2AJAA

X-ray structure of an ankyrin repeat family protein q5zsv0 from legionella pneumophila. northeast structural genomics consortium target lgr21.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
347
structure length
343
Chain Sequence
NLTIHNIENYENDPQLRLIPWILWENLFQHFISANELSLMTLSYKEAIHIFLPGTKNMEQVRQLLCLYYAHYNRNAKQLWSDAHKKGIKSEVICFVAAITGCSSALDTLCLLSDEIVKQAENYQAFRLAAENGHLHVLNRLCELAPTEIMAMIQAENYHAFRLAAENGHLHVLNRLCELAPTEATAMIQAENYYAFRWAAVGRGHHNVINFLLDCPVMLAYAEIHEFEYGEKYVNPFIARHVNRLKEMHDAFKLSNPDGVFDLVTKSECLQGFYMLRNLIRRNDEVLLDDIRFLLSIPGIKALAPTATIPGDANELLRLALRLGNQGACALLLSIPSVLALTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ankyrin repeat family protein
publication title X-Ray structure of an ankyrin repeat family protein Q5ZSV0 from Legionella pneumophila.
rcsb
source organism Legionella pneumophila
molecule tags Protein binding
total genus 97
structure length 343
sequence length 347
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2ajaA00
4DX6D 4UUCA 3Q9UC 5ENOD 5JMND 1SW6A 3AAAC 1D9SA 1K1BA 1TR4A 3J5PA 1YCSB 2A5EA 2BKGA 2F37A 4K5AB 5ENQD 4O1OA 3TWXA 3SO8A 5CEAA 2ZGGA 2DWZA 4ZFHA 4O60A 5CERB 4U8YD 2KBXA 3B7BA 3KEAA 2RFMA 5CBOA 5FIOA 2KXPC 3JUEA 5CBNA 2Y0BG 3V2OA 3TWTA 5EYPF 2DZOA 4F1PA 4ZHBA 4LSZE 2AJAA 1SVXA 4JB8P 3ZNGA 1MX6A 2P2CP 5EYLA 5AQAA 2QC9A 4HI9A 4ATZD 5JA4D 1WG0A 2QYJA 1QYMA 4OAVB 3DEOA 3TWUA 3TWQA 4GPMA 4HBDA 4DX7D 3NOGD 4DX5D 3Q9NC 5AQBA 5BXUA 1N0QA 3W9FA 4TUMA 1K1AA 2MYOA 1DC2A 1OY3D 4F6RD 1WDYA 4A63B 4J8YA 4OAUC 3F6QA 2XEHA 4G8KA 4B93B 1DCQA 1IHBA 1A5EA 4QQIA 3TWVA 5D66A 1YYHA 2ZGDA 2PNNA 4BETA 4K5CA 1BI8B 4HB5A 5KBAA 4HNAD 4DX2A 2NYJA 1UOHA 5ENRD 4DRXE 3IXEA 5HKPA 4GMRA 2HE0A 2B0OE 3NBNB 3UTMA 3V30A 3EHQA 4HI8A 4YDWA 1N11A 2DVWA 3EHRA 3ZKJA 3DEPA 3D9HA 4NIKA 3NOCD 5EN5D 4CZ2D 3V31A 1MX4A 5AQ9A 5BXOA 5AAOA 1BD8A 5HS0A 2L6BA 4HRMB 3HRAA 5ENSD 2J8SD 1MX2A 2DZNA 4LG6A 4O1PA 4BSZB 3W9GA 5HRYA 1AWCB 4HRNA 5AN8A 2F8YA 1N0RA 1BLXB 3JXIA 3TWRA 2RFAA 3T9KA 4BEPA 5ITZF 5KWDA 3V2XA 3UI2A 1NFIE 1BU9A 2Y1LE 5EIDA 5CEDB 2V5QC 4K5BA 4U8VD 1K3ZD 2BKKB 3T8KA 5KNGA 5AARA 4HQDA 4HLLA 3V79K 1IKND 2V4HC 4LNUD 4RLYA 4N5QA 3TWSA 2XEEA 2VGEA 5KNHD 4U95D 3ZU7B 1MYOA 3JXJA 4DUIA 4Z68A 1AP7A 4U96D 1IXVA 5AQ7A 3ZUVB 2ETAA 3HG0D 2XZTG 3EU9A 3J5QB 1YMPA 5EILA 4BERA 3B95A 5CECB 4J7WA 5ENTD 1S70B 4G8LA 3TWWA 2FO1E 5EIBE 1OT8A 1G3NB 4CYMD 4C48B 3LJNA 1MJ0A 2ETCA 2ETBA 2XZDG 2F8XK 4BESA 5ENPD 3AJIA 2JABA 4QFVA 4HRLA 3C5RA 4YDYA 5FINA 1BI7B 3UXGA 2XENA 4DX1A
chains in the Genus database with same CATH superfamily
4YDEA 2XPIA 3UM1A 3E30A 2GRLA 3FH8A 1H2UA 1U2VG 3J5PA 3WXXA 3L08A 3RKVA 5G04J 5CBNA 3TL5A 2XHEA 3ZNGA 2AVPA 4PDXA 2LXMA 2WXRA 2IO3C 2QYJA 4JHKA 2LSVA 4APFA 1N0QA 3VTYA 1X5BA 4XZ4A 4U8HA 2H6FA 4M7CA 5CCMA 4DI4A 4PS7A 4QQIA 4A3VA 2NYJA 4JA7A 4J8FA 2HE0A 4HXIA 3U64A 1RW2A 4ILGA 3DPDA 1V55E 3VLFA 3IEGA 4CZ2D 1INZA 2LO6A 4FLBA 3QARA 3U66A 4B8AA 4EQFA 3MEKA 4AOFA 5G04C 5G55A 3UI2A 1NP7A 4HOTA 4K0RA 1IKND 4EBAA 4DK5A 2XEEA 2WXMA 2BF0X 1MYOA 2IFUA 2WXJA 2CFUA 3LY7A 1TNUA 1G3NB 3U3WA 3ZXSA 3PNTB 1SA5A 2XENA 3EDTB 4DX6D 4JVSA 4K5AB 3CR3A 3EJNA 3FUEA 4BX9A 4JB8P 3FUIA 5JJTA 2AXVA 4L23A 5LOZA 4NRHB 4DX5D 1FVHA 1EYHA 3HVEB 1OY3D 2IOLA 4HOQA 4TRQA 1QBQA 3EU5A 2V8SE 3ASHA 4GTSA 3ZKJA 4GZ3A 3PUKA 3JQ0A 5EN5D 4I1OB 5LCWC 5T4YA 2IY0C 5AN8A 3ONKA 3JXIA 3FTXA 5EDSA 4LNBA 1EPUA 4U63A 2BKKB 2IU1A 3BQOA 1E8ZA 3ZHEA 3HYMB 1E7UA 3ENEA 4RG6A 1QQEA 1IXVA 3ESLA 3ZUVB 1JWGA 3PE3A 3BUAA 1KT1A 3X2QE 1E90A 4PH4B 5EIBE 2ETBA 2XZDG 2I6HA 1BI7B 4CRWA 1V54E 5D0OD 4U04A 1QZ2A 5D0QD 2VGXB 4BT8A 4I2WA 3R7QA 5CBOA 1TJCA 4LEUA 4GA2A 4KZCA 4HOSA 4WWNA 4KVMA 3PEVB 4MBGA 3CIAA 2M63A 3C72A 3NOGD 4C9BB 4APOA 4F6RD 4MS6A 3F6QA 5BW8C 2RKKA 2GRMA 2XQ0A 2ZGDA 2EILE 4J8EA 2CHXA 1KLXA 2AXUA 3B7SA 1BI8B 3SHFA 3TG5A 5B1AE 3GZSA 4GAAA 3AS4A 3GW4A 3ZEFA 4YVQC 3ZGQA 2WPVA 4IN3B 1TN7A 3FUFA 3RRNB 4A3TA 2IEJA 4I6JA 1DVPA 1O1TA 3UX4A 3ZRHA 4GU5A 1WAO1 4AM9A 4HQDA 3CVXA 4D10C 4LNUD 5HQ8A 3FTUA 3MX3A 3ZW3A 1OCZE 4UWLA 4CT0A 3FDHA 4BTAA 3MGBA 2P9LG 3HG0D 4B94A 2LAHA 1PY1A 3SNXA 3WG7E 3ZYMA 2F8XK 3ASNE 4AIFA 3ZYQA 2HO1A 3HHMA 3AAAC 4AV7A 3LVRE 3DWLG 2A5EA 3SO8A 3FUNA 2WXGA 2VSNA 4GYOA 3MKRA 3SFZA 3R7RA 4U0SA 3UINC 1MX6A 4Q94A 5JA4D 1H19A 4XI0A 4P29A 2RG8A 3L17A 3HXFA 2R2LA 3I4RB 4CGVA 2C2LA 2PNNA 4U0UA 2ONDA 4DI3A 3NBNB 3NF1A 3PZ1A 1NI1A 5H7PA 3T5XA 3L6AA 3ABLE 3ISMC 5ENSD 1MX2A 4MLPA 2DZNA 2XPZA 3CK7A 1FCHA 1HE8A 4KXKB 4ANVA 4XE0A 2RFAA 1KZOA 3UPVA 4RLYA 2NXPA 3QNKA 1TNZA 4F1SA 1NL4A 4RVBA 4I17A 2WMNA 3EIJA 2UY1B 4BSXA 1N9AA 3ULQA 3TGOA 3S7FA 1OT8A 3FUJA 3UXGA 4HRLA 1TEZA 4LCTA 2NSZA 4JPSA 2A4ZA 2H6GA 4EZLA 5A7DB 3ZVVA 1D9SA 3ASGA 3CSTA 2FULA 2OCCE 2X6FA 3B7TA 4DLQA 2DZOA 3T5VA 3C3OA 3PH0C 4OAVB 3DEOA 4FADA 2VYIA 5EX3A 3BG1B 2R5SA 2YHEA 3E34A 2P58C 5BPPA 3C98A 3U4TA 3SY2A 3CQGB 3CK8A 4K5CA 2AW6A 2I1KA 5CHEE 3PUJA 3FTSA 1H6OA 5AQ9A 3MCXA 1BD8A 5HS0A 1LD8A 2L6BA 4HRMB 5DIZA 1YA0A 2IO2C 4E85A 2XGSA 3W9GA 3QJZA 2ZXWE 5AJDA 1AWCB 4HRNA 4GZDA 3CVPA 4I2ZA 1D8DA 5HI7A 4N5QA 3CVVA 3HXEA 3CHRA 4JXTA 3UIOC 3T8MA 3E33A 4CEMA 3BEEA 4I1MA 1ZB1A 4GCOA 2ZIRA 1TN8A 1S70B 3TWWA 3EUVA 5KJMA 1UJJA 4GTQA 3AJIA 4GMLA 3C5RA 4WWPA 3I5PA 5AJLA 3SZ7A 3ASFA 5J08A 4UUCA 2LNIA 1LF8A 2BKGA 3QC1A 3S7BA 3IV0A 5AIJA 4ILHB 1S64A 3TXMA 4OYSA 1E7VA 4J8DA 1SZ9A 2WXLA 3RIBA 2QC9A 2VSOE 5FQ6A 3SI5A 2GRRB 3BU8A 1IQRA 3FULA 2GW1A 5ARGA 3W9FA 4H7YA 3TJPA 5LP0A 1A5EA 1VDYA 5FZRA 2ZU6B 3L22A 2X6HA 2X6JA 3UTMA 2WXOA 4GMJA 5BXOA 3R9AB 3HRAA 2J8SD 3O48A 4BSZB 5ENNA 4MRUA 2WQ7A 3T8KA 3C3RA 4XKCA 3V79K 3QKYA 4UQZA 4G1TA 4O6FA 4ILIA 4A55A 3FEXA 1JUQA 1U3DA 4N2SA 4FP7A 3PE4A 3JQ1A 2DIWA 3O4ZA 4JEHA 3FP3A 1RZ4A 3CVQA 4WNFA 3UQ3A 5AENA 5CCLA 4EZJA 3LJ3A 4PUCA 3CKBA 1EDUA 2YHCA 5ENQD 3HXDA 2ZGGA 2KBXA 3B7RL 1SQMA 3MA5A 4XKBA 5FIOA 3UT4A 2YNQA 5FT9A 5B3SE 3HXBA 4XX5A 5KJNA 2WB2A 3OXFA 4BWRA 2X6IA 4HBDA 1OWOA 3FTWA 3RJVA 2WQHA 1H2VC 5LCWJ 4N3BA 4CGWA 1WDYA 1OWNA 4A63B 1HG5A 3RRUA 1TYQG 1Q2ZA 2R05A 4NACA 3SFYA 5D66A 4KYOB 4IRUA 3SD5A 5KBAA 3RO2A 2QFCA 3Q78A 4JC8A 2J49A 3LPZA 2QZAA 1ZBPA 2X3MA 3NOCD 2L0IA 2XPYA 2VSYA 4ANWA 1N94A 2F8YA 2L0TB 2EIJE 4X8QA 3PVLA 3TWRA 3T9KA 5ITZF 4G25A 4FJZA 4U8VD 3VLDA 4Q69A 1Y6IA 3PNLB 3UKRG 2V4HC 1L5JA 3I4GA 2OOEA 4ATGA 3ABKE 4DJAA 4UQXA 4G2VA 1AP7A 3D9KA 3LEWA 4LERA 2XCBA 3B95A 3NQPA 3PRZA 5ENTD 5FQ7A 3P2BA 3Q73A 3LJNA 2P9KG 4BESA 5ENPD 3QDNA 2JABA 2WM9A 1OWPA 1N95A 5E76A 4ACLA 2Q7FA 3UM3A 1TR4A 2PM7A 4GZ6A 5B1BE 5KCMA 3GYZA 4IULA 4AEZC 3E4BA 2BUGA 4UQYA 2KXPC 1DNPA 3HIZA 3DSUA 2H6HA 3OXLA 4TV3A 3E32A 4HVBA 2LAIA 1Z3XA 3IHYA 4AP2A 4GCNA 4TUMA 3FTVA 1FT1A 1TNOA 2CG3A 2OEWA 3D9IA 3FUKA 4GTVA 2Y3AA 2WQ6A 1YYHA 1TNYA 1TJFA 5KJKA 2P9NG 1N11A 2VTBB 3LY9A 2KCKA 1MX4A 5BNWA 5BUZA 3Q7AA 2I1JA 3FU6A 4F3VA 1D8EA 4KZ0A 2P9PG 3BG0B 1B89A 3SBSA 3CGHA 1S63A 4N3CA 3CSFA 2OEVA 2WXNA 1OCRE 4YNDA 4AVXA 4YVOA 2KCLA 2XZTG 3EU9A 4GTOA 2VQ2A 4IYPA 1UJKA 2YINA 5EX0A 3HVEA 4TXRA 2GROB 5EKQD 2F37A 5ANRA 2RD0A 5JJ7A 2FBNA 2IONA 5AYWD 2LSUA 4K03A 2VSXE 4FU3A 1TNBA 3V2OA 2OVBA 3URZA 3JUIA 2AJAA 3FWVA 5AQAA 4TUUA 1KT0A 3L13A 1Z5SC 3TWQA 3TWUA 1NA0A 4L1BA 3SQVA 3NZUA 1DC2A 4EECA 3PZ2A 3CV0A 3FTYA 1QNFA 2JLBA 3HXCA 3R9MA 4ME2A 2GRQB 3DSXA 3FU3A 3NZSA 3TWVA 4FULA 3SGHA 4BX8A 4J6IA 5ENRD 2MOWA 3ASDA 3V30A 3K9IA 3ZIMA 2DVWA 3AG1E 4NIKA 3L9TA 4U07A 2LUHA 4GTTA 3D9PA 4CDRA 3FH5A 1GW6A 2EIME 2H6IA 4WNDA 2ZISA 1Z6TA 3LCAA 5HRYA 1BLXB 2EINE 1P5QA 1PC2A 1SZAA 4BEPA 1O5MA 4GB9A 2P9UG 3LVQE 5FQ8A 2VGXA 1H0AA 3G2WA 3CQCB 4MKTA 4J0UA 2CFZA 3QAQA 2LXLA 1E8YA 1N4PA 4F7AA 3PZ4A 4GYWA 5FQ4A 5D2MC 1XNFA 4ANXA 5JHAA 5KJLA 2Y4UA 1H6KA 2YQ8A 2VTBA 4UWFA 1E96B 3S7DA 1MJ0A 4QFVA 3CVYA 5C2YA 1K1BA 2L9BA 3C3QA 5CEAA 5CERB 3B7BA 2Y0BG 3EHNA 1SVXA 2XEVA 5EYLA 2OV8A 2DBAA 4HI9A 1OUVA 2KZTB 1N4QA 4WWOA 3ULEG 3G2SA 1WY6A 3Q47B 4I9EA 4J8YA 3RSEG 3PDNA 4OAUC 5T8IA 4EPZA 1IHBA 4XI9A 2KC7A 3G2VA 3UT7A 4LRZA 1UW4B 4HI8A 2L6JA 3DEPA 3NAWA 4JD2G 1O1SA 5AAOA 3OAWA 4C0MA 3APFA 4LG6A 1JCQA 3U9WA 5G2NA 4N2QA 3DSWA 5KWDA 3V2XA 1ELRA 4WAFA 3RU0A 5AARA 1HO8A 2XGMA 3FU5A 3VTXA 1A17A 4F53A 2XCCA 4JEUA 4WNGA 1E8WA 2AWIA 3N71A 3J5QB 5E75A 3Q79A 2F0YA 3ML9A 1XGWA 1OWMA 3TAXA 3LYAA 2FO7A 3PZ3A 3DSSA 3CK9A 3TWXA 4Y6CA 2J9QA 3IBEA 3MKQB 2KM4A 2AXZA 1HH8A 3JUEA 2VGYA 4ZHBA 1OCOE 3FU0A 4XIFA 3KSLA 2P9IG 1H6PA 3FUHA 2P2CP 4NURA 4HS2A 1JCRA 3G2TA 4KMOA 3CHPA 4KT6B 4ACKA 4C0EA 4H7XA 4JA9A 3AG3E 4LNGA 4BY6A 2GGFA 4AY5A 2QYUA 1DCQA 1MHQA 3DBSA 3Q5MA 3PEUB 5BV0A 4LUNU 1W3BA 2WVIA 2WXPA 4HNAD 4DRXE 4UWKA 3D9NA 3OTNA 3EHRA 3FUDA 2FI7A 2UY1A 4W9RA 1KZPA 3V31A 4GZCA 2HR2A 2J08A 2UWJG 3QWWA 5FWQA 5FJYA 4G26A 3KSQA 1X81A 3ZYKA 1NFIE 2XGOA 1N4SA 2IOSA 3E37A 4EBAG 4RG9A 5BT1A 3JXJA 2MRIA 4U96D 3GZ1A 4TXQA 3CHSA 3ONLA 1N4RA 3UMVA 3ULYA 3PS6A 1OCCE 3GZ2A 5FINA 4DX1A 3Q9UC 3UUXA 3ZXPA 3FFLA 3ZHEB 4ZFHA 4A1SA 1UN9A 4O60A 5LFAA 3UM0A 2RFMA 4FA6A 4JW1A 4CDMA 5EYPF 4GTRA 5ARFA 3LDZA 4LSZE 3ASOE 4FLHA 4OVUA 1OWLA 4EHMA 4ABNA 3AU4A 2E0IA 4AJWA 3DXMG 4XEIG 4PS3A 4BETA 1JPLA 1UOHA 1Y8MA 3QWPA 1OXJA 4UI9J 3MKQA 1H2TC 4B89A 2EQXA 2CHWA 1U3CA 3I3NA 4I6EA 3D9MA 1IYGA 2Y1LE 4K5BA 3KAEA 1K3ZD 3G2UA 3DRAA 3UIPC 3RRMB 3ZU7B 4DUIA 2P9SG 3QB2A 5G05J 2WXIA 4NQ0A 5EILA 4FHKA 3MV3B 4Q96A 2QY7A 2ETCA 2WXHA 1DCEA 2Y69E 5JMND 4UI9C 3D3MA 1YCSB 2DWZA 4JZYA 3QWVA 3KS2A 4GA1A 3UKUG 4I6GA 3LS8A 3TWTA 4F1PA 3AU5A 3Q7FA 1LD7A 2DYRE 4GZ5A 4ANUA 1N54A 3KD7A 1ELKA 4L9PA 3TXNA 3Q9NC 2J09A 4GYYA 3FY4A 4N3AA 1HG2A 4B0ZA 3Q4AB 5IY5E 2XEHA 4G8KA 4B93B 5G05C 1BPOA 4GTPA 4GMRA 4AY6A 4FHJA 3Q75A 2GRNB 3JYSA 3D9OA 4J8SA 4KBQA 3EIQC 1BU9A 4FC8A 5EIDA 2PZIA 3AG2E 2R02A 2B6CA 3Q15A 1LTXA 2V4LA 4WNEA 2PQNA 4I1AA 5BV1A 3FUMA 5FTPA 3RAUA 5JHBA 5CECB 3L54A 4YDOA 5CMWA 4G8LA 3DPYA 2V0PA 3ESKA 4M3OA 4YDYA 3PZDA 1EF1C 3KEZA 3TG4A 5A6CA 5ENOD 4WUYA 3VLEA 4RQIA 3LXUX 1HS6A 3CHQA 4O1OA 3FEYA 3DSTA 3L82A 4U8YD 1HX8A 4GA0A 4GTMA 2J07A 3MJWA 1KPSB 4ATZD 4JHJA 5M72A 4JHRA 4GPMA 4DX7D 5BXUA 1JCSA 3MZLB 3APCA 4DLOA 5JJ6A 4CCAA 4TXPA 2C0LA 4HLEA 5DBKA 2WMOA 4GPKA 3IXEA 4U7EB 3FH7A 2B0OE 3Q49B 1ZU2A 2FF4A 2V5FA 1FVFA 3D9HA 2J4BA 4L7TA 2XS8A 3FTZA 4O1PA 4UWHA 2CHZA 1N0RA 4BT9A 1FPPA 3DSVA 1PAQA 3CVNA 4V3IA 4G24A 4RSYA 1SA4A 3CKCA 4U95D 3UM2A 4HOUA 2ETAA 3MV2B 4J7WA 4URKA 2BTDA 4PS8A 2R03A 2NC9A 3DXKG 4C48B 2PL2A 4BFRA 3IHVA 5J90A 2BEDA 2OVFA 2CG2A 3AS5A 2WXFA 1SW6A 1HXIA 4G23A 1MZCA 3CEQA 3D9LA 2E2EA 2HM8A 2X6KA 1WG0A 3OXGA 2MHKA 1QYMA 5ANLA 2JEKA 4AXHA 2Y4TA 1S0PA 3EHMA 2MYOA 5LX8A 1HF8A 3CVWA 4L2YA 2HYZA 4L2LA 4FJYA 2A5UA 4HB5A 4DX2A 3HDXA 1WM5A 3JCKC 1HZ4A 3EHQA 5CRVA 3UT8A 4CDNA 2XRYA 4U0ZA 3ABME 3IKOB 1IHGA 3SBTB 3SFXA 3CHOA 2PM6A 3CHMA 2V5QC 4KVOA 3CLJA 4HLLA 5A23A 2VGEA 2GRPB 5KNHD 4Z68A 1NZNA 4OVVA 3PREA 3RO3A 3P1UA 2IF4A 1YMPA 1ELWA 2C0MA 1UN8A 2IJGX 1TN6A 4E6HA 3S7JA 2KATA 1Z3YA 1FT2A 2DCPA 5FZSA 3FHEA 3ZPJA 3RK6A 3B13A 3ZN3A 3QOUA 4HFGA 4Y6WA 4I43A 2DYSE 1N52A 2I2OA 3KEAA 1JWFA 2R59A 2R17C 2XS1A 3ZYLA 1O1RA 5C1DA 4EZKA 5AQBA 2VJ8A 1K1AA 4UI9K 4BTBA 4G11A 3D9JA 2WXKA 3QK0A 3L16A 2J4DA 1MQSA 3LKUA 3APDA 1IQUA 1E8XA 2EIKE 5HKPA 5FZQA 4YDWA 3LY8A 2XRZA 1NA3A 3ZFWA 2PQRA 5CMYA 2ILRA 3CVLA 2WXQA 4CT4A 2IQCA 3MYVA 1HFAA 2FEZA 3AS8A 1K8KG 3B7UX 1UG3A 4I9CA 3ML8A 5CEDB 3S2AA 5KNGA 2X38A 3TWSA 2KCVA 5CRUA 4N5CA 1HU3A 4HORA 5T3RA 4JL0A 3AG4E 4R7LA 4B8CB 4A1GA 4N39A 5AQ7A 4UWGA 4BERA 3CVUA 2I9CA 2KZTA 2FO1E 4DPRA 4CYMD 3SF4A 3NB2A
chains in the Genus database with same CATH topology
4DX6D 4UUCA 3Q9UC 5ENOD 5JMND 1SW6A 3AAAC 1D9SA 1K1BA 1TR4A 3J5PA 1YCSB 2A5EA 2BKGA 2F37A 4K5AB 5ENQD 4O1OA 3TWXA 3SO8A 5CEAA 2ZGGA 2DWZA 4ZFHA 4O60A 5CERB 4U8YD 2KBXA 3B7BA 3KEAA 2RFMA 5CBOA 5FIOA 2KXPC 3JUEA 5CBNA 2Y0BG 3V2OA 3TWTA 5EYPF 2DZOA 4F1PA 4ZHBA 4LSZE 2AJAA 1SVXA 4JB8P 3ZNGA 1MX6A 2P2CP 5EYLA 5AQAA 2QC9A 4HI9A 4ATZD 5JA4D 1WG0A 2QYJA 1QYMA 4OAVB 3DEOA 3TWUA 3TWQA 4GPMA 4HBDA 4DX7D 3NOGD 4DX5D 3Q9NC 5AQBA 5BXUA 1N0QA 3W9FA 4TUMA 1K1AA 2MYOA 1DC2A 1OY3D 4F6RD 1WDYA 4A63B 4J8YA 4OAUC 3F6QA 2XEHA 4G8KA 4B93B 1DCQA 1IHBA 1A5EA 4QQIA 3TWVA 5D66A 1YYHA 2ZGDA 2PNNA 4BETA 4K5CA 1BI8B 4HB5A 5KBAA 4HNAD 4DX2A 2NYJA 1UOHA 5ENRD 4DRXE 3IXEA 5HKPA 4GMRA 2HE0A 2B0OE 3NBNB 3UTMA 3V30A 3EHQA 4HI8A 4YDWA 1N11A 2DVWA 3EHRA 3ZKJA 3DEPA 3D9HA 4NIKA 3NOCD 5EN5D 4CZ2D 3V31A 1MX4A 5AQ9A 5BXOA 5AAOA 1BD8A 5HS0A 2L6BA 4HRMB 3HRAA 5ENSD 2J8SD 1MX2A 2DZNA 4LG6A 4O1PA 4BSZB 3W9GA 5HRYA 1AWCB 4HRNA 5AN8A 2F8YA 1N0RA 1BLXB 3JXIA 3TWRA 2RFAA 3T9KA 4BEPA 5ITZF 5KWDA 3V2XA 3UI2A 1NFIE 1BU9A 2Y1LE 5EIDA 5CEDB 2V5QC 4K5BA 4U8VD 1K3ZD 2BKKB 3T8KA 5KNGA 5AARA 4HQDA 4HLLA 3V79K 1IKND 2V4HC 4LNUD 4RLYA 4N5QA 3TWSA 2XEEA 2VGEA 5KNHD 4U95D 3ZU7B 1MYOA 3JXJA 4DUIA 4Z68A 1AP7A 4U96D 1IXVA 5AQ7A 3ZUVB 2ETAA 3HG0D 2XZTG 3EU9A 3J5QB 1YMPA 5EILA 4BERA 3B95A 5CECB 4J7WA 5ENTD 1S70B 4G8LA 3TWWA 2FO1E 5EIBE 1OT8A 1G3NB 4CYMD 4C48B 3LJNA 1MJ0A 2ETCA 2ETBA 2XZDG 2F8XK 4BESA 5ENPD 3AJIA 2JABA 4QFVA 4HRLA 3C5RA 4YDYA 5FINA 1BI7B 3UXGA 2XENA 4DX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DX6 D;  4UUC A;  3Q9U C;  5ENO D;  5JMN D;  1SW6 A;  3AAA C;  1D9S A;  1K1B A;  1TR4 A;  3J5P A;  1YCS B;  2A5E A;  2BKG A;  2F37 A;  4K5A B;  5ENQ D;  4O1O A;  3TWX A;  3SO8 A;  5CEA A;  2ZGG A;  2DWZ A;  4ZFH A;  4O60 A;  5CER B;  4U8Y D;  2KBX A;  3B7B A;  3KEA A;  2RFM A;  5CBO A;  5FIO A;  2KXP C;  3JUE A;  5CBN A;  2Y0B G;  3V2O A;  3TWT A;  5EYP F;  2DZO A;  4F1P A;  4ZHB A;  4LSZ E;  2AJA A;  1SVX A;  4JB8 P;  3ZNG A;  1MX6 A;  2P2C P;  5EYL A;  5AQA A;  2QC9 A;  4HI9 A;  4ATZ D;  5JA4 D;  1WG0 A;  2QYJ A;  1QYM A;  4OAV B;  3DEO A;  3TWU A;  3TWQ A;  4GPM A;  4HBD A;  4DX7 D;  3NOG D;  4DX5 D;  3Q9N C;  5AQB A;  5BXU A;  1N0Q A;  3W9F A;  4TUM A;  1K1A A;  2MYO A;  1DC2 A;  1OY3 D;  4F6R D;  1WDY A;  4A63 B;  4J8Y A;  4OAU C;  3F6Q A;  2XEH A;  4G8K A;  4B93 B;  1DCQ A;  1IHB A;  1A5E A;  4QQI A;  3TWV A;  5D66 A;  1YYH A;  2ZGD A;  2PNN A;  4BET A;  4K5C A;  1BI8 B;  4HB5 A;  5KBA A;  4HNA D;  4DX2 A;  2NYJ A;  1UOH A;  5ENR D;  4DRX E;  3IXE A;  5HKP A;  4GMR A;  2HE0 A;  2B0O E;  3NBN B;  3UTM A;  3V30 A;  3EHQ A;  4HI8 A;  4YDW A;  1N11 A;  2DVW A;  3EHR A;  3ZKJ A;  3DEP A;  3D9H A;  4NIK A;  3NOC D;  5EN5 D;  4CZ2 D;  3V31 A;  1MX4 A;  5AQ9 A;  5BXO A;  5AAO A;  1BD8 A;  5HS0 A;  2L6B A;  4HRM B;  3HRA A;  5ENS D;  2J8S D;  1MX2 A;  2DZN A;  4LG6 A;  4O1P A;  4BSZ B;  3W9G A;  5HRY A;  1AWC B;  4HRN A;  5AN8 A;  2F8Y A;  1N0R A;  1BLX B;  3JXI A;  3TWR A;  2RFA A;  3T9K A;  4BEP A;  5ITZ F;  5KWD A;  3V2X A;  3UI2 A;  1NFI E;  1BU9 A;  2Y1L E;  5EID A;  5CED B;  2V5Q C;  4K5B A;  4U8V D;  1K3Z D;  2BKK B;  3T8K A;  5KNG A;  5AAR A;  4HQD A;  4HLL A;  3V79 K;  1IKN D;  2V4H C;  4LNU D;  4RLY A;  4N5Q A;  3TWS A;  2XEE A;  2VGE A;  5KNH D;  4U95 D;  3ZU7 B;  1MYO A;  3JXJ A;  4DUI A;  4Z68 A;  1AP7 A;  4U96 D;  1IXV A;  5AQ7 A;  3ZUV B;  2ETA A;  3HG0 D;  2XZT G;  3EU9 A;  3J5Q B;  1YMP A;  5EIL A;  4BER A;  3B95 A;  5CEC B;  4J7W A;  5ENT D;  1S70 B;  4G8L A;  3TWW A;  2FO1 E;  5EIB E;  1OT8 A;  1G3N B;  4CYM D;  4C48 B;  3LJN A;  1MJ0 A;  2ETC A;  2ETB A;  2XZD G;  2F8X K;  4BES A;  5ENP D;  3AJI A;  2JAB A;  4QFV A;  4HRL A;  3C5R A;  4YDY A;  5FIN A;  1BI7 B;  3UXG A;  2XEN A;  4DX1 A; 
#chains in the Genus database with same CATH topology
 4YDE A;  2XPI A;  3UM1 A;  3E30 A;  2GRL A;  3FH8 A;  1H2U A;  1U2V G;  3J5P A;  3WXX A;  3L08 A;  3RKV A;  5G04 J;  5CBN A;  3TL5 A;  2XHE A;  3ZNG A;  2AVP A;  4PDX A;  2LXM A;  2WXR A;  2IO3 C;  2QYJ A;  4JHK A;  2LSV A;  4APF A;  1N0Q A;  3VTY A;  1X5B A;  4XZ4 A;  4U8H A;  2H6F A;  4M7C A;  5CCM A;  4DI4 A;  4PS7 A;  4QQI A;  4A3V A;  2NYJ A;  4JA7 A;  4J8F A;  2HE0 A;  4HXI A;  3U64 A;  1RW2 A;  4ILG A;  3DPD A;  1V55 E;  3VLF A;  3IEG A;  4CZ2 D;  1INZ A;  2LO6 A;  4FLB A;  3QAR A;  3U66 A;  4B8A A;  4EQF A;  3MEK A;  4AOF A;  5G04 C;  5G55 A;  3UI2 A;  1NP7 A;  4HOT A;  4K0R A;  1IKN D;  4EBA A;  4DK5 A;  2XEE A;  2WXM A;  2BF0 X;  1MYO A;  2IFU A;  2WXJ A;  2CFU A;  3LY7 A;  1TNU A;  1G3N B;  3U3W A;  3ZXS A;  3PNT B;  1SA5 A;  2XEN A;  3EDT B;  4DX6 D;  4JVS A;  4K5A B;  3CR3 A;  3EJN A;  3FUE A;  4BX9 A;  4JB8 P;  3FUI A;  5JJT A;  2AXV A;  4L23 A;  5LOZ A;  4NRH B;  4DX5 D;  1FVH A;  1EYH A;  3HVE B;  1OY3 D;  2IOL A;  4HOQ A;  4TRQ A;  1QBQ A;  3EU5 A;  2V8S E;  3ASH A;  4GTS A;  3ZKJ A;  4GZ3 A;  3PUK A;  3JQ0 A;  5EN5 D;  4I1O B;  5LCW C;  5T4Y A;  2IY0 C;  5AN8 A;  3ONK A;  3JXI A;  3FTX A;  5EDS A;  4LNB A;  1EPU A;  4U63 A;  2BKK B;  2IU1 A;  3BQO A;  1E8Z A;  3ZHE A;  3HYM B;  1E7U A;  3ENE A;  4RG6 A;  1QQE A;  1IXV A;  3ESL A;  3ZUV B;  1JWG A;  3PE3 A;  3BUA A;  1KT1 A;  3X2Q E;  1E90 A;  4PH4 B;  5EIB E;  2ETB A;  2XZD G;  2I6H A;  1BI7 B;  4CRW A;  1V54 E;  5D0O D;  4U04 A;  1QZ2 A;  5D0Q D;  2VGX B;  4BT8 A;  4I2W A;  3R7Q A;  5CBO A;  1TJC A;  4LEU A;  4GA2 A;  4KZC A;  4HOS A;  4WWN A;  4KVM A;  3PEV B;  4MBG A;  3CIA A;  2M63 A;  3C72 A;  3NOG D;  4C9B B;  4APO A;  4F6R D;  4MS6 A;  3F6Q A;  5BW8 C;  2RKK A;  2GRM A;  2XQ0 A;  2ZGD A;  2EIL E;  4J8E A;  2CHX A;  1KLX A;  2AXU A;  3B7S A;  1BI8 B;  3SHF A;  3TG5 A;  5B1A E;  3GZS A;  4GAA A;  3AS4 A;  3GW4 A;  3ZEF A;  4YVQ C;  3ZGQ A;  2WPV A;  4IN3 B;  1TN7 A;  3FUF A;  3RRN B;  4A3T A;  2IEJ A;  4I6J A;  1DVP A;  1O1T A;  3UX4 A;  3ZRH A;  4GU5 A;  1WAO 1;  4AM9 A;  4HQD A;  3CVX A;  4D10 C;  4LNU D;  5HQ8 A;  3FTU A;  3MX3 A;  3ZW3 A;  1OCZ E;  4UWL A;  4CT0 A;  3FDH A;  4BTA A;  3MGB A;  2P9L G;  3HG0 D;  4B94 A;  2LAH A;  1PY1 A;  3SNX A;  3WG7 E;  3ZYM A;  2F8X K;  3ASN E;  4AIF A;  3ZYQ A;  2HO1 A;  3HHM A;  3AAA C;  4AV7 A;  3LVR E;  3DWL G;  2A5E A;  3SO8 A;  3FUN A;  2WXG A;  2VSN A;  4GYO A;  3MKR A;  3SFZ A;  3R7R A;  4U0S A;  3UIN C;  1MX6 A;  4Q94 A;  5JA4 D;  1H19 A;  4XI0 A;  4P29 A;  2RG8 A;  3L17 A;  3HXF A;  2R2L A;  3I4R B;  4CGV A;  2C2L A;  2PNN A;  4U0U A;  2OND A;  4DI3 A;  3NBN B;  3NF1 A;  3PZ1 A;  1NI1 A;  5H7P A;  3T5X A;  3L6A A;  3ABL E;  3ISM C;  5ENS D;  1MX2 A;  4MLP A;  2DZN A;  2XPZ A;  3CK7 A;  1FCH A;  1HE8 A;  4KXK B;  4ANV A;  4XE0 A;  2RFA A;  1KZO A;  3UPV A;  4RLY A;  2NXP A;  3QNK A;  1TNZ A;  4F1S A;  1NL4 A;  4RVB A;  4I17 A;  2WMN A;  3EIJ A;  2UY1 B;  4BSX A;  1N9A A;  3ULQ A;  3TGO A;  3S7F A;  1OT8 A;  3FUJ A;  3UXG A;  4HRL A;  1TEZ A;  4LCT A;  2NSZ A;  4JPS A;  2A4Z A;  2H6G A;  4EZL A;  5A7D B;  3ZVV A;  1D9S A;  3ASG A;  3CST A;  2FUL A;  2OCC E;  2X6F A;  3B7T A;  4DLQ A;  2DZO A;  3T5V A;  3C3O A;  3PH0 C;  4OAV B;  3DEO A;  4FAD A;  2VYI A;  5EX3 A;  3BG1 B;  2R5S A;  2YHE A;  3E34 A;  2P58 C;  5BPP A;  3C98 A;  3U4T A;  3SY2 A;  3CQG B;  3CK8 A;  4K5C A;  2AW6 A;  2I1K A;  5CHE E;  3PUJ A;  3FTS A;  1H6O A;  5AQ9 A;  3MCX A;  1BD8 A;  5HS0 A;  1LD8 A;  2L6B A;  4HRM B;  5DIZ A;  1YA0 A;  2IO2 C;  4E85 A;  2XGS A;  3W9G A;  3QJZ A;  2ZXW E;  5AJD A;  1AWC B;  4HRN A;  4GZD A;  3CVP A;  4I2Z A;  1D8D A;  5HI7 A;  4N5Q A;  3CVV A;  3HXE A;  3CHR A;  4JXT A;  3UIO C;  3T8M A;  3E33 A;  4CEM A;  3BEE A;  4I1M A;  1ZB1 A;  4GCO A;  2ZIR A;  1TN8 A;  1S70 B;  3TWW A;  3EUV A;  5KJM A;  1UJJ A;  4GTQ A;  3AJI A;  4GML A;  3C5R A;  4WWP A;  3I5P A;  5AJL A;  3SZ7 A;  3ASF A;  5J08 A;  4UUC A;  2LNI A;  1LF8 A;  2BKG A;  3QC1 A;  3S7B A;  3IV0 A;  5AIJ A;  4ILH B;  1S64 A;  3TXM A;  4OYS A;  1E7V A;  4J8D A;  1SZ9 A;  2WXL A;  3RIB A;  2QC9 A;  2VSO E;  5FQ6 A;  3SI5 A;  2GRR B;  3BU8 A;  1IQR A;  3FUL A;  2GW1 A;  5ARG A;  3W9F A;  4H7Y A;  3TJP A;  5LP0 A;  1A5E A;  1VDY A;  5FZR A;  2ZU6 B;  3L22 A;  2X6H A;  2X6J A;  3UTM A;  2WXO A;  4GMJ A;  5BXO A;  3R9A B;  3HRA A;  2J8S D;  3O48 A;  4BSZ B;  5ENN A;  4MRU A;  2WQ7 A;  3T8K A;  3C3R A;  4XKC A;  3V79 K;  3QKY A;  4UQZ A;  4G1T A;  4O6F A;  4ILI A;  4A55 A;  3FEX A;  1JUQ A;  1U3D A;  4N2S A;  4FP7 A;  3PE4 A;  3JQ1 A;  2DIW A;  3O4Z A;  4JEH A;  3FP3 A;  1RZ4 A;  3CVQ A;  4WNF A;  3UQ3 A;  5AEN A;  5CCL A;  4EZJ A;  3LJ3 A;  4PUC A;  3CKB A;  1EDU A;  2YHC A;  5ENQ D;  3HXD A;  2ZGG A;  2KBX A;  3B7R L;  1SQM A;  3MA5 A;  4XKB A;  5FIO A;  3UT4 A;  2YNQ A;  5FT9 A;  5B3S E;  3HXB A;  4XX5 A;  5KJN A;  2WB2 A;  3OXF A;  4BWR A;  2X6I A;  4HBD A;  1OWO A;  3FTW A;  3RJV A;  2WQH A;  1H2V C;  5LCW J;  4N3B A;  4CGW A;  1WDY A;  1OWN A;  4A63 B;  1HG5 A;  3RRU A;  1TYQ G;  1Q2Z A;  2R05 A;  4NAC A;  3SFY A;  5D66 A;  4KYO B;  4IRU A;  3SD5 A;  5KBA A;  3RO2 A;  2QFC A;  3Q78 A;  4JC8 A;  2J49 A;  3LPZ A;  2QZA A;  1ZBP A;  2X3M A;  3NOC D;  2L0I A;  2XPY A;  2VSY A;  4ANW A;  1N94 A;  2F8Y A;  2L0T B;  2EIJ E;  4X8Q A;  3PVL A;  3TWR A;  3T9K A;  5ITZ F;  4G25 A;  4FJZ A;  4U8V D;  3VLD A;  4Q69 A;  1Y6I A;  3PNL B;  3UKR G;  2V4H C;  1L5J A;  3I4G A;  2OOE A;  4ATG A;  3ABK E;  4DJA A;  4UQX A;  4G2V A;  1AP7 A;  3D9K A;  3LEW A;  4LER A;  2XCB A;  3B95 A;  3NQP A;  3PRZ A;  5ENT D;  5FQ7 A;  3P2B A;  3Q73 A;  3LJN A;  2P9K G;  4BES A;  5ENP D;  3QDN A;  2JAB A;  2WM9 A;  1OWP A;  1N95 A;  5E76 A;  4ACL A;  2Q7F A;  3UM3 A;  1TR4 A;  2PM7 A;  4GZ6 A;  5B1B E;  5KCM A;  3GYZ A;  4IUL A;  4AEZ C;  3E4B A;  2BUG A;  4UQY A;  2KXP C;  1DNP A;  3HIZ A;  3DSU A;  2H6H A;  3OXL A;  4TV3 A;  3E32 A;  4HVB A;  2LAI A;  1Z3X A;  3IHY A;  4AP2 A;  4GCN A;  4TUM A;  3FTV A;  1FT1 A;  1TNO A;  2CG3 A;  2OEW A;  3D9I A;  3FUK A;  4GTV A;  2Y3A A;  2WQ6 A;  1YYH A;  1TNY A;  1TJF A;  5KJK A;  2P9N G;  1N11 A;  2VTB B;  3LY9 A;  2KCK A;  1MX4 A;  5BNW A;  5BUZ A;  3Q7A A;  2I1J A;  3FU6 A;  4F3V A;  1D8E A;  4KZ0 A;  2P9P G;  3BG0 B;  1B89 A;  3SBS A;  3CGH A;  1S63 A;  4N3C A;  3CSF A;  2OEV A;  2WXN A;  1OCR E;  4YND A;  4AVX A;  4YVO A;  2KCL A;  2XZT G;  3EU9 A;  4GTO A;  2VQ2 A;  4IYP A;  1UJK A;  2YIN A;  5EX0 A;  3HVE A;  4TXR A;  2GRO B;  5EKQ D;  2F37 A;  5ANR A;  2RD0 A;  5JJ7 A;  2FBN A;  2ION A;  5AYW D;  2LSU A;  4K03 A;  2VSX E;  4FU3 A;  1TNB A;  3V2O A;  2OVB A;  3URZ A;  3JUI A;  2AJA A;  3FWV A;  5AQA A;  4TUU A;  1KT0 A;  3L13 A;  1Z5S C;  3TWQ A;  3TWU A;  1NA0 A;  4L1B A;  3SQV A;  3NZU A;  1DC2 A;  4EEC A;  3PZ2 A;  3CV0 A;  3FTY A;  1QNF A;  2JLB A;  3HXC A;  3R9M A;  4ME2 A;  2GRQ B;  3DSX A;  3FU3 A;  3NZS A;  3TWV A;  4FUL A;  3SGH A;  4BX8 A;  4J6I A;  5ENR D;  2MOW A;  3ASD A;  3V30 A;  3K9I A;  3ZIM A;  2DVW A;  3AG1 E;  4NIK A;  3L9T A;  4U07 A;  2LUH A;  4GTT A;  3D9P A;  4CDR A;  3FH5 A;  1GW6 A;  2EIM E;  2H6I A;  4WND A;  2ZIS A;  1Z6T A;  3LCA A;  5HRY A;  1BLX B;  2EIN E;  1P5Q A;  1PC2 A;  1SZA A;  4BEP A;  1O5M A;  4GB9 A;  2P9U G;  3LVQ E;  5FQ8 A;  2VGX A;  1H0A A;  3G2W A;  3CQC B;  4MKT A;  4J0U A;  2CFZ A;  3QAQ A;  2LXL A;  1E8Y A;  1N4P A;  4F7A A;  3PZ4 A;  4GYW A;  5FQ4 A;  5D2M C;  1XNF A;  4ANX A;  5JHA A;  5KJL A;  2Y4U A;  1H6K A;  2YQ8 A;  2VTB A;  4UWF A;  1E96 B;  3S7D A;  1MJ0 A;  4QFV A;  3CVY A;  5C2Y A;  1K1B A;  2L9B A;  3C3Q A;  5CEA A;  5CER B;  3B7B A;  2Y0B G;  3EHN A;  1SVX A;  2XEV A;  5EYL A;  2OV8 A;  2DBA A;  4HI9 A;  1OUV A;  2KZT B;  1N4Q A;  4WWO A;  3ULE G;  3G2S A;  1WY6 A;  3Q47 B;  4I9E A;  4J8Y A;  3RSE G;  3PDN A;  4OAU C;  5T8I A;  4EPZ A;  1IHB A;  4XI9 A;  2KC7 A;  3G2V A;  3UT7 A;  4LRZ A;  1UW4 B;  4HI8 A;  2L6J A;  3DEP A;  3NAW A;  4JD2 G;  1O1S A;  5AAO A;  3OAW A;  4C0M A;  3APF A;  4LG6 A;  1JCQ A;  3U9W A;  5G2N A;  4N2Q A;  3DSW A;  5KWD A;  3V2X A;  1ELR A;  4WAF A;  3RU0 A;  5AAR A;  1HO8 A;  2XGM A;  3FU5 A;  3VTX A;  1A17 A;  4F53 A;  2XCC A;  4JEU A;  4WNG A;  1E8W A;  2AWI A;  3N71 A;  3J5Q B;  5E75 A;  3Q79 A;  2F0Y A;  3ML9 A;  1XGW A;  1OWM A;  3TAX A;  3LYA A;  2FO7 A;  3PZ3 A;  3DSS A;  3CK9 A;  3TWX A;  4Y6C A;  2J9Q A;  3IBE A;  3MKQ B;  2KM4 A;  2AXZ A;  1HH8 A;  3JUE A;  2VGY A;  4ZHB A;  1OCO E;  3FU0 A;  4XIF A;  3KSL A;  2P9I G;  1H6P A;  3FUH A;  2P2C P;  4NUR A;  4HS2 A;  1JCR A;  3G2T A;  4KMO A;  3CHP A;  4KT6 B;  4ACK A;  4C0E A;  4H7X A;  4JA9 A;  3AG3 E;  4LNG A;  4BY6 A;  2GGF A;  4AY5 A;  2QYU A;  1DCQ A;  1MHQ A;  3DBS A;  3Q5M A;  3PEU B;  5BV0 A;  4LUN U;  1W3B A;  2WVI A;  2WXP A;  4HNA D;  4DRX E;  4UWK A;  3D9N A;  3OTN A;  3EHR A;  3FUD A;  2FI7 A;  2UY1 A;  4W9R A;  1KZP A;  3V31 A;  4GZC A;  2HR2 A;  2J08 A;  2UWJ G;  3QWW A;  5FWQ A;  5FJY A;  4G26 A;  3KSQ A;  1X81 A;  3ZYK A;  1NFI E;  2XGO A;  1N4S A;  2IOS A;  3E37 A;  4EBA G;  4RG9 A;  5BT1 A;  3JXJ A;  2MRI A;  4U96 D;  3GZ1 A;  4TXQ A;  3CHS A;  3ONL A;  1N4R A;  3UMV A;  3ULY A;  3PS6 A;  1OCC E;  3GZ2 A;  5FIN A;  4DX1 A;  3Q9U C;  3UUX A;  3ZXP A;  3FFL A;  3ZHE B;  4ZFH A;  4A1S A;  1UN9 A;  4O60 A;  5LFA A;  3UM0 A;  2RFM A;  4FA6 A;  4JW1 A;  4CDM A;  5EYP F;  4GTR A;  5ARF A;  3LDZ A;  4LSZ E;  3ASO E;  4FLH A;  4OVU A;  1OWL A;  4EHM A;  4ABN A;  3AU4 A;  2E0I A;  4AJW A;  3DXM G;  4XEI G;  4PS3 A;  4BET A;  1JPL A;  1UOH A;  1Y8M A;  3QWP A;  1OXJ A;  4UI9 J;  3MKQ A;  1H2T C;  4B89 A;  2EQX A;  2CHW A;  1U3C A;  3I3N A;  4I6E A;  3D9M A;  1IYG A;  2Y1L E;  4K5B A;  3KAE A;  1K3Z D;  3G2U A;  3DRA A;  3UIP C;  3RRM B;  3ZU7 B;  4DUI A;  2P9S G;  3QB2 A;  5G05 J;  2WXI A;  4NQ0 A;  5EIL A;  4FHK A;  3MV3 B;  4Q96 A;  2QY7 A;  2ETC A;  2WXH A;  1DCE A;  2Y69 E;  5JMN D;  4UI9 C;  3D3M A;  1YCS B;  2DWZ A;  4JZY A;  3QWV A;  3KS2 A;  4GA1 A;  3UKU G;  4I6G A;  3LS8 A;  3TWT A;  4F1P A;  3AU5 A;  3Q7F A;  1LD7 A;  2DYR E;  4GZ5 A;  4ANU A;  1N54 A;  3KD7 A;  1ELK A;  4L9P A;  3TXN A;  3Q9N C;  2J09 A;  4GYY A;  3FY4 A;  4N3A A;  1HG2 A;  4B0Z A;  3Q4A B;  5IY5 E;  2XEH A;  4G8K A;  4B93 B;  5G05 C;  1BPO A;  4GTP A;  4GMR A;  4AY6 A;  4FHJ A;  3Q75 A;  2GRN B;  3JYS A;  3D9O A;  4J8S A;  4KBQ A;  3EIQ C;  1BU9 A;  4FC8 A;  5EID A;  2PZI A;  3AG2 E;  2R02 A;  2B6C A;  3Q15 A;  1LTX A;  2V4L A;  4WNE A;  2PQN A;  4I1A A;  5BV1 A;  3FUM A;  5FTP A;  3RAU A;  5JHB A;  5CEC B;  3L54 A;  4YDO A;  5CMW A;  4G8L A;  3DPY A;  2V0P A;  3ESK A;  4M3O A;  4YDY A;  3PZD A;  1EF1 C;  3KEZ A;  3TG4 A;  5A6C A;  5ENO D;  4WUY A;  3VLE A;  4RQI A;  3LXU X;  1HS6 A;  3CHQ A;  4O1O A;  3FEY A;  3DST A;  3L82 A;  4U8Y D;  1HX8 A;  4GA0 A;  4GTM A;  2J07 A;  3MJW A;  1KPS B;  4ATZ D;  4JHJ A;  5M72 A;  4JHR A;  4GPM A;  4DX7 D;  5BXU A;  1JCS A;  3MZL B;  3APC A;  4DLO A;  5JJ6 A;  4CCA A;  4TXP A;  2C0L A;  4HLE A;  5DBK A;  2WMO A;  4GPK A;  3IXE A;  4U7E B;  3FH7 A;  2B0O E;  3Q49 B;  1ZU2 A;  2FF4 A;  2V5F A;  1FVF A;  3D9H A;  2J4B A;  4L7T A;  2XS8 A;  3FTZ A;  4O1P A;  4UWH A;  2CHZ A;  1N0R A;  4BT9 A;  1FPP A;  3DSV A;  1PAQ A;  3CVN A;  4V3I A;  4G24 A;  4RSY A;  1SA4 A;  3CKC A;  4U95 D;  3UM2 A;  4HOU A;  2ETA A;  3MV2 B;  4J7W A;  4URK A;  2BTD A;  4PS8 A;  2R03 A;  2NC9 A;  3DXK G;  4C48 B;  2PL2 A;  4BFR A;  3IHV A;  5J90 A;  2BED A;  2OVF A;  2CG2 A;  3AS5 A;  2WXF A;  1SW6 A;  1HXI A;  4G23 A;  1MZC A;  3CEQ A;  3D9L A;  2E2E A;  2HM8 A;  2X6K A;  1WG0 A;  3OXG A;  2MHK A;  1QYM A;  5ANL A;  2JEK A;  4AXH A;  2Y4T A;  1S0P A;  3EHM A;  2MYO A;  5LX8 A;  1HF8 A;  3CVW A;  4L2Y A;  2HYZ A;  4L2L A;  4FJY A;  2A5U A;  4HB5 A;  4DX2 A;  3HDX A;  1WM5 A;  3JCK C;  1HZ4 A;  3EHQ A;  5CRV A;  3UT8 A;  4CDN A;  2XRY A;  4U0Z A;  3ABM E;  3IKO B;  1IHG A;  3SBT B;  3SFX A;  3CHO A;  2PM6 A;  3CHM A;  2V5Q C;  4KVO A;  3CLJ A;  4HLL A;  5A23 A;  2VGE A;  2GRP B;  5KNH D;  4Z68 A;  1NZN A;  4OVV A;  3PRE A;  3RO3 A;  3P1U A;  2IF4 A;  1YMP A;  1ELW A;  2C0M A;  1UN8 A;  2IJG X;  1TN6 A;  4E6H A;  3S7J A;  2KAT A;  1Z3Y A;  1FT2 A;  2DCP A;  5FZS A;  3FHE A;  3ZPJ A;  3RK6 A;  3B13 A;  3ZN3 A;  3QOU A;  4HFG A;  4Y6W A;  4I43 A;  2DYS E;  1N52 A;  2I2O A;  3KEA A;  1JWF A;  2R59 A;  2R17 C;  2XS1 A;  3ZYL A;  1O1R A;  5C1D A;  4EZK A;  5AQB A;  2VJ8 A;  1K1A A;  4UI9 K;  4BTB A;  4G11 A;  3D9J A;  2WXK A;  3QK0 A;  3L16 A;  2J4D A;  1MQS A;  3LKU A;  3APD A;  1IQU A;  1E8X A;  2EIK E;  5HKP A;  5FZQ A;  4YDW A;  3LY8 A;  2XRZ A;  1NA3 A;  3ZFW A;  2PQR A;  5CMY A;  2ILR A;  3CVL A;  2WXQ A;  4CT4 A;  2IQC A;  3MYV A;  1HFA A;  2FEZ A;  3AS8 A;  1K8K G;  3B7U X;  1UG3 A;  4I9C A;  3ML8 A;  5CED B;  3S2A A;  5KNG A;  2X38 A;  3TWS A;  2KCV A;  5CRU A;  4N5C A;  1HU3 A;  4HOR A;  5T3R A;  4JL0 A;  3AG4 E;  4R7L A;  4B8C B;  4A1G A;  4N39 A;  5AQ7 A;  4UWG A;  4BER A;  3CVU A;  2I9C A;  2KZT A;  2FO1 E;  4DPR A;  4CYM D;  3SF4 A;  3NB2 A; 
#chains in the Genus database with same CATH homology
 4DX6 D;  4UUC A;  3Q9U C;  5ENO D;  5JMN D;  1SW6 A;  3AAA C;  1D9S A;  1K1B A;  1TR4 A;  3J5P A;  1YCS B;  2A5E A;  2BKG A;  2F37 A;  4K5A B;  5ENQ D;  4O1O A;  3TWX A;  3SO8 A;  5CEA A;  2ZGG A;  2DWZ A;  4ZFH A;  4O60 A;  5CER B;  4U8Y D;  2KBX A;  3B7B A;  3KEA A;  2RFM A;  5CBO A;  5FIO A;  2KXP C;  3JUE A;  5CBN A;  2Y0B G;  3V2O A;  3TWT A;  5EYP F;  2DZO A;  4F1P A;  4ZHB A;  4LSZ E;  2AJA A;  1SVX A;  4JB8 P;  3ZNG A;  1MX6 A;  2P2C P;  5EYL A;  5AQA A;  2QC9 A;  4HI9 A;  4ATZ D;  5JA4 D;  1WG0 A;  2QYJ A;  1QYM A;  4OAV B;  3DEO A;  3TWU A;  3TWQ A;  4GPM A;  4HBD A;  4DX7 D;  3NOG D;  4DX5 D;  3Q9N C;  5AQB A;  5BXU A;  1N0Q A;  3W9F A;  4TUM A;  1K1A A;  2MYO A;  1DC2 A;  1OY3 D;  4F6R D;  1WDY A;  4A63 B;  4J8Y A;  4OAU C;  3F6Q A;  2XEH A;  4G8K A;  4B93 B;  1DCQ A;  1IHB A;  1A5E A;  4QQI A;  3TWV A;  5D66 A;  1YYH A;  2ZGD A;  2PNN A;  4BET A;  4K5C A;  1BI8 B;  4HB5 A;  5KBA A;  4HNA D;  4DX2 A;  2NYJ A;  1UOH A;  5ENR D;  4DRX E;  3IXE A;  5HKP A;  4GMR A;  2HE0 A;  2B0O E;  3NBN B;  3UTM A;  3V30 A;  3EHQ A;  4HI8 A;  4YDW A;  1N11 A;  2DVW A;  3EHR A;  3ZKJ A;  3DEP A;  3D9H A;  4NIK A;  3NOC D;  5EN5 D;  4CZ2 D;  3V31 A;  1MX4 A;  5AQ9 A;  5BXO A;  5AAO A;  1BD8 A;  5HS0 A;  2L6B A;  4HRM B;  3HRA A;  5ENS D;  2J8S D;  1MX2 A;  2DZN A;  4LG6 A;  4O1P A;  4BSZ B;  3W9G A;  5HRY A;  1AWC B;  4HRN A;  5AN8 A;  2F8Y A;  1N0R A;  1BLX B;  3JXI A;  3TWR A;  2RFA A;  3T9K A;  4BEP A;  5ITZ F;  5KWD A;  3V2X A;  3UI2 A;  1NFI E;  1BU9 A;  2Y1L E;  5EID A;  5CED B;  2V5Q C;  4K5B A;  4U8V D;  1K3Z D;  2BKK B;  3T8K A;  5KNG A;  5AAR A;  4HQD A;  4HLL A;  3V79 K;  1IKN D;  2V4H C;  4LNU D;  4RLY A;  4N5Q A;  3TWS A;  2XEE A;  2VGE A;  5KNH D;  4U95 D;  3ZU7 B;  1MYO A;  3JXJ A;  4DUI A;  4Z68 A;  1AP7 A;  4U96 D;  1IXV A;  5AQ7 A;  3ZUV B;  2ETA A;  3HG0 D;  2XZT G;  3EU9 A;  3J5Q B;  1YMP A;  5EIL A;  4BER A;  3B95 A;  5CEC B;  4J7W A;  5ENT D;  1S70 B;  4G8L A;  3TWW A;  2FO1 E;  5EIB E;  1OT8 A;  1G3N B;  4CYM D;  4C48 B;  3LJN A;  1MJ0 A;  2ETC A;  2ETB A;  2XZD G;  2F8X K;  4BES A;  5ENP D;  3AJI A;  2JAB A;  4QFV A;  4HRL A;  3C5R A;  4YDY A;  5FIN A;  1BI7 B;  3UXG A;  2XEN A;  4DX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...