3ZYKA

Structure of calm (picalm) anth domain
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
269
structure length
269
Chain Sequence
SAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis for the endocytosis of small R-SNAREs by the clathrin adaptor CALM.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
molecule keywords PHOSPHATIDYLINOSITOL-BINDING CLATHRIN ASSEMBLY PROTEIN
total genus 111
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zykA02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zykA01
1EYHA 1JWFA 3D9KA 3G2SA 1HF8A 2V8SE 3D9NA 3ONKA 1JWGA 5J08A 3G2UA 4FLBA 3ZYKA 2BF0X 1UJJA 2MOWA 1HX8A 3ZYMA 1UJKA 2L0IA 3G2WA 4Q96A 5LOZA 5CMWA 5LP0A 3G2VA 2QY7A 1VDYA 1JPLA 3D9LA 1SZ9A 1H0AA 1SZAA 1EDUA 2L0TB 3D9JA 1DVPA 1XGWA 4FU3A 4NACA 4AVXA 3D9MA 3CLJA 1X5BA 2LO6A 3D9OA 1INZA 3D9PA 1HG5A 1HFAA 2KM4A 1PY1A 5CMYA 1ELKA 3LDZA 3G2TA 4Q94A 3ZYLA 1JUQA 4GZDA 1HG2A 1MHQA 4GZCA 1LF8A 2DIWA 3D9IA 4HFGA 3RRUA 3ZYQA 4JXTA 2DCPA 3ONLA
chains in the Genus database with same CATH superfamily
4AXPA 5EIBE 2B1EA 3KV6A 3VTYA 3PS6A 2LHNA 3QWPA 3N9QA 5M4YA 4M1PA 2KCVA 3K1SA 4ANJA 4E85A 4CI3B 1KF6A 5EK2A 4WNGA 3HKEE 4B8CB 3MXZA 2K48A 2P9BA 2VSYA 5AENA 5LGUB 3FULA 5B1AE 3VRBA 2GK9A 2CEAA 1U3DA 3KINB 1SHZC 1QLBA 2FJAA 5LCYA 4U7EB 1HCIA 2J49A 1YQ3A 2LRLA 3BQKA 4G26A 3VU7H 3Q9UC 4UI9K 1J5ET 4UUCA 3UUXA 3E30A 2OCCE 3AVRA 2XRZA 4TXRA 4HB5A 1E90A 5AN8A 3QWWA 3M3ZB 4I43A 5D66A 1PAQA 3UT4A 3HKBE 4GPKA 5AQFB 4U3CA 2RA1A 1ZV4X 3N9MA 3LG7A 5BT1A 5HEGA 3AEFA 2QYWA 2CLYC 3EDUA 4MHCA 2UXXB 3ETUA 2QVAA 4K0UA 2LHRA 4LF6T 3ZGQA 4ZI3C 3E0ZA 4HE8A 2IOLA 3K8PC 3IV0A 4TN7B 3APFA 2V7MA 1TEZA 2JIWA 2KZTA 4Y6WA 2I6HA 2QA7A 4BX8A 3HKCE 1S70B 5FTPA 3I3NA 3NBNB 1UUSA 4MLPA 3GN5B 1HO8A 3RRUA 3N9PA 2R59A 3L17A 3WAKA 4EZJA 3UM1A 2PM6A 1FCHA 2EIKE 4UQYA 2KINB 3SGHA 4JUYA 1E8YA 2P9PG 1BR2A 3PUWF 4JYAT 2UUAT 2XCCA 2B6CA 3LVRE 3U9WA 3MK7C 1HU3A 1MIVA 2C2LA 3IHYA 5JDGA 3NZUA 4LCTA 2MYOA 2FO1E 4DR4T 2JLBA 2BTDA 3SD5A 4U8VD 5HAXA 4ZEYA 5HYAA 4IL4A 4A98A 3PU3A 5HXSA 1JWFA 3PUJA 1ZOYA 5KWDA 4BTBA 1L0VA 2M63A 3FTSA 3T8KA 3PV0F 2HPJA 4PDXA 3E37A 3AE5A 5DQWA 3D9HA 3SO8A 3U64A 3SBSA 1FMWA 2WBLA 2V6XA 1IBLT 3SI5A 2P9SG 3LFMA 2V7KA 4ATGA 4N2SA 4TNVA 4JZYA 5AARA 2IAKA 1NENA 3E34A 3RF1A 4F53A 4UWHA 3C98A 3LDQB 4D10C 3Q49B 5FY0A 3AAIA 3AG4E 4M3OA 4KBMB 5C2YA 1NZNA 3BEEA 4QH1A 4YVOA 1RZ4A 5F8PA 1E2AA 3EAMA 5JREA 2IY0C 5G2NA 4GYRA 3C51A 2J9QA 4KT6B 1HNZT 1H2TC 5EX0A 3TXNA 2LRKA 3JXJA 2XAJB 2UUCT 1OWPA 3CK9A 3UQ3A 3I1AA 4NUUA 3RRMB 1UK5A 4C0MA 3J5QB 4PS8A 2NW7A 3HXFA 2WAUA 4J8YA 5C2TA 2P2CP 2V4LA 1DU2A 5BW8C 4LF4T 4DNDA 2XPZA 2CMRA 3ASOE 3BG0B 4J8SA 5LP0A 2R03A 3SBTB 4WNEA 2X9XA 2V7JA 3RAUA 5CFBA 1U3CA 3FHEA 3LKUA 4U8YD 4WWPA 3ZN0B 4I6JA 2J4DA 5LGNB 4AI6A 5CA1E 4HI8A 1YKHB 5IUXA 4TUYE 3GW4A 3RYFE 3HL6A 3EDTB 4QX8B 1NAFA 2Y6XA 2XAQB 2X6IA 3SQVA 3AAAB 3FTZA 4U33A 5LOZA 1S94A 2W00A 3RRCA 3P4PA 3UI2A 5KDMC 3NQPA 4UVAB 3TWQA 3CEQA 2VGYA 3TWUA 2F8YA 1S35A 2E8IA 5GONE 3EHRA 4PS7A 3X2QE 4CI1B 3Q5WA 2UXNB 3E22E 5AQMB 4PJLA 2C0SA 5AQBA 3VTXA 2FULA 2IONA 1O1SA 5H6QB 5AQAA 2WXPA 4AISA 5LGTB 5FY7A 4AIUA 1QQEA 2WU5A 2BKKB 3AEEA 3K9IA 4IULA 4ACKA 1KNPA 4EPZA 5CGMA 2ACXA 2XQ9A 1CUNA 2X9WA 3RIAA 5HEOA 4JI6T 2VJ8A 1IKND 2IO3C 5T4YA 2AXUA 3VLEA 4B0ZA 3RC3A 2CFUA 2WSSV 4G2AA 1SVXA 3ASFA 2BBHA 4Y6CA 2E5VA 3ZMZB 5CRUA 4YSZA 1N95A 2X6FA 3JADA 4IT4A 2V26A 3ZT5A 4G63A 2WZIA 5KMGP 2LSJA 5LOVE 5KJLA 4JA7A 3RU0A 4PFPA 1BR1A 2J08A 3GZ2A 3BK9A 1HX1B 4B3MT 3UTMA 3EI0A 2XEEA 3Q73A 1Z0PA 3N71A 1MMGA 4TUUA 1JCRA 3BQOA 3TXMA 2OOEA 2YN6A 1PY1A 3LY7A 4P29A 3PZ1A 1YKEB 3V79K 5JRCA 3LCAA 2WQYA 5D0QD 4I6EA 3L16A 5ARFA 3O48A 3I9WA 5LNKA 4H9NC 4ANVA 2CXLA 1U5PA 3FUIA 3UM0A 1IJ6A 3RHWA 1S0PA 4BAYB 3KSLA 3ZLIA 2A5EA 2GRRB 2KATA 3Q5MA 1FMVA 3CLJA 2KLQA 3CK6A 3W15B 4AQYT 3QB2A 4HI9A 2KM4A 3ZXSA 4DIDB 5EK3A 5HRYA 2RFAA 3DSUA 5G05C 1GW6A 4DV5T 2VGEA 3N9NA 4HFGA 1O5MA 2H3RA 4HBDA 5ABHA 3TLWA 3I0QA 1LD7A 3PREA 4ILHB 2Q9QC 3P4RA 4FADA 2BKPA 3DXMG 4KZCA 3LK3B 4YSYA 1DNPA 1V54E 3AG3E 5FINA 4LNGA 2Q9QD 3ML9A 3JQ1A 4B6XA 1UOHA 4TUMA 4AEZC 3JAEA 2GROB 3LBXA 2H6FA 3GA8A 3MACA 3TAXA 4QXCB 3T1HT 2XQ5A 5ITZF 4O4HE 3FBZA 2P9NG 2V8SV 3QAQA 4AJWA 4ASKA 2XS8A 4XI9A 5HWXA 4U63A 3AECA 4GOUA 4PFOA 2EINE 1T7SA 2KBXA 2D0TA 4ADZA 2E9XD 4F1PA 3QK6A 3VKGA 3IKOB 4PUCA 4YNDA 3ZYLA 3L09A 3FY4A 3UUXB 2XY8B 3AE6A 5LJNA 4ISSA 4U0ZA 2VTBA 1A17A 2BS2A 4YTPA 4M7CA 1N54A 1BR0A 2CXDA 4J8EA 1AJ3A 3B7RL 4KMCA 3D0TA 3FFLA 2DZNA 3G2VA 4DV6T 4I1AA 5KNHD 1KNZA 5KJKA 2N1GA 4MBQA 5FVKA 4BERA 4UWGA 4NUVA 2MPKA 1T8BA 2BG9E 4G2VA 4UQXA 3G06A 3MCXA 4L23A 3SOLA 5CERB 4AKHA 5HEJA 3FTXA 3EHQA 3JYSA 2PFVA 2WXQA 3CPZA 4I43B 2WXKA 4JEUA 1N4PA 3TLUA 5M72A 2K24A 2NSZA 5ENQD 2VVSA 4HVBA 2YU1A 1LVKA 4YTMA 2C0MA 4H9OC 4ATZD 4B89A 1IAPA 2H6HA 4UIGA 1HR0T 3OBVE 4WWNA 3CWZB 4WNDA 4N39A 5LMUT 3B7TA 3OXGA 4GYWA 2IC6A 3ZUVB 4FULA 4U0SA 4G1TA 3S7FA 4E6HA 5CBNA 4C91A 1ELKA 3KS2A 5EILA 3L9TA 2YDRA 3CMLA 4PJNA 3ETVA 2D0UA 4P0BA 5HWYA 3PUKA 5J2TE 1ZP0A 3SFYA 4U7YA 5AQGB 4F6RC 3ZYMA 4ANWA 2NWBA 5CMWA 4DR5T 4ANXA 5HKPA 2ODUA 1B89A 5JJ7A 4KVOA 3DSSA 3TWWA 5FIOA 4EAHA 1MJ0A 2X9YA 3N2GE 2GRNB 2BVMA 2X0HA 4DV7T 5H6RB 5LMNT 3FU0A 1N0RA 4U8HA 2DYSE 3CV0A 1OXZA 3LBXB 5JMND 3AE1A 2W4XA 1E7VA 2VB6A 2VL0A 2XSBA 3CX7B 3ONKA 2EQXA 4CEMA 3NOCD 5JVDE 2DVWA 2BF0X 1UJJA 5AQRB 2VQET 3UM2A 4GTQA 2W0GA 1XDPA 2X9HA 1HH8A 4HFIA 2R2LA 2FBNA 3D3MA 3ABVA 3AAAC 3JUIA 1ZEEA 5BV1A 4UI9C 4GKKT 4I55E 4BX9A 1FPPA 1MYOA 3DP7A 3ZJ1A 4WBOA 3O9XA 1LF8A 4G23A 3GN5A 2RFMA 3B7BA 3MEKA 2XQAA 2UY1A 4XBFB 1Q2ZA 3ONXA 5KXJA 3CHMA 1UURA 5ABGA 2C5JA 1OUVA 2I2OA 4HFBA 3V5SA 5F5WA 3L22A 4ANUA 1D9SA 3EU9A 1BU9A 3UQ7A 3UUBA 3FP3A 1MMAA 3FB2A 4KI0F 2H89A 1V9DA 3AU4A 1N32T 4IE4A 3F2EA 2VYIA 1EZ3A 3SY2A 3HI2A 1YA0A 3ASNE 3SFXA 4MLKA 3FU3A 2R17C 3CKBA 5ENTD 3PVLA 1TNUA 2HE0A 2UXCT 4JW1A 2L6BA 3ZIMA 3MV3B 2BBJA 3P50A 3RK6A 2ZISA 3AG1E 4GU5A 5FXZA 1BR4A 3P4WA 5AQLB 1BPOA 2F37A 5TAOA 4AVXA 1HS7A 1J1JA 2RP4A 3H3AA 5CHEE 2OVFA 3T9KA 4AM9A 2IUBA 4EBAA 1NWMX 3OVUA 1KEYA 4DMVA 3RH3A 4GZ6A 1HE8A 2G0UA 3FZLB 2AXZA 2RKKA 1OWLA 3RRWA 1N36T 1Z3XA 1WYCA 2WY2A 4DX5D 3C3OA 4CI2B 2GRMA 3R6NA 3PEUB 4GTOA 5JHAA 5ENRD 3C5RA 1JCQA 1NEKA 2AWIA 4GZ5A 1SW6A 2V5FA 5BUZA 4BJMA 3RIFA 4CQIA 2UWJG 5BXOA 3JCKC 4PAGA 4A63B 3N9OA 2UXBT 2AW6A 1Y6IA 3AS5A 5JRCB 4JEUB 3S2AA 3AE9A 2UUBT 2DZOA 1HF8A 1HZ4A 4TWFA 3EHNA 3SRZA 3LPZA 4LEUA 4MBGA 2L3LA 2MOWA 4ZI3D 3ZW3A 4DUYT 4EBAG 2WQ7A 2VASA 4Q25A 1OCCE 2YKSA 4JB8P 2P58C 2KNDA 3L39A 1ZU2A 3OKQA 4DUZT 1YXRA 1N33T 1N11A 2DNXA 2DBAA 2WMOA 1N9AA 1H2VC 1PC2A 1KT0A 1DCQA 2PQNA 3ZKJA 4LRZA 4O2BE 1KNRA 3VRAA 3ZYKA 3ZMSB 2PQRA 2PNNA 4K0RA 5LG4A 3UU3A 5A7DB 2LAHA 2ES0A 3UQ4A 4UWFA 2A72A 4EYUA 4H9QC 3FU6A 3HYMB 3LEWA 1TYQG 1SUMB 2F4VT 4HLEA 2A3DA 3IA3A 2VQFT 3DSXA 1N52A 3AA0B 2IJGX 3C4XA 3FUKA 4TRQA 4PNIA 4RG9A 2Y8DA 2XEVA 4JVSA 2WQHA 3EHMA 3IEEA 5L4EA 3UUMA 4FI5A 4UR9A 4E7ZA 5J08A 1OWAA 1WM5A 3EABA 2BS4A 2K3WA 4U74A 1EF1C 1AP7A 4AKGA 2XPYA 4AY6A 5LG3A 2LOSA 3ZRHA 1SQMA 3RIUA 2XQ6A 4HS2A 3D9JA 3CVUA 2WQ6A 3AA1B 3WXXA 4EEDA 2BEDA 5AYWD 3EUHA 3SS1A 2AVPA 2J47A 4ZHQE 3AEBA 2RG8A 1IBMT 2AE9A 4OYSA 3AEDA 3APCA 3AAEB 4CN4A 4DVDA 2WVIA 3PJAJ 2E2EA 2FJDA 3DEOA 1MIYA 2Z6EA 3L82A 5H7PA 4Z91A 5L2LA 1LRZA 2Q7FA 4BSXA 4NPPA 3CIRA 3CX6B 3Q5EA 3HG0D 4IN3B 3FUMA 1WR0A 4Z90A 3ZMUB 3A7MA 3FDHA 1X9BA 5FXWA 5G05J 2R6GF 3UX4A 5DBKA 3UXGA 5LBMA 2GRLA 2XASB 5ANRA 5LP6E 2LXMA 3R84B 3KVBA 2I0MA 4UV8B 1K8KG 2LO6A 2HH7A 4GMJA 3SHFA 4GKJT 2KXPC 3ZHEB 3L13A 3G2TA 5FXVA 5FYMA 3GZ1A 4JL0A 2DIWA 4LFCT 1FIOA 2X66A 1TNOA 1G73A 4ABNA 3RYIE 4EECA 2C5IT 5FVLA 4JA9A 1YMPA 2XM1A 2XHEA 4DLOA 4H9SE 4CDNA 5HCMA 4TWHA 1IQUA 1TN7A 2LSKA 2XPIA 3EUVA 5HS0A 2NTXA 3UT7A 3ZXPA 3CVPA 2NP9A 1ZB1A 4RLYA 4LNBA 2LJLA 4RQIA 1WLXA 3RLFF 5HI7A 1AWCB 2ETAA 4XEIG 4X1KE 4LMJA 4HWFA 5C3JA 3NBXX 4IE7A 3QNUA 4N3CA 2ODVA 3C4WA 4HOTA 2M6IA 2E2AA 4YHJA 2BDEA 2YHCA 4Z68A 4FJZA 1DVPA 4K5CA 4BSZB 4NACA 3FTYA 1IBKT 2HN2A 4HWHA 2J4GA 3DSVA 3ZU7B 5DJQC 3RSEG 3AXJB 3NZQA 4KUMB 5A6CA 2ACZA 2BUGA 4JI7T 1FT1A 3AEGA 4YY3T 4CN1A 5ABFB 2N2NA 1OWNA 3U3WA 5AJLA 4YLHA 2P9UG 2PJQA 3EIQC 1N0QA 3CX8B 2XAGB 5DIZA 3JUEA 3W9FA 4TV8E 3RJVA 2VKDA 4YDOA 2ZIRA 4PJMA 2IOSA 3R9AB 3LSVA 3ISMC 1FVHA 3CHPA 4N5CA 5CMYA 4CT0A 3AE4A 2YEVC 2WXOA 2H7OA 5JHBA 4F1SA 3LVQE 5AQTB 3QKYA 4XIFA 2HN1A 2IU1A 4BA9A 2H6GA 3JC6C 4HFEA 2NYJA 2X6HA 3I4RB 5AQJB 2ZU6B 2XQ8A 2ZGDA 3F31A 2HYZA 4G25A 4HWCA 3B57A 1E7PA 2YDSA 4IREA 1N4RA 2D5UA 4Q94A 3VLFA 1HNXT 5EKQD 1UG3A 3I4GA 4CXXA 2ILRA 4JLEA 2XHEB 5JDFA 4QFVA 4Q69A 2WMNA 4PK5A 4FJOA 2M6BA 1MIWA 1NP7A 3AG2E 2VGXB 3GYZA 5L3DB 2LSGA 1UX4A 4KVMA 3FZHB 4U0UA 1N94A 2C0LA 3EVYA 4JC8A 1ZHCA 4K0KT 4FU3A 4CZZB 3SFEA 3FUDA 2IEJA 2CPTA 3MYVA 2WWUA 1I94T 1VOMA 4UXNB 5L4HA 2V7LA 4GTMA 4UI9J 4A5XA 4U96D 4ILUA 5HXHA 3UT8A 3C3RA 3RO3A 2ONDA 4JHKA 5LFAA 4CXYA 3TWXA 2QGSA 2JJ9A 2W61A 3PTRB 3ZMVB 4UVBB 4AKIA 3RQWA 3HVEA 5JA4D 4CCAA 5JJTA 3MKQA 4N78D 1WFDA 1BI8B 5FQ7A 3H3MA 4EV6A 2GRQB 3C72A 1Y64B 2MBGA 3ZHEA 2I1KA 4HNAD 2LSIA 2Y0BG 5FL1A 1W0BA 3CHOA 3UKUG 2YNQA 3IBEA 4LUNU 2B76A 3CVLA 3D9NA 1BI7B 3TG5A 1JCSA 5FNVE 3TWTA 4HWDA 5KJMA 4HRLA 1MZCA 3JCFA 2QYUA 4JHJA 3A5XA 5L3FB 5F3JA 5L3BB 4KMOA 4QWNB 4C9BB 2CWOA 2LKGA 3ENEA 2WM9A 3ZT6A 4ACLA 3F57A 4XX5A 3AS8A 3O1JA 3URZA 1UW4B 3RYCE 2BKNA 3C4ZA 3L8RA 4PH4B 4OVUA 1HTJF 2NXPA 3CVXA 2E9XB 4YJ2E 4GPMA 1OWMA 4NRHB 3IBPA 3PZDA 3IHVA 3HXCA 3UIOC 5J0ZA 3UUNA 1TNBA 4NXMT 1XDOA 4GMRA 4MKTA 4X20E 1QBQA 4O1OA 4B93B 3KEAA 5HEHA 4OAUC 2LM9A 1O1TA 1OY3D 3PNLB 1KT1A 2Q9QB 2V6YA 3FU5A 2ZLYA 3PE0A 1WR6A 4X5TA 5ADXL 4L0RA 3N5LA 5LHIB 3VHLA 2RD0A 4JD2G 5AQHB 4ZHBA 1MQSA 3ANWB 2WXRA 3HDXA 5CRVA 3UPVA 2GW1A 5KJNA 2X6KA 2A9UA 4IGUA 5BXUA 3CKCA 2XQ0A 3Q7FA 4FLHA 2BZBA 2M67A 2KC7A 2A2FX 4A55A 2KCLA 2VSOE 2E9XC 4AQGA 2Y69E 4EIWA 4GIWA 2DWKA 3QOUA 1TJFA 3LJ3A 3PZ2A 3UU5A 2H88A 2XZDG 3DEPA 3FEXA 5LHHB 4YJ3E 3NF1A 3Q7AA 4GYYA 4OX9T 4F6RD 1H0AA 2NW8A 3QNKA 1TR4A 2ZM2A 4V3IA 4O1PA 4TXQA 1U2VG 4GK5E 2WCAA 3P7IA 4NXNT 3CHQA 3S7DA 3OXLA 1FEWA 3LY9A 3PDYA 4DJAA 3PUSA 4GZDA 5E0OA 1IXVA 5JDNA 3OXFA 2MOZA 1S63A 5KX5E 3RIUC 4IDZA 2IFUA 2LOPA 3FUFA 1OCZE 3BUAA 3KV9A 4DBQA 2VSNA 4LFBT 3TJPA 2BVLA 3OYXA 1JPLA 1MX6A 4GTTA 5B1BE 3MZLB 2MYSA 3KBUA 4TZ4C 4JI3T 3T5XA 2IF4A 5B3SE 4FJYA 3H37A 1HG5A 4U2ZA 4OVVA 4J2CA 2C5KT 4I4TE 3Q5DA 4Z8XA 4GTPA 4HWIB 3PUXF 4AIFA 4BTAA 5FP3A 3RC8A 5D0OD 4IYPA 5AQUB 4QH4A 1YW0A 4X64T 4J6IA 4A1GA 3OTNA 4IDOA 2P9LG 2D9DA 1EDUA 2P9KG 2HO1A 2WZHA 3K3QC 4UWKA 4DX1A 4EZKA 2XGMA 4DLQA 4OFZA 3UIPC 5CCMA 3ZEFA 2AXDS 3FWVA 4LNUD 3UULA 2KWIB 3ZKRA 1D0XA 4DBRA 2WXHA 3FTVA 2X38A 3OAWA 1JNRA 4BEPA 1G8XA 4H9RC 3TL5A 3WI3A 2DLRA 2FUPA 1L5JA 2WXMA 5ENPD 3V2XA 3AB3B 4YXDA 3DWLG 4K03A 2WB5A 4CYMD 4WW0A 4BT9A 3D9MA 4WYVA 3D9OA 2CE7A 3VR9A 4G8LA 4I1OB 3KFWX 3JC6D 2LSYA 4X62T 3ZYQA 2A5UA 5HXCA 2OV8A 4L9PA 2XGSA 4XKCA 5EIDA 4O4LE 4BT8A 4DI4A 4DMWA 1UN9A 2X67A 1UCUA 2FJBA 1SA5A 3UT5E 4K5BA 4PJJA 4CGWA 2QC9A 2PG8A 5ENNA 1XZYA 3ZPOA 4AQFC 3S7BA 4AV7A 5L47A 4RG6A 3RX6A 1SZ9A 3CKDA 4TNWA 3UFGA 3BG1B 3PUZF 3NWIA 2XAHB 3WAJA 1X5BA 4YTNA 4HOQA 3AE7A 2PBIA 3V5UA 4EZ4A 1MHQA 1NA0A 1YQ4A 3MKDA 4O6FA 5LCWC 4HQDA 4UVCB 3TWRA 2EHOA 3MV2B 1JWGA 3PU8A 2JPFA 4EZLA 5ABEA 3ULYA 1K3ZD 1LD8A 1UJKA 3RO2A 2KWHA 1KPSB 3U3IA 3ZN3A 4L5GA 4X66T 1OEDE 4PK4A 4X1IE 2L6JA 4O4JE 3FHNA 1OCOE 2YDQA 3OYZA 2HR2A 4YDWA 1FVFA 1N4SA 2J8SD 2WXNA 4XE0A 3S4UA 5FMNA 3C50A 1JUQA 4O4IE 4JEHA 5AQOB 4DR7T 2X6JA 3DPDA 3CK8A 2DL1A 5EN5D 3JQ0A 4DI3A 4JV5T 4I1MA 5BNWA 3G2UA 4HTEA 3L08A 3HIZA 1HX8A 5AQNB 3N9LA 3QWVA 3PURA 3IXEA 3Q79A 3B7SA 2Y3AA 4J8DA 1QNFA 5CJ5A 4YHHT 3IHRA 1D8DA 2KT9A 2CG2A 3I9YA 3BU8A 2XQ7A 1OT8A 3MX3A 1HXIA 2IDOB 2OV9A 2B0OE 3PEVB 4EYYR 3I0OA 4DR2T 2VKHA 3LJNA 1Y8MA 1ZBPA 3R7QA 2BG9C 3ZEFB 3NRXA 2P9IG 2DI4A 3MKRA 4ZI7E 2L0IA 4G24A 4Q96A 2V5CA 4BY6A 5T3RA 3P8CD 4JBWF 2EIJE 5AQQB 2XQYA 3AE2A 4HFCA 4FA6A 4I6GA 2OVBA 1TNZA 1MNEA 4WWOA 1T98A 1E96B 3PUQA 2RPAA 3IEGA 5FQ6A 3QUJA 2EHOC 3T8OA 4HRNA 4N3BA 2BKGA 3FUNA 2H7VC 3V30A 3P4SA 3T1YT 1ELWA 1K1AA 1W9RA 1SA0E 3B7UX 4HN9A 2HPLA 2Y48B 4IRUA 1KZPA 2IC9A 1O1RA 3O1IA 4C48B 4XZ4A 4KHZF 4B3ST 3FZMB 3MKQB 5BV0A 3HXEA 2R5SA 2KZ7B 3ZPJA 3DPYA 5JJ6A 5AQSB 1NL4A 3CVRA 2VQ2A 4AQFA 5HCJA 5LHGB 3ZVVA 4PS3A 4CRWA 5AQVB 4CN6A 2LT3A 3OTOT 2X3MA 4LF8T 4EQFA 4H7YA 4AXHA 4EGWA 3CK7A 4N3AA 4FP7A 1KFYA 4CGVA 1R8IA 3AE8A 4BWRA 4FLBA 3CQXC 4URKA 1YYHA 2A4ZA 4MALA 4U2YA 5ENOD 2CBJA 2X0YA 1M7KA 5JR9C 1I6ZA 2EILE 5EYPF 4I0UA 4YVQC 3PNTB 5AQKB 1KK7A 4AP2A 2XJ7A 4E7SA 1Z5SC 4GCOA 4G8KA 5HQ8A 2I9CA 2VWAA 2XUEA 4ZI2C 1N34T 3ZCIA 3QB5A 3CQGB 4KYOB 3Q9DA 2E0IA 4ERRA 2I1JA 3ZSTA 5FJYA 5FXXA 1WCRA 1X81A 1EYHA 2J4BA 4B94A 2VL8A 4WNKA 4UEMA 3DSWA 2XQ3A 3UU4A 1G3NB 3UMVA 4P1NA 2WS3A 1XWMA 5LA6E 3SFDA 1D8EA 3RQUA 4I9CA 1BLXB 4I50E 3Q2MA 5DQVA 1JNZA 2YOEA 4TV3A 4KXKB 1LVFA 1H6OA 3QARA 3DBSA 4ME2A 3U4TA 4YSXA 4ISTA 3PE3A 2KSRA 2MTQA 4ILBA 2DYRE 2GRPB 3QJZA 2UY1B 2AXVA 2GGFA 2YU2A 2XEHA 2CRBA 3KDSE 3MA9A 5FQ8A 3PUVF 4F8HA 3C3QA 3J5PA 3CGHA 2ZM0A 5LJMA 2IHR1 2NR4A 2ZGGA 4WAFA 5ABFA 3ABKE 3L3PA 1T72A 2CBIA 1GQEA 3OPCA 1W09A 2UXDT 4EZHA 2CHOA 2CHNA 3NAWA 3A8YC 1D0YA 4JI4T 5C1DA 4N5QA 5FZSA 2CA5A 3SF4A 1B7TA 4GAAA 3AXJA 4QH5A 4GCNA 2WXIA 3FH8A 4HKAA 4I9EA 1XNQT 3G2SA 1H7CA 5JDHA 3FBLA 2XTLA 3KV5A 3Q15A 1N4QA 1HNWT 2YHEA 2VSXE 3GWHA 4H63H 4DK5A 3PH0C 1FJGT 3ABLE 3KSQA 1E8WA 4BJNA 3PZ3A 2XS1A 3L6AA 1XNFA 3CR3A 1YD8G 3TKLB 4JI1T 3BQLA 4JEHB 3GZSA 4A1SA 4AOFA 2JQHA 3RIBA 5BR8T 1QUUA 3IF8B 4ILAA 2WXLA 2L8KA 2W2UA 4HXIA 3KVAA 3E32A 1P5QA 3TLVA 5AJDA 3HHMA 2JRKA 3ZT7A 4U31A 2PTFA 1SE7A 2XAFB 4DV3T 3HXBA 5LYJE 5JR9A 5BMVE 4OHFA 3EDVA 3QC1A 2QRXA 4ZS2A 5FL0A 4O60A 4GA0A 4GZCA 2JQQA 5AQ7A 1XNRT 3KAEA 3HR0A 2CXFA 2WDVA 3PRZA 5JH7E 2J1DG 3ZC0A 3CIAA 2LUHA 3WG7E 1J5WA 4UQZA 1DC2A 1OEDC 3SFZA 1DCEA 1IHBA 2QYJA 1MX2A 4WNFA 5JDQA 5J1GA 4P0AA 2Y1LE 3FH5A 2AJAA 3QDNA 4MRUA 1HFAA 2MAWA 1US7B 3N2OA 4UF0A 4LF9T 3GMIA 4CZ2D 4TX5A 3W9GA 4N2QA 3J7Yq 4IE5A 4JPSA 4GK0E 3FZKB 5KBAA 1MX4A 1QZ2A 2DWGA 2ZM6T 3MJXA 5FZRA 4U07A 3TGOA 4XAXB 4KHPT 4KBQA 1MNDA 4EHMA 3FXDB 1WG0A 3ZC1A 2VKJA 3ZN1B 2HM8A 3HVEB 4LF7T 3ULQA 1CHUA 4LSZE 3N2KE 3PE4A 2VURA 1VRBA 5JDLA 3QC9A 4A3VA 3NZPA 5CEDB 5EDSA 3ONLA 3ASDA 2K5BB 4L2YA 3OJAA 1Z8UA 3PJAA 2XGOA 4ILGA 2XM2A 4IE6A 2V5QC 4K5AB 1WDYA 1S64A 4UELA 1Z6TA 4TV9E 2OLTA 1H6PA 3MA5A 4G11A 3ZMTB 5LX8A 1INZA 2R02A 3AJIA 3L54A 4L1BA 3SZ7A 1D1BA 2QZAA 3UKRG 4XZCA 5JQGE 2LNIA 2J62A 2CWYA 2JQ9A 3ESLA 3KD7A 4L7TA 3DSTA 1U4QA 3O4XE 1WRDA 2NW9A 2V5DA 1NFIE 5ANLA 4DV1T 2J09A 2VGXA 4NIKA 4L9IA 1OCRE 2QY7A 1VDYA 1VCSA 5JR9B 2W67A 3VR8A 3LJCA 4R7LA 5ARGA 3T8MA 5CCLA 2ETCA 2IIUA 1X79A 3UTKA 3AE3A 2IO2C 4W9RA 3AVSA 4HFVA 4GYOA 3TWVA 2LLYA 4IDQA 3RKVA 5AQIB 1A5EA 5KCMA 2N9DA 3S7JA 3O4ZA 2MHKA 4DV2T 4DR3T 3AA6B 4WBNE 2W63A 3QB5K 3F6QA 1BD8A 4UV9B 2WDQA 4I17A 3X1DA 3DTOA 3O1HA 3EHZA 1WY6A 2Y4TA 5LBQB 3MGBA 2PZIA 3Q47B 2MRIA 4ZZBA 4XI0A 3U66A 4H9PC 2I59A 4H7XA 3TWSA 1WAO1 1ZKEA 3ANWA 3QOFA 4J7WA 5FWQA 3RI5A 5IYZE 4CT4A 4NIQA 4QQIA 4NURA 1W3BA 2LSVA 4B3TT 3RKGA 1KLXA 5LXTE 4J8FA 2H6IA 4XKBA 3VLDA 1ELRA 3CVNA 3CHSA 2LE8A 2FBWA 4C0EA 1TNYA 4ILIA 4DV4T 5FQ4A 4YT0A 2IQCA 4JXTA 4GMLA 1H6KA 3HKDE 3AEAA 4JHRA 3CQCB 3ESKA 2E9XA 2XPKA 1SA4A 2LAIA 3ABME 2FO7A 3ASHA 2Y4UA 3CSTA 5DABA 4H63V 5AQPB 2QFCA 3B5MA 2WXJA 4HRMB 4DUIA 2XSAA 3KEZA 1XMOT 4O8SA 3PUYF 2BG9A 1K1BA 5KNGA 3E33A 3R7RA 4HORA 5L3EB 5JDMA 2V4HC 3RKOA 1UGOA 2NC9A 1IHGA 3PDNA 3FUHA 2X68A 3FEYA 4A3TA 4CDMA 3HA4A 3E4BA 3CVQA 1H19A 2XZEA 3CVYA 3PZ4A 3AS4A 5C8YE 3NZSA 2LKHA 4KP3C 4GYSA 1QSDA 4IHJE 4YDYA 4ZI2D 3JXIA 2WU2A 3ONJA 5HXEA 4MS6A 3E08A 5JTGA 4B8AA 1E1HB 2WPVA 1KZOA 4ZOLE 3SNXA 5IY5E 4JI5T 4EEBA 4L2LA 4JI2T 2PM7A 1OEDA 1Z3YA 4LMLA 3FTUA 2EIME 4C90A 1FT2A 2NTYA 5E76A 4IDPA 3CVVA 2LEHA 3D9LA 1SZAA 2XQ4A 4PW8A 2ZXWE 3Q4AB 1XGWA 2LM2A 4P09A 3R9MA 1VCTA 2JQKA 1H2UA 2CHZA 4NQ0A 5BPPA 5G04C 1TJCA 3CSFA 2W62A 4RVBA 4OYKA 3FUJA 5A1LA 1E8ZA 4BFRA 2DWZA 1IQRA 1E8XA 3M65A 4LFAT 4LERA 3Q78A 2XENA 5L3GB 4A97A 3NOGD 2ETBA 4DPRA 4WZXA 2KMFA 5E75A 4HOSA 2VKOA 4ZFHA 4WUYA 2FI7A 4APOA 2L0TB 4EXTA 4JI8T 4LG6A 4ZZCA 3CHRA 3UM3A 4FC8A 3D9PA 1LTXA 4DR1T 4GB9A 3LDZA 3TG4A 2BS3A 1HG2A 3UINC 3D9IA 2OA5A 4AKRB 3TLTA 4BETA 3D9KA 1IZNB 4YDEA 3ZNGA 4IIJE 2XRYA 2V8SE 3B95A 2R05A 3PUGA 3P2BA 2CFZA 4GA2A 2WDRA 2NOXA 5ETWA 4IL9A 2ZMAA 4TWDA 1D1CA 1NA3A 3NB2A 4JI0T 3NRYA 5L3CB 4ILCA 1YCSB 4I2ZA 4UF0B 3U78A 4LF5T 4J0UA 3ULEG 4U72A 2V7IA 1Y01A 3Q9NC 3ZSSA 4DRXE 2V6YB 1D1AA 2Q9QA 4KX6A 3RPUA 4F3VA 2CHWA 2JABA 3LXUX 3C64A 5T8IA 4ZXLA 1LKXA 3V31A 2WWVA 2IW5B 4DX7D 2JMKA 2X0LB 2VK9A 3APDA 3FZFB 2EHOB 4F7AA 1TN6A 3PUAA 4DV0T 1OXJA 4B3RT 3AA7B 1TN8A 4HFHA 2V0PA 4GTVA 2OEVA 3T5VA 3Q75A 2F8XK 1V55E 4MFRA 5CEAA 5D2MC 2VTBB 4U7IA 2EHOD 3RRNB 4U04A 2WXFA 3UU8A 4HOUA 4OYJA 4AKLA 2X51A 3DXKG 4BESA 3SWHA 4HLLA 3KV4A 3MZKB 5EK4A 4QXBB 1RW2A 3EIJA 3K3OA 5LB7B 3HRAA 1W0AA 3DRAA 4DR6T 5HXRA 3ZFWA 3Q5XA 2JMHA 2FJEA 2YQ8A 4GTRA 4OAVB 1D0ZA 4FHJA 2W66A 4CXWA 4I2WA 2CM0A 2KXPB 2YK0A 5FKYA 5AIJA 5CBOA 2HHHT 4X65T 2E5LT 3G2WA 3LS8A 4A56A 4RSYA 4HEAA 3LK42 3ZJ2A 3HXDA 4QX7B 4COFA 1IJ5A 3B13A 4QHOA 3FUEA 2KCKA 3LY8A 2LXLA 2BG9B 4FHKA 2WXGA 3MJWA 5FT9A 4U95D 1IYGA 5ENSD 3BQIA 2YINA 2JEKA 3RGLA 3QK0A 1MMDA 5IHYA 3RYHE 2XCBA 2D2SA 5CB4E 2L9BA 3ZCJA 4CDRA 4DO0A 2BKOA 2UU9T 3TLSA 2F0YA 1E7UA 4HFDA 5FZQA 3EU5A 4O2AE 4IE0A 1QYMA 4X1YE 5AQ9A 4APFA 1XMQT 2FF4A 3LK2B 3FXEB 2L9QA 4PK6A 3KBTA 3FTWA 2CG3A 2KZTB 1HS6A 1OEDB 4V1Av 5J2UE 4KZ0A 1NI1A 4EB6E 1OWOA 3P4QA 4HGAA 2DCPA 2J07A 4IDNA 2VVNA 4X8QA 3EJNA 2DHRA 3UFEA 4OK0A 2CCQA 2XZTG 3NKZA 4EOZB 4DX2A 2CHXA 2PL2A 5AAOA 2IMLA 3VKHA 4UWLA 3DJBA 3NVOA 3P1UA 2FEZA 2WB2A 3V2OA 3ASGA 4AY5A 3CVWA 3I5PA 1MMNA 5CECB 5EX3A 5EZYE 4DX6D 2ZM8A 4LMKA 2V1DB 3UU6A 5G55A 2SPCA 2DCFA 1O3XA 5G04J 3JAFA 5J90A 4QKNA 2WP9A 4QXHB 2OEWA 1WYBA 4GA1A 3ONLC 2CLYB 1EPUA 3K3NA 4GZ3A 4GTSA 1UX5A 5AFUL 1M62A 2LSUA 5A23A 5IWAT 3C98B 3ML8A 5CA0E 3LYAA 4ZS3A 3FH7A 3J9X1 5EYLA 5LCWJ 2K9AA 5HEUA 5FY1A 4YFSA 1UN8A 4TXPA 3AU5A
chains in the Genus database with same CATH topology
4AXPA 2B1EA 3KV6A 3VTYA 3PS6A 2LHNA 3QWPA 3N9QA 5M4YA 4M1PA 2KCVA 4ANJA 4E85A 4CI3B 5EK2A 4WNGA 3HKEE 4B8CB 3MXZA 2K48A 2P9BA 2VSYA 5AENA 5LGUB 3FULA 2GK9A 2CEAA 1U3DA 3KINB 1SHZC 5LCYA 1HCIA 2J49A 3BQKA 4G26A 3VU7H 4UI9K 3UUXA 3AVRA 2XRZA 1E90A 3QWWA 4I43A 1PAQA 3UT4A 3HKBE 4GPKA 2RA1A 1ZV4X 3N9MA 3LG7A 5BT1A 2CLYC 3EDUA 4MHCA 2UXXB 3ETUA 4K0UA 2LHRA 3ZGQA 4ZI3C 3E0ZA 4HE8A 2IOLA 3K8PC 3IV0A 4TN7B 3APFA 2V7MA 1TEZA 2KZTA 4Y6WA 2I6HA 2QA7A 4BX8A 3HKCE 5FTPA 3I3NA 4MLPA 3GN5B 1HO8A 3RRUA 3N9PA 2R59A 3L17A 3WAKA 4EZJA 2PM6A 1FCHA 4UQYA 2KINB 3SGHA 4JUYA 1E8YA 1BR2A 2XCCA 3LVRE 3U9WA 3MK7C 1HU3A 1MIVA 2C2LA 3IHYA 5JDGA 3NZUA 4LCTA 2JLBA 2BTDA 3SD5A 5HAXA 5HYAA 3PU3A 5HXSA 1JWFA 3PUJA 4BTBA 2M63A 3FTSA 2HPJA 4PDXA 5DQWA 3U64A 3SBSA 1FMWA 2WBLA 3SI5A 3LFMA 2V7KA 4ATGA 4N2SA 4JZYA 2IAKA 4F53A 4UWHA 3C98A 4D10C 3Q49B 5FY0A 3AAIA 4M3OA 4KBMB 5C2YA 1NZNA 3BEEA 4YVOA 5F8PA 5JREA 5G2NA 4GYRA 3C51A 2J9QA 4KT6B 3TXNA 1H2TC 5EX0A 2XAJB 1OWPA 3CK9A 3UQ3A 3I1AA 4NUUA 3RRMB 4C0MA 4PS8A 2NW7A 2WAUA 2V4LA 5BW8C 4J8SA 4DNDA 2CMRA 2XPZA 3BG0B 5LP0A 3SBTB 4WNEA 2X9XA 2V7JA 1U3CA 3FHEA 3LKUA 4WWPA 3ZN0B 4I6JA 2J4DA 5LGNB 4AI6A 5CA1E 1YKHB 3GW4A 4TUYE 3RYFE 3HL6A 3EDTB 4QX8B 1NAFA 2Y6XA 2XAQB 2X6IA 3AAAB 3FTZA 5LOZA 1S94A 2W00A 3RRCA 5KDMC 3NQPA 4UVAB 3CEQA 2VGYA 1S35A 2E8IA 5GONE 4PS7A 4CI1B 3Q5WA 2UXNB 3E22E 4PJLA 2C0SA 3VTXA 2FULA 2IONA 5H6QB 2WXPA 5LGTB 5FY7A 1QQEA 4ACKA 3K9IA 4IULA 4EPZA 2ACXA 1CUNA 2X9WA 2VJ8A 5T4YA 2AXUA 3VLEA 4B0ZA 3RC3A 2CFUA 2WSSV 4G2AA 3ASFA 4Y6CA 3ZMZB 2X6FA 2V26A 4G63A 5KMGP 2LSJA 5LOVE 5KJLA 4JA7A 3RU0A 4PFPA 1BR1A 2J08A 3GZ2A 3BK9A 1Z0PA 3N71A 1MMGA 4TUUA 3TXMA 2OOEA 1PY1A 3LY7A 4P29A 1YKEB 5JRCA 3LCAA 5D0QD 4I6EA 3L16A 5ARFA 3O48A 3I9WA 5LNKA 4H9NC 4ANVA 2CXLA 1U5PA 3FUIA 1IJ6A 1S0PA 4BAYB 3ZLIA 2KATA 3Q5MA 1FMVA 3CLJA 2KLQA 3W15B 3QB2A 3ZXSA 2KM4A 5EK3A 5G05C 1GW6A 4HFGA 3N9NA 2H3RA 3I0QA 3PREA 4ILHB 2Q9QC 4FADA 4KZCA 3LK3B 1DNPA 2Q9QD 3ML9A 3JQ1A 4B6XA 4AEZC 3LBXA 3GA8A 3MACA 3TAXA 4QXCB 4O4HE 3FBZA 3QAQA 4AJWA 4ASKA 4XI9A 5HWXA 4U63A 4GOUA 4PFOA 2D0TA 2E9XD 4ADZA 3QK6A 3VKGA 3IKOB 4PUCA 4YNDA 3ZYLA 3L09A 3FY4A 3UUXB 4ISSA 5LJNA 4U0ZA 2VTBA 1A17A 1N54A 1BR0A 2CXDA 4J8EA 1AJ3A 3B7RL 4KMCA 3D0TA 3FFLA 3G2VA 4I1AA 1KNZA 5KJKA 2N1GA 4MBQA 4UWGA 4NUVA 4G2VA 4UQXA 3MCXA 4L23A 3SOLA 4AKHA 3FTXA 3JYSA 2PFVA 2WXQA 3CPZA 4I43B 2WXKA 4JEUA 5M72A 2K24A 2NSZA 4HVBA 2YU1A 1LVKA 2C0MA 4H9OC 4B89A 1IAPA 4UIGA 3OBVE 4WWNA 3CWZB 4WNDA 4N39A 3B7TA 4GYWA 3OXGA 2IC6A 4FULA 4U0SA 4G1TA 3S7FA 4E6HA 4C91A 1ELKA 3KS2A 3CMLA 4PJNA 3ETVA 2D0UA 4P0BA 5HWYA 3PUKA 5J2TE 4F6RC 3ZYMA 4ANWA 2NWBA 5CMWA 4ANXA 2ODUA 1B89A 5JJ7A 4KVOA 4EAHA 2X9YA 3N2GE 2BVMA 5H6RB 3FU0A 4U8HA 3CV0A 1OXZA 3LBXB 4CEMA 2VB6A 1E7VA 3CX7B 3ONKA 2EQXA 5JVDE 2BF0X 1UJJA 2W0GA 2X9HA 1HH8A 2FBNA 3D3MA 3JUIA 1ZEEA 5BV1A 4UI9C 4I55E 4BX9A 3DP7A 3ZJ1A 4WBOA 3O9XA 1LF8A 4G23A 3GN5A 3MEKA 2UY1A 4XBFB 3ONXA 3CHMA 2C5JA 1OUVA 2I2OA 3V5SA 3L22A 4ANUA 3FP3A 1MMAA 3FB2A 1V9DA 3AU4A 4IE4A 3F2EA 2VYIA 1EZ3A 3HI2A 1YA0A 4MLKA 3FU3A 2R17C 3CKBA 3PVLA 4JW1A 3ZIMA 3MV3B 3RK6A 4GU5A 5FXZA 1BR4A 1BPOA 5TAOA 4AVXA 1HS7A 2RP4A 3H3AA 5CHEE 2OVFA 4EBAA 4AM9A 1NWMX 4DMVA 3RH3A 4GZ6A 1HE8A 2G0UA 2AXZA 1OWLA 3RRWA 1Z3XA 1WYCA 5JHAA 4CI2B 2GRMA 3R6NA 3PEUB 2AWIA 4GZ5A 2V5FA 5BUZA 4BJMA 4CQIA 2UWJG 3JCKC 4PAGA 3N9OA 2AW6A 1Y6IA 3AS5A 5JRCB 4JEUB 3S2AA 1HF8A 1HZ4A 3EHNA 4LEUA 3SRZA 3LPZA 2L3LA 2MOWA 4ZI3D 3ZW3A 4EBAG 2WQ7A 2VASA 2P58C 2KNDA 1ZU2A 3OKQA 2DNXA 2DBAA 2WMOA 1H2VC 1PC2A 1KT0A 2PQNA 4LRZA 4O2BE 3ZYKA 3ZMSB 2PQRA 4K0RA 5LG4A 5A7DB 2LAHA 2ES0A 4UWFA 2A72A 4EYUA 4H9QC 3FU6A 3HYMB 3LEWA 4HLEA 2A3DA 1N52A 3AA0B 2IJGX 3C4XA 3FUKA 4TRQA 4PNIA 4RG9A 2Y8DA 2XEVA 4JVSA 2WQHA 3EHMA 3IEEA 3UUMA 4FI5A 4E7ZA 5J08A 1OWAA 1WM5A 1EF1C 4U74A 4AKGA 2XPYA 4AY6A 2LOSA 3ZRHA 1SQMA 4HS2A 3D9JA 3CVUA 2WQ6A 3AA1B 3WXXA 5AYWD 3EUHA 3SS1A 2AVPA 4ZHQE 2RG8A 4OYSA 3APCA 3AAEB 4DVDA 2WVIA 2E2EA 1MIYA 2Z6EA 5L2LA 1LRZA 2Q7FA 4BSXA 3CX6B 4IN3B 3FUMA 3ZMUB 3FDHA 5FXWA 5G05J 3UX4A 5DBKA 5LBMA 2GRLA 2XASB 5ANRA 5LP6E 3R84B 3KVBA 4UV8B 2LO6A 2HH7A 4GMJA 3SHFA 3ZHEB 3L13A 3G2TA 5FXVA 5FYMA 3GZ1A 4JL0A 2DIWA 1FIOA 2X66A 1G73A 4ABNA 3RYIE 4EECA 2C5IT 4JA9A 2XHEA 4DLOA 4H9SE 4CDNA 1IQUA 2LSKA 2XPIA 2NTXA 3UT7A 3CVPA 2NP9A 2LJLA 1WLXA 5HI7A 4X1KE 3NBXX 4IE7A 4N3CA 2ODVA 3C4WA 4HOTA 4YHJA 2BDEA 2YHCA 4FJZA 1DVPA 4NACA 3FTYA 5DJQC 3NZQA 4KUMB 5A6CA 2BUGA 2N2NA 1OWNA 3U3WA 5AJLA 4YLHA 2PJQA 3EIQC 3CX8B 2XAGB 5DIZA 4TV8E 3RJVA 2VKDA 3R9AB 4PJMA 2IOSA 1FVHA 3CHPA 4N5CA 5CMYA 4CT0A 2YEVC 2WXOA 2H7OA 5JHBA 4F1SA 3LVQE 3QKYA 4XIFA 2IU1A 4BA9A 3JC6C 2X6HA 3I4RB 2ZU6B 3F31A 2HYZA 4G25A 3B57A 2D5UA 4Q94A 3VLFA 5EKQD 1UG3A 3I4GA 4CXXA 2ILRA 4JLEA 2XHEB 5JDFA 4QFVA 4Q69A 2WMNA 4PK5A 4FJOA 1MIWA 1NP7A 2VGXB 3GYZA 5L3DB 2LSGA 1UX4A 4KVMA 4U0UA 2C0LA 3EVYA 4JC8A 1ZHCA 4FU3A 4CZZB 3FUDA 3MYVA 2WWUA 1VOMA 4UXNB 2V7LA 4UI9J 4ILUA 5HXHA 3UT8A 3RO3A 2ONDA 4JHKA 5LFAA 4CXYA 2QGSA 2JJ9A 2W61A 3PTRB 3ZMVB 4UVBB 4AKIA 3HVEA 5JJTA 4CCAA 3MKQA 4N78D 5FQ7A 1Y64B 2MBGA 3ZHEA 2I1KA 2LSIA 3CHOA 2YNQA 3IBEA 4LUNU 3CVLA 3D9NA 3TG5A 5FNVE 5KJMA 4JHJA 4KMOA 3A5XA 5L3FB 5F3JA 5L3BB 4C9BB 4QWNB 2CWOA 3ENEA 2WM9A 4ACLA 3F57A 4XX5A 3AS8A 3O1JA 3URZA 1UW4B 3RYCE 3C4ZA 4PH4B 4OVUA 1HTJF 2NXPA 3CVXA 2E9XB 4YJ2E 1OWMA 4NRHB 3IBPA 3PZDA 3IHVA 3UUNA 4MKTA 4X20E 2LM9A 3PNLB 1KT1A 2Q9QB 3FU5A 2ZLYA 3PE0A 1WR6A 5ADXL 4L0RA 3N5LA 5LHIB 3VHLA 2RD0A 1MQSA 3ANWB 2WXRA 3HDXA 3UPVA 2GW1A 5KJNA 2X6KA 4IGUA 3CKCA 2XQ0A 4FLHA 2BZBA 2M67A 2KC7A 2A2FX 4A55A 2KCLA 2VSOE 2E9XC 4AQGA 3QOUA 4EIWA 4GIWA 2DWKA 1TJFA 3LJ3A 3FEXA 5LHHB 4YJ3E 3NF1A 4GYYA 3QNKA 2NW8A 1H0AA 2ZM2A 4V3IA 4GK5E 3P7IA 3CHQA 3S7DA 3OXLA 1FEWA 3LY9A 3PDYA 4DJAA 3PUSA 4GZDA 5E0OA 5JDNA 3OXFA 2MOZA 5KX5E 4IDZA 2IFUA 2LOPA 3FUFA 3KV9A 4DBQA 2VSNA 3TJPA 2BVLA 3OYXA 1JPLA 3MZLB 2MYSA 3KBUA 4TZ4C 3T5XA 2IF4A 4FJYA 3H37A 1HG5A 4OVVA 4J2CA 2C5KT 4I4TE 4Z8XA 4AIFA 4BTAA 5FP3A 3RC8A 5D0OD 4IYPA 1YW0A 4J6IA 4A1GA 3OTNA 1EDUA 2HO1A 3K3QC 4UWKA 4EZKA 2XGMA 4DLQA 4OFZA 5CCMA 3ZEFA 3FWVA 3UULA 2KWIB 4DBRA 1D0XA 3FTVA 2WXHA 2X38A 3OAWA 1G8XA 4H9RC 3TL5A 3WI3A 2DLRA 1L5JA 2WXMA 3AB3B 4K03A 4WW0A 4BT9A 3D9MA 3D9OA 2CE7A 4I1OB 3KFWX 3JC6D 2LSYA 3ZYQA 2A5UA 5HXCA 2OV8A 4XKCA 2XGSA 4BT8A 4DI4A 4O4LE 4DMWA 1UN9A 2X67A 1UCUA 3UT5E 4PJJA 4CGWA 2PG8A 5ENNA 3S7BA 3ZPOA 4AQFC 4AV7A 4RG6A 3RX6A 1SZ9A 3CKDA 3BG1B 2XAHB 3WAJA 1X5BA 4HOQA 2PBIA 3V5UA 4EZ4A 1MHQA 1NA0A 3MKDA 4O6FA 5LCWC 4UVCB 2EHOA 3MV2B 1JWGA 3PU8A 2JPFA 4EZLA 1UJKA 3RO2A 2KWHA 3U3IA 3ZN3A 4L5GA 4PK4A 4X1IE 2L6JA 4O4JE 3FHNA 3OYZA 2HR2A 1FVFA 2WXNA 4XE0A 3S4UA 5FMNA 3C50A 1JUQA 4O4IE 4JEHA 2X6JA 3DPDA 3CK8A 3JQ0A 4DI3A 4I1MA 5BNWA 3G2UA 4HTEA 3L08A 3HIZA 1HX8A 3N9LA 3QWVA 3PURA 3B7SA 2Y3AA 4J8DA 1QNFA 3IHRA 2KT9A 2CG2A 3I9YA 3MX3A 1HXIA 3PEVB 4EYYR 3I0OA 2VKHA 1Y8MA 1ZBPA 3R7QA 3ZEFB 3NRXA 2DI4A 3MKRA 4ZI7E 2L0IA 4G24A 4Q96A 4BY6A 5T3RA 3P8CD 2XQYA 4FA6A 4I6GA 2OVBA 1MNEA 4WWOA 1T98A 1E96B 3PUQA 3IEGA 5FQ6A 3QUJA 2EHOC 3T8OA 4N3BA 3FUNA 2H7VC 1ELWA 1SA0E 3B7UX 4HN9A 2HPLA 2Y48B 4IRUA 2IC9A 3O1IA 4XZ4A 3MKQB 5BV0A 2R5SA 2KZ7B 3ZPJA 5JJ6A 3CVRA 2VQ2A 4AQFA 3ZVVA 5LHGB 4CRWA 4PS3A 2LT3A 2X3MA 4EQFA 4H7YA 4AXHA 4N3AA 3CK7A 4FP7A 4CGVA 4BWRA 4FLBA 3CQXC 4URKA 2A4ZA 4MALA 5JR9C 4YVQC 3PNTB 1KK7A 4AP2A 4E7SA 4GCOA 5HQ8A 2I9CA 2VWAA 2XUEA 4ZI2C 3ZCIA 3CQGB 4KYOB 3Q9DA 2E0IA 4ERRA 2I1JA 5FJYA 5FXXA 1EYHA 2J4BA 4B94A 2VL8A 4WNKA 4UEMA 3UMVA 5LA6E 4I9CA 4I50E 3Q2MA 5DQVA 4TV3A 4KXKB 1LVFA 3QARA 3DBSA 4ME2A 3U4TA 4ISTA 3PE3A 2MTQA 3QJZA 2UY1B 2AXVA 2GGFA 2YU2A 3MA9A 3KDSE 5FQ8A 3CGHA 2ZM0A 5LJMA 4WAFA 3L3PA 4EZHA 1D0YA 5C1DA 5FZSA 2CA5A 3SF4A 1B7TA 4GAAA 4GCNA 2WXIA 3FH8A 4HKAA 4I9EA 3G2SA 1H7CA 5JDHA 3FBLA 2XTLA 3KV5A 3Q15A 2YHEA 2VSXE 3GWHA 4H63H 4DK5A 3PH0C 1E8WA 4BJNA 3L6AA 1XNFA 3CR3A 1YD8G 3TKLB 3BQLA 4JEHB 3GZSA 4AOFA 3RIBA 1QUUA 3IF8B 2WXLA 2L8KA 4HXIA 3KVAA 1P5QA 5AJDA 3HHMA 2JRKA 2XAFB 5LYJE 5JR9A 5BMVE 4OHFA 3EDVA 3QC1A 4ZS2A 4GA0A 4GZCA 2JQQA 3KAEA 3HR0A 2CXFA 3PRZA 5JH7E 2J1DG 3ZC0A 3CIAA 4UQZA 3SFZA 4WNFA 5JDQA 5J1GA 4P0AA 3FH5A 3QDNA 4MRUA 1HFAA 1US7B 3N2OA 4UF0A 3GMIA 4TX5A 4N2QA 3J7Yq 4IE5A 4JPSA 4GK0E 1QZ2A 2DWGA 3MJXA 5FZRA 4U07A 3TGOA 4XAXB 4KBQA 1MNDA 3FXDB 3ZC1A 2VKJA 3ZN1B 2HM8A 3HVEB 3ULQA 3N2KE 3PE4A 1VRBA 5JDLA 3QC9A 4A3VA 3NZPA 5EDSA 3ONLA 3ASDA 2K5BB 4L2YA 3OJAA 2XGOA 4ILGA 4IE6A 4UELA 1Z6TA 4TV9E 3MA5A 4G11A 3ZMTB 5LX8A 1INZA 3L54A 4L1BA 3SZ7A 1D1BA 4XZCA 5JQGE 2LNIA 2CWYA 3ESLA 3KD7A 4L7TA 1U4QA 3O4XE 1WRDA 2NW9A 5ANLA 2J09A 2VGXA 4L9IA 2QY7A 1VDYA 5JR9B 3LJCA 4R7LA 5ARGA 3T8MA 5CCLA 1X79A 3UTKA 4W9RA 3AVSA 4HFVA 4GYOA 3RKVA 5KCMA 2N9DA 3S7JA 3O4ZA 2MHKA 3AA6B 4WBNE 2W63A 4UV9B 4I17A 3DTOA 3O1HA 1WY6A 2Y4TA 5LBQB 3MGBA 2PZIA 3Q47B 2MRIA 4XI0A 3U66A 4H9PC 2I59A 4H7XA 1WAO1 1ZKEA 3ANWA 5FWQA 5IYZE 4CT4A 4NURA 1W3BA 2LSVA 1KLXA 5LXTE 4J8FA 4XKBA 3VLDA 1ELRA 3CVNA 3CHSA 2LE8A 4C0EA 4ILIA 5FQ4A 2IQCA 4JXTA 4GMLA 1H6KA 3HKDE 4JHRA 3CQCB 3ESKA 2E9XA 2LAIA 2FO7A 3ASHA 2Y4UA 3CSTA 5DABA 4H63V 2QFCA 2WXJA 3KEZA 4O8SA 3R7RA 4HORA 5L3EB 5JDMA 3RKOA 2NC9A 1IHGA 3PDNA 3FUHA 2X68A 3FEYA 4A3TA 4CDMA 3HA4A 3E4BA 3CVQA 1H19A 3CVYA 3AS4A 5C8YE 3NZSA 4KP3C 4GYSA 1QSDA 4IHJE 4ZI2D 5HXEA 4MS6A 3E08A 4B8AA 1E1HB 2WPVA 4ZOLE 3SNXA 4L2LA 2PM7A 1Z3YA 3FTUA 4C90A 2NTYA 5E76A 3CVVA 2LEHA 3D9LA 1SZAA 4PW8A 3Q4AB 1XGWA 4P09A 2CHZA 1H2UA 4NQ0A 5BPPA 5G04C 1TJCA 3CSFA 2W62A 4RVBA 4OYKA 3FUJA 5A1LA 1E8ZA 4BFRA 1IQRA 1E8XA 3M65A 4LERA 5L3GB 4DPRA 2KMFA 5E75A 4HOSA 2VKOA 4WUYA 2FI7A 4APOA 2L0TB 4EXTA 3CHRA 4FC8A 3D9PA 4GB9A 3LDZA 3TG4A 1HG2A 3D9IA 2OA5A 4AKRB 3D9KA 1IZNB 4IIJE 2XRYA 2V8SE 3PUGA 3P2BA 2CFZA 4GA2A 2NOXA 5ETWA 2ZMAA 1D1CA 1NA3A 3NRYA 5L3CB 4I2ZA 4UF0B 3U78A 4J0UA 4U72A 2V7IA 1D1AA 2Q9QA 3RPUA 4F3VA 2CHWA 3LXUX 3C64A 5T8IA 1LKXA 2IW5B 2JMKA 2X0LB 2VK9A 3APDA 2EHOB 4F7AA 3PUAA 3AA7B 2V0PA 3T5VA 4MFRA 2VTBB 2EHOD 3RRNB 4U04A 2WXFA 4HOUA 4OYJA 4AKLA 2X51A 3SWHA 3KV4A 3MZKB 5EK4A 4QXBB 3EIJA 3K3OA 5HXRA 3ZFWA 3Q5XA 2JMHA 2YQ8A 1D0ZA 4FHJA 4CXWA 4I2WA 2CM0A 2KXPB 2YK0A 5AIJA 3LS8A 3G2WA 4A56A 4RSYA 4HEAA 3LK42 3ZJ2A 4QX7B 1IJ5A 3B13A 4QHOA 3FUEA 2KCKA 3LY8A 4FHKA 2WXGA 3MJWA 5FT9A 1IYGA 3BQIA 2YINA 2JEKA 3QK0A 1MMDA 5IHYA 3RYHE 2XCBA 2D2SA 5CB4E 2L9BA 3ZCJA 4CDRA 4DO0A 5FZQA 1E7UA 4O2AE 4IE0A 4X1YE 4APFA 2FF4A 3LK2B 3FXEB 2L9QA 4PK6A 3KBTA 3FTWA 2CG3A 2KZTB 1HS6A 4V1Av 5J2UE 4KZ0A 4EB6E 1OWOA 4HGAA 2DCPA 2J07A 3EJNA 2DHRA 3UFEA 4OK0A 2CCQA 4EOZB 2CHXA 2PL2A 3VKHA 4UWLA 3DJBA 3P1UA 2FEZA 2WB2A 3ASGA 4AY5A 3CVWA 3I5PA 1MMNA 5EX3A 5EZYE 2ZM8A 2V1DB 5G55A 2SPCA 2DCFA 1O3XA 5G04J 5J90A 4QKNA 4QXHB 1WYBA 4GA1A 2CLYB 1EPUA 3K3NA 4GZ3A 1UX5A 5AFUL 2LSUA 5A23A 3C98B 3ML8A 5CA0E 3LYAA 4ZS3A 3FH7A 3J9X1 5LCWJ 2K9AA 5FY1A 4YFSA 1UN8A 4A1SA 3AU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYH A;  1JWF A;  3D9K A;  3G2S A;  1HF8 A;  2V8S E;  3D9N A;  3ONK A;  1JWG A;  5J08 A;  3G2U A;  4FLB A;  3ZYK A;  2BF0 X;  1UJJ A;  2MOW A;  1HX8 A;  3ZYM A;  1UJK A;  2L0I A;  3G2W A;  4Q96 A;  5LOZ A;  5CMW A;  5LP0 A;  3G2V A;  2QY7 A;  1VDY A;  1JPL A;  3D9L A;  1SZ9 A;  1H0A A;  1SZA A;  1EDU A;  2L0T B;  3D9J A;  1DVP A;  1XGW A;  4FU3 A;  4NAC A;  4AVX A;  3D9M A;  3CLJ A;  1X5B A;  2LO6 A;  3D9O A;  1INZ A;  3D9P A;  1HG5 A;  1HFA A;  2KM4 A;  1PY1 A;  5CMY A;  1ELK A;  3LDZ A;  3G2T A;  4Q94 A;  3ZYL A;  1JUQ A;  4GZD A;  1HG2 A;  1MHQ A;  4GZC A;  1LF8 A;  2DIW A;  3D9I A;  4HFG A;  3RRU A;  3ZYQ A;  4JXT A;  2DCP A;  3ONL A; 
#chains in the Genus database with same CATH topology
 4AXP A;  5EIB E;  2B1E A;  3KV6 A;  3VTY A;  3PS6 A;  2LHN A;  3QWP A;  3N9Q A;  5M4Y A;  4M1P A;  2KCV A;  3K1S A;  4ANJ A;  4E85 A;  4CI3 B;  1KF6 A;  5EK2 A;  4WNG A;  3HKE E;  4B8C B;  3MXZ A;  2K48 A;  2P9B A;  2VSY A;  5AEN A;  5LGU B;  3FUL A;  5B1A E;  3VRB A;  2GK9 A;  2CEA A;  1U3D A;  3KIN B;  1SHZ C;  1QLB A;  2FJA A;  5LCY A;  4U7E B;  1HCI A;  2J49 A;  1YQ3 A;  2LRL A;  3BQK A;  4G26 A;  3VU7 H;  3Q9U C;  4UI9 K;  1J5E T;  4UUC A;  3UUX A;  3E30 A;  2OCC E;  3AVR A;  2XRZ A;  4TXR A;  4HB5 A;  1E90 A;  5AN8 A;  3QWW A;  3M3Z B;  4I43 A;  5D66 A;  1PAQ A;  3UT4 A;  3HKB E;  4GPK A;  5AQF B;  4U3C A;  2RA1 A;  1ZV4 X;  3N9M A;  3LG7 A;  5BT1 A;  5HEG A;  3AEF A;  2QYW A;  2CLY C;  3EDU A;  4MHC A;  2UXX B;  3ETU A;  2QVA A;  4K0U A;  2LHR A;  4LF6 T;  3ZGQ A;  4ZI3 C;  3E0Z A;  4HE8 A;  2IOL A;  3K8P C;  3IV0 A;  4TN7 B;  3APF A;  2V7M A;  1TEZ A;  2JIW A;  2KZT A;  4Y6W A;  2I6H A;  2QA7 A;  4BX8 A;  3HKC E;  1S70 B;  5FTP A;  3I3N A;  3NBN B;  1UUS A;  4MLP A;  3GN5 B;  1HO8 A;  3RRU A;  3N9P A;  2R59 A;  3L17 A;  3WAK A;  4EZJ A;  3UM1 A;  2PM6 A;  1FCH A;  2EIK E;  4UQY A;  2KIN B;  3SGH A;  4JUY A;  1E8Y A;  2P9P G;  1BR2 A;  3PUW F;  4JYA T;  2UUA T;  2XCC A;  2B6C A;  3LVR E;  3U9W A;  3MK7 C;  1HU3 A;  1MIV A;  2C2L A;  3IHY A;  5JDG A;  3NZU A;  4LCT A;  2MYO A;  2FO1 E;  4DR4 T;  2JLB A;  2BTD A;  3SD5 A;  4U8V D;  5HAX A;  4ZEY A;  5HYA A;  4IL4 A;  4A98 A;  3PU3 A;  5HXS A;  1JWF A;  3PUJ A;  1ZOY A;  5KWD A;  4BTB A;  1L0V A;  2M63 A;  3FTS A;  3T8K A;  3PV0 F;  2HPJ A;  4PDX A;  3E37 A;  3AE5 A;  5DQW A;  3D9H A;  3SO8 A;  3U64 A;  3SBS A;  1FMW A;  2WBL A;  2V6X A;  1IBL T;  3SI5 A;  2P9S G;  3LFM A;  2V7K A;  4ATG A;  4N2S A;  4TNV A;  4JZY A;  5AAR A;  2IAK A;  1NEN A;  3E34 A;  3RF1 A;  4F53 A;  4UWH A;  3C98 A;  3LDQ B;  4D10 C;  3Q49 B;  5FY0 A;  3AAI A;  3AG4 E;  4M3O A;  4KBM B;  5C2Y A;  1NZN A;  3BEE A;  4QH1 A;  4YVO A;  1RZ4 A;  5F8P A;  1E2A A;  3EAM A;  5JRE A;  2IY0 C;  5G2N A;  4GYR A;  3C51 A;  2J9Q A;  4KT6 B;  1HNZ T;  1H2T C;  5EX0 A;  3TXN A;  2LRK A;  3JXJ A;  2XAJ B;  2UUC T;  1OWP A;  3CK9 A;  3UQ3 A;  3I1A A;  4NUU A;  3RRM B;  1UK5 A;  4C0M A;  3J5Q B;  4PS8 A;  2NW7 A;  3HXF A;  2WAU A;  4J8Y A;  5C2T A;  2P2C P;  2V4L A;  1DU2 A;  5BW8 C;  4LF4 T;  4DND A;  2XPZ A;  2CMR A;  3ASO E;  3BG0 B;  4J8S A;  5LP0 A;  2R03 A;  3SBT B;  4WNE A;  2X9X A;  2V7J A;  3RAU A;  5CFB A;  1U3C A;  3FHE A;  3LKU A;  4U8Y D;  4WWP A;  3ZN0 B;  4I6J A;  2J4D A;  5LGN B;  4AI6 A;  5CA1 E;  4HI8 A;  1YKH B;  5IUX A;  4TUY E;  3GW4 A;  3RYF E;  3HL6 A;  3EDT B;  4QX8 B;  1NAF A;  2Y6X A;  2XAQ B;  2X6I A;  3SQV A;  3AAA B;  3FTZ A;  4U33 A;  5LOZ A;  1S94 A;  2W00 A;  3RRC A;  3P4P A;  3UI2 A;  5KDM C;  3NQP A;  4UVA B;  3TWQ A;  3CEQ A;  2VGY A;  3TWU A;  2F8Y A;  1S35 A;  2E8I A;  5GON E;  3EHR A;  4PS7 A;  3X2Q E;  4CI1 B;  3Q5W A;  2UXN B;  3E22 E;  5AQM B;  4PJL A;  2C0S A;  5AQB A;  3VTX A;  2FUL A;  2ION A;  1O1S A;  5H6Q B;  5AQA A;  2WXP A;  4AIS A;  5LGT B;  5FY7 A;  4AIU A;  1QQE A;  2WU5 A;  2BKK B;  3AEE A;  3K9I A;  4IUL A;  4ACK A;  1KNP A;  4EPZ A;  5CGM A;  2ACX A;  2XQ9 A;  1CUN A;  2X9W A;  3RIA A;  5HEO A;  4JI6 T;  2VJ8 A;  1IKN D;  2IO3 C;  5T4Y A;  2AXU A;  3VLE A;  4B0Z A;  3RC3 A;  2CFU A;  2WSS V;  4G2A A;  1SVX A;  3ASF A;  2BBH A;  4Y6C A;  2E5V A;  3ZMZ B;  5CRU A;  4YSZ A;  1N95 A;  2X6F A;  3JAD A;  4IT4 A;  2V26 A;  3ZT5 A;  4G63 A;  2WZI A;  5KMG P;  2LSJ A;  5LOV E;  5KJL A;  4JA7 A;  3RU0 A;  4PFP A;  1BR1 A;  2J08 A;  3GZ2 A;  3BK9 A;  1HX1 B;  4B3M T;  3UTM A;  3EI0 A;  2XEE A;  3Q73 A;  1Z0P A;  3N71 A;  1MMG A;  4TUU A;  1JCR A;  3BQO A;  3TXM A;  2OOE A;  2YN6 A;  1PY1 A;  3LY7 A;  4P29 A;  3PZ1 A;  1YKE B;  3V79 K;  5JRC A;  3LCA A;  2WQY A;  5D0Q D;  4I6E A;  3L16 A;  5ARF A;  3O48 A;  3I9W A;  5LNK A;  4H9N C;  4ANV A;  2CXL A;  1U5P A;  3FUI A;  3UM0 A;  1IJ6 A;  3RHW A;  1S0P A;  4BAY B;  3KSL A;  3ZLI A;  2A5E A;  2GRR B;  2KAT A;  3Q5M A;  1FMV A;  3CLJ A;  2KLQ A;  3CK6 A;  3W15 B;  4AQY T;  3QB2 A;  4HI9 A;  2KM4 A;  3ZXS A;  4DID B;  5EK3 A;  5HRY A;  2RFA A;  3DSU A;  5G05 C;  1GW6 A;  4DV5 T;  2VGE A;  3N9N A;  4HFG A;  1O5M A;  2H3R A;  4HBD A;  5ABH A;  3TLW A;  3I0Q A;  1LD7 A;  3PRE A;  4ILH B;  2Q9Q C;  3P4R A;  4FAD A;  2BKP A;  3DXM G;  4KZC A;  3LK3 B;  4YSY A;  1DNP A;  1V54 E;  3AG3 E;  5FIN A;  4LNG A;  2Q9Q D;  3ML9 A;  3JQ1 A;  4B6X A;  1UOH A;  4TUM A;  4AEZ C;  3JAE A;  2GRO B;  3LBX A;  2H6F A;  3GA8 A;  3MAC A;  3TAX A;  4QXC B;  3T1H T;  2XQ5 A;  5ITZ F;  4O4H E;  3FBZ A;  2P9N G;  2V8S V;  3QAQ A;  4AJW A;  4ASK A;  2XS8 A;  4XI9 A;  5HWX A;  4U63 A;  3AEC A;  4GOU A;  4PFO A;  2EIN E;  1T7S A;  2KBX A;  2D0T A;  4ADZ A;  2E9X D;  4F1P A;  3QK6 A;  3VKG A;  3IKO B;  4PUC A;  4YND A;  3ZYL A;  3L09 A;  3FY4 A;  3UUX B;  2XY8 B;  3AE6 A;  5LJN A;  4ISS A;  4U0Z A;  2VTB A;  1A17 A;  2BS2 A;  4YTP A;  4M7C A;  1N54 A;  1BR0 A;  2CXD A;  4J8E A;  1AJ3 A;  3B7R L;  4KMC A;  3D0T A;  3FFL A;  2DZN A;  3G2V A;  4DV6 T;  4I1A A;  5KNH D;  1KNZ A;  5KJK A;  2N1G A;  4MBQ A;  5FVK A;  4BER A;  4UWG A;  4NUV A;  2MPK A;  1T8B A;  2BG9 E;  4G2V A;  4UQX A;  3G06 A;  3MCX A;  4L23 A;  3SOL A;  5CER B;  4AKH A;  5HEJ A;  3FTX A;  3EHQ A;  3JYS A;  2PFV A;  2WXQ A;  3CPZ A;  4I43 B;  2WXK A;  4JEU A;  1N4P A;  3TLU A;  5M72 A;  2K24 A;  2NSZ A;  5ENQ D;  2VVS A;  4HVB A;  2YU1 A;  1LVK A;  4YTM A;  2C0M A;  4H9O C;  4ATZ D;  4B89 A;  1IAP A;  2H6H A;  4UIG A;  1HR0 T;  3OBV E;  4WWN A;  3CWZ B;  4WND A;  4N39 A;  5LMU T;  3B7T A;  3OXG A;  4GYW A;  2IC6 A;  3ZUV B;  4FUL A;  4U0S A;  4G1T A;  3S7F A;  4E6H A;  5CBN A;  4C91 A;  1ELK A;  3KS2 A;  5EIL A;  3L9T A;  2YDR A;  3CML A;  4PJN A;  3ETV A;  2D0U A;  4P0B A;  5HWY A;  3PUK A;  5J2T E;  1ZP0 A;  3SFY A;  4U7Y A;  5AQG B;  4F6R C;  3ZYM A;  4ANW A;  2NWB A;  5CMW A;  4DR5 T;  4ANX A;  5HKP A;  2ODU A;  1B89 A;  5JJ7 A;  4KVO A;  3DSS A;  3TWW A;  5FIO A;  4EAH A;  1MJ0 A;  2X9Y A;  3N2G E;  2GRN B;  2BVM A;  2X0H A;  4DV7 T;  5H6R B;  5LMN T;  3FU0 A;  1N0R A;  4U8H A;  2DYS E;  3CV0 A;  1OXZ A;  3LBX B;  5JMN D;  3AE1 A;  2W4X A;  1E7V A;  2VB6 A;  2VL0 A;  2XSB A;  3CX7 B;  3ONK A;  2EQX A;  4CEM A;  3NOC D;  5JVD E;  2DVW A;  2BF0 X;  1UJJ A;  5AQR B;  2VQE T;  3UM2 A;  4GTQ A;  2W0G A;  1XDP A;  2X9H A;  1HH8 A;  4HFI A;  2R2L A;  2FBN A;  3D3M A;  3ABV A;  3AAA C;  3JUI A;  1ZEE A;  5BV1 A;  4UI9 C;  4GKK T;  4I55 E;  4BX9 A;  1FPP A;  1MYO A;  3DP7 A;  3ZJ1 A;  4WBO A;  3O9X A;  1LF8 A;  4G23 A;  3GN5 A;  2RFM A;  3B7B A;  3MEK A;  2XQA A;  2UY1 A;  4XBF B;  1Q2Z A;  3ONX A;  5KXJ A;  3CHM A;  1UUR A;  5ABG A;  2C5J A;  1OUV A;  2I2O A;  4HFB A;  3V5S A;  5F5W A;  3L22 A;  4ANU A;  1D9S A;  3EU9 A;  1BU9 A;  3UQ7 A;  3UUB A;  3FP3 A;  1MMA A;  3FB2 A;  4KI0 F;  2H89 A;  1V9D A;  3AU4 A;  1N32 T;  4IE4 A;  3F2E A;  2VYI A;  1EZ3 A;  3SY2 A;  3HI2 A;  1YA0 A;  3ASN E;  3SFX A;  4MLK A;  3FU3 A;  2R17 C;  3CKB A;  5ENT D;  3PVL A;  1TNU A;  2HE0 A;  2UXC T;  4JW1 A;  2L6B A;  3ZIM A;  3MV3 B;  2BBJ A;  3P50 A;  3RK6 A;  2ZIS A;  3AG1 E;  4GU5 A;  5FXZ A;  1BR4 A;  3P4W A;  5AQL B;  1BPO A;  2F37 A;  5TAO A;  4AVX A;  1HS7 A;  1J1J A;  2RP4 A;  3H3A A;  5CHE E;  2OVF A;  3T9K A;  4AM9 A;  2IUB A;  4EBA A;  1NWM X;  3OVU A;  1KEY A;  4DMV A;  3RH3 A;  4GZ6 A;  1HE8 A;  2G0U A;  3FZL B;  2AXZ A;  2RKK A;  1OWL A;  3RRW A;  1N36 T;  1Z3X A;  1WYC A;  2WY2 A;  4DX5 D;  3C3O A;  4CI2 B;  2GRM A;  3R6N A;  3PEU B;  4GTO A;  5JHA A;  5ENR D;  3C5R A;  1JCQ A;  1NEK A;  2AWI A;  4GZ5 A;  1SW6 A;  2V5F A;  5BUZ A;  4BJM A;  3RIF A;  4CQI A;  2UWJ G;  5BXO A;  3JCK C;  4PAG A;  4A63 B;  3N9O A;  2UXB T;  2AW6 A;  1Y6I A;  3AS5 A;  5JRC B;  4JEU B;  3S2A A;  3AE9 A;  2UUB T;  2DZO A;  1HF8 A;  1HZ4 A;  4TWF A;  3EHN A;  3SRZ A;  3LPZ A;  4LEU A;  4MBG A;  2L3L A;  2MOW A;  4ZI3 D;  3ZW3 A;  4DUY T;  4EBA G;  2WQ7 A;  2VAS A;  4Q25 A;  1OCC E;  2YKS A;  4JB8 P;  2P58 C;  2KND A;  3L39 A;  1ZU2 A;  3OKQ A;  4DUZ T;  1YXR A;  1N33 T;  1N11 A;  2DNX A;  2DBA A;  2WMO A;  1N9A A;  1H2V C;  1PC2 A;  1KT0 A;  1DCQ A;  2PQN A;  3ZKJ A;  4LRZ A;  4O2B E;  1KNR A;  3VRA A;  3ZYK A;  3ZMS B;  2PQR A;  2PNN A;  4K0R A;  5LG4 A;  3UU3 A;  5A7D B;  2LAH A;  2ES0 A;  3UQ4 A;  4UWF A;  2A72 A;  4EYU A;  4H9Q C;  3FU6 A;  3HYM B;  3LEW A;  1TYQ G;  1SUM B;  2F4V T;  4HLE A;  2A3D A;  3IA3 A;  2VQF T;  3DSX A;  1N52 A;  3AA0 B;  2IJG X;  3C4X A;  3FUK A;  4TRQ A;  4PNI A;  4RG9 A;  2Y8D A;  2XEV A;  4JVS A;  2WQH A;  3EHM A;  3IEE A;  5L4E A;  3UUM A;  4FI5 A;  4UR9 A;  4E7Z A;  5J08 A;  1OWA A;  1WM5 A;  3EAB A;  2BS4 A;  2K3W A;  4U74 A;  1EF1 C;  1AP7 A;  4AKG A;  2XPY A;  4AY6 A;  5LG3 A;  2LOS A;  3ZRH A;  1SQM A;  3RIU A;  2XQ6 A;  4HS2 A;  3D9J A;  3CVU A;  2WQ6 A;  3AA1 B;  3WXX A;  4EED A;  2BED A;  5AYW D;  3EUH A;  3SS1 A;  2AVP A;  2J47 A;  4ZHQ E;  3AEB A;  2RG8 A;  1IBM T;  2AE9 A;  4OYS A;  3AED A;  3APC A;  3AAE B;  4CN4 A;  4DVD A;  2WVI A;  3PJA J;  2E2E A;  2FJD A;  3DEO A;  1MIY A;  2Z6E A;  3L82 A;  5H7P A;  4Z91 A;  5L2L A;  1LRZ A;  2Q7F A;  4BSX A;  4NPP A;  3CIR A;  3CX6 B;  3Q5E A;  3HG0 D;  4IN3 B;  3FUM A;  1WR0 A;  4Z90 A;  3ZMU B;  3A7M A;  3FDH A;  1X9B A;  5FXW A;  5G05 J;  2R6G F;  3UX4 A;  5DBK A;  3UXG A;  5LBM A;  2GRL A;  2XAS B;  5ANR A;  5LP6 E;  2LXM A;  3R84 B;  3KVB A;  2I0M A;  4UV8 B;  1K8K G;  2LO6 A;  2HH7 A;  4GMJ A;  3SHF A;  4GKJ T;  2KXP C;  3ZHE B;  3L13 A;  3G2T A;  5FXV A;  5FYM A;  3GZ1 A;  4JL0 A;  2DIW A;  4LFC T;  1FIO A;  2X66 A;  1TNO A;  1G73 A;  4ABN A;  3RYI E;  4EEC A;  2C5I T;  5FVL A;  4JA9 A;  1YMP A;  2XM1 A;  2XHE A;  4DLO A;  4H9S E;  4CDN A;  5HCM A;  4TWH A;  1IQU A;  1TN7 A;  2LSK A;  2XPI A;  3EUV A;  5HS0 A;  2NTX A;  3UT7 A;  3ZXP A;  3CVP A;  2NP9 A;  1ZB1 A;  4RLY A;  4LNB A;  2LJL A;  4RQI A;  1WLX A;  3RLF F;  5HI7 A;  1AWC B;  2ETA A;  4XEI G;  4X1K E;  4LMJ A;  4HWF A;  5C3J A;  3NBX X;  4IE7 A;  3QNU A;  4N3C A;  2ODV A;  3C4W A;  4HOT A;  2M6I A;  2E2A A;  4YHJ A;  2BDE A;  2YHC A;  4Z68 A;  4FJZ A;  1DVP A;  4K5C A;  4BSZ B;  4NAC A;  3FTY A;  1IBK T;  2HN2 A;  4HWH A;  2J4G A;  3DSV A;  3ZU7 B;  5DJQ C;  3RSE G;  3AXJ B;  3NZQ A;  4KUM B;  5A6C A;  2ACZ A;  2BUG A;  4JI7 T;  1FT1 A;  3AEG A;  4YY3 T;  4CN1 A;  5ABF B;  2N2N A;  1OWN A;  3U3W A;  5AJL A;  4YLH A;  2P9U G;  2PJQ A;  3EIQ C;  1N0Q A;  3CX8 B;  2XAG B;  5DIZ A;  3JUE A;  3W9F A;  4TV8 E;  3RJV A;  2VKD A;  4YDO A;  2ZIR A;  4PJM A;  2IOS A;  3R9A B;  3LSV A;  3ISM C;  1FVH A;  3CHP A;  4N5C A;  5CMY A;  4CT0 A;  3AE4 A;  2YEV C;  2WXO A;  2H7O A;  5JHB A;  4F1S A;  3LVQ E;  5AQT B;  3QKY A;  4XIF A;  2HN1 A;  2IU1 A;  4BA9 A;  2H6G A;  3JC6 C;  4HFE A;  2NYJ A;  2X6H A;  3I4R B;  5AQJ B;  2ZU6 B;  2XQ8 A;  2ZGD A;  3F31 A;  2HYZ A;  4G25 A;  4HWC A;  3B57 A;  1E7P A;  2YDS A;  4IRE A;  1N4R A;  2D5U A;  4Q94 A;  3VLF A;  1HNX T;  5EKQ D;  1UG3 A;  3I4G A;  4CXX A;  2ILR A;  4JLE A;  2XHE B;  5JDF A;  4QFV A;  4Q69 A;  2WMN A;  4PK5 A;  4FJO A;  2M6B A;  1MIW A;  1NP7 A;  3AG2 E;  2VGX B;  3GYZ A;  5L3D B;  2LSG A;  1UX4 A;  4KVM A;  3FZH B;  4U0U A;  1N94 A;  2C0L A;  3EVY A;  4JC8 A;  1ZHC A;  4K0K T;  4FU3 A;  4CZZ B;  3SFE A;  3FUD A;  2IEJ A;  2CPT A;  3MYV A;  2WWU A;  1I94 T;  1VOM A;  4UXN B;  5L4H A;  2V7L A;  4GTM A;  4UI9 J;  4A5X A;  4U96 D;  4ILU A;  5HXH A;  3UT8 A;  3C3R A;  3RO3 A;  2OND A;  4JHK A;  5LFA A;  4CXY A;  3TWX A;  2QGS A;  2JJ9 A;  2W61 A;  3PTR B;  3ZMV B;  4UVB B;  4AKI A;  3RQW A;  3HVE A;  5JA4 D;  4CCA A;  5JJT A;  3MKQ A;  4N78 D;  1WFD A;  1BI8 B;  5FQ7 A;  3H3M A;  4EV6 A;  2GRQ B;  3C72 A;  1Y64 B;  2MBG A;  3ZHE A;  2I1K A;  4HNA D;  2LSI A;  2Y0B G;  5FL1 A;  1W0B A;  3CHO A;  3UKU G;  2YNQ A;  3IBE A;  4LUN U;  2B76 A;  3CVL A;  3D9N A;  1BI7 B;  3TG5 A;  1JCS A;  5FNV E;  3TWT A;  4HWD A;  5KJM A;  4HRL A;  1MZC A;  3JCF A;  2QYU A;  4JHJ A;  3A5X A;  5L3F B;  5F3J A;  5L3B B;  4KMO A;  4QWN B;  4C9B B;  2CWO A;  2LKG A;  3ENE A;  2WM9 A;  3ZT6 A;  4ACL A;  3F57 A;  4XX5 A;  3AS8 A;  3O1J A;  3URZ A;  1UW4 B;  3RYC E;  2BKN A;  3C4Z A;  3L8R A;  4PH4 B;  4OVU A;  1HTJ F;  2NXP A;  3CVX A;  2E9X B;  4YJ2 E;  4GPM A;  1OWM A;  4NRH B;  3IBP A;  3PZD A;  3IHV A;  3HXC A;  3UIO C;  5J0Z A;  3UUN A;  1TNB A;  4NXM T;  1XDO A;  4GMR A;  4MKT A;  4X20 E;  1QBQ A;  4O1O A;  4B93 B;  3KEA A;  5HEH A;  4OAU C;  2LM9 A;  1O1T A;  1OY3 D;  3PNL B;  1KT1 A;  2Q9Q B;  2V6Y A;  3FU5 A;  2ZLY A;  3PE0 A;  1WR6 A;  4X5T A;  5ADX L;  4L0R A;  3N5L A;  5LHI B;  3VHL A;  2RD0 A;  4JD2 G;  5AQH B;  4ZHB A;  1MQS A;  3ANW B;  2WXR A;  3HDX A;  5CRV A;  3UPV A;  2GW1 A;  5KJN A;  2X6K A;  2A9U A;  4IGU A;  5BXU A;  3CKC A;  2XQ0 A;  3Q7F A;  4FLH A;  2BZB A;  2M67 A;  2KC7 A;  2A2F X;  4A55 A;  2KCL A;  2VSO E;  2E9X C;  4AQG A;  2Y69 E;  4EIW A;  4GIW A;  2DWK A;  3QOU A;  1TJF A;  3LJ3 A;  3PZ2 A;  3UU5 A;  2H88 A;  2XZD G;  3DEP A;  3FEX A;  5LHH B;  4YJ3 E;  3NF1 A;  3Q7A A;  4GYY A;  4OX9 T;  4F6R D;  1H0A A;  2NW8 A;  3QNK A;  1TR4 A;  2ZM2 A;  4V3I A;  4O1P A;  4TXQ A;  1U2V G;  4GK5 E;  2WCA A;  3P7I A;  4NXN T;  3CHQ A;  3S7D A;  3OXL A;  1FEW A;  3LY9 A;  3PDY A;  4DJA A;  3PUS A;  4GZD A;  5E0O A;  1IXV A;  5JDN A;  3OXF A;  2MOZ A;  1S63 A;  5KX5 E;  3RIU C;  4IDZ A;  2IFU A;  2LOP A;  3FUF A;  1OCZ E;  3BUA A;  3KV9 A;  4DBQ A;  2VSN A;  4LFB T;  3TJP A;  2BVL A;  3OYX A;  1JPL A;  1MX6 A;  4GTT A;  5B1B E;  3MZL B;  2MYS A;  3KBU A;  4TZ4 C;  4JI3 T;  3T5X A;  2IF4 A;  5B3S E;  4FJY A;  3H37 A;  1HG5 A;  4U2Z A;  4OVV A;  4J2C A;  2C5K T;  4I4T E;  3Q5D A;  4Z8X A;  4GTP A;  4HWI B;  3PUX F;  4AIF A;  4BTA A;  5FP3 A;  3RC8 A;  5D0O D;  4IYP A;  5AQU B;  4QH4 A;  1YW0 A;  4X64 T;  4J6I A;  4A1G A;  3OTN A;  4IDO A;  2P9L G;  2D9D A;  1EDU A;  2P9K G;  2HO1 A;  2WZH A;  3K3Q C;  4UWK A;  4DX1 A;  4EZK A;  2XGM A;  4DLQ A;  4OFZ A;  3UIP C;  5CCM A;  3ZEF A;  2AXD S;  3FWV A;  4LNU D;  3UUL A;  2KWI B;  3ZKR A;  1D0X A;  4DBR A;  2WXH A;  3FTV A;  2X38 A;  3OAW A;  1JNR A;  4BEP A;  1G8X A;  4H9R C;  3TL5 A;  3WI3 A;  2DLR A;  2FUP A;  1L5J A;  2WXM A;  5ENP D;  3V2X A;  3AB3 B;  4YXD A;  3DWL G;  4K03 A;  2WB5 A;  4CYM D;  4WW0 A;  4BT9 A;  3D9M A;  4WYV A;  3D9O A;  2CE7 A;  3VR9 A;  4G8L A;  4I1O B;  3KFW X;  3JC6 D;  2LSY A;  4X62 T;  3ZYQ A;  2A5U A;  5HXC A;  2OV8 A;  4L9P A;  2XGS A;  4XKC A;  5EID A;  4O4L E;  4BT8 A;  4DI4 A;  4DMW A;  1UN9 A;  2X67 A;  1UCU A;  2FJB A;  1SA5 A;  3UT5 E;  4K5B A;  4PJJ A;  4CGW A;  2QC9 A;  2PG8 A;  5ENN A;  1XZY A;  3ZPO A;  4AQF C;  3S7B A;  4AV7 A;  5L47 A;  4RG6 A;  3RX6 A;  1SZ9 A;  3CKD A;  4TNW A;  3UFG A;  3BG1 B;  3PUZ F;  3NWI A;  2XAH B;  3WAJ A;  1X5B A;  4YTN A;  4HOQ A;  3AE7 A;  2PBI A;  3V5U A;  4EZ4 A;  1MHQ A;  1NA0 A;  1YQ4 A;  3MKD A;  4O6F A;  5LCW C;  4HQD A;  4UVC B;  3TWR A;  2EHO A;  3MV2 B;  1JWG A;  3PU8 A;  2JPF A;  4EZL A;  5ABE A;  3ULY A;  1K3Z D;  1LD8 A;  1UJK A;  3RO2 A;  2KWH A;  1KPS B;  3U3I A;  3ZN3 A;  4L5G A;  4X66 T;  1OED E;  4PK4 A;  4X1I E;  2L6J A;  4O4J E;  3FHN A;  1OCO E;  2YDQ A;  3OYZ A;  2HR2 A;  4YDW A;  1FVF A;  1N4S A;  2J8S D;  2WXN A;  4XE0 A;  3S4U A;  5FMN A;  3C50 A;  1JUQ A;  4O4I E;  4JEH A;  5AQO B;  4DR7 T;  2X6J A;  3DPD A;  3CK8 A;  2DL1 A;  5EN5 D;  3JQ0 A;  4DI3 A;  4JV5 T;  4I1M A;  5BNW A;  3G2U A;  4HTE A;  3L08 A;  3HIZ A;  1HX8 A;  5AQN B;  3N9L A;  3QWV A;  3PUR A;  3IXE A;  3Q79 A;  3B7S A;  2Y3A A;  4J8D A;  1QNF A;  5CJ5 A;  4YHH T;  3IHR A;  1D8D A;  2KT9 A;  2CG2 A;  3I9Y A;  3BU8 A;  2XQ7 A;  1OT8 A;  3MX3 A;  1HXI A;  2IDO B;  2OV9 A;  2B0O E;  3PEV B;  4EYY R;  3I0O A;  4DR2 T;  2VKH A;  3LJN A;  1Y8M A;  1ZBP A;  3R7Q A;  2BG9 C;  3ZEF B;  3NRX A;  2P9I G;  2DI4 A;  3MKR A;  4ZI7 E;  2L0I A;  4G24 A;  4Q96 A;  2V5C A;  4BY6 A;  5T3R A;  3P8C D;  4JBW F;  2EIJ E;  5AQQ B;  2XQY A;  3AE2 A;  4HFC A;  4FA6 A;  4I6G A;  2OVB A;  1TNZ A;  1MNE A;  4WWO A;  1T98 A;  1E96 B;  3PUQ A;  2RPA A;  3IEG A;  5FQ6 A;  3QUJ A;  2EHO C;  3T8O A;  4HRN A;  4N3B A;  2BKG A;  3FUN A;  2H7V C;  3V30 A;  3P4S A;  3T1Y T;  1ELW A;  1K1A A;  1W9R A;  1SA0 E;  3B7U X;  4HN9 A;  2HPL A;  2Y48 B;  4IRU A;  1KZP A;  2IC9 A;  1O1R A;  3O1I A;  4C48 B;  4XZ4 A;  4KHZ F;  4B3S T;  3FZM B;  3MKQ B;  5BV0 A;  3HXE A;  2R5S A;  2KZ7 B;  3ZPJ A;  3DPY A;  5JJ6 A;  5AQS B;  1NL4 A;  3CVR A;  2VQ2 A;  4AQF A;  5HCJ A;  5LHG B;  3ZVV A;  4PS3 A;  4CRW A;  5AQV B;  4CN6 A;  2LT3 A;  3OTO T;  2X3M A;  4LF8 T;  4EQF A;  4H7Y A;  4AXH A;  4EGW A;  3CK7 A;  4N3A A;  4FP7 A;  1KFY A;  4CGV A;  1R8I A;  3AE8 A;  4BWR A;  4FLB A;  3CQX C;  4URK A;  1YYH A;  2A4Z A;  4MAL A;  4U2Y A;  5ENO D;  2CBJ A;  2X0Y A;  1M7K A;  5JR9 C;  1I6Z A;  2EIL E;  5EYP F;  4I0U A;  4YVQ C;  3PNT B;  5AQK B;  1KK7 A;  4AP2 A;  2XJ7 A;  4E7S A;  1Z5S C;  4GCO A;  4G8K A;  5HQ8 A;  2I9C A;  2VWA A;  2XUE A;  4ZI2 C;  1N34 T;  3ZCI A;  3QB5 A;  3CQG B;  4KYO B;  3Q9D A;  2E0I A;  4ERR A;  2I1J A;  3ZST A;  5FJY A;  5FXX A;  1WCR A;  1X81 A;  1EYH A;  2J4B A;  4B94 A;  2VL8 A;  4WNK A;  4UEM A;  3DSW A;  2XQ3 A;  3UU4 A;  1G3N B;  3UMV A;  4P1N A;  2WS3 A;  1XWM A;  5LA6 E;  3SFD A;  1D8E A;  3RQU A;  4I9C A;  1BLX B;  4I50 E;  3Q2M A;  5DQV A;  1JNZ A;  2YOE A;  4TV3 A;  4KXK B;  1LVF A;  1H6O A;  3QAR A;  3DBS A;  4ME2 A;  3U4T A;  4YSX A;  4IST A;  3PE3 A;  2KSR A;  2MTQ A;  4ILB A;  2DYR E;  2GRP B;  3QJZ A;  2UY1 B;  2AXV A;  2GGF A;  2YU2 A;  2XEH A;  2CRB A;  3KDS E;  3MA9 A;  5FQ8 A;  3PUV F;  4F8H A;  3C3Q A;  3J5P A;  3CGH A;  2ZM0 A;  5LJM A;  2IHR 1;  2NR4 A;  2ZGG A;  4WAF A;  5ABF A;  3ABK E;  3L3P A;  1T72 A;  2CBI A;  1GQE A;  3OPC A;  1W09 A;  2UXD T;  4EZH A;  2CHO A;  2CHN A;  3NAW A;  3A8Y C;  1D0Y A;  4JI4 T;  5C1D A;  4N5Q A;  5FZS A;  2CA5 A;  3SF4 A;  1B7T A;  4GAA A;  3AXJ A;  4QH5 A;  4GCN A;  2WXI A;  3FH8 A;  4HKA A;  4I9E A;  1XNQ T;  3G2S A;  1H7C A;  5JDH A;  3FBL A;  2XTL A;  3KV5 A;  3Q15 A;  1N4Q A;  1HNW T;  2YHE A;  2VSX E;  3GWH A;  4H63 H;  4DK5 A;  3PH0 C;  1FJG T;  3ABL E;  3KSQ A;  1E8W A;  4BJN A;  3PZ3 A;  2XS1 A;  3L6A A;  1XNF A;  3CR3 A;  1YD8 G;  3TKL B;  4JI1 T;  3BQL A;  4JEH B;  3GZS A;  4A1S A;  4AOF A;  2JQH A;  3RIB A;  5BR8 T;  1QUU A;  3IF8 B;  4ILA A;  2WXL A;  2L8K A;  2W2U A;  4HXI A;  3KVA A;  3E32 A;  1P5Q A;  3TLV A;  5AJD A;  3HHM A;  2JRK A;  3ZT7 A;  4U31 A;  2PTF A;  1SE7 A;  2XAF B;  4DV3 T;  3HXB A;  5LYJ E;  5JR9 A;  5BMV E;  4OHF A;  3EDV A;  3QC1 A;  2QRX A;  4ZS2 A;  5FL0 A;  4O60 A;  4GA0 A;  4GZC A;  2JQQ A;  5AQ7 A;  1XNR T;  3KAE A;  3HR0 A;  2CXF A;  2WDV A;  3PRZ A;  5JH7 E;  2J1D G;  3ZC0 A;  3CIA A;  2LUH A;  3WG7 E;  1J5W A;  4UQZ A;  1DC2 A;  1OED C;  3SFZ A;  1DCE A;  1IHB A;  2QYJ A;  1MX2 A;  4WNF A;  5JDQ A;  5J1G A;  4P0A A;  2Y1L E;  3FH5 A;  2AJA A;  3QDN A;  4MRU A;  1HFA A;  2MAW A;  1US7 B;  3N2O A;  4UF0 A;  4LF9 T;  3GMI A;  4CZ2 D;  4TX5 A;  3W9G A;  4N2Q A;  3J7Y q;  4IE5 A;  4JPS A;  4GK0 E;  3FZK B;  5KBA A;  1MX4 A;  1QZ2 A;  2DWG A;  2ZM6 T;  3MJX A;  5FZR A;  4U07 A;  3TGO A;  4XAX B;  4KHP T;  4KBQ A;  1MND A;  4EHM A;  3FXD B;  1WG0 A;  3ZC1 A;  2VKJ A;  3ZN1 B;  2HM8 A;  3HVE B;  4LF7 T;  3ULQ A;  1CHU A;  4LSZ E;  3N2K E;  3PE4 A;  2VUR A;  1VRB A;  5JDL A;  3QC9 A;  4A3V A;  3NZP A;  5CED B;  5EDS A;  3ONL A;  3ASD A;  2K5B B;  4L2Y A;  3OJA A;  1Z8U A;  3PJA A;  2XGO A;  4ILG A;  2XM2 A;  4IE6 A;  2V5Q C;  4K5A B;  1WDY A;  1S64 A;  4UEL A;  1Z6T A;  4TV9 E;  2OLT A;  1H6P A;  3MA5 A;  4G11 A;  3ZMT B;  5LX8 A;  1INZ A;  2R02 A;  3AJI A;  3L54 A;  4L1B A;  3SZ7 A;  1D1B A;  2QZA A;  3UKR G;  4XZC A;  5JQG E;  2LNI A;  2J62 A;  2CWY A;  2JQ9 A;  3ESL A;  3KD7 A;  4L7T A;  3DST A;  1U4Q A;  3O4X E;  1WRD A;  2NW9 A;  2V5D A;  1NFI E;  5ANL A;  4DV1 T;  2J09 A;  2VGX A;  4NIK A;  4L9I A;  1OCR E;  2QY7 A;  1VDY A;  1VCS A;  5JR9 B;  2W67 A;  3VR8 A;  3LJC A;  4R7L A;  5ARG A;  3T8M A;  5CCL A;  2ETC A;  2IIU A;  1X79 A;  3UTK A;  3AE3 A;  2IO2 C;  4W9R A;  3AVS A;  4HFV A;  4GYO A;  3TWV A;  2LLY A;  4IDQ A;  3RKV A;  5AQI B;  1A5E A;  5KCM A;  2N9D A;  3S7J A;  3O4Z A;  2MHK A;  4DV2 T;  4DR3 T;  3AA6 B;  4WBN E;  2W63 A;  3QB5 K;  3F6Q A;  1BD8 A;  4UV9 B;  2WDQ A;  4I17 A;  3X1D A;  3DTO A;  3O1H A;  3EHZ A;  1WY6 A;  2Y4T A;  5LBQ B;  3MGB A;  2PZI A;  3Q47 B;  2MRI A;  4ZZB A;  4XI0 A;  3U66 A;  4H9P C;  2I59 A;  4H7X A;  3TWS A;  1WAO 1;  1ZKE A;  3ANW A;  3QOF A;  4J7W A;  5FWQ A;  3RI5 A;  5IYZ E;  4CT4 A;  4NIQ A;  4QQI A;  4NUR A;  1W3B A;  2LSV A;  4B3T T;  3RKG A;  1KLX A;  5LXT E;  4J8F A;  2H6I A;  4XKB A;  3VLD A;  1ELR A;  3CVN A;  3CHS A;  2LE8 A;  2FBW A;  4C0E A;  1TNY A;  4ILI A;  4DV4 T;  5FQ4 A;  4YT0 A;  2IQC A;  4JXT A;  4GML A;  1H6K A;  3HKD E;  3AEA A;  4JHR A;  3CQC B;  3ESK A;  2E9X A;  2XPK A;  1SA4 A;  2LAI A;  3ABM E;  2FO7 A;  3ASH A;  2Y4U A;  3CST A;  5DAB A;  4H63 V;  5AQP B;  2QFC A;  3B5M A;  2WXJ A;  4HRM B;  4DUI A;  2XSA A;  3KEZ A;  1XMO T;  4O8S A;  3PUY F;  2BG9 A;  1K1B A;  5KNG A;  3E33 A;  3R7R A;  4HOR A;  5L3E B;  5JDM A;  2V4H C;  3RKO A;  1UGO A;  2NC9 A;  1IHG A;  3PDN A;  3FUH A;  2X68 A;  3FEY A;  4A3T A;  4CDM A;  3HA4 A;  3E4B A;  3CVQ A;  1H19 A;  2XZE A;  3CVY A;  3PZ4 A;  3AS4 A;  5C8Y E;  3NZS A;  2LKH A;  4KP3 C;  4GYS A;  1QSD A;  4IHJ E;  4YDY A;  4ZI2 D;  3JXI A;  2WU2 A;  3ONJ A;  5HXE A;  4MS6 A;  3E08 A;  5JTG A;  4B8A A;  1E1H B;  2WPV A;  1KZO A;  4ZOL E;  3SNX A;  5IY5 E;  4JI5 T;  4EEB A;  4L2L A;  4JI2 T;  2PM7 A;  1OED A;  1Z3Y A;  4LML A;  3FTU A;  2EIM E;  4C90 A;  1FT2 A;  2NTY A;  5E76 A;  4IDP A;  3CVV A;  2LEH A;  3D9L A;  1SZA A;  2XQ4 A;  4PW8 A;  2ZXW E;  3Q4A B;  1XGW A;  2LM2 A;  4P09 A;  3R9M A;  1VCT A;  2JQK A;  1H2U A;  2CHZ A;  4NQ0 A;  5BPP A;  5G04 C;  1TJC A;  3CSF A;  2W62 A;  4RVB A;  4OYK A;  3FUJ A;  5A1L A;  1E8Z A;  4BFR A;  2DWZ A;  1IQR A;  1E8X A;  3M65 A;  4LFA T;  4LER A;  3Q78 A;  2XEN A;  5L3G B;  4A97 A;  3NOG D;  2ETB A;  4DPR A;  4WZX A;  2KMF A;  5E75 A;  4HOS A;  2VKO A;  4ZFH A;  4WUY A;  2FI7 A;  4APO A;  2L0T B;  4EXT A;  4JI8 T;  4LG6 A;  4ZZC A;  3CHR A;  3UM3 A;  4FC8 A;  3D9P A;  1LTX A;  4DR1 T;  4GB9 A;  3LDZ A;  3TG4 A;  2BS3 A;  1HG2 A;  3UIN C;  3D9I A;  2OA5 A;  4AKR B;  3TLT A;  4BET A;  3D9K A;  1IZN B;  4YDE A;  3ZNG A;  4IIJ E;  2XRY A;  2V8S E;  3B95 A;  2R05 A;  3PUG A;  3P2B A;  2CFZ A;  4GA2 A;  2WDR A;  2NOX A;  5ETW A;  4IL9 A;  2ZMA A;  4TWD A;  1D1C A;  1NA3 A;  3NB2 A;  4JI0 T;  3NRY A;  5L3C B;  4ILC A;  1YCS B;  4I2Z A;  4UF0 B;  3U78 A;  4LF5 T;  4J0U A;  3ULE G;  4U72 A;  2V7I A;  1Y01 A;  3Q9N C;  3ZSS A;  4DRX E;  2V6Y B;  1D1A A;  2Q9Q A;  4KX6 A;  3RPU A;  4F3V A;  2CHW A;  2JAB A;  3LXU X;  3C64 A;  5T8I A;  4ZXL A;  1LKX A;  3V31 A;  2WWV A;  2IW5 B;  4DX7 D;  2JMK A;  2X0L B;  2VK9 A;  3APD A;  3FZF B;  2EHO B;  4F7A A;  1TN6 A;  3PUA A;  4DV0 T;  1OXJ A;  4B3R T;  3AA7 B;  1TN8 A;  4HFH A;  2V0P A;  4GTV A;  2OEV A;  3T5V A;  3Q75 A;  2F8X K;  1V55 E;  4MFR A;  5CEA A;  5D2M C;  2VTB B;  4U7I A;  2EHO D;  3RRN B;  4U04 A;  2WXF A;  3UU8 A;  4HOU A;  4OYJ A;  4AKL A;  2X51 A;  3DXK G;  4BES A;  3SWH A;  4HLL A;  3KV4 A;  3MZK B;  5EK4 A;  4QXB B;  1RW2 A;  3EIJ A;  3K3O A;  5LB7 B;  3HRA A;  1W0A A;  3DRA A;  4DR6 T;  5HXR A;  3ZFW A;  3Q5X A;  2JMH A;  2FJE A;  2YQ8 A;  4GTR A;  4OAV B;  1D0Z A;  4FHJ A;  2W66 A;  4CXW A;  4I2W A;  2CM0 A;  2KXP B;  2YK0 A;  5FKY A;  5AIJ A;  5CBO A;  2HHH T;  4X65 T;  2E5L T;  3G2W A;  3LS8 A;  4A56 A;  4RSY A;  4HEA A;  3LK4 2;  3ZJ2 A;  3HXD A;  4QX7 B;  4COF A;  1IJ5 A;  3B13 A;  4QHO A;  3FUE A;  2KCK A;  3LY8 A;  2LXL A;  2BG9 B;  4FHK A;  2WXG A;  3MJW A;  5FT9 A;  4U95 D;  1IYG A;  5ENS D;  3BQI A;  2YIN A;  2JEK A;  3RGL A;  3QK0 A;  1MMD A;  5IHY A;  3RYH E;  2XCB A;  2D2S A;  5CB4 E;  2L9B A;  3ZCJ A;  4CDR A;  4DO0 A;  2BKO A;  2UU9 T;  3TLS A;  2F0Y A;  1E7U A;  4HFD A;  5FZQ A;  3EU5 A;  4O2A E;  4IE0 A;  1QYM A;  4X1Y E;  5AQ9 A;  4APF A;  1XMQ T;  2FF4 A;  3LK2 B;  3FXE B;  2L9Q A;  4PK6 A;  3KBT A;  3FTW A;  2CG3 A;  2KZT B;  1HS6 A;  1OED B;  4V1A v;  5J2U E;  4KZ0 A;  1NI1 A;  4EB6 E;  1OWO A;  3P4Q A;  4HGA A;  2DCP A;  2J07 A;  4IDN A;  2VVN A;  4X8Q A;  3EJN A;  2DHR A;  3UFE A;  4OK0 A;  2CCQ A;  2XZT G;  3NKZ A;  4EOZ B;  4DX2 A;  2CHX A;  2PL2 A;  5AAO A;  2IML A;  3VKH A;  4UWL A;  3DJB A;  3NVO A;  3P1U A;  2FEZ A;  2WB2 A;  3V2O A;  3ASG A;  4AY5 A;  3CVW A;  3I5P A;  1MMN A;  5CEC B;  5EX3 A;  5EZY E;  4DX6 D;  2ZM8 A;  4LMK A;  2V1D B;  3UU6 A;  5G55 A;  2SPC A;  2DCF A;  1O3X A;  5G04 J;  3JAF A;  5J90 A;  4QKN A;  2WP9 A;  4QXH B;  2OEW A;  1WYB A;  4GA1 A;  3ONL C;  2CLY B;  1EPU A;  3K3N A;  4GZ3 A;  4GTS A;  1UX5 A;  5AFU L;  1M62 A;  2LSU A;  5A23 A;  5IWA T;  3C98 B;  3ML8 A;  5CA0 E;  3LYA A;  4ZS3 A;  3FH7 A;  3J9X 1;  5EYL A;  5LCW J;  2K9A A;  5HEU A;  5FY1 A;  4YFS A;  1UN8 A;  4TXP A;  3AU5 A; 
#chains in the Genus database with same CATH homology
 4AXP A;  2B1E A;  3KV6 A;  3VTY A;  3PS6 A;  2LHN A;  3QWP A;  3N9Q A;  5M4Y A;  4M1P A;  2KCV A;  4ANJ A;  4E85 A;  4CI3 B;  5EK2 A;  4WNG A;  3HKE E;  4B8C B;  3MXZ A;  2K48 A;  2P9B A;  2VSY A;  5AEN A;  5LGU B;  3FUL A;  2GK9 A;  2CEA A;  1U3D A;  3KIN B;  1SHZ C;  5LCY A;  1HCI A;  2J49 A;  3BQK A;  4G26 A;  3VU7 H;  4UI9 K;  3UUX A;  3AVR A;  2XRZ A;  1E90 A;  3QWW A;  4I43 A;  1PAQ A;  3UT4 A;  3HKB E;  4GPK A;  2RA1 A;  1ZV4 X;  3N9M A;  3LG7 A;  5BT1 A;  2CLY C;  3EDU A;  4MHC A;  2UXX B;  3ETU A;  4K0U A;  2LHR A;  3ZGQ A;  4ZI3 C;  3E0Z A;  4HE8 A;  2IOL A;  3K8P C;  3IV0 A;  4TN7 B;  3APF A;  2V7M A;  1TEZ A;  2KZT A;  4Y6W A;  2I6H A;  2QA7 A;  4BX8 A;  3HKC E;  5FTP A;  3I3N A;  4MLP A;  3GN5 B;  1HO8 A;  3RRU A;  3N9P A;  2R59 A;  3L17 A;  3WAK A;  4EZJ A;  2PM6 A;  1FCH A;  4UQY A;  2KIN B;  3SGH A;  4JUY A;  1E8Y A;  1BR2 A;  2XCC A;  3LVR E;  3U9W A;  3MK7 C;  1HU3 A;  1MIV A;  2C2L A;  3IHY A;  5JDG A;  3NZU A;  4LCT A;  2JLB A;  2BTD A;  3SD5 A;  5HAX A;  5HYA A;  3PU3 A;  5HXS A;  1JWF A;  3PUJ A;  4BTB A;  2M63 A;  3FTS A;  2HPJ A;  4PDX A;  5DQW A;  3U64 A;  3SBS A;  1FMW A;  2WBL A;  3SI5 A;  3LFM A;  2V7K A;  4ATG A;  4N2S A;  4JZY A;  2IAK A;  4F53 A;  4UWH A;  3C98 A;  4D10 C;  3Q49 B;  5FY0 A;  3AAI A;  4M3O A;  4KBM B;  5C2Y A;  1NZN A;  3BEE A;  4YVO A;  5F8P A;  5JRE A;  5G2N A;  4GYR A;  3C51 A;  2J9Q A;  4KT6 B;  3TXN A;  1H2T C;  5EX0 A;  2XAJ B;  1OWP A;  3CK9 A;  3UQ3 A;  3I1A A;  4NUU A;  3RRM B;  4C0M A;  4PS8 A;  2NW7 A;  2WAU A;  2V4L A;  5BW8 C;  4J8S A;  4DND A;  2CMR A;  2XPZ A;  3BG0 B;  5LP0 A;  3SBT B;  4WNE A;  2X9X A;  2V7J A;  1U3C A;  3FHE A;  3LKU A;  4WWP A;  3ZN0 B;  4I6J A;  2J4D A;  5LGN B;  4AI6 A;  5CA1 E;  1YKH B;  3GW4 A;  4TUY E;  3RYF E;  3HL6 A;  3EDT B;  4QX8 B;  1NAF A;  2Y6X A;  2XAQ B;  2X6I A;  3AAA B;  3FTZ A;  5LOZ A;  1S94 A;  2W00 A;  3RRC A;  5KDM C;  3NQP A;  4UVA B;  3CEQ A;  2VGY A;  1S35 A;  2E8I A;  5GON E;  4PS7 A;  4CI1 B;  3Q5W A;  2UXN B;  3E22 E;  4PJL A;  2C0S A;  3VTX A;  2FUL A;  2ION A;  5H6Q B;  2WXP A;  5LGT B;  5FY7 A;  1QQE A;  4ACK A;  3K9I A;  4IUL A;  4EPZ A;  2ACX A;  1CUN A;  2X9W A;  2VJ8 A;  5T4Y A;  2AXU A;  3VLE A;  4B0Z A;  3RC3 A;  2CFU A;  2WSS V;  4G2A A;  3ASF A;  4Y6C A;  3ZMZ B;  2X6F A;  2V26 A;  4G63 A;  5KMG P;  2LSJ A;  5LOV E;  5KJL A;  4JA7 A;  3RU0 A;  4PFP A;  1BR1 A;  2J08 A;  3GZ2 A;  3BK9 A;  1Z0P A;  3N71 A;  1MMG A;  4TUU A;  3TXM A;  2OOE A;  1PY1 A;  3LY7 A;  4P29 A;  1YKE B;  5JRC A;  3LCA A;  5D0Q D;  4I6E A;  3L16 A;  5ARF A;  3O48 A;  3I9W A;  5LNK A;  4H9N C;  4ANV A;  2CXL A;  1U5P A;  3FUI A;  1IJ6 A;  1S0P A;  4BAY B;  3ZLI A;  2KAT A;  3Q5M A;  1FMV A;  3CLJ A;  2KLQ A;  3W15 B;  3QB2 A;  3ZXS A;  2KM4 A;  5EK3 A;  5G05 C;  1GW6 A;  4HFG A;  3N9N A;  2H3R A;  3I0Q A;  3PRE A;  4ILH B;  2Q9Q C;  4FAD A;  4KZC A;  3LK3 B;  1DNP A;  2Q9Q D;  3ML9 A;  3JQ1 A;  4B6X A;  4AEZ C;  3LBX A;  3GA8 A;  3MAC A;  3TAX A;  4QXC B;  4O4H E;  3FBZ A;  3QAQ A;  4AJW A;  4ASK A;  4XI9 A;  5HWX A;  4U63 A;  4GOU A;  4PFO A;  2D0T A;  2E9X D;  4ADZ A;  3QK6 A;  3VKG A;  3IKO B;  4PUC A;  4YND A;  3ZYL A;  3L09 A;  3FY4 A;  3UUX B;  4ISS A;  5LJN A;  4U0Z A;  2VTB A;  1A17 A;  1N54 A;  1BR0 A;  2CXD A;  4J8E A;  1AJ3 A;  3B7R L;  4KMC A;  3D0T A;  3FFL A;  3G2V A;  4I1A A;  1KNZ A;  5KJK A;  2N1G A;  4MBQ A;  4UWG A;  4NUV A;  4G2V A;  4UQX A;  3MCX A;  4L23 A;  3SOL A;  4AKH A;  3FTX A;  3JYS A;  2PFV A;  2WXQ A;  3CPZ A;  4I43 B;  2WXK A;  4JEU A;  5M72 A;  2K24 A;  2NSZ A;  4HVB A;  2YU1 A;  1LVK A;  2C0M A;  4H9O C;  4B89 A;  1IAP A;  4UIG A;  3OBV E;  4WWN A;  3CWZ B;  4WND A;  4N39 A;  3B7T A;  4GYW A;  3OXG A;  2IC6 A;  4FUL A;  4U0S A;  4G1T A;  3S7F A;  4E6H A;  4C91 A;  1ELK A;  3KS2 A;  3CML A;  4PJN A;  3ETV A;  2D0U A;  4P0B A;  5HWY A;  3PUK A;  5J2T E;  4F6R C;  3ZYM A;  4ANW A;  2NWB A;  5CMW A;  4ANX A;  2ODU A;  1B89 A;  5JJ7 A;  4KVO A;  4EAH A;  2X9Y A;  3N2G E;  2BVM A;  5H6R B;  3FU0 A;  4U8H A;  3CV0 A;  1OXZ A;  3LBX B;  4CEM A;  2VB6 A;  1E7V A;  3CX7 B;  3ONK A;  2EQX A;  5JVD E;  2BF0 X;  1UJJ A;  2W0G A;  2X9H A;  1HH8 A;  2FBN A;  3D3M A;  3JUI A;  1ZEE A;  5BV1 A;  4UI9 C;  4I55 E;  4BX9 A;  3DP7 A;  3ZJ1 A;  4WBO A;  3O9X A;  1LF8 A;  4G23 A;  3GN5 A;  3MEK A;  2UY1 A;  4XBF B;  3ONX A;  3CHM A;  2C5J A;  1OUV A;  2I2O A;  3V5S A;  3L22 A;  4ANU A;  3FP3 A;  1MMA A;  3FB2 A;  1V9D A;  3AU4 A;  4IE4 A;  3F2E A;  2VYI A;  1EZ3 A;  3HI2 A;  1YA0 A;  4MLK A;  3FU3 A;  2R17 C;  3CKB A;  3PVL A;  4JW1 A;  3ZIM A;  3MV3 B;  3RK6 A;  4GU5 A;  5FXZ A;  1BR4 A;  1BPO A;  5TAO A;  4AVX A;  1HS7 A;  2RP4 A;  3H3A A;  5CHE E;  2OVF A;  4EBA A;  4AM9 A;  1NWM X;  4DMV A;  3RH3 A;  4GZ6 A;  1HE8 A;  2G0U A;  2AXZ A;  1OWL A;  3RRW A;  1Z3X A;  1WYC A;  5JHA A;  4CI2 B;  2GRM A;  3R6N A;  3PEU B;  2AWI A;  4GZ5 A;  2V5F A;  5BUZ A;  4BJM A;  4CQI A;  2UWJ G;  3JCK C;  4PAG A;  3N9O A;  2AW6 A;  1Y6I A;  3AS5 A;  5JRC B;  4JEU B;  3S2A A;  1HF8 A;  1HZ4 A;  3EHN A;  4LEU A;  3SRZ A;  3LPZ A;  2L3L A;  2MOW A;  4ZI3 D;  3ZW3 A;  4EBA G;  2WQ7 A;  2VAS A;  2P58 C;  2KND A;  1ZU2 A;  3OKQ A;  2DNX A;  2DBA A;  2WMO A;  1H2V C;  1PC2 A;  1KT0 A;  2PQN A;  4LRZ A;  4O2B E;  3ZYK A;  3ZMS B;  2PQR A;  4K0R A;  5LG4 A;  5A7D B;  2LAH A;  2ES0 A;  4UWF A;  2A72 A;  4EYU A;  4H9Q C;  3FU6 A;  3HYM B;  3LEW A;  4HLE A;  2A3D A;  1N52 A;  3AA0 B;  2IJG X;  3C4X A;  3FUK A;  4TRQ A;  4PNI A;  4RG9 A;  2Y8D A;  2XEV A;  4JVS A;  2WQH A;  3EHM A;  3IEE A;  3UUM A;  4FI5 A;  4E7Z A;  5J08 A;  1OWA A;  1WM5 A;  1EF1 C;  4U74 A;  4AKG A;  2XPY A;  4AY6 A;  2LOS A;  3ZRH A;  1SQM A;  4HS2 A;  3D9J A;  3CVU A;  2WQ6 A;  3AA1 B;  3WXX A;  5AYW D;  3EUH A;  3SS1 A;  2AVP A;  4ZHQ E;  2RG8 A;  4OYS A;  3APC A;  3AAE B;  4DVD A;  2WVI A;  2E2E A;  1MIY A;  2Z6E A;  5L2L A;  1LRZ A;  2Q7F A;  4BSX A;  3CX6 B;  4IN3 B;  3FUM A;  3ZMU B;  3FDH A;  5FXW A;  5G05 J;  3UX4 A;  5DBK A;  5LBM A;  2GRL A;  2XAS B;  5ANR A;  5LP6 E;  3R84 B;  3KVB A;  4UV8 B;  2LO6 A;  2HH7 A;  4GMJ A;  3SHF A;  3ZHE B;  3L13 A;  3G2T A;  5FXV A;  5FYM A;  3GZ1 A;  4JL0 A;  2DIW A;  1FIO A;  2X66 A;  1G73 A;  4ABN A;  3RYI E;  4EEC A;  2C5I T;  4JA9 A;  2XHE A;  4DLO A;  4H9S E;  4CDN A;  1IQU A;  2LSK A;  2XPI A;  2NTX A;  3UT7 A;  3CVP A;  2NP9 A;  2LJL A;  1WLX A;  5HI7 A;  4X1K E;  3NBX X;  4IE7 A;  4N3C A;  2ODV A;  3C4W A;  4HOT A;  4YHJ A;  2BDE A;  2YHC A;  4FJZ A;  1DVP A;  4NAC A;  3FTY A;  5DJQ C;  3NZQ A;  4KUM B;  5A6C A;  2BUG A;  2N2N A;  1OWN A;  3U3W A;  5AJL A;  4YLH A;  2PJQ A;  3EIQ C;  3CX8 B;  2XAG B;  5DIZ A;  4TV8 E;  3RJV A;  2VKD A;  3R9A B;  4PJM A;  2IOS A;  1FVH A;  3CHP A;  4N5C A;  5CMY A;  4CT0 A;  2YEV C;  2WXO A;  2H7O A;  5JHB A;  4F1S A;  3LVQ E;  3QKY A;  4XIF A;  2IU1 A;  4BA9 A;  3JC6 C;  2X6H A;  3I4R B;  2ZU6 B;  3F31 A;  2HYZ A;  4G25 A;  3B57 A;  2D5U A;  4Q94 A;  3VLF A;  5EKQ D;  1UG3 A;  3I4G A;  4CXX A;  2ILR A;  4JLE A;  2XHE B;  5JDF A;  4QFV A;  4Q69 A;  2WMN A;  4PK5 A;  4FJO A;  1MIW A;  1NP7 A;  2VGX B;  3GYZ A;  5L3D B;  2LSG A;  1UX4 A;  4KVM A;  4U0U A;  2C0L A;  3EVY A;  4JC8 A;  1ZHC A;  4FU3 A;  4CZZ B;  3FUD A;  3MYV A;  2WWU A;  1VOM A;  4UXN B;  2V7L A;  4UI9 J;  4ILU A;  5HXH A;  3UT8 A;  3RO3 A;  2OND A;  4JHK A;  5LFA A;  4CXY A;  2QGS A;  2JJ9 A;  2W61 A;  3PTR B;  3ZMV B;  4UVB B;  4AKI A;  3HVE A;  5JJT A;  4CCA A;  3MKQ A;  4N78 D;  5FQ7 A;  1Y64 B;  2MBG A;  3ZHE A;  2I1K A;  2LSI A;  3CHO A;  2YNQ A;  3IBE A;  4LUN U;  3CVL A;  3D9N A;  3TG5 A;  5FNV E;  5KJM A;  4JHJ A;  4KMO A;  3A5X A;  5L3F B;  5F3J A;  5L3B B;  4C9B B;  4QWN B;  2CWO A;  3ENE A;  2WM9 A;  4ACL A;  3F57 A;  4XX5 A;  3AS8 A;  3O1J A;  3URZ A;  1UW4 B;  3RYC E;  3C4Z A;  4PH4 B;  4OVU A;  1HTJ F;  2NXP A;  3CVX A;  2E9X B;  4YJ2 E;  1OWM A;  4NRH B;  3IBP A;  3PZD A;  3IHV A;  3UUN A;  4MKT A;  4X20 E;  2LM9 A;  3PNL B;  1KT1 A;  2Q9Q B;  3FU5 A;  2ZLY A;  3PE0 A;  1WR6 A;  5ADX L;  4L0R A;  3N5L A;  5LHI B;  3VHL A;  2RD0 A;  1MQS A;  3ANW B;  2WXR A;  3HDX A;  3UPV A;  2GW1 A;  5KJN A;  2X6K A;  4IGU A;  3CKC A;  2XQ0 A;  4FLH A;  2BZB A;  2M67 A;  2KC7 A;  2A2F X;  4A55 A;  2KCL A;  2VSO E;  2E9X C;  4AQG A;  3QOU A;  4EIW A;  4GIW A;  2DWK A;  1TJF A;  3LJ3 A;  3FEX A;  5LHH B;  4YJ3 E;  3NF1 A;  4GYY A;  3QNK A;  2NW8 A;  1H0A A;  2ZM2 A;  4V3I A;  4GK5 E;  3P7I A;  3CHQ A;  3S7D A;  3OXL A;  1FEW A;  3LY9 A;  3PDY A;  4DJA A;  3PUS A;  4GZD A;  5E0O A;  5JDN A;  3OXF A;  2MOZ A;  5KX5 E;  4IDZ A;  2IFU A;  2LOP A;  3FUF A;  3KV9 A;  4DBQ A;  2VSN A;  3TJP A;  2BVL A;  3OYX A;  1JPL A;  3MZL B;  2MYS A;  3KBU A;  4TZ4 C;  3T5X A;  2IF4 A;  4FJY A;  3H37 A;  1HG5 A;  4OVV A;  4J2C A;  2C5K T;  4I4T E;  4Z8X A;  4AIF A;  4BTA A;  5FP3 A;  3RC8 A;  5D0O D;  4IYP A;  1YW0 A;  4J6I A;  4A1G A;  3OTN A;  1EDU A;  2HO1 A;  3K3Q C;  4UWK A;  4EZK A;  2XGM A;  4DLQ A;  4OFZ A;  5CCM A;  3ZEF A;  3FWV A;  3UUL A;  2KWI B;  4DBR A;  1D0X A;  3FTV A;  2WXH A;  2X38 A;  3OAW A;  1G8X A;  4H9R C;  3TL5 A;  3WI3 A;  2DLR A;  1L5J A;  2WXM A;  3AB3 B;  4K03 A;  4WW0 A;  4BT9 A;  3D9M A;  3D9O A;  2CE7 A;  4I1O B;  3KFW X;  3JC6 D;  2LSY A;  3ZYQ A;  2A5U A;  5HXC A;  2OV8 A;  4XKC A;  2XGS A;  4BT8 A;  4DI4 A;  4O4L E;  4DMW A;  1UN9 A;  2X67 A;  1UCU A;  3UT5 E;  4PJJ A;  4CGW A;  2PG8 A;  5ENN A;  3S7B A;  3ZPO A;  4AQF C;  4AV7 A;  4RG6 A;  3RX6 A;  1SZ9 A;  3CKD A;  3BG1 B;  2XAH B;  3WAJ A;  1X5B A;  4HOQ A;  2PBI A;  3V5U A;  4EZ4 A;  1MHQ A;  1NA0 A;  3MKD A;  4O6F A;  5LCW C;  4UVC B;  2EHO A;  3MV2 B;  1JWG A;  3PU8 A;  2JPF A;  4EZL A;  1UJK A;  3RO2 A;  2KWH A;  3U3I A;  3ZN3 A;  4L5G A;  4PK4 A;  4X1I E;  2L6J A;  4O4J E;  3FHN A;  3OYZ A;  2HR2 A;  1FVF A;  2WXN A;  4XE0 A;  3S4U A;  5FMN A;  3C50 A;  1JUQ A;  4O4I E;  4JEH A;  2X6J A;  3DPD A;  3CK8 A;  3JQ0 A;  4DI3 A;  4I1M A;  5BNW A;  3G2U A;  4HTE A;  3L08 A;  3HIZ A;  1HX8 A;  3N9L A;  3QWV A;  3PUR A;  3B7S A;  2Y3A A;  4J8D A;  1QNF A;  3IHR A;  2KT9 A;  2CG2 A;  3I9Y A;  3MX3 A;  1HXI A;  3PEV B;  4EYY R;  3I0O A;  2VKH A;  1Y8M A;  1ZBP A;  3R7Q A;  3ZEF B;  3NRX A;  2DI4 A;  3MKR A;  4ZI7 E;  2L0I A;  4G24 A;  4Q96 A;  4BY6 A;  5T3R A;  3P8C D;  2XQY A;  4FA6 A;  4I6G A;  2OVB A;  1MNE A;  4WWO A;  1T98 A;  1E96 B;  3PUQ A;  3IEG A;  5FQ6 A;  3QUJ A;  2EHO C;  3T8O A;  4N3B A;  3FUN A;  2H7V C;  1ELW A;  1SA0 E;  3B7U X;  4HN9 A;  2HPL A;  2Y48 B;  4IRU A;  2IC9 A;  3O1I A;  4XZ4 A;  3MKQ B;  5BV0 A;  2R5S A;  2KZ7 B;  3ZPJ A;  5JJ6 A;  3CVR A;  2VQ2 A;  4AQF A;  3ZVV A;  5LHG B;  4CRW A;  4PS3 A;  2LT3 A;  2X3M A;  4EQF A;  4H7Y A;  4AXH A;  4N3A A;  3CK7 A;  4FP7 A;  4CGV A;  4BWR A;  4FLB A;  3CQX C;  4URK A;  2A4Z A;  4MAL A;  5JR9 C;  4YVQ C;  3PNT B;  1KK7 A;  4AP2 A;  4E7S A;  4GCO A;  5HQ8 A;  2I9C A;  2VWA A;  2XUE A;  4ZI2 C;  3ZCI A;  3CQG B;  4KYO B;  3Q9D A;  2E0I A;  4ERR A;  2I1J A;  5FJY A;  5FXX A;  1EYH A;  2J4B A;  4B94 A;  2VL8 A;  4WNK A;  4UEM A;  3UMV A;  5LA6 E;  4I9C A;  4I50 E;  3Q2M A;  5DQV A;  4TV3 A;  4KXK B;  1LVF A;  3QAR A;  3DBS A;  4ME2 A;  3U4T A;  4IST A;  3PE3 A;  2MTQ A;  3QJZ A;  2UY1 B;  2AXV A;  2GGF A;  2YU2 A;  3MA9 A;  3KDS E;  5FQ8 A;  3CGH A;  2ZM0 A;  5LJM A;  4WAF A;  3L3P A;  4EZH A;  1D0Y A;  5C1D A;  5FZS A;  2CA5 A;  3SF4 A;  1B7T A;  4GAA A;  4GCN A;  2WXI A;  3FH8 A;  4HKA A;  4I9E A;  3G2S A;  1H7C A;  5JDH A;  3FBL A;  2XTL A;  3KV5 A;  3Q15 A;  2YHE A;  2VSX E;  3GWH A;  4H63 H;  4DK5 A;  3PH0 C;  1E8W A;  4BJN A;  3L6A A;  1XNF A;  3CR3 A;  1YD8 G;  3TKL B;  3BQL A;  4JEH B;  3GZS A;  4AOF A;  3RIB A;  1QUU A;  3IF8 B;  2WXL A;  2L8K A;  4HXI A;  3KVA A;  1P5Q A;  5AJD A;  3HHM A;  2JRK A;  2XAF B;  5LYJ E;  5JR9 A;  5BMV E;  4OHF A;  3EDV A;  3QC1 A;  4ZS2 A;  4GA0 A;  4GZC A;  2JQQ A;  3KAE A;  3HR0 A;  2CXF A;  3PRZ A;  5JH7 E;  2J1D G;  3ZC0 A;  3CIA A;  4UQZ A;  3SFZ A;  4WNF A;  5JDQ A;  5J1G A;  4P0A A;  3FH5 A;  3QDN A;  4MRU A;  1HFA A;  1US7 B;  3N2O A;  4UF0 A;  3GMI A;  4TX5 A;  4N2Q A;  3J7Y q;  4IE5 A;  4JPS A;  4GK0 E;  1QZ2 A;  2DWG A;  3MJX A;  5FZR A;  4U07 A;  3TGO A;  4XAX B;  4KBQ A;  1MND A;  3FXD B;  3ZC1 A;  2VKJ A;  3ZN1 B;  2HM8 A;  3HVE B;  3ULQ A;  3N2K E;  3PE4 A;  1VRB A;  5JDL A;  3QC9 A;  4A3V A;  3NZP A;  5EDS A;  3ONL A;  3ASD A;  2K5B B;  4L2Y A;  3OJA A;  2XGO A;  4ILG A;  4IE6 A;  4UEL A;  1Z6T A;  4TV9 E;  3MA5 A;  4G11 A;  3ZMT B;  5LX8 A;  1INZ A;  3L54 A;  4L1B A;  3SZ7 A;  1D1B A;  4XZC A;  5JQG E;  2LNI A;  2CWY A;  3ESL A;  3KD7 A;  4L7T A;  1U4Q A;  3O4X E;  1WRD A;  2NW9 A;  5ANL A;  2J09 A;  2VGX A;  4L9I A;  2QY7 A;  1VDY A;  5JR9 B;  3LJC A;  4R7L A;  5ARG A;  3T8M A;  5CCL A;  1X79 A;  3UTK A;  4W9R A;  3AVS A;  4HFV A;  4GYO A;  3RKV A;  5KCM A;  2N9D A;  3S7J A;  3O4Z A;  2MHK A;  3AA6 B;  4WBN E;  2W63 A;  4UV9 B;  4I17 A;  3DTO A;  3O1H A;  1WY6 A;  2Y4T A;  5LBQ B;  3MGB A;  2PZI A;  3Q47 B;  2MRI A;  4XI0 A;  3U66 A;  4H9P C;  2I59 A;  4H7X A;  1WAO 1;  1ZKE A;  3ANW A;  5FWQ A;  5IYZ E;  4CT4 A;  4NUR A;  1W3B A;  2LSV A;  1KLX A;  5LXT E;  4J8F A;  4XKB A;  3VLD A;  1ELR A;  3CVN A;  3CHS A;  2LE8 A;  4C0E A;  4ILI A;  5FQ4 A;  2IQC A;  4JXT A;  4GML A;  1H6K A;  3HKD E;  4JHR A;  3CQC B;  3ESK A;  2E9X A;  2LAI A;  2FO7 A;  3ASH A;  2Y4U A;  3CST A;  5DAB A;  4H63 V;  2QFC A;  2WXJ A;  3KEZ A;  4O8S A;  3R7R A;  4HOR A;  5L3E B;  5JDM A;  3RKO A;  2NC9 A;  1IHG A;  3PDN A;  3FUH A;  2X68 A;  3FEY A;  4A3T A;  4CDM A;  3HA4 A;  3E4B A;  3CVQ A;  1H19 A;  3CVY A;  3AS4 A;  5C8Y E;  3NZS A;  4KP3 C;  4GYS A;  1QSD A;  4IHJ E;  4ZI2 D;  5HXE A;  4MS6 A;  3E08 A;  4B8A A;  1E1H B;  2WPV A;  4ZOL E;  3SNX A;  4L2L A;  2PM7 A;  1Z3Y A;  3FTU A;  4C90 A;  2NTY A;  5E76 A;  3CVV A;  2LEH A;  3D9L A;  1SZA A;  4PW8 A;  3Q4A B;  1XGW A;  4P09 A;  2CHZ A;  1H2U A;  4NQ0 A;  5BPP A;  5G04 C;  1TJC A;  3CSF A;  2W62 A;  4RVB A;  4OYK A;  3FUJ A;  5A1L A;  1E8Z A;  4BFR A;  1IQR A;  1E8X A;  3M65 A;  4LER A;  5L3G B;  4DPR A;  2KMF A;  5E75 A;  4HOS A;  2VKO A;  4WUY A;  2FI7 A;  4APO A;  2L0T B;  4EXT A;  3CHR A;  4FC8 A;  3D9P A;  4GB9 A;  3LDZ A;  3TG4 A;  1HG2 A;  3D9I A;  2OA5 A;  4AKR B;  3D9K A;  1IZN B;  4IIJ E;  2XRY A;  2V8S E;  3PUG A;  3P2B A;  2CFZ A;  4GA2 A;  2NOX A;  5ETW A;  2ZMA A;  1D1C A;  1NA3 A;  3NRY A;  5L3C B;  4I2Z A;  4UF0 B;  3U78 A;  4J0U A;  4U72 A;  2V7I A;  1D1A A;  2Q9Q A;  3RPU A;  4F3V A;  2CHW A;  3LXU X;  3C64 A;  5T8I A;  1LKX A;  2IW5 B;  2JMK A;  2X0L B;  2VK9 A;  3APD A;  2EHO B;  4F7A A;  3PUA A;  3AA7 B;  2V0P A;  3T5V A;  4MFR A;  2VTB B;  2EHO D;  3RRN B;  4U04 A;  2WXF A;  4HOU A;  4OYJ A;  4AKL A;  2X51 A;  3SWH A;  3KV4 A;  3MZK B;  5EK4 A;  4QXB B;  3EIJ A;  3K3O A;  5HXR A;  3ZFW A;  3Q5X A;  2JMH A;  2YQ8 A;  1D0Z A;  4FHJ A;  4CXW A;  4I2W A;  2CM0 A;  2KXP B;  2YK0 A;  5AIJ A;  3LS8 A;  3G2W A;  4A56 A;  4RSY A;  4HEA A;  3LK4 2;  3ZJ2 A;  4QX7 B;  1IJ5 A;  3B13 A;  4QHO A;  3FUE A;  2KCK A;  3LY8 A;  4FHK A;  2WXG A;  3MJW A;  5FT9 A;  1IYG A;  3BQI A;  2YIN A;  2JEK A;  3QK0 A;  1MMD A;  5IHY A;  3RYH E;  2XCB A;  2D2S A;  5CB4 E;  2L9B A;  3ZCJ A;  4CDR A;  4DO0 A;  5FZQ A;  1E7U A;  4O2A E;  4IE0 A;  4X1Y E;  4APF A;  2FF4 A;  3LK2 B;  3FXE B;  2L9Q A;  4PK6 A;  3KBT A;  3FTW A;  2CG3 A;  2KZT B;  1HS6 A;  4V1A v;  5J2U E;  4KZ0 A;  4EB6 E;  1OWO A;  4HGA A;  2DCP A;  2J07 A;  3EJN A;  2DHR A;  3UFE A;  4OK0 A;  2CCQ A;  4EOZ B;  2CHX A;  2PL2 A;  3VKH A;  4UWL A;  3DJB A;  3P1U A;  2FEZ A;  2WB2 A;  3ASG A;  4AY5 A;  3CVW A;  3I5P A;  1MMN A;  5EX3 A;  5EZY E;  2ZM8 A;  2V1D B;  5G55 A;  2SPC A;  2DCF A;  1O3X A;  5G04 J;  5J90 A;  4QKN A;  4QXH B;  1WYB A;  4GA1 A;  2CLY B;  1EPU A;  3K3N A;  4GZ3 A;  1UX5 A;  5AFU L;  2LSU A;  5A23 A;  3C98 B;  3ML8 A;  5CA0 E;  3LYA A;  4ZS3 A;  3FH7 A;  3J9X 1;  5LCW J;  2K9A A;  5FY1 A;  4YFS A;  1UN8 A;  4A1S A;  3AU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...