3ZYKA

Structure of calm (picalm) anth domain
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
269
structure length
269
Chain Sequence
SAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis for the endocytosis of small R-SNAREs by the clathrin adaptor CALM.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
molecule keywords PHOSPHATIDYLINOSITOL-BINDING CLATHRIN ASSEMBLY PROTEIN
total genus 111
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zykA02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3zykA01
1SZ9A 1SZAA 3D9PA 3D9JA 1MHQA 3ONKA 1PY1A 1JWGA 3D9OA 5LP0A 1H0AA 3D9IA 3G2VA 2DCPA 4JXTA 2QY7A 4NACA 3G2SA 2DIWA 2L0TB 4FLBA 1EDUA 3RRUA 4HFGA 3ZYKA 3D9NA 3ZYMA 5LOZA 1HG5A 3ZYQA 4AVXA 5J08A 1HX8A 1X5BA 3D9LA 4GZCA 1HG2A 2LO6A 3D9MA 1UJJA 3G2UA 4FU3A 1JUQA 3D9KA 1EYHA 2MOWA 1JWFA 5CMYA 1HFAA 4GZDA 1LF8A 4Q94A 1VDYA 2KM4A 3G2TA 2V8SE 5CMWA 1HF8A 1ELKA 1DVPA 3G2WA 3CLJA 3ONLA 1UJKA 1INZA 4Q96A 1JPLA 2L0IA 1XGWA 3ZYLA 2BF0X 3LDZA
chains in the Genus database with same CATH superfamily
4A56A 3LY9A 3Q5XA 3PURA 4ZHQE 2CLYB 4PFPA 4TN7B 3RO3A 1FVHA 5LG3A 3E08A 2DIWA 3UU6A 3GYZA 4CN1A 5G04C 4AP2A 5EYLA 3QOFA 2PTFA 3CK8A 1OCZE 4LF8T 5LHGB 1WLXA 2CXLA 4HFCA 3A8YC 2E9XB 4WUYA 5F8PA 3RRCA 3ABME 1WY6A 2BKOA 2X9HA 4CXXA 5JDGA 2XPZA 4UWFA 4L2YA 4DUIA 3CHMA 4HOUA 1TN8A 3AS4A 4YDEA 4QFVA 3OTOT 3D9JA 4A3VA 2QYUA 4CXYA 4G8LA 1BI7B 4TNVA 4DR6T 2KBXA 3KSQA 2IIUA 2VSOE 4Q69A 3HXCA 3DEOA 4F6RD 3HXEA 5AQIB 2FBWA 1BR4A 5AQOB 2WXMA 3D9LA 3B57A 4ASKA 3MJWA 5C1DA 4UVCB 4H9OC 5FXXA 5FP3A 5KWDA 5JRCA 2A4ZA 5ARGA 3KV4A 4LG6A 1T7SA 2BZBA 2QGSA 4EZ4A 4BJNA 2YU1A 2WCAA 2JLBA 3U78A 1UN9A 2W66A 4B3TT 1B89A 2RD0A 4I55E 2MAWA 4A63B 3ZYLA 3Q73A 3BQKA 2P9SG 4UV9B 3JC6C 5H7PA 1N4RA 3WG7E 2DZOA 3UU8A 5LGTB 5J90A 5CA0E 1ZU2A 4U72A 2IHR1 5HEOA 2OEVA 2IC6A 3UTKA 2DWZA 4XEIG 4U33A 3OBVE 4DV7T 2IOLA 3NZUA 4WBOA 1UG3A 2JABA 2WZIA 5G05J 3V2OA 2V26A 1FT1A 4XZ4A 3I0OA 4LF4T 4ZEYA 4EECA 2FI7A 3NRYA 3DWLG 3ANWA 5FZSA 1Z8UA 5KCMA 4IGUA 3UQ7A 2XQAA 2BKGA 2CBJA 4L9IA 4U95D 3SO8A 5DJQC 2WMOA 4ZI2D 3E4BA 3OAWA 3L9TA 3EI0A 2J9QA 4E7SA 2GRQB 1US7B 4HFDA 4CDNA 1MMDA 2FO7A 4GYWA 4UI9J 4JEHA 2XQ8A 1H6PA 3CHOA 4PH4B 3DTOA 2KATA 3V5SA 2VJ8A 3L13A 2FJBA 2MOZA 4ANVA 1D0ZA 2HPJA 4TWHA 3WAKA 3LYAA 2CBIA 3IHRA 4I9EA 3UTMA 4AM9A 3P4WA 1T72A 4HGAA 4K03A 2L3LA 2KSRA 4MLKA 2YHCA 3TWTA 4TUUA 5G04J 2PQRA 4H63V 3SRZA 3PUAA 4YY3T 4YXDA 2VASA 2FJEA 3AE9A 3DJBA 4DV4T 4DRXE 2FJDA 1W0BA 3ZJ1A 1S94A 4IE6A 4O4HE 1HE8A 4I9CA 3H37A 2XAQB 2BG9E 5ENTD 4I17A 3BEEA 1BR0A 2ZLYA 4GMLA 4MS6A 2WXFA 3KS2A 3UQ4A 2PQNA 5IY5E 2I1JA 4UF0B 2AJAA 4TV3A 5AQ9A 4IE4A 3RIUC 3HA4A 3WI3A 2M6IA 2P2CP 4GA2A 4KI0F 5CMYA 1XWMA 2Z6EA 3ULQA 1HNXT 5FQ7A 3B7UX 2X0HA 2KINB 2F4VT 2P9KG 3CSFA 1INZA 2YQ8A 4I6JA 3RIFA 4CYMD 4NQ0A 5D2MC 1D8DA 2DYSE 1N52A 5FYMA 2J4DA 3AAAC 3LJ3A 4U7IA 2J47A 5FXZA 2DL1A 1NA3A 4G2AA 2B0OE 2V4HC 1AWCB 1SHZC 5EK4A 2GK9A 3K3OA 4AXPA 3K1SA 4QHOA 3TKLB 4FJZA 1XMQT 4KXKB 2H7OA 2LSGA 2XPKA 1HH8A 3KDSE 1IQUA 3UM3A 5EX3A 3EAMA 5BXUA 4GMRA 3FUDA 1S35A 3ZC0A 2H89A 5JA4D 2NWBA 4EIWA 3CX8B 2M63A 4TWDA 5L47A 4NACA 3WAJA 1N34T 1IBKT 2A5UA 4BWRA 1N95A 3DPYA 1VOMA 5HRYA 3PDYA 5ANLA 3D9KA 3V31A 3OXLA 1KFYA 1Z3YA 3MA5A 3GZ2A 2X6HA 3RHWA 3ENEA 2XASB 3QK0A 5FJYA 3I5PA 3TAXA 1YD8G 3BG0B 4UEMA 3ZCIA 3TWVA 3RU0A 1OEDC 5BXOA 4GIWA 1UCUA 1WFDA 3LBXB 4YJ3E 1H0AA 5BMVE 3ONJA 1D1CA 5DIZA 2Y4UA 1HG5A 2LXMA 3J9X1 5L2LA 1Y01A 3EUHA 2VYIA 3D9MA 1QQEA 5JDQA 4U31A 4BERA 5EZYE 4IRUA 3Q9UC 2NW7A 3CVRA 5LG4A 1FT2A 1H2UA 2LSKA 4QX7B 3ZMZB 1IHBA 1MMGA 3FTVA 4RLYA 3UX4A 2Y6XA 3L82A 5ABFA 4EV6A 4FULA 5CECB 3Q5DA 4UQYA 5G55A 4AQGA 2WQ7A 2BS3A 2VL0A 2CG2A 3Q9NC 5F3JA 3QC1A 4HKAA 3AEGA 2WXKA 2V7KA 4I0UA 4APFA 5KX5E 3M65A 2PM7A 3LK42 2GW1A 3VKHA 2VK9A 4EXTA 3IBPA 4JI8T 2KC7A 3UI2A 1FPPA 4YLHA 3JQ0A 3CHPA 4E85A 3LEWA 2KXPC 3ONXA 4AQFC 4L9PA 1OWNA 5D66A 2ZMAA 3RIAA 2XCCA 3MEKA 4EEBA 2MRIA 1ZV4X 3AU5A 1HO8A 4GB9A 4PUCA 5AQVB 5BNWA 2VKJA 1ZBPA 2E5LT 3FY4A 3EDVA 4F1PA 2KCLA 3ZCJA 4CXWA 2A72A 3CQCB 4A3TA 3AE7A 4N5QA 4K0UA 3AE4A 1LTXA 2XHEA 4U8YD 4JI5T 3MV2B 5LCWJ 4O2BE 5EN5D 5L3EB 5FL1A 4UQZA 2XCBA 4PAGA 1TEZA 1A17A 3ULEG 1HX8A 3Q79A 5TAOA 1T8BA 4X20E 3ZFWA 1NFIE 2ZM8A 2MTQA 4TRQA 3K3NA 4BETA 3GN5A 4GZ6A 1UW4B 1X79A 4KT6B 3FH8A 2UY1B 5KNGA 3C72A 3KBTA 1JPLA 2L0IA 3Q7AA 2XAFB 1E8WA 2J08A 1N9AA 2FULA 1E2AA 4XAXB 3HKCE 3IEEA 4QH5A 3I3NA 2YINA 1SW6A 3PVLA 3N9LA 4LMLA 4MBGA 4JUYA 3VTYA 3SFZA 4H9SE 3FZLB 3RIBA 4FI5A 4CGVA 3EHQA 2UUCT 5BPPA 4I6GA 4TNWA 5JDFA 2NSZA 3HXFA 2DCFA 4JI4T 2N2NA 2LNIA 4B93B 2XPIA 3P2BA 5FKYA 4WWNA 1TNOA 4GMJA 1EDUA 3PJAA 4I1MA 5CRVA 1ELWA 4UVBB 1L5JA 4X66T 4BJMA 2OV8A 1E8XA 2XAHB 4ME2A 1D9SA 5LX8A 1HZ4A 2CA5A 2YOEA 2BG9A 3KVBA 4DV0T 3CR3A 1YW0A 1UJKA 2E9XC 2LOSA 5FT9A 2UY1A 1MNEA 2ZM6T 4NXNT 4CZZB 5AYWD 1T98A 3T8MA 3V30A 4U8HA 2J1DG 1VCSA 4OYJA 5JREA 1HNZT 3RJVA 1KPSB 2C5JA 5LMUT 4JI1T 2I6HA 2L0TB 2VSXE 3LK2B 2WDRA 2IY0C 4G2VA 4YTNA 4WW0A 4RSYA 3RK6A 4ATGA 2V7MA 3ZW3A 4G23A 5A23A 4IDZA 2XSBA 2OVBA 3CEQA 2NW8A 2I59A 2XHEB 3OYZA 2MPKA 3EHNA 2FEZA 2UXNB 4FADA 4BT9A 4HOSA 2NC9A 3NBNB 4N3BA 2V5FA 5JTGA 4AKIA 3RC8A 5CB4E 4QXCB 3UPVA 4A1GA 4IDQA 3S7JA 3FBLA 4YJ2E 3ZT6A 2MHKA 3AG2E 3TGOA 3ZJ2A 2XSAA 2LSYA 2HPLA 3APDA 4YHHT 4YTPA 4HWDA 4B94A 4HI8A 2JQQA 3T5VA 4LSZE 3ZUVB 1E7UA 3U9WA 4B8AA 4JI0T 3MGBA 5ENRD 4O6FA 3FUNA 5FZRA 4AV7A 4KP3C 4YHJA 1HXIA 2P9PG 2Y4TA 5EILA 2IUBA 4A5XA 4O8SA 3ZYQA 4TWFA 5JDNA 3PZ4A 1Z5SC 3OXFA 3CVWA 4ILIA 4U7EB 4DNDA 2VKDA 3CVQA 1LVKA 3IBEA 3DSSA 4BSZB 5AQKB 1WYBA 4UQXA 2KMFA 2KWIB 3A5XA 5AQHB 3T8OA 1TJFA 2DWKA 4MHCA 3N5LA 1HCIA 1NZNA 3C98A 5H6QB 3PUKA 1SUMB 2VGEA 2VL8A 2W62A 4KYOB 3QNKA 5DBKA 2XEVA 4K0KT 2XGSA 5CEDB 4N39A 3QWPA 2V8SV 1YKEB 2V7LA 4V3IA 3AAEB 4PS3A 3I0QA 3S7FA 3ZT5A 1ELKA 3GZSA 3VLFA 4DR4T 3IHVA 4P0BA 4UWGA 1IZNB 4YVQC 2ZU6B 3SFEA 4LF6T 3C50A 1WR0A 2FJAA 4O4LE 2CPTA 5HWYA 2H7VC 1QYMA 3FFLA 4LFCT 3SFYA 4AKHA 4U3CA 3FUFA 2WXOA 3JCFA 2R2LA 4IDOA 3R7RA 2R5SA 4ZS2A 2X9YA 3AE6A 2HN1A 3HHMA 4WNGA 3FXDB 4CDMA 3PZDA 4CQIA 3GWHA 2BUGA 1CHUA 1DVPA 3ISMC 2P9NG 3JXIA 3W9GA 5JHAA 1S64A 3N2KE 1EF1C 3DEPA 1FCHA 3R6NA 1Y6IA 4RG6A 3K8PC 3PUQA 2X6IA 3SFDA 1S70B 4BT8A 5AQQB 1G3NB 4HRMB 3M3ZB 2DCPA 3J5QB 2BTDA 2C5KT 3CK7A 4LRZA 3AJIA 3UM0A 4CRWA 5BV0A 3IV0A 2DI4A 4K5BA 4OVVA 4P1NA 1J5ET 3G2UA 1HTJF 3SOLA 4MBQA 3H3MA 4TX5A 3TLUA 5CMWA 3IA3A 1W3BA 3ZGQA 4CN6A 4P29A 4AI6A 2W63A 4UUCA 4AIUA 3FUKA 3CVXA 1MNDA 2UUBT 2CEAA 2H88A 3O4ZA 4JZYA 3RKGA 3B7TA 4U04A 3QK6A 2XGOA 2AXVA 3ZMVB 2W2UA 3ZLIA 2UWJG 1UJJA 2VQ2A 5KBAA 5ADXL 3UQ3A 5CEAA 1HX1B 4XBFB 2ES0A 1WG0A 4FJYA 3ESKA 5T3RA 3GN5B 3E33A 2VB6A 3DSUA 2K5BB 3Q5MA 2YDQA 1LKXA 4TUYE 5G2NA 2VVNA 2LSVA 2QY7A 3UMVA 1KF6A 3G06A 1O1TA 2OEWA 2SPCA 2V5CA 3IXEA 4N3CA 2CFUA 4KMOA 4FU3A 5ETWA 5ABFB 4L1BA 4AIFA 4C91A 1W0AA 4ZI3D 4BTBA 4CDRA 3PUSA 2BKNA 4ABNA 4I1OB 2VSNA 2HE0A 3MZLB 2XS1A 3MZKB 4KBMB 4OYSA 2ZISA 2IJGX 2X68A 3UT8A 3FUHA 4ADZA 2OV9A 4JEUA 2WPVA 4DI3A 1IKND 5B1BE 3E0ZA 3CKCA 4IL4A 5FXWA 3CV0A 3LVQE 3RRMB 3K9IA 1TNYA 2V8SE 4HFHA 3BG1B 3Q15A 3ABKE 5CA1E 3SBSA 1N4PA 1WM5A 2L9BA 5JR9A 3PTRB 3B5MA 4XI0A 4KX6A 1OWLA 3UUXA 2UXBT 3EDTB 3QARA 4U7YA 5LP0A 4HN9A 3ETUA 4JXTA 1LRZA 4PK4A 5AQPB 5EIBE 3HIZA 2WXPA 4FP7A 3LDQB 5HXRA 2I1KA 3X1DA 2FUPA 4ZZBA 4JD2G 1CUNA 1NP7A 1TR4A 5ENNA 3SHFA 2WS3A 2XM2A 2X9XA 3UU3A 2WXJA 4NRHB 4ISTA 3MK7C 1N33T 2CRBA 1E90A 5FY0A 2E0IA 4IE0A 2EIKE 3AEEA 4I2WA 3QNUA 5IHYA 4JL0A 2Y8DA 4GYSA 1N11A 1XDPA 2A5EA 1DCEA 1Y64B 4IIJE 1K1BA 3AU4A 1OT8A 3FHNA 1KT1A 4TXRA 3CVUA 1TJCA 5G05C 4IDPA 2V5DA 1OCRE 4XKCA 2AW6A 4O60A 3WXXA 1MIWA 2DHRA 4Z90A 2DLRA 3PNTB 1IBLT 3C3RA 4QX8B 4WAFA 3AXJA 3URZA 3UXGA 1OXJA 3NZQA 4HB5A 3C4ZA 1MQSA 2V4LA 5ABHA 3U3IA 1H19A 5HCJA 4WYVA 2IU1A 5AQAA 3LKUA 5AARA 4XX5A 4WZXA 4JVSA 3C64A 4QWNB 3ABLE 3MKQB 4UF0A 4DMWA 4N2SA 2WXNA 2XQ9A 4HFVA 2XGMA 1UN8A 3FTYA 2EHOD 4EB6E 4PK6A 2L6JA 5LP6E 3RYCE 1LVFA 4BA9A 3CIAA 2A9UA 3EHZA 3ASGA 1XGWA 2AXUA 3D9PA 3PREA 4GAAA 2RKKA 2J8SD 3MV3B 3L17A 5LFAA 2R6GF 4KVOA 1QNFA 1NL4A 3O1IA 4GU5A 4CT0A 2IONA 4L0RA 5HEJA 4LUNU 5CBNA 4AQYT 4MALA 1K1AA 5AN8A 2XQYA 3KVAA 3TJPA 4YDWA 1D1BA 1BR1A 3ASNE 4ZI3C 4JPSA 3TXMA 5DQVA 4M1PA 2QC9A 3UUNA 2XRYA 2QFCA 2BBJA 4X8QA 5EK2A 5J1GA 1AJ3A 5LXTE 2J4GA 1E8YA 3JC6D 2RFAA 4AVXA 4IREA 3D9HA 2UXDT 3QAQA 4W9RA 4DR5T 3B7BA 5AQMB 1HG2A 5CRUA 2VQFT 4HLLA 2YN6A 1LD7A 2XUEA 2P9LG 1HFAA 4GTOA 4XE0A 2K9AA 4DI4A 1BU9A 4YVOA 2Q9QA 3TWXA 2PNNA 2EQXA 3KV5A 3RSEG 3ONKA 1AP7A 4X1YE 5ENOD 5B3SE 2UU9T 5HXSA 2VWAA 2Q7FA 4GTRA 4CEMA 3UM1A 4EZHA 4H9NC 2ILRA 4DX5D 4DV2T 4O4JE 2EHOB 2CMRA 3NF1A 2AVPA 5CFBA 4WNEA 5AQUB 1EYHA 3TWSA 1ZKEA 4YDYA 1EZ3A 1N4QA 2Y1LE 3AA1B 3NOCD 3O48A 2B76A 1W9RA 1FIOA 5CCLA 3JXJA 4JEHB 3TWUA 1GQEA 3ZN0B 2ACZA 3B13A 4U8VD 3OPCA 1PAQA 2V6XA 5LCYA 4F8HA 2NTXA 5L3DB 4WNKA 1HR0T 2P9IG 4G26A 5FXVA 1MYOA 2IW5B 3ABVA 2R02A 2PFVA 5LOZA 1KNRA 4J8DA 2VGXA 1KNPA 1MX2A 4DR2T 5EDSA 3HYMB 2JMKA 2WB5A 3BU8A 2F37A 3R9AB 5FY1A 2XM1A 3G2TA 1OCCE 2XQ7A 5EYPF 4LNUD 5AENA 3L3PA 4Q25A 4BFRA 3ZEFB 5FY7A 4YSZA 2BKKB 5KJNA 5ENQD 1PY1A 1LD8A 3PUGA 4ZOLE 4DJAA 3FTSA 3MYVA 2H6IA 5D0OD 3ASOE 5LCWC 3DRAA 5FTPA 5BT1A 2IC9A 3W9FA 4JEUB 4UI9C 2L8KA 2ODVA 3PEVB 2CHWA 2X3MA 4LF5T 2EHOC 4JHJA 1U4QA 2ZIRA 2F0YA 3FH7A 3EJNA 2WQYA 4UIGA 2DVWA 4KMCA 3J7Yq 4OVUA 4G24A 2JRKA 2X6KA 3PUXF 4RVBA 2WXQA 1YXRA 3PU8A 4WWPA 4HWFA 2PG8A 1ZHCA 2RPAA 3LJCA 4B3ST 4EZLA 4FLBA 2IEJA 4PS7A 1Y8MA 2C0SA 4JA9A 1VCTA 2OA5A 4PJLA 1QUUA 3PU3A 2W00A 3AG4E 1OEDE 4X65T 1G8XA 5LBMA 2M67A 2ZGDA 2W0GA 1WCRA 3CLJA 5JVDE 5LOVE 2XPYA 4X5TA 2JQKA 3ZKRA 5JR9B 2ETAA 5CCMA 3VKGA 3UKRG 4X1IE 2CCQA 2I9CA 3T5XA 2E2AA 1JWGA 2A3DA 2C5IT 5LGNB 3CQXC 3E30A 3CIRA 4UXNB 4DV3T 3ASDA 4ERRA 4TV8E 3Q78A 4E6HA 4TZ4C 4AOFA 3NBXX 4CCAA 5LHIB 2E8IA 4ISSA 5BV1A 1DCQA 1N0QA 5JQGE 2E9XD 2BF0X 2B1EA 1K8KG 2IOSA 4CN4A 5AJLA 2MYOA 1TN6A 4EQFA 5KJKA 3B95A 4URKA 4U74A 1FMVA 4LF9T 4DX1A 2XZEA 1SA0E 4RQIA 5EKQD 5LYJE 1KK7A 4AEZC 3CK9A 3HKDE 1JWFA 3QOUA 5JDHA 3NZPA 2VKHA 2R17C 4BY6A 3RX6A 2FF4A 2LM2A 4UWKA 4HOQA 1OEDA 2V7JA 2CXDA 1UX4A 4IE5A 3PDNA 4N3AA 3D0TA 5T8IA 1IBMT 2LT3A 2P58C 3L54A 3SQVA 5E76A 1YQ4A 1XDOA 2XQ0A 4A55A 4KVMA 3FTXA 2F8YA 1KNZA 5KXJA 2V1DB 2MYSA 1JNRA 4UVAB 2RA1A 3HL6A 4H7YA 1BD8A 4J8SA 2Q9QD 3ZPJA 1NI1A 4ZHBA 3N9OA 5C2YA 3CGHA 4HI9A 5HYAA 2LAHA 2XJ7A 2GROB 2K24A 2DWGA 3BQOA 4GYYA 4HEAA 1SVXA 4DO0A 4KHZF 5ENSD 3PNLB 1E96B 2G0UA 1TYQG 1TN7A 3QKYA 3NKZA 3FBZA 4GOUA 1BI8B 5CHEE 4GZ3A 1XNRT 2H3RA 3ZPOA 2Y69E 3C98B 4O2AE 3FDHA 4K5CA 2JJ9A 3AG1E 4PS8A 4DBRA 5KMGP 4AQFA 4ACLA 1IXVA 5BUZA 3AA6B 2Y48B 4EOZB 4YTMA 3JYSA 3HR0A 1Z0PA 1SQMA 4QXHB 3UT5E 1ZP0A 4GK5E 4GTQA 4N2QA 4CI3B 4CI2B 5JMND 1JUQA 3UUXB 1LF8A 3QDNA 2QVAA 3FU6A 3OXGA 1MX6A 3TG5A 4B89A 4F3VA 4JV5T 3FZHB 2NP9A 5DABA 4HXIA 3KSLA 3RGLA 2LM9A 3FXEB 2YEVC 3SY2A 3ZHEB 2LEHA 3DSTA 4U63A 2CHXA 3S7DA 5L4EA 2WDVA 5EK3A 3KEZA 4HWHA 4PW8A 3MKQA 5FNVE 4OAVB 5KNHD 1X81A 5AQBA 1EPUA 3UU5A 2CG3A 3ASFA 2HO1A 2YU2A 4U07A 3AA0B 3JAFA 4ANJA 2CHNA 3G2WA 5AIJA 2IO3C 4P0AA 3ASHA 3C5RA 4UELA 3O9XA 3PH0C 4DBQA 1E7PA 2CHOA 2LJLA 5HXEA 2XQ4A 4HFIA 2VGXB 1BR2A 4JLEA 5J0ZA 2UUAT 5GONE 1FJGT 2BVLA 3QUJA 2PL2A 4DPRA 3QB5A 1X5BA 1WRDA 4H9RC 2X6JA 3AS5A 3QJZA 4ILBA 2VTBB 2V6YB 2MOWA 3RAUA 1MJ0A 4HFEA 3L08A 3PZ1A 5HAXA 4DLQA 1KZPA 3S4UA 3VU7H 3W15B 3KFWX 3TG4A 2DBAA 4UWHA 2AXDS 3I1AA 3TLWA 4ILUA 4TUMA 3D9IA 2BBHA 3HVEB 2HYZA 1JCRA 4HFGA 2XRZA 2WQHA 3FUJA 3X2QE 4V1Av 2BG9C 2BS4A 3CVPA 4KZCA 1WR6A 3E22E 5IYZE 3NRXA 4I50E 4P09A 2LOPA 2LRKA 3OYXA 3Q47B 3LCAA 2NXPA 3RKOA 3I9WA 5BR8T 3I4RB 3F31A 3O4XE 3P50A 2OLTA 2E2EA 3FWVA 1N0RA 3N9NA 2NR4A 3C3OA 2NW9A 4JYAT 2CWYA 3U4TA 4HE8A 1OWMA 3HI2A 3FTUA 3ZN1B 5HXHA 5JJTA 1YMPA 5J2TE 5FQ8A 5C3JA 1NA0A 3CHQA 3TLTA 4HLEA 2E5VA 2QYJA 2QRXA 2CHZA 3U64A 1TNUA 2VVSA 4FJOA 3ONLA 2RFMA 3EHRA 3PE4A 1O1RA 3MKRA 4EPZA 2KNDA 4LEUA 3ZRHA 4J0UA 1QLBA 3AEBA 3HKBE 4LERA 4WNDA 1MHQA 4DUYT 3TL5A 4MFRA 2RG8A 4B0ZA 2XQ6A 2XEEA 5FQ6A 3LS8A 3BUAA 3RRUA 4YNDA 3ZKJA 1QBQA 2IO2C 4HWIB 3CK6A 4ANXA 3PJAJ 2WWUA 4AY6A 2CFZA 3VLEA 1YYHA 3PE0A 3V5UA 1B7TA 4BAYB 4GZDA 2XENA 3Q7FA 4PK5A 5E75A 3FU5A 2CE7A 1UUSA 5HXCA 4G1TA 1N94A 1G73A 3N9MA 3LPZA 3N9PA 3BK9A 4OK0A 4HRLA 2YDSA 1SZAA 5AAOA 5J2UE 2NTYA 5ABGA 4XIFA 4NUUA 2CXFA 5IWAT 5LBQB 3FUEA 4CZ2D 4FC8A 2FO1E 4Z68A 3R84B 1FMWA 2FBNA 1U5PA 3HKEE 2XQ3A 1JCSA 2OVFA 2HR2A 2Y3AA 2YKSA 4QH4A 5T4YA 4IE7A 4LCTA 1V55E 4N5CA 3PRZA 1D0YA 4U0ZA 4LNGA 2ZGGA 3I9YA 4JHRA 4DV5T 1YKHB 2VGYA 3AEDA 2KLQA 3IF8B 1DU2A 1RZ4A 2ETCA 4C0MA 2BVMA 2X51A 3E34A 3DSXA 1MMAA 2VQET 3RLFF 3NB2A 2PJQA 4JI2T 2X6FA 1MIVA 3ULYA 3FTZA 2L9QA 5LNKA 3OJAA 4Z8XA 3T1YT 5CERB 5EIDA 3T1HT 3SBTB 4HFBA 4X1KE 5LA6E 2WU5A 4B3MT 3N2OA 2YHEA 4GTPA 5AQFB 2K48A 2N1GA 2KCVA 2XQ5A 4U2YA 2EILE 2GRLA 1GW6A 3E32A 5ANRA 4DLOA 1HU3A 2WM9A 4R7LA 3AE5A 5FVLA 2R05A 4X64T 1P5QA 2ACXA 4J2CA 3LFMA 4L7TA 4ZZCA 3LG7A 5LMNT 1KT0A 4B6XA 3CMLA 2DYRE 1WAO1 3PUJA 2W61A 4JI7T 4LFAT 5JHBA 4J6IA 3LY7A 4LF7T 4GA0A 3G2VA 1I94T 2PBIA 3KV6A 2Y0BG 3D9NA 4ILHB 5HEGA 3DSVA 4IL9A 4G11A 3SZ7A 4C90A 1D8EA 2X9WA 1IHGA 2ZM0A 4FHJA 3HVEA 4NIKA 2NOXA 3VR8A 4DX6D 5HCMA 4U0UA 4IULA 4DK5A 4PJMA 4HQDA 2WWVA 3OKQA 3FEXA 5AQ7A 2KZTA 3P4SA 3HDXA 2X66A 2BG9B 1QZ2A 3KEAA 4GCOA 3RH3A 1MMNA 4KUMB 1NWMX 5LHHB 4JC8A 5E0OA 3ZC1A 5KDMC 1KZOA 5ITZF 2W67A 3L8RA 4EGWA 5L3FB 1FVFA 4HRNA 4EBAG 3DP7A 1N32T 2IQCA 3EUVA 3LY8A 2ZXWE 4PFOA 4WNFA 2KZ7B 3L09A 3ZSTA 4A97A 3ZMTB 5FQ4A 1U2VG 2GRMA 1X9BA 1I6ZA 4K5AB 4ILGA 2XS8A 4DUZT 3D3MA 1J5WA 2WDQA 3P4QA 4GKKT 3IEGA 2V7IA 1UX5A 5DQWA 3E37A 1O5MA 1N36T 3PS6A 5BW8C 4AJWA 3S7BA 4ILAA 3O1HA 2X67A 3C4XA 3MX3A 3RQUA 1Z3XA 3IHYA 4DMVA 4UI9K 4EZJA 2P9BA 1SA4A 2V5QC 3P8CD 4LMKA 3AE1A 4DR1T 4U96D 3A7MA 3TXNA 1E8ZA 3RF1A 3AG3E 4BEPA 3F57A 2WXLA 2LHNA 1OEDB 2QA7A 1IAPA 4DR7T 3PZ3A 4ZI2C 3FB2A 5FVKA 3FULA 1S63A 2MBGA 2X0YA 1UGOA 5LJNA 3RYHE 3AE8A 2LLYA 3MACA 5AQJB 3RRNB 3AS8A 4O1PA 3FH5A 4RG9A 3KV9A 5LGUB 4EZKA 5CJ5A 1TNBA 4I1AA 3TLVA 3NWIA 5FL0A 4DV6T 4A98A 4A1SA 4HORA 5EX0A 4TV9E 2LSIA 2R03A 1ZEEA 3QWWA 2A2FX 1OWOA 5L3GB 3JUEA 4NURA 2C0LA 4K0RA 1IJ5A 3DPDA 3Q9DA 1JNZA 1NENA 4AY5A 3PE3A 5HI7A 3CHRA 3J5PA 4C48B 4F53A 4GCNA 4M3OA 2RP4A 4JI3T 2BS2A 1IJ6A 4ACKA 4LMJA 3VHLA 2B6CA 4I4TE 1W09A 4GYRA 3DBSA 5FMNA 3PUZF 3ZSSA 4I2ZA 1MX4A 4JA7A 1MZCA 3JADA 3PV0F 1H2TC 3RO2A 5HEUA 3VRAA 1OXZA 3I4GA 2UXCT 5M72A 1BPOA 4WWOA 4BESA 2KZTB 3APFA 4WBNE 4C9BB 2J4BA 1V54E 5L4HA 5JDMA 3GZ1A 3FZMB 3QWVA 2WB2A 4KBQA 3R9MA 2BEDA 4ATZD 5AQTB 3UULA 4EYUA 3RKVA 2KXPB 3F6QA 2XTLA 4HBDA 2IAKA 3HXBA 4QH1A 2VSYA 5AQGB 3BQLA 5JRCB 2QZAA 3P7IA 4MLPA 3FEYA 2UXXB 2AXZA 4EBAA 1S0PA 3DSWA 4H63H 1ZOYA 4ANUA 2LKGA 2PZIA 3VTXA 5LB7B 1PC2A 3CQGB 4AKRB 3LK3B 2GRNB 4EHMA 2LXLA 2K3WA 2JQHA 2JEKA 2N9DA 4ZS3A 3L6AA 2HHHT 3AEAA 2V0PA 2JIWA 3FU3A 3C3QA 3V2XA 4ANWA 3V79K 3MJXA 5M4YA 4DX2A 4F6RC 2WAUA 5C2TA 3VR9A 2H6FA 2LO6A 3EU9A 4GZ5A 3AAIA 1O3XA 4QQIA 3HG0D 3ZHEA 2WXGA 5IUXA 3CKDA 3QC9A 2XZTG 5H6RB 5FINA 4YSXA 2H6HA 4COFA 2WXHA 3B7SA 1ELRA 3CHSA 3SNXA 3L16A 1N4SA 4LNBA 2XAGB 3S2AA 3ZIMA 4DIDB 3PEUB 3UUBA 2XAJB 4HOTA 5D0QD 4GTMA 2CLYC 3MXZA 3UIOC 3RI5A 3RQWA 3LSVA 3EIJA 4ZI7E 4X62T 4OAUC 2OOEA 3LVRE 4GA1A 2XEHA 3FZKB 5JDLA 1XMOT 3CX7B 4M7CA 4UV8B 2WP9A 1H6OA 1K3ZD 2LAIA 5AQSB 1KLXA 2HM8A 3UFGA 3U3WA 1Z6TA 3ZMSB 2E9XA 5KJMA 3EVYA 1M7KA 3VLDA 4BX9A 4ZFHA 4J7WA 1HNWT 2C2LA 4DR3T 3ML8A 1E1HB 2LHRA 3FTWA 3CPZA 3KD7A 4FLHA 3GA8A 3ONLC 4Q94A 3UINC 3ZXPA 3L22A 3LXUX 2JQ9A 4JBWF 1D0XA 4CT4A 1R8IA 3EABA 3ZT7A 2M6BA 1L0VA 1WYCA 3HRAA 1SE7A 3OTNA 3CWZB 3JQ1A 2J07A 3QB2A 3SD5A 1XZYA 4G63A 4NIQA 3ZYMA 2OCCE 1UOHA 4KZ0A 3QB5K 4UWLA 3EDUA 1UK5A 1FEWA 3ZNGA 3NAWA 4JI6T 3T9KA 4OFZA 1H6KA 3Q2MA 3Q5WA 1IYGA 3CX6B 2LE8A 1IQRA 4DX7D 3RIUA 2XY8B 4G25A 4Y6WA 4O1OA 1SA5A 2YNQA 4BTAA 3T8KA 3SI5A 4U2ZA 5HEHA 3UU4A 2X0LB 1M62A 2W4XA 3ESLA 3MA9A 4EEDA 4JHKA 2D0TA 2V6YA 2VTBA 3SGHA 4N78D 4HVBA 4AXHA 3G2SA 1ZB1A 4UR9A 3SFXA 3ZXSA 1NEKA 3U66A 2JPFA 2F8XK 2I0MA 3APCA 2EHOA 3AA7B 1D1AA 3LBXA 3NOGD 5HS0A 3TWWA 2IMLA 1HS6A 4F1SA 1KEYA 3NVOA 3IKOB 2HH7A 2QYWA 2WZHA 4CI1B 3TWRA 3DXKG 1XNFA 4JB8P 2LSUA 3Q4AB 2DZNA 3ETVA 3B7RL 3ZEFA 1OWAA 3RPUA 2VKOA 3F2EA 2LKHA 3CVNA 3KBUA 3LDZA 2Q9QB 3AECA 4TXPA 4MKTA 2X38A 3D9OA 5AQRB 4LFBT 2JMHA 1JCQA 4MRUA 4GTTA 3UT7A 1V9DA 3ZMUB 4HTEA 2GGFA 3CVYA 5AQLB 2LUHA 1HF8A 3SWHA 1YCSB 2AWIA 3ZVVA 3FZFB 4Q96A 2J62A 5C8YE 3UFEA 5AFUL 2WSSV 4PJNA 4OYKA 2L6BA 4HWCA 3EHMA 3OVUA 3MCXA 2LRLA 3JUIA 1H7CA 1OY3D 1U3CA 1UURA 1WDYA 2WMNA 2J49A 3R7QA 2IDOB 2D9DA 4AISA 4AKGA 4U0SA 2WVIA 1HS7A 5JH7E 1VDYA 3GMIA 4YDOA 2EIME 2VURA 5HWXA 4GTVA 4XI9A 4OX9T 4J8FA 1H2VC 4IN3B 5F5WA 1N54A 2YK0A 5A1LA 2HN2A 4XZCA 4AKLA 2CWOA 4GKJT 3P4PA 3UIPC 5HKPA 4GTSA 3K3QC 1E7VA 2GRPB 2WY2A 3PUWF 3FUMA 5ABEA 3FU0A 4IDNA 4NUVA 2ODUA 5JJ6A 3O1JA 3FUIA 1DNPA 2NYJA 1J1JA 4YT0A 4BSXA 3ANWB 2ZM2A 1OCOE 3CKBA 1Q2ZA 4Y6CA 2ETBA 2P9UG 2WQ6A 2WBLA 2KCKA 2GRRB 5ARFA 3CSTA 1SZ9A 4EAHA 3JAEA 2H6GA 5A7DB 3TLSA 3AEFA 4IHJE 5B1AE 3ZYKA 5J08A 4JW1A 4L23A 3KINB 4OHFA 3ML9A 4DV1T 4KHPT 3EIQC 3N9QA 5L3BB 2XZDG 3Q49B 1YA0A 3AB3B 3RRWA 4G8KA 2KM4A 4B8CB 4TXQA 3ZN3A 2YDRA 4H9PC 2WU2A 4O4IE 4XKBA 1OWPA 2D0UA 2IF4A 3P4RA 3EU5A 1TNZA 4HNAD 4I6EA 5FIOA 4H7XA 3SS1A 5JR9C 3LJNA 3N71A 3AE3A 5AQNB 1RW2A 1XNQT 3RYFE 3RC3A 3C51A 4E7ZA 1VRBA 4EYYR 4H9QC 2AE9A 4D10C 2D5UA 4QKNA 4GYOA 5CBOA 4GZCA 4J8YA 2PM6A 2BKPA 3DXMG 4GPMA 1A5EA 2I2OA 5LJMA 4BX8A 4DVDA 3CVLA 2WXIA 5KJLA 4HS2A 4ILCA 4PJJA 5JJ7A 3PUVF 4F7AA 4NXMT 2J09A 3PUYF 4L2LA 2WXRA 3AXJB 1MIYA 4QXBB 3AAAB 4ZXLA 3FHEA 3KAEA 4PDXA 3C4WA 2EINE 3Q5EA 4FHKA 3RYIE 1QSDA 4YSYA 5FZQA 2DNXA 3Q75A 2BDEA 3UT4A 3CVVA 1DC2A 3AVSA 3FP3A 4NPPA 1U3DA 1YQ3A 4GPKA 2LSJA 4CGWA 4IYPA 3VRBA 2CM0A 3JCKC 3L39A 3N2GE 3AVRA 2ONDA 2EIJE 2C0MA 3MKDA 1NAFA 3BQIA 4IT4A 3AE2A 4B3RT 5L3CB 2KT9A 4PNIA 1BLXB 3UM2A 4I43B 1OUVA 3UUMA 3TWQA 2R59A 4L5GA 5FWQA 5A6CA 3GW4A 5CGMA 5ENPD 3HXDA 4C0EA 2Q9QC 3SF4A 2D2SA 4I43A 3NZSA 4YFSA 1O1SA 3NQPA 4Z91A 4FA6A 3PZ2A 5AJDA 4J8EA 4APOA 3H3AA 2KWHA 4GK0E 2IFUA 3ZU7B 5HQ8A 3P1UA 3UKUG
chains in the Genus database with same CATH topology
4A56A 3LY9A 3Q5XA 3PURA 4ZHQE 2CLYB 4PFPA 4TN7B 3RO3A 1FVHA 3E08A 2DIWA 3GYZA 5G04C 4AP2A 3CK8A 5LHGB 1WLXA 2CXLA 2E9XB 4WUYA 5F8PA 3RRCA 1WY6A 5JDGA 2X9HA 4CXXA 2XPZA 4UWFA 4L2YA 3CHMA 4HOUA 3AS4A 4QFVA 3D9JA 4A3VA 4CXYA 2VSOE 4Q69A 1BR4A 2WXMA 3D9LA 3B57A 4ASKA 3MJWA 5C1DA 4UVCB 4H9OC 5FXXA 5FP3A 5JRCA 2A4ZA 5ARGA 3KV4A 2BZBA 2QGSA 2YU1A 4BJNA 4EZ4A 2JLBA 3U78A 1UN9A 1B89A 2RD0A 4I55E 3ZYLA 3BQKA 4UV9B 3JC6C 5LGTB 5J90A 5CA0E 1ZU2A 4U72A 2IC6A 3UTKA 2IOLA 3OBVE 3NZUA 4WBOA 1UG3A 5G05J 2V26A 4XZ4A 3I0OA 4EECA 2FI7A 3NRYA 3ANWA 5FZSA 5KCMA 4IGUA 4L9IA 5DJQC 2WMOA 4ZI2D 3E4BA 3OAWA 2J9QA 4E7SA 1US7B 4CDNA 1MMDA 2FO7A 4GYWA 4UI9J 4JEHA 3CHOA 4PH4B 3DTOA 2KATA 3V5SA 2VJ8A 3L13A 2MOZA 4ANVA 1D0ZA 2HPJA 3WAKA 3LYAA 3IHRA 4I9EA 4AM9A 4HGAA 4K03A 2L3LA 4MLKA 2YHCA 4TUUA 5G04J 2PQRA 4H63V 3SRZA 3PUAA 2VASA 3DJBA 3ZJ1A 1S94A 4I9CA 4IE6A 4O4HE 1HE8A 3H37A 2XAQB 4I17A 3BEEA 1BR0A 2ZLYA 4GMLA 4MS6A 2WXFA 3KS2A 2PQNA 2I1JA 4UF0B 4TV3A 4IE4A 3HA4A 3WI3A 4GA2A 5CMYA 2Z6EA 3ULQA 5FQ7A 3B7UX 2KINB 3CSFA 1INZA 2YQ8A 4I6JA 4NQ0A 1N52A 5FYMA 2J4DA 3LJ3A 5FXZA 1NA3A 4G2AA 1SHZC 5EK4A 2GK9A 3K3OA 4AXPA 4QHOA 3TKLB 4FJZA 4KXKB 2H7OA 2LSGA 1HH8A 3KDSE 1IQUA 5EX3A 3FUDA 1S35A 3ZC0A 2NWBA 4EIWA 3CX8B 2M63A 4NACA 3WAJA 2A5UA 4BWRA 1VOMA 3PDYA 5ANLA 3D9KA 3OXLA 1Z3YA 3MA5A 3GZ2A 2X6HA 3ENEA 2XASB 3QK0A 5FJYA 3I5PA 3TAXA 1YD8G 3BG0B 4UEMA 3ZCIA 3RU0A 4GIWA 1UCUA 4YJ3E 3LBXB 1H0AA 5BMVE 1D1CA 5DIZA 2Y4UA 1HG5A 3J9X1 5L2LA 3EUHA 2VYIA 3D9MA 1QQEA 5JDQA 5EZYE 4IRUA 2NW7A 3CVRA 5LG4A 1H2UA 2LSKA 4QX7B 3ZMZB 1MMGA 3FTVA 3UX4A 2Y6XA 4FULA 4UQYA 5G55A 4AQGA 2WQ7A 2CG2A 3QC1A 5F3JA 4HKAA 2WXKA 2V7KA 4APFA 5KX5E 3M65A 2PM7A 3LK42 2GW1A 3VKHA 2VK9A 4EXTA 3IBPA 2KC7A 4YLHA 3JQ0A 3CHPA 4E85A 3LEWA 3ONXA 4AQFC 1OWNA 2ZMAA 2XCCA 3MEKA 2MRIA 1ZV4X 3AU5A 1HO8A 4GB9A 4PUCA 5BNWA 2VKJA 1ZBPA 3FY4A 3EDVA 2KCLA 3ZCJA 4CXWA 2A72A 3CQCB 4A3TA 4K0UA 2XHEA 3MV2B 5LCWJ 4O2BE 5L3EB 4UQZA 2XCBA 4PAGA 1TEZA 1A17A 1HX8A 5TAOA 4X20E 3ZFWA 2ZM8A 2MTQA 4TRQA 3K3NA 3GN5A 4GZ6A 1UW4B 1X79A 4KT6B 3FH8A 2UY1B 3KBTA 1JPLA 2L0IA 2XAFB 1E8WA 2J08A 2FULA 4XAXB 3HKCE 3IEEA 3I3NA 2YINA 3PVLA 3N9LA 4JUYA 3VTYA 3SFZA 4H9SE 3RIBA 4FI5A 4CGVA 5BPPA 4I6GA 5JDFA 2NSZA 2DCFA 2N2NA 2LNIA 2XPIA 3P2BA 4WWNA 4GMJA 1EDUA 4I1MA 1ELWA 4UVBB 1L5JA 4BJMA 2OV8A 1E8XA 2XAHB 4ME2A 5LX8A 1HZ4A 2CA5A 3KVBA 3CR3A 1YW0A 1UJKA 2E9XC 2LOSA 5FT9A 2UY1A 1MNEA 4CZZB 5AYWD 3T8MA 1T98A 4U8HA 2J1DG 4OYJA 5JREA 3RJVA 2C5JA 2I6HA 2L0TB 2VSXE 3LK2B 4G2VA 4WW0A 4RSYA 3RK6A 4ATGA 2V7MA 3ZW3A 4G23A 5A23A 4IDZA 2OVBA 3CEQA 2NW8A 2I59A 2XHEB 3OYZA 3EHNA 2FEZA 2UXNB 4FADA 4BT9A 4HOSA 2NC9A 4N3BA 2V5FA 4AKIA 3RC8A 5CB4E 4QXCB 3UPVA 4A1GA 3S7JA 3FBLA 4YJ2E 2MHKA 3TGOA 3ZJ2A 2LSYA 2HPLA 3APDA 4B94A 2JQQA 3T5VA 1E7UA 3U9WA 4B8AA 3MGBA 4O6FA 3FUNA 5FZRA 4AV7A 4KP3C 4YHJA 1HXIA 2Y4TA 4O8SA 3ZYQA 5JDNA 3OXFA 3CVWA 4ILIA 4DNDA 2VKDA 3CVQA 1LVKA 3IBEA 1WYBA 4UQXA 2KMFA 2KWIB 3A5XA 3T8OA 1TJFA 2DWKA 4MHCA 3N5LA 1HCIA 1NZNA 3C98A 5H6QB 3PUKA 2VL8A 2W62A 4KYOB 3QNKA 5DBKA 2XEVA 2XGSA 4N39A 3QWPA 1YKEB 2V7LA 4V3IA 3AAEB 4PS3A 3I0QA 3S7FA 1ELKA 3GZSA 3VLFA 3IHVA 4P0BA 4UWGA 1IZNB 4YVQC 2ZU6B 3C50A 4O4LE 5HWYA 2H7VC 3FFLA 4AKHA 3FUFA 2WXOA 3R7RA 2R5SA 4ZS2A 2X9YA 4WNGA 3HHMA 4CDMA 3FXDB 3PZDA 4CQIA 3GWHA 2BUGA 1DVPA 5JHAA 3N2KE 1EF1C 4RG6A 1FCHA 3R6NA 1Y6IA 3K8PC 3PUQA 2X6IA 4BT8A 2DCPA 2BTDA 2C5KT 3CK7A 4LRZA 4CRWA 5BV0A 3IV0A 2DI4A 4OVVA 3G2UA 1HTJF 3SOLA 4MBQA 4TX5A 5CMWA 1W3BA 3ZGQA 4P29A 4AI6A 2W63A 3FUKA 3CVXA 1MNDA 2CEAA 3O4ZA 4JZYA 3B7TA 4U04A 3QK6A 2XGOA 2AXVA 3ZMVB 2UWJG 3ZLIA 2VQ2A 1UJJA 5ADXL 3UQ3A 4XBFB 2ES0A 4FJYA 3ESKA 5T3RA 3GN5B 2VB6A 2K5BB 3Q5MA 1LKXA 4TUYE 5G2NA 2LSVA 2QY7A 3UMVA 2SPCA 4N3CA 2CFUA 4KMOA 4FU3A 5ETWA 4L1BA 4AIFA 4C91A 4ZI3D 4BTBA 4CDRA 3PUSA 4ABNA 4I1OB 2VSNA 3MZLB 3MZKB 4KBMB 4OYSA 2IJGX 2X68A 3UT8A 3FUHA 4ADZA 4JEUA 2WPVA 4DI3A 3E0ZA 3CKCA 5FXWA 3CV0A 3LVQE 3RRMB 3K9IA 2V8SE 3BG1B 3Q15A 5CA1E 3SBSA 1WM5A 2L9BA 5JR9A 3PTRB 4XI0A 1OWLA 3UUXA 3EDTB 3QARA 5LP0A 4HN9A 3ETUA 4JXTA 1LRZA 4PK4A 3HIZA 2WXPA 4FP7A 5HXRA 2I1KA 1CUNA 1NP7A 5ENNA 3SHFA 2X9XA 2WXJA 4NRHB 4ISTA 3MK7C 1E90A 5FY0A 2E0IA 4IE0A 4I2WA 4JL0A 5IHYA 2Y8DA 4GYSA 1Y64B 4IIJE 3AU4A 3FHNA 1KT1A 3CVUA 1TJCA 5G05C 4XKCA 2AW6A 3WXXA 1MIWA 2DHRA 3PNTB 2DLRA 4QX8B 4WAFA 3URZA 3NZQA 3C4ZA 1MQSA 2V4LA 3U3IA 1H19A 2IU1A 3LKUA 4XX5A 4JVSA 3C64A 4QWNB 3MKQB 4UF0A 4DMWA 4N2SA 2WXNA 4HFVA 3FTYA 2XGMA 1UN8A 2EHOD 4EB6E 4PK6A 2L6JA 5LP6E 3RYCE 1LVFA 4BA9A 3CIAA 3ASGA 1XGWA 2AXUA 3D9PA 3PREA 4GAAA 3MV3B 3L17A 5LFAA 4KVOA 1QNFA 4CT0A 3O1IA 4GU5A 2IONA 4L0RA 4LUNU 4MALA 2XQYA 3KVAA 3TJPA 1D1BA 1BR1A 4ZI3C 4JPSA 3TXMA 5DQVA 4M1PA 3UUNA 2XRYA 2QFCA 5EK2A 5J1GA 1AJ3A 5LXTE 1E8YA 3JC6D 4AVXA 3QAQA 4W9RA 1HG2A 2XUEA 1HFAA 4XE0A 2K9AA 4DI4A 4YVOA 2Q9QA 2EQXA 3KV5A 3ONKA 4X1YE 5HXSA 2Q7FA 2VWAA 4CEMA 4EZHA 4H9NC 2ILRA 4O4JE 2EHOB 2CMRA 3NF1A 2AVPA 4WNEA 1EYHA 1ZKEA 1EZ3A 3AA1B 3O48A 1FIOA 5CCLA 4JEHB 3ZN0B 3B13A 1PAQA 5LCYA 5L3DB 4G26A 2NTXA 4WNKA 5FXVA 2IW5B 2PFVA 5LOZA 4J8DA 2VGXA 5EDSA 3HYMB 2JMKA 3R9AB 5FY1A 3G2TA 5AENA 3L3PA 4BFRA 3ZEFB 5FY7A 5KJNA 1PY1A 3PUGA 4ZOLE 4DJAA 3FTSA 3MYVA 5D0OD 5LCWC 5BT1A 5FTPA 2IC9A 4JEUB 4UI9C 2L8KA 2ODVA 3PEVB 2CHWA 2X3MA 2EHOC 4JHJA 1U4QA 3FH7A 3EJNA 4UIGA 4KMCA 3J7Yq 4OVUA 4G24A 2JRKA 2X6KA 4RVBA 2WXQA 3PU8A 4WWPA 2PG8A 1ZHCA 3LJCA 4EZLA 4FLBA 4PS7A 1Y8MA 2C0SA 4JA9A 2OA5A 4PJLA 1QUUA 3PU3A 2W00A 1G8XA 5LBMA 2M67A 2W0GA 3CLJA 5JVDE 5LOVE 2XPYA 5JR9B 5CCMA 3VKGA 4X1IE 2CCQA 2I9CA 3T5XA 1JWGA 2A3DA 2C5IT 5LGNB 3CQXC 4UXNB 3ASDA 4ERRA 4TV8E 4E6HA 4TZ4C 4AOFA 3NBXX 4CCAA 5LHIB 2E8IA 4ISSA 5BV1A 5JQGE 2E9XD 2BF0X 2B1EA 2IOSA 5AJLA 4EQFA 5KJKA 4URKA 4U74A 1FMVA 1SA0E 5EKQD 5LYJE 1KK7A 4AEZC 3CK9A 3HKDE 1JWFA 3QOUA 5JDHA 3NZPA 2VKHA 2R17C 4BY6A 3RX6A 2FF4A 4UWKA 4HOQA 2V7JA 2CXDA 1UX4A 4IE5A 3PDNA 4N3AA 3D0TA 5T8IA 2LT3A 2P58C 3L54A 5E76A 2XQ0A 4A55A 4KVMA 3FTXA 1KNZA 2V1DB 2MYSA 4UVAB 2RA1A 3HL6A 4H7YA 4J8SA 2Q9QD 3ZPJA 3N9OA 5C2YA 3CGHA 5HYAA 2LAHA 2K24A 2DWGA 4GYYA 4HEAA 4DO0A 3PNLB 1E96B 2G0UA 3QKYA 3FBZA 4GOUA 5CHEE 4GZ3A 2H3RA 3ZPOA 3C98B 4O2AE 3FDHA 2JJ9A 4PS8A 4DBRA 5KMGP 4AQFA 4ACLA 5BUZA 3AA6B 2Y48B 4EOZB 3JYSA 3HR0A 1Z0PA 1SQMA 4QXHB 3UT5E 4GK5E 4N2QA 4CI3B 4CI2B 1JUQA 3UUXB 1LF8A 3QDNA 3FU6A 3OXGA 3TG5A 4F3VA 4B89A 2NP9A 5DABA 4HXIA 2LM9A 3FXEB 2YEVC 3ZHEB 2LEHA 4U63A 2CHXA 3S7DA 3KEZA 5EK3A 4PW8A 3MKQA 5FNVE 1EPUA 2CG3A 3ASFA 2HO1A 2YU2A 4U07A 3AA0B 4ANJA 3G2WA 5AIJA 4P0AA 3ASHA 4UELA 3O9XA 3PH0C 4DBQA 2LJLA 5HXEA 2VGXB 1BR2A 4JLEA 5GONE 2BVLA 3QUJA 2PL2A 4DPRA 1X5BA 1WRDA 4H9RC 2X6JA 3AS5A 3QJZA 2VTBB 2MOWA 3L08A 5HAXA 4DLQA 3S4UA 3VU7H 3W15B 3KFWX 3TG4A 2DBAA 4UWHA 3I1AA 4ILUA 3D9IA 3HVEB 2HYZA 4HFGA 2XRZA 2WQHA 3FUJA 4V1Av 3CVPA 4KZCA 1WR6A 3E22E 5IYZE 3NRXA 4I50E 4P09A 2LOPA 3OYXA 3Q47B 3LCAA 2NXPA 3RKOA 3I9WA 3I4RB 3F31A 3O4XE 2E2EA 3FWVA 3N9NA 2NW9A 2CWYA 3U4TA 4HE8A 1OWMA 3HI2A 3FTUA 3ZN1B 5HXHA 5JJTA 5J2TE 5FQ8A 1NA0A 3CHQA 4HLEA 2CHZA 3U64A 4FJOA 3ONLA 3PE4A 3MKRA 4EPZA 2KNDA 4LEUA 3ZRHA 4J0UA 3HKBE 4LERA 4WNDA 1MHQA 3TL5A 4MFRA 2RG8A 4B0ZA 5FQ6A 3LS8A 3RRUA 4YNDA 4ANXA 2WWUA 4AY6A 2CFZA 3VLEA 3PE0A 3V5UA 1B7TA 4BAYB 4GZDA 4PK5A 5E75A 3FU5A 2CE7A 5HXCA 4G1TA 1G73A 3N9MA 3LPZA 3N9PA 3BK9A 4OK0A 1SZAA 5J2UE 2NTYA 4XIFA 4NUUA 2CXFA 3FUEA 5LBQB 4FC8A 3R84B 1FMWA 2FBNA 1U5PA 3HKEE 2OVFA 2Y3AA 2HR2A 5T4YA 4IE7A 4LCTA 4N5CA 3PRZA 1D0YA 4U0ZA 3I9YA 4JHRA 1YKHB 2VGYA 2KLQA 3IF8B 4C0MA 2BVMA 2X51A 1MMAA 2PJQA 2X6FA 1MIVA 3FTZA 2L9QA 5LNKA 3OJAA 4Z8XA 3SBTB 4X1KE 5LA6E 3N2OA 2YHEA 2K48A 2N1GA 2KCVA 2GRLA 1GW6A 5ANRA 4DLOA 1HU3A 2WM9A 4R7LA 1P5QA 2ACXA 4J2CA 3LFMA 4L7TA 1KT0A 3LG7A 4B6XA 3CMLA 1WAO1 3PUJA 2W61A 5JHBA 4J6IA 3LY7A 4GA0A 3G2VA 2PBIA 3KV6A 3D9NA 4ILHB 4G11A 3SZ7A 4C90A 2X9WA 1IHGA 2ZM0A 4FHJA 3HVEA 2NOXA 4U0UA 4IULA 4DK5A 4PJMA 3OKQA 3FEXA 2KZTA 3HDXA 2X66A 1QZ2A 4GCOA 3RH3A 1MMNA 4KUMB 1NWMX 5LHHB 4JC8A 5E0OA 3ZC1A 5KDMC 5L3FB 1FVFA 4EBAG 3DP7A 2IQCA 3LY8A 4PFOA 4WNFA 2KZ7B 3L09A 3ZMTB 5FQ4A 2GRMA 4ILGA 3D3MA 3IEGA 2V7IA 1UX5A 5DQWA 3PS6A 5BW8C 4AJWA 3S7BA 3O1HA 2X67A 3C4XA 3MX3A 1Z3XA 3IHYA 4DMVA 4UI9K 4EZJA 2P9BA 3P8CD 3TXNA 1E8ZA 3F57A 2WXLA 2LHNA 2QA7A 1IAPA 4ZI2C 3FB2A 3FULA 2MBGA 5LJNA 3RYHE 3MACA 3RRNB 3AS8A 3FH5A 4RG9A 3KV9A 5LGUB 4EZKA 4I1AA 4A1SA 4HORA 5EX0A 4TV9E 2LSIA 1ZEEA 3QWWA 2A2FX 1OWOA 5L3GB 4NURA 2C0LA 4K0RA 1IJ5A 3DPDA 3Q9DA 4AY5A 3PE3A 5HI7A 3CHRA 4F53A 4GCNA 4M3OA 2RP4A 1IJ6A 4ACKA 3VHLA 4I4TE 4GYRA 3DBSA 5FMNA 4I2ZA 4JA7A 1H2TC 3RO2A 1OXZA 3I4GA 5M72A 1BPOA 4WWOA 2KZTB 3APFA 4WBNE 4C9BB 2J4BA 3GZ1A 2WB2A 5JDMA 3QWVA 4KBQA 3UULA 4EYUA 3RKVA 2KXPB 2XTLA 2IAKA 2VSYA 3BQLA 5JRCB 3P7IA 4MLPA 3FEYA 2UXXB 2AXZA 4EBAA 1S0PA 4H63H 4ANUA 2PZIA 3VTXA 1PC2A 3CQGB 4AKRB 3LK3B 2JEKA 2N9DA 4ZS3A 3L6AA 2V0PA 4ANWA 3FU3A 3MJXA 5M4YA 4F6RC 2WAUA 4GZ5A 2LO6A 3AAIA 1O3XA 3ZHEA 2WXGA 3CKDA 3QC9A 5H6RB 3B7SA 2WXHA 1ELRA 3CHSA 3SNXA 3L16A 2XAGB 3S2AA 3ZIMA 3PEUB 2XAJB 4HOTA 5D0QD 2CLYC 3MXZA 3EIJA 4ZI7E 2OOEA 3LVRE 4GA1A 5JDLA 3CX7B 4UV8B 2LAIA 1KLXA 2HM8A 3U3WA 1Z6TA 3ZMSB 2E9XA 5KJMA 3EVYA 3VLDA 4BX9A 2C2LA 3ML8A 1E1HB 2LHRA 3FTWA 3CPZA 3KD7A 4FLHA 3GA8A 4Q94A 3L22A 3LXUX 1D0XA 4CT4A 1WYCA 3OTNA 3CWZB 3JQ1A 2J07A 3QB2A 3SD5A 4G63A 4KZ0A 3ZYMA 4UWLA 3EDUA 1FEWA 4OFZA 1H6KA 3Q2MA 3Q5WA 1IYGA 3CX6B 2LE8A 1IQRA 4G25A 4Y6WA 2YNQA 4BTAA 3SI5A 2X0LB 3MA9A 4JHKA 3ESLA 2D0TA 2VTBA 3SGHA 4N78D 4HVBA 4AXHA 3G2SA 3ZXSA 3U66A 2JPFA 3APCA 2EHOA 3AA7B 1D1AA 3LBXA 4F1SA 1HS6A 3IKOB 2HH7A 4CI1B 1XNFA 2LSUA 3Q4AB 3B7RL 3ETVA 3ZEFA 1OWAA 3RPUA 2VKOA 3F2EA 3CVNA 3KBUA 3LDZA 2Q9QB 4MKTA 2X38A 3D9OA 2JMHA 4MRUA 3UT7A 1V9DA 3ZMUB 4HTEA 2GGFA 3CVYA 1HF8A 3SWHA 2AWIA 3ZVVA 4Q96A 5C8YE 3UFEA 5AFUL 2WSSV 4PJNA 4OYKA 3EHMA 3MCXA 3JUIA 1H7CA 1U3CA 2WMNA 2J49A 3R7QA 4AKGA 4U0SA 2WVIA 1HS7A 5JH7E 1VDYA 3GMIA 5HWXA 4XI9A 4J8FA 1H2VC 4IN3B 1N54A 2YK0A 5A1LA 4XZCA 4AKLA 2CWOA 3K3QC 1E7VA 3FUMA 3FU0A 4NUVA 2ODUA 5JJ6A 3O1JA 3FUIA 1DNPA 4BSXA 3ANWB 2ZM2A 3CKBA 4Y6CA 2WQ6A 2WBLA 2KCKA 5ARFA 3CSTA 1SZ9A 4EAHA 5A7DB 4IHJE 3ZYKA 5J08A 4JW1A 4L23A 3KINB 4OHFA 3ML9A 3EIQC 3N9QA 5L3BB 3Q49B 1YA0A 3AB3B 3RRWA 2KM4A 4B8CB 3ZN3A 4H9PC 4O4IE 4XKBA 1OWPA 2D0UA 2IF4A 4I6EA 4H7XA 3SS1A 5JR9C 3N71A 3RYFE 3RC3A 3C51A 4E7ZA 1VRBA 4EYYR 4H9QC 4D10C 4GYOA 2D5UA 4QKNA 4GZCA 2PM6A 2I2OA 5LJMA 4BX8A 4DVDA 3CVLA 2WXIA 5KJLA 4HS2A 4PJJA 5JJ7A 4F7AA 2J09A 4L2LA 2WXRA 1MIYA 4QXBB 3AAAB 3FHEA 3KAEA 4PDXA 3C4WA 4FHKA 3RYIE 1QSDA 5FZQA 2DNXA 3UT4A 2BDEA 3CVVA 3AVSA 3FP3A 1U3DA 4GPKA 2LSJA 4CGWA 4IYPA 2CM0A 3JCKC 3N2GE 3AVRA 2ONDA 2C0MA 3MKDA 1NAFA 3BQIA 5L3CB 2KT9A 4PNIA 4I43B 1OUVA 3UUMA 2R59A 4L5GA 5FWQA 5A6CA 3GW4A 4C0EA 2Q9QC 3SF4A 4I43A 2D2SA 3NZSA 4YFSA 3NQPA 4FA6A 5AJDA 4J8EA 4APOA 3H3AA 2KWHA 4GK0E 2IFUA 5HQ8A 3P1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZ9 A;  1SZA A;  3D9P A;  3D9J A;  1MHQ A;  3ONK A;  1PY1 A;  1JWG A;  3D9O A;  5LP0 A;  1H0A A;  3D9I A;  3G2V A;  2DCP A;  4JXT A;  2QY7 A;  4NAC A;  3G2S A;  2DIW A;  2L0T B;  4FLB A;  1EDU A;  3RRU A;  4HFG A;  3ZYK A;  3D9N A;  3ZYM A;  5LOZ A;  1HG5 A;  3ZYQ A;  4AVX A;  5J08 A;  1HX8 A;  1X5B A;  3D9L A;  4GZC A;  1HG2 A;  2LO6 A;  3D9M A;  1UJJ A;  3G2U A;  4FU3 A;  1JUQ A;  3D9K A;  1EYH A;  2MOW A;  1JWF A;  5CMY A;  1HFA A;  4GZD A;  1LF8 A;  4Q94 A;  1VDY A;  2KM4 A;  3G2T A;  2V8S E;  5CMW A;  1HF8 A;  1ELK A;  1DVP A;  3G2W A;  3CLJ A;  3ONL A;  1UJK A;  1INZ A;  4Q96 A;  1JPL A;  2L0I A;  1XGW A;  3ZYL A;  2BF0 X;  3LDZ A; 
#chains in the Genus database with same CATH topology
 4A56 A;  3LY9 A;  3Q5X A;  3PUR A;  4ZHQ E;  2CLY B;  4PFP A;  4TN7 B;  3RO3 A;  1FVH A;  5LG3 A;  3E08 A;  2DIW A;  3UU6 A;  3GYZ A;  4CN1 A;  5G04 C;  4AP2 A;  5EYL A;  3QOF A;  2PTF A;  3CK8 A;  1OCZ E;  4LF8 T;  5LHG B;  1WLX A;  2CXL A;  4HFC A;  3A8Y C;  2E9X B;  4WUY A;  5F8P A;  3RRC A;  3ABM E;  1WY6 A;  2BKO A;  2X9H A;  4CXX A;  5JDG A;  2XPZ A;  4UWF A;  4L2Y A;  4DUI A;  3CHM A;  4HOU A;  1TN8 A;  3AS4 A;  4YDE A;  4QFV A;  3OTO T;  3D9J A;  4A3V A;  2QYU A;  4CXY A;  4G8L A;  1BI7 B;  4TNV A;  4DR6 T;  2KBX A;  3KSQ A;  2IIU A;  2VSO E;  4Q69 A;  3HXC A;  3DEO A;  4F6R D;  3HXE A;  5AQI B;  2FBW A;  1BR4 A;  5AQO B;  2WXM A;  3D9L A;  3B57 A;  4ASK A;  3MJW A;  5C1D A;  4UVC B;  4H9O C;  5FXX A;  5FP3 A;  5KWD A;  5JRC A;  2A4Z A;  5ARG A;  3KV4 A;  4LG6 A;  1T7S A;  2BZB A;  2QGS A;  4EZ4 A;  4BJN A;  2YU1 A;  2WCA A;  2JLB A;  3U78 A;  1UN9 A;  2W66 A;  4B3T T;  1B89 A;  2RD0 A;  4I55 E;  2MAW A;  4A63 B;  3ZYL A;  3Q73 A;  3BQK A;  2P9S G;  4UV9 B;  3JC6 C;  5H7P A;  1N4R A;  3WG7 E;  2DZO A;  3UU8 A;  5LGT B;  5J90 A;  5CA0 E;  1ZU2 A;  4U72 A;  2IHR 1;  5HEO A;  2OEV A;  2IC6 A;  3UTK A;  2DWZ A;  4XEI G;  4U33 A;  3OBV E;  4DV7 T;  2IOL A;  3NZU A;  4WBO A;  1UG3 A;  2JAB A;  2WZI A;  5G05 J;  3V2O A;  2V26 A;  1FT1 A;  4XZ4 A;  3I0O A;  4LF4 T;  4ZEY A;  4EEC A;  2FI7 A;  3NRY A;  3DWL G;  3ANW A;  5FZS A;  1Z8U A;  5KCM A;  4IGU A;  3UQ7 A;  2XQA A;  2BKG A;  2CBJ A;  4L9I A;  4U95 D;  3SO8 A;  5DJQ C;  2WMO A;  4ZI2 D;  3E4B A;  3OAW A;  3L9T A;  3EI0 A;  2J9Q A;  4E7S A;  2GRQ B;  1US7 B;  4HFD A;  4CDN A;  1MMD A;  2FO7 A;  4GYW A;  4UI9 J;  4JEH A;  2XQ8 A;  1H6P A;  3CHO A;  4PH4 B;  3DTO A;  2KAT A;  3V5S A;  2VJ8 A;  3L13 A;  2FJB A;  2MOZ A;  4ANV A;  1D0Z A;  2HPJ A;  4TWH A;  3WAK A;  3LYA A;  2CBI A;  3IHR A;  4I9E A;  3UTM A;  4AM9 A;  3P4W A;  1T72 A;  4HGA A;  4K03 A;  2L3L A;  2KSR A;  4MLK A;  2YHC A;  3TWT A;  4TUU A;  5G04 J;  2PQR A;  4H63 V;  3SRZ A;  3PUA A;  4YY3 T;  4YXD A;  2VAS A;  2FJE A;  3AE9 A;  3DJB A;  4DV4 T;  4DRX E;  2FJD A;  1W0B A;  3ZJ1 A;  1S94 A;  4IE6 A;  4O4H E;  1HE8 A;  4I9C A;  3H37 A;  2XAQ B;  2BG9 E;  5ENT D;  4I17 A;  3BEE A;  1BR0 A;  2ZLY A;  4GML A;  4MS6 A;  2WXF A;  3KS2 A;  3UQ4 A;  2PQN A;  5IY5 E;  2I1J A;  4UF0 B;  2AJA A;  4TV3 A;  5AQ9 A;  4IE4 A;  3RIU C;  3HA4 A;  3WI3 A;  2M6I A;  2P2C P;  4GA2 A;  4KI0 F;  5CMY A;  1XWM A;  2Z6E A;  3ULQ A;  1HNX T;  5FQ7 A;  3B7U X;  2X0H A;  2KIN B;  2F4V T;  2P9K G;  3CSF A;  1INZ A;  2YQ8 A;  4I6J A;  3RIF A;  4CYM D;  4NQ0 A;  5D2M C;  1D8D A;  2DYS E;  1N52 A;  5FYM A;  2J4D A;  3AAA C;  3LJ3 A;  4U7I A;  2J47 A;  5FXZ A;  2DL1 A;  1NA3 A;  4G2A A;  2B0O E;  2V4H C;  1AWC B;  1SHZ C;  5EK4 A;  2GK9 A;  3K3O A;  4AXP A;  3K1S A;  4QHO A;  3TKL B;  4FJZ A;  1XMQ T;  4KXK B;  2H7O A;  2LSG A;  2XPK A;  1HH8 A;  3KDS E;  1IQU A;  3UM3 A;  5EX3 A;  3EAM A;  5BXU A;  4GMR A;  3FUD A;  1S35 A;  3ZC0 A;  2H89 A;  5JA4 D;  2NWB A;  4EIW A;  3CX8 B;  2M63 A;  4TWD A;  5L47 A;  4NAC A;  3WAJ A;  1N34 T;  1IBK T;  2A5U A;  4BWR A;  1N95 A;  3DPY A;  1VOM A;  5HRY A;  3PDY A;  5ANL A;  3D9K A;  3V31 A;  3OXL A;  1KFY A;  1Z3Y A;  3MA5 A;  3GZ2 A;  2X6H A;  3RHW A;  3ENE A;  2XAS B;  3QK0 A;  5FJY A;  3I5P A;  3TAX A;  1YD8 G;  3BG0 B;  4UEM A;  3ZCI A;  3TWV A;  3RU0 A;  1OED C;  5BXO A;  4GIW A;  1UCU A;  1WFD A;  3LBX B;  4YJ3 E;  1H0A A;  5BMV E;  3ONJ A;  1D1C A;  5DIZ A;  2Y4U A;  1HG5 A;  2LXM A;  3J9X 1;  5L2L A;  1Y01 A;  3EUH A;  2VYI A;  3D9M A;  1QQE A;  5JDQ A;  4U31 A;  4BER A;  5EZY E;  4IRU A;  3Q9U C;  2NW7 A;  3CVR A;  5LG4 A;  1FT2 A;  1H2U A;  2LSK A;  4QX7 B;  3ZMZ B;  1IHB A;  1MMG A;  3FTV A;  4RLY A;  3UX4 A;  2Y6X A;  3L82 A;  5ABF A;  4EV6 A;  4FUL A;  5CEC B;  3Q5D A;  4UQY A;  5G55 A;  4AQG A;  2WQ7 A;  2BS3 A;  2VL0 A;  2CG2 A;  3Q9N C;  5F3J A;  3QC1 A;  4HKA A;  3AEG A;  2WXK A;  2V7K A;  4I0U A;  4APF A;  5KX5 E;  3M65 A;  2PM7 A;  3LK4 2;  2GW1 A;  3VKH A;  2VK9 A;  4EXT A;  3IBP A;  4JI8 T;  2KC7 A;  3UI2 A;  1FPP A;  4YLH A;  3JQ0 A;  3CHP A;  4E85 A;  3LEW A;  2KXP C;  3ONX A;  4AQF C;  4L9P A;  1OWN A;  5D66 A;  2ZMA A;  3RIA A;  2XCC A;  3MEK A;  4EEB A;  2MRI A;  1ZV4 X;  3AU5 A;  1HO8 A;  4GB9 A;  4PUC A;  5AQV B;  5BNW A;  2VKJ A;  1ZBP A;  2E5L T;  3FY4 A;  3EDV A;  4F1P A;  2KCL A;  3ZCJ A;  4CXW A;  2A72 A;  3CQC B;  4A3T A;  3AE7 A;  4N5Q A;  4K0U A;  3AE4 A;  1LTX A;  2XHE A;  4U8Y D;  4JI5 T;  3MV2 B;  5LCW J;  4O2B E;  5EN5 D;  5L3E B;  5FL1 A;  4UQZ A;  2XCB A;  4PAG A;  1TEZ A;  1A17 A;  3ULE G;  1HX8 A;  3Q79 A;  5TAO A;  1T8B A;  4X20 E;  3ZFW A;  1NFI E;  2ZM8 A;  2MTQ A;  4TRQ A;  3K3N A;  4BET A;  3GN5 A;  4GZ6 A;  1UW4 B;  1X79 A;  4KT6 B;  3FH8 A;  2UY1 B;  5KNG A;  3C72 A;  3KBT A;  1JPL A;  2L0I A;  3Q7A A;  2XAF B;  1E8W A;  2J08 A;  1N9A A;  2FUL A;  1E2A A;  4XAX B;  3HKC E;  3IEE A;  4QH5 A;  3I3N A;  2YIN A;  1SW6 A;  3PVL A;  3N9L A;  4LML A;  4MBG A;  4JUY A;  3VTY A;  3SFZ A;  4H9S E;  3FZL B;  3RIB A;  4FI5 A;  4CGV A;  3EHQ A;  2UUC T;  5BPP A;  4I6G A;  4TNW A;  5JDF A;  2NSZ A;  3HXF A;  2DCF A;  4JI4 T;  2N2N A;  2LNI A;  4B93 B;  2XPI A;  3P2B A;  5FKY A;  4WWN A;  1TNO A;  4GMJ A;  1EDU A;  3PJA A;  4I1M A;  5CRV A;  1ELW A;  4UVB B;  1L5J A;  4X66 T;  4BJM A;  2OV8 A;  1E8X A;  2XAH B;  4ME2 A;  1D9S A;  5LX8 A;  1HZ4 A;  2CA5 A;  2YOE A;  2BG9 A;  3KVB A;  4DV0 T;  3CR3 A;  1YW0 A;  1UJK A;  2E9X C;  2LOS A;  5FT9 A;  2UY1 A;  1MNE A;  2ZM6 T;  4NXN T;  4CZZ B;  5AYW D;  1T98 A;  3T8M A;  3V30 A;  4U8H A;  2J1D G;  1VCS A;  4OYJ A;  5JRE A;  1HNZ T;  3RJV A;  1KPS B;  2C5J A;  5LMU T;  4JI1 T;  2I6H A;  2L0T B;  2VSX E;  3LK2 B;  2WDR A;  2IY0 C;  4G2V A;  4YTN A;  4WW0 A;  4RSY A;  3RK6 A;  4ATG A;  2V7M A;  3ZW3 A;  4G23 A;  5A23 A;  4IDZ A;  2XSB A;  2OVB A;  3CEQ A;  2NW8 A;  2I59 A;  2XHE B;  3OYZ A;  2MPK A;  3EHN A;  2FEZ A;  2UXN B;  4FAD A;  4BT9 A;  4HOS A;  2NC9 A;  3NBN B;  4N3B A;  2V5F A;  5JTG A;  4AKI A;  3RC8 A;  5CB4 E;  4QXC B;  3UPV A;  4A1G A;  4IDQ A;  3S7J A;  3FBL A;  4YJ2 E;  3ZT6 A;  2MHK A;  3AG2 E;  3TGO A;  3ZJ2 A;  2XSA A;  2LSY A;  2HPL A;  3APD A;  4YHH T;  4YTP A;  4HWD A;  4B94 A;  4HI8 A;  2JQQ A;  3T5V A;  4LSZ E;  3ZUV B;  1E7U A;  3U9W A;  4B8A A;  4JI0 T;  3MGB A;  5ENR D;  4O6F A;  3FUN A;  5FZR A;  4AV7 A;  4KP3 C;  4YHJ A;  1HXI A;  2P9P G;  2Y4T A;  5EIL A;  2IUB A;  4A5X A;  4O8S A;  3ZYQ A;  4TWF A;  5JDN A;  3PZ4 A;  1Z5S C;  3OXF A;  3CVW A;  4ILI A;  4U7E B;  4DND A;  2VKD A;  3CVQ A;  1LVK A;  3IBE A;  3DSS A;  4BSZ B;  5AQK B;  1WYB A;  4UQX A;  2KMF A;  2KWI B;  3A5X A;  5AQH B;  3T8O A;  1TJF A;  2DWK A;  4MHC A;  3N5L A;  1HCI A;  1NZN A;  3C98 A;  5H6Q B;  3PUK A;  1SUM B;  2VGE A;  2VL8 A;  2W62 A;  4KYO B;  3QNK A;  5DBK A;  2XEV A;  4K0K T;  2XGS A;  5CED B;  4N39 A;  3QWP A;  2V8S V;  1YKE B;  2V7L A;  4V3I A;  3AAE B;  4PS3 A;  3I0Q A;  3S7F A;  3ZT5 A;  1ELK A;  3GZS A;  3VLF A;  4DR4 T;  3IHV A;  4P0B A;  4UWG A;  1IZN B;  4YVQ C;  2ZU6 B;  3SFE A;  4LF6 T;  3C50 A;  1WR0 A;  2FJA A;  4O4L E;  2CPT A;  5HWY A;  2H7V C;  1QYM A;  3FFL A;  4LFC T;  3SFY A;  4AKH A;  4U3C A;  3FUF A;  2WXO A;  3JCF A;  2R2L A;  4IDO A;  3R7R A;  2R5S A;  4ZS2 A;  2X9Y A;  3AE6 A;  2HN1 A;  3HHM A;  4WNG A;  3FXD B;  4CDM A;  3PZD A;  4CQI A;  3GWH A;  2BUG A;  1CHU A;  1DVP A;  3ISM C;  2P9N G;  3JXI A;  3W9G A;  5JHA A;  1S64 A;  3N2K E;  1EF1 C;  3DEP A;  1FCH A;  3R6N A;  1Y6I A;  4RG6 A;  3K8P C;  3PUQ A;  2X6I A;  3SFD A;  1S70 B;  4BT8 A;  5AQQ B;  1G3N B;  4HRM B;  3M3Z B;  2DCP A;  3J5Q B;  2BTD A;  2C5K T;  3CK7 A;  4LRZ A;  3AJI A;  3UM0 A;  4CRW A;  5BV0 A;  3IV0 A;  2DI4 A;  4K5B A;  4OVV A;  4P1N A;  1J5E T;  3G2U A;  1HTJ F;  3SOL A;  4MBQ A;  3H3M A;  4TX5 A;  3TLU A;  5CMW A;  3IA3 A;  1W3B A;  3ZGQ A;  4CN6 A;  4P29 A;  4AI6 A;  2W63 A;  4UUC A;  4AIU A;  3FUK A;  3CVX A;  1MND A;  2UUB T;  2CEA A;  2H88 A;  3O4Z A;  4JZY A;  3RKG A;  3B7T A;  4U04 A;  3QK6 A;  2XGO A;  2AXV A;  3ZMV B;  2W2U A;  3ZLI A;  2UWJ G;  1UJJ A;  2VQ2 A;  5KBA A;  5ADX L;  3UQ3 A;  5CEA A;  1HX1 B;  4XBF B;  2ES0 A;  1WG0 A;  4FJY A;  3ESK A;  5T3R A;  3GN5 B;  3E33 A;  2VB6 A;  3DSU A;  2K5B B;  3Q5M A;  2YDQ A;  1LKX A;  4TUY E;  5G2N A;  2VVN A;  2LSV A;  2QY7 A;  3UMV A;  1KF6 A;  3G06 A;  1O1T A;  2OEW A;  2SPC A;  2V5C A;  3IXE A;  4N3C A;  2CFU A;  4KMO A;  4FU3 A;  5ETW A;  5ABF B;  4L1B A;  4AIF A;  4C91 A;  1W0A A;  4ZI3 D;  4BTB A;  4CDR A;  3PUS A;  2BKN A;  4ABN A;  4I1O B;  2VSN A;  2HE0 A;  3MZL B;  2XS1 A;  3MZK B;  4KBM B;  4OYS A;  2ZIS A;  2IJG X;  2X68 A;  3UT8 A;  3FUH A;  4ADZ A;  2OV9 A;  4JEU A;  2WPV A;  4DI3 A;  1IKN D;  5B1B E;  3E0Z A;  3CKC A;  4IL4 A;  5FXW A;  3CV0 A;  3LVQ E;  3RRM B;  3K9I A;  1TNY A;  2V8S E;  4HFH A;  3BG1 B;  3Q15 A;  3ABK E;  5CA1 E;  3SBS A;  1N4P A;  1WM5 A;  2L9B A;  5JR9 A;  3PTR B;  3B5M A;  4XI0 A;  4KX6 A;  1OWL A;  3UUX A;  2UXB T;  3EDT B;  3QAR A;  4U7Y A;  5LP0 A;  4HN9 A;  3ETU A;  4JXT A;  1LRZ A;  4PK4 A;  5AQP B;  5EIB E;  3HIZ A;  2WXP A;  4FP7 A;  3LDQ B;  5HXR A;  2I1K A;  3X1D A;  2FUP A;  4ZZB A;  4JD2 G;  1CUN A;  1NP7 A;  1TR4 A;  5ENN A;  3SHF A;  2WS3 A;  2XM2 A;  2X9X A;  3UU3 A;  2WXJ A;  4NRH B;  4IST A;  3MK7 C;  1N33 T;  2CRB A;  1E90 A;  5FY0 A;  2E0I A;  4IE0 A;  2EIK E;  3AEE A;  4I2W A;  3QNU A;  5IHY A;  4JL0 A;  2Y8D A;  4GYS A;  1N11 A;  1XDP A;  2A5E A;  1DCE A;  1Y64 B;  4IIJ E;  1K1B A;  3AU4 A;  1OT8 A;  3FHN A;  1KT1 A;  4TXR A;  3CVU A;  1TJC A;  5G05 C;  4IDP A;  2V5D A;  1OCR E;  4XKC A;  2AW6 A;  4O60 A;  3WXX A;  1MIW A;  2DHR A;  4Z90 A;  2DLR A;  3PNT B;  1IBL T;  3C3R A;  4QX8 B;  4WAF A;  3AXJ A;  3URZ A;  3UXG A;  1OXJ A;  3NZQ A;  4HB5 A;  3C4Z A;  1MQS A;  2V4L A;  5ABH A;  3U3I A;  1H19 A;  5HCJ A;  4WYV A;  2IU1 A;  5AQA A;  3LKU A;  5AAR A;  4XX5 A;  4WZX A;  4JVS A;  3C64 A;  4QWN B;  3ABL E;  3MKQ B;  4UF0 A;  4DMW A;  4N2S A;  2WXN A;  2XQ9 A;  4HFV A;  2XGM A;  1UN8 A;  3FTY A;  2EHO D;  4EB6 E;  4PK6 A;  2L6J A;  5LP6 E;  3RYC E;  1LVF A;  4BA9 A;  3CIA A;  2A9U A;  3EHZ A;  3ASG A;  1XGW A;  2AXU A;  3D9P A;  3PRE A;  4GAA A;  2RKK A;  2J8S D;  3MV3 B;  3L17 A;  5LFA A;  2R6G F;  4KVO A;  1QNF A;  1NL4 A;  3O1I A;  4GU5 A;  4CT0 A;  2ION A;  4L0R A;  5HEJ A;  4LUN U;  5CBN A;  4AQY T;  4MAL A;  1K1A A;  5AN8 A;  2XQY A;  3KVA A;  3TJP A;  4YDW A;  1D1B A;  1BR1 A;  3ASN E;  4ZI3 C;  4JPS A;  3TXM A;  5DQV A;  4M1P A;  2QC9 A;  3UUN A;  2XRY A;  2QFC A;  2BBJ A;  4X8Q A;  5EK2 A;  5J1G A;  1AJ3 A;  5LXT E;  2J4G A;  1E8Y A;  3JC6 D;  2RFA A;  4AVX A;  4IRE A;  3D9H A;  2UXD T;  3QAQ A;  4W9R A;  4DR5 T;  3B7B A;  5AQM B;  1HG2 A;  5CRU A;  2VQF T;  4HLL A;  2YN6 A;  1LD7 A;  2XUE A;  2P9L G;  1HFA A;  4GTO A;  4XE0 A;  2K9A A;  4DI4 A;  1BU9 A;  4YVO A;  2Q9Q A;  3TWX A;  2PNN A;  2EQX A;  3KV5 A;  3RSE G;  3ONK A;  1AP7 A;  4X1Y E;  5ENO D;  5B3S E;  2UU9 T;  5HXS A;  2VWA A;  2Q7F A;  4GTR A;  4CEM A;  3UM1 A;  4EZH A;  4H9N C;  2ILR A;  4DX5 D;  4DV2 T;  4O4J E;  2EHO B;  2CMR A;  3NF1 A;  2AVP A;  5CFB A;  4WNE A;  5AQU B;  1EYH A;  3TWS A;  1ZKE A;  4YDY A;  1EZ3 A;  1N4Q A;  2Y1L E;  3AA1 B;  3NOC D;  3O48 A;  2B76 A;  1W9R A;  1FIO A;  5CCL A;  3JXJ A;  4JEH B;  3TWU A;  1GQE A;  3ZN0 B;  2ACZ A;  3B13 A;  4U8V D;  3OPC A;  1PAQ A;  2V6X A;  5LCY A;  4F8H A;  2NTX A;  5L3D B;  4WNK A;  1HR0 T;  2P9I G;  4G26 A;  5FXV A;  1MYO A;  2IW5 B;  3ABV A;  2R02 A;  2PFV A;  5LOZ A;  1KNR A;  4J8D A;  2VGX A;  1KNP A;  1MX2 A;  4DR2 T;  5EDS A;  3HYM B;  2JMK A;  2WB5 A;  3BU8 A;  2F37 A;  3R9A B;  5FY1 A;  2XM1 A;  3G2T A;  1OCC E;  2XQ7 A;  5EYP F;  4LNU D;  5AEN A;  3L3P A;  4Q25 A;  4BFR A;  3ZEF B;  5FY7 A;  4YSZ A;  2BKK B;  5KJN A;  5ENQ D;  1PY1 A;  1LD8 A;  3PUG A;  4ZOL E;  4DJA A;  3FTS A;  3MYV A;  2H6I A;  5D0O D;  3ASO E;  5LCW C;  3DRA A;  5FTP A;  5BT1 A;  2IC9 A;  3W9F A;  4JEU B;  4UI9 C;  2L8K A;  2ODV A;  3PEV B;  2CHW A;  2X3M A;  4LF5 T;  2EHO C;  4JHJ A;  1U4Q A;  2ZIR A;  2F0Y A;  3FH7 A;  3EJN A;  2WQY A;  4UIG A;  2DVW A;  4KMC A;  3J7Y q;  4OVU A;  4G24 A;  2JRK A;  2X6K A;  3PUX F;  4RVB A;  2WXQ A;  1YXR A;  3PU8 A;  4WWP A;  4HWF A;  2PG8 A;  1ZHC A;  2RPA A;  3LJC A;  4B3S T;  4EZL A;  4FLB A;  2IEJ A;  4PS7 A;  1Y8M A;  2C0S A;  4JA9 A;  1VCT A;  2OA5 A;  4PJL A;  1QUU A;  3PU3 A;  2W00 A;  3AG4 E;  1OED E;  4X65 T;  1G8X A;  5LBM A;  2M67 A;  2ZGD A;  2W0G A;  1WCR A;  3CLJ A;  5JVD E;  5LOV E;  2XPY A;  4X5T A;  2JQK A;  3ZKR A;  5JR9 B;  2ETA A;  5CCM A;  3VKG A;  3UKR G;  4X1I E;  2CCQ A;  2I9C A;  3T5X A;  2E2A A;  1JWG A;  2A3D A;  2C5I T;  5LGN B;  3CQX C;  3E30 A;  3CIR A;  4UXN B;  4DV3 T;  3ASD A;  4ERR A;  4TV8 E;  3Q78 A;  4E6H A;  4TZ4 C;  4AOF A;  3NBX X;  4CCA A;  5LHI B;  2E8I A;  4ISS A;  5BV1 A;  1DCQ A;  1N0Q A;  5JQG E;  2E9X D;  2BF0 X;  2B1E A;  1K8K G;  2IOS A;  4CN4 A;  5AJL A;  2MYO A;  1TN6 A;  4EQF A;  5KJK A;  3B95 A;  4URK A;  4U74 A;  1FMV A;  4LF9 T;  4DX1 A;  2XZE A;  1SA0 E;  4RQI A;  5EKQ D;  5LYJ E;  1KK7 A;  4AEZ C;  3CK9 A;  3HKD E;  1JWF A;  3QOU A;  5JDH A;  3NZP A;  2VKH A;  2R17 C;  4BY6 A;  3RX6 A;  2FF4 A;  2LM2 A;  4UWK A;  4HOQ A;  1OED A;  2V7J A;  2CXD A;  1UX4 A;  4IE5 A;  3PDN A;  4N3A A;  3D0T A;  5T8I A;  1IBM T;  2LT3 A;  2P58 C;  3L54 A;  3SQV A;  5E76 A;  1YQ4 A;  1XDO A;  2XQ0 A;  4A55 A;  4KVM A;  3FTX A;  2F8Y A;  1KNZ A;  5KXJ A;  2V1D B;  2MYS A;  1JNR A;  4UVA B;  2RA1 A;  3HL6 A;  4H7Y A;  1BD8 A;  4J8S A;  2Q9Q D;  3ZPJ A;  1NI1 A;  4ZHB A;  3N9O A;  5C2Y A;  3CGH A;  4HI9 A;  5HYA A;  2LAH A;  2XJ7 A;  2GRO B;  2K24 A;  2DWG A;  3BQO A;  4GYY A;  4HEA A;  1SVX A;  4DO0 A;  4KHZ F;  5ENS D;  3PNL B;  1E96 B;  2G0U A;  1TYQ G;  1TN7 A;  3QKY A;  3NKZ A;  3FBZ A;  4GOU A;  1BI8 B;  5CHE E;  4GZ3 A;  1XNR T;  2H3R A;  3ZPO A;  2Y69 E;  3C98 B;  4O2A E;  3FDH A;  4K5C A;  2JJ9 A;  3AG1 E;  4PS8 A;  4DBR A;  5KMG P;  4AQF A;  4ACL A;  1IXV A;  5BUZ A;  3AA6 B;  2Y48 B;  4EOZ B;  4YTM A;  3JYS A;  3HR0 A;  1Z0P A;  1SQM A;  4QXH B;  3UT5 E;  1ZP0 A;  4GK5 E;  4GTQ A;  4N2Q A;  4CI3 B;  4CI2 B;  5JMN D;  1JUQ A;  3UUX B;  1LF8 A;  3QDN A;  2QVA A;  3FU6 A;  3OXG A;  1MX6 A;  3TG5 A;  4B89 A;  4F3V A;  4JV5 T;  3FZH B;  2NP9 A;  5DAB A;  4HXI A;  3KSL A;  3RGL A;  2LM9 A;  3FXE B;  2YEV C;  3SY2 A;  3ZHE B;  2LEH A;  3DST A;  4U63 A;  2CHX A;  3S7D A;  5L4E A;  2WDV A;  5EK3 A;  3KEZ A;  4HWH A;  4PW8 A;  3MKQ A;  5FNV E;  4OAV B;  5KNH D;  1X81 A;  5AQB A;  1EPU A;  3UU5 A;  2CG3 A;  3ASF A;  2HO1 A;  2YU2 A;  4U07 A;  3AA0 B;  3JAF A;  4ANJ A;  2CHN A;  3G2W A;  5AIJ A;  2IO3 C;  4P0A A;  3ASH A;  3C5R A;  4UEL A;  3O9X A;  3PH0 C;  4DBQ A;  1E7P A;  2CHO A;  2LJL A;  5HXE A;  2XQ4 A;  4HFI A;  2VGX B;  1BR2 A;  4JLE A;  5J0Z A;  2UUA T;  5GON E;  1FJG T;  2BVL A;  3QUJ A;  2PL2 A;  4DPR A;  3QB5 A;  1X5B A;  1WRD A;  4H9R C;  2X6J A;  3AS5 A;  3QJZ A;  4ILB A;  2VTB B;  2V6Y B;  2MOW A;  3RAU A;  1MJ0 A;  4HFE A;  3L08 A;  3PZ1 A;  5HAX A;  4DLQ A;  1KZP A;  3S4U A;  3VU7 H;  3W15 B;  3KFW X;  3TG4 A;  2DBA A;  4UWH A;  2AXD S;  3I1A A;  3TLW A;  4ILU A;  4TUM A;  3D9I A;  2BBH A;  3HVE B;  2HYZ A;  1JCR A;  4HFG A;  2XRZ A;  2WQH A;  3FUJ A;  3X2Q E;  4V1A v;  2BG9 C;  2BS4 A;  3CVP A;  4KZC A;  1WR6 A;  3E22 E;  5IYZ E;  3NRX A;  4I50 E;  4P09 A;  2LOP A;  2LRK A;  3OYX A;  3Q47 B;  3LCA A;  2NXP A;  3RKO A;  3I9W A;  5BR8 T;  3I4R B;  3F31 A;  3O4X E;  3P50 A;  2OLT A;  2E2E A;  3FWV A;  1N0R A;  3N9N A;  2NR4 A;  3C3O A;  2NW9 A;  4JYA T;  2CWY A;  3U4T A;  4HE8 A;  1OWM A;  3HI2 A;  3FTU A;  3ZN1 B;  5HXH A;  5JJT A;  1YMP A;  5J2T E;  5FQ8 A;  5C3J A;  1NA0 A;  3CHQ A;  3TLT A;  4HLE A;  2E5V A;  2QYJ A;  2QRX A;  2CHZ A;  3U64 A;  1TNU A;  2VVS A;  4FJO A;  3ONL A;  2RFM A;  3EHR A;  3PE4 A;  1O1R A;  3MKR A;  4EPZ A;  2KND A;  4LEU A;  3ZRH A;  4J0U A;  1QLB A;  3AEB A;  3HKB E;  4LER A;  4WND A;  1MHQ A;  4DUY T;  3TL5 A;  4MFR A;  2RG8 A;  4B0Z A;  2XQ6 A;  2XEE A;  5FQ6 A;  3LS8 A;  3BUA A;  3RRU A;  4YND A;  3ZKJ A;  1QBQ A;  2IO2 C;  4HWI B;  3CK6 A;  4ANX A;  3PJA J;  2WWU A;  4AY6 A;  2CFZ A;  3VLE A;  1YYH A;  3PE0 A;  3V5U A;  1B7T A;  4BAY B;  4GZD A;  2XEN A;  3Q7F A;  4PK5 A;  5E75 A;  3FU5 A;  2CE7 A;  1UUS A;  5HXC A;  4G1T A;  1N94 A;  1G73 A;  3N9M A;  3LPZ A;  3N9P A;  3BK9 A;  4OK0 A;  4HRL A;  2YDS A;  1SZA A;  5AAO A;  5J2U E;  2NTY A;  5ABG A;  4XIF A;  4NUU A;  2CXF A;  5IWA T;  5LBQ B;  3FUE A;  4CZ2 D;  4FC8 A;  2FO1 E;  4Z68 A;  3R84 B;  1FMW A;  2FBN A;  1U5P A;  3HKE E;  2XQ3 A;  1JCS A;  2OVF A;  2HR2 A;  2Y3A A;  2YKS A;  4QH4 A;  5T4Y A;  4IE7 A;  4LCT A;  1V55 E;  4N5C A;  3PRZ A;  1D0Y A;  4U0Z A;  4LNG A;  2ZGG A;  3I9Y A;  4JHR A;  4DV5 T;  1YKH B;  2VGY A;  3AED A;  2KLQ A;  3IF8 B;  1DU2 A;  1RZ4 A;  2ETC A;  4C0M A;  2BVM A;  2X51 A;  3E34 A;  3DSX A;  1MMA A;  2VQE T;  3RLF F;  3NB2 A;  2PJQ A;  4JI2 T;  2X6F A;  1MIV A;  3ULY A;  3FTZ A;  2L9Q A;  5LNK A;  3OJA A;  4Z8X A;  3T1Y T;  5CER B;  5EID A;  3T1H T;  3SBT B;  4HFB A;  4X1K E;  5LA6 E;  2WU5 A;  4B3M T;  3N2O A;  2YHE A;  4GTP A;  5AQF B;  2K48 A;  2N1G A;  2KCV A;  2XQ5 A;  4U2Y A;  2EIL E;  2GRL A;  1GW6 A;  3E32 A;  5ANR A;  4DLO A;  1HU3 A;  2WM9 A;  4R7L A;  3AE5 A;  5FVL A;  2R05 A;  4X64 T;  1P5Q A;  2ACX A;  4J2C A;  3LFM A;  4L7T A;  4ZZC A;  3LG7 A;  5LMN T;  1KT0 A;  4B6X A;  3CML A;  2DYR E;  1WAO 1;  3PUJ A;  2W61 A;  4JI7 T;  4LFA T;  5JHB A;  4J6I A;  3LY7 A;  4LF7 T;  4GA0 A;  3G2V A;  1I94 T;  2PBI A;  3KV6 A;  2Y0B G;  3D9N A;  4ILH B;  5HEG A;  3DSV A;  4IL9 A;  4G11 A;  3SZ7 A;  4C90 A;  1D8E A;  2X9W A;  1IHG A;  2ZM0 A;  4FHJ A;  3HVE A;  4NIK A;  2NOX A;  3VR8 A;  4DX6 D;  5HCM A;  4U0U A;  4IUL A;  4DK5 A;  4PJM A;  4HQD A;  2WWV A;  3OKQ A;  3FEX A;  5AQ7 A;  2KZT A;  3P4S A;  3HDX A;  2X66 A;  2BG9 B;  1QZ2 A;  3KEA A;  4GCO A;  3RH3 A;  1MMN A;  4KUM B;  1NWM X;  5LHH B;  4JC8 A;  5E0O A;  3ZC1 A;  5KDM C;  1KZO A;  5ITZ F;  2W67 A;  3L8R A;  4EGW A;  5L3F B;  1FVF A;  4HRN A;  4EBA G;  3DP7 A;  1N32 T;  2IQC A;  3EUV A;  3LY8 A;  2ZXW E;  4PFO A;  4WNF A;  2KZ7 B;  3L09 A;  3ZST A;  4A97 A;  3ZMT B;  5FQ4 A;  1U2V G;  2GRM A;  1X9B A;  1I6Z A;  4K5A B;  4ILG A;  2XS8 A;  4DUZ T;  3D3M A;  1J5W A;  2WDQ A;  3P4Q A;  4GKK T;  3IEG A;  2V7I A;  1UX5 A;  5DQW A;  3E37 A;  1O5M A;  1N36 T;  3PS6 A;  5BW8 C;  4AJW A;  3S7B A;  4ILA A;  3O1H A;  2X67 A;  3C4X A;  3MX3 A;  3RQU A;  1Z3X A;  3IHY A;  4DMV A;  4UI9 K;  4EZJ A;  2P9B A;  1SA4 A;  2V5Q C;  3P8C D;  4LMK A;  3AE1 A;  4DR1 T;  4U96 D;  3A7M A;  3TXN A;  1E8Z A;  3RF1 A;  3AG3 E;  4BEP A;  3F57 A;  2WXL A;  2LHN A;  1OED B;  2QA7 A;  1IAP A;  4DR7 T;  3PZ3 A;  4ZI2 C;  3FB2 A;  5FVK A;  3FUL A;  1S63 A;  2MBG A;  2X0Y A;  1UGO A;  5LJN A;  3RYH E;  3AE8 A;  2LLY A;  3MAC A;  5AQJ B;  3RRN B;  3AS8 A;  4O1P A;  3FH5 A;  4RG9 A;  3KV9 A;  5LGU B;  4EZK A;  5CJ5 A;  1TNB A;  4I1A A;  3TLV A;  3NWI A;  5FL0 A;  4DV6 T;  4A98 A;  4A1S A;  4HOR A;  5EX0 A;  4TV9 E;  2LSI A;  2R03 A;  1ZEE A;  3QWW A;  2A2F X;  1OWO A;  5L3G B;  3JUE A;  4NUR A;  2C0L A;  4K0R A;  1IJ5 A;  3DPD A;  3Q9D A;  1JNZ A;  1NEN A;  4AY5 A;  3PE3 A;  5HI7 A;  3CHR A;  3J5P A;  4C48 B;  4F53 A;  4GCN A;  4M3O A;  2RP4 A;  4JI3 T;  2BS2 A;  1IJ6 A;  4ACK A;  4LMJ A;  3VHL A;  2B6C A;  4I4T E;  1W09 A;  4GYR A;  3DBS A;  5FMN A;  3PUZ F;  3ZSS A;  4I2Z A;  1MX4 A;  4JA7 A;  1MZC A;  3JAD A;  3PV0 F;  1H2T C;  3RO2 A;  5HEU A;  3VRA A;  1OXZ A;  3I4G A;  2UXC T;  5M72 A;  1BPO A;  4WWO A;  4BES A;  2KZT B;  3APF A;  4WBN E;  4C9B B;  2J4B A;  1V54 E;  5L4H A;  5JDM A;  3GZ1 A;  3FZM B;  3QWV A;  2WB2 A;  4KBQ A;  3R9M A;  2BED A;  4ATZ D;  5AQT B;  3UUL A;  4EYU A;  3RKV A;  2KXP B;  3F6Q A;  2XTL A;  4HBD A;  2IAK A;  3HXB A;  4QH1 A;  2VSY A;  5AQG B;  3BQL A;  5JRC B;  2QZA A;  3P7I A;  4MLP A;  3FEY A;  2UXX B;  2AXZ A;  4EBA A;  1S0P A;  3DSW A;  4H63 H;  1ZOY A;  4ANU A;  2LKG A;  2PZI A;  3VTX A;  5LB7 B;  1PC2 A;  3CQG B;  4AKR B;  3LK3 B;  2GRN B;  4EHM A;  2LXL A;  2K3W A;  2JQH A;  2JEK A;  2N9D A;  4ZS3 A;  3L6A A;  2HHH T;  3AEA A;  2V0P A;  2JIW A;  3FU3 A;  3C3Q A;  3V2X A;  4ANW A;  3V79 K;  3MJX A;  5M4Y A;  4DX2 A;  4F6R C;  2WAU A;  5C2T A;  3VR9 A;  2H6F A;  2LO6 A;  3EU9 A;  4GZ5 A;  3AAI A;  1O3X A;  4QQI A;  3HG0 D;  3ZHE A;  2WXG A;  5IUX A;  3CKD A;  3QC9 A;  2XZT G;  5H6R B;  5FIN A;  4YSX A;  2H6H A;  4COF A;  2WXH A;  3B7S A;  1ELR A;  3CHS A;  3SNX A;  3L16 A;  1N4S A;  4LNB A;  2XAG B;  3S2A A;  3ZIM A;  4DID B;  3PEU B;  3UUB A;  2XAJ B;  4HOT A;  5D0Q D;  4GTM A;  2CLY C;  3MXZ A;  3UIO C;  3RI5 A;  3RQW A;  3LSV A;  3EIJ A;  4ZI7 E;  4X62 T;  4OAU C;  2OOE A;  3LVR E;  4GA1 A;  2XEH A;  3FZK B;  5JDL A;  1XMO T;  3CX7 B;  4M7C A;  4UV8 B;  2WP9 A;  1H6O A;  1K3Z D;  2LAI A;  5AQS B;  1KLX A;  2HM8 A;  3UFG A;  3U3W A;  1Z6T A;  3ZMS B;  2E9X A;  5KJM A;  3EVY A;  1M7K A;  3VLD A;  4BX9 A;  4ZFH A;  4J7W A;  1HNW T;  2C2L A;  4DR3 T;  3ML8 A;  1E1H B;  2LHR A;  3FTW A;  3CPZ A;  3KD7 A;  4FLH A;  3GA8 A;  3ONL C;  4Q94 A;  3UIN C;  3ZXP A;  3L22 A;  3LXU X;  2JQ9 A;  4JBW F;  1D0X A;  4CT4 A;  1R8I A;  3EAB A;  3ZT7 A;  2M6B A;  1L0V A;  1WYC A;  3HRA A;  1SE7 A;  3OTN A;  3CWZ B;  3JQ1 A;  2J07 A;  3QB2 A;  3SD5 A;  1XZY A;  4G63 A;  4NIQ A;  3ZYM A;  2OCC E;  1UOH A;  4KZ0 A;  3QB5 K;  4UWL A;  3EDU A;  1UK5 A;  1FEW A;  3ZNG A;  3NAW A;  4JI6 T;  3T9K A;  4OFZ A;  1H6K A;  3Q2M A;  3Q5W A;  1IYG A;  3CX6 B;  2LE8 A;  1IQR A;  4DX7 D;  3RIU A;  2XY8 B;  4G25 A;  4Y6W A;  4O1O A;  1SA5 A;  2YNQ A;  4BTA A;  3T8K A;  3SI5 A;  4U2Z A;  5HEH A;  3UU4 A;  2X0L B;  1M62 A;  2W4X A;  3ESL A;  3MA9 A;  4EED A;  4JHK A;  2D0T A;  2V6Y A;  2VTB A;  3SGH A;  4N78 D;  4HVB A;  4AXH A;  3G2S A;  1ZB1 A;  4UR9 A;  3SFX A;  3ZXS A;  1NEK A;  3U66 A;  2JPF A;  2F8X K;  2I0M A;  3APC A;  2EHO A;  3AA7 B;  1D1A A;  3LBX A;  3NOG D;  5HS0 A;  3TWW A;  2IML A;  1HS6 A;  4F1S A;  1KEY A;  3NVO A;  3IKO B;  2HH7 A;  2QYW A;  2WZH A;  4CI1 B;  3TWR A;  3DXK G;  1XNF A;  4JB8 P;  2LSU A;  3Q4A B;  2DZN A;  3ETV A;  3B7R L;  3ZEF A;  1OWA A;  3RPU A;  2VKO A;  3F2E A;  2LKH A;  3CVN A;  3KBU A;  3LDZ A;  2Q9Q B;  3AEC A;  4TXP A;  4MKT A;  2X38 A;  3D9O A;  5AQR B;  4LFB T;  2JMH A;  1JCQ A;  4MRU A;  4GTT A;  3UT7 A;  1V9D A;  3ZMU B;  4HTE A;  2GGF A;  3CVY A;  5AQL B;  2LUH A;  1HF8 A;  3SWH A;  1YCS B;  2AWI A;  3ZVV A;  3FZF B;  4Q96 A;  2J62 A;  5C8Y E;  3UFE A;  5AFU L;  2WSS V;  4PJN A;  4OYK A;  2L6B A;  4HWC A;  3EHM A;  3OVU A;  3MCX A;  2LRL A;  3JUI A;  1H7C A;  1OY3 D;  1U3C A;  1UUR A;  1WDY A;  2WMN A;  2J49 A;  3R7Q A;  2IDO B;  2D9D A;  4AIS A;  4AKG A;  4U0S A;  2WVI A;  1HS7 A;  5JH7 E;  1VDY A;  3GMI A;  4YDO A;  2EIM E;  2VUR A;  5HWX A;  4GTV A;  4XI9 A;  4OX9 T;  4J8F A;  1H2V C;  4IN3 B;  5F5W A;  1N54 A;  2YK0 A;  5A1L A;  2HN2 A;  4XZC A;  4AKL A;  2CWO A;  4GKJ T;  3P4P A;  3UIP C;  5HKP A;  4GTS A;  3K3Q C;  1E7V A;  2GRP B;  2WY2 A;  3PUW F;  3FUM A;  5ABE A;  3FU0 A;  4IDN A;  4NUV A;  2ODU A;  5JJ6 A;  3O1J A;  3FUI A;  1DNP A;  2NYJ A;  1J1J A;  4YT0 A;  4BSX A;  3ANW B;  2ZM2 A;  1OCO E;  3CKB A;  1Q2Z A;  4Y6C A;  2ETB A;  2P9U G;  2WQ6 A;  2WBL A;  2KCK A;  2GRR B;  5ARF A;  3CST A;  1SZ9 A;  4EAH A;  3JAE A;  2H6G A;  5A7D B;  3TLS A;  3AEF A;  4IHJ E;  5B1A E;  3ZYK A;  5J08 A;  4JW1 A;  4L23 A;  3KIN B;  4OHF A;  3ML9 A;  4DV1 T;  4KHP T;  3EIQ C;  3N9Q A;  5L3B B;  2XZD G;  3Q49 B;  1YA0 A;  3AB3 B;  3RRW A;  4G8K A;  2KM4 A;  4B8C B;  4TXQ A;  3ZN3 A;  2YDR A;  4H9P C;  2WU2 A;  4O4I E;  4XKB A;  1OWP A;  2D0U A;  2IF4 A;  3P4R A;  3EU5 A;  1TNZ A;  4HNA D;  4I6E A;  5FIO A;  4H7X A;  3SS1 A;  5JR9 C;  3LJN A;  3N71 A;  3AE3 A;  5AQN B;  1RW2 A;  1XNQ T;  3RYF E;  3RC3 A;  3C51 A;  4E7Z A;  1VRB A;  4EYY R;  4H9Q C;  2AE9 A;  4D10 C;  2D5U A;  4QKN A;  4GYO A;  5CBO A;  4GZC A;  4J8Y A;  2PM6 A;  2BKP A;  3DXM G;  4GPM A;  1A5E A;  2I2O A;  5LJM A;  4BX8 A;  4DVD A;  3CVL A;  2WXI A;  5KJL A;  4HS2 A;  4ILC A;  4PJJ A;  5JJ7 A;  3PUV F;  4F7A A;  4NXM T;  2J09 A;  3PUY F;  4L2L A;  2WXR A;  3AXJ B;  1MIY A;  4QXB B;  3AAA B;  4ZXL A;  3FHE A;  3KAE A;  4PDX A;  3C4W A;  2EIN E;  3Q5E A;  4FHK A;  3RYI E;  1QSD A;  4YSY A;  5FZQ A;  2DNX A;  3Q75 A;  2BDE A;  3UT4 A;  3CVV A;  1DC2 A;  3AVS A;  3FP3 A;  4NPP A;  1U3D A;  1YQ3 A;  4GPK A;  2LSJ A;  4CGW A;  4IYP A;  3VRB A;  2CM0 A;  3JCK C;  3L39 A;  3N2G E;  3AVR A;  2OND A;  2EIJ E;  2C0M A;  3MKD A;  1NAF A;  3BQI A;  4IT4 A;  3AE2 A;  4B3R T;  5L3C B;  2KT9 A;  4PNI A;  1BLX B;  3UM2 A;  4I43 B;  1OUV A;  3UUM A;  3TWQ A;  2R59 A;  4L5G A;  5FWQ A;  5A6C A;  3GW4 A;  5CGM A;  5ENP D;  3HXD A;  4C0E A;  2Q9Q C;  3SF4 A;  2D2S A;  4I43 A;  3NZS A;  4YFS A;  1O1S A;  3NQP A;  4Z91 A;  4FA6 A;  3PZ2 A;  5AJD A;  4J8E A;  4APO A;  3H3A A;  2KWH A;  4GK0 E;  2IFU A;  3ZU7 B;  5HQ8 A;  3P1U A;  3UKU G; 
#chains in the Genus database with same CATH homology
 4A56 A;  3LY9 A;  3Q5X A;  3PUR A;  4ZHQ E;  2CLY B;  4PFP A;  4TN7 B;  3RO3 A;  1FVH A;  3E08 A;  2DIW A;  3GYZ A;  5G04 C;  4AP2 A;  3CK8 A;  5LHG B;  1WLX A;  2CXL A;  2E9X B;  4WUY A;  5F8P A;  3RRC A;  1WY6 A;  5JDG A;  2X9H A;  4CXX A;  2XPZ A;  4UWF A;  4L2Y A;  3CHM A;  4HOU A;  3AS4 A;  4QFV A;  3D9J A;  4A3V A;  4CXY A;  2VSO E;  4Q69 A;  1BR4 A;  2WXM A;  3D9L A;  3B57 A;  4ASK A;  3MJW A;  5C1D A;  4UVC B;  4H9O C;  5FXX A;  5FP3 A;  5JRC A;  2A4Z A;  5ARG A;  3KV4 A;  2BZB A;  2QGS A;  2YU1 A;  4BJN A;  4EZ4 A;  2JLB A;  3U78 A;  1UN9 A;  1B89 A;  2RD0 A;  4I55 E;  3ZYL A;  3BQK A;  4UV9 B;  3JC6 C;  5LGT B;  5J90 A;  5CA0 E;  1ZU2 A;  4U72 A;  2IC6 A;  3UTK A;  2IOL A;  3OBV E;  3NZU A;  4WBO A;  1UG3 A;  5G05 J;  2V26 A;  4XZ4 A;  3I0O A;  4EEC A;  2FI7 A;  3NRY A;  3ANW A;  5FZS A;  5KCM A;  4IGU A;  4L9I A;  5DJQ C;  2WMO A;  4ZI2 D;  3E4B A;  3OAW A;  2J9Q A;  4E7S A;  1US7 B;  4CDN A;  1MMD A;  2FO7 A;  4GYW A;  4UI9 J;  4JEH A;  3CHO A;  4PH4 B;  3DTO A;  2KAT A;  3V5S A;  2VJ8 A;  3L13 A;  2MOZ A;  4ANV A;  1D0Z A;  2HPJ A;  3WAK A;  3LYA A;  3IHR A;  4I9E A;  4AM9 A;  4HGA A;  4K03 A;  2L3L A;  4MLK A;  2YHC A;  4TUU A;  5G04 J;  2PQR A;  4H63 V;  3SRZ A;  3PUA A;  2VAS A;  3DJB A;  3ZJ1 A;  1S94 A;  4I9C A;  4IE6 A;  4O4H E;  1HE8 A;  3H37 A;  2XAQ B;  4I17 A;  3BEE A;  1BR0 A;  2ZLY A;  4GML A;  4MS6 A;  2WXF A;  3KS2 A;  2PQN A;  2I1J A;  4UF0 B;  4TV3 A;  4IE4 A;  3HA4 A;  3WI3 A;  4GA2 A;  5CMY A;  2Z6E A;  3ULQ A;  5FQ7 A;  3B7U X;  2KIN B;  3CSF A;  1INZ A;  2YQ8 A;  4I6J A;  4NQ0 A;  1N52 A;  5FYM A;  2J4D A;  3LJ3 A;  5FXZ A;  1NA3 A;  4G2A A;  1SHZ C;  5EK4 A;  2GK9 A;  3K3O A;  4AXP A;  4QHO A;  3TKL B;  4FJZ A;  4KXK B;  2H7O A;  2LSG A;  1HH8 A;  3KDS E;  1IQU A;  5EX3 A;  3FUD A;  1S35 A;  3ZC0 A;  2NWB A;  4EIW A;  3CX8 B;  2M63 A;  4NAC A;  3WAJ A;  2A5U A;  4BWR A;  1VOM A;  3PDY A;  5ANL A;  3D9K A;  3OXL A;  1Z3Y A;  3MA5 A;  3GZ2 A;  2X6H A;  3ENE A;  2XAS B;  3QK0 A;  5FJY A;  3I5P A;  3TAX A;  1YD8 G;  3BG0 B;  4UEM A;  3ZCI A;  3RU0 A;  4GIW A;  1UCU A;  4YJ3 E;  3LBX B;  1H0A A;  5BMV E;  1D1C A;  5DIZ A;  2Y4U A;  1HG5 A;  3J9X 1;  5L2L A;  3EUH A;  2VYI A;  3D9M A;  1QQE A;  5JDQ A;  5EZY E;  4IRU A;  2NW7 A;  3CVR A;  5LG4 A;  1H2U A;  2LSK A;  4QX7 B;  3ZMZ B;  1MMG A;  3FTV A;  3UX4 A;  2Y6X A;  4FUL A;  4UQY A;  5G55 A;  4AQG A;  2WQ7 A;  2CG2 A;  3QC1 A;  5F3J A;  4HKA A;  2WXK A;  2V7K A;  4APF A;  5KX5 E;  3M65 A;  2PM7 A;  3LK4 2;  2GW1 A;  3VKH A;  2VK9 A;  4EXT A;  3IBP A;  2KC7 A;  4YLH A;  3JQ0 A;  3CHP A;  4E85 A;  3LEW A;  3ONX A;  4AQF C;  1OWN A;  2ZMA A;  2XCC A;  3MEK A;  2MRI A;  1ZV4 X;  3AU5 A;  1HO8 A;  4GB9 A;  4PUC A;  5BNW A;  2VKJ A;  1ZBP A;  3FY4 A;  3EDV A;  2KCL A;  3ZCJ A;  4CXW A;  2A72 A;  3CQC B;  4A3T A;  4K0U A;  2XHE A;  3MV2 B;  5LCW J;  4O2B E;  5L3E B;  4UQZ A;  2XCB A;  4PAG A;  1TEZ A;  1A17 A;  1HX8 A;  5TAO A;  4X20 E;  3ZFW A;  2ZM8 A;  2MTQ A;  4TRQ A;  3K3N A;  3GN5 A;  4GZ6 A;  1UW4 B;  1X79 A;  4KT6 B;  3FH8 A;  2UY1 B;  3KBT A;  1JPL A;  2L0I A;  2XAF B;  1E8W A;  2J08 A;  2FUL A;  4XAX B;  3HKC E;  3IEE A;  3I3N A;  2YIN A;  3PVL A;  3N9L A;  4JUY A;  3VTY A;  3SFZ A;  4H9S E;  3RIB A;  4FI5 A;  4CGV A;  5BPP A;  4I6G A;  5JDF A;  2NSZ A;  2DCF A;  2N2N A;  2LNI A;  2XPI A;  3P2B A;  4WWN A;  4GMJ A;  1EDU A;  4I1M A;  1ELW A;  4UVB B;  1L5J A;  4BJM A;  2OV8 A;  1E8X A;  2XAH B;  4ME2 A;  5LX8 A;  1HZ4 A;  2CA5 A;  3KVB A;  3CR3 A;  1YW0 A;  1UJK A;  2E9X C;  2LOS A;  5FT9 A;  2UY1 A;  1MNE A;  4CZZ B;  5AYW D;  3T8M A;  1T98 A;  4U8H A;  2J1D G;  4OYJ A;  5JRE A;  3RJV A;  2C5J A;  2I6H A;  2L0T B;  2VSX E;  3LK2 B;  4G2V A;  4WW0 A;  4RSY A;  3RK6 A;  4ATG A;  2V7M A;  3ZW3 A;  4G23 A;  5A23 A;  4IDZ A;  2OVB A;  3CEQ A;  2NW8 A;  2I59 A;  2XHE B;  3OYZ A;  3EHN A;  2FEZ A;  2UXN B;  4FAD A;  4BT9 A;  4HOS A;  2NC9 A;  4N3B A;  2V5F A;  4AKI A;  3RC8 A;  5CB4 E;  4QXC B;  3UPV A;  4A1G A;  3S7J A;  3FBL A;  4YJ2 E;  2MHK A;  3TGO A;  3ZJ2 A;  2LSY A;  2HPL A;  3APD A;  4B94 A;  2JQQ A;  3T5V A;  1E7U A;  3U9W A;  4B8A A;  3MGB A;  4O6F A;  3FUN A;  5FZR A;  4AV7 A;  4KP3 C;  4YHJ A;  1HXI A;  2Y4T A;  4O8S A;  3ZYQ A;  5JDN A;  3OXF A;  3CVW A;  4ILI A;  4DND A;  2VKD A;  3CVQ A;  1LVK A;  3IBE A;  1WYB A;  4UQX A;  2KMF A;  2KWI B;  3A5X A;  3T8O A;  1TJF A;  2DWK A;  4MHC A;  3N5L A;  1HCI A;  1NZN A;  3C98 A;  5H6Q B;  3PUK A;  2VL8 A;  2W62 A;  4KYO B;  3QNK A;  5DBK A;  2XEV A;  2XGS A;  4N39 A;  3QWP A;  1YKE B;  2V7L A;  4V3I A;  3AAE B;  4PS3 A;  3I0Q A;  3S7F A;  1ELK A;  3GZS A;  3VLF A;  3IHV A;  4P0B A;  4UWG A;  1IZN B;  4YVQ C;  2ZU6 B;  3C50 A;  4O4L E;  5HWY A;  2H7V C;  3FFL A;  4AKH A;  3FUF A;  2WXO A;  3R7R A;  2R5S A;  4ZS2 A;  2X9Y A;  4WNG A;  3HHM A;  4CDM A;  3FXD B;  3PZD A;  4CQI A;  3GWH A;  2BUG A;  1DVP A;  5JHA A;  3N2K E;  1EF1 C;  4RG6 A;  1FCH A;  3R6N A;  1Y6I A;  3K8P C;  3PUQ A;  2X6I A;  4BT8 A;  2DCP A;  2BTD A;  2C5K T;  3CK7 A;  4LRZ A;  4CRW A;  5BV0 A;  3IV0 A;  2DI4 A;  4OVV A;  3G2U A;  1HTJ F;  3SOL A;  4MBQ A;  4TX5 A;  5CMW A;  1W3B A;  3ZGQ A;  4P29 A;  4AI6 A;  2W63 A;  3FUK A;  3CVX A;  1MND A;  2CEA A;  3O4Z A;  4JZY A;  3B7T A;  4U04 A;  3QK6 A;  2XGO A;  2AXV A;  3ZMV B;  2UWJ G;  3ZLI A;  2VQ2 A;  1UJJ A;  5ADX L;  3UQ3 A;  4XBF B;  2ES0 A;  4FJY A;  3ESK A;  5T3R A;  3GN5 B;  2VB6 A;  2K5B B;  3Q5M A;  1LKX A;  4TUY E;  5G2N A;  2LSV A;  2QY7 A;  3UMV A;  2SPC A;  4N3C A;  2CFU A;  4KMO A;  4FU3 A;  5ETW A;  4L1B A;  4AIF A;  4C91 A;  4ZI3 D;  4BTB A;  4CDR A;  3PUS A;  4ABN A;  4I1O B;  2VSN A;  3MZL B;  3MZK B;  4KBM B;  4OYS A;  2IJG X;  2X68 A;  3UT8 A;  3FUH A;  4ADZ A;  4JEU A;  2WPV A;  4DI3 A;  3E0Z A;  3CKC A;  5FXW A;  3CV0 A;  3LVQ E;  3RRM B;  3K9I A;  2V8S E;  3BG1 B;  3Q15 A;  5CA1 E;  3SBS A;  1WM5 A;  2L9B A;  5JR9 A;  3PTR B;  4XI0 A;  1OWL A;  3UUX A;  3EDT B;  3QAR A;  5LP0 A;  4HN9 A;  3ETU A;  4JXT A;  1LRZ A;  4PK4 A;  3HIZ A;  2WXP A;  4FP7 A;  5HXR A;  2I1K A;  1CUN A;  1NP7 A;  5ENN A;  3SHF A;  2X9X A;  2WXJ A;  4NRH B;  4IST A;  3MK7 C;  1E90 A;  5FY0 A;  2E0I A;  4IE0 A;  4I2W A;  4JL0 A;  5IHY A;  2Y8D A;  4GYS A;  1Y64 B;  4IIJ E;  3AU4 A;  3FHN A;  1KT1 A;  3CVU A;  1TJC A;  5G05 C;  4XKC A;  2AW6 A;  3WXX A;  1MIW A;  2DHR A;  3PNT B;  2DLR A;  4QX8 B;  4WAF A;  3URZ A;  3NZQ A;  3C4Z A;  1MQS A;  2V4L A;  3U3I A;  1H19 A;  2IU1 A;  3LKU A;  4XX5 A;  4JVS A;  3C64 A;  4QWN B;  3MKQ B;  4UF0 A;  4DMW A;  4N2S A;  2WXN A;  4HFV A;  3FTY A;  2XGM A;  1UN8 A;  2EHO D;  4EB6 E;  4PK6 A;  2L6J A;  5LP6 E;  3RYC E;  1LVF A;  4BA9 A;  3CIA A;  3ASG A;  1XGW A;  2AXU A;  3D9P A;  3PRE A;  4GAA A;  3MV3 B;  3L17 A;  5LFA A;  4KVO A;  1QNF A;  4CT0 A;  3O1I A;  4GU5 A;  2ION A;  4L0R A;  4LUN U;  4MAL A;  2XQY A;  3KVA A;  3TJP A;  1D1B A;  1BR1 A;  4ZI3 C;  4JPS A;  3TXM A;  5DQV A;  4M1P A;  3UUN A;  2XRY A;  2QFC A;  5EK2 A;  5J1G A;  1AJ3 A;  5LXT E;  1E8Y A;  3JC6 D;  4AVX A;  3QAQ A;  4W9R A;  1HG2 A;  2XUE A;  1HFA A;  4XE0 A;  2K9A A;  4DI4 A;  4YVO A;  2Q9Q A;  2EQX A;  3KV5 A;  3ONK A;  4X1Y E;  5HXS A;  2Q7F A;  2VWA A;  4CEM A;  4EZH A;  4H9N C;  2ILR A;  4O4J E;  2EHO B;  2CMR A;  3NF1 A;  2AVP A;  4WNE A;  1EYH A;  1ZKE A;  1EZ3 A;  3AA1 B;  3O48 A;  1FIO A;  5CCL A;  4JEH B;  3ZN0 B;  3B13 A;  1PAQ A;  5LCY A;  5L3D B;  4G26 A;  2NTX A;  4WNK A;  5FXV A;  2IW5 B;  2PFV A;  5LOZ A;  4J8D A;  2VGX A;  5EDS A;  3HYM B;  2JMK A;  3R9A B;  5FY1 A;  3G2T A;  5AEN A;  3L3P A;  4BFR A;  3ZEF B;  5FY7 A;  5KJN A;  1PY1 A;  3PUG A;  4ZOL E;  4DJA A;  3FTS A;  3MYV A;  5D0O D;  5LCW C;  5BT1 A;  5FTP A;  2IC9 A;  4JEU B;  4UI9 C;  2L8K A;  2ODV A;  3PEV B;  2CHW A;  2X3M A;  2EHO C;  4JHJ A;  1U4Q A;  3FH7 A;  3EJN A;  4UIG A;  4KMC A;  3J7Y q;  4OVU A;  4G24 A;  2JRK A;  2X6K A;  4RVB A;  2WXQ A;  3PU8 A;  4WWP A;  2PG8 A;  1ZHC A;  3LJC A;  4EZL A;  4FLB A;  4PS7 A;  1Y8M A;  2C0S A;  4JA9 A;  2OA5 A;  4PJL A;  1QUU A;  3PU3 A;  2W00 A;  1G8X A;  5LBM A;  2M67 A;  2W0G A;  3CLJ A;  5JVD E;  5LOV E;  2XPY A;  5JR9 B;  5CCM A;  3VKG A;  4X1I E;  2CCQ A;  2I9C A;  3T5X A;  1JWG A;  2A3D A;  2C5I T;  5LGN B;  3CQX C;  4UXN B;  3ASD A;  4ERR A;  4TV8 E;  4E6H A;  4TZ4 C;  4AOF A;  3NBX X;  4CCA A;  5LHI B;  2E8I A;  4ISS A;  5BV1 A;  5JQG E;  2E9X D;  2BF0 X;  2B1E A;  2IOS A;  5AJL A;  4EQF A;  5KJK A;  4URK A;  4U74 A;  1FMV A;  1SA0 E;  5EKQ D;  5LYJ E;  1KK7 A;  4AEZ C;  3CK9 A;  3HKD E;  1JWF A;  3QOU A;  5JDH A;  3NZP A;  2VKH A;  2R17 C;  4BY6 A;  3RX6 A;  2FF4 A;  4UWK A;  4HOQ A;  2V7J A;  2CXD A;  1UX4 A;  4IE5 A;  3PDN A;  4N3A A;  3D0T A;  5T8I A;  2LT3 A;  2P58 C;  3L54 A;  5E76 A;  2XQ0 A;  4A55 A;  4KVM A;  3FTX A;  1KNZ A;  2V1D B;  2MYS A;  4UVA B;  2RA1 A;  3HL6 A;  4H7Y A;  4J8S A;  2Q9Q D;  3ZPJ A;  3N9O A;  5C2Y A;  3CGH A;  5HYA A;  2LAH A;  2K24 A;  2DWG A;  4GYY A;  4HEA A;  4DO0 A;  3PNL B;  1E96 B;  2G0U A;  3QKY A;  3FBZ A;  4GOU A;  5CHE E;  4GZ3 A;  2H3R A;  3ZPO A;  3C98 B;  4O2A E;  3FDH A;  2JJ9 A;  4PS8 A;  4DBR A;  5KMG P;  4AQF A;  4ACL A;  5BUZ A;  3AA6 B;  2Y48 B;  4EOZ B;  3JYS A;  3HR0 A;  1Z0P A;  1SQM A;  4QXH B;  3UT5 E;  4GK5 E;  4N2Q A;  4CI3 B;  4CI2 B;  1JUQ A;  3UUX B;  1LF8 A;  3QDN A;  3FU6 A;  3OXG A;  3TG5 A;  4F3V A;  4B89 A;  2NP9 A;  5DAB A;  4HXI A;  2LM9 A;  3FXE B;  2YEV C;  3ZHE B;  2LEH A;  4U63 A;  2CHX A;  3S7D A;  3KEZ A;  5EK3 A;  4PW8 A;  3MKQ A;  5FNV E;  1EPU A;  2CG3 A;  3ASF A;  2HO1 A;  2YU2 A;  4U07 A;  3AA0 B;  4ANJ A;  3G2W A;  5AIJ A;  4P0A A;  3ASH A;  4UEL A;  3O9X A;  3PH0 C;  4DBQ A;  2LJL A;  5HXE A;  2VGX B;  1BR2 A;  4JLE A;  5GON E;  2BVL A;  3QUJ A;  2PL2 A;  4DPR A;  1X5B A;  1WRD A;  4H9R C;  2X6J A;  3AS5 A;  3QJZ A;  2VTB B;  2MOW A;  3L08 A;  5HAX A;  4DLQ A;  3S4U A;  3VU7 H;  3W15 B;  3KFW X;  3TG4 A;  2DBA A;  4UWH A;  3I1A A;  4ILU A;  3D9I A;  3HVE B;  2HYZ A;  4HFG A;  2XRZ A;  2WQH A;  3FUJ A;  4V1A v;  3CVP A;  4KZC A;  1WR6 A;  3E22 E;  5IYZ E;  3NRX A;  4I50 E;  4P09 A;  2LOP A;  3OYX A;  3Q47 B;  3LCA A;  2NXP A;  3RKO A;  3I9W A;  3I4R B;  3F31 A;  3O4X E;  2E2E A;  3FWV A;  3N9N A;  2NW9 A;  2CWY A;  3U4T A;  4HE8 A;  1OWM A;  3HI2 A;  3FTU A;  3ZN1 B;  5HXH A;  5JJT A;  5J2T E;  5FQ8 A;  1NA0 A;  3CHQ A;  4HLE A;  2CHZ A;  3U64 A;  4FJO A;  3ONL A;  3PE4 A;  3MKR A;  4EPZ A;  2KND A;  4LEU A;  3ZRH A;  4J0U A;  3HKB E;  4LER A;  4WND A;  1MHQ A;  3TL5 A;  4MFR A;  2RG8 A;  4B0Z A;  5FQ6 A;  3LS8 A;  3RRU A;  4YND A;  4ANX A;  2WWU A;  4AY6 A;  2CFZ A;  3VLE A;  3PE0 A;  3V5U A;  1B7T A;  4BAY B;  4GZD A;  4PK5 A;  5E75 A;  3FU5 A;  2CE7 A;  5HXC A;  4G1T A;  1G73 A;  3N9M A;  3LPZ A;  3N9P A;  3BK9 A;  4OK0 A;  1SZA A;  5J2U E;  2NTY A;  4XIF A;  4NUU A;  2CXF A;  3FUE A;  5LBQ B;  4FC8 A;  3R84 B;  1FMW A;  2FBN A;  1U5P A;  3HKE E;  2OVF A;  2Y3A A;  2HR2 A;  5T4Y A;  4IE7 A;  4LCT A;  4N5C A;  3PRZ A;  1D0Y A;  4U0Z A;  3I9Y A;  4JHR A;  1YKH B;  2VGY A;  2KLQ A;  3IF8 B;  4C0M A;  2BVM A;  2X51 A;  1MMA A;  2PJQ A;  2X6F A;  1MIV A;  3FTZ A;  2L9Q A;  5LNK A;  3OJA A;  4Z8X A;  3SBT B;  4X1K E;  5LA6 E;  3N2O A;  2YHE A;  2K48 A;  2N1G A;  2KCV A;  2GRL A;  1GW6 A;  5ANR A;  4DLO A;  1HU3 A;  2WM9 A;  4R7L A;  1P5Q A;  2ACX A;  4J2C A;  3LFM A;  4L7T A;  1KT0 A;  3LG7 A;  4B6X A;  3CML A;  1WAO 1;  3PUJ A;  2W61 A;  5JHB A;  4J6I A;  3LY7 A;  4GA0 A;  3G2V A;  2PBI A;  3KV6 A;  3D9N A;  4ILH B;  4G11 A;  3SZ7 A;  4C90 A;  2X9W A;  1IHG A;  2ZM0 A;  4FHJ A;  3HVE A;  2NOX A;  4U0U A;  4IUL A;  4DK5 A;  4PJM A;  3OKQ A;  3FEX A;  2KZT A;  3HDX A;  2X66 A;  1QZ2 A;  4GCO A;  3RH3 A;  1MMN A;  4KUM B;  1NWM X;  5LHH B;  4JC8 A;  5E0O A;  3ZC1 A;  5KDM C;  5L3F B;  1FVF A;  4EBA G;  3DP7 A;  2IQC A;  3LY8 A;  4PFO A;  4WNF A;  2KZ7 B;  3L09 A;  3ZMT B;  5FQ4 A;  2GRM A;  4ILG A;  3D3M A;  3IEG A;  2V7I A;  1UX5 A;  5DQW A;  3PS6 A;  5BW8 C;  4AJW A;  3S7B A;  3O1H A;  2X67 A;  3C4X A;  3MX3 A;  1Z3X A;  3IHY A;  4DMV A;  4UI9 K;  4EZJ A;  2P9B A;  3P8C D;  3TXN A;  1E8Z A;  3F57 A;  2WXL A;  2LHN A;  2QA7 A;  1IAP A;  4ZI2 C;  3FB2 A;  3FUL A;  2MBG A;  5LJN A;  3RYH E;  3MAC A;  3RRN B;  3AS8 A;  3FH5 A;  4RG9 A;  3KV9 A;  5LGU B;  4EZK A;  4I1A A;  4A1S A;  4HOR A;  5EX0 A;  4TV9 E;  2LSI A;  1ZEE A;  3QWW A;  2A2F X;  1OWO A;  5L3G B;  4NUR A;  2C0L A;  4K0R A;  1IJ5 A;  3DPD A;  3Q9D A;  4AY5 A;  3PE3 A;  5HI7 A;  3CHR A;  4F53 A;  4GCN A;  4M3O A;  2RP4 A;  1IJ6 A;  4ACK A;  3VHL A;  4I4T E;  4GYR A;  3DBS A;  5FMN A;  4I2Z A;  4JA7 A;  1H2T C;  3RO2 A;  1OXZ A;  3I4G A;  5M72 A;  1BPO A;  4WWO A;  2KZT B;  3APF A;  4WBN E;  4C9B B;  2J4B A;  3GZ1 A;  2WB2 A;  5JDM A;  3QWV A;  4KBQ A;  3UUL A;  4EYU A;  3RKV A;  2KXP B;  2XTL A;  2IAK A;  2VSY A;  3BQL A;  5JRC B;  3P7I A;  4MLP A;  3FEY A;  2UXX B;  2AXZ A;  4EBA A;  1S0P A;  4H63 H;  4ANU A;  2PZI A;  3VTX A;  1PC2 A;  3CQG B;  4AKR B;  3LK3 B;  2JEK A;  2N9D A;  4ZS3 A;  3L6A A;  2V0P A;  4ANW A;  3FU3 A;  3MJX A;  5M4Y A;  4F6R C;  2WAU A;  4GZ5 A;  2LO6 A;  3AAI A;  1O3X A;  3ZHE A;  2WXG A;  3CKD A;  3QC9 A;  5H6R B;  3B7S A;  2WXH A;  1ELR A;  3CHS A;  3SNX A;  3L16 A;  2XAG B;  3S2A A;  3ZIM A;  3PEU B;  2XAJ B;  4HOT A;  5D0Q D;  2CLY C;  3MXZ A;  3EIJ A;  4ZI7 E;  2OOE A;  3LVR E;  4GA1 A;  5JDL A;  3CX7 B;  4UV8 B;  2LAI A;  1KLX A;  2HM8 A;  3U3W A;  1Z6T A;  3ZMS B;  2E9X A;  5KJM A;  3EVY A;  3VLD A;  4BX9 A;  2C2L A;  3ML8 A;  1E1H B;  2LHR A;  3FTW A;  3CPZ A;  3KD7 A;  4FLH A;  3GA8 A;  4Q94 A;  3L22 A;  3LXU X;  1D0X A;  4CT4 A;  1WYC A;  3OTN A;  3CWZ B;  3JQ1 A;  2J07 A;  3QB2 A;  3SD5 A;  4G63 A;  4KZ0 A;  3ZYM A;  4UWL A;  3EDU A;  1FEW A;  4OFZ A;  1H6K A;  3Q2M A;  3Q5W A;  1IYG A;  3CX6 B;  2LE8 A;  1IQR A;  4G25 A;  4Y6W A;  2YNQ A;  4BTA A;  3SI5 A;  2X0L B;  3MA9 A;  4JHK A;  3ESL A;  2D0T A;  2VTB A;  3SGH A;  4N78 D;  4HVB A;  4AXH A;  3G2S A;  3ZXS A;  3U66 A;  2JPF A;  3APC A;  2EHO A;  3AA7 B;  1D1A A;  3LBX A;  4F1S A;  1HS6 A;  3IKO B;  2HH7 A;  4CI1 B;  1XNF A;  2LSU A;  3Q4A B;  3B7R L;  3ETV A;  3ZEF A;  1OWA A;  3RPU A;  2VKO A;  3F2E A;  3CVN A;  3KBU A;  3LDZ A;  2Q9Q B;  4MKT A;  2X38 A;  3D9O A;  2JMH A;  4MRU A;  3UT7 A;  1V9D A;  3ZMU B;  4HTE A;  2GGF A;  3CVY A;  1HF8 A;  3SWH A;  2AWI A;  3ZVV A;  4Q96 A;  5C8Y E;  3UFE A;  5AFU L;  2WSS V;  4PJN A;  4OYK A;  3EHM A;  3MCX A;  3JUI A;  1H7C A;  1U3C A;  2WMN A;  2J49 A;  3R7Q A;  4AKG A;  4U0S A;  2WVI A;  1HS7 A;  5JH7 E;  1VDY A;  3GMI A;  5HWX A;  4XI9 A;  4J8F A;  1H2V C;  4IN3 B;  1N54 A;  2YK0 A;  5A1L A;  4XZC A;  4AKL A;  2CWO A;  3K3Q C;  1E7V A;  3FUM A;  3FU0 A;  4NUV A;  2ODU A;  5JJ6 A;  3O1J A;  3FUI A;  1DNP A;  4BSX A;  3ANW B;  2ZM2 A;  3CKB A;  4Y6C A;  2WQ6 A;  2WBL A;  2KCK A;  5ARF A;  3CST A;  1SZ9 A;  4EAH A;  5A7D B;  4IHJ E;  3ZYK A;  5J08 A;  4JW1 A;  4L23 A;  3KIN B;  4OHF A;  3ML9 A;  3EIQ C;  3N9Q A;  5L3B B;  3Q49 B;  1YA0 A;  3AB3 B;  3RRW A;  2KM4 A;  4B8C B;  3ZN3 A;  4H9P C;  4O4I E;  4XKB A;  1OWP A;  2D0U A;  2IF4 A;  4I6E A;  4H7X A;  3SS1 A;  5JR9 C;  3N71 A;  3RYF E;  3RC3 A;  3C51 A;  4E7Z A;  1VRB A;  4EYY R;  4H9Q C;  4D10 C;  4GYO A;  2D5U A;  4QKN A;  4GZC A;  2PM6 A;  2I2O A;  5LJM A;  4BX8 A;  4DVD A;  3CVL A;  2WXI A;  5KJL A;  4HS2 A;  4PJJ A;  5JJ7 A;  4F7A A;  2J09 A;  4L2L A;  2WXR A;  1MIY A;  4QXB B;  3AAA B;  3FHE A;  3KAE A;  4PDX A;  3C4W A;  4FHK A;  3RYI E;  1QSD A;  5FZQ A;  2DNX A;  3UT4 A;  2BDE A;  3CVV A;  3AVS A;  3FP3 A;  1U3D A;  4GPK A;  2LSJ A;  4CGW A;  4IYP A;  2CM0 A;  3JCK C;  3N2G E;  3AVR A;  2OND A;  2C0M A;  3MKD A;  1NAF A;  3BQI A;  5L3C B;  2KT9 A;  4PNI A;  4I43 B;  1OUV A;  3UUM A;  2R59 A;  4L5G A;  5FWQ A;  5A6C A;  3GW4 A;  4C0E A;  2Q9Q C;  3SF4 A;  4I43 A;  2D2S A;  3NZS A;  4YFS A;  3NQP A;  4FA6 A;  5AJD A;  4J8E A;  4APO A;  3H3A A;  2KWH A;  4GK0 E;  2IFU A;  5HQ8 A;  3P1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...