2AJAA

X-ray structure of an ankyrin repeat family protein q5zsv0 from legionella pneumophila. northeast structural genomics consortium target lgr21.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
347
structure length
343
Chain Sequence
NLTIHNIENYENDPQLRLIPWILWENLFQHFISANELSLMTLSYKEAIHIFLPGTKNMEQVRQLLCLYYAHYNRNAKQLWSDAHKKGIKSEVICFVAAITGCSSALDTLCLLSDEIVKQAENYQAFRLAAENGHLHVLNRLCELAPTEIMAMIQAENYHAFRLAAENGHLHVLNRLCELAPTEATAMIQAENYYAFRWAAVGRGHHNVINFLLDCPVMLAYAEIHEFEYGEKYVNPFIARHVNRLKEMHDAFKLSNPDGVFDLVTKSECLQGFYMLRNLIRRNDEVLLDDIRFLLSIPGIKALAPTATIPGDANELLRLALRLGNQGACALLLSIPSVLALTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords ankyrin repeat family protein
publication title X-Ray structure of an ankyrin repeat family protein Q5ZSV0 from Legionella pneumophila.
rcsb
source organism Legionella pneumophila
total genus 97
structure length 343
sequence length 347
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2ajaA00
1S70B 1AP7A 3ZUVB 2A5EA 2BKGA 3B95A 3TWVA 3ZU7B 4DUIA 2JABA 2VGEA 1N0RA 2XEHA 4F1PA 2MYOA 1AWCB 4UUCA 4HLLA 3T9KA 1BD8A 5ENSD 2HE0A 3TWWA 3TWQA 4DRXE 5JA4D 2DVWA 2Y0BG 4DX2A 2BKKB 4O60A 5ENOD 4HNAD 3HRAA 3JXJA 5HS0A 2RFAA 4NIKA 5KNHD 1TR4A 3UXGA 4DX7D 4BESA 3EU9A 2DZNA 3V31A 4OAVB 5AQ7A 3TWRA 4K5CA 1NFIE 3DEPA 2ETCA 4Z68A 2AJAA 5FINA 3DEOA 4QQIA 4HRLA 4TUMA 3NOCD 3IXEA 5D66A 3V2XA 4CZ2D 3V30A 5BXOA 5ENQD 3Q9UC 4J7WA 1IKND 4HI8A 2QC9A 2F8XK 4HRNA 1G3NB 4BERA 5CEAA 1YYHA 2FO1E 5CBOA 1MX4A 2NYJA 4O1OA 1MX2A 1MJ0A 3J5QB 1SW6A 4U95D 5EN5D 3EHQA 3TWUA 5CEDB 4DX1A 5AAOA 3J5PA 5HKPA 2KBXA 3C5RA 2PNNA 1IHBA 3V79K 4YDYA 3T8KA 4BSZB 1IXVA 1K1BA 3TWTA 2DZOA 4HI9A 1YMPA 4CYMD 4LNUD 5AN8A 4A63B 4N5QA 4B93B 4DX5D 2Y1LE 1N11A 3SO8A 3B7BA 2V4HC 1D9SA 5ENTD 4U8VD 4LSZE 4YDWA 1YCSB 4C48B 2XZDG 3NBNB 5CBNA 4G8KA 4LG6A 3W9FA 1BLXB 3AJIA 2XENA 5KWDA 3JUEA 4BEPA 1BI8B 3LJNA 1OY3D 1K3ZD 3V2OA 2F37A 5ITZF 5KNGA 2ETAA 3TWXA 5AQ9A 4BETA 5AQBA 4HRMB 5ENPD 5CERB 4GMRA 1K1AA 3HG0D 3JXIA 3Q9NC 3UI2A 4ATZD 4OAUC 1WG0A 4DX6D 1DCQA 2F8YA 3AAAC 4RLYA 4G8LA 2L6BA 5EYPF 5KBAA 2XZTG 2ZGDA 4ZFHA 1WDYA 1MX6A 5AARA 4K5AB 5HRYA 2V5QC 3EHRA 1A5EA 1SVXA 4HQDA 3UTMA 2QYJA 2KXPC 4QFVA 5EIBE 3NOGD 2XEEA 5AQAA 4GPMA 2B0OE 1DC2A 1BI7B 3KEAA 4K5BA 1OT8A 1MYOA 4J8YA 4U8YD 3F6QA 3TWSA 3ZKJA 3ZNGA 3D9HA 5FIOA 5ENRD 4F6RD 4U96D 4O1PA 2J8SD 5EIDA 2P2CP 5JMND 1UOHA 2ETBA 5EYLA 5BXUA 1QYMA 2ZGGA 1N0QA 4HBDA 5EILA 3W9GA 4HB5A 2DWZA 5CECB 4JB8P 2RFMA 4ZHBA 1BU9A
chains in the Genus database with same CATH superfamily
3QB2A 4TXQA 4GTSA 3ZU7B 1N9AA 4BTAA 2JEKA 3CK7A 1BD8A 1UW4B 4V3IA 2JLBA 5CRUA 3SFYA 4JC8A 5KNHD 3U3WA 1FT2A 4Z68A 4TXRA 1JWFA 3ML8A 3Q5MA 4AY5A 1U3CA 1G3NB 3FEXA 3LXUX 3U66A 3BUAA 3ZHEB 1ZU2A 1SW6A 3SFZA 4BWRA 3FUHA 3SFXA 3UPVA 1IHBA 3HXFA 1OWLA 3B7UX 4N5QA 3B7SA 2Y1LE 4WWOA 2V4HC 1IYGA 3MEKA 2ZU6B 5AJDA 3UMVA 2WXQA 3JUEA 3ASDA 4G2VA 4GA0A 2P9KG 3D9OA 3HG0D 3CQCB 3ESKA 3MX3A 3CVXA 4LUNU 1TYQG 4DLOA 3SNXA 1OCCE 1WDYA 2GRMA 3N71A 4XZ4A 3DXKG 2H6FA 3EIJA 1DC2A 2OEWA 2XQ0A 4XKCA 3DPYA 5FIOA 2CHXA 4O1PA 5BXUA 3ENEA 5EYLA 2LXMA 1N0QA 3KD7A 4HVBA 2LUHA 2A5EA 5ANLA 4GB9A 2XEHA 3CK9A 5ARFA 4O60A 1TNUA 1JCSA 4A55A 2DZNA 4OAVB 2DCPA 2WXRA 3D9IA 3DEPA 4U63A 3UX4A 4BX8A 4NACA 4BT8A 3RRMB 3UM1A 3L6AA 1ZB1A 4JVSA 2LAHA 3MKRA 3CHMA 5CBOA 1IQUA 3KEZA 3CVQA 2H6HA 3TWUA 4DJAA 4H7YA 3L82A 3Q49B 3G2WA 1INZA 4C48B 1JWGA 3W9FA 4HS2A 4Q96A 2CFUA 2XGMA 4J8DA 5E76A 3CEQA 1D8EA 5ARGA 2BEDA 5G55A 4L2YA 4GMRA 3HDXA 2WXMA 3JXIA 3FUFA 5AENA 4DX6D 2WXOA 3ZEFA 2V5FA 1DNPA 3CLJA 4H7XA 2QYJA 3UTMA 3D9MA 4LRZA 1XGWA 1OCOE 3E37A 1ELKA 4U96D 4CGWA 1TNOA 3I3NA 4HB5A 3DBSA 4JB8P 1NP7A 4L23A 2BKGA 4G25A 4KVMA 4CRWA 4CCAA 5FZSA 2VQ2A 3AG1E 3O4ZA 3L08A 1SQMA 3AG2E 3Q75A 3FUMA 3LEWA 3URZA 4UWHA 2ILRA 5ENNA 3BEEA 1E7UA 5A7DB 2AXZA 1ELRA 5KJKA 2A5UA 3LY9A 2XENA 4UI9K 2L9BA 2F37A 4BETA 3LDZA 3KSQA 2EILE 2R59A 1X81A 2J07A 1UN8A 3R9MA 4UQZA 3FWVA 2RD0A 1N52A 3FH7A 4AVXA 3DSWA 3ZYMA 4OYSA 3FTSA 4KYOB 3CV0A 2ONDA 3BG1B 3Q7AA 4GTVA 4R7LA 2DYSE 2CG3A 4EZJA 2RFMA 2P9PG 4UQXA 3CIAA 3ULYA 5KCMA 4AM9A 4FJZA 2CFZA 3ZW3A 3SHFA 4UUCA 1UN9A 2IF4A 5ENSD 4AXHA 4LEUA 1SZ9A 2FO7A 5JJ6A 3FU3A 4W9RA 4KMOA 2X38A 4WWPA 1V55E 3FUEA 3PREA 5FZRA 5BXOA 4CEMA 3Q9UC 1ELWA 1TN8A 3SY2A 4N2SA 2WVIA 4FP7A 5EN5D 1LF8A 2GRRB 2WXKA 4L7TA 1S0PA 3C5RA 3JQ1A 4N39A 3RO2A 3HXBA 3DSSA 5C2YA 3I4RB 4DX5D 4LCTA 1E96B 4FC8A 1H0AA 4AOFA 2VTBB 2L6JA 1MQSA 4FADA 3G2VA 2GRQB 4U07A 4DPRA 4KVOA 2J4BA 1NL4A 4WUYA 3PZ2A 4PH4B 2IOLA 1EF1C 1HH8A 5KBAA 2WXPA 4PS8A 1VDYA 5AARA 3ZVVA 3SI5A 3ZGQA 3DWLG 4O6FA 3Q78A 4CDMA 2DIWA 4J8YA 3BG0B 3ZNGA 3S7FA 4URKA 3ZRHA 3D3MA 1HS6A 4GZCA 3W9GA 2GGFA 3PS6A 4APOA 1KZPA 3SGHA 3LS8A 5A6CA 5G2NA 3ZN3A 1LD8A 5FQ4A 3TWVA 2AWIA 3HIZA 3FHEA 3CVUA 3CQGB 3AG4E 5FTPA 1E7VA 1TN7A 4DX7D 5D0OD 2IO3C 4QQIA 3Q7FA 5CCMA 4CZ2D 2P58C 2OVBA 1Z3YA 1UJKA 3ASFA 2GW1A 2M63A 5BPPA 4AJWA 1W3BA 1HG5A 4B8CB 2AVPA 3ABME 4JZYA 4MS6A 2XPIA 3J5PA 4AEZC 2KBXA 3EIQC 3ZIMA 4CYMD 4A63B 4CGVA 4KZCA 5T4YA 2WXIA 3MGBA 4LSZE 2XZDG 3AJIA 5HQ8A 3FTZA 2R2LA 1BI8B 4GTMA 4ABNA 3AS4A 2LSUA 3APCA 4B89A 2F8YA 4G8LA 5JHBA 2EIKE 3MYVA 3ULQA 5KJMA 1EPUA 1MYOA 3F6QA 4DI3A 2E2EA 2P2CP 2EIJE 1FCHA 3KAEA 4YVOA 4EHMA 5T8IA 3HXCA 1BU9A 2UWJG 1OUVA 3TJPA 2IONA 4F1PA 2MYOA 3E34A 4DRXE 3TWQA 5JA4D 3FTVA 3UM3A 2LNIA 1TR4A 4BESA 3LVRE 5LCWJ 4DK5A 1ZBPA 3HVEA 4ACKA 3OXLA 2QC9A 4ME2A 4N3CA 3CHRA 4YDEA 3FTYA 4N3BA 4GYYA 3IHVA 2VSNA 3LVQE 4L1BA 2IU1A 4FLBA 4AV7A 3UKUG 3WXXA 3FULA 3SBSA 2Y3AA 2CG2A 5ENTD 2XCBA 2KM4A 5CBNA 4LG6A 3UT7A 1BLXB 4JEUA 2RG8A 1O1RA 5CMWA 4KT6B 1KT1A 3EU5A 5DIZA 3CVWA 4HOQA 5CERB 4C0EA 3MV2B 3Q9NC 3UINC 2LXLA 2J9QA 2QYUA 3PUKA 5LFAA 2UY1A 2I2OA 1SVXA 3GW4A 4EZKA 3FUIA 2FULA 5EIBE 2PM7A 3R9AB 2WQ6A 1X5BA 2I6HA 3U9WA 2IJGX 2P9UG 4DI4A 5EILA 4EECA 3IHYA 3VTYA 3TAXA 2P9SG 1N4SA 2QZAA 3FEYA 4OVVA 2KZTA 2JABA 3QKYA 2GRLA 2ZIRA 3TWWA 4J8SA 4ILGA 3NQPA 5JJ7A 2V0PA 5D2MC 4FULA 3DEOA 1E8WA 2WQ7A 5T3RA 3ISMC 2MRIA 2HM8A 2WXNA 3FU5A 4LNGA 5EX3A 4D10C 1S64A 1TEZA 4TXPA 5CEDB 4YNDA 5HKPA 2IQCA 3JCKC 1K1BA 2XCCA 3SF4A 1LD7A 4G1TA 5AN8A 5HI7A 4DLQA 3DPDA 5LCWC 3SO8A 2X6JA 4Q69A 2LO6A 4GZ3A 5LOZA 4GCOA 3IKOB 5J90A 1OCZE 2RKKA 4GTQA 3P2BA 3S7JA 5ENPD 3UT8A 4ATZD 3FP3A 4OAUC 3PEUB 2L6BA 3BU8A 4TUUA 1MX6A 5FQ6A 2P9NG 2VGXA 2QFCA 3NOGD 4GPMA 1OT8A 3HYMB 3QWPA 4I9EA 2XRYA 5G05J 2J8SD 5EIDA 2ETBA 4JEHA 1NZNA 4GZ6A 4ACLA 3LCAA 4GA2A 1TN6A 3GZ1A 1MZCA 4J6IA 5BW8C 3UM0A 3OXGA 1DCEA 4PS7A 5HS0A 3ZXSA 4NIKA 1YA0A 3V31A 3FFLA 2MHKA 1H6PA 2WXGA 3MA5A 3RU0A 1YYHA 2J09A 5ANRA 4BFRA 1MJ0A 1TNBA 3CSFA 1UJJA 1Q2ZA 3T8KA 3UT4A 2DZOA 1KPSB 1OWOA 2CHZA 3NF1A 3RRUA 5AJLA 3MV3B 3EUVA 4B94A 2VSXE 4BTBA 4BEPA 3E32A 3V2OA 5AQBA 3NAWA 3CVPA 1Y6IA 3OTNA 3VTXA 2OOEA 2DBAA 3ASGA 3GZSA 1A5EA 3JUIA 3RRNB 4CT0A 4U7EB 3D9LA 3D9PA 1E8XA 3DRAA 3E30A 4GTTA 3PRZA 3MKQA 1QYMA 3RKVA 4M7CA 3L16A 1LTXA 2WM9A 2X6FA 3IEGA 1D8DA 2ZISA 2BUGA 4HOTA 5BV1A 1WM5A 5A23A 3HRAA 2CHWA 3OAWA 3PNLB 1HXIA 4Q94A 5B1AE 1FT1A 4G23A 4YDOA 2FBNA 4IULA 2R05A 5G05C 1FPPA 2VSYA 3V30A 1H2VC 3DSUA 2P9LG 2EINE 3ZYKA 5CEAA 1HZ4A 3ABKE 1MX4A 4J0UA 2H6IA 4O1OA 1WY6A 1Z3XA 4JA7A 1IXVA 1Y8MA 3FUDA 4MKTA 4LNUD 1E90A 3D9JA 3ASNE 1OXJA 5J08A 3MJWA 4GPKA 1EYHA 1N4RA 2GROB 5E75A 1OY3D 4KZ0A 1K1AA 4HOSA 4GAAA 4I9CA 2FF4A 2XS8A 4MLPA 4G26A 1PY1A 4P29A 3CHOA 3RSEG 3UIPC 2ZGGA 3UIOC 3DSVA 5CECB 3ZPJA 3EHNA 1N94A 1H2TC 2PM6A 2XS1A 3ULEG 1JPLA 1N0RA 1E8YA 4GU5A 4UI9C 5DBKA 1H19A 3RIBA 5EX0A 4BSXA 3L22A 5BT1A 3E33A 3APFA 3FUJA 4FU3A 4TUMA 1MHQA 4HI8A 2KCKA 2F8XK 2V8SE 4HXIA 3VLEA 1JCRA 4Y6CA 4L2LA 4GCNA 3QJZA 4ANWA 1Z6TA 2PNNA 4YVQC 4BSZB 2MOWA 2XEVA 1YMPA 3CHPA 3AS5A 1D9SA 2XHEA 4JHRA 5JHAA 4N3AA 1TJFA 5KNGA 3B13A 1WG0A 2Y69E 1HF8A 2AW6A 3CK8A 2X6HA 1UG3A 3CVLA 2YQ8A 3CR3A 1IQRA 4MBGA 2VGYA 2DYRE 1H2UA 4F6RD 2KCVA 2X3MA 1HU3A 3L17A 4JXTA 2GRPB 4ZHBA 3JYSA 3LYAA 4GTOA 3QK0A 3ZUVB 4GMLA 3ZHEA 2VGEA 4C9BB 1RZ4A 3SBTB 4DX2A 3I5PA 4U8HA 4N5CA 4PUCA 3TWRA 1P5QA 5FINA 5IY5E 2EQXA 2WXFA 3G2SA 3GYZA 3L54A 3PZ4A 3QWVA 1PC2A 5D66A 5ENQD 4RSYA 1IKND 4WNEA 4BERA 3SQVA 2AXVA 4PDXA 4IYPA 2NYJA 2YNQA 4RG9A 3J5QB 3PE3A 3E4BA 5FZQA 3MCXA 2IEJA 4APFA 4HI9A 2X6KA 3B7BA 3ZXPA 3FTUA 4U8VD 3NBNB 5FWQA 1QZ2A 3D9NA 3PZDA 3LJNA 1N54A 1HX8A 1S63A 2P9IG 2J08A 3AAAC 5FJYA 3QNKA 4U0SA 4EQFA 2XZTG 2OCCE 4ZFHA 4ILIA 2I1JA 3KSLA 5AQAA 4K5BA 4ANUA 3PNTB 1OWNA 1RW2A 5ENRD 2Y4TA 2L0IA 2FEZA 1XNFA 3KS2A 4HBDA 1DVPA 2DWZA 4A3TA 3FU0A 3PDNA 4FHKA 5B3SE 4EZLA 4HLLA 3T8MA 4I1MA 4U04A 2BKKB 3QC1A 3HHMA 4I2WA 3ZYQA 4UWLA 1SA5A 4I1AA 4I2ZA 4UWFA 4HOUA 4HRLA 4XIFA 5D0QD 1N4PA 3C72A 4JW1A 2PQNA 3LKUA 2R02A 3LPZA 3G2UA 4X8QA 5AIJA 1E8ZA 4I1OB 1SA4A 1HO8A 3PZ3A 4B0ZA 3TL5A 3QDNA 4K03A 1WAO1 1JUQA 4G8KA 3QOUA 3DXMG 3FUKA 2QY7A 1NA3A 2IOSA 3HVEB 3R7RA 4RQIA 5ITZF 5CHEE 2NSZA 4NRHB 4ANVA 3UI2A 4I6JA 1QQEA 4J8FA 4AY6A 3AU4A 3FH8A 4ANXA 1KZOA 4GMJA 1IHGA 4F3VA 2OEVA 2KXPC 2BF0X 3C98A 3Q4AB 3FU6A 4CDNA 2NXPA 2XEEA 3NB2A 1H6KA 4KXKB 3UUXA 4TRQA 2WXLA 2KC7A 5JMND 3FY4A 3PE4A 2NC9A 5KJLA 3ASHA 5C1DA 2WMOA 1S70B 4HLEA 2C0MA 2UY1B 3T9KA 2DVWA 3ONKA 3NZSA 2YINA 5ENOD 4FA6A 2VYIA 4I6GA 2AJAA 3PVLA 3O48A 1U3DA 5G04J 4J7WA 4K0RA 3ASOE 2R03A 3EHMA 4I17A 4CT4A 3FDHA 1MX2A 2KZTB 4U95D 3UM2A 2EIME 3EHQA 4FLHA 3UQ3A 2WXJA 3NZUA 4BY6A 3L13A 4JL0A 4LERA 2F0YA 5FQ7A 2PL2A 2Q7FA 4A3VA 4YDWA 4E85A 3S7DA 3CVYA 3B7RL 5B1BE 5LX8A 3PZ1A 1K3ZD 2ETAA 4EPZA 4WNFA 4JHJA 3IV0A 4UQYA 4G24A 4WAFA 3T5XA 2R5SA 4BX9A 2YHCA 3T5VA 1HG2A 3RAUA 4M3OA 2I1KA 3UKRG 5M72A 1TNZA 4EBAA 3IBEA 2WB2A 5KJNA 3C3QA 3ZKJA 3ZYLA 4J8EA 5CCLA 3DSTA 1OCRE 1QNFA 2IY0C 4GA1A 3S7BA 4C0MA 1N95A 2KCLA 4IRUA 2C2LA 4UI9J 3B7TA 3VLDA 4XEIG 2VGXB 3AU5A 2HE0A 2Y0BG 3AG3E 3CVVA 4HNAD 4I43A 4L9PA 4BT9A 3UXGA 4EBAG 3EU9A 5AQ7A 2ETCA 3PH0C 4JA9A 2VTBA 3GZ2A 2A4ZA 4F7AA 3S2AA 4JHKA 5FT9A 2B6CA 4F53A 2XGOA 2J49A 3HXEA 1KLXA 3CHQA 3Q47B 2LAIA 2E0IA 4OVUA 1A17A 2HR2A 4Y6WA 2OV8A 1YCSB 2XGSA 2KATA 4GTPA 3Q73A 5G04C 3K9IA 1HE8A 1O1TA 5AQ9A 3LY8A 4HRMB 3CKBA 4JPSA 2YHEA 4GZ5A 4I6EA 4FHJA 1DCQA 3TG4A 2LSVA 2ZGDA 3CHSA 5AYWD 4K5AB 2V5QC 3EHRA 2WMNA 2VJ8A 1EDUA 5LP0A 3KEAA 5EKQD 1FVHA 3ONLA 5CMYA 4TV3A 4WWNA 4PS3A 3RO3A 3TG5A 4F1SA 2J4DA 4AIFA 1BPOA 1AP7A 3TXNA 4IN3B 4B8AA 3BQOA 3G2TA 3ML9A 1NI1A 4U0ZA 3QARA 5BUZA 2WPVA 3RK6A 4N2QA 1TJCA 3ABLE 3VLFA 3CSTA 4NURA 3NOCD 3IXEA 3MKQB 2IO2C 4KBQA 3L9TA 3CGHA 4JD2G 1FVFA 2ZXWE 4GTRA 3RJVA 2AXUA 3X2QE 2FO1E 4WNDA 5JJTA 3FUNA 1B89A 5AAOA 3Q79A 2X6IA 3PUJA 2GRNB 3APDA 1N4QA 3HXDA 1N11A 4ATGA 3DSXA 1O5MA 1H6OA 4HORA 2C0LA 3QWWA 5KWDA 4E6HA 3CVNA 4HFGA 3TWXA 1HFAA 4U0UA 4GYOA 2V4LA 1JCQA 4AP2A 4UWKA 2BTDA 4FJYA 1OWMA 5EYPF 2PQRA 2OVFA 2R17C 2I9CA 5HRYA 2XRZA 4HQDA 3TGOA 1L5JA 3SZ7A 3P1UA 2B0OE 1BI7B 4LNBA 3WG7E 4U8YD 1O1SA 3D9HA 3FTXA 3SD5A 4XI9A 3ZFWA 2L0TB 1NA0A 5BV0A 3EJNA 4WNGA 3B95A 4DUIA 1AWCB 2PZIA 4XI0A 2WXHA 3PEVB 2VSOE 2XPYA 3JXJA 3LY7A 1V54E 2RFAA 3QAQA 3U64A 4K5CA 1NFIE 3Q15A 3FH5A 3U4TA 4NQ0A 3V2XA 3JQ0A 5H7PA 4MRUA 4G11A 4HRNA 5CRVA 1GW6A 2H6GA 3C3OA 3MZLB 4DX1A 2XPZA 2FI7A 4RG6A 3V79K 4YDYA 3TWTA 4UWGA 4B93B 1Z5SC 4RVBA 2IFUA 1PAQA 1OWPA 3AS8A 2WQHA 5FQ8A 3D9KA 1QBQA 3FTWA 4RLYA 4CDRA 1KT0A 1SZAA 3R7QA 4A1SA 4XE0A 5BNWA 1TNYA 4ILHB 1K8KG 2HYZA 3ESLA 2Y4UA 3C3RA 4QFVA 4GYWA 4GZDA 3EDTB 2HO1A 3LJ3A 4XKBA 3TWSA 3I4GA 3OXFA 4XX5A 1UOHA 3CKCA 4A1GA 5EDSA 3TXMA 1U2VG
chains in the Genus database with same CATH topology
1S70B 1AP7A 3ZUVB 2A5EA 2BKGA 3B95A 3TWVA 3ZU7B 4DUIA 2JABA 2VGEA 1N0RA 2XEHA 4F1PA 2MYOA 1AWCB 4UUCA 4HLLA 3T9KA 1BD8A 5ENSD 2HE0A 3TWWA 3TWQA 4DRXE 5JA4D 2DVWA 2Y0BG 4DX2A 2BKKB 4O60A 5ENOD 4HNAD 3HRAA 3JXJA 5HS0A 2RFAA 4NIKA 5KNHD 1TR4A 3UXGA 4DX7D 4BESA 3EU9A 2DZNA 3V31A 4OAVB 5AQ7A 3TWRA 4K5CA 1NFIE 3DEPA 2ETCA 4Z68A 2AJAA 5FINA 3DEOA 4QQIA 4HRLA 4TUMA 3NOCD 3IXEA 5D66A 3V2XA 4CZ2D 3V30A 5BXOA 5ENQD 3Q9UC 4J7WA 1IKND 4HI8A 2QC9A 2F8XK 4HRNA 1G3NB 4BERA 5CEAA 1YYHA 2FO1E 5CBOA 1MX4A 2NYJA 4O1OA 1MX2A 1MJ0A 3J5QB 1SW6A 4U95D 5EN5D 3EHQA 3TWUA 5CEDB 4DX1A 5AAOA 3J5PA 5HKPA 2KBXA 3C5RA 2PNNA 1IHBA 3V79K 4YDYA 3T8KA 4BSZB 1IXVA 1K1BA 3TWTA 2DZOA 4HI9A 1YMPA 4CYMD 4LNUD 5AN8A 4A63B 4N5QA 4B93B 4DX5D 2Y1LE 1N11A 3SO8A 3B7BA 2V4HC 1D9SA 5ENTD 4U8VD 4LSZE 4YDWA 1YCSB 4C48B 2XZDG 3NBNB 5CBNA 4G8KA 4LG6A 3W9FA 1BLXB 3AJIA 2XENA 5KWDA 3JUEA 4BEPA 1BI8B 3LJNA 1OY3D 1K3ZD 3V2OA 2F37A 5ITZF 5KNGA 2ETAA 3TWXA 5AQ9A 4BETA 5AQBA 4HRMB 5ENPD 5CERB 4GMRA 1K1AA 3HG0D 3JXIA 3Q9NC 3UI2A 4ATZD 4OAUC 1WG0A 4DX6D 1DCQA 2F8YA 3AAAC 4RLYA 4G8LA 2L6BA 5EYPF 5KBAA 2XZTG 2ZGDA 4ZFHA 1WDYA 1MX6A 5AARA 4K5AB 5HRYA 2V5QC 3EHRA 1A5EA 1SVXA 4HQDA 3UTMA 2QYJA 2KXPC 4QFVA 5EIBE 3NOGD 2XEEA 5AQAA 4GPMA 2B0OE 1DC2A 1BI7B 3KEAA 4K5BA 1OT8A 1MYOA 4J8YA 4U8YD 3F6QA 3TWSA 3ZKJA 3ZNGA 3D9HA 5FIOA 5ENRD 4F6RD 4U96D 4O1PA 2J8SD 5EIDA 2P2CP 5JMND 1UOHA 2ETBA 5EYLA 5BXUA 1QYMA 2ZGGA 1N0QA 4HBDA 5EILA 3W9GA 4HB5A 2DWZA 5CECB 4JB8P 2RFMA 4ZHBA 1BU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S70 B;  1AP7 A;  3ZUV B;  2A5E A;  2BKG A;  3B95 A;  3TWV A;  3ZU7 B;  4DUI A;  2JAB A;  2VGE A;  1N0R A;  2XEH A;  4F1P A;  2MYO A;  1AWC B;  4UUC A;  4HLL A;  3T9K A;  1BD8 A;  5ENS D;  2HE0 A;  3TWW A;  3TWQ A;  4DRX E;  5JA4 D;  2DVW A;  2Y0B G;  4DX2 A;  2BKK B;  4O60 A;  5ENO D;  4HNA D;  3HRA A;  3JXJ A;  5HS0 A;  2RFA A;  4NIK A;  5KNH D;  1TR4 A;  3UXG A;  4DX7 D;  4BES A;  3EU9 A;  2DZN A;  3V31 A;  4OAV B;  5AQ7 A;  3TWR A;  4K5C A;  1NFI E;  3DEP A;  2ETC A;  4Z68 A;  2AJA A;  5FIN A;  3DEO A;  4QQI A;  4HRL A;  4TUM A;  3NOC D;  3IXE A;  5D66 A;  3V2X A;  4CZ2 D;  3V30 A;  5BXO A;  5ENQ D;  3Q9U C;  4J7W A;  1IKN D;  4HI8 A;  2QC9 A;  2F8X K;  4HRN A;  1G3N B;  4BER A;  5CEA A;  1YYH A;  2FO1 E;  5CBO A;  1MX4 A;  2NYJ A;  4O1O A;  1MX2 A;  1MJ0 A;  3J5Q B;  1SW6 A;  4U95 D;  5EN5 D;  3EHQ A;  3TWU A;  5CED B;  4DX1 A;  5AAO A;  3J5P A;  5HKP A;  2KBX A;  3C5R A;  2PNN A;  1IHB A;  3V79 K;  4YDY A;  3T8K A;  4BSZ B;  1IXV A;  1K1B A;  3TWT A;  2DZO A;  4HI9 A;  1YMP A;  4CYM D;  4LNU D;  5AN8 A;  4A63 B;  4N5Q A;  4B93 B;  4DX5 D;  2Y1L E;  1N11 A;  3SO8 A;  3B7B A;  2V4H C;  1D9S A;  5ENT D;  4U8V D;  4LSZ E;  4YDW A;  1YCS B;  4C48 B;  2XZD G;  3NBN B;  5CBN A;  4G8K A;  4LG6 A;  3W9F A;  1BLX B;  3AJI A;  2XEN A;  5KWD A;  3JUE A;  4BEP A;  1BI8 B;  3LJN A;  1OY3 D;  1K3Z D;  3V2O A;  2F37 A;  5ITZ F;  5KNG A;  2ETA A;  3TWX A;  5AQ9 A;  4BET A;  5AQB A;  4HRM B;  5ENP D;  5CER B;  4GMR A;  1K1A A;  3HG0 D;  3JXI A;  3Q9N C;  3UI2 A;  4ATZ D;  4OAU C;  1WG0 A;  4DX6 D;  1DCQ A;  2F8Y A;  3AAA C;  4RLY A;  4G8L A;  2L6B A;  5EYP F;  5KBA A;  2XZT G;  2ZGD A;  4ZFH A;  1WDY A;  1MX6 A;  5AAR A;  4K5A B;  5HRY A;  2V5Q C;  3EHR A;  1A5E A;  1SVX A;  4HQD A;  3UTM A;  2QYJ A;  2KXP C;  4QFV A;  5EIB E;  3NOG D;  2XEE A;  5AQA A;  4GPM A;  2B0O E;  1DC2 A;  1BI7 B;  3KEA A;  4K5B A;  1OT8 A;  1MYO A;  4J8Y A;  4U8Y D;  3F6Q A;  3TWS A;  3ZKJ A;  3ZNG A;  3D9H A;  5FIO A;  5ENR D;  4F6R D;  4U96 D;  4O1P A;  2J8S D;  5EID A;  2P2C P;  5JMN D;  1UOH A;  2ETB A;  5EYL A;  5BXU A;  1QYM A;  2ZGG A;  1N0Q A;  4HBD A;  5EIL A;  3W9G A;  4HB5 A;  2DWZ A;  5CEC B;  4JB8 P;  2RFM A;  4ZHB A;  1BU9 A; 
#chains in the Genus database with same CATH topology
 3QB2 A;  4TXQ A;  4GTS A;  3ZU7 B;  1N9A A;  4BTA A;  2JEK A;  3CK7 A;  1BD8 A;  1UW4 B;  4V3I A;  2JLB A;  5CRU A;  3SFY A;  4JC8 A;  5KNH D;  3U3W A;  1FT2 A;  4Z68 A;  4TXR A;  1JWF A;  3ML8 A;  3Q5M A;  4AY5 A;  1U3C A;  1G3N B;  3FEX A;  3LXU X;  3U66 A;  3BUA A;  3ZHE B;  1ZU2 A;  1SW6 A;  3SFZ A;  4BWR A;  3FUH A;  3SFX A;  3UPV A;  1IHB A;  3HXF A;  1OWL A;  3B7U X;  4N5Q A;  3B7S A;  2Y1L E;  4WWO A;  2V4H C;  1IYG A;  3MEK A;  2ZU6 B;  5AJD A;  3UMV A;  2WXQ A;  3JUE A;  3ASD A;  4G2V A;  4GA0 A;  2P9K G;  3D9O A;  3HG0 D;  3CQC B;  3ESK A;  3MX3 A;  3CVX A;  4LUN U;  1TYQ G;  4DLO A;  3SNX A;  1OCC E;  1WDY A;  2GRM A;  3N71 A;  4XZ4 A;  3DXK G;  2H6F A;  3EIJ A;  1DC2 A;  2OEW A;  2XQ0 A;  4XKC A;  3DPY A;  5FIO A;  2CHX A;  4O1P A;  5BXU A;  3ENE A;  5EYL A;  2LXM A;  1N0Q A;  3KD7 A;  4HVB A;  2LUH A;  2A5E A;  5ANL A;  4GB9 A;  2XEH A;  3CK9 A;  5ARF A;  4O60 A;  1TNU A;  1JCS A;  4A55 A;  2DZN A;  4OAV B;  2DCP A;  2WXR A;  3D9I A;  3DEP A;  4U63 A;  3UX4 A;  4BX8 A;  4NAC A;  4BT8 A;  3RRM B;  3UM1 A;  3L6A A;  1ZB1 A;  4JVS A;  2LAH A;  3MKR A;  3CHM A;  5CBO A;  1IQU A;  3KEZ A;  3CVQ A;  2H6H A;  3TWU A;  4DJA A;  4H7Y A;  3L82 A;  3Q49 B;  3G2W A;  1INZ A;  4C48 B;  1JWG A;  3W9F A;  4HS2 A;  4Q96 A;  2CFU A;  2XGM A;  4J8D A;  5E76 A;  3CEQ A;  1D8E A;  5ARG A;  2BED A;  5G55 A;  4L2Y A;  4GMR A;  3HDX A;  2WXM A;  3JXI A;  3FUF A;  5AEN A;  4DX6 D;  2WXO A;  3ZEF A;  2V5F A;  1DNP A;  3CLJ A;  4H7X A;  2QYJ A;  3UTM A;  3D9M A;  4LRZ A;  1XGW A;  1OCO E;  3E37 A;  1ELK A;  4U96 D;  4CGW A;  1TNO A;  3I3N A;  4HB5 A;  3DBS A;  4JB8 P;  1NP7 A;  4L23 A;  2BKG A;  4G25 A;  4KVM A;  4CRW A;  4CCA A;  5FZS A;  2VQ2 A;  3AG1 E;  3O4Z A;  3L08 A;  1SQM A;  3AG2 E;  3Q75 A;  3FUM A;  3LEW A;  3URZ A;  4UWH A;  2ILR A;  5ENN A;  3BEE A;  1E7U A;  5A7D B;  2AXZ A;  1ELR A;  5KJK A;  2A5U A;  3LY9 A;  2XEN A;  4UI9 K;  2L9B A;  2F37 A;  4BET A;  3LDZ A;  3KSQ A;  2EIL E;  2R59 A;  1X81 A;  2J07 A;  1UN8 A;  3R9M A;  4UQZ A;  3FWV A;  2RD0 A;  1N52 A;  3FH7 A;  4AVX A;  3DSW A;  3ZYM A;  4OYS A;  3FTS A;  4KYO B;  3CV0 A;  2OND A;  3BG1 B;  3Q7A A;  4GTV A;  4R7L A;  2DYS E;  2CG3 A;  4EZJ A;  2RFM A;  2P9P G;  4UQX A;  3CIA A;  3ULY A;  5KCM A;  4AM9 A;  4FJZ A;  2CFZ A;  3ZW3 A;  3SHF A;  4UUC A;  1UN9 A;  2IF4 A;  5ENS D;  4AXH A;  4LEU A;  1SZ9 A;  2FO7 A;  5JJ6 A;  3FU3 A;  4W9R A;  4KMO A;  2X38 A;  4WWP A;  1V55 E;  3FUE A;  3PRE A;  5FZR A;  5BXO A;  4CEM A;  3Q9U C;  1ELW A;  1TN8 A;  3SY2 A;  4N2S A;  2WVI A;  4FP7 A;  5EN5 D;  1LF8 A;  2GRR B;  2WXK A;  4L7T A;  1S0P A;  3C5R A;  3JQ1 A;  4N39 A;  3RO2 A;  3HXB A;  3DSS A;  5C2Y A;  3I4R B;  4DX5 D;  4LCT A;  1E96 B;  4FC8 A;  1H0A A;  4AOF A;  2VTB B;  2L6J A;  1MQS A;  4FAD A;  3G2V A;  2GRQ B;  4U07 A;  4DPR A;  4KVO A;  2J4B A;  1NL4 A;  4WUY A;  3PZ2 A;  4PH4 B;  2IOL A;  1EF1 C;  1HH8 A;  5KBA A;  2WXP A;  4PS8 A;  1VDY A;  5AAR A;  3ZVV A;  3SI5 A;  3ZGQ A;  3DWL G;  4O6F A;  3Q78 A;  4CDM A;  2DIW A;  4J8Y A;  3BG0 B;  3ZNG A;  3S7F A;  4URK A;  3ZRH A;  3D3M A;  1HS6 A;  4GZC A;  3W9G A;  2GGF A;  3PS6 A;  4APO A;  1KZP A;  3SGH A;  3LS8 A;  5A6C A;  5G2N A;  3ZN3 A;  1LD8 A;  5FQ4 A;  3TWV A;  2AWI A;  3HIZ A;  3FHE A;  3CVU A;  3CQG B;  3AG4 E;  5FTP A;  1E7V A;  1TN7 A;  4DX7 D;  5D0O D;  2IO3 C;  4QQI A;  3Q7F A;  5CCM A;  4CZ2 D;  2P58 C;  2OVB A;  1Z3Y A;  1UJK A;  3ASF A;  2GW1 A;  2M63 A;  5BPP A;  4AJW A;  1W3B A;  1HG5 A;  4B8C B;  2AVP A;  3ABM E;  4JZY A;  4MS6 A;  2XPI A;  3J5P A;  4AEZ C;  2KBX A;  3EIQ C;  3ZIM A;  4CYM D;  4A63 B;  4CGV A;  4KZC A;  5T4Y A;  2WXI A;  3MGB A;  4LSZ E;  2XZD G;  3AJI A;  5HQ8 A;  3FTZ A;  2R2L A;  1BI8 B;  4GTM A;  4ABN A;  3AS4 A;  2LSU A;  3APC A;  4B89 A;  2F8Y A;  4G8L A;  5JHB A;  2EIK E;  3MYV A;  3ULQ A;  5KJM A;  1EPU A;  1MYO A;  3F6Q A;  4DI3 A;  2E2E A;  2P2C P;  2EIJ E;  1FCH A;  3KAE A;  4YVO A;  4EHM A;  5T8I A;  3HXC A;  1BU9 A;  2UWJ G;  1OUV A;  3TJP A;  2ION A;  4F1P A;  2MYO A;  3E34 A;  4DRX E;  3TWQ A;  5JA4 D;  3FTV A;  3UM3 A;  2LNI A;  1TR4 A;  4BES A;  3LVR E;  5LCW J;  4DK5 A;  1ZBP A;  3HVE A;  4ACK A;  3OXL A;  2QC9 A;  4ME2 A;  4N3C A;  3CHR A;  4YDE A;  3FTY A;  4N3B A;  4GYY A;  3IHV A;  2VSN A;  3LVQ E;  4L1B A;  2IU1 A;  4FLB A;  4AV7 A;  3UKU G;  3WXX A;  3FUL A;  3SBS A;  2Y3A A;  2CG2 A;  5ENT D;  2XCB A;  2KM4 A;  5CBN A;  4LG6 A;  3UT7 A;  1BLX B;  4JEU A;  2RG8 A;  1O1R A;  5CMW A;  4KT6 B;  1KT1 A;  3EU5 A;  5DIZ A;  3CVW A;  4HOQ A;  5CER B;  4C0E A;  3MV2 B;  3Q9N C;  3UIN C;  2LXL A;  2J9Q A;  2QYU A;  3PUK A;  5LFA A;  2UY1 A;  2I2O A;  1SVX A;  3GW4 A;  4EZK A;  3FUI A;  2FUL A;  5EIB E;  2PM7 A;  3R9A B;  2WQ6 A;  1X5B A;  2I6H A;  3U9W A;  2IJG X;  2P9U G;  4DI4 A;  5EIL A;  4EEC A;  3IHY A;  3VTY A;  3TAX A;  2P9S G;  1N4S A;  2QZA A;  3FEY A;  4OVV A;  2KZT A;  2JAB A;  3QKY A;  2GRL A;  2ZIR A;  3TWW A;  4J8S A;  4ILG A;  3NQP A;  5JJ7 A;  2V0P A;  5D2M C;  4FUL A;  3DEO A;  1E8W A;  2WQ7 A;  5T3R A;  3ISM C;  2MRI A;  2HM8 A;  2WXN A;  3FU5 A;  4LNG A;  5EX3 A;  4D10 C;  1S64 A;  1TEZ A;  4TXP A;  5CED B;  4YND A;  5HKP A;  2IQC A;  3JCK C;  1K1B A;  2XCC A;  3SF4 A;  1LD7 A;  4G1T A;  5AN8 A;  5HI7 A;  4DLQ A;  3DPD A;  5LCW C;  3SO8 A;  2X6J A;  4Q69 A;  2LO6 A;  4GZ3 A;  5LOZ A;  4GCO A;  3IKO B;  5J90 A;  1OCZ E;  2RKK A;  4GTQ A;  3P2B A;  3S7J A;  5ENP D;  3UT8 A;  4ATZ D;  3FP3 A;  4OAU C;  3PEU B;  2L6B A;  3BU8 A;  4TUU A;  1MX6 A;  5FQ6 A;  2P9N G;  2VGX A;  2QFC A;  3NOG D;  4GPM A;  1OT8 A;  3HYM B;  3QWP A;  4I9E A;  2XRY A;  5G05 J;  2J8S D;  5EID A;  2ETB A;  4JEH A;  1NZN A;  4GZ6 A;  4ACL A;  3LCA A;  4GA2 A;  1TN6 A;  3GZ1 A;  1MZC A;  4J6I A;  5BW8 C;  3UM0 A;  3OXG A;  1DCE A;  4PS7 A;  5HS0 A;  3ZXS A;  4NIK A;  1YA0 A;  3V31 A;  3FFL A;  2MHK A;  1H6P A;  2WXG A;  3MA5 A;  3RU0 A;  1YYH A;  2J09 A;  5ANR A;  4BFR A;  1MJ0 A;  1TNB A;  3CSF A;  1UJJ A;  1Q2Z A;  3T8K A;  3UT4 A;  2DZO A;  1KPS B;  1OWO A;  2CHZ A;  3NF1 A;  3RRU A;  5AJL A;  3MV3 B;  3EUV A;  4B94 A;  2VSX E;  4BTB A;  4BEP A;  3E32 A;  3V2O A;  5AQB A;  3NAW A;  3CVP A;  1Y6I A;  3OTN A;  3VTX A;  2OOE A;  2DBA A;  3ASG A;  3GZS A;  1A5E A;  3JUI A;  3RRN B;  4CT0 A;  4U7E B;  3D9L A;  3D9P A;  1E8X A;  3DRA A;  3E30 A;  4GTT A;  3PRZ A;  3MKQ A;  1QYM A;  3RKV A;  4M7C A;  3L16 A;  1LTX A;  2WM9 A;  2X6F A;  3IEG A;  1D8D A;  2ZIS A;  2BUG A;  4HOT A;  5BV1 A;  1WM5 A;  5A23 A;  3HRA A;  2CHW A;  3OAW A;  3PNL B;  1HXI A;  4Q94 A;  5B1A E;  1FT1 A;  4G23 A;  4YDO A;  2FBN A;  4IUL A;  2R05 A;  5G05 C;  1FPP A;  2VSY A;  3V30 A;  1H2V C;  3DSU A;  2P9L G;  2EIN E;  3ZYK A;  5CEA A;  1HZ4 A;  3ABK E;  1MX4 A;  4J0U A;  2H6I A;  4O1O A;  1WY6 A;  1Z3X A;  4JA7 A;  1IXV A;  1Y8M A;  3FUD A;  4MKT A;  4LNU D;  1E90 A;  3D9J A;  3ASN E;  1OXJ A;  5J08 A;  3MJW A;  4GPK A;  1EYH A;  1N4R A;  2GRO B;  5E75 A;  1OY3 D;  4KZ0 A;  1K1A A;  4HOS A;  4GAA A;  4I9C A;  2FF4 A;  2XS8 A;  4MLP A;  4G26 A;  1PY1 A;  4P29 A;  3CHO A;  3RSE G;  3UIP C;  2ZGG A;  3UIO C;  3DSV A;  5CEC B;  3ZPJ A;  3EHN A;  1N94 A;  1H2T C;  2PM6 A;  2XS1 A;  3ULE G;  1JPL A;  1N0R A;  1E8Y A;  4GU5 A;  4UI9 C;  5DBK A;  1H19 A;  3RIB A;  5EX0 A;  4BSX A;  3L22 A;  5BT1 A;  3E33 A;  3APF A;  3FUJ A;  4FU3 A;  4TUM A;  1MHQ A;  4HI8 A;  2KCK A;  2F8X K;  2V8S E;  4HXI A;  3VLE A;  1JCR A;  4Y6C A;  4L2L A;  4GCN A;  3QJZ A;  4ANW A;  1Z6T A;  2PNN A;  4YVQ C;  4BSZ B;  2MOW A;  2XEV A;  1YMP A;  3CHP A;  3AS5 A;  1D9S A;  2XHE A;  4JHR A;  5JHA A;  4N3A A;  1TJF A;  5KNG A;  3B13 A;  1WG0 A;  2Y69 E;  1HF8 A;  2AW6 A;  3CK8 A;  2X6H A;  1UG3 A;  3CVL A;  2YQ8 A;  3CR3 A;  1IQR A;  4MBG A;  2VGY A;  2DYR E;  1H2U A;  4F6R D;  2KCV A;  2X3M A;  1HU3 A;  3L17 A;  4JXT A;  2GRP B;  4ZHB A;  3JYS A;  3LYA A;  4GTO A;  3QK0 A;  3ZUV B;  4GML A;  3ZHE A;  2VGE A;  4C9B B;  1RZ4 A;  3SBT B;  4DX2 A;  3I5P A;  4U8H A;  4N5C A;  4PUC A;  3TWR A;  1P5Q A;  5FIN A;  5IY5 E;  2EQX A;  2WXF A;  3G2S A;  3GYZ A;  3L54 A;  3PZ4 A;  3QWV A;  1PC2 A;  5D66 A;  5ENQ D;  4RSY A;  1IKN D;  4WNE A;  4BER A;  3SQV A;  2AXV A;  4PDX A;  4IYP A;  2NYJ A;  2YNQ A;  4RG9 A;  3J5Q B;  3PE3 A;  3E4B A;  5FZQ A;  3MCX A;  2IEJ A;  4APF A;  4HI9 A;  2X6K A;  3B7B A;  3ZXP A;  3FTU A;  4U8V D;  3NBN B;  5FWQ A;  1QZ2 A;  3D9N A;  3PZD A;  3LJN A;  1N54 A;  1HX8 A;  1S63 A;  2P9I G;  2J08 A;  3AAA C;  5FJY A;  3QNK A;  4U0S A;  4EQF A;  2XZT G;  2OCC E;  4ZFH A;  4ILI A;  2I1J A;  3KSL A;  5AQA A;  4K5B A;  4ANU A;  3PNT B;  1OWN A;  1RW2 A;  5ENR D;  2Y4T A;  2L0I A;  2FEZ A;  1XNF A;  3KS2 A;  4HBD A;  1DVP A;  2DWZ A;  4A3T A;  3FU0 A;  3PDN A;  4FHK A;  5B3S E;  4EZL A;  4HLL A;  3T8M A;  4I1M A;  4U04 A;  2BKK B;  3QC1 A;  3HHM A;  4I2W A;  3ZYQ A;  4UWL A;  1SA5 A;  4I1A A;  4I2Z A;  4UWF A;  4HOU A;  4HRL A;  4XIF A;  5D0Q D;  1N4P A;  3C72 A;  4JW1 A;  2PQN A;  3LKU A;  2R02 A;  3LPZ A;  3G2U A;  4X8Q A;  5AIJ A;  1E8Z A;  4I1O B;  1SA4 A;  1HO8 A;  3PZ3 A;  4B0Z A;  3TL5 A;  3QDN A;  4K03 A;  1WAO 1;  1JUQ A;  4G8K A;  3QOU A;  3DXM G;  3FUK A;  2QY7 A;  1NA3 A;  2IOS A;  3HVE B;  3R7R A;  4RQI A;  5ITZ F;  5CHE E;  2NSZ A;  4NRH B;  4ANV A;  3UI2 A;  4I6J A;  1QQE A;  4J8F A;  4AY6 A;  3AU4 A;  3FH8 A;  4ANX A;  1KZO A;  4GMJ A;  1IHG A;  4F3V A;  2OEV A;  2KXP C;  2BF0 X;  3C98 A;  3Q4A B;  3FU6 A;  4CDN A;  2NXP A;  2XEE A;  3NB2 A;  1H6K A;  4KXK B;  3UUX A;  4TRQ A;  2WXL A;  2KC7 A;  5JMN D;  3FY4 A;  3PE4 A;  2NC9 A;  5KJL A;  3ASH A;  5C1D A;  2WMO A;  1S70 B;  4HLE A;  2C0M A;  2UY1 B;  3T9K A;  2DVW A;  3ONK A;  3NZS A;  2YIN A;  5ENO D;  4FA6 A;  2VYI A;  4I6G A;  2AJA A;  3PVL A;  3O48 A;  1U3D A;  5G04 J;  4J7W A;  4K0R A;  3ASO E;  2R03 A;  3EHM A;  4I17 A;  4CT4 A;  3FDH A;  1MX2 A;  2KZT B;  4U95 D;  3UM2 A;  2EIM E;  3EHQ A;  4FLH A;  3UQ3 A;  2WXJ A;  3NZU A;  4BY6 A;  3L13 A;  4JL0 A;  4LER A;  2F0Y A;  5FQ7 A;  2PL2 A;  2Q7F A;  4A3V A;  4YDW A;  4E85 A;  3S7D A;  3CVY A;  3B7R L;  5B1B E;  5LX8 A;  3PZ1 A;  1K3Z D;  2ETA A;  4EPZ A;  4WNF A;  4JHJ A;  3IV0 A;  4UQY A;  4G24 A;  4WAF A;  3T5X A;  2R5S A;  4BX9 A;  2YHC A;  3T5V A;  1HG2 A;  3RAU A;  4M3O A;  2I1K A;  3UKR G;  5M72 A;  1TNZ A;  4EBA A;  3IBE A;  2WB2 A;  5KJN A;  3C3Q A;  3ZKJ A;  3ZYL A;  4J8E A;  5CCL A;  3DST A;  1OCR E;  1QNF A;  2IY0 C;  4GA1 A;  3S7B A;  4C0M A;  1N95 A;  2KCL A;  4IRU A;  2C2L A;  4UI9 J;  3B7T A;  3VLD A;  4XEI G;  2VGX B;  3AU5 A;  2HE0 A;  2Y0B G;  3AG3 E;  3CVV A;  4HNA D;  4I43 A;  4L9P A;  4BT9 A;  3UXG A;  4EBA G;  3EU9 A;  5AQ7 A;  2ETC A;  3PH0 C;  4JA9 A;  2VTB A;  3GZ2 A;  2A4Z A;  4F7A A;  3S2A A;  4JHK A;  5FT9 A;  2B6C A;  4F53 A;  2XGO A;  2J49 A;  3HXE A;  1KLX A;  3CHQ A;  3Q47 B;  2LAI A;  2E0I A;  4OVU A;  1A17 A;  2HR2 A;  4Y6W A;  2OV8 A;  1YCS B;  2XGS A;  2KAT A;  4GTP A;  3Q73 A;  5G04 C;  3K9I A;  1HE8 A;  1O1T A;  5AQ9 A;  3LY8 A;  4HRM B;  3CKB A;  4JPS A;  2YHE A;  4GZ5 A;  4I6E A;  4FHJ A;  1DCQ A;  3TG4 A;  2LSV A;  2ZGD A;  3CHS A;  5AYW D;  4K5A B;  2V5Q C;  3EHR A;  2WMN A;  2VJ8 A;  1EDU A;  5LP0 A;  3KEA A;  5EKQ D;  1FVH A;  3ONL A;  5CMY A;  4TV3 A;  4WWN A;  4PS3 A;  3RO3 A;  3TG5 A;  4F1S A;  2J4D A;  4AIF A;  1BPO A;  1AP7 A;  3TXN A;  4IN3 B;  4B8A A;  3BQO A;  3G2T A;  3ML9 A;  1NI1 A;  4U0Z A;  3QAR A;  5BUZ A;  2WPV A;  3RK6 A;  4N2Q A;  1TJC A;  3ABL E;  3VLF A;  3CST A;  4NUR A;  3NOC D;  3IXE A;  3MKQ B;  2IO2 C;  4KBQ A;  3L9T A;  3CGH A;  4JD2 G;  1FVF A;  2ZXW E;  4GTR A;  3RJV A;  2AXU A;  3X2Q E;  2FO1 E;  4WND A;  5JJT A;  3FUN A;  1B89 A;  5AAO A;  3Q79 A;  2X6I A;  3PUJ A;  2GRN B;  3APD A;  1N4Q A;  3HXD A;  1N11 A;  4ATG A;  3DSX A;  1O5M A;  1H6O A;  4HOR A;  2C0L A;  3QWW A;  5KWD A;  4E6H A;  3CVN A;  4HFG A;  3TWX A;  1HFA A;  4U0U A;  4GYO A;  2V4L A;  1JCQ A;  4AP2 A;  4UWK A;  2BTD A;  4FJY A;  1OWM A;  5EYP F;  2PQR A;  2OVF A;  2R17 C;  2I9C A;  5HRY A;  2XRZ A;  4HQD A;  3TGO A;  1L5J A;  3SZ7 A;  3P1U A;  2B0O E;  1BI7 B;  4LNB A;  3WG7 E;  4U8Y D;  1O1S A;  3D9H A;  3FTX A;  3SD5 A;  4XI9 A;  3ZFW A;  2L0T B;  1NA0 A;  5BV0 A;  3EJN A;  4WNG A;  3B95 A;  4DUI A;  1AWC B;  2PZI A;  4XI0 A;  2WXH A;  3PEV B;  2VSO E;  2XPY A;  3JXJ A;  3LY7 A;  1V54 E;  2RFA A;  3QAQ A;  3U64 A;  4K5C A;  1NFI E;  3Q15 A;  3FH5 A;  3U4T A;  4NQ0 A;  3V2X A;  3JQ0 A;  5H7P A;  4MRU A;  4G11 A;  4HRN A;  5CRV A;  1GW6 A;  2H6G A;  3C3O A;  3MZL B;  4DX1 A;  2XPZ A;  2FI7 A;  4RG6 A;  3V79 K;  4YDY A;  3TWT A;  4UWG A;  4B93 B;  1Z5S C;  4RVB A;  2IFU A;  1PAQ A;  1OWP A;  3AS8 A;  2WQH A;  5FQ8 A;  3D9K A;  1QBQ A;  3FTW A;  4RLY A;  4CDR A;  1KT0 A;  1SZA A;  3R7Q A;  4A1S A;  4XE0 A;  5BNW A;  1TNY A;  4ILH B;  1K8K G;  2HYZ A;  3ESL A;  2Y4U A;  3C3R A;  4QFV A;  4GYW A;  4GZD A;  3EDT B;  2HO1 A;  3LJ3 A;  4XKB A;  3TWS A;  3I4G A;  3OXF A;  4XX5 A;  1UOH A;  3CKC A;  4A1G A;  5EDS A;  3TXM A;  1U2V G; 
#chains in the Genus database with same CATH homology
 1S70 B;  1AP7 A;  3ZUV B;  2A5E A;  2BKG A;  3B95 A;  3TWV A;  3ZU7 B;  4DUI A;  2JAB A;  2VGE A;  1N0R A;  2XEH A;  4F1P A;  2MYO A;  1AWC B;  4UUC A;  4HLL A;  3T9K A;  1BD8 A;  5ENS D;  2HE0 A;  3TWW A;  3TWQ A;  4DRX E;  5JA4 D;  2DVW A;  2Y0B G;  4DX2 A;  2BKK B;  4O60 A;  5ENO D;  4HNA D;  3HRA A;  3JXJ A;  5HS0 A;  2RFA A;  4NIK A;  5KNH D;  1TR4 A;  3UXG A;  4DX7 D;  4BES A;  3EU9 A;  2DZN A;  3V31 A;  4OAV B;  5AQ7 A;  3TWR A;  4K5C A;  1NFI E;  3DEP A;  2ETC A;  4Z68 A;  2AJA A;  5FIN A;  3DEO A;  4QQI A;  4HRL A;  4TUM A;  3NOC D;  3IXE A;  5D66 A;  3V2X A;  4CZ2 D;  3V30 A;  5BXO A;  5ENQ D;  3Q9U C;  4J7W A;  1IKN D;  4HI8 A;  2QC9 A;  2F8X K;  4HRN A;  1G3N B;  4BER A;  5CEA A;  1YYH A;  2FO1 E;  5CBO A;  1MX4 A;  2NYJ A;  4O1O A;  1MX2 A;  1MJ0 A;  3J5Q B;  1SW6 A;  4U95 D;  5EN5 D;  3EHQ A;  3TWU A;  5CED B;  4DX1 A;  5AAO A;  3J5P A;  5HKP A;  2KBX A;  3C5R A;  2PNN A;  1IHB A;  3V79 K;  4YDY A;  3T8K A;  4BSZ B;  1IXV A;  1K1B A;  3TWT A;  2DZO A;  4HI9 A;  1YMP A;  4CYM D;  4LNU D;  5AN8 A;  4A63 B;  4N5Q A;  4B93 B;  4DX5 D;  2Y1L E;  1N11 A;  3SO8 A;  3B7B A;  2V4H C;  1D9S A;  5ENT D;  4U8V D;  4LSZ E;  4YDW A;  1YCS B;  4C48 B;  2XZD G;  3NBN B;  5CBN A;  4G8K A;  4LG6 A;  3W9F A;  1BLX B;  3AJI A;  2XEN A;  5KWD A;  3JUE A;  4BEP A;  1BI8 B;  3LJN A;  1OY3 D;  1K3Z D;  3V2O A;  2F37 A;  5ITZ F;  5KNG A;  2ETA A;  3TWX A;  5AQ9 A;  4BET A;  5AQB A;  4HRM B;  5ENP D;  5CER B;  4GMR A;  1K1A A;  3HG0 D;  3JXI A;  3Q9N C;  3UI2 A;  4ATZ D;  4OAU C;  1WG0 A;  4DX6 D;  1DCQ A;  2F8Y A;  3AAA C;  4RLY A;  4G8L A;  2L6B A;  5EYP F;  5KBA A;  2XZT G;  2ZGD A;  4ZFH A;  1WDY A;  1MX6 A;  5AAR A;  4K5A B;  5HRY A;  2V5Q C;  3EHR A;  1A5E A;  1SVX A;  4HQD A;  3UTM A;  2QYJ A;  2KXP C;  4QFV A;  5EIB E;  3NOG D;  2XEE A;  5AQA A;  4GPM A;  2B0O E;  1DC2 A;  1BI7 B;  3KEA A;  4K5B A;  1OT8 A;  1MYO A;  4J8Y A;  4U8Y D;  3F6Q A;  3TWS A;  3ZKJ A;  3ZNG A;  3D9H A;  5FIO A;  5ENR D;  4F6R D;  4U96 D;  4O1P A;  2J8S D;  5EID A;  2P2C P;  5JMN D;  1UOH A;  2ETB A;  5EYL A;  5BXU A;  1QYM A;  2ZGG A;  1N0Q A;  4HBD A;  5EIL A;  3W9G A;  4HB5 A;  2DWZ A;  5CEC B;  4JB8 P;  2RFM A;  4ZHB A;  1BU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...