3ZYKA

Structure of calm (picalm) anth domain
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
269
structure length
269
Chain Sequence
SAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords PHOSPHATIDYLINOSITOL-BINDING CLATHRIN ASSEMBLY PROTEIN
publication title The molecular basis for the endocytosis of small R-SNAREs by the clathrin adaptor CALM.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 111
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zykA02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zykA01
1MHQA 3D9IA 3ONLA 3D9JA 1EDUA 1SZAA 2V8SE 4HFGA 3D9LA 3RRUA 1JWFA 3G2TA 1HF8A 1DVPA 1ELKA 1HFAA 3D9KA 5CMWA 5CMYA 4AVXA 1UJJA 4FLBA 4JXTA 2DCPA 3D9PA 5LP0A 1HX8A 1X5BA 4GZCA 3ZYQA 3G2SA 1HG2A 1EYHA 1XGWA 3ZYKA 1SZ9A 1PY1A 2MOWA 2L0TB 2QY7A 3LDZA 3ZYLA 3ONKA 4FU3A 3G2WA 4Q96A 1UJKA 3D9MA 4Q94A 1HG5A 3CLJA 1VDYA 1INZA 3ZYMA 2LO6A 1JWGA 1JUQA 3D9OA 5LOZA 3D9NA 2BF0X 1H0AA 4NACA 1LF8A 2L0IA 3G2UA 5J08A 2DIWA 4GZDA 2KM4A 1JPLA 3G2VA
chains in the Genus database with same CATH superfamily
2VVNA 3ZW3A 4HKAA 4BAYB 5CBOA 3KV4A 1KLXA 4ASKA 4TRQA 4I6EA 1O1SA 4PW8A 1WLXA 2XSAA 3NVOA 4GMJA 1U4QA 4H9NC 2WXLA 5JJTA 4G2AA 5D66A 1MIYA 1OT8A 3DEOA 5LJNA 5AQMB 2MBGA 2F0YA 2C0LA 5ENTD 2ZLYA 2WXQA 4TUMA 5LGNB 4AQFC 1N4PA 4L0RA 3L16A 4EAHA 2B76A 3FTZA 2XUEA 2YDQA 1HU3A 4YNDA 4JXTA 4B0ZA 2LM9A 3KSQA 3MCXA 4U8VD 2FUPA 5LNKA 3NAWA 4HOQA 3GMIA 4EBAG 3UM1A 2Q7FA 5AQVB 5G05J 1YW0A 3Q78A 2XCCA 4CCAA 1ZV4X 2E9XA 3EIJA 1A17A 4YHJA 2J62A 4DIDB 3LDQB 4ILCA 1UX4A 3QK6A 3V31A 2CLYB 2B0OE 5CA0E 2F8XK 1HX1B 3CKCA 3NF1A 5CCMA 3AE7A 2DYRE 2FBWA 2WWUA 1UJJA 4HRNA 3I4GA 3NOCD 1D1CA 4O4HE 3RHWA 2EILE 2X0LB 2PM6A 3CHQA 2ETAA 1E8YA 2KCVA 2XGSA 1N11A 5A6CA 5H6RB 3ZGQA 2FJEA 2C5JA 4AOFA 3T9KA 4OK0A 2DLRA 2JQQA 4H9QC 3CX7B 2RPAA 2NXPA 4BA9A 5HXHA 3CVVA 3HG0D 4HRMB 2V6YA 2WDRA 3AU5A 2XAGB 2QYJA 5M4YA 2DNXA 1OWMA 4AJWA 3EDVA 2QYUA 3LJNA 1BLXB 3UU4A 4HWFA 2AXVA 2V5DA 3DP7A 2K9AA 5F3JA 3DSTA 3ABME 2V7IA 4UV8B 3KVAA 3CSTA 3PZ4A 1XDOA 3ZPJA 5AQPB 3U64A 4IL9A 2P9UG 1KF6A 2I2OA 2XY8B 4JEUB 4GZ6A 2YU1A 3MA9A 2HHHT 4MHCA 1T72A 3MXZA 2LKHA 5E0OA 4JD2G 1NA3A 3PEUB 2Y0BG 2AJAA 4RSYA 3Q7AA 3I9YA 3BEEA 2N2NA 5HCJA 3AS4A 4HBDA 3TLTA 4AIUA 2IONA 5DQWA 2L6BA 3GZ1A 4UVCB 5FZSA 5D0OD 1FJGT 3PZDA 2R2LA 2ONDA 2NW8A 2RA1A 3FZKB 3L82A 5FL0A 2BKPA 3LCAA 2V8SV 2IUBA 3RGLA 5D2MC 5LOZA 3TWQA 5AQNB 1DU2A 4GZ3A 4J8FA 2LSGA 3PRZA 3SFDA 3E22E 4EGWA 4O8SA 2Y6XA 5BW8C 3Q7FA 4XX5A 2PL2A 3LJ3A 4H9OC 1MZCA 4YSXA 3UM3A 3T1HT 4GZ5A 1E7UA 3SY2A 2J4GA 2XTLA 2VKJA 2H7OA 1DC2A 1Z6TA 3DXMG 2P9KG 4CGVA 2XQ7A 3BQLA 3CVLA 3FUHA 1SUMB 4U95D 2VGEA 1WG0A 3U78A 4HB5A 4I9CA 3RLFF 4UQYA 3QWPA 3FBZA 4F8HA 4YTNA 3Q47B 3D9LA 5CFBA 1P5QA 2BEDA 5EK3A 3V30A 2P9BA 3SBTB 3ZJ1A 2VK9A 1TNZA 5G05C 3LPZA 5KNHD 3RK6A 4IDNA 3CX6B 4QH4A 3MA5A 4GYSA 5AQBA 1SA0E 2CXLA 5C2TA 3NWIA 2MOWA 2VGXB 4IE7A 3IBPA 3PV0F 4YHHT 1UN9A 4PH4B 4Z68A 3VRAA 1UJKA 2BS4A 4APOA 4COFA 2WBLA 4DO0A 3MKQB 3QDNA 3RX6A 3ZYMA 4ILUA 2OCCE 4IULA 5FNVE 2IC9A 5FQ7A 2KATA 3ZN0B 5J0ZA 4JPSA 1ELKA 2P2CP 1Z3XA 1HR0T 4JUYA 2VYIA 5EK2A 3ENEA 1ELRA 4MKTA 1UCUA 4EHMA 3OJAA 4C90A 3URZA 5DIZA 4I2WA 5FVLA 4EYYR 4H9SE 3AEBA 3RI5A 3WAJA 1ZOYA 4WWOA 4BERA 4GA1A 5BXUA 5IYZE 2H6FA 3ABKE 1K1AA 3FEXA 3C5RA 4LMJA 1YXRA 4EOZB 1HNZT 1OWLA 5BT1A 2FO1E 3MACA 3TLUA 2R03A 1N4QA 5HYAA 2KWHA 4Q25A 2VGYA 3HA4A 4GK0E 3FH7A 5G2NA 4L23A 2VVSA 3RRNB 4TXPA 4CDRA 2LEHA 5KX5E 5FY0A 4TN7B 4U31A 4GTOA 4H7YA 3K1SA 4KP3C 1T8BA 5L3CB 2WXNA 3AA1B 3CHPA 1QSDA 5C3JA 5LHIB 4EXTA 4GYWA 2XAQB 2VKHA 4HFGA 4UI9J 4LF4T 2WSSV 1XMQT 3LVQE 4NXNT 2FULA 5BR8T 2C5KT 5LHHB 2RD0A 3VKHA 1E2AA 3OAWA 4DLOA 4DX5D 2GROB 2QY7A 2CWYA 2J09A 3TWVA 3UT5E 4Z91A 2NOXA 1N9AA 3IEEA 3HKDE 2G0UA 4BT9A 2R6GF 5ANLA 4B8CB 3FTVA 2UU9T 2VL8A 3G2TA 1BR4A 1HFAA 2GK9A 2ODVA 4H9RC 2YQ8A 3HR0A 3RKGA 2Q9QB 4ZZBA 1N54A 3K3QC 3VTYA 3TXMA 3B5MA 3KEAA 3X2QE 3L09A 3EI0A 3FFLA 1UX5A 4IDOA 1HNWT 3ASNE 3FUJA 4I1MA 1ZEEA 3ONLC 3ZHEA 3ZN3A 1UURA 4B94A 3UIOC 5L47A 2J4BA 4J8DA 1Z8UA 2FJBA 1FT1A 3ASHA 1TN7A 3ZMUB 3DBSA 2E0IA 4X65T 4NQ0A 2XM1A 3UKUG 1LTXA 1IAPA 5LG3A 1Y64B 2LXMA 4N3BA 2BG9B 3PUYF 1N32T 3ONXA 4P29A 4L7TA 4U2YA 4TV3A 2X0HA 1HG5A 1J1JA 1WY6A 1O1RA 1D0ZA 4A5XA 2VASA 3C3RA 3ML9A 2PTFA 4H63H 4HOSA 4WAFA 4EZLA 5CERB 3NQPA 3KFWX 3O1IA 3OXLA 4KXKB 4UWGA 5A23A 4G23A 3S2AA 4UWLA 2CLYC 4JV5T 3ANWB 3DSSA 4Q94A 4CXXA 4O4JE 4OFZA 4ZI3D 5IUXA 1VOMA 4CI1B 3V2XA 5ENPD 3MV2B 3B95A 2DL1A 2IW5B 3PUXF 2P58C 4LEUA 3SFZA 5LOVE 4GZDA 2LSIA 2XQ5A 5EDSA 2QA7A 5ENSD 1SHZC 3L6AA 3ABVA 2ZM6T 3I1AA 3MV3B 3IHRA 4GMRA 1MYOA 1YMPA 3RAUA 4K5CA 2AXZA 1SA4A 4O4LE 5ETWA 1MNEA 4K03A 2HN1A 2I59A 4HS2A 3GN5A 4B93B 2V26A 4BT8A 2ZM8A 3AE3A 3D9OA 2C0MA 3AA7B 3ML8A 3ZJ2A 2WCAA 3ASOE 1IZNB 3Q75A 3UUXB 1OXJA 4YDWA 4JI1T 1E96B 2A9UA 3GA8A 4IE6A 2IY0C 5ABHA 4UI9C 1LVFA 1EDUA 1HO8A 5JA4D 2LE8A 4DBRA 4LSZE 2YK0A 4B3MT 1SQMA 2IQCA 4U0UA 1D1BA 1SW6A 2KINB 5T8IA 5FTPA 4ANUA 3BK9A 1YA0A 4UWKA 1WR0A 3C50A 4YLHA 3L08A 4L9IA 5JDNA 3GYZA 5AQKB 1OEDA 4MFRA 3E0ZA 3OVUA 2FI7A 2E9XB 3B7BA 5J2UE 1LVKA 1D0XA 3SWHA 3HVEA 4MLPA 3E4BA 3KSLA 3UU8A 4EIWA 4JI3T 4HN9A 3ZMTB 2PNNA 3CK9A 3D0TA 4LNGA 1E90A 4Y6WA 1Z3YA 2EINE 5JDFA 3S7BA 1N36T 3PS6A 1EYHA 5AQ7A 5ARGA 1AP7A 2IEJA 3J7Yq 4LNBA 2WMNA 3NRXA 4AEZC 3V2OA 1Y8MA 3Q49B 3FXDB 4L5GA 2FEZA 3J9X1 3QJZA 4C0MA 3UUBA 5F5WA 3LY8A 1CUNA 4AKHA 1EZ3A 2PQRA 4ANWA 2Q9QD 4ANXA 4B89A 3CWZB 3VLEA 4IE4A 1KZOA 2OLTA 3RC8A 1Z5SC 4LFAT 2XCBA 1OUVA 2VKOA 4M7CA 3AEEA 4QX7B 3FWVA 3TG5A 2H6GA 5HXSA 4DVDA 3GW4A 3RF1A 5B1BE 1H0AA 2ZGDA 2WQYA 2UUCT 1V54E 2I0MA 4ZS2A 3CVPA 1UOHA 4TXRA 3CPZA 2EIJE 2LSVA 2CMRA 2P9IG 1GQEA 1W0AA 1HCIA 1N0RA 2BKGA 4UEMA 1RZ4A 4HQDA 1FMVA 5A1LA 4ZI3C 3VRBA 2LNIA 4X1YE 4A56A 3RQUA 4UELA 1H2VC 2LT3A 3C4XA 5JJ7A 3S7JA 4DR3T 5EZYE 4U04A 3MEKA 4G63A 3QB5K 3UU3A 5CCLA 3AJIA 3O4ZA 2CHZA 1X79A 4XE0A 5IWAT 4J8SA 1MIVA 1BR2A 3JXJA 3KD7A 4AI6A 3SHFA 5IHYA 4J6IA 4DMVA 1LKXA 4DUYT 4JBWF 4RLYA 4JI6T 5FQ4A 2VKDA 3RYHE 2QGSA 4IDQA 3FU5A 1HG2A 5AN8A 3CHMA 3ZCIA 1WCRA 2EIME 4J8EA 3LG7A 5LCYA 4DR1T 4CT4A 3PTRB 3FXEB 4PJJA 2GRLA 5HEOA 4N3CA 2X51A 3Q9DA 2H6HA 5JDMA 2A72A 4G11A 4AXPA 3W9GA 2XS1A 3TWSA 2EHOB 2XEEA 4KBQA 2XQ0A 4KZ0A 2L9QA 1IBMT 3Q4AB 4NRHB 1ZHCA 2CEAA 4U3CA 4RQIA 5FMNA 4IE5A 4JC8A 3FTSA 4YSZA 4I6JA 4BSXA 5JDQA 3PREA 3U3IA 4WZXA 2UXCT 1KT1A 3FUNA 1Y01A 4JEHB 2WWVA 5E76A 4GIWA 3ZMZB 4KHPT 1NFIE 4JI5T 4HWCA 2H89A 4FI5A 2OEWA 3JUEA 3MJXA 2KM4A 5HWXA 2AW6A 3HRAA 1H6PA 1YQ3A 2VQET 4HRLA 4GU5A 5L3EB 3CKBA 3L9TA 2XRZA 4YY3T 3PUVF 3UUMA 3ESKA 4BEPA 2DHRA 4AY5A 3O1HA 4LF9T 3TWTA 5LA6E 3DSUA 4YDEA 2Q9QC 3BG0B 3I0OA 1L0VA 4ZXLA 1PC2A 2H88A 4EQFA 4LF7T 1UG3A 3IKOB 2YOEA 2XEHA 2X67A 1IJ5A 3A8YC 2JABA 4QXCB 3PNLB 4I50E 4DMWA 4HORA 4ISTA 4B8AA 4PJMA 1TNOA 3JC6C 4C91A 1B89A 3LJCA 3AXJB 3LY7A 1MX6A 2BF0X 1IXVA 2BKOA 2CPTA 4AKGA 2BG9C 4YVQC 1SZAA 5FQ6A 3Q9NC 2KXPB 3AG2E 5HCMA 4QHOA 5G04C 1KNRA 3AB3B 5FKYA 4YVOA 2JRKA 2A3DA 4RG9A 2K24A 2ODUA 1HE8A 2BS3A 3RRWA 4DV2T 3RIBA 4CDNA 3R84B 4AY6A 4NIQA 1NP7A 4F3VA 4U0ZA 4JI7T 5AQJB 2YDRA 4P09A 4IL4A 1WYCA 4NXMT 4JYAT 2I9CA 5AJLA 1N95A 5CRUA 2KC7A 1FPPA 4ILHB 3ZMSB 2NC9A 4UUCA 1E8XA 1SVXA 1KZPA 4WW0A 1TEZA 2DZNA 4N5QA 3AU4A 3UTKA 3QC1A 3PZ2A 2ETBA 4ILBA 3UU5A 2P9PG 3ULEG 3T8KA 2ACXA 4Q69A 1XDPA 1I6ZA 2D0TA 2LHRA 2J49A 2XQ6A 1IJ6A 1VDYA 1ELWA 5AIJA 3AS8A 4GYRA 2KWIB 4TWHA 3W15B 3EDTB 4B3ST 5HXCA 4NPPA 3NB2A 2BBHA 1W09A 2WXJA 4M3OA 4ERRA 4AP2A 1H7CA 4O4IE 1RW2A 2KCKA 2ILRA 4NURA 2WY2A 5ABFA 1G3NB 5LG4A 2Z6EA 5T4YA 5AQRB 2LRLA 3N9LA 5KJLA 1KPSB 3FDHA 3LVRE 4WNKA 1NA0A 4F53A 3HDXA 3UM2A 1QQEA 2H7VC 2EHOD 3RPUA 5AQOB 3CGHA 4BETA 1LD7A 4F1PA 2XPIA 1MIWA 3IBEA 3UXGA 3PVLA 2BG9E 4FJYA 5ENNA 3C98A 4KT6B 4GYOA 5FZRA 3CK7A 3K3NA 3LK2B 2VURA 2A5UA 2V5QC 4PJNA 2PG8A 3PUJA 5AQFB 4EYUA 5C2YA 3UT8A 2XPZA 2E9XC 5JQGE 4DV0T 3IHYA 4I43A 1SZ9A 3UTMA 2X6FA 3RH3A 3FH8A 3ONKA 5JREA 5CHEE 2KSRA 3U4TA 2BUGA 4BJNA 4L2LA 1G8XA 4HLEA 4UXNB 3PZ3A 1IBKT 2DWKA 5LFAA 4XKCA 1ZB1A 2XHEA 4UWFA 3FHNA 3PURA 4IREA 3JQ0A 4U74A 1MQSA 5FXZA 2MYOA 2X6KA 4BY6A 5CEDB 2ZXWE 2D2SA 4IDZA 4IYPA 2K3WA 2WXIA 3ZXSA 2X68A 3B7RL 5L3GB 1PAQA 1IQUA 4PNIA 3UFGA 4ZFHA 2ZM2A 4LMLA 4GA0A 2CG2A 5JDGA 2YKSA 3UU6A 2WM9A 3GN5B 3ZC0A 3JXIA 2XQ9A 4I6GA 4Y6CA 4ANVA 5H6QB 5C8YE 1TNBA 3DTOA 3QC9A 4RG6A 3BQIA 3QOFA 4NIKA 4NUVA 1KFYA 2FJAA 2LHNA 3QNKA 3B7UX 1SE7A 3DPYA 3UQ4A 4EECA 1FVHA 2J08A 1ZP0A 4B3RT 5ENOD 2LSJA 5AQUB 3ZCJA 2C0SA 4M1PA 3IV0A 3IEGA 1KNZA 5KBAA 5KWDA 4CYMD 4DI4A 1QLBA 1JPLA 3G2VA 1OEDB 4LFCT 4CZZB 3L3PA 4DX6D 3CIRA 3TLVA 3DPDA 3RIFA 4WWNA 2IMLA 4JHJA 2KCLA 3RRMB 3HVEB 5AQGB 3C72A 2NTYA 1ZU2A 3AEFA 3FUFA 4PUCA 1QNFA 1YKEB 4I4TE 3LS8A 3UPVA 4G8LA 1H2UA 3S7FA 3MYVA 2XAFB 5AAOA 1K1BA 3AA6B 3FZMB 5B1AE 5HWYA 3QWWA 2Y69E 4IHJE 3S4UA 2NR4A 4AV7A 5LBMA 1FT2A 4HFCA 2BZBA 3DXKG 1HF8A 4QXHB 4AVXA 3N71A 3ZC1A 3E08A 3OPCA 2M6IA 4HOTA 4JI2T 2QZAA 3R7RA 2EHOC 3NOGD 4XAXB 4IDPA 2X38A 3CIAA 3B57A 2V0PA 4XI9A 1S70B 2Y8DA 3AE4A 1W0BA 4JLEA 4I0UA 5CA1E 1MMNA 2YNQA 3UFEA 1E8ZA 3AG1E 4CI2B 4UQXA 3CHRA 2UXXB 4GCNA 3AAEB 4XZ4A 2L0TB 3HXEA 4GTSA 3D9MA 2FF4A 3APFA 3AAAB 1Z0PA 2L8KA 2ZU6B 4HFDA 1DCEA 4JHRA 2I1JA 1IHBA 1KK7A 4CDMA 4ZZCA 4D10C 5A7DB 3P50A 3AS5A 3HXBA 4IRUA 4PDXA 3RO2A 5BV0A 2LAIA 2RP4A 2LM2A 5HEUA 3FUEA 3QARA 1M62A 3HIZA 4GKJT 3CVYA 3OXGA 4QKNA 2XJ7A 1WYBA 2R05A 3FU0A 4E85A 4C0EA 3ZVVA 4UI9K 5LX8A 3FZFB 2PZIA 3SFXA 4DUIA 4G1TA 5AQAA 1U2VG 3KV5A 3D9IA 4DUZT 2KMFA 4N2QA 1O5MA 3KDSE 3JAEA 3VR8A 2XZTG 4O2BE 3FZHB 3KINB 2HR2A 1X81A 1N4SA 4TUYE 3ZYKA 3ASFA 2JQKA 4X8QA 3CVUA 3E34A 2KXPC 1IHGA 2UY1B 3CHSA 5AQQB 1QYMA 5AJDA 2J07A 5ABGA 4X20E 3CVQA 2HN2A 4PAGA 2MTQA 3X1DA 4JHKA 2M6BA 4APFA 2B1EA 1R8IA 2IOSA 2WDVA 3PUWF 3H3MA 2V7MA 3HXDA 4TNWA 4JA9A 3RIUA 3UQ3A 1OXZA 2WB2A 3CQGB 4QH1A 4UF0B 5G55A 5DABA 4EPZA 3KBTA 4HFHA 1S64A 3H37A 2JQHA 3HL6A 3IA3A 2ETCA 4U8HA 4JEUA 1TR4A 4BX8A 3F2EA 4J0UA 3C64A 5JR9A 3HXCA 5HEJA 3J5QB 2DVWA 3PZ1A 4MS6A 3W9FA 4HI8A 5L3DB 2RG8A 3QB2A 2WXFA 3S7DA 3ISMC 1G73A 2W67A 4QX8B 2H6IA 2WXOA 2XRYA 4PK6A 4ILIA 4HLLA 4YTPA 2ZIRA 4FHJA 3D9KA 4DR5T 3N2GE 3FULA 1E1HB 1K8KG 2Y4UA 3V5UA 2LSKA 5DJQC 4KZCA 3EDUA 5JH7E 3FP3A 4QWNB 2J4DA 3ZYLA 1OCRE 2X9XA 4GPKA 3JCKC 5HEGA 4ZI7E 1TYQG 2NWBA 5L3FB 4QH5A 1IBLT 3PJAJ 2XZEA 3D9NA 4E7SA 3MKRA 3N9PA 3LK42 3PUQA 5CJ5A 5EX3A 3RKOA 2CFUA 4FJZA 2ZISA 4O60A 2IIUA 4DV4T 1NZNA 3VLFA 3IXEA 2ZM0A 4LF8T 3NZQA 1QZ2A 4GZCA 5JMND 5L3BB 5LGUB 4HVBA 4ATGA 2UXDT 2IC6A 1UK5A 4LMKA 1XMOT 2J8SD 2OV8A 3TAXA 2WPVA 2IJGX 3QKYA 4AQYT 4OAVB 4I2ZA 4N78D 2XASB 4EV6A 3TJPA 1NENA 3QAQA 3FU6A 5AQTB 2Y4TA 4GA2A 1FEWA 3ZLIA 1MNDA 3SS1A 3UQ7A 3VR9A 1N52A 1TJFA 2VGXA 4FJOA 3PUZF 5KJKA 2CFZA 3Q73A 4X66T 5FL1A 2M63A 4LRZA 1S35A 4FC8A 1YD8G 1BI8B 3PEVB 2LOSA 4TXQA 5JTGA 1KT0A 2VTBA 4A97A 5ENQD 1EF1C 1U3DA 2WXMA 4PJLA 3TXNA 2BVMA 1H19A 2W0GA 4ISSA 3ZEFA 5ABFB 5FIOA 2YU2A 5FT9A 2V6YB 2V7JA 4X1IE 4ILGA 4I9EA 3DSWA 5LB7B 5FXWA 3UMVA 3RJVA 5CEAA 2Y3AA 3TLWA 4BX9A 1DNPA 5LCWJ 3SBSA 4ZI2D 3KVBA 1KEYA 3CVWA 3RRCA 4L9PA 3JC6D 1FMWA 1H6OA 4P0BA 5HKPA 1MHQA 3T8MA 1D0YA 2XQAA 3OYZA 2CBIA 3FTUA 4WNFA 3FBLA 1XWMA 2OEVA 2VSXE 5E75A 4YT0A 1N94A 3EUHA 1FCHA 2AWIA 3CR3A 5ABEA 3TKLB 3EJNA 4C48B 1OEDC 4J2CA 4DLQA 2FBNA 4GTQA 4I43B 2JEKA 2ZGGA 3ASGA 3EU9A 2KBXA 4I55E 3HKEE 5J90A 4UR9A 3QUJA 1E7VA 4DV5T 4K0RA 2CE7A 3G2UA 4ZEYA 2B6CA 5AQIB 4AKLA 2XHEB 2XQYA 4DV1T 3HKBE 3RU0A 2NYJA 1W9RA 1O1TA 2YN6A 2HPLA 4F6RD 5FQ8A 3K9IA 4U8YD 2WXKA 4YSYA 4G24A 3C4WA 3UT7A 2C2LA 1MMAA 3UI2A 2X0YA 1N34T 4IN3B 4N2SA 2R5SA 2LKGA 2W63A 1UGOA 1NWMX 4LG6A 5CMWA 3EHNA 2CWOA 4MBQA 1NL4A 4DJAA 4DX1A 2D0UA 3OTOT 2W4XA 4X1KE 5L4EA 4H63V 4N39A 4WNEA 1ZKEA 3FHEA 5KJMA 3CVXA 2GGFA 3QB5A 2QYWA 1OWAA 4GCOA 1HH8A 2PFVA 3MZLB 4HWHA 4GTVA 2MPKA 3AECA 5LHGB 1B7TA 3ASDA 2XENA 1HZ4A 2WXRA 3AEGA 5D0QD 3RSEG 3FEYA 1UW4B 3CK6A 3P2BA 2MAWA 4KMCA 5FY7A 2KZTA 2GW1A 4BWRA 3RIAA 3TWUA 2LUHA 4DR6T 5HS0A 4OVVA 2VL0A 5FXVA 2JJ9A 3E30A 2WDQA 5AFUL 1JWFA 2X6IA 4U7YA 4LFBT 3H3AA 1IYGA 4AQFA 1WM5A 5J2TE 5KXJA 1X5BA 3AAAC 3VU7H 3PNTB 3APCA 4O6FA 2WQ7A 2XQ8A 5FZQA 2WZIA 3NBNB 2EIKE 3FU3A 4FU3A 2WB5A 2IF4A 3ABLE 1OEDE 2XGOA 4N5CA 3UINC 1UUSA 3EHZA 3K3OA 4CGWA 3MGBA 2E9XD 4DV6T 4A1SA 2D9DA 4FLHA 5J08A 3ZIMA 2K5BB 3NZSA 4HGAA 2WXPA 3NBXX 2WU2A 4FA6A 2GRQB 1GW6A 4TX5A 4GOUA 4ILAA 3ANWA 2XS8A 4WBNE 2BS2A 3F31A 4XKBA 4HE8A 3AE2A 1T98A 4V1Av 3TWRA 3ZSSA 3KAEA 3JQ1A 5LCWC 4ZI2C 4JVSA 2CRBA 4NUUA 3GZ2A 4EZ4A 3PUAA 4ZS3A 2DI4A 2LXLA 3ZSTA 4XBFB 4GTRA 2WVIA 3FY4A 2XAJB 3ETUA 4AQGA 1S63A 4NACA 3TGOA 3N9QA 3VTXA 3P4SA 2X66A 3F6QA 3N2KE 3BG1B 4MBGA 1U5PA 1WRDA 5CBNA 3JAFA 2F8YA 3RYIE 5C1DA 4CQIA 2CHOA 2BKNA 1DVPA 3KBUA 1XNRT 3EAMA 1ZBPA 2RFMA 3SZ7A 1E7PA 2CA5A 3C51A 3E32A 4JA7A 4XI0A 2OV9A 3LYAA 1TJCA 3BQKA 3N5LA 2JPFA 3L54A 4AXHA 2JQ9A 3PE4A 3UUXA 2P9SG 2W61A 4PFOA 3OXFA 1JUQA 1VCSA 4O2AE 1H6KA 2XGMA 4KVOA 4A55A 2XSBA 4YJ2E 2DZOA 3ZUVB 4QFVA 3RO3A 4CN1A 2NW7A 3EHMA 5T3RA 4P1NA 4GTTA 4AIFA 3LFMA 4F6RC 3R9MA 2UXBT 4WYVA 4DNDA 5AQSB 1HX8A 5AARA 3PE3A 3ZT7A 4PK4A 2J9QA 3SOLA 2A2FX 5HXRA 4TWFA 2PBIA 4DRXE 5EIBE 4L1BA 4IGUA 3SO8A 3RYFE 1OCCE 1J5WA 3LBXA 5DQVA 1W3BA 2LAHA 3HXFA 1HS6A 2KZ7B 3MK7C 3BU8A 1CHUA 3PDNA 4TZ4C 5ITZF 4HOUA 1QBQA 2WAUA 5CB4E 3ZHEB 3CHOA 1VCTA 2JLBA 4O1PA 1NAFA 3JYSA 3ZNGA 2UUAT 3EIQC 2BBJA 5JVDE 3LDZA 5JRCA 4JL0A 2VSNA 2AE9A 4WWPA 3OKQA 4P0AA 3SFYA 2Y48B 2NW9A 3FUDA 4PS8A 2IO2C 3ONJA 1BR1A 4E7ZA 4U72A 2PJQA 4OX9T 3PDYA 2RKKA 2R02A 1JNRA 4BESA 3I4RB 2GRPB 1S0PA 4LF5T 2N1GA 4A98A 1LD8A 4BFRA 2UWJG 4QXBB 5IY5E 3T1YT 2FJDA 2VSYA 3LSVA 2AXDS 1XGWA 4YFSA 2BDEA 3KV6A 2VQ2A 5M72A 4LERA 3R7QA 3ZKRA 1JWGA 2BTDA 4HFBA 1J5ET 2E2AA 5JR9B 4G2VA 3GWHA 3N2OA 1N33T 4WNDA 4ABNA 4ATZD 3HHMA 4AISA 4PK5A 2YHEA 1NEKA 3L22A 2HE0A 2OVBA 2I1KA 1Y6IA 2CBJA 2X3MA 5KDMC 4JI0T 3P4PA 4U07A 2W66A 5J1GA 4CEMA 5BV1A 1FVFA 2LLYA 4GMLA 4L2YA 3QWVA 2V8SE 3FTXA 2WQ6A 2E5VA 4LCTA 2LJLA 2GRRB 1HNXT 3UX4A 4JI8T 5LP0A 4HNAD 2IU1A 4K0KT 1S94A 1NI1A 1XNQT 4JZYA 4PS3A 5LMUT 2RFAA 3DEPA 4DI3A 3EABA 3L39A 1LRZA 3EHRA 4I17A 3Q5EA 3D9HA 4F1SA 2XQ3A 4G8KA 2L6JA 2EHOA 4RVBA 1N4RA 3Q5DA 3ZFWA 3J5PA 1X9BA 4GPMA 4GKKT 1OY3D 3A5XA 1OCOE 1DCQA 3NRYA 2IDOB 4LNUD 1MMGA 5F8PA 4DR7T 4JEHA 3QNUA 3FB2A 4Z8XA 3KV9A 4HTEA 4A3VA 1D8EA 4OYJA 4Z90A 1SA5A 3P1UA 3EHQA 3R9AB 5KJNA 4ZHQE 1YYHA 2WS3A 4CXYA 3I0QA 4YTMA 3UULA 4KBMB 1OWPA 2IOLA 2GRMA 3CK8A 2CHNA 3CX8B 2CXFA 3EU5A 3EUVA 5AYWD 3R6NA 4PFPA 2VTBB 5ADXL 3SGHA 2QRXA 4G26A 5AQLB 4U63A 2DCPA 3Q5MA 3BUAA 2PM7A 3P4WA 2IO3C 2XM2A 3L8RA 4EZKA 2OA5A 3ULYA 4ME2A 3ZEFB 4KX6A 2OVFA 1BI7B 4EEBA 4QQIA 3ZKJA 1N0QA 3PE0A 4URKA 2F37A 4KI0F 2L0IA 3U3WA 2HPJA 1D8DA 3FTYA 3ONLA 3SD5A 3B7TA 1I94T 3AAIA 2W2UA 5HQ8A 3DJBA 2C5IT 3AE1A 1JNZA 4OYSA 3KEZA 3AXJA 1PY1A 2V1DB 2Y1LE 3PU8A 4HI9A 3G06A 4GAAA 2JMHA 3AG4E 3SNXA 3I9WA 4FHKA 3T8OA 2DCFA 2R17C 4KVMA 2KNDA 5HEHA 5LMNT 3P4QA 1BPOA 5AQHB 5LYJE 3FUMA 5AENA 2XZDG 4UVAB 1T7SA 4DBQA 3TL5A 2P9LG 2HYZA 3NKZA 3ZT5A 3D9PA 4K0UA 4MALA 3WAKA 3ZT6A 4O1OA 2ACZA 4MLKA 3PU3A 2V5CA 1E8WA 2DYSE 2MHKA 1HXIA 2XPKA 4I1OB 4UWHA 1HS7A 3ZMVB 5JHBA 2CCQA 4ANJA 3M3ZB 3CSFA 5JDLA 3PUGA 3WI3A 4OHFA 1YKHB 4CN6A 4K5AB 2JMKA 1BD8A 1M7KA 4ZOLE 3OTNA 4DR2T 3U9WA 5HI7A 3TG4A 2F4VT 5EILA 1BR0A 2D5UA 2LOPA 2NP9A 2K48A 2I6HA 4U96D 3CKDA 1Q2ZA 4GYYA 3C3OA 3P7IA 3RKVA 5CGMA 4FP7A 5AQ9A 2V4HC 1INZA 3LKUA 2ES0A 4DV7T 3D3MA 3KS2A 1LF8A 4TNVA 2A5EA 1YCSB 2FO7A 4BSZB 4HWDA 5EK4A 3D9JA 5KCMA 2IAKA 2KZTB 5BMVE 3AE5A 3JUIA 3FZLB 2CHXA 4OYKA 4C9BB 3NZPA 4YDOA 2AXUA 3AVRA 3SQVA 2JIWA 4BTAA 4KUMB 5FINA 5FP3A 2ZMAA 4GTMA 3LK3B 4DK5A 5ARFA 4GTPA 3LY9A 3MZKB 4LF6T 2HO1A 3CVNA 4BTBA 3OYXA 4W9RA 4JB8P 1IKND 2N9DA 4EEDA 4H9PC 3L13A 2MYSA 2R59A 3DWLG 1IQRA 5JJ6A 3FTWA 3OBVE 3B13A 4AKRB 5BUZA 4U0SA 5DBKA 4ADZA 4IT4A 3RYCE 5ENRD 3IHVA 3ZPOA 4CT0A 2SPCA 4DV3T 3SI5A 4A1GA 2XQ4A 1D1AA 3AA0B 4E6HA 4TUUA 2P9NG 3DSXA 1AWCB 4U33A 3B7SA 4OAUC 4DX2A 1TN6A 4ACLA 5GONE 3AEDA 3N9NA 3CQXC 4YXDA 5JDHA 3Q9UC 2DWGA 1WFDA 2IFUA 2L3LA 4B3TT 2HM8A 3ZN1B 4H7XA 1HTJF 4G25A 5LBQB 1JCQA 4U7EB 3F57A 1K3ZD 3BQOA 3FUKA 1JCRA 3ETVA 4TWDA 3DRAA 3TLSA 3G2WA 4WBOA 3QOUA 4TV9E 2M67A 2UUBT 4DR4T 2EQXA 4IE0A 2YINA 1AJ3A 2A4ZA 3RIUC 1MMDA 3MX3A 3FH5A 3N9OA 1US7B 3HI2A 3T5XA 3P4RA 2CG3A 4X64T 5HRYA 3A7MA 3O1JA 2H3RA 3AE9A 1MJ0A 3Q2MA 3AEAA 5L4HA 2CHWA 4YDYA 3TWXA 4U2ZA 5JR9C 5LJMA 3MKQA 3CEQA 3UIPC 2VSOE 3IF8B 3O9XA 4A3TA 2NTXA 4YJ3E 1MX2A 2X9WA 4TV8E 3PUSA 2W62A 3AVSA 4WUYA 3LBXB 4CI3B 2CM0A 2LSYA 2WU5A 4KHZF 3AE8A 3E33A 4X62T 4EBAA 5FJYA 2XEVA 5EN5D 2WP9A 5FVKA 2VQFT 1VRBA 3RC3A 4UVBB 3I5PA 3WXXA 3L17A 3EVYA 2AVPA 3FUIA 2J1DG 1U3CA 1XZYA 3UT4A 5EKQD 4IIJE 4AKIA 1D9SA 4F7AA 3K8PC 2XAHB 3Q5WA 5FWQA 5JRCB 3SFEA 3PJAA 2X9HA 2E8IA 1KNPA 3O4XE 2HH7A 3JADA 2DWZA 2E5LT 4LUNU 2LSUA 3M65A 3RRUA 1QUUA 3AG3E 2J47A 3ZRHA 4R7LA 2V4LA 4J8YA 3NZUA 4EB6E 2YEVC 3C98B 2MOZA 3V79K 3AE6A 4DX7D 2IHR1 3E37A 3ESLA 5L2LA 5HAXA 5EYPF 1A5EA 4CN4A 4BJMA 3V5SA 1MX4A 4HFVA 3MJWA 4DPRA 4XZCA 4ACKA 3ZXPA 2X6HA 4I1AA 4AM9A 2W00A 2OOEA 3HKCE 2L9BA 4J7WA 5BXOA 2BKKB 4KMOA 5CRVA 4HFEA 4UIGA 4CXWA 3DSVA 5LXTE 2X9YA 2E2EA 4XIFA 3UM0A 2UXNB 4FLBA 3LEWA 1L5JA 5G04J 5KMGP 1BU9A 4A63B 5H7PA 4B6XA 5HXEA 4EZHA 5FXXA 3UUNA 2QFCA 1JCSA 4Q96A 3CLJA 2VJ8A 3TWWA 3O48A 1O3XA 4CZ2D 2VB6A 1H2TC 2WXHA 1V55E 3QK0A 4N3AA 1WDYA 2WMOA 4XEIG 2PQNA 2Q9QA 4FULA 3WG7E 2WZHA 2YHCA 5LGTB 5EX0A 1WR6A 2VWAA 3CV0A 3ZYQA 3G2SA 2MRIA 3CQCB 4GK5E 5LP6E 2V5FA 4PS7A 4V3IA 2V7KA 5B3SE 3I3NA 1YQ4A 2GRNB 2CXDA 2V6XA 1OWOA 3LXUX 2LO6A 5EYLA 1XNFA 3ULQA 2LRKA 3APDA 3VHLA 4EZJA 4HWIB 3SRZA 4FADA 2YDSA 4K5BA 4U7IA 1TN8A 2BG9A 2BVLA 3U66A 3N9MA 3Q15A 2UY1A 1EPUA 4WNGA 4X5TA 3CVRA 3PH0C 3MKDA 4JI4T 2WXGA 4HEAA 2NSZA 5CECB 5FYMA 3CMLA 3VLDA 4UQZA 4CRWA 3Q5XA 1TNYA 3HYMB 1FIOA 4GB9A 3JCFA 3VKGA 1WAO1 4UF0A 3GZSA 1OWNA 4JW1A 5CMYA 2X6JA 3P8CD 1OCZE 4ZHBA 5JHAA 3T5VA 4OVUA 3C4ZA 3Q79A 2V7LA 5KNGA 3ZU7B 5BNWA 5FY1A 2QC9A 4UV9B 1TNUA 3PUKA 5BPPA 2DBAA 5EIDA 3UKRG 4HFIA 3RQWA 2XPYA 5ANRA 5TAOA 3SF4A 2KLQA 1V9DA 1UN8A 2QVAA 4HXIA 4KYOB 2KT9A 2DIWA 2WQHA 3C3QA 4MRUA
chains in the Genus database with same CATH topology
3ZW3A 4HKAA 4BAYB 3KV4A 1KLXA 4ASKA 4TRQA 4I6EA 4PW8A 1WLXA 4GMJA 1U4QA 4H9NC 2WXLA 5JJTA 4G2AA 1MIYA 5LJNA 2MBGA 2C0LA 2ZLYA 2WXQA 5LGNB 4AQFC 3L16A 4L0RA 4EAHA 3FTZA 2XUEA 1HU3A 4YNDA 4JXTA 4B0ZA 2LM9A 3MCXA 5LNKA 4HOQA 3GMIA 4EBAG 2Q7FA 5G05J 1YW0A 2XCCA 4CCAA 1ZV4X 2E9XA 3EIJA 1A17A 4YHJA 1UX4A 3QK6A 2CLYB 5CA0E 3CKCA 3NF1A 5CCMA 2WWUA 1UJJA 3I4GA 1D1CA 4O4HE 2X0LB 2PM6A 3CHQA 1E8YA 2KCVA 2XGSA 5A6CA 5H6RB 3ZGQA 2C5JA 4AOFA 4OK0A 2DLRA 2JQQA 4H9QC 3CX7B 2NXPA 4BA9A 5HXHA 3CVVA 3AU5A 2XAGB 5M4YA 2DNXA 1OWMA 4AJWA 3EDVA 2AXVA 3DP7A 2K9AA 5F3JA 2V7IA 4UV8B 3KVAA 3CSTA 3ZPJA 3U64A 2I2OA 4JEUB 4GZ6A 2YU1A 3MA9A 4MHCA 3MXZA 5E0OA 1NA3A 3PEUB 4RSYA 3I9YA 3BEEA 2N2NA 3AS4A 2IONA 5DQWA 3GZ1A 4UVCB 5FZSA 5D0OD 3PZDA 2ONDA 2NW8A 2RA1A 3LCAA 5LOZA 4GZ3A 4J8FA 2LSGA 3PRZA 3E22E 4O8SA 2Y6XA 5BW8C 4XX5A 2PL2A 3LJ3A 4H9OC 4GZ5A 1E7UA 2XTLA 2VKJA 2H7OA 1Z6TA 4CGVA 3BQLA 3CVLA 3FUHA 3U78A 4I9CA 4UQYA 3QWPA 3FBZA 3Q47B 3D9LA 1P5QA 5EK3A 2P9BA 3SBTB 3ZJ1A 2VK9A 5G05C 3LPZA 3RK6A 3CX6B 3MA5A 4GYSA 1SA0E 2CXLA 2MOWA 2VGXB 4IE7A 3IBPA 1UN9A 4PH4B 1UJKA 4APOA 3QDNA 2WBLA 4DO0A 3MKQB 3RX6A 3ZYMA 4ILUA 4IULA 5FNVE 2IC9A 5FQ7A 2KATA 3ZN0B 4JPSA 1ELKA 1Z3XA 4JUYA 2VYIA 5EK2A 3ENEA 1ELRA 4MKTA 1UCUA 3OJAA 4C90A 3URZA 5DIZA 4I2WA 4H9SE 4EYYR 3WAJA 4WWOA 4GA1A 5IYZE 3FEXA 4EOZB 1OWLA 5BT1A 3MACA 5HYAA 2KWHA 2VGYA 3HA4A 4GK0E 3FH7A 5G2NA 4L23A 3RRNB 4CDRA 2LEHA 5KX5E 5FY0A 4TN7B 4H7YA 4KP3C 5L3CB 2WXNA 3AA1B 3CHPA 1QSDA 5LHIB 4GYWA 4EXTA 2XAQB 2VKHA 4HFGA 4UI9J 2WSSV 3LVQE 2FULA 2C5KT 5LHHB 2RD0A 3VKHA 4DLOA 3OAWA 2QY7A 2CWYA 2J09A 3UT5E 2NOXA 3IEEA 3HKDE 2G0UA 4BT9A 5ANLA 4B8CB 3FTVA 3G2TA 2VL8A 1BR4A 1HFAA 2GK9A 2ODVA 4H9RC 2YQ8A 3HR0A 2Q9QB 1N54A 3K3QC 3VTYA 3TXMA 3L09A 3FFLA 1UX5A 3FUJA 4I1MA 1ZEEA 3ZHEA 3ZN3A 4B94A 2J4BA 4J8DA 3ASHA 3ZMUB 3DBSA 2E0IA 4NQ0A 1IAPA 1Y64B 4N3BA 3ONXA 4P29A 4L7TA 4TV3A 1HG5A 1WY6A 1D0ZA 2VASA 3ML9A 4H63H 4HOSA 4WAFA 4EZLA 3NQPA 3KFWX 3O1IA 3OXLA 4KXKB 4UWGA 5A23A 4G23A 3S2AA 4UWLA 2CLYC 3ANWB 4Q94A 4CXXA 4O4JE 4OFZA 4ZI3D 1VOMA 4CI1B 3MV2B 2IW5B 4LEUA 2P58C 3SFZA 5LOVE 4GZDA 2LSIA 5EDSA 2QA7A 1SHZC 3L6AA 3I1AA 3MV3B 3IHRA 2AXZA 4O4LE 5ETWA 1MNEA 4K03A 2I59A 4HS2A 3GN5A 4BT8A 2V26A 2ZM8A 3D9OA 2C0MA 3AA7B 3ML8A 3ZJ2A 1IZNB 3UUXB 1E96B 3GA8A 4IE6A 4UI9C 1LVFA 1EDUA 1HO8A 2LE8A 4DBRA 2YK0A 1SQMA 2IQCA 4U0UA 1D1BA 2KINB 5T8IA 5FTPA 4ANUA 3BK9A 1YA0A 4UWKA 3C50A 4YLHA 3L08A 4L9IA 5JDNA 3GYZA 4MFRA 3E0ZA 2FI7A 2E9XB 5J2UE 1LVKA 1D0XA 3SWHA 3HVEA 4MLPA 3E4BA 4EIWA 4HN9A 3ZMTB 3CK9A 3D0TA 1E90A 4Y6WA 1Z3YA 5JDFA 3S7BA 3PS6A 1EYHA 5ARGA 3J7Yq 2WMNA 3NRXA 4AEZC 1Y8MA 3Q49B 3FXDB 4L5GA 2FEZA 3J9X1 3QJZA 4C0MA 3LY8A 1CUNA 4AKHA 1EZ3A 2PQRA 4ANWA 2Q9QD 4ANXA 4B89A 3CWZB 3VLEA 4IE4A 3RC8A 2XCBA 1OUVA 2VKOA 4QX7B 3FWVA 3TG5A 5HXSA 4DVDA 3GW4A 1H0AA 4ZS2A 3CVPA 3CPZA 2LSVA 2CMRA 1HCIA 4UEMA 1FMVA 5A1LA 4ZI3C 2LNIA 4X1YE 4A56A 4UELA 1H2VC 2LT3A 3C4XA 5JJ7A 3S7JA 5EZYE 4U04A 3MEKA 4G63A 5CCLA 3O4ZA 2CHZA 1X79A 4XE0A 4J8SA 1MIVA 1BR2A 3KD7A 4AI6A 3SHFA 5IHYA 4J6IA 4DMVA 1LKXA 5FQ4A 2VKDA 3RYHE 2QGSA 3FU5A 1HG2A 3CHMA 3ZCIA 4J8EA 3LG7A 5LCYA 4CT4A 3PTRB 3FXEB 4PJJA 2GRLA 4N3CA 2X51A 3Q9DA 5JDMA 2A72A 4G11A 4AXPA 2EHOB 4KBQA 2XQ0A 4KZ0A 2L9QA 3Q4AB 4NRHB 1ZHCA 2CEAA 5FMNA 4IE5A 4JC8A 3FTSA 4I6JA 4BSXA 5JDQA 3PREA 3U3IA 1KT1A 3FUNA 4JEHB 5E76A 4GIWA 3ZMZB 4FI5A 3MJXA 2KM4A 5HWXA 2AW6A 4GU5A 5L3EB 3CKBA 2XRZA 3UUMA 3ESKA 2DHRA 4AY5A 3O1HA 5LA6E 2Q9QC 3BG0B 3I0OA 1PC2A 4EQFA 1UG3A 3IKOB 2X67A 1IJ5A 4QXCB 3PNLB 4I50E 4DMWA 4HORA 4ISTA 4B8AA 4PJMA 3JC6C 4C91A 1B89A 3LJCA 3LY7A 2BF0X 4AKGA 4YVQC 1SZAA 5FQ6A 2KXPB 4QHOA 5G04C 3AB3B 4YVOA 2JRKA 2A3DA 4RG9A 2K24A 2ODUA 1HE8A 3RRWA 3RIBA 4CDNA 3R84B 4AY6A 1NP7A 4F3VA 4U0ZA 4P09A 1WYCA 2I9CA 5AJLA 2KC7A 4ILHB 3ZMSB 2NC9A 1E8XA 4WW0A 1TEZA 3AU4A 3UTKA 3QC1A 2ACXA 4Q69A 2D0TA 2LHRA 2J49A 1IJ6A 1VDYA 1ELWA 5AIJA 3AS8A 4GYRA 2KWIB 3W15B 3EDTB 5HXCA 4M3OA 2WXJA 4ERRA 4AP2A 1H7CA 4O4IE 2KCKA 2ILRA 4NURA 5LG4A 2Z6EA 5T4YA 3N9LA 5KJLA 3FDHA 3LVRE 4WNKA 1NA0A 4F53A 3HDXA 1QQEA 2H7VC 2EHOD 3RPUA 3CGHA 2XPIA 1MIWA 3IBEA 3PVLA 5ENNA 4FJYA 3C98A 4KT6B 4GYOA 5FZRA 3CK7A 3K3NA 3LK2B 2A5UA 4PJNA 2PG8A 3PUJA 4EYUA 5C2YA 3UT8A 2XPZA 2E9XC 5JQGE 3IHYA 4I43A 1SZ9A 2X6FA 3RH3A 3FH8A 3ONKA 5JREA 5CHEE 3U4TA 2BUGA 4BJNA 4L2LA 1G8XA 4HLEA 4UXNB 2DWKA 5LFAA 4XKCA 2XHEA 4UWFA 3FHNA 3PURA 3JQ0A 4U74A 1MQSA 5FXZA 2X6KA 4BY6A 2D2SA 4IDZA 4IYPA 2WXIA 3ZXSA 2X68A 3B7RL 5L3GB 1PAQA 1IQUA 4PNIA 2ZM2A 4GA0A 2CG2A 5JDGA 2WM9A 3GN5B 3ZC0A 4I6GA 4Y6CA 4ANVA 5H6QB 5C8YE 3DTOA 3QC9A 4RG6A 3BQIA 4NUVA 2LHNA 3QNKA 3B7UX 4EECA 1FVHA 2J08A 2LSJA 3ZCJA 2C0SA 4M1PA 3IV0A 3IEGA 1KNZA 4DI4A 1JPLA 3G2VA 4CZZB 3L3PA 3DPDA 4WWNA 4JHJA 2KCLA 3RRMB 3HVEB 2NTYA 1ZU2A 3FUFA 4PUCA 1QNFA 1YKEB 4I4TE 3LS8A 3UPVA 1H2UA 3S7FA 3MYVA 2XAFB 3AA6B 5HWYA 3QWWA 4IHJE 3S4UA 4AV7A 5LBMA 2BZBA 1HF8A 4QXHB 4AVXA 3N71A 3ZC1A 3E08A 4HOTA 3R7RA 2EHOC 4XAXB 2X38A 3CIAA 3B57A 2V0PA 4XI9A 2Y8DA 4JLEA 5CA1E 1MMNA 2YNQA 3UFEA 1E8ZA 4CI2B 4UQXA 3CHRA 2UXXB 4GCNA 3AAEB 4XZ4A 2L0TB 3D9MA 2FF4A 3APFA 3AAAB 1Z0PA 2L8KA 2ZU6B 4JHRA 2I1JA 1KK7A 4CDMA 4D10C 5A7DB 3AS5A 4IRUA 4PDXA 3RO2A 5BV0A 2LAIA 2RP4A 3FUEA 3QARA 3HIZA 3CVYA 3OXGA 4QKNA 1WYBA 3FU0A 4E85A 4C0EA 3ZVVA 4UI9K 5LX8A 2PZIA 4G1TA 3KV5A 3D9IA 2KMFA 4N2QA 3KDSE 4O2BE 3KINB 2HR2A 4TUYE 3ZYKA 3ASFA 3CVUA 1IHGA 2UY1B 3CHSA 5AJDA 2J07A 4X20E 3CVQA 4PAGA 2MTQA 4JHKA 4APFA 2B1EA 2IOSA 2V7MA 4JA9A 3UQ3A 1OXZA 2WB2A 3CQGB 4UF0B 5G55A 5DABA 4EPZA 3KBTA 3H37A 3HL6A 4U8HA 4JEUA 4BX8A 3F2EA 4J0UA 3C64A 5JR9A 4MS6A 5L3DB 2RG8A 3QB2A 2WXFA 3S7DA 1G73A 2WXOA 4QX8B 2XRYA 4PK6A 4ILIA 4FHJA 3D9KA 3N2GE 3FULA 1E1HB 2Y4UA 3V5UA 2LSKA 5DJQC 4KZCA 3EDUA 5JH7E 3FP3A 4QWNB 2J4DA 3ZYLA 2X9XA 4GPKA 3JCKC 4ZI7E 2NWBA 5L3FB 3D9NA 4E7SA 3MKRA 3N9PA 3LK42 3PUQA 5EX3A 3RKOA 2CFUA 4FJZA 1NZNA 3VLFA 2ZM0A 3NZQA 1QZ2A 4GZCA 5L3BB 5LGUB 4HVBA 4ATGA 2IC6A 2OV8A 3TAXA 2WPVA 2IJGX 3QKYA 4I2ZA 4N78D 2XASB 3TJPA 3QAQA 3FU6A 2Y4TA 4GA2A 1FEWA 3ZLIA 1MNDA 3SS1A 1N52A 1TJFA 2VGXA 4FJOA 5KJKA 2CFZA 2M63A 4LRZA 1S35A 4FC8A 1YD8G 3PEVB 2LOSA 1KT0A 2VTBA 1EF1C 1U3DA 2WXMA 4PJLA 3TXNA 2BVMA 1H19A 2W0GA 4ISSA 3ZEFA 2YU2A 5FT9A 2V7JA 4X1IE 4ILGA 4I9EA 5FXWA 3UMVA 3RJVA 2Y3AA 4BX9A 1DNPA 5LCWJ 3SBSA 4ZI2D 3KVBA 3CVWA 3RRCA 3JC6D 1FMWA 4P0BA 1MHQA 3T8MA 1D0YA 3OYZA 3FTUA 4WNFA 3FBLA 2VSXE 5E75A 3EUHA 1FCHA 2AWIA 3CR3A 3TKLB 3EJNA 4J2CA 4DLQA 2FBNA 4I43B 2JEKA 3ASGA 4I55E 3HKEE 5J90A 3QUJA 1E7VA 4K0RA 2CE7A 3G2UA 4AKLA 2XHEB 2XQYA 3HKBE 3RU0A 2HPLA 5FQ8A 3K9IA 2WXKA 4G24A 3C4WA 3UT7A 2C2LA 1MMAA 4IN3B 4N2SA 2R5SA 2W63A 1NWMX 5CMWA 3EHNA 2CWOA 4MBQA 4DJAA 2D0UA 4X1KE 4H63V 4N39A 4WNEA 1ZKEA 3FHEA 5KJMA 3CVXA 2GGFA 1OWAA 4GCOA 1HH8A 2PFVA 3MZLB 5LHGB 1B7TA 3ASDA 1HZ4A 2WXRA 5D0QD 3FEYA 1UW4B 3P2BA 4KMCA 5FY7A 2KZTA 2GW1A 4BWRA 4OVVA 5FXVA 2JJ9A 5AFUL 1JWFA 2X6IA 3H3AA 1IYGA 4AQFA 1WM5A 5J2TE 1X5BA 3VU7H 3PNTB 3APCA 4O6FA 2WQ7A 5FZQA 3FU3A 4FU3A 2IF4A 2XGOA 4N5CA 3K3OA 4CGWA 3MGBA 2E9XD 4A1SA 4FLHA 5J08A 3ZIMA 2K5BB 3NZSA 4HGAA 2WXPA 3NBXX 4FA6A 1GW6A 4TX5A 4GOUA 4XKBA 3ANWA 4WBNE 3F31A 4HE8A 1T98A 4V1Av 3KAEA 3JQ1A 5LCWC 4ZI2C 4JVSA 4NUUA 3GZ2A 4EZ4A 3PUAA 4ZS3A 2DI4A 4XBFB 2WVIA 3FY4A 2XAJB 3ETUA 4AQGA 4NACA 3TGOA 3N9QA 3VTXA 2X66A 3N2KE 3BG1B 1U5PA 1WRDA 3RYIE 5C1DA 4CQIA 1DVPA 3KBUA 1ZBPA 3SZ7A 2CA5A 3C51A 4JA7A 4XI0A 3LYAA 1TJCA 3BQKA 3N5LA 2JPFA 3L54A 4AXHA 3PE4A 3UUXA 2W61A 4PFOA 3OXFA 1JUQA 4O2AE 1H6KA 2XGMA 4KVOA 4A55A 4YJ2E 4QFVA 3RO3A 2NW7A 3EHMA 5T3RA 4AIFA 3LFMA 4F6RC 4DNDA 1HX8A 3PE3A 4PK4A 2J9QA 3SOLA 2A2FX 5HXRA 2PBIA 4L1BA 4IGUA 3RYFE 3LBXA 5DQVA 1W3BA 2LAHA 1HS6A 2KZ7B 3MK7C 3PDNA 4TZ4C 4HOUA 3ZHEB 2WAUA 5CB4E 3CHOA 2JLBA 1NAFA 3JYSA 3EIQC 5JVDE 3LDZA 5JRCA 4JL0A 2VSNA 4WWPA 3OKQA 4P0AA 2Y48B 2NW9A 3FUDA 4PS8A 1BR1A 4E7ZA 4U72A 2PJQA 3PDYA 3I4RB 1S0PA 2N1GA 4BFRA 2UWJG 4QXBB 2VSYA 1XGWA 4YFSA 2BDEA 3KV6A 2VQ2A 5M72A 4LERA 3R7QA 1JWGA 2BTDA 5JR9B 4G2VA 3GWHA 3N2OA 4WNDA 4ABNA 3HHMA 4PK5A 2YHEA 3L22A 2OVBA 2I1KA 1Y6IA 2X3MA 5KDMC 4U07A 5J1GA 4CEMA 5BV1A 1FVFA 4GMLA 4L2YA 3QWVA 2V8SE 3FTXA 2WQ6A 4LCTA 2LJLA 3UX4A 5LP0A 2IU1A 1S94A 4JZYA 4PS3A 4DI3A 1LRZA 4I17A 4F1SA 2L6JA 2EHOA 4RVBA 3ZFWA 3A5XA 3NRYA 1MMGA 5F8PA 4JEHA 3FB2A 4Z8XA 3KV9A 4HTEA 4A3VA 4OYJA 3P1UA 3R9AB 5KJNA 4ZHQE 4CXYA 3I0QA 3UULA 4KBMB 1OWPA 2IOLA 2GRMA 3CK8A 3CX8B 2CXFA 5AYWD 3R6NA 4PFPA 2VTBB 5ADXL 3SGHA 4G26A 4U63A 2DCPA 3Q5MA 2PM7A 4EZKA 2OA5A 4ME2A 3ZEFB 2OVFA 4URKA 3PE0A 2L0IA 3U3WA 2HPJA 3FTYA 3ONLA 3SD5A 3B7TA 3AAIA 5HQ8A 3DJBA 2C5IT 4OYSA 3KEZA 1PY1A 2V1DB 3PU8A 4GAAA 2JMHA 3SNXA 3I9WA 4FHKA 3T8OA 2DCFA 2R17C 4KVMA 2KNDA 1BPOA 5LYJE 3FUMA 5AENA 4UVAB 4DBQA 3TL5A 2HYZA 3D9PA 4K0UA 4MALA 3WAKA 4MLKA 3PU3A 1E8WA 2MHKA 1HXIA 4I1OB 4UWHA 1HS7A 3ZMVB 5JHBA 2CCQA 4ANJA 3CSFA 5JDLA 3PUGA 3WI3A 4OHFA 1YKHB 2JMKA 4ZOLE 3OTNA 3U9WA 5HI7A 3TG4A 1BR0A 2D5UA 2LOPA 2NP9A 2K48A 2I6HA 3CKDA 4GYYA 3P7IA 3RKVA 4FP7A 1INZA 3LKUA 2ES0A 3D3MA 3KS2A 1LF8A 2FO7A 5EK4A 3D9JA 5KCMA 2IAKA 2KZTB 5BMVE 3JUIA 2CHXA 4OYKA 4C9BB 3NZPA 2AXUA 3AVRA 4BTAA 4KUMB 5FP3A 2ZMAA 4DK5A 3LK3B 5ARFA 3LY9A 3MZKB 2HO1A 3CVNA 4BTBA 3OYXA 4W9RA 2N9DA 4H9PC 3L13A 2MYSA 2R59A 1IQRA 5JJ6A 3FTWA 3OBVE 3B13A 4AKRB 5BUZA 4U0SA 5DBKA 4ADZA 3RYCE 3IHVA 3ZPOA 4CT0A 2SPCA 3SI5A 4A1GA 1D1AA 3AA0B 4E6HA 4TUUA 3B7SA 4ACLA 5GONE 3N9NA 3CQXC 5JDHA 2DWGA 2IFUA 4H7XA 2L3LA 2HM8A 3ZN1B 1HTJF 4G25A 5LBQB 3F57A 3FUKA 3ETVA 3G2WA 4WBOA 3QOUA 4TV9E 2M67A 2EQXA 4IE0A 2YINA 1AJ3A 2A4ZA 1MMDA 3MX3A 3FH5A 3N9OA 1US7B 3HI2A 3T5XA 2CG3A 3O1JA 2H3RA 3Q2MA 2CHWA 5JR9C 5LJMA 3MKQA 3CEQA 2VSOE 3IF8B 3O9XA 4A3TA 2NTXA 4YJ3E 2X9WA 4TV8E 3PUSA 2W62A 3AVSA 4WUYA 3LBXB 4CI3B 2CM0A 2LSYA 4EBAA 5FJYA 2XEVA 1VRBA 3RC3A 4UVBB 3I5PA 3WXXA 3L17A 3EVYA 2AVPA 3FUIA 2J1DG 1U3CA 3UT4A 5EKQD 4IIJE 4AKIA 4F7AA 3K8PC 2XAHB 3Q5WA 5FWQA 5JRCB 2X9HA 2E8IA 3O4XE 2HH7A 4LUNU 2LSUA 3M65A 3RRUA 1QUUA 3ZRHA 4R7LA 2V4LA 3NZUA 4EB6E 2YEVC 3C98B 2MOZA 3ESLA 5L2LA 5HAXA 4BJMA 3V5SA 4HFVA 3MJWA 4DPRA 4XZCA 4ACKA 2X6HA 4I1AA 4AM9A 2W00A 2OOEA 3HKCE 2L9BA 4KMOA 4UIGA 4CXWA 5LXTE 2X9YA 2E2EA 4XIFA 2UXNB 4FLBA 3LEWA 1L5JA 5G04J 5KMGP 4B6XA 5HXEA 4EZHA 5FXXA 3UUNA 2QFCA 4Q96A 3CLJA 2VJ8A 3O48A 1O3XA 2VB6A 1H2TC 2WXHA 3QK0A 4N3AA 2WMOA 2PQNA 2Q9QA 4FULA 2YHCA 5LGTB 5EX0A 1WR6A 2VWAA 3CV0A 3ZYQA 3G2SA 2MRIA 3CQCB 4GK5E 5LP6E 2V5FA 4PS7A 4V3IA 2V7KA 3I3NA 2CXDA 1OWOA 3LXUX 2LO6A 1XNFA 3ULQA 4EZJA 3APDA 3VHLA 3SRZA 4FADA 2BVLA 3U66A 3N9MA 3Q15A 2UY1A 1EPUA 4WNGA 3CVRA 3PH0C 3MKDA 2WXGA 4HEAA 2NSZA 5FYMA 3CMLA 3VLDA 4UQZA 4CRWA 3Q5XA 4GB9A 3HYMB 1FIOA 3VKGA 1WAO1 4UF0A 3GZSA 1OWNA 4JW1A 5CMYA 2X6JA 3P8CD 5JHAA 3T5VA 4OVUA 3C4ZA 5BNWA 2V7LA 5FY1A 3PUKA 4UV9B 5BPPA 2DBAA 2XPYA 5ANRA 5TAOA 3SF4A 2KLQA 1V9DA 1UN8A 4HXIA 4KYOB 2KT9A 2DIWA 2WQHA 4MRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHQ A;  3D9I A;  3ONL A;  3D9J A;  1EDU A;  1SZA A;  2V8S E;  4HFG A;  3D9L A;  3RRU A;  1JWF A;  3G2T A;  1HF8 A;  1DVP A;  1ELK A;  1HFA A;  3D9K A;  5CMW A;  5CMY A;  4AVX A;  1UJJ A;  4FLB A;  4JXT A;  2DCP A;  3D9P A;  5LP0 A;  1HX8 A;  1X5B A;  4GZC A;  3ZYQ A;  3G2S A;  1HG2 A;  1EYH A;  1XGW A;  3ZYK A;  1SZ9 A;  1PY1 A;  2MOW A;  2L0T B;  2QY7 A;  3LDZ A;  3ZYL A;  3ONK A;  4FU3 A;  3G2W A;  4Q96 A;  1UJK A;  3D9M A;  4Q94 A;  1HG5 A;  3CLJ A;  1VDY A;  1INZ A;  3ZYM A;  2LO6 A;  1JWG A;  1JUQ A;  3D9O A;  5LOZ A;  3D9N A;  2BF0 X;  1H0A A;  4NAC A;  1LF8 A;  2L0I A;  3G2U A;  5J08 A;  2DIW A;  4GZD A;  2KM4 A;  1JPL A;  3G2V A; 
#chains in the Genus database with same CATH topology
 2VVN A;  3ZW3 A;  4HKA A;  4BAY B;  5CBO A;  3KV4 A;  1KLX A;  4ASK A;  4TRQ A;  4I6E A;  1O1S A;  4PW8 A;  1WLX A;  2XSA A;  3NVO A;  4GMJ A;  1U4Q A;  4H9N C;  2WXL A;  5JJT A;  4G2A A;  5D66 A;  1MIY A;  1OT8 A;  3DEO A;  5LJN A;  5AQM B;  2MBG A;  2F0Y A;  2C0L A;  5ENT D;  2ZLY A;  2WXQ A;  4TUM A;  5LGN B;  4AQF C;  1N4P A;  4L0R A;  3L16 A;  4EAH A;  2B76 A;  3FTZ A;  2XUE A;  2YDQ A;  1HU3 A;  4YND A;  4JXT A;  4B0Z A;  2LM9 A;  3KSQ A;  3MCX A;  4U8V D;  2FUP A;  5LNK A;  3NAW A;  4HOQ A;  3GMI A;  4EBA G;  3UM1 A;  2Q7F A;  5AQV B;  5G05 J;  1YW0 A;  3Q78 A;  2XCC A;  4CCA A;  1ZV4 X;  2E9X A;  3EIJ A;  1A17 A;  4YHJ A;  2J62 A;  4DID B;  3LDQ B;  4ILC A;  1UX4 A;  3QK6 A;  3V31 A;  2CLY B;  2B0O E;  5CA0 E;  2F8X K;  1HX1 B;  3CKC A;  3NF1 A;  5CCM A;  3AE7 A;  2DYR E;  2FBW A;  2WWU A;  1UJJ A;  4HRN A;  3I4G A;  3NOC D;  1D1C A;  4O4H E;  3RHW A;  2EIL E;  2X0L B;  2PM6 A;  3CHQ A;  2ETA A;  1E8Y A;  2KCV A;  2XGS A;  1N11 A;  5A6C A;  5H6R B;  3ZGQ A;  2FJE A;  2C5J A;  4AOF A;  3T9K A;  4OK0 A;  2DLR A;  2JQQ A;  4H9Q C;  3CX7 B;  2RPA A;  2NXP A;  4BA9 A;  5HXH A;  3CVV A;  3HG0 D;  4HRM B;  2V6Y A;  2WDR A;  3AU5 A;  2XAG B;  2QYJ A;  5M4Y A;  2DNX A;  1OWM A;  4AJW A;  3EDV A;  2QYU A;  3LJN A;  1BLX B;  3UU4 A;  4HWF A;  2AXV A;  2V5D A;  3DP7 A;  2K9A A;  5F3J A;  3DST A;  3ABM E;  2V7I A;  4UV8 B;  3KVA A;  3CST A;  3PZ4 A;  1XDO A;  3ZPJ A;  5AQP B;  3U64 A;  4IL9 A;  2P9U G;  1KF6 A;  2I2O A;  2XY8 B;  4JEU B;  4GZ6 A;  2YU1 A;  3MA9 A;  2HHH T;  4MHC A;  1T72 A;  3MXZ A;  2LKH A;  5E0O A;  4JD2 G;  1NA3 A;  3PEU B;  2Y0B G;  2AJA A;  4RSY A;  3Q7A A;  3I9Y A;  3BEE A;  2N2N A;  5HCJ A;  3AS4 A;  4HBD A;  3TLT A;  4AIU A;  2ION A;  5DQW A;  2L6B A;  3GZ1 A;  4UVC B;  5FZS A;  5D0O D;  1FJG T;  3PZD A;  2R2L A;  2OND A;  2NW8 A;  2RA1 A;  3FZK B;  3L82 A;  5FL0 A;  2BKP A;  3LCA A;  2V8S V;  2IUB A;  3RGL A;  5D2M C;  5LOZ A;  3TWQ A;  5AQN B;  1DU2 A;  4GZ3 A;  4J8F A;  2LSG A;  3PRZ A;  3SFD A;  3E22 E;  4EGW A;  4O8S A;  2Y6X A;  5BW8 C;  3Q7F A;  4XX5 A;  2PL2 A;  3LJ3 A;  4H9O C;  1MZC A;  4YSX A;  3UM3 A;  3T1H T;  4GZ5 A;  1E7U A;  3SY2 A;  2J4G A;  2XTL A;  2VKJ A;  2H7O A;  1DC2 A;  1Z6T A;  3DXM G;  2P9K G;  4CGV A;  2XQ7 A;  3BQL A;  3CVL A;  3FUH A;  1SUM B;  4U95 D;  2VGE A;  1WG0 A;  3U78 A;  4HB5 A;  4I9C A;  3RLF F;  4UQY A;  3QWP A;  3FBZ A;  4F8H A;  4YTN A;  3Q47 B;  3D9L A;  5CFB A;  1P5Q A;  2BED A;  5EK3 A;  3V30 A;  2P9B A;  3SBT B;  3ZJ1 A;  2VK9 A;  1TNZ A;  5G05 C;  3LPZ A;  5KNH D;  3RK6 A;  4IDN A;  3CX6 B;  4QH4 A;  3MA5 A;  4GYS A;  5AQB A;  1SA0 E;  2CXL A;  5C2T A;  3NWI A;  2MOW A;  2VGX B;  4IE7 A;  3IBP A;  3PV0 F;  4YHH T;  1UN9 A;  4PH4 B;  4Z68 A;  3VRA A;  1UJK A;  2BS4 A;  4APO A;  4COF A;  2WBL A;  4DO0 A;  3MKQ B;  3QDN A;  3RX6 A;  3ZYM A;  4ILU A;  2OCC E;  4IUL A;  5FNV E;  2IC9 A;  5FQ7 A;  2KAT A;  3ZN0 B;  5J0Z A;  4JPS A;  1ELK A;  2P2C P;  1Z3X A;  1HR0 T;  4JUY A;  2VYI A;  5EK2 A;  3ENE A;  1ELR A;  4MKT A;  1UCU A;  4EHM A;  3OJA A;  4C90 A;  3URZ A;  5DIZ A;  4I2W A;  5FVL A;  4EYY R;  4H9S E;  3AEB A;  3RI5 A;  3WAJ A;  1ZOY A;  4WWO A;  4BER A;  4GA1 A;  5BXU A;  5IYZ E;  2H6F A;  3ABK E;  1K1A A;  3FEX A;  3C5R A;  4LMJ A;  1YXR A;  4EOZ B;  1HNZ T;  1OWL A;  5BT1 A;  2FO1 E;  3MAC A;  3TLU A;  2R03 A;  1N4Q A;  5HYA A;  2KWH A;  4Q25 A;  2VGY A;  3HA4 A;  4GK0 E;  3FH7 A;  5G2N A;  4L23 A;  2VVS A;  3RRN B;  4TXP A;  4CDR A;  2LEH A;  5KX5 E;  5FY0 A;  4TN7 B;  4U31 A;  4GTO A;  4H7Y A;  3K1S A;  4KP3 C;  1T8B A;  5L3C B;  2WXN A;  3AA1 B;  3CHP A;  1QSD A;  5C3J A;  5LHI B;  4EXT A;  4GYW A;  2XAQ B;  2VKH A;  4HFG A;  4UI9 J;  4LF4 T;  2WSS V;  1XMQ T;  3LVQ E;  4NXN T;  2FUL A;  5BR8 T;  2C5K T;  5LHH B;  2RD0 A;  3VKH A;  1E2A A;  3OAW A;  4DLO A;  4DX5 D;  2GRO B;  2QY7 A;  2CWY A;  2J09 A;  3TWV A;  3UT5 E;  4Z91 A;  2NOX A;  1N9A A;  3IEE A;  3HKD E;  2G0U A;  4BT9 A;  2R6G F;  5ANL A;  4B8C B;  3FTV A;  2UU9 T;  2VL8 A;  3G2T A;  1BR4 A;  1HFA A;  2GK9 A;  2ODV A;  4H9R C;  2YQ8 A;  3HR0 A;  3RKG A;  2Q9Q B;  4ZZB A;  1N54 A;  3K3Q C;  3VTY A;  3TXM A;  3B5M A;  3KEA A;  3X2Q E;  3L09 A;  3EI0 A;  3FFL A;  1UX5 A;  4IDO A;  1HNW T;  3ASN E;  3FUJ A;  4I1M A;  1ZEE A;  3ONL C;  3ZHE A;  3ZN3 A;  1UUR A;  4B94 A;  3UIO C;  5L47 A;  2J4B A;  4J8D A;  1Z8U A;  2FJB A;  1FT1 A;  3ASH A;  1TN7 A;  3ZMU B;  3DBS A;  2E0I A;  4X65 T;  4NQ0 A;  2XM1 A;  3UKU G;  1LTX A;  1IAP A;  5LG3 A;  1Y64 B;  2LXM A;  4N3B A;  2BG9 B;  3PUY F;  1N32 T;  3ONX A;  4P29 A;  4L7T A;  4U2Y A;  4TV3 A;  2X0H A;  1HG5 A;  1J1J A;  1WY6 A;  1O1R A;  1D0Z A;  4A5X A;  2VAS A;  3C3R A;  3ML9 A;  2PTF A;  4H63 H;  4HOS A;  4WAF A;  4EZL A;  5CER B;  3NQP A;  3KFW X;  3O1I A;  3OXL A;  4KXK B;  4UWG A;  5A23 A;  4G23 A;  3S2A A;  4UWL A;  2CLY C;  4JV5 T;  3ANW B;  3DSS A;  4Q94 A;  4CXX A;  4O4J E;  4OFZ A;  4ZI3 D;  5IUX A;  1VOM A;  4CI1 B;  3V2X A;  5ENP D;  3MV2 B;  3B95 A;  2DL1 A;  2IW5 B;  3PUX F;  2P58 C;  4LEU A;  3SFZ A;  5LOV E;  4GZD A;  2LSI A;  2XQ5 A;  5EDS A;  2QA7 A;  5ENS D;  1SHZ C;  3L6A A;  3ABV A;  2ZM6 T;  3I1A A;  3MV3 B;  3IHR A;  4GMR A;  1MYO A;  1YMP A;  3RAU A;  4K5C A;  2AXZ A;  1SA4 A;  4O4L E;  5ETW A;  1MNE A;  4K03 A;  2HN1 A;  2I59 A;  4HS2 A;  3GN5 A;  4B93 B;  2V26 A;  4BT8 A;  2ZM8 A;  3AE3 A;  3D9O A;  2C0M A;  3AA7 B;  3ML8 A;  3ZJ2 A;  2WCA A;  3ASO E;  1IZN B;  3Q75 A;  3UUX B;  1OXJ A;  4YDW A;  4JI1 T;  1E96 B;  2A9U A;  3GA8 A;  4IE6 A;  2IY0 C;  5ABH A;  4UI9 C;  1LVF A;  1EDU A;  1HO8 A;  5JA4 D;  2LE8 A;  4DBR A;  4LSZ E;  2YK0 A;  4B3M T;  1SQM A;  2IQC A;  4U0U A;  1D1B A;  1SW6 A;  2KIN B;  5T8I A;  5FTP A;  4ANU A;  3BK9 A;  1YA0 A;  4UWK A;  1WR0 A;  3C50 A;  4YLH A;  3L08 A;  4L9I A;  5JDN A;  3GYZ A;  5AQK B;  1OED A;  4MFR A;  3E0Z A;  3OVU A;  2FI7 A;  2E9X B;  3B7B A;  5J2U E;  1LVK A;  1D0X A;  3SWH A;  3HVE A;  4MLP A;  3E4B A;  3KSL A;  3UU8 A;  4EIW A;  4JI3 T;  4HN9 A;  3ZMT B;  2PNN A;  3CK9 A;  3D0T A;  4LNG A;  1E90 A;  4Y6W A;  1Z3Y A;  2EIN E;  5JDF A;  3S7B A;  1N36 T;  3PS6 A;  1EYH A;  5AQ7 A;  5ARG A;  1AP7 A;  2IEJ A;  3J7Y q;  4LNB A;  2WMN A;  3NRX A;  4AEZ C;  3V2O A;  1Y8M A;  3Q49 B;  3FXD B;  4L5G A;  2FEZ A;  3J9X 1;  3QJZ A;  4C0M A;  3UUB A;  5F5W A;  3LY8 A;  1CUN A;  4AKH A;  1EZ3 A;  2PQR A;  4ANW A;  2Q9Q D;  4ANX A;  4B89 A;  3CWZ B;  3VLE A;  4IE4 A;  1KZO A;  2OLT A;  3RC8 A;  1Z5S C;  4LFA T;  2XCB A;  1OUV A;  2VKO A;  4M7C A;  3AEE A;  4QX7 B;  3FWV A;  3TG5 A;  2H6G A;  5HXS A;  4DVD A;  3GW4 A;  3RF1 A;  5B1B E;  1H0A A;  2ZGD A;  2WQY A;  2UUC T;  1V54 E;  2I0M A;  4ZS2 A;  3CVP A;  1UOH A;  4TXR A;  3CPZ A;  2EIJ E;  2LSV A;  2CMR A;  2P9I G;  1GQE A;  1W0A A;  1HCI A;  1N0R A;  2BKG A;  4UEM A;  1RZ4 A;  4HQD A;  1FMV A;  5A1L A;  4ZI3 C;  3VRB A;  2LNI A;  4X1Y E;  4A56 A;  3RQU A;  4UEL A;  1H2V C;  2LT3 A;  3C4X A;  5JJ7 A;  3S7J A;  4DR3 T;  5EZY E;  4U04 A;  3MEK A;  4G63 A;  3QB5 K;  3UU3 A;  5CCL A;  3AJI A;  3O4Z A;  2CHZ A;  1X79 A;  4XE0 A;  5IWA T;  4J8S A;  1MIV A;  1BR2 A;  3JXJ A;  3KD7 A;  4AI6 A;  3SHF A;  5IHY A;  4J6I A;  4DMV A;  1LKX A;  4DUY T;  4JBW F;  4RLY A;  4JI6 T;  5FQ4 A;  2VKD A;  3RYH E;  2QGS A;  4IDQ A;  3FU5 A;  1HG2 A;  5AN8 A;  3CHM A;  3ZCI A;  1WCR A;  2EIM E;  4J8E A;  3LG7 A;  5LCY A;  4DR1 T;  4CT4 A;  3PTR B;  3FXE B;  4PJJ A;  2GRL A;  5HEO A;  4N3C A;  2X51 A;  3Q9D A;  2H6H A;  5JDM A;  2A72 A;  4G11 A;  4AXP A;  3W9G A;  2XS1 A;  3TWS A;  2EHO B;  2XEE A;  4KBQ A;  2XQ0 A;  4KZ0 A;  2L9Q A;  1IBM T;  3Q4A B;  4NRH B;  1ZHC A;  2CEA A;  4U3C A;  4RQI A;  5FMN A;  4IE5 A;  4JC8 A;  3FTS A;  4YSZ A;  4I6J A;  4BSX A;  5JDQ A;  3PRE A;  3U3I A;  4WZX A;  2UXC T;  1KT1 A;  3FUN A;  1Y01 A;  4JEH B;  2WWV A;  5E76 A;  4GIW A;  3ZMZ B;  4KHP T;  1NFI E;  4JI5 T;  4HWC A;  2H89 A;  4FI5 A;  2OEW A;  3JUE A;  3MJX A;  2KM4 A;  5HWX A;  2AW6 A;  3HRA A;  1H6P A;  1YQ3 A;  2VQE T;  4HRL A;  4GU5 A;  5L3E B;  3CKB A;  3L9T A;  2XRZ A;  4YY3 T;  3PUV F;  3UUM A;  3ESK A;  4BEP A;  2DHR A;  4AY5 A;  3O1H A;  4LF9 T;  3TWT A;  5LA6 E;  3DSU A;  4YDE A;  2Q9Q C;  3BG0 B;  3I0O A;  1L0V A;  4ZXL A;  1PC2 A;  2H88 A;  4EQF A;  4LF7 T;  1UG3 A;  3IKO B;  2YOE A;  2XEH A;  2X67 A;  1IJ5 A;  3A8Y C;  2JAB A;  4QXC B;  3PNL B;  4I50 E;  4DMW A;  4HOR A;  4IST A;  4B8A A;  4PJM A;  1TNO A;  3JC6 C;  4C91 A;  1B89 A;  3LJC A;  3AXJ B;  3LY7 A;  1MX6 A;  2BF0 X;  1IXV A;  2BKO A;  2CPT A;  4AKG A;  2BG9 C;  4YVQ C;  1SZA A;  5FQ6 A;  3Q9N C;  2KXP B;  3AG2 E;  5HCM A;  4QHO A;  5G04 C;  1KNR A;  3AB3 B;  5FKY A;  4YVO A;  2JRK A;  2A3D A;  4RG9 A;  2K24 A;  2ODU A;  1HE8 A;  2BS3 A;  3RRW A;  4DV2 T;  3RIB A;  4CDN A;  3R84 B;  4AY6 A;  4NIQ A;  1NP7 A;  4F3V A;  4U0Z A;  4JI7 T;  5AQJ B;  2YDR A;  4P09 A;  4IL4 A;  1WYC A;  4NXM T;  4JYA T;  2I9C A;  5AJL A;  1N95 A;  5CRU A;  2KC7 A;  1FPP A;  4ILH B;  3ZMS B;  2NC9 A;  4UUC A;  1E8X A;  1SVX A;  1KZP A;  4WW0 A;  1TEZ A;  2DZN A;  4N5Q A;  3AU4 A;  3UTK A;  3QC1 A;  3PZ2 A;  2ETB A;  4ILB A;  3UU5 A;  2P9P G;  3ULE G;  3T8K A;  2ACX A;  4Q69 A;  1XDP A;  1I6Z A;  2D0T A;  2LHR A;  2J49 A;  2XQ6 A;  1IJ6 A;  1VDY A;  1ELW A;  5AIJ A;  3AS8 A;  4GYR A;  2KWI B;  4TWH A;  3W15 B;  3EDT B;  4B3S T;  5HXC A;  4NPP A;  3NB2 A;  2BBH A;  1W09 A;  2WXJ A;  4M3O A;  4ERR A;  4AP2 A;  1H7C A;  4O4I E;  1RW2 A;  2KCK A;  2ILR A;  4NUR A;  2WY2 A;  5ABF A;  1G3N B;  5LG4 A;  2Z6E A;  5T4Y A;  5AQR B;  2LRL A;  3N9L A;  5KJL A;  1KPS B;  3FDH A;  3LVR E;  4WNK A;  1NA0 A;  4F53 A;  3HDX A;  3UM2 A;  1QQE A;  2H7V C;  2EHO D;  3RPU A;  5AQO B;  3CGH A;  4BET A;  1LD7 A;  4F1P A;  2XPI A;  1MIW A;  3IBE A;  3UXG A;  3PVL A;  2BG9 E;  4FJY A;  5ENN A;  3C98 A;  4KT6 B;  4GYO A;  5FZR A;  3CK7 A;  3K3N A;  3LK2 B;  2VUR A;  2A5U A;  2V5Q C;  4PJN A;  2PG8 A;  3PUJ A;  5AQF B;  4EYU A;  5C2Y A;  3UT8 A;  2XPZ A;  2E9X C;  5JQG E;  4DV0 T;  3IHY A;  4I43 A;  1SZ9 A;  3UTM A;  2X6F A;  3RH3 A;  3FH8 A;  3ONK A;  5JRE A;  5CHE E;  2KSR A;  3U4T A;  2BUG A;  4BJN A;  4L2L A;  1G8X A;  4HLE A;  4UXN B;  3PZ3 A;  1IBK T;  2DWK A;  5LFA A;  4XKC A;  1ZB1 A;  2XHE A;  4UWF A;  3FHN A;  3PUR A;  4IRE A;  3JQ0 A;  4U74 A;  1MQS A;  5FXZ A;  2MYO A;  2X6K A;  4BY6 A;  5CED B;  2ZXW E;  2D2S A;  4IDZ A;  4IYP A;  2K3W A;  2WXI A;  3ZXS A;  2X68 A;  3B7R L;  5L3G B;  1PAQ A;  1IQU A;  4PNI A;  3UFG A;  4ZFH A;  2ZM2 A;  4LML A;  4GA0 A;  2CG2 A;  5JDG A;  2YKS A;  3UU6 A;  2WM9 A;  3GN5 B;  3ZC0 A;  3JXI A;  2XQ9 A;  4I6G A;  4Y6C A;  4ANV A;  5H6Q B;  5C8Y E;  1TNB A;  3DTO A;  3QC9 A;  4RG6 A;  3BQI A;  3QOF A;  4NIK A;  4NUV A;  1KFY A;  2FJA A;  2LHN A;  3QNK A;  3B7U X;  1SE7 A;  3DPY A;  3UQ4 A;  4EEC A;  1FVH A;  2J08 A;  1ZP0 A;  4B3R T;  5ENO D;  2LSJ A;  5AQU B;  3ZCJ A;  2C0S A;  4M1P A;  3IV0 A;  3IEG A;  1KNZ A;  5KBA A;  5KWD A;  4CYM D;  4DI4 A;  1QLB A;  1JPL A;  3G2V A;  1OED B;  4LFC T;  4CZZ B;  3L3P A;  4DX6 D;  3CIR A;  3TLV A;  3DPD A;  3RIF A;  4WWN A;  2IML A;  4JHJ A;  2KCL A;  3RRM B;  3HVE B;  5AQG B;  3C72 A;  2NTY A;  1ZU2 A;  3AEF A;  3FUF A;  4PUC A;  1QNF A;  1YKE B;  4I4T E;  3LS8 A;  3UPV A;  4G8L A;  1H2U A;  3S7F A;  3MYV A;  2XAF B;  5AAO A;  1K1B A;  3AA6 B;  3FZM B;  5B1A E;  5HWY A;  3QWW A;  2Y69 E;  4IHJ E;  3S4U A;  2NR4 A;  4AV7 A;  5LBM A;  1FT2 A;  4HFC A;  2BZB A;  3DXK G;  1HF8 A;  4QXH B;  4AVX A;  3N71 A;  3ZC1 A;  3E08 A;  3OPC A;  2M6I A;  4HOT A;  4JI2 T;  2QZA A;  3R7R A;  2EHO C;  3NOG D;  4XAX B;  4IDP A;  2X38 A;  3CIA A;  3B57 A;  2V0P A;  4XI9 A;  1S70 B;  2Y8D A;  3AE4 A;  1W0B A;  4JLE A;  4I0U A;  5CA1 E;  1MMN A;  2YNQ A;  3UFE A;  1E8Z A;  3AG1 E;  4CI2 B;  4UQX A;  3CHR A;  2UXX B;  4GCN A;  3AAE B;  4XZ4 A;  2L0T B;  3HXE A;  4GTS A;  3D9M A;  2FF4 A;  3APF A;  3AAA B;  1Z0P A;  2L8K A;  2ZU6 B;  4HFD A;  1DCE A;  4JHR A;  2I1J A;  1IHB A;  1KK7 A;  4CDM A;  4ZZC A;  4D10 C;  5A7D B;  3P50 A;  3AS5 A;  3HXB A;  4IRU A;  4PDX A;  3RO2 A;  5BV0 A;  2LAI A;  2RP4 A;  2LM2 A;  5HEU A;  3FUE A;  3QAR A;  1M62 A;  3HIZ A;  4GKJ T;  3CVY A;  3OXG A;  4QKN A;  2XJ7 A;  1WYB A;  2R05 A;  3FU0 A;  4E85 A;  4C0E A;  3ZVV A;  4UI9 K;  5LX8 A;  3FZF B;  2PZI A;  3SFX A;  4DUI A;  4G1T A;  5AQA A;  1U2V G;  3KV5 A;  3D9I A;  4DUZ T;  2KMF A;  4N2Q A;  1O5M A;  3KDS E;  3JAE A;  3VR8 A;  2XZT G;  4O2B E;  3FZH B;  3KIN B;  2HR2 A;  1X81 A;  1N4S A;  4TUY E;  3ZYK A;  3ASF A;  2JQK A;  4X8Q A;  3CVU A;  3E34 A;  2KXP C;  1IHG A;  2UY1 B;  3CHS A;  5AQQ B;  1QYM A;  5AJD A;  2J07 A;  5ABG A;  4X20 E;  3CVQ A;  2HN2 A;  4PAG A;  2MTQ A;  3X1D A;  4JHK A;  2M6B A;  4APF A;  2B1E A;  1R8I A;  2IOS A;  2WDV A;  3PUW F;  3H3M A;  2V7M A;  3HXD A;  4TNW A;  4JA9 A;  3RIU A;  3UQ3 A;  1OXZ A;  2WB2 A;  3CQG B;  4QH1 A;  4UF0 B;  5G55 A;  5DAB A;  4EPZ A;  3KBT A;  4HFH A;  1S64 A;  3H37 A;  2JQH A;  3HL6 A;  3IA3 A;  2ETC A;  4U8H A;  4JEU A;  1TR4 A;  4BX8 A;  3F2E A;  4J0U A;  3C64 A;  5JR9 A;  3HXC A;  5HEJ A;  3J5Q B;  2DVW A;  3PZ1 A;  4MS6 A;  3W9F A;  4HI8 A;  5L3D B;  2RG8 A;  3QB2 A;  2WXF A;  3S7D A;  3ISM C;  1G73 A;  2W67 A;  4QX8 B;  2H6I A;  2WXO A;  2XRY A;  4PK6 A;  4ILI A;  4HLL A;  4YTP A;  2ZIR A;  4FHJ A;  3D9K A;  4DR5 T;  3N2G E;  3FUL A;  1E1H B;  1K8K G;  2Y4U A;  3V5U A;  2LSK A;  5DJQ C;  4KZC A;  3EDU A;  5JH7 E;  3FP3 A;  4QWN B;  2J4D A;  3ZYL A;  1OCR E;  2X9X A;  4GPK A;  3JCK C;  5HEG A;  4ZI7 E;  1TYQ G;  2NWB A;  5L3F B;  4QH5 A;  1IBL T;  3PJA J;  2XZE A;  3D9N A;  4E7S A;  3MKR A;  3N9P A;  3LK4 2;  3PUQ A;  5CJ5 A;  5EX3 A;  3RKO A;  2CFU A;  4FJZ A;  2ZIS A;  4O60 A;  2IIU A;  4DV4 T;  1NZN A;  3VLF A;  3IXE A;  2ZM0 A;  4LF8 T;  3NZQ A;  1QZ2 A;  4GZC A;  5JMN D;  5L3B B;  5LGU B;  4HVB A;  4ATG A;  2UXD T;  2IC6 A;  1UK5 A;  4LMK A;  1XMO T;  2J8S D;  2OV8 A;  3TAX A;  2WPV A;  2IJG X;  3QKY A;  4AQY T;  4OAV B;  4I2Z A;  4N78 D;  2XAS B;  4EV6 A;  3TJP A;  1NEN A;  3QAQ A;  3FU6 A;  5AQT B;  2Y4T A;  4GA2 A;  1FEW A;  3ZLI A;  1MND A;  3SS1 A;  3UQ7 A;  3VR9 A;  1N52 A;  1TJF A;  2VGX A;  4FJO A;  3PUZ F;  5KJK A;  2CFZ A;  3Q73 A;  4X66 T;  5FL1 A;  2M63 A;  4LRZ A;  1S35 A;  4FC8 A;  1YD8 G;  1BI8 B;  3PEV B;  2LOS A;  4TXQ A;  5JTG A;  1KT0 A;  2VTB A;  4A97 A;  5ENQ D;  1EF1 C;  1U3D A;  2WXM A;  4PJL A;  3TXN A;  2BVM A;  1H19 A;  2W0G A;  4ISS A;  3ZEF A;  5ABF B;  5FIO A;  2YU2 A;  5FT9 A;  2V6Y B;  2V7J A;  4X1I E;  4ILG A;  4I9E A;  3DSW A;  5LB7 B;  5FXW A;  3UMV A;  3RJV A;  5CEA A;  2Y3A A;  3TLW A;  4BX9 A;  1DNP A;  5LCW J;  3SBS A;  4ZI2 D;  3KVB A;  1KEY A;  3CVW A;  3RRC A;  4L9P A;  3JC6 D;  1FMW A;  1H6O A;  4P0B A;  5HKP A;  1MHQ A;  3T8M A;  1D0Y A;  2XQA A;  3OYZ A;  2CBI A;  3FTU A;  4WNF A;  3FBL A;  1XWM A;  2OEV A;  2VSX E;  5E75 A;  4YT0 A;  1N94 A;  3EUH A;  1FCH A;  2AWI A;  3CR3 A;  5ABE A;  3TKL B;  3EJN A;  4C48 B;  1OED C;  4J2C A;  4DLQ A;  2FBN A;  4GTQ A;  4I43 B;  2JEK A;  2ZGG A;  3ASG A;  3EU9 A;  2KBX A;  4I55 E;  3HKE E;  5J90 A;  4UR9 A;  3QUJ A;  1E7V A;  4DV5 T;  4K0R A;  2CE7 A;  3G2U A;  4ZEY A;  2B6C A;  5AQI B;  4AKL A;  2XHE B;  2XQY A;  4DV1 T;  3HKB E;  3RU0 A;  2NYJ A;  1W9R A;  1O1T A;  2YN6 A;  2HPL A;  4F6R D;  5FQ8 A;  3K9I A;  4U8Y D;  2WXK A;  4YSY A;  4G24 A;  3C4W A;  3UT7 A;  2C2L A;  1MMA A;  3UI2 A;  2X0Y A;  1N34 T;  4IN3 B;  4N2S A;  2R5S A;  2LKG A;  2W63 A;  1UGO A;  1NWM X;  4LG6 A;  5CMW A;  3EHN A;  2CWO A;  4MBQ A;  1NL4 A;  4DJA A;  4DX1 A;  2D0U A;  3OTO T;  2W4X A;  4X1K E;  5L4E A;  4H63 V;  4N39 A;  4WNE A;  1ZKE A;  3FHE A;  5KJM A;  3CVX A;  2GGF A;  3QB5 A;  2QYW A;  1OWA A;  4GCO A;  1HH8 A;  2PFV A;  3MZL B;  4HWH A;  4GTV A;  2MPK A;  3AEC A;  5LHG B;  1B7T A;  3ASD A;  2XEN A;  1HZ4 A;  2WXR A;  3AEG A;  5D0Q D;  3RSE G;  3FEY A;  1UW4 B;  3CK6 A;  3P2B A;  2MAW A;  4KMC A;  5FY7 A;  2KZT A;  2GW1 A;  4BWR A;  3RIA A;  3TWU A;  2LUH A;  4DR6 T;  5HS0 A;  4OVV A;  2VL0 A;  5FXV A;  2JJ9 A;  3E30 A;  2WDQ A;  5AFU L;  1JWF A;  2X6I A;  4U7Y A;  4LFB T;  3H3A A;  1IYG A;  4AQF A;  1WM5 A;  5J2T E;  5KXJ A;  1X5B A;  3AAA C;  3VU7 H;  3PNT B;  3APC A;  4O6F A;  2WQ7 A;  2XQ8 A;  5FZQ A;  2WZI A;  3NBN B;  2EIK E;  3FU3 A;  4FU3 A;  2WB5 A;  2IF4 A;  3ABL E;  1OED E;  2XGO A;  4N5C A;  3UIN C;  1UUS A;  3EHZ A;  3K3O A;  4CGW A;  3MGB A;  2E9X D;  4DV6 T;  4A1S A;  2D9D A;  4FLH A;  5J08 A;  3ZIM A;  2K5B B;  3NZS A;  4HGA A;  2WXP A;  3NBX X;  2WU2 A;  4FA6 A;  2GRQ B;  1GW6 A;  4TX5 A;  4GOU A;  4ILA A;  3ANW A;  2XS8 A;  4WBN E;  2BS2 A;  3F31 A;  4XKB A;  4HE8 A;  3AE2 A;  1T98 A;  4V1A v;  3TWR A;  3ZSS A;  3KAE A;  3JQ1 A;  5LCW C;  4ZI2 C;  4JVS A;  2CRB A;  4NUU A;  3GZ2 A;  4EZ4 A;  3PUA A;  4ZS3 A;  2DI4 A;  2LXL A;  3ZST A;  4XBF B;  4GTR A;  2WVI A;  3FY4 A;  2XAJ B;  3ETU A;  4AQG A;  1S63 A;  4NAC A;  3TGO A;  3N9Q A;  3VTX A;  3P4S A;  2X66 A;  3F6Q A;  3N2K E;  3BG1 B;  4MBG A;  1U5P A;  1WRD A;  5CBN A;  3JAF A;  2F8Y A;  3RYI E;  5C1D A;  4CQI A;  2CHO A;  2BKN A;  1DVP A;  3KBU A;  1XNR T;  3EAM A;  1ZBP A;  2RFM A;  3SZ7 A;  1E7P A;  2CA5 A;  3C51 A;  3E32 A;  4JA7 A;  4XI0 A;  2OV9 A;  3LYA A;  1TJC A;  3BQK A;  3N5L A;  2JPF A;  3L54 A;  4AXH A;  2JQ9 A;  3PE4 A;  3UUX A;  2P9S G;  2W61 A;  4PFO A;  3OXF A;  1JUQ A;  1VCS A;  4O2A E;  1H6K A;  2XGM A;  4KVO A;  4A55 A;  2XSB A;  4YJ2 E;  2DZO A;  3ZUV B;  4QFV A;  3RO3 A;  4CN1 A;  2NW7 A;  3EHM A;  5T3R A;  4P1N A;  4GTT A;  4AIF A;  3LFM A;  4F6R C;  3R9M A;  2UXB T;  4WYV A;  4DND A;  5AQS B;  1HX8 A;  5AAR A;  3PE3 A;  3ZT7 A;  4PK4 A;  2J9Q A;  3SOL A;  2A2F X;  5HXR A;  4TWF A;  2PBI A;  4DRX E;  5EIB E;  4L1B A;  4IGU A;  3SO8 A;  3RYF E;  1OCC E;  1J5W A;  3LBX A;  5DQV A;  1W3B A;  2LAH A;  3HXF A;  1HS6 A;  2KZ7 B;  3MK7 C;  3BU8 A;  1CHU A;  3PDN A;  4TZ4 C;  5ITZ F;  4HOU A;  1QBQ A;  2WAU A;  5CB4 E;  3ZHE B;  3CHO A;  1VCT A;  2JLB A;  4O1P A;  1NAF A;  3JYS A;  3ZNG A;  2UUA T;  3EIQ C;  2BBJ A;  5JVD E;  3LDZ A;  5JRC A;  4JL0 A;  2VSN A;  2AE9 A;  4WWP A;  3OKQ A;  4P0A A;  3SFY A;  2Y48 B;  2NW9 A;  3FUD A;  4PS8 A;  2IO2 C;  3ONJ A;  1BR1 A;  4E7Z A;  4U72 A;  2PJQ A;  4OX9 T;  3PDY A;  2RKK A;  2R02 A;  1JNR A;  4BES A;  3I4R B;  2GRP B;  1S0P A;  4LF5 T;  2N1G A;  4A98 A;  1LD8 A;  4BFR A;  2UWJ G;  4QXB B;  5IY5 E;  3T1Y T;  2FJD A;  2VSY A;  3LSV A;  2AXD S;  1XGW A;  4YFS A;  2BDE A;  3KV6 A;  2VQ2 A;  5M72 A;  4LER A;  3R7Q A;  3ZKR A;  1JWG A;  2BTD A;  4HFB A;  1J5E T;  2E2A A;  5JR9 B;  4G2V A;  3GWH A;  3N2O A;  1N33 T;  4WND A;  4ABN A;  4ATZ D;  3HHM A;  4AIS A;  4PK5 A;  2YHE A;  1NEK A;  3L22 A;  2HE0 A;  2OVB A;  2I1K A;  1Y6I A;  2CBJ A;  2X3M A;  5KDM C;  4JI0 T;  3P4P A;  4U07 A;  2W66 A;  5J1G A;  4CEM A;  5BV1 A;  1FVF A;  2LLY A;  4GML A;  4L2Y A;  3QWV A;  2V8S E;  3FTX A;  2WQ6 A;  2E5V A;  4LCT A;  2LJL A;  2GRR B;  1HNX T;  3UX4 A;  4JI8 T;  5LP0 A;  4HNA D;  2IU1 A;  4K0K T;  1S94 A;  1NI1 A;  1XNQ T;  4JZY A;  4PS3 A;  5LMU T;  2RFA A;  3DEP A;  4DI3 A;  3EAB A;  3L39 A;  1LRZ A;  3EHR A;  4I17 A;  3Q5E A;  3D9H A;  4F1S A;  2XQ3 A;  4G8K A;  2L6J A;  2EHO A;  4RVB A;  1N4R A;  3Q5D A;  3ZFW A;  3J5P A;  1X9B A;  4GPM A;  4GKK T;  1OY3 D;  3A5X A;  1OCO E;  1DCQ A;  3NRY A;  2IDO B;  4LNU D;  1MMG A;  5F8P A;  4DR7 T;  4JEH A;  3QNU A;  3FB2 A;  4Z8X A;  3KV9 A;  4HTE A;  4A3V A;  1D8E A;  4OYJ A;  4Z90 A;  1SA5 A;  3P1U A;  3EHQ A;  3R9A B;  5KJN A;  4ZHQ E;  1YYH A;  2WS3 A;  4CXY A;  3I0Q A;  4YTM A;  3UUL A;  4KBM B;  1OWP A;  2IOL A;  2GRM A;  3CK8 A;  2CHN A;  3CX8 B;  2CXF A;  3EU5 A;  3EUV A;  5AYW D;  3R6N A;  4PFP A;  2VTB B;  5ADX L;  3SGH A;  2QRX A;  4G26 A;  5AQL B;  4U63 A;  2DCP A;  3Q5M A;  3BUA A;  2PM7 A;  3P4W A;  2IO3 C;  2XM2 A;  3L8R A;  4EZK A;  2OA5 A;  3ULY A;  4ME2 A;  3ZEF B;  4KX6 A;  2OVF A;  1BI7 B;  4EEB A;  4QQI A;  3ZKJ A;  1N0Q A;  3PE0 A;  4URK A;  2F37 A;  4KI0 F;  2L0I A;  3U3W A;  2HPJ A;  1D8D A;  3FTY A;  3ONL A;  3SD5 A;  3B7T A;  1I94 T;  3AAI A;  2W2U A;  5HQ8 A;  3DJB A;  2C5I T;  3AE1 A;  1JNZ A;  4OYS A;  3KEZ A;  3AXJ A;  1PY1 A;  2V1D B;  2Y1L E;  3PU8 A;  4HI9 A;  3G06 A;  4GAA A;  2JMH A;  3AG4 E;  3SNX A;  3I9W A;  4FHK A;  3T8O A;  2DCF A;  2R17 C;  4KVM A;  2KND A;  5HEH A;  5LMN T;  3P4Q A;  1BPO A;  5AQH B;  5LYJ E;  3FUM A;  5AEN A;  2XZD G;  4UVA B;  1T7S A;  4DBQ A;  3TL5 A;  2P9L G;  2HYZ A;  3NKZ A;  3ZT5 A;  3D9P A;  4K0U A;  4MAL A;  3WAK A;  3ZT6 A;  4O1O A;  2ACZ A;  4MLK A;  3PU3 A;  2V5C A;  1E8W A;  2DYS E;  2MHK A;  1HXI A;  2XPK A;  4I1O B;  4UWH A;  1HS7 A;  3ZMV B;  5JHB A;  2CCQ A;  4ANJ A;  3M3Z B;  3CSF A;  5JDL A;  3PUG A;  3WI3 A;  4OHF A;  1YKH B;  4CN6 A;  4K5A B;  2JMK A;  1BD8 A;  1M7K A;  4ZOL E;  3OTN A;  4DR2 T;  3U9W A;  5HI7 A;  3TG4 A;  2F4V T;  5EIL A;  1BR0 A;  2D5U A;  2LOP A;  2NP9 A;  2K48 A;  2I6H A;  4U96 D;  3CKD A;  1Q2Z A;  4GYY A;  3C3O A;  3P7I A;  3RKV A;  5CGM A;  4FP7 A;  5AQ9 A;  2V4H C;  1INZ A;  3LKU A;  2ES0 A;  4DV7 T;  3D3M A;  3KS2 A;  1LF8 A;  4TNV A;  2A5E A;  1YCS B;  2FO7 A;  4BSZ B;  4HWD A;  5EK4 A;  3D9J A;  5KCM A;  2IAK A;  2KZT B;  5BMV E;  3AE5 A;  3JUI A;  3FZL B;  2CHX A;  4OYK A;  4C9B B;  3NZP A;  4YDO A;  2AXU A;  3AVR A;  3SQV A;  2JIW A;  4BTA A;  4KUM B;  5FIN A;  5FP3 A;  2ZMA A;  4GTM A;  3LK3 B;  4DK5 A;  5ARF A;  4GTP A;  3LY9 A;  3MZK B;  4LF6 T;  2HO1 A;  3CVN A;  4BTB A;  3OYX A;  4W9R A;  4JB8 P;  1IKN D;  2N9D A;  4EED A;  4H9P C;  3L13 A;  2MYS A;  2R59 A;  3DWL G;  1IQR A;  5JJ6 A;  3FTW A;  3OBV E;  3B13 A;  4AKR B;  5BUZ A;  4U0S A;  5DBK A;  4ADZ A;  4IT4 A;  3RYC E;  5ENR D;  3IHV A;  3ZPO A;  4CT0 A;  2SPC A;  4DV3 T;  3SI5 A;  4A1G A;  2XQ4 A;  1D1A A;  3AA0 B;  4E6H A;  4TUU A;  2P9N G;  3DSX A;  1AWC B;  4U33 A;  3B7S A;  4OAU C;  4DX2 A;  1TN6 A;  4ACL A;  5GON E;  3AED A;  3N9N A;  3CQX C;  4YXD A;  5JDH A;  3Q9U C;  2DWG A;  1WFD A;  2IFU A;  2L3L A;  4B3T T;  2HM8 A;  3ZN1 B;  4H7X A;  1HTJ F;  4G25 A;  5LBQ B;  1JCQ A;  4U7E B;  3F57 A;  1K3Z D;  3BQO A;  3FUK A;  1JCR A;  3ETV A;  4TWD A;  3DRA A;  3TLS A;  3G2W A;  4WBO A;  3QOU A;  4TV9 E;  2M67 A;  2UUB T;  4DR4 T;  2EQX A;  4IE0 A;  2YIN A;  1AJ3 A;  2A4Z A;  3RIU C;  1MMD A;  3MX3 A;  3FH5 A;  3N9O A;  1US7 B;  3HI2 A;  3T5X A;  3P4R A;  2CG3 A;  4X64 T;  5HRY A;  3A7M A;  3O1J A;  2H3R A;  3AE9 A;  1MJ0 A;  3Q2M A;  3AEA A;  5L4H A;  2CHW A;  4YDY A;  3TWX A;  4U2Z A;  5JR9 C;  5LJM A;  3MKQ A;  3CEQ A;  3UIP C;  2VSO E;  3IF8 B;  3O9X A;  4A3T A;  2NTX A;  4YJ3 E;  1MX2 A;  2X9W A;  4TV8 E;  3PUS A;  2W62 A;  3AVS A;  4WUY A;  3LBX B;  4CI3 B;  2CM0 A;  2LSY A;  2WU5 A;  4KHZ F;  3AE8 A;  3E33 A;  4X62 T;  4EBA A;  5FJY A;  2XEV A;  5EN5 D;  2WP9 A;  5FVK A;  2VQF T;  1VRB A;  3RC3 A;  4UVB B;  3I5P A;  3WXX A;  3L17 A;  3EVY A;  2AVP A;  3FUI A;  2J1D G;  1U3C A;  1XZY A;  3UT4 A;  5EKQ D;  4IIJ E;  4AKI A;  1D9S A;  4F7A A;  3K8P C;  2XAH B;  3Q5W A;  5FWQ A;  5JRC B;  3SFE A;  3PJA A;  2X9H A;  2E8I A;  1KNP A;  3O4X E;  2HH7 A;  3JAD A;  2DWZ A;  2E5L T;  4LUN U;  2LSU A;  3M65 A;  3RRU A;  1QUU A;  3AG3 E;  2J47 A;  3ZRH A;  4R7L A;  2V4L A;  4J8Y A;  3NZU A;  4EB6 E;  2YEV C;  3C98 B;  2MOZ A;  3V79 K;  3AE6 A;  4DX7 D;  2IHR 1;  3E37 A;  3ESL A;  5L2L A;  5HAX A;  5EYP F;  1A5E A;  4CN4 A;  4BJM A;  3V5S A;  1MX4 A;  4HFV A;  3MJW A;  4DPR A;  4XZC A;  4ACK A;  3ZXP A;  2X6H A;  4I1A A;  4AM9 A;  2W00 A;  2OOE A;  3HKC E;  2L9B A;  4J7W A;  5BXO A;  2BKK B;  4KMO A;  5CRV A;  4HFE A;  4UIG A;  4CXW A;  3DSV A;  5LXT E;  2X9Y A;  2E2E A;  4XIF A;  3UM0 A;  2UXN B;  4FLB A;  3LEW A;  1L5J A;  5G04 J;  5KMG P;  1BU9 A;  4A63 B;  5H7P A;  4B6X A;  5HXE A;  4EZH A;  5FXX A;  3UUN A;  2QFC A;  1JCS A;  4Q96 A;  3CLJ A;  2VJ8 A;  3TWW A;  3O48 A;  1O3X A;  4CZ2 D;  2VB6 A;  1H2T C;  2WXH A;  1V55 E;  3QK0 A;  4N3A A;  1WDY A;  2WMO A;  4XEI G;  2PQN A;  2Q9Q A;  4FUL A;  3WG7 E;  2WZH A;  2YHC A;  5LGT B;  5EX0 A;  1WR6 A;  2VWA A;  3CV0 A;  3ZYQ A;  3G2S A;  2MRI A;  3CQC B;  4GK5 E;  5LP6 E;  2V5F A;  4PS7 A;  4V3I A;  2V7K A;  5B3S E;  3I3N A;  1YQ4 A;  2GRN B;  2CXD A;  2V6X A;  1OWO A;  3LXU X;  2LO6 A;  5EYL A;  1XNF A;  3ULQ A;  2LRK A;  3APD A;  3VHL A;  4EZJ A;  4HWI B;  3SRZ A;  4FAD A;  2YDS A;  4K5B A;  4U7I A;  1TN8 A;  2BG9 A;  2BVL A;  3U66 A;  3N9M A;  3Q15 A;  2UY1 A;  1EPU A;  4WNG A;  4X5T A;  3CVR A;  3PH0 C;  3MKD A;  4JI4 T;  2WXG A;  4HEA A;  2NSZ A;  5CEC B;  5FYM A;  3CML A;  3VLD A;  4UQZ A;  4CRW A;  3Q5X A;  1TNY A;  3HYM B;  1FIO A;  4GB9 A;  3JCF A;  3VKG A;  1WAO 1;  4UF0 A;  3GZS A;  1OWN A;  4JW1 A;  5CMY A;  2X6J A;  3P8C D;  1OCZ E;  4ZHB A;  5JHA A;  3T5V A;  4OVU A;  3C4Z A;  3Q79 A;  2V7L A;  5KNG A;  3ZU7 B;  5BNW A;  5FY1 A;  2QC9 A;  4UV9 B;  1TNU A;  3PUK A;  5BPP A;  2DBA A;  5EID A;  3UKR G;  4HFI A;  3RQW A;  2XPY A;  5ANR A;  5TAO A;  3SF4 A;  2KLQ A;  1V9D A;  1UN8 A;  2QVA A;  4HXI A;  4KYO B;  2KT9 A;  2DIW A;  2WQH A;  3C3Q A;  4MRU A; 
#chains in the Genus database with same CATH homology
 3ZW3 A;  4HKA A;  4BAY B;  3KV4 A;  1KLX A;  4ASK A;  4TRQ A;  4I6E A;  4PW8 A;  1WLX A;  4GMJ A;  1U4Q A;  4H9N C;  2WXL A;  5JJT A;  4G2A A;  1MIY A;  5LJN A;  2MBG A;  2C0L A;  2ZLY A;  2WXQ A;  5LGN B;  4AQF C;  3L16 A;  4L0R A;  4EAH A;  3FTZ A;  2XUE A;  1HU3 A;  4YND A;  4JXT A;  4B0Z A;  2LM9 A;  3MCX A;  5LNK A;  4HOQ A;  3GMI A;  4EBA G;  2Q7F A;  5G05 J;  1YW0 A;  2XCC A;  4CCA A;  1ZV4 X;  2E9X A;  3EIJ A;  1A17 A;  4YHJ A;  1UX4 A;  3QK6 A;  2CLY B;  5CA0 E;  3CKC A;  3NF1 A;  5CCM A;  2WWU A;  1UJJ A;  3I4G A;  1D1C A;  4O4H E;  2X0L B;  2PM6 A;  3CHQ A;  1E8Y A;  2KCV A;  2XGS A;  5A6C A;  5H6R B;  3ZGQ A;  2C5J A;  4AOF A;  4OK0 A;  2DLR A;  2JQQ A;  4H9Q C;  3CX7 B;  2NXP A;  4BA9 A;  5HXH A;  3CVV A;  3AU5 A;  2XAG B;  5M4Y A;  2DNX A;  1OWM A;  4AJW A;  3EDV A;  2AXV A;  3DP7 A;  2K9A A;  5F3J A;  2V7I A;  4UV8 B;  3KVA A;  3CST A;  3ZPJ A;  3U64 A;  2I2O A;  4JEU B;  4GZ6 A;  2YU1 A;  3MA9 A;  4MHC A;  3MXZ A;  5E0O A;  1NA3 A;  3PEU B;  4RSY A;  3I9Y A;  3BEE A;  2N2N A;  3AS4 A;  2ION A;  5DQW A;  3GZ1 A;  4UVC B;  5FZS A;  5D0O D;  3PZD A;  2OND A;  2NW8 A;  2RA1 A;  3LCA A;  5LOZ A;  4GZ3 A;  4J8F A;  2LSG A;  3PRZ A;  3E22 E;  4O8S A;  2Y6X A;  5BW8 C;  4XX5 A;  2PL2 A;  3LJ3 A;  4H9O C;  4GZ5 A;  1E7U A;  2XTL A;  2VKJ A;  2H7O A;  1Z6T A;  4CGV A;  3BQL A;  3CVL A;  3FUH A;  3U78 A;  4I9C A;  4UQY A;  3QWP A;  3FBZ A;  3Q47 B;  3D9L A;  1P5Q A;  5EK3 A;  2P9B A;  3SBT B;  3ZJ1 A;  2VK9 A;  5G05 C;  3LPZ A;  3RK6 A;  3CX6 B;  3MA5 A;  4GYS A;  1SA0 E;  2CXL A;  2MOW A;  2VGX B;  4IE7 A;  3IBP A;  1UN9 A;  4PH4 B;  1UJK A;  4APO A;  3QDN A;  2WBL A;  4DO0 A;  3MKQ B;  3RX6 A;  3ZYM A;  4ILU A;  4IUL A;  5FNV E;  2IC9 A;  5FQ7 A;  2KAT A;  3ZN0 B;  4JPS A;  1ELK A;  1Z3X A;  4JUY A;  2VYI A;  5EK2 A;  3ENE A;  1ELR A;  4MKT A;  1UCU A;  3OJA A;  4C90 A;  3URZ A;  5DIZ A;  4I2W A;  4H9S E;  4EYY R;  3WAJ A;  4WWO A;  4GA1 A;  5IYZ E;  3FEX A;  4EOZ B;  1OWL A;  5BT1 A;  3MAC A;  5HYA A;  2KWH A;  2VGY A;  3HA4 A;  4GK0 E;  3FH7 A;  5G2N A;  4L23 A;  3RRN B;  4CDR A;  2LEH A;  5KX5 E;  5FY0 A;  4TN7 B;  4H7Y A;  4KP3 C;  5L3C B;  2WXN A;  3AA1 B;  3CHP A;  1QSD A;  5LHI B;  4GYW A;  4EXT A;  2XAQ B;  2VKH A;  4HFG A;  4UI9 J;  2WSS V;  3LVQ E;  2FUL A;  2C5K T;  5LHH B;  2RD0 A;  3VKH A;  4DLO A;  3OAW A;  2QY7 A;  2CWY A;  2J09 A;  3UT5 E;  2NOX A;  3IEE A;  3HKD E;  2G0U A;  4BT9 A;  5ANL A;  4B8C B;  3FTV A;  3G2T A;  2VL8 A;  1BR4 A;  1HFA A;  2GK9 A;  2ODV A;  4H9R C;  2YQ8 A;  3HR0 A;  2Q9Q B;  1N54 A;  3K3Q C;  3VTY A;  3TXM A;  3L09 A;  3FFL A;  1UX5 A;  3FUJ A;  4I1M A;  1ZEE A;  3ZHE A;  3ZN3 A;  4B94 A;  2J4B A;  4J8D A;  3ASH A;  3ZMU B;  3DBS A;  2E0I A;  4NQ0 A;  1IAP A;  1Y64 B;  4N3B A;  3ONX A;  4P29 A;  4L7T A;  4TV3 A;  1HG5 A;  1WY6 A;  1D0Z A;  2VAS A;  3ML9 A;  4H63 H;  4HOS A;  4WAF A;  4EZL A;  3NQP A;  3KFW X;  3O1I A;  3OXL A;  4KXK B;  4UWG A;  5A23 A;  4G23 A;  3S2A A;  4UWL A;  2CLY C;  3ANW B;  4Q94 A;  4CXX A;  4O4J E;  4OFZ A;  4ZI3 D;  1VOM A;  4CI1 B;  3MV2 B;  2IW5 B;  4LEU A;  2P58 C;  3SFZ A;  5LOV E;  4GZD A;  2LSI A;  5EDS A;  2QA7 A;  1SHZ C;  3L6A A;  3I1A A;  3MV3 B;  3IHR A;  2AXZ A;  4O4L E;  5ETW A;  1MNE A;  4K03 A;  2I59 A;  4HS2 A;  3GN5 A;  4BT8 A;  2V26 A;  2ZM8 A;  3D9O A;  2C0M A;  3AA7 B;  3ML8 A;  3ZJ2 A;  1IZN B;  3UUX B;  1E96 B;  3GA8 A;  4IE6 A;  4UI9 C;  1LVF A;  1EDU A;  1HO8 A;  2LE8 A;  4DBR A;  2YK0 A;  1SQM A;  2IQC A;  4U0U A;  1D1B A;  2KIN B;  5T8I A;  5FTP A;  4ANU A;  3BK9 A;  1YA0 A;  4UWK A;  3C50 A;  4YLH A;  3L08 A;  4L9I A;  5JDN A;  3GYZ A;  4MFR A;  3E0Z A;  2FI7 A;  2E9X B;  5J2U E;  1LVK A;  1D0X A;  3SWH A;  3HVE A;  4MLP A;  3E4B A;  4EIW A;  4HN9 A;  3ZMT B;  3CK9 A;  3D0T A;  1E90 A;  4Y6W A;  1Z3Y A;  5JDF A;  3S7B A;  3PS6 A;  1EYH A;  5ARG A;  3J7Y q;  2WMN A;  3NRX A;  4AEZ C;  1Y8M A;  3Q49 B;  3FXD B;  4L5G A;  2FEZ A;  3J9X 1;  3QJZ A;  4C0M A;  3LY8 A;  1CUN A;  4AKH A;  1EZ3 A;  2PQR A;  4ANW A;  2Q9Q D;  4ANX A;  4B89 A;  3CWZ B;  3VLE A;  4IE4 A;  3RC8 A;  2XCB A;  1OUV A;  2VKO A;  4QX7 B;  3FWV A;  3TG5 A;  5HXS A;  4DVD A;  3GW4 A;  1H0A A;  4ZS2 A;  3CVP A;  3CPZ A;  2LSV A;  2CMR A;  1HCI A;  4UEM A;  1FMV A;  5A1L A;  4ZI3 C;  2LNI A;  4X1Y E;  4A56 A;  4UEL A;  1H2V C;  2LT3 A;  3C4X A;  5JJ7 A;  3S7J A;  5EZY E;  4U04 A;  3MEK A;  4G63 A;  5CCL A;  3O4Z A;  2CHZ A;  1X79 A;  4XE0 A;  4J8S A;  1MIV A;  1BR2 A;  3KD7 A;  4AI6 A;  3SHF A;  5IHY A;  4J6I A;  4DMV A;  1LKX A;  5FQ4 A;  2VKD A;  3RYH E;  2QGS A;  3FU5 A;  1HG2 A;  3CHM A;  3ZCI A;  4J8E A;  3LG7 A;  5LCY A;  4CT4 A;  3PTR B;  3FXE B;  4PJJ A;  2GRL A;  4N3C A;  2X51 A;  3Q9D A;  5JDM A;  2A72 A;  4G11 A;  4AXP A;  2EHO B;  4KBQ A;  2XQ0 A;  4KZ0 A;  2L9Q A;  3Q4A B;  4NRH B;  1ZHC A;  2CEA A;  5FMN A;  4IE5 A;  4JC8 A;  3FTS A;  4I6J A;  4BSX A;  5JDQ A;  3PRE A;  3U3I A;  1KT1 A;  3FUN A;  4JEH B;  5E76 A;  4GIW A;  3ZMZ B;  4FI5 A;  3MJX A;  2KM4 A;  5HWX A;  2AW6 A;  4GU5 A;  5L3E B;  3CKB A;  2XRZ A;  3UUM A;  3ESK A;  2DHR A;  4AY5 A;  3O1H A;  5LA6 E;  2Q9Q C;  3BG0 B;  3I0O A;  1PC2 A;  4EQF A;  1UG3 A;  3IKO B;  2X67 A;  1IJ5 A;  4QXC B;  3PNL B;  4I50 E;  4DMW A;  4HOR A;  4IST A;  4B8A A;  4PJM A;  3JC6 C;  4C91 A;  1B89 A;  3LJC A;  3LY7 A;  2BF0 X;  4AKG A;  4YVQ C;  1SZA A;  5FQ6 A;  2KXP B;  4QHO A;  5G04 C;  3AB3 B;  4YVO A;  2JRK A;  2A3D A;  4RG9 A;  2K24 A;  2ODU A;  1HE8 A;  3RRW A;  3RIB A;  4CDN A;  3R84 B;  4AY6 A;  1NP7 A;  4F3V A;  4U0Z A;  4P09 A;  1WYC A;  2I9C A;  5AJL A;  2KC7 A;  4ILH B;  3ZMS B;  2NC9 A;  1E8X A;  4WW0 A;  1TEZ A;  3AU4 A;  3UTK A;  3QC1 A;  2ACX A;  4Q69 A;  2D0T A;  2LHR A;  2J49 A;  1IJ6 A;  1VDY A;  1ELW A;  5AIJ A;  3AS8 A;  4GYR A;  2KWI B;  3W15 B;  3EDT B;  5HXC A;  4M3O A;  2WXJ A;  4ERR A;  4AP2 A;  1H7C A;  4O4I E;  2KCK A;  2ILR A;  4NUR A;  5LG4 A;  2Z6E A;  5T4Y A;  3N9L A;  5KJL A;  3FDH A;  3LVR E;  4WNK A;  1NA0 A;  4F53 A;  3HDX A;  1QQE A;  2H7V C;  2EHO D;  3RPU A;  3CGH A;  2XPI A;  1MIW A;  3IBE A;  3PVL A;  5ENN A;  4FJY A;  3C98 A;  4KT6 B;  4GYO A;  5FZR A;  3CK7 A;  3K3N A;  3LK2 B;  2A5U A;  4PJN A;  2PG8 A;  3PUJ A;  4EYU A;  5C2Y A;  3UT8 A;  2XPZ A;  2E9X C;  5JQG E;  3IHY A;  4I43 A;  1SZ9 A;  2X6F A;  3RH3 A;  3FH8 A;  3ONK A;  5JRE A;  5CHE E;  3U4T A;  2BUG A;  4BJN A;  4L2L A;  1G8X A;  4HLE A;  4UXN B;  2DWK A;  5LFA A;  4XKC A;  2XHE A;  4UWF A;  3FHN A;  3PUR A;  3JQ0 A;  4U74 A;  1MQS A;  5FXZ A;  2X6K A;  4BY6 A;  2D2S A;  4IDZ A;  4IYP A;  2WXI A;  3ZXS A;  2X68 A;  3B7R L;  5L3G B;  1PAQ A;  1IQU A;  4PNI A;  2ZM2 A;  4GA0 A;  2CG2 A;  5JDG A;  2WM9 A;  3GN5 B;  3ZC0 A;  4I6G A;  4Y6C A;  4ANV A;  5H6Q B;  5C8Y E;  3DTO A;  3QC9 A;  4RG6 A;  3BQI A;  4NUV A;  2LHN A;  3QNK A;  3B7U X;  4EEC A;  1FVH A;  2J08 A;  2LSJ A;  3ZCJ A;  2C0S A;  4M1P A;  3IV0 A;  3IEG A;  1KNZ A;  4DI4 A;  1JPL A;  3G2V A;  4CZZ B;  3L3P A;  3DPD A;  4WWN A;  4JHJ A;  2KCL A;  3RRM B;  3HVE B;  2NTY A;  1ZU2 A;  3FUF A;  4PUC A;  1QNF A;  1YKE B;  4I4T E;  3LS8 A;  3UPV A;  1H2U A;  3S7F A;  3MYV A;  2XAF B;  3AA6 B;  5HWY A;  3QWW A;  4IHJ E;  3S4U A;  4AV7 A;  5LBM A;  2BZB A;  1HF8 A;  4QXH B;  4AVX A;  3N71 A;  3ZC1 A;  3E08 A;  4HOT A;  3R7R A;  2EHO C;  4XAX B;  2X38 A;  3CIA A;  3B57 A;  2V0P A;  4XI9 A;  2Y8D A;  4JLE A;  5CA1 E;  1MMN A;  2YNQ A;  3UFE A;  1E8Z A;  4CI2 B;  4UQX A;  3CHR A;  2UXX B;  4GCN A;  3AAE B;  4XZ4 A;  2L0T B;  3D9M A;  2FF4 A;  3APF A;  3AAA B;  1Z0P A;  2L8K A;  2ZU6 B;  4JHR A;  2I1J A;  1KK7 A;  4CDM A;  4D10 C;  5A7D B;  3AS5 A;  4IRU A;  4PDX A;  3RO2 A;  5BV0 A;  2LAI A;  2RP4 A;  3FUE A;  3QAR A;  3HIZ A;  3CVY A;  3OXG A;  4QKN A;  1WYB A;  3FU0 A;  4E85 A;  4C0E A;  3ZVV A;  4UI9 K;  5LX8 A;  2PZI A;  4G1T A;  3KV5 A;  3D9I A;  2KMF A;  4N2Q A;  3KDS E;  4O2B E;  3KIN B;  2HR2 A;  4TUY E;  3ZYK A;  3ASF A;  3CVU A;  1IHG A;  2UY1 B;  3CHS A;  5AJD A;  2J07 A;  4X20 E;  3CVQ A;  4PAG A;  2MTQ A;  4JHK A;  4APF A;  2B1E A;  2IOS A;  2V7M A;  4JA9 A;  3UQ3 A;  1OXZ A;  2WB2 A;  3CQG B;  4UF0 B;  5G55 A;  5DAB A;  4EPZ A;  3KBT A;  3H37 A;  3HL6 A;  4U8H A;  4JEU A;  4BX8 A;  3F2E A;  4J0U A;  3C64 A;  5JR9 A;  4MS6 A;  5L3D B;  2RG8 A;  3QB2 A;  2WXF A;  3S7D A;  1G73 A;  2WXO A;  4QX8 B;  2XRY A;  4PK6 A;  4ILI A;  4FHJ A;  3D9K A;  3N2G E;  3FUL A;  1E1H B;  2Y4U A;  3V5U A;  2LSK A;  5DJQ C;  4KZC A;  3EDU A;  5JH7 E;  3FP3 A;  4QWN B;  2J4D A;  3ZYL A;  2X9X A;  4GPK A;  3JCK C;  4ZI7 E;  2NWB A;  5L3F B;  3D9N A;  4E7S A;  3MKR A;  3N9P A;  3LK4 2;  3PUQ A;  5EX3 A;  3RKO A;  2CFU A;  4FJZ A;  1NZN A;  3VLF A;  2ZM0 A;  3NZQ A;  1QZ2 A;  4GZC A;  5L3B B;  5LGU B;  4HVB A;  4ATG A;  2IC6 A;  2OV8 A;  3TAX A;  2WPV A;  2IJG X;  3QKY A;  4I2Z A;  4N78 D;  2XAS B;  3TJP A;  3QAQ A;  3FU6 A;  2Y4T A;  4GA2 A;  1FEW A;  3ZLI A;  1MND A;  3SS1 A;  1N52 A;  1TJF A;  2VGX A;  4FJO A;  5KJK A;  2CFZ A;  2M63 A;  4LRZ A;  1S35 A;  4FC8 A;  1YD8 G;  3PEV B;  2LOS A;  1KT0 A;  2VTB A;  1EF1 C;  1U3D A;  2WXM A;  4PJL A;  3TXN A;  2BVM A;  1H19 A;  2W0G A;  4ISS A;  3ZEF A;  2YU2 A;  5FT9 A;  2V7J A;  4X1I E;  4ILG A;  4I9E A;  5FXW A;  3UMV A;  3RJV A;  2Y3A A;  4BX9 A;  1DNP A;  5LCW J;  3SBS A;  4ZI2 D;  3KVB A;  3CVW A;  3RRC A;  3JC6 D;  1FMW A;  4P0B A;  1MHQ A;  3T8M A;  1D0Y A;  3OYZ A;  3FTU A;  4WNF A;  3FBL A;  2VSX E;  5E75 A;  3EUH A;  1FCH A;  2AWI A;  3CR3 A;  3TKL B;  3EJN A;  4J2C A;  4DLQ A;  2FBN A;  4I43 B;  2JEK A;  3ASG A;  4I55 E;  3HKE E;  5J90 A;  3QUJ A;  1E7V A;  4K0R A;  2CE7 A;  3G2U A;  4AKL A;  2XHE B;  2XQY A;  3HKB E;  3RU0 A;  2HPL A;  5FQ8 A;  3K9I A;  2WXK A;  4G24 A;  3C4W A;  3UT7 A;  2C2L A;  1MMA A;  4IN3 B;  4N2S A;  2R5S A;  2W63 A;  1NWM X;  5CMW A;  3EHN A;  2CWO A;  4MBQ A;  4DJA A;  2D0U A;  4X1K E;  4H63 V;  4N39 A;  4WNE A;  1ZKE A;  3FHE A;  5KJM A;  3CVX A;  2GGF A;  1OWA A;  4GCO A;  1HH8 A;  2PFV A;  3MZL B;  5LHG B;  1B7T A;  3ASD A;  1HZ4 A;  2WXR A;  5D0Q D;  3FEY A;  1UW4 B;  3P2B A;  4KMC A;  5FY7 A;  2KZT A;  2GW1 A;  4BWR A;  4OVV A;  5FXV A;  2JJ9 A;  5AFU L;  1JWF A;  2X6I A;  3H3A A;  1IYG A;  4AQF A;  1WM5 A;  5J2T E;  1X5B A;  3VU7 H;  3PNT B;  3APC A;  4O6F A;  2WQ7 A;  5FZQ A;  3FU3 A;  4FU3 A;  2IF4 A;  2XGO A;  4N5C A;  3K3O A;  4CGW A;  3MGB A;  2E9X D;  4A1S A;  4FLH A;  5J08 A;  3ZIM A;  2K5B B;  3NZS A;  4HGA A;  2WXP A;  3NBX X;  4FA6 A;  1GW6 A;  4TX5 A;  4GOU A;  4XKB A;  3ANW A;  4WBN E;  3F31 A;  4HE8 A;  1T98 A;  4V1A v;  3KAE A;  3JQ1 A;  5LCW C;  4ZI2 C;  4JVS A;  4NUU A;  3GZ2 A;  4EZ4 A;  3PUA A;  4ZS3 A;  2DI4 A;  4XBF B;  2WVI A;  3FY4 A;  2XAJ B;  3ETU A;  4AQG A;  4NAC A;  3TGO A;  3N9Q A;  3VTX A;  2X66 A;  3N2K E;  3BG1 B;  1U5P A;  1WRD A;  3RYI E;  5C1D A;  4CQI A;  1DVP A;  3KBU A;  1ZBP A;  3SZ7 A;  2CA5 A;  3C51 A;  4JA7 A;  4XI0 A;  3LYA A;  1TJC A;  3BQK A;  3N5L A;  2JPF A;  3L54 A;  4AXH A;  3PE4 A;  3UUX A;  2W61 A;  4PFO A;  3OXF A;  1JUQ A;  4O2A E;  1H6K A;  2XGM A;  4KVO A;  4A55 A;  4YJ2 E;  4QFV A;  3RO3 A;  2NW7 A;  3EHM A;  5T3R A;  4AIF A;  3LFM A;  4F6R C;  4DND A;  1HX8 A;  3PE3 A;  4PK4 A;  2J9Q A;  3SOL A;  2A2F X;  5HXR A;  2PBI A;  4L1B A;  4IGU A;  3RYF E;  3LBX A;  5DQV A;  1W3B A;  2LAH A;  1HS6 A;  2KZ7 B;  3MK7 C;  3PDN A;  4TZ4 C;  4HOU A;  3ZHE B;  2WAU A;  5CB4 E;  3CHO A;  2JLB A;  1NAF A;  3JYS A;  3EIQ C;  5JVD E;  3LDZ A;  5JRC A;  4JL0 A;  2VSN A;  4WWP A;  3OKQ A;  4P0A A;  2Y48 B;  2NW9 A;  3FUD A;  4PS8 A;  1BR1 A;  4E7Z A;  4U72 A;  2PJQ A;  3PDY A;  3I4R B;  1S0P A;  2N1G A;  4BFR A;  2UWJ G;  4QXB B;  2VSY A;  1XGW A;  4YFS A;  2BDE A;  3KV6 A;  2VQ2 A;  5M72 A;  4LER A;  3R7Q A;  1JWG A;  2BTD A;  5JR9 B;  4G2V A;  3GWH A;  3N2O A;  4WND A;  4ABN A;  3HHM A;  4PK5 A;  2YHE A;  3L22 A;  2OVB A;  2I1K A;  1Y6I A;  2X3M A;  5KDM C;  4U07 A;  5J1G A;  4CEM A;  5BV1 A;  1FVF A;  4GML A;  4L2Y A;  3QWV A;  2V8S E;  3FTX A;  2WQ6 A;  4LCT A;  2LJL A;  3UX4 A;  5LP0 A;  2IU1 A;  1S94 A;  4JZY A;  4PS3 A;  4DI3 A;  1LRZ A;  4I17 A;  4F1S A;  2L6J A;  2EHO A;  4RVB A;  3ZFW A;  3A5X A;  3NRY A;  1MMG A;  5F8P A;  4JEH A;  3FB2 A;  4Z8X A;  3KV9 A;  4HTE A;  4A3V A;  4OYJ A;  3P1U A;  3R9A B;  5KJN A;  4ZHQ E;  4CXY A;  3I0Q A;  3UUL A;  4KBM B;  1OWP A;  2IOL A;  2GRM A;  3CK8 A;  3CX8 B;  2CXF A;  5AYW D;  3R6N A;  4PFP A;  2VTB B;  5ADX L;  3SGH A;  4G26 A;  4U63 A;  2DCP A;  3Q5M A;  2PM7 A;  4EZK A;  2OA5 A;  4ME2 A;  3ZEF B;  2OVF A;  4URK A;  3PE0 A;  2L0I A;  3U3W A;  2HPJ A;  3FTY A;  3ONL A;  3SD5 A;  3B7T A;  3AAI A;  5HQ8 A;  3DJB A;  2C5I T;  4OYS A;  3KEZ A;  1PY1 A;  2V1D B;  3PU8 A;  4GAA A;  2JMH A;  3SNX A;  3I9W A;  4FHK A;  3T8O A;  2DCF A;  2R17 C;  4KVM A;  2KND A;  1BPO A;  5LYJ E;  3FUM A;  5AEN A;  4UVA B;  4DBQ A;  3TL5 A;  2HYZ A;  3D9P A;  4K0U A;  4MAL A;  3WAK A;  4MLK A;  3PU3 A;  1E8W A;  2MHK A;  1HXI A;  4I1O B;  4UWH A;  1HS7 A;  3ZMV B;  5JHB A;  2CCQ A;  4ANJ A;  3CSF A;  5JDL A;  3PUG A;  3WI3 A;  4OHF A;  1YKH B;  2JMK A;  4ZOL E;  3OTN A;  3U9W A;  5HI7 A;  3TG4 A;  1BR0 A;  2D5U A;  2LOP A;  2NP9 A;  2K48 A;  2I6H A;  3CKD A;  4GYY A;  3P7I A;  3RKV A;  4FP7 A;  1INZ A;  3LKU A;  2ES0 A;  3D3M A;  3KS2 A;  1LF8 A;  2FO7 A;  5EK4 A;  3D9J A;  5KCM A;  2IAK A;  2KZT B;  5BMV E;  3JUI A;  2CHX A;  4OYK A;  4C9B B;  3NZP A;  2AXU A;  3AVR A;  4BTA A;  4KUM B;  5FP3 A;  2ZMA A;  4DK5 A;  3LK3 B;  5ARF A;  3LY9 A;  3MZK B;  2HO1 A;  3CVN A;  4BTB A;  3OYX A;  4W9R A;  2N9D A;  4H9P C;  3L13 A;  2MYS A;  2R59 A;  1IQR A;  5JJ6 A;  3FTW A;  3OBV E;  3B13 A;  4AKR B;  5BUZ A;  4U0S A;  5DBK A;  4ADZ A;  3RYC E;  3IHV A;  3ZPO A;  4CT0 A;  2SPC A;  3SI5 A;  4A1G A;  1D1A A;  3AA0 B;  4E6H A;  4TUU A;  3B7S A;  4ACL A;  5GON E;  3N9N A;  3CQX C;  5JDH A;  2DWG A;  2IFU A;  4H7X A;  2L3L A;  2HM8 A;  3ZN1 B;  1HTJ F;  4G25 A;  5LBQ B;  3F57 A;  3FUK A;  3ETV A;  3G2W A;  4WBO A;  3QOU A;  4TV9 E;  2M67 A;  2EQX A;  4IE0 A;  2YIN A;  1AJ3 A;  2A4Z A;  1MMD A;  3MX3 A;  3FH5 A;  3N9O A;  1US7 B;  3HI2 A;  3T5X A;  2CG3 A;  3O1J A;  2H3R A;  3Q2M A;  2CHW A;  5JR9 C;  5LJM A;  3MKQ A;  3CEQ A;  2VSO E;  3IF8 B;  3O9X A;  4A3T A;  2NTX A;  4YJ3 E;  2X9W A;  4TV8 E;  3PUS A;  2W62 A;  3AVS A;  4WUY A;  3LBX B;  4CI3 B;  2CM0 A;  2LSY A;  4EBA A;  5FJY A;  2XEV A;  1VRB A;  3RC3 A;  4UVB B;  3I5P A;  3WXX A;  3L17 A;  3EVY A;  2AVP A;  3FUI A;  2J1D G;  1U3C A;  3UT4 A;  5EKQ D;  4IIJ E;  4AKI A;  4F7A A;  3K8P C;  2XAH B;  3Q5W A;  5FWQ A;  5JRC B;  2X9H A;  2E8I A;  3O4X E;  2HH7 A;  4LUN U;  2LSU A;  3M65 A;  3RRU A;  1QUU A;  3ZRH A;  4R7L A;  2V4L A;  3NZU A;  4EB6 E;  2YEV C;  3C98 B;  2MOZ A;  3ESL A;  5L2L A;  5HAX A;  4BJM A;  3V5S A;  4HFV A;  3MJW A;  4DPR A;  4XZC A;  4ACK A;  2X6H A;  4I1A A;  4AM9 A;  2W00 A;  2OOE A;  3HKC E;  2L9B A;  4KMO A;  4UIG A;  4CXW A;  5LXT E;  2X9Y A;  2E2E A;  4XIF A;  2UXN B;  4FLB A;  3LEW A;  1L5J A;  5G04 J;  5KMG P;  4B6X A;  5HXE A;  4EZH A;  5FXX A;  3UUN A;  2QFC A;  4Q96 A;  3CLJ A;  2VJ8 A;  3O48 A;  1O3X A;  2VB6 A;  1H2T C;  2WXH A;  3QK0 A;  4N3A A;  2WMO A;  2PQN A;  2Q9Q A;  4FUL A;  2YHC A;  5LGT B;  5EX0 A;  1WR6 A;  2VWA A;  3CV0 A;  3ZYQ A;  3G2S A;  2MRI A;  3CQC B;  4GK5 E;  5LP6 E;  2V5F A;  4PS7 A;  4V3I A;  2V7K A;  3I3N A;  2CXD A;  1OWO A;  3LXU X;  2LO6 A;  1XNF A;  3ULQ A;  4EZJ A;  3APD A;  3VHL A;  3SRZ A;  4FAD A;  2BVL A;  3U66 A;  3N9M A;  3Q15 A;  2UY1 A;  1EPU A;  4WNG A;  3CVR A;  3PH0 C;  3MKD A;  2WXG A;  4HEA A;  2NSZ A;  5FYM A;  3CML A;  3VLD A;  4UQZ A;  4CRW A;  3Q5X A;  4GB9 A;  3HYM B;  1FIO A;  3VKG A;  1WAO 1;  4UF0 A;  3GZS A;  1OWN A;  4JW1 A;  5CMY A;  2X6J A;  3P8C D;  5JHA A;  3T5V A;  4OVU A;  3C4Z A;  5BNW A;  2V7L A;  5FY1 A;  3PUK A;  4UV9 B;  5BPP A;  2DBA A;  2XPY A;  5ANR A;  5TAO A;  3SF4 A;  2KLQ A;  1V9D A;  1UN8 A;  4HXI A;  4KYO B;  2KT9 A;  2DIW A;  2WQH A;  4MRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...