;  3WXX A;  4EPZ A;  2YNQ A;  3ULQ A;  3ZPO A;  5JHB A;  4CI2 B;  3LBX B;  5LP6 E;  5CA1 E;  5C1D A;  4MBQ A;  3RO2 A;  5G04 C;  4CI1 B;  5AJD A;  4UVB B;  4DBR A;  1OWP A;  2W62 A;  3BG0 B;  3ZEF A;  3CHR A;  2OV8 A;  3DTO A;  3SOL A;  4I4T E;  2NWB A;  2BTD A;  5LOV E;  2IU1 A;  5EX0 A;  5AFU L;  1SZA A;  1UN8 A;  5LXT E;  1TJF A;  4F6R C;  3PH0 C;  4HFV A;  5HYA A;  3RC8 A;  4MLK A;  2I2O A;  4ILH B;  3MXZ A;  2PQN A;  4N5C A;  1H2T C;  4G2A A;  2BVL A;  5IYZ E;  2FEZ A;  2WXF A;  3B57 A;  3RKV A;  4X20 E;  2V0P A;  3U9W A;  4JEH A;  5T3R A;  3HKD E;  4PW8 A;  1HCI A;  3P7I A;  4H9P C;  2G0U A;  2A4Z A;  4WNF A;  2KM4 A;  4H9R C;  1VDY A;  4I1A A;  4WBO A;  3EHM A;  5AEN A;  4P29 A;  5AYW D;  2YHE A;  3KFW X;  3FXD B;  3CV0 A;  1UJJ A;  3QWV A;  2L0T B;  1HZ4 A;  3FEY A;  2Y6X A;  3L54 A;  3APF A;  1OWN A;  1EZ3 A;  4B8A A;  2VGX A;  2WXK A;  4ZI3 C;  4V3I A;  3HA4 A;  2IFU A;  3KBU A;  5KJL A;  3V5S A;  3N9N A;  3HL6 A;  5L3F B;  2C0L A;  3JQ1 A;  4CRW A;  4ZS2 A;  1MIV A;  2MOZ A;  3K3N A;  4GU5 A;  1LF8 A;  3ZLI A;  2FO7 A;  4LER A;  4IST A;  4F53 A;  2VSY A;  2HH7 A;  3OBV E;  1MIW A;  4JEU B;  3CVX A;  4DMV A;  3APC A;  3E22 E;  3QOU A;  4N3B A;  3KV6 A;  2KWH A;  4GZ5 A;  3VLD A;  5E76 A;  5D0Q D;  1ELK A;  3CQX C;  2XCB A;  2ODU A;  4AVX A;  4JL0 A;  3ZYQ A;  4AI6 A;  3Q5W A;  4QX8 B;  2VB6 A;  5FXW A;  2OA5 A;  4YLH A;  3GN5 B;  3KDS E;  3L13 A;  4ZHQ E;  2QY7 A;  3G2S A;  4BY6 A;  4A3T A;  2KAT A;  3MAC A;  3U78 A;  3PUK A;  5LFA A;  4AJW A;  2CHX A;  5BV0 A;  3RKO A;  4JUY A;  4JHR A;  3QAQ A;  1WAO 1;  5JVD E;  2NC9 A;  2VSO E;  3CHO A;  5KJN A;  1SQM A;  2DIW A;  5HXR A;  5G04 J;  3LG7 A;  4GZC A;  5BMV E;  2C2L A;  4Z8X A;  4UV9 B;  3GA8 A;  3E0Z A;  4X1Y E;  4AM9 A;  4XKB A;  4UI9 K;  3PUS A;  3S7J A;  1SZ9 A;  4ABN A;  2CFU A;  3NZU A;  5DQV A;  3MZL B;  4XIF A;  3CEQ A;  3Q5M A;  5HXC A;  3HI2 A;  4IE4 A;  5EK2 A;  2HYZ A;  3R84 B;  1KNZ A;  3BQK A;  4N3A A;  4RG6 A;  3FH5 A;  2HM8 A;  4C0M A;  3FTY A;  4WW0 A;  4G26 A;  5CCM A;  5HXE A;  1KLX A;  2YHC A;  2X6F A;  3MV3 B;  3ZEF B;  3ENE A;  2ZM2 A;  3KV5 A;  4O8S A;  2DBA A;  2FI7 A;  3LPZ A;  3RH3 A;  3T5X A;  3Q5X A;  4CXW A;  4AKH A;  4GIW A;  4IIJ E;  4HKA A;  2KCV A;  5CCL A;  1NP7 A;  2N1G A;  5LHG B;  3WI3 A;  3WAK A;  4EIW A;  2NP9 A;  2C5I T;  2WXN A;  2KWI B;  3EVY A;  4GYR A;  4HTE A;  3EHN A;  4ANU A;  3CSF A;  2MOW A;  1YW0 A;  2LNI A;  3LY9 A;  3MGB A;  3CVU A;  2YEV C;  3ZFW A;  5EKQ D;  3E08 A;  2RA1 A;  2EHO B;  3HYM B;  3Q4A B;  4B8C B;  1NA3 A;  5EDS A;  3SBS A;  3AA7 B;  5FY7 A;  3G2V A;  4O4H E;  3ANW B;  3JYS A;  1OWM A;  5IHY A;  2CCQ A;  3ZGQ A;  4UI9 J;  3RC3 A;  2AVP A;  2Y4T A;  5HXH A;  2FF4 A;  3U64 A;  2JQQ A;  2VQ2 A;  3PDY A;  3VHL A;  3R7Q A;  3TGO A;  2E9X B;  1LVF A;  3O1J A;  4HGA A;  4H7X A;  3AAI A;  5JRE A;  1U3D A;  1BR1 A;  4HOT A;  2V8S E;  2WM9 A;  3NF1 A;  2VGY A;  3RIB A;  3WAJ A;  3QJZ A;  3NRY A;  2ZMA A;  4JHK A;  5HXS A;  3IHV A;  4GA2 A;  4PAG A;  1HX8 A;  4PH4 B;  4BAY B;  4AQF A;  3LY7 A;  4TX5 A;  2A2F X;  5EZY E;  4X1K E;  1INZ A;  4ZS3 A;  2KLQ A;  1E8W A;  5J1G A;  4QHO A;  3LVQ E;  2RP4 A;  5L3B B;  3FUJ A;  3VTY A;  4MS6 A;  1FCH A;  5ANR A;  1B7T A;  4FA6 A;  5DQW A;  4K03 A;  3NZP A;  4GCO A;  2KZT B;  1G8X A;  2UXN B;  4KT6 B;  2X66 A;  2J4B A;  3HKE E;  5DAB A;  4AKR B;  3PS6 A;  3PUA A;  3IKO B;  2BF0 X;  2X3M A;  4GK0 E;  4I1O B;  5FQ7 A;  4HOS A;  3HKB E;  2PJQ A;  3KVB A;  3ZIM A;  2WXH A;  3VLF A;  4I1M A;  4A1S A;  4I2W A;  4GML A;  4FI5 A;  4PK4 A;  3CVQ A;  2CA5 A;  4XZC A;  4O2A E;  2CFZ A;  3TAX A;  3VLE A;  2OND A;  2JEK A;  2WXO A;  3H37 A;  3UUX B;  4UVA B;  1TEZ A;  4HOU A;  2IC6 A;  3PNL B;  3QK0 A;  4EAH A;  3FBL A;  4CI3 B;  3PEU B;  3PNT B;  4XZ4 A;  1IQR A;  4RSY A;  3RU0 A;  2KXP B;  3ZCJ A;  2V7M A;  4P0A A;  3E4B A;  5TAO A;  4L2Y A;  2KCL A;  4C0E A;  3ZJ2 A;  4PFP A;  1MHQ A;  2DCF A;  3UMV A;  4XBF B;  1BR4 A;  4BSX A;  4L5G A;  4AKL A;  4Y6W A;  1X79 A;  2V26 A;  4TZ4 C;  3CVL A;  4PJL A;  3ZMT B;  3L08 A;  3LYA A;  4QKN A;  4U63 A;  3AA1 B;  3VTX A;  5EK4 A;  4ZI3 D;  2H7V C;  2IW5 B;  1HG2 A;  1N52 A;  4J8F A;  2ION A;  3ASH A;  3Q15 A;  3CVP A;  3KAE A;  2V7L A;  2PM7 A;  2ZM8 A;  4ANW A;  4GMJ A;  3K3O A;  1TJC A;  3ONX A;  2XAG B;  4ME2 A;  1UG3 A;  4H9S E;  4CZZ B;  2NOX A;  2VGX B;  2X38 A;  4CXX A;  2WB2 A;  3PDN A;  3ZJ1 A;  3FUH A;  5J08 A;  5LGN B;  3DBS A;  1EYH A;  4ANX A;  3IHY A;  3FTX A;  3UX4 A;  4PK6 A;  4FAD A;  4ZI2 D;  3AS5 A;  3LY8 A;  5JDN A;  3CVV A;  1QSD A;  3OJA A;  1FMV A;  4AY5 A;  1W3B A;  4N78 D;  4L23 A;  4QXB B;  4E7S A;  3MYV A;  3RYH E;  5JDH A;  2W61 A;  2SPC A;  4WND A;  4CDM A;  3RYC E;  2WSS V;  3ZPJ A;  3ZW3 A;  2I9C A;  3I4G A;  4CDR A;  2MHK A;  4C90 A;  4FC8 A;  4ILG A;  4U0S A;  2LEH A;  2A72 A;  3I5P A;  3ZHE A;  1E90 A;  5LGT B;  5JDM A;  2HR2 A;  1MIY A;  3N2O A;  1WRD A;  4EBA G;  4IHJ E;  4GA0 A;  3N2G E;  4QWN B;  3BEE A;  2YU1 A;  3L3P A;  1U5P A;  2NW8 A;  4FJO A;  1NAF A;  4MAL A;  5L3E B;  3QC1 A;  3QDN A;  3CK7 A;  3L09 A;  1ZBP A;  2LT3 A;  4OHF A;  3OXL A;  3MKD A;  5KJM A;  3C50 A;  4TRQ A;  3GYZ A;  5DJQ C;  2Y4U A;  3HDX A;  4KYO B;  4UWG A;  3FHN A;  4E7Z A;  2XGO A;  1QQE A;  4I43 B;  3P1U A;  4AP2 A;  4ERR A;  5C8Y E;  3ETU A;  1H6K A;  1JWF A;  1H19 A;  4G23 A;  2I1K A;  5FNV E;  3J7Y q;  2KT9 A;  3GW4 A;  2ZLY A;  3AA6 B;  4NAC A;  3FH8 A;  5ARG A;  5BV1 A;  3CWZ B;  4AEZ C;  4EZ4 A;  4UF0 B;  1U4Q A;  3LK3 B;  3HR0 A;  4WNK A;  2A3D A;  2CXF A;  4I43 A;  2EHO C;  3FUN A;  3ZYL A;  3L16 A;  4J8D A;  2E0I A;  5JJT A;  4ATG A;  4I50 E;  3O4Z A;  2K5B B;  3ZMU B;  3M65 A;  3GWH A;  5LX8 A;  1WYC A;  3FP3 A;  4U0Z A;  3QK6 A;  5DBK A;  3RRM B;  3OYX A;  3G2T A;  3LCA A;  2NW9 A;  4KMC A;  4EXT A;  5KJK A;  1FMW A;  2ZM0 A;  4JEU A;  2E2E A;  4CT4 A;  4J8E A;  3U66 A;  3CX8 B;  4BTB A;  1Z6T A;  4I6J A;  1D1A A;  5D0O D;  3FUF A;  4U74 A;  3UUM A;  3CQG B;  4NUV A;  4BX9 A;  3ETV A;  5AIJ A;  5JR9 A;  5BNW A;  4O6F A;  5FY0 A;  2MYS A;  3SWH A;  3GZ1 A;  2XUE A;  4HEA A;  3TG5 A;  2K9A A;  3I3N A;  4GYO A;  4UQX A;  4HE8 A;  4UF0 A;  5E0O A;  4U0U A;  4AXH A;  3CIA A;  5FXX A;  1E8X A;  1D1C A;  3GMI A;  3T8M A;  2JRK A;  3AU5 A;  3ZXS A;  4FUL A;  5FJY A;  4BA9 A;  4A55 A;  2DHR A;  3F31 A;  2L9B A;  3PUG A;  4L9I A;  4P09 A;  3ASD A;  5FXV A;  1EPU A;  2FBN A;  2AXV A;  2LAI A;  2QGS A;  3VU7 H;  3QUJ A;  3RYF E;  3D9N A;  1EF1 C;  4JHJ A;  3CLJ A;  1HXI A;  4DK5 A;  2DWG A;  3G2W A;  3EDU A;  2NXP A;  1KT1 A;  4DPR A;  1HF8 A;  4JZY A;  3KVA A;  4F7A A;  3K8P C;  5JDF A;  5FZS A;  3JC6 D;  3SS1 A;  3C98 B;  1WM5 A;  5A6C A;  4ISS A;  2IOS A;  1MNE A;  4G63 A;  2X9Y A;  3LVR E;  4HXI A;  3A5X A;  4EEC A;  2LSG A;  3BK9 A;  2CG2 A;  3CKB A;  5LG4 A;  3ZYK A;  5A1L A;  1ELW A;  2J49 A;  3JQ0 A;  1WLX A;  4OVU A;  1MMD A;  4NUR A;  5JHA A;  4DVD A;  4URK A;  1PC2 A;  4WUY A;  2V7J A;  2WPV A;  2LOP A;  4ACK A;  4HFG A;  5FQ4 A;  4EZJ A;  4HOQ A;  2XHE B;  5M72 A;  3ASF A;  5LJN A;  4OYS A;  2CHW A;  2LE8 A;  2ILR A;  1UCU A;  2BZB A;  2I1J A;  1CUN A;  4KZC A;  3S7F A;  4NQ0 A;  4KVM A;  3UTK A;  4WWN A;  2GRL A;  4L1B A;  1IYG A;  2X6J A;  4IDZ A;  3CKC A;  5G2N A;  5LGU B;  4DI4 A;  5G55 A;  2DI4 A;  4D10 C;  4ILI A;  3S7B A;  2KZ7 B;  3TKL B;  1HFA A;  2WXQ A;  1QUU A;  3FWV A;  4DO0 A;  2JJ9 A;  2DNX A;  3RX6 A;  5FWQ A;  3F2E A;  4BJM A;  2JLB A;  1WYB A;  3PE0 A;  2DLR A;  3O1I A;  3ASG A;  2L8K A;  5LYJ E;  1UX5 A;  3CPZ A;  4KMO A;  2C5J A;  3T8O A;  2AXU A;  3V5U A;  3QAR A;  4RVB A;  3LBX A;  3MK7 C;  2DWK A;  2CWY A;  2CLY B;  2W63 A;  2UWJ G;  1D0X A;  5ARF A;  2E9X D;  3CX7 B;  3ANW A;  4XX5 A;  5H6Q B;  2X51 A;  2C0S A;  1OWO A;  5ETW A;  5JQG E;  2XGS A;  3D9K A;  3FFL A;  2BVM A;  3MEK A;  4CEM A;  3CST A;  3IHR A;  3F57 A;  2NSZ A;  2CXD A;  5JR9 B;  3FTU A;  4EZL A;  2VWA A;  4CDN A;  4JA9 A;  4IE6 A;  2LHR A;  3UPV A;  4G2V A;  3TXM A;  4BTA A;  2YU2 A;  3PTR B;  2MBG A;  2YIN A;  2XHE A;  2WXI A;  1PY1 A;  3IEG A;  4WBN E;  3MZK B;  1GW6 A;  4K0U A;  3L6A A;  3NRX A;  4AKG A;  2WQ6 A;  4YND A;  4L0R A;  3LXU X;  4V1A v;  1ZEE A;  5FZQ A;  1HU3 A;  2WMN A;  4I9E A;  3IBP A;  3I4R B;  2Y8D A;  3Q47 B;  4GCN A;  4GZ3 A;  2AXZ A;  2W00 A;  4FJZ A;  5FZR A;  3K3Q C;  4HN9 A;  4ACL A;  2N9D A;  3UT4 A;  3KBT A;  3N9M A;  3ZCI A;  3ML8 A;  5ADX L;  4FLH A;  1S94 A;  3LJ3 A;  4DND A;  2XRZ A;  2J1D G;  3KEZ A;  1YD8 G;  3L17 A;  4F3V A;  1S35 A;  4I2Z A;  2PL2 A;  4XI9 A;  3FU6 A;  5FP3 A;  1JPL A;  1LVK A;  3MJX A;  2HO1 A;  4X1I E;  1D0Z A;  3I1A A;  1UW4 B;  4TUY E;  2WMO A;  4EOZ B;  1KT0 A;  2E9X A;  4EB6 E;  3B7S A;  4WWP A;  4BX8 A;  3TJP A;  3MKR A;  3CHM A;  4DMW A;  2XCC A;  2WAU A;  4UWF A;  4QFV A;  1MQS A;  3B13 A;  2XAS B;  5HWX A;  3UT8 A;  1NZN A;  4KP3 C;  2VKD A;  3O4X E;  3PU3 A;  4LRZ A;  1E96 B;  2A5U A;  3Q49 B;  5J2U E;  1JWG A;  3QNK A;  3J9X 1;  2IQC A;  3FBZ A;  3LS8 A;  1UN9 A;  2JPF A;  4C9B B;  3D9L A;  1H2V C;  2Q7F A;  2EHO D;  3NZQ A;  4DLO A;  3ZMS B;  3ZHE B;  3OYZ A;  3PUR A;  2I59 A;  3T5V A;  2WXR A;  3CHP A;  5LHH B;  5JJ6 A;  4N2Q A;  3D0T A;  2NW7 A;  1MMA A;  3NBX X;  2LSV A;  4QXH B;  3TL5 A;  2WWU A;  4AQG A;  3FUL A;  3LDZ A;  4C91 A;  4IE7 A;  5KX5 E;  5G05 C;  2VKO A;  4TUU A;  2FUL A;  3W15 B;  3EUH A;  3IF8 B;  4YJ2 E;  4TV3 A;  3ZN0 B;  4JW1 A;  2D2S A;  3S2A A;  2PG8 A;  2XAQ B;  3H3A A;  5LHI B;  3SGH A;  2KND A;  4YVO A;  3N9Q A;  4BWR A;  4NUU A;  1L5J A;  3SF4 A;  3SD5 A;  5F3J A;  5BPP A;  3FUK A;  2R59 A;  1H0A A;  3VKH A;  1MND A;  4B6X A;  4I17 A;  1V9D A;  2AWI A;  3KIN B;  1DNP A;  2XGM A;  2VKH A;  4YVQ C;  2XTL A;  4UQZ A;  3N5L A;  4O4L E;  4CT0 A;  3EJN A;  5G05 J;  5L3D B;  2LSU A;  3S7D A;  5CB4 E;  1SA0 E;  2M63 A;  4EZH A;  3LK4 2;  3MA5 A;  2V1D B;  4U04 A;  2GK9 A;  5J90 A;  1H7C A;  1BPO A;  5LCW C;  5JDQ A;  4EZK A;  3OKQ A;  2GRM A;  3UT7 A;  3AVS A;  3APD A;  2X68 A;  2XAH B;  1ELR A;  4AIF A;  5JJ7 A;  3I0Q A;  3HKC E;  1OXZ A;  4GZD A;  1D1B A;  2UY1 A;  3JC6 C;  2ODV A;  2XPI A;  4OK0 A;  1Y6I A;  4PUC A;  3D9P A;  3CK9 A;  1T98 A;  3B7T A;  2X67 A;  2VYI A;  3PE3 A;  2GGF A;  3HHM A;  4MRU A;  1N54 A;  4A56 A;  1DVP A;  1XGW A;  4U72 A;  2XPY A;  1QZ2 A;  3ONK A;  4DI3 A;  4APO A;  5BT1 A;  1UX4 A;  3N2K E;  3SFZ A;  5JRC B;  4RG9 A;  5J2T E;  3FTS A;  4FLB A;  4AQF C;  2N2N A;  5ENN A;  2Q9Q D;  4XAX B;  2CM0 A;  4UXN B;  2V4L A;  3OXG A;  3RYI E;  5FT9 A;  2ES0 A;  4JVS A;  4APF A;  3ONL A;  4UWH A;  2XQY A;  4BT9 A;  3D9O A;  2Y48 B;  2OVB A;  2CEA A;  2P9B A;  1BR2 A;  4H9N C;  4ZI2 C;  1MMG A;  4B0Z A;  4KBM B;  2DCP A;  3CK8 A;  3FUM A;  3U3I A;  3MX3 A;  2CXL A;  2E8I A;  4O4I E;  2Y3A A;  1YKH B;  1HH8 A;  2I6H A;  3UUN A;  1FVF A;  2RG8 A;  4UWL A;  4EQF A;  4UQY A;  2OVF A;  5E75 A;  3TG4 A;  4Y6C A;  3N71 A;  3ZMZ B;  2J09 A;  1E8Z A;  2L9Q A;  4IUL A;  4M3O A;  3P2B A;  3KD7 A;  4HS2 A;  3SNX A;  1WR6 A;  4ZI7 E;  4PS7 A;  3UUX A;  1HE8 A;  4JXT A;  5AJL A;  3FUD A;  4GYY A;  3B7R L;  3RJV A;  2J07 A;  1E1H B;  4ILU A;  4ANV A;  1US7 B;  2BDE A;  2LJL A;  5LP0 A;  4OYJ A;  4UI9 C;  3Q2M A;  1EDU A;  3FHE A;  2QA7 A;  2VJ8 A;  1A17 A;  3O48 A;  3FU5 A;  3PUJ A;  2VSX E;  3O1H A;  5FQ6 A;  1S0P A;  3CR3 A;  4J6I A;  5ANL A;  5L2L A;  1UJK A;  5LNK A;  4M1P A;  2Z6E A;  3LEW A;  2WXG A;  5L3C B;  5C2Y A;  4GB9 A;  2P58 C;  2VL8 A;  3C98 A;  3ZC0 A;  4GZ6 A;  1QNF A;  4EBA A;  4I55 E;  5T4Y A;  2IJG X;  1Z0P A;  4U8H A;  4CCA A;  4DBQ A;  5CMW A;  5FMN A;  3FB2 A;  4YHJ A;  4KBQ A;  3B7U X;  5KMG P;  3EIQ C;  2X9H A;  3URZ A;  3NQP A;  3KV4 A;  3FUI A;  1SHZ C;  1WY6 A;  3LFM A;  3FU0 A;  3ZRH A;  1IJ6 A;  5KCM A;  4UWK A;  4AV7 A;  3KS2 A;  4PS3 A;  2WXP A;  2KMF A;  4TV9 E;  2XPZ A;  3MKQ B;  4WAF A;  3FDH A;  2X9X A;  3RRW A;  4L7T A;  3QKY A;  4IN3 B;  2V7K A;  4GYS A;  4XE0 A;  1G73 A;  3C64 A;  3FTZ A;  3CML A;  3DP7 A;  1FEW A;  3CQC B;  3I0O A;  2HPJ A;  4BT8 A;  4UEM A;  3N9L A;  4A3V A;  2KZT A;  2VKJ A;  5LCY A;  3CHQ A;  4I6G A;  2X9W A;  2X6H A;  3TXN A;  3QB2 A;  1HS7 A;  1MMN A;  3JUI A;  3RO3 A;  1X5B A;  3U3W A;  2ZU6 B;  5JRC A;  3DPD A;  3SHF A;  1IAP A;  4PS8 A;  4Q96 A;  2PFV A;  3AU4 A;  5BW8 C;  4H9Q C;  4HVB A;  3SI5 A;  3RRU A;  4H63 H;  2X0L B;  3QWP A;  4GOU A;  4UV8 B;  4H7Y A;  1IJ5 A;  2B1E A;  4IRU A;  4GYW A;  3AVR A;  5EX3 A;  2C0M A;  2M67 A;  4UEL A;  3C51 A;  4FU3 A;  3MA9 A;  1ZKE A;  3FU3 A;  4AOF A;  1E8Y A;  5LCW J;  3UT5 E;  2R5S A;  3BG1 B;  2CMR A;  4WNE A;  4HOR A;  2WQ7 A;  3ZVV A;  3MCX A;  4EYY R;  4J2C A;  2NTX A;  4N2S A;  4KXK B;  3ML9 A;  4EYU A;  2UXX B;  4PJJ A;  4CGV A;  3UUL A;  3FTV A;  3BQL A;  2IAK A;  3P8C D;  3FTW A;  4B94 A;  2Q9Q B;  1ZV4 X;  5JH7 E;  2KC7 A;  2LSJ A;  5CHE E;  5DIZ A;  3NZS A;  4ASK A;  4JC8 A;  4FHJ A;  3PUQ A;  4NRH B;  2YK0 A;  4BFR A;  4P0B A;  1LRZ A;  2LAH A;  3RK6 A;  4N3C A;  3FY4 A;  3Q9D A;  2VTB A;  4H63 V;  2AW6 A;  3R6N A;  3DJB A;  2JMK A;  3CX6 B;  1E7U A;  1BR0 A;  2GW1 A;  4ZOL E;  2WVI A;  4O2B E;  3N9O A;  3OAW A;  2MTQ A;  4YFS A;  4AXP A;  5FYM A;  2C5K T;  3FH7 A;  4L2L A;  5LBM A;  1P5Q A;  4TN7 B;  4IE5 A;  4I6E A;  4IYP A;  4PJM A;  4R7L A;  5JR9 C;  1FIO A;  2WQH A;  3D9I A;  2CE7 A;  3RRN B;  2LSY A;  5FTP A;  3PVL A;  4OVV A;  5H6R B;  3QWW A;  2VK9 A;  2K48 A;  2K24 A;  3HIZ A;  1ZHC A;  1PAQ A;  3GZS A;  4XKC A;  3EDT B;  4FJY A;  3PRZ A;  1LKX A;  5EK3 A;  2LSK A;  4IE0 A;  4OFZ A;  3ZC1 A;  2Q9Q C;  3EDV A;  4IGU A;  4DJA A;  4JLE A;  2IC9 A;  3AS8 A;  4KVO A;  4WWO A;  4QX7 B;  2V5F A;  3FUE A;  5KDM C;  1IZN B;  2H7O A;  3HVE B;  5FXZ A;  3AA0 B;  2CG3 A;  3ESL A;  3AAA B;  4PK5 A;  2W0G A;  3CHS A;  3MJW A;  1VOM A;  3D9M A;  3C4X A;  2XQ0 A;  3GN5 A;  3CKD A;  2BUG A;  2WXL A;  2WBL A;  2JMH A;  1H2U A;  3CVW A;  4MHC A;  2L0I A;  4G24 A;  3KV9 A;  4U07 A;  2V7I A;  3AS4 A;  2HPL A;  4G25 A;  2PBI A;  3CVR A;  1NWM X;  3QC9 A;  5HI7 A;  4ADZ A;  5T8I A;  2LO6 A;  3I9W A;  5A7D B;  2VAS A;  1Z3Y A;  4E85 A;  4KUM B;  4ANJ A;  5LA6 E;  2CLY C;  2RD0 A;  1AJ3 A;  2PM6 A;  2VSN A;  4JPS A;  1XNF A;  4GA1 A;  1Y8M A;  4KZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...