4HS2A

Crystal structure of the human spop c-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
64
structure length
64
Chain Sequence
NLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Speckle-type POZ protein
publication title Structural basis of high-order oligomerization of the cullin-3 adaptor SPOP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 23
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2012-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4hs2A00
4APFA 4HXIA 3HVEA 4HS2A 3I3NA 3HVEB 2EQXA 4AP2A
chains in the Genus database with same CATH superfamily
3HRAA 1HFAA 3TWRA 2M63A 4ATZD 4RQIA 4UWLA 1TEZA 1Y6IA 1RZ4A 3MX3A 5G05C 4EBAA 3LPZA 3B7BA 4NIKA 2MHKA 3NB2A 1SZ9A 1KZOA 4J6IA 2OCCE 3O4ZA 4LEUA 3DEOA 5G05J 3L08A 1OWOA 3L13A 5ENNA 5AAOA 4KZCA 3IEGA 2Y4UA 4BT8A 4U95D 2WXMA 4ANXA 1HXIA 2WB2A 1UN9A 4GA2A 4ACLA 3P2BA 2WQ6A 2KATA 2P9UG 4P29A 3S7JA 4ZHBA 5HS0A 4XEIG 4AEZC 4ANUA 3VLFA 1N94A 3UTMA 4HB5A 2YHCA 3T8KA 5JMND 4U8HA 3ZYQA 3E37A 4UUCA 3MZLB 4HVBA 1E8ZA 4JL0A 3ASHA 3T5XA 3KSQA 2P9SG 1PAQA 5KWDA 3D9PA 3GZ2A 1HE8A 3VTXA 3RO2A 5E75A 5EKQD 3ZW3A 4XI0A 3PEUB 3R9MA 4KVMA 4BETA 3APDA 4A1SA 3TG4A 3AJIA 3RJVA 3JQ0A 2C0LA 3D9LA 1L5JA 1MYOA 4L2LA 4N3BA 3NZUA 2WXFA 1HG2A 5BXUA 3W9GA 1LD8A 5FJYA 5D0QD 3QWPA 4MRUA 4UI9C 1TN8A 3ZHEA 3DWLG 2L6BA 3TWUA 1S0PA 2ZU6B 5KJMA 3C98A 2J07A 3S7BA 3QDNA 4UI9J 2FO1E 3ISMC 3FTUA 2J8SD 4HOQA 2I6HA 5LX8A 1P5QA 4TXRA 2GW1A 3EDTB 4GPKA 4ILIA 3MEKA 4GU5A 1SA5A 3E30A 5A6CA 3ZKJA 4B8CB 3PNLB 3IKOB 1TN6A 2VTBB 5AQAA 5EX3A 4U8YD 4BSXA 5CRVA 4ABNA 3RKVA 3FTXA 1G3NB 2F37A 2BKGA 5KBAA 3SGHA 3AG1E 1KPSB 1SA4A 5FZSA 2DCPA 4E6HA 2DWZA 3FUNA 1N4SA 4MKTA 4TRQA 2DIWA 2LXMA 1JCSA 4MLPA 4GMRA 4RVBA 3NOGD 4O6FA 3JXIA 2AWIA 1E8XA 1W3BA 1LF8A 1V55E 2EIME 2LUHA 1OWPA 2UY1A 5ANRA 1JWGA 3BQOA 5JHAA 5JJ6A 3CVXA 2ETBA 1E96B 2XENA 2VSOE 3EUVA 3PEVB 5LCWJ 5KJKA 1S64A 2GROB 3CKBA 5JJTA 3D9OA 4A1GA 3FFLA 1X81A 2KCVA 1FT1A 3FULA 1D8DA 3UKUG 3E33A 1DC2A 3ESLA 4F53A 4EHMA 2DVWA 1N0RA 4O60A 3S7FA 4XKCA 1SW6A 2VSYA 2IONA 3CHRA 2KCLA 2R02A 4EECA 3GZ1A 4LSZE 4WNFA 4GTVA 1WDYA 3DSTA 3CK7A 4CDMA 3TWVA 3CQCB 3FDHA 4V3IA 1H6OA 3QK0A 1NZNA 1X5BA 3FUEA 3PZ2A 3V2OA 1TR4A 3D9IA 4KVOA 4DLQA 2C2LA 4FP7A 3TXMA 4G2VA 3MCXA 3FUIA 1FVFA 2A4ZA 2AVPA 4YDWA 5EYPF 1IHGA 1PC2A 3ZXPA 5FQ6A 3SQVA 2NXPA 3KEAA 3RRMB 1E7UA 2WPVA 3V30A 3FTYA 2NYJA 4X8QA 5D66A 4JPSA 4JHKA 3ZYMA 2VGEA 5BXOA 2I1JA 4WNEA 4UQXA 4CT4A 1FT2A 3SY2A 2ZISA 4BEPA 4ATGA 4OVUA 2XGSA 2DZNA 4K5BA 5ENPD 2QYUA 3BEEA 5DBKA 4G23A 5AJDA 3RU0A 1IQUA 2IU1A 3UIOC 4BERA 3ZRHA 5IY5E 5CHEE 3GYZA 4G8LA 4C0MA 3PZ3A 5AENA 4CYMD 1K1AA 1NA0A 2KCKA 2Q7FA 3TWTA 3CVWA 4WNDA 5BNWA 2NSZA 2X6HA 4DX6D 4YDEA 2QC9A 3CK9A 4HI8A 1E7VA 3IHYA 4FC8A 4NURA 3QJZA 4F7AA 2YHEA 3ZN3A 1H6KA 4UQZA 4J8EA 2IFUA 4GZ5A 1HU3A 4UQYA 3QB2A 2HM8A 3ESKA 4GMLA 1DCQA 3L6AA 4K0RA 4WNGA 3TWQA 2IO2C 3AU5A 1N4QA 4OAVB 3ASOE 3QARA 4HLEA 3HXCA 2XEHA 1TYQG 4OAUC 4I9CA 4WWOA 4K03A 2OVBA 4PH4B 4B94A 3I4GA 1KZPA 1OWLA 5KJNA 2E0IA 2P9KG 1HH8A 3L16A 3MKRA 1JPLA 1Q2ZA 5ENOD 2XPIA 3FWVA 5BUZA 3LVRE 4ILHB 1ELWA 4HOUA 3ZU7B 1ZU2A 3MA5A 5B1BE 3LKUA 3AS8A 4XKBA 4U0SA 1N4RA 2HE0A 5FINA 1OWMA 1TNYA 4HQDA 2P9LG 2YQ8A 3TWWA 1TJCA 2V5FA 4EZKA 4F1PA 1H2VC 1K8KG 1HX8A 3Q47B 2HO1A 1N52A 5ITZF 2PNNA 2R59A 3G2UA 3DSWA 3VLDA 4N2SA 3EU9A 3ONLA 4B8AA 1EPUA 2AW6A 3Q7AA 5CCMA 4H7YA 1TN7A 2PZIA 3NOCD 3ZEFA 3D9MA 2UY1B 4IN3B 4LRZA 2C0MA 5AIJA 3CVLA 2XRYA 4Q96A 1BLXB 3C3RA 2J4DA 5FZRA 3NBNB 3AS5A 3SFXA 5LOZA 2R2LA 4LCTA 4LERA 4AXHA 1PY1A 3LY8A 3DSUA 4GMJA 2KM4A 3C72A 2BEDA 5CCLA 4GZ3A 2VSNA 3TG5A 5FT9A 2CFUA 3UUXA 3LY7A 2J08A 2L0TB 4EQFA 1HO8A 1IHBA 3J5QB 4FHJA 4JC8A 2KXPC 4BWRA 3UM3A 2XS8A 4HORA 3Q5MA 3UKRG 3X2QE 3PDNA 3FUMA 5EILA 2LXLA 3FY4A 1MZCA 1Z3XA 3IHVA 2BUGA 4YDYA 1DCEA 3NZSA 1QZ2A 2WXLA 3EIQC 1UOHA 2BTDA 4MBGA 4J8FA 4I6GA 1V54E 3JQ1A 3BG0B 3UM1A 1UW4B 4BFRA 2WQHA 5T4YA 1HG5A 2LNIA 5CRUA 3ZNGA 3ASDA 3G2VA 5G2NA 4A3VA 3CLJA 2VJ8A 2XGMA 2X38A 5EIBE 3LJNA 1OUVA 2WXKA 3ENEA 2JLBA 1A17A 1JCQA 3LS8A 2VGXB 2F0YA 1WM5A 3E34A 4KT6B 4U8VD 2XGOA 2LSUA 1EF1C 1XGWA 2P9IG 4LG6A 1IKND 3HDXA 2CG2A 3BU8A 4GA0A 3AG2E 2F8YA 3FUDA 5D2MC 2EILE 4Z68A 2LSVA 3PNTB 2KC7A 2WMOA 2P58C 3L82A 3ASGA 3LJ3A 4U0ZA 4YDOA 2I1KA 3T5VA 2RFAA 4U04A 5FQ4A 3UMVA 5E76A 3B7RL 5G55A 4KYOB 2FI7A 5BW8C 4HI9A 3RAUA 3CVVA 1MX2A 1Z3YA 3CV0A 5ENTD 1TNBA 4DJAA 3DEPA 1RW2A 2WXHA 3MKQA 4I1OB 4XE0A 3RRUA 4MS6A 3B7TA 4ILGA 3T9KA 3TL5A 4DLOA 3V79K 5JHBA 2F8XK 2QZAA 4FLHA 5FTPA 3U3WA 2DYSE 1OXJA 2B6CA 2AXVA 3PE3A 5B1AE 2JEKA 3TWXA 1WAO1 2R17C 3HHMA 4F3VA 3CEQA 3AU4A 3EU5A 3QAQA 5LCWC 3KS2A 4HRNA 3ZYKA 2AJAA 1O1TA 4U7EB 5A7DB 2XCBA 4GTMA 4HRMB 2HR2A 3ZPJA 2VGYA 3U9WA 4J8DA 2Y4TA 4IYPA 3BG1B 5CECB 1EDUA 3KAEA 4M3OA 4BTBA 1UN8A 1BI7B 4JEUA 2ETCA 4DI4A 4J8SA 4LNUD 4BY6A 3JUEA 4E85A 2MOWA 4JA9A 3FUJA 5CBOA 4FLBA 3HXFA 3CVUA 4XZ4A 2VSXE 1XNFA 2WM9A 3DPDA 1Z6TA 1MQSA 4J0UA 1OCZE 4G11A 4DI3A 4DUIA 4ZFHA 4L23A 3ZGQA 1AWCB 2X6FA 4GA1A 1QNFA 1BI8B 2H6HA 3FUKA 3QNKA 3JCKC 1QBQA 4Y6CA 3CHQA 5DIZA 5KJLA 1ELKA 1ZB1A 1OT8A 5CEDB 4TUUA 1N4PA 3HIZA 4EZJA 5CEAA 4PUCA 4I43A 3OTNA 1HZ4A 3MV3B 4I1AA 1U2VG 3F6QA 5KNHD 4AY6A 2WMNA 4HLLA 4JD2G 1UJJA 3SNXA 1BPOA 1ELRA 3C3QA 2PQNA 3FTWA 4QQIA 3FTVA 2RKKA 4WAFA 1OCRE 3HYMB 3QKYA 5EDSA 2V5QC 1QQEA 5BV0A 4DRXE 2Y1LE 4ANVA 1E8WA 4D10C 1DVPA 5ENQD 3RO3A 3KD7A 1LD7A 2CHXA 2YNQA 4GAAA 2KBXA 4JZYA 4CGWA 3Q7FA 5C2YA 2CG3A 4HNAD 4O1OA 4PS8A 3CKCA 5HKPA 2FULA 1Y8MA 3Q9UC 2IQCA 4RSYA 4G25A 4RLYA 2CHZA 3ONKA 4DX7D 5AQBA 1N95A 4YNDA 2GRQB 4ACKA 2XPZA 3PE4A 4O1PA 4FA6A 1O5MA 3ZHEB 4N3AA 3Q75A 3G2TA 4C9BB 2WXNA 1MX6A 4KXKB 2WXPA 5AYWD 1KLXA 4UWGA 5HRYA 3ULEG 2IO3C 3ZVVA 4XX5A 1H2TC 3PZDA 4JXTA 3VTYA 3QOUA 3SBTB 1OCOE 5H7PA 3GW4A 2OEVA 3W9FA 2PL2A 1TNUA 3CHPA 3VLEA 3C5RA 3S2AA 3ZYLA 4LNBA 1WY6A 4I1MA 5G04C 3D9NA 5AARA 3MKQB 3L9TA 3ZFWA 1OWNA 2WVIA 3DPYA 4GTPA 3AG3E 5G04J 3FHEA 1OY3D 4I6JA 5AQ7A 3B13A 3B7UX 2EINE 3E32A 4ANWA 4KMOA 3PREA 4G24A 4AY5A 5ENRD 2ZXWE 3DXMG 4TXQA 3LY9A 4GZDA 4LNGA 3R7RA 2XPYA 3R9AB 5FQ8A 3B7SA 4OVVA 4N5QA 3IXEA 1WG0A 4Q69A 2VYIA 2X3MA 3V31A 4YVOA 4BTAA 4FADA 3APFA 4EPZA 3CSTA 4GZ6A 1FPPA 4FU3A 1FCHA 4CT0A 1TJFA 3HXBA 3R7QA 3Q73A 3ULQA 4I17A 3SO8A 4YVQC 3FTZA 5BPPA 3QC1A 3RSEG 2V8SE 4U63A 4BT9A 3D9KA 3SHFA 2A5EA 3EIJA 5D0OD 2P2CP 4PS7A 3FH8A 2RFMA 4UI9K 5B3SE 4CCAA 3U64A 4BX9A 3I3NA 1FVHA 4AVXA 5ARGA 4GZCA 4L1BA 1SQMA 2GRLA 2PM6A 3D9HA 3SZ7A 1S63A 1NP7A 4L7TA 2WQ7A 3UINC 5FZQA 3MJWA 2J4BA 4CEMA 1NA3A 1YCSB 4G8KA 1H19A 4F1SA 1EYHA 4AP2A 1GW6A 2DYRE 1E8YA 2IEJA 3BUAA 4UWKA 3WG7E 5CBNA 5ARFA 3LYAA 4C0EA 5EIDA 3J5PA 1BD8A 1H6PA 3CVYA 1HS6A 1D8EA 4B0ZA 4N5CA 2J09A 3RRNB 3LCAA 4LUNU 3PH0C 5CMYA 3OXGA 2H6FA 3ML9A 4PDXA 4CZ2D 4IULA 5FIOA 2RD0A 3PRZA 2IOLA 3IBEA 2XEVA 3CSFA 4XIFA 3DXKG 2IOSA 3D3MA 2RG8A 3Q9NC 4HFGA 2WXQA 1YA0A 2E2EA 2AXZA 3FH7A 1NL4A 1H2UA 2IF4A 4ME2A 5C1DA 2V4HC 1YMPA 2P9PG 4I6EA 2BF0X 3U4TA 3ASFA 3FUFA 3ZIMA 3HXDA 4RG6A 3V2XA 4J8YA 2B0OE 2GRNB 2ILRA 2QYJA 4GYOA 1BU9A 2PM7A 3AS4A 3CK8A 2P9NG 4I2ZA 4I9EA 3UM2A 4HOSA 2FF4A 3FU3A 5HI7A 5FWQA 3RIBA 3Q79A 1N54A 1YYHA 2AXUA 1N11A 5AQ9A 3FEXA 2OEWA 3GZSA 2DZOA 1JCRA 4B89A 4M7CA 3IV0A 2V4LA 3HVEA 3CHSA 4OYSA 3DSXA 4RG9A 3EHQA 5LP0A 4W9RA 4HOTA 2JABA 4HXIA 2KZTA 3PVLA 4DK5A 1SVXA 4GPMA 2ZGDA 2Y0BG 5J90A 4A55A 3FEYA 3DRAA 1K3ZD 3Q15A 3QWWA 5T3RA 4K5AB 3HG0D 3HXEA 3KEZA 3UT4A 5ENSD 3SFYA 3UQ3A 3U66A 5KCMA 1MJ0A 4TV3A 4GCNA 4GYYA 1O1RA 4J7WA 4AIFA 1HF8A 3JXJA 4APFA 2LO6A 3I4RB 4N39A 3WXXA 5BT1A 1U3DA 3UXGA 5ANLA 3PUJA 2MRIA 2GRPB 1IYGA 3T8MA 3CR3A 2PQRA 3OXLA 5BV1A 3G2WA 3UT8A 4H7XA 4I2WA 2EQXA 4N3CA 4HBDA 1UJKA 4EBAG 1N9AA 3MV2B 2UWJG 3NAWA 1A5EA 3ASNE 4URKA 3NF1A 2CHWA 4K5CA 3EHMA 3UT7A 1D9SA 2YINA 4QFVA 3N71A 4HS2A 3L54A 2BKKB 1VDYA 3TGOA 2WXOA 1AP7A 3CHOA 5HQ8A 4JW1A 2OOEA 4L9PA 2EIKE 3PS6A 4DX1A 3URZA 2QFCA 3LEWA 1MX4A 5A23A 2A5UA 3CHMA 3LVQE 2R05A 3DBSA 2XEEA 3O48A 3OAWA 4JB8P 2XRZA 3SF4A 4BX8A 2WXIA 4IRUA 5LFAA 4AV7A 4JEHA 3AG4E 3UI2A 4GCOA 5KNGA 4GYWA 1Z5SC 2XQ0A 3DSSA 4XI9A 4AM9A 2XS1A 3CVQA 1SZAA 4APOA 3UX4A 2H6IA 3Q4AB 4GTQA 1NFIE 3FH5A 2J9QA 3ML8A 5AJLA 4PS3A 1INZA 4A3TA 2EIJE 3CQGB 1LTXA 3P1UA 4Y6WA 2OV8A 4B93B 2R5SA 4BSZB 3PZ4A 2OVFA 2WXJA 3K9IA 4TXPA 3ABME 1IQRA 4WUYA 4EZLA 2FBNA 4GTOA 4TUMA 2CFZA 3MYVA 3CVNA 1S70B 1DNPA 3FUHA 3SFZA 2ZGGA 5JA4D 4R7LA 4KBQA 2VGXA 4GTTA 2FEZA 2L0IA 3G2SA 3TAXA 3L17A 3NQPA 3DSVA 4FJZA 1KT0A 2MYOA 4CRWA 4JVSA 3CIAA 2IY0C 2NC9A 4GTRA 4F6RD 3Q78A 5FQ7A 4DX2A 2LAHA 3FP3A 2X6JA 4AOFA 2R03A 3JUIA 2L6JA 1E90A 2GRRB 3D9JA 2XZDG 1B89A 2L9BA 4U96D 4NQ0A 4C48B 3Q49B 1O1SA 1N0QA 3EHNA 4CDRA 5T8IA 4GB9A 3CVPA 4U07A 3MGBA 4JHRA 3ZXSA 3FU0A 1TNOA 1NI1A 2VQ2A 4UWHA 2ONDA 3C3OA 4CGVA 5J08A 3ABLE 3LXUX 4CDNA 2ZIRA 3B95A 1JUQA 3UIPC 2VTBA 2H6GA 5EYLA 3ABKE 4HRLA 5JJ7A 5AN8A 1TNZA 1JWFA 4FHKA 4DX5D 3SBSA 2X6KA 4AJWA 4G1TA 3HVEB 2XHEA 2I9CA 2GRMA 3E4BA 5CERB 3PUKA 2WXGA 2LAIA 2KZTB 5CMWA 5M72A 3KSLA 3ZUVB 1U3CA 3S7DA 4U0UA 4WWNA 1KT1A 3ULYA 3JYSA 4A63B 2XCCA 2DBAA 4NACA 1IXVA 2GGFA 1OCCE 2Y3AA 2V0PA 4N2QA 2IJGX 2ETAA 3AAAC 2XZTG 2I2OA 3TJPA 3UM0A 3UPVA 1UG3A 1K1BA 3TXNA 3EJNA 4Q94A 1MHQA 4JA7A 3SD5A 5EX0A 2HYZA 4BESA 2QY7A 3QWVA 3I5PA 2Y69E 4GTSA 3SI5A 5EN5D 2J49A 2FO7A 3FTSA 4FJYA 4NRHB 3PZ1A 4FULA 1H0AA 3FU5A 1ZBPA 3APCA 4JHJA 3TWSA 2WXRA 2X6IA 4DPRA 3EHRA 3FU6A 3L22A 4UWFA 4WWPA 3CGHA 4G26A 3OXFA 4KZ0A 3RK6A 3LDZA 1QYMA 4L2YA
chains in the Genus database with same CATH topology
3L6AA 1HFAA 2X6FA 3FEXA 2M63A 3GZSA 4GA1A 1QNFA 4K0RA 4WNGA 4B89A 4UWLA 3AU5A 3FUKA 3IV0A 3QNKA 2V4LA 3HVEA 3JCKC 3CHSA 4OYSA 1TEZA 4RG9A 1Y6IA 3CHQA 3MX3A 3QARA 4Y6CA 5DIZA 5G05C 4HLEA 5KJLA 1ELKA 4EBAA 5LP0A 4W9RA 3LPZA 4I9CA 4WWOA 4K03A 4HOTA 2OVBA 4PH4B 4B94A 3I4GA 1OWLA 4HXIA 4TUUA 2MHKA 5KJNA 3HIZA 1SZ9A 4EZJA 4J6IA 2E0IA 3O4ZA 2KZTA 4I43A 1HH8A 4PUCA 3PVLA 4DK5A 3OTNA 4LEUA 3L16A 5G05J 1HZ4A 3L08A 3MV3B 1OWOA 5J90A 3L13A 4I1AA 3MKRA 4A55A 5ENNA 1JPLA 3FEYA 4KZCA 3IEGA 4AY6A 2Y4UA 4BT8A 2XPIA 3Q15A 3QWWA 5T3RA 2WXMA 4ANXA 3FWVA 1HXIA 3KEZA 3UT4A 5BUZA 2WB2A 3UQ3A 3U66A 1UN9A 2WMNA 3LVRE 4GA2A 4ILHB 5KCMA 4ACLA 1ELWA 3P2BA 4GCNA 4HOUA 4TV3A 2WQ6A 1ZU2A 3MA5A 1UJJA 2KATA 4P29A 3LKUA 4GYYA 3AS8A 3S7JA 4XKBA 3SNXA 1BPOA 1ELRA 4U0SA 2PQNA 4AEZC 4ANUA 3VLFA 4AIFA 1HF8A 4APFA 3FTWA 2LO6A 3I4RB 3FTVA 4N39A 2YHCA 3WXXA 5BT1A 1OWMA 4U8HA 3ZYQA 1U3DA 5ANLA 4WAFA 3MZLB 3PUJA 2MRIA 2YQ8A 4HVBA 1E8ZA 3T8MA 1IYGA 1TJCA 3HYMB 3QKYA 5EDSA 1QQEA 5BV0A 4JL0A 3ASHA 3CR3A 3T5XA 2V5FA 1PAQA 2PQRA 1E8WA 3OXLA 3D9PA 3GZ2A 4ANVA 4D10C 1DVPA 1HE8A 3RO3A 3KD7A 5BV1A 4EZKA 3VTXA 3G2WA 3UT8A 4H7XA 1H2VC 4I2WA 1HX8A 2EQXA 3Q47B 4N3CA 1UJKA 1N52A 2HO1A 3RO2A 4EBAG 2R59A 5E75A 5EKQD 3G2UA 3MV2B 3ZW3A 4XI0A 2UWJG 3PEUB 4KVMA 4URKA 3VLDA 4N2SA 2CHXA 2CHWA 3NF1A 3ONLA 3APDA 4A1SA 4B8AA 2YNQA 3TG4A 1EPUA 2AW6A 3EHMA 4GAAA 3RJVA 5CCMA 3JQ0A 3UT7A 4JZYA 4H7YA 2YINA 2PZIA 4CGWA 3ZEFA 4QFVA 2C0LA 3D9MA 3L54A 3N71A 2UY1B 4HS2A 1VDYA 3D9LA 1L5JA 4IN3B 4LRZA 2WXOA 2C0MA 3TGOA 5AIJA 5C2YA 4L2LA 3CHOA 4N3BA 2CG3A 3CVLA 3NZUA 2XRYA 4Q96A 5HQ8A 4JW1A 2OOEA 4PS8A 3CKCA 2WXFA 1HG2A 2J4DA 2FULA 5FZRA 1Y8MA 3PS6A 3URZA 2QFCA 2IQCA 3AS5A 5FJYA 5LOZA 4RSYA 3LEWA 5D0QD 3QWPA 4MRUA 4G25A 4LCTA 4LERA 4UI9C 2CHZA 3ONKA 5A23A 3ZHEA 4AXHA 2A5UA 1PY1A 1S0PA 3CHMA 4YNDA 4ACKA 2XPZA 2ZU6B 5KJMA 3LVQE 3C98A 2J07A 3PE4A 3S7BA 3DBSA 3QDNA 3LY8A 4UI9J 3O48A 3OAWA 2XRZA 4FA6A 4GMJA 3FTUA 3SF4A 4BX8A 4HOQA 2KM4A 2I6HA 5LX8A 3ZHEB 5CCLA 2WXIA 4N3AA 3G2TA 4IRUA 4GZ3A 5LFAA 1P5QA 4C9BB 2VSNA 2WXNA 2GW1A 3TG5A 5FT9A 3EDTB 2CFUA 4AV7A 4KXKB 3UUXA 3LY7A 4GPKA 2J08A 2L0TB 2WXPA 4JEHA 4GCOA 4ILIA 5AYWD 4EQFA 1KLXA 1HO8A 4GYWA 4UWGA 2XQ0A 3MEKA 4FHJA 4JC8A 3ZVVA 4XX5A 1H2TC 4GU5A 3PZDA 4JXTA 4XI9A 3VTYA 3QOUA 4AM9A 3CVQA 5A6CA 4BWRA 1SZAA 4APOA 3SBTB 4B8CB 3UX4A 3GW4A 3Q4AB 4HORA 3PNLB 3IKOB 3Q5MA 3FH5A 3PDNA 3FUMA 2J9QA 2PL2A 3ML8A 4PS3A 5AJLA 1INZA 2VTBB 3CHPA 3FY4A 4A3TA 1Z3XA 3IHVA 5EX3A 2BUGA 3VLEA 3S2AA 4BSXA 3CQGB 4ABNA 3NZSA 3ZYLA 1WY6A 3RKVA 4I1MA 3FTXA 3P1UA 1QZ2A 2WXLA 4Y6WA 3EIQC 5G04C 2OV8A 2R5SA 3D9NA 2OVFA 3SGHA 2BTDA 2WXJA 3K9IA 3MKQB 4J8FA 5FZSA 2DCPA 4E6HA 4I6GA 3FUNA 3ZFWA 1OWNA 2WVIA 4MKTA 4TRQA 3JQ1A 3BG0B 1IQRA 1UW4B 2DIWA 4WUYA 5G04J 3FHEA 4BFRA 2WQHA 4I6JA 4EZLA 5T4YA 4MLPA 2FBNA 4RVBA 2CFZA 1HG5A 3B13A 2LNIA 3B7UX 3MYVA 3CVNA 4O6FA 4ANWA 2AWIA 4KMOA 1E8XA 1W3BA 1LF8A 1DNPA 3PREA 4G24A 1OWPA 4AY5A 2UY1A 3ASDA 3FUHA 3G2VA 3SFZA 5ANRA 5G2NA 1JWGA 4R7LA 4KBQA 4A3VA 2VGXA 3CLJA 3LY9A 2FEZA 2VJ8A 2L0IA 4GZDA 5JHAA 2XGMA 3G2SA 5JJ6A 3R7RA 3TAXA 2XPYA 3R9AB 3L17A 5FQ8A 3NQPA 4FJZA 1KT0A 3CVXA 3B7SA 4OVVA 1E96B 4CRWA 2VSOE 4JVSA 3PEVB 2X38A 4Q69A 1OUVA 5LCWJ 5KJKA 2WXKA 3CKBA 3ENEA 2VYIA 2JLBA 1A17A 2X3MA 2NC9A 3CIAA 3LS8A 5JJTA 2VGXB 4YVOA 4BTAA 4FADA 3D9OA 3APFA 1WM5A 4EPZA 5FQ7A 3CSTA 4KT6B 2LAHA 4A1GA 3FFLA 2X6JA 2XGOA 3FP3A 4FU3A 4GZ6A 1FCHA 1EF1C 1XGWA 2LSUA 4CT0A 4AOFA 3HDXA 2KCVA 1TJFA 3JUIA 2L6JA 2CG2A 3FULA 1E90A 4GA0A 3R7QA 3ULQA 3D9JA 3ESLA 4F53A 1B89A 2L9BA 4I17A 3FUDA 4YVQC 3FTZA 5BPPA 3QC1A 4NQ0A 2V8SE 3S7FA 4XKCA 3Q49B 4U63A 4BT9A 3D9KA 3SHFA 2VSYA 2IONA 2LSVA 3CHRA 2KCLA 3PNTB 3EIJA 4EECA 5D0OD 2KC7A 3EHNA 4PS7A 3FH8A 2WMOA 3GZ1A 2P58C 4WNFA 3ASGA 3LJ3A 4UI9K 4CDRA 5T8IA 4GB9A 4U0ZA 4CCAA 3U64A 3CVPA 4BX9A 4U07A 2I1KA 3I3NA 3MGBA 4JHRA 4U04A 3T5VA 5FQ4A 3UMVA 5E76A 3B7RL 1FVHA 3ZXSA 3FU0A 3CK7A 4AVXA 2VQ2A 5ARGA 4GZCA 4L1BA 1SQMA 4UWHA 2GRLA 5G55A 4CDMA 2ONDA 4KYOB 4CGVA 5J08A 3CQCB 2FI7A 3LXUX 5BW8C 3FDHA 2PM6A 4V3IA 4CDNA 3QK0A 1JUQA 2VTBA 1NZNA 3SZ7A 1X5BA 3FUEA 5JJ7A 1NP7A 3D9IA 3CVVA 1JWFA 4FHKA 4KVOA 4L7TA 2WQ7A 4DLQA 1Z3YA 3SBSA 2C2LA 3CV0A 5FZQA 4FP7A 3MJWA 2J4BA 2X6KA 3TXMA 4CEMA 1NA3A 4AJWA 4DJAA 1H19A 4F1SA 1EYHA 4G1TA 3HVEB 4AP2A 2WXHA 4G2VA 3MKQA 3MCXA 2XHEA 1GW6A 4I1OB 4XE0A 3FUIA 3RRUA 4MS6A 1FVFA 2I9CA 2A4ZA 2AVPA 3B7TA 4ILGA 2GRMA 1E8YA 3E4BA 1IHGA 3PUKA 1PC2A 2WXGA 3TL5A 4DLOA 4UWKA 5JHBA 2LAIA 5FQ6A 5ARFA 3LYAA 2NXPA 4C0EA 2KZTB 3RRMB 1E7UA 4FLHA 5CMWA 2WPVA 5FTPA 5M72A 3U3WA 1U3CA 3S7DA 4U0UA 3CVYA 3FTYA 1KT1A 4WWNA 1HS6A 3JYSA 4JPSA 2XCCA 2AXVA 2DBAA 4JHKA 4NACA 3ZYMA 4B0ZA 2GGFA 4N5CA 3PE3A 2J09A 3RRNB 3LCAA 2JEKA 2Y3AA 4LUNU 2I1JA 2V0PA 3PH0C 4WNEA 4UQXA 4N2QA 2IJGX 4CT4A 1WAO1 2R17C 5CMYA 3HHMA 4F3VA 2I2OA 3CEQA 3OXGA 3AU4A 3ML9A 4PDXA 4ATGA 3TJPA 3QAQA 4OVUA 3UPVA 4IULA 1UG3A 2RD0A 3TXNA 3PRZA 2XGSA 3EJNA 4Q94A 2IOLA 5LCWC 1MHQA 3IBEA 3KS2A 2XEVA 3CSFA 3BEEA 5DBKA 4G23A 5AJDA 4XIFA 3RU0A 3ZYKA 2IOSA 3D3MA 1IQUA 4JA7A 5A7DB 2RG8A 3SD5A 2IU1A 2XCBA 5EX0A 4HFGA 2HYZA 3ZRHA 2HR2A 3ZPJA 2VGYA 3U9WA 2QY7A 3QWVA 2WXQA 4J8DA 1YA0A 2E2EA 2Y4TA 3I5PA 4IYPA 3GYZA 5CHEE 3BG1B 2AXZA 3FH7A 1EDUA 3KAEA 4M3OA 4C0MA 3SI5A 4BTBA 1UN8A 5AENA 1H2UA 2IF4A 4ME2A 4JEUA 5C1DA 1NA0A 4DI4A 2KCKA 2J49A 2Q7FA 4I6EA 3CVWA 2FO7A 2BF0X 4J8SA 3FTSA 4FJYA 4WNDA 5BNWA 4NRHB 3U4TA 4BY6A 4FULA 2NSZA 1H0AA 2X6HA 3ASFA 4E85A 3FUFA 3ZIMA 3FU5A 2MOWA 1ZBPA 4RG6A 4JA9A 3CK9A 1E7VA 4GYOA 2ILRA 3FUJA 2PM7A 3APCA 3IHYA 3AS4A 3CK8A 4FC8A 4FLBA 3QJZA 4NURA 4F7AA 2YHEA 3ZN3A 3CVUA 4XZ4A 1H6KA 4I2ZA 4UQZA 4I9EA 2VSXE 4JHJA 2WXRA 2X6IA 1XNFA 4DPRA 4J8EA 2WM9A 4HOSA 2IFUA 3DPDA 2FF4A 3FU3A 3FU6A 1HU3A 4GZ5A 3L22A 4UWFA 5FWQA 4WWPA 5HI7A 3CGHA 3RIBA 4G26A 1Z6TA 4UQYA 3OXFA 4KZ0A 3RK6A 1MQSA 4J0UA 3LDZA 2HM8A 3QB2A 1N54A 3ESKA 4G11A 4DI3A 2AXUA 4L2YA 4L23A 4GMLA 3ZGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4APF A;  4HXI A;  3HVE A;  4HS2 A;  3I3N A;  3HVE B;  2EQX A;  4AP2 A; 
#chains in the Genus database with same CATH topology
 3HRA A;  1HFA A;  3TWR A;  2M63 A;  4ATZ D;  4RQI A;  4UWL A;  1TEZ A;  1Y6I A;  1RZ4 A;  3MX3 A;  5G05 C;  4EBA A;  3LPZ A;  3B7B A;  4NIK A;  2MHK A;  3NB2 A;  1SZ9 A;  1KZO A;  4J6I A;  2OCC E;  3O4Z A;  4LEU A;  3DEO A;  5G05 J;  3L08 A;  1OWO A;  3L13 A;  5ENN A;  5AAO A;  4KZC A;  3IEG A;  2Y4U A;  4BT8 A;  4U95 D;  2WXM A;  4ANX A;  1HXI A;  2WB2 A;  1UN9 A;  4GA2 A;  4ACL A;  3P2B A;  2WQ6 A;  2KAT A;  2P9U G;  4P29 A;  3S7J A;  4ZHB A;  5HS0 A;  4XEI G;  4AEZ C;  4ANU A;  3VLF A;  1N94 A;  3UTM A;  4HB5 A;  2YHC A;  3T8K A;  5JMN D;  4U8H A;  3ZYQ A;  3E37 A;  4UUC A;  3MZL B;  4HVB A;  1E8Z A;  4JL0 A;  3ASH A;  3T5X A;  3KSQ A;  2P9S G;  1PAQ A;  5KWD A;  3D9P A;  3GZ2 A;  1HE8 A;  3VTX A;  3RO2 A;  5E75 A;  5EKQ D;  3ZW3 A;  4XI0 A;  3PEU B;  3R9M A;  4KVM A;  4BET A;  3APD A;  4A1S A;  3TG4 A;  3AJI A;  3RJV A;  3JQ0 A;  2C0L A;  3D9L A;  1L5J A;  1MYO A;  4L2L A;  4N3B A;  3NZU A;  2WXF A;  1HG2 A;  5BXU A;  3W9G A;  1LD8 A;  5FJY A;  5D0Q D;  3QWP A;  4MRU A;  4UI9 C;  1TN8 A;  3ZHE A;  3DWL G;  2L6B A;  3TWU A;  1S0P A;  2ZU6 B;  5KJM A;  3C98 A;  2J07 A;  3S7B A;  3QDN A;  4UI9 J;  2FO1 E;  3ISM C;  3FTU A;  2J8S D;  4HOQ A;  2I6H A;  5LX8 A;  1P5Q A;  4TXR A;  2GW1 A;  3EDT B;  4GPK A;  4ILI A;  3MEK A;  4GU5 A;  1SA5 A;  3E30 A;  5A6C A;  3ZKJ A;  4B8C B;  3PNL B;  3IKO B;  1TN6 A;  2VTB B;  5AQA A;  5EX3 A;  4U8Y D;  4BSX A;  5CRV A;  4ABN A;  3RKV A;  3FTX A;  1G3N B;  2F37 A;  2BKG A;  5KBA A;  3SGH A;  3AG1 E;  1KPS B;  1SA4 A;  5FZS A;  2DCP A;  4E6H A;  2DWZ A;  3FUN A;  1N4S A;  4MKT A;  4TRQ A;  2DIW A;  2LXM A;  1JCS A;  4MLP A;  4GMR A;  4RVB A;  3NOG D;  4O6F A;  3JXI A;  2AWI A;  1E8X A;  1W3B A;  1LF8 A;  1V55 E;  2EIM E;  2LUH A;  1OWP A;  2UY1 A;  5ANR A;  1JWG A;  3BQO A;  5JHA A;  5JJ6 A;  3CVX A;  2ETB A;  1E96 B;  2XEN A;  2VSO E;  3EUV A;  3PEV B;  5LCW J;  5KJK A;  1S64 A;  2GRO B;  3CKB A;  5JJT A;  3D9O A;  4A1G A;  3FFL A;  1X81 A;  2KCV A;  1FT1 A;  3FUL A;  1D8D A;  3UKU G;  3E33 A;  1DC2 A;  3ESL A;  4F53 A;  4EHM A;  2DVW A;  1N0R A;  4O60 A;  3S7F A;  4XKC A;  1SW6 A;  2VSY A;  2ION A;  3CHR A;  2KCL A;  2R02 A;  4EEC A;  3GZ1 A;  4LSZ E;  4WNF A;  4GTV A;  1WDY A;  3DST A;  3CK7 A;  4CDM A;  3TWV A;  3CQC B;  3FDH A;  4V3I A;  1H6O A;  3QK0 A;  1NZN A;  1X5B A;  3FUE A;  3PZ2 A;  3V2O A;  1TR4 A;  3D9I A;  4KVO A;  4DLQ A;  2C2L A;  4FP7 A;  3TXM A;  4G2V A;  3MCX A;  3FUI A;  1FVF A;  2A4Z A;  2AVP A;  4YDW A;  5EYP F;  1IHG A;  1PC2 A;  3ZXP A;  5FQ6 A;  3SQV A;  2NXP A;  3KEA A;  3RRM B;  1E7U A;  2WPV A;  3V30 A;  3FTY A;  2NYJ A;  4X8Q A;  5D66 A;  4JPS A;  4JHK A;  3ZYM A;  2VGE A;  5BXO A;  2I1J A;  4WNE A;  4UQX A;  4CT4 A;  1FT2 A;  3SY2 A;  2ZIS A;  4BEP A;  4ATG A;  4OVU A;  2XGS A;  2DZN A;  4K5B A;  5ENP D;  2QYU A;  3BEE A;  5DBK A;  4G23 A;  5AJD A;  3RU0 A;  1IQU A;  2IU1 A;  3UIO C;  4BER A;  3ZRH A;  5IY5 E;  5CHE E;  3GYZ A;  4G8L A;  4C0M A;  3PZ3 A;  5AEN A;  4CYM D;  1K1A A;  1NA0 A;  2KCK A;  2Q7F A;  3TWT A;  3CVW A;  4WND A;  5BNW A;  2NSZ A;  2X6H A;  4DX6 D;  4YDE A;  2QC9 A;  3CK9 A;  4HI8 A;  1E7V A;  3IHY A;  4FC8 A;  4NUR A;  3QJZ A;  4F7A A;  2YHE A;  3ZN3 A;  1H6K A;  4UQZ A;  4J8E A;  2IFU A;  4GZ5 A;  1HU3 A;  4UQY A;  3QB2 A;  2HM8 A;  3ESK A;  4GML A;  1DCQ A;  3L6A A;  4K0R A;  4WNG A;  3TWQ A;  2IO2 C;  3AU5 A;  1N4Q A;  4OAV B;  3ASO E;  3QAR A;  4HLE A;  3HXC A;  2XEH A;  1TYQ G;  4OAU C;  4I9C A;  4WWO A;  4K03 A;  2OVB A;  4PH4 B;  4B94 A;  3I4G A;  1KZP A;  1OWL A;  5KJN A;  2E0I A;  2P9K G;  1HH8 A;  3L16 A;  3MKR A;  1JPL A;  1Q2Z A;  5ENO D;  2XPI A;  3FWV A;  5BUZ A;  3LVR E;  4ILH B;  1ELW A;  4HOU A;  3ZU7 B;  1ZU2 A;  3MA5 A;  5B1B E;  3LKU A;  3AS8 A;  4XKB A;  4U0S A;  1N4R A;  2HE0 A;  5FIN A;  1OWM A;  1TNY A;  4HQD A;  2P9L G;  2YQ8 A;  3TWW A;  1TJC A;  2V5F A;  4EZK A;  4F1P A;  1H2V C;  1K8K G;  1HX8 A;  3Q47 B;  2HO1 A;  1N52 A;  5ITZ F;  2PNN A;  2R59 A;  3G2U A;  3DSW A;  3VLD A;  4N2S A;  3EU9 A;  3ONL A;  4B8A A;  1EPU A;  2AW6 A;  3Q7A A;  5CCM A;  4H7Y A;  1TN7 A;  2PZI A;  3NOC D;  3ZEF A;  3D9M A;  2UY1 B;  4IN3 B;  4LRZ A;  2C0M A;  5AIJ A;  3CVL A;  2XRY A;  4Q96 A;  1BLX B;  3C3R A;  2J4D A;  5FZR A;  3NBN B;  3AS5 A;  3SFX A;  5LOZ A;  2R2L A;  4LCT A;  4LER A;  4AXH A;  1PY1 A;  3LY8 A;  3DSU A;  4GMJ A;  2KM4 A;  3C72 A;  2BED A;  5CCL A;  4GZ3 A;  2VSN A;  3TG5 A;  5FT9 A;  2CFU A;  3UUX A;  3LY7 A;  2J08 A;  2L0T B;  4EQF A;  1HO8 A;  1IHB A;  3J5Q B;  4FHJ A;  4JC8 A;  2KXP C;  4BWR A;  3UM3 A;  2XS8 A;  4HOR A;  3Q5M A;  3UKR G;  3X2Q E;  3PDN A;  3FUM A;  5EIL A;  2LXL A;  3FY4 A;  1MZC A;  1Z3X A;  3IHV A;  2BUG A;  4YDY A;  1DCE A;  3NZS A;  1QZ2 A;  2WXL A;  3EIQ C;  1UOH A;  2BTD A;  4MBG A;  4J8F A;  4I6G A;  1V54 E;  3JQ1 A;  3BG0 B;  3UM1 A;  1UW4 B;  4BFR A;  2WQH A;  5T4Y A;  1HG5 A;  2LNI A;  5CRU A;  3ZNG A;  3ASD A;  3G2V A;  5G2N A;  4A3V A;  3CLJ A;  2VJ8 A;  2XGM A;  2X38 A;  5EIB E;  3LJN A;  1OUV A;  2WXK A;  3ENE A;  2JLB A;  1A17 A;  1JCQ A;  3LS8 A;  2VGX B;  2F0Y A;  1WM5 A;  3E34 A;  4KT6 B;  4U8V D;  2XGO A;  2LSU A;  1EF1 C;  1XGW A;  2P9I G;  4LG6 A;  1IKN D;  3HDX A;  2CG2 A;  3BU8 A;  4GA0 A;  3AG2 E;  2F8Y A;  3FUD A;  5D2M C;  2EIL E;  4Z68 A;  2LSV A;  3PNT B;  2KC7 A;  2WMO A;  2P58 C;  3L82 A;  3ASG A;  3LJ3 A;  4U0Z A;  4YDO A;  2I1K A;  3T5V A;  2RFA A;  4U04 A;  5FQ4 A;  3UMV A;  5E76 A;  3B7R L;  5G55 A;  4KYO B;  2FI7 A;  5BW8 C;  4HI9 A;  3RAU A;  3CVV A;  1MX2 A;  1Z3Y A;  3CV0 A;  5ENT D;  1TNB A;  4DJA A;  3DEP A;  1RW2 A;  2WXH A;  3MKQ A;  4I1O B;  4XE0 A;  3RRU A;  4MS6 A;  3B7T A;  4ILG A;  3T9K A;  3TL5 A;  4DLO A;  3V79 K;  5JHB A;  2F8X K;  2QZA A;  4FLH A;  5FTP A;  3U3W A;  2DYS E;  1OXJ A;  2B6C A;  2AXV A;  3PE3 A;  5B1A E;  2JEK A;  3TWX A;  1WAO 1;  2R17 C;  3HHM A;  4F3V A;  3CEQ A;  3AU4 A;  3EU5 A;  3QAQ A;  5LCW C;  3KS2 A;  4HRN A;  3ZYK A;  2AJA A;  1O1T A;  4U7E B;  5A7D B;  2XCB A;  4GTM A;  4HRM B;  2HR2 A;  3ZPJ A;  2VGY A;  3U9W A;  4J8D A;  2Y4T A;  4IYP A;  3BG1 B;  5CEC B;  1EDU A;  3KAE A;  4M3O A;  4BTB A;  1UN8 A;  1BI7 B;  4JEU A;  2ETC A;  4DI4 A;  4J8S A;  4LNU D;  4BY6 A;  3JUE A;  4E85 A;  2MOW A;  4JA9 A;  3FUJ A;  5CBO A;  4FLB A;  3HXF A;  3CVU A;  4XZ4 A;  2VSX E;  1XNF A;  2WM9 A;  3DPD A;  1Z6T A;  1MQS A;  4J0U A;  1OCZ E;  4G11 A;  4DI3 A;  4DUI A;  4ZFH A;  4L23 A;  3ZGQ A;  1AWC B;  2X6F A;  4GA1 A;  1QNF A;  1BI8 B;  2H6H A;  3FUK A;  3QNK A;  3JCK C;  1QBQ A;  4Y6C A;  3CHQ A;  5DIZ A;  5KJL A;  1ELK A;  1ZB1 A;  1OT8 A;  5CED B;  4TUU A;  1N4P A;  3HIZ A;  4EZJ A;  5CEA A;  4PUC A;  4I43 A;  3OTN A;  1HZ4 A;  3MV3 B;  4I1A A;  1U2V G;  3F6Q A;  5KNH D;  4AY6 A;  2WMN A;  4HLL A;  4JD2 G;  1UJJ A;  3SNX A;  1BPO A;  1ELR A;  3C3Q A;  2PQN A;  3FTW A;  4QQI A;  3FTV A;  2RKK A;  4WAF A;  1OCR E;  3HYM B;  3QKY A;  5EDS A;  2V5Q C;  1QQE A;  5BV0 A;  4DRX E;  2Y1L E;  4ANV A;  1E8W A;  4D10 C;  1DVP A;  5ENQ D;  3RO3 A;  3KD7 A;  1LD7 A;  2CHX A;  2YNQ A;  4GAA A;  2KBX A;  4JZY A;  4CGW A;  3Q7F A;  5C2Y A;  2CG3 A;  4HNA D;  4O1O A;  4PS8 A;  3CKC A;  5HKP A;  2FUL A;  1Y8M A;  3Q9U C;  2IQC A;  4RSY A;  4G25 A;  4RLY A;  2CHZ A;  3ONK A;  4DX7 D;  5AQB A;  1N95 A;  4YND A;  2GRQ B;  4ACK A;  2XPZ A;  3PE4 A;  4O1P A;  4FA6 A;  1O5M A;  3ZHE B;  4N3A A;  3Q75 A;  3G2T A;  4C9B B;  2WXN A;  1MX6 A;  4KXK B;  2WXP A;  5AYW D;  1KLX A;  4UWG A;  5HRY A;  3ULE G;  2IO3 C;  3ZVV A;  4XX5 A;  1H2T C;  3PZD A;  4JXT A;  3VTY A;  3QOU A;  3SBT B;  1OCO E;  5H7P A;  3GW4 A;  2OEV A;  3W9F A;  2PL2 A;  1TNU A;  3CHP A;  3VLE A;  3C5R A;  3S2A A;  3ZYL A;  4LNB A;  1WY6 A;  4I1M A;  5G04 C;  3D9N A;  5AAR A;  3MKQ B;  3L9T A;  3ZFW A;  1OWN A;  2WVI A;  3DPY A;  4GTP A;  3AG3 E;  5G04 J;  3FHE A;  1OY3 D;  4I6J A;  5AQ7 A;  3B13 A;  3B7U X;  2EIN E;  3E32 A;  4ANW A;  4KMO A;  3PRE A;  4G24 A;  4AY5 A;  5ENR D;  2ZXW E;  3DXM G;  4TXQ A;  3LY9 A;  4GZD A;  4LNG A;  3R7R A;  2XPY A;  3R9A B;  5FQ8 A;  3B7S A;  4OVV A;  4N5Q A;  3IXE A;  1WG0 A;  4Q69 A;  2VYI A;  2X3M A;  3V31 A;  4YVO A;  4BTA A;  4FAD A;  3APF A;  4EPZ A;  3CST A;  4GZ6 A;  1FPP A;  4FU3 A;  1FCH A;  4CT0 A;  1TJF A;  3HXB A;  3R7Q A;  3Q73 A;  3ULQ A;  4I17 A;  3SO8 A;  4YVQ C;  3FTZ A;  5BPP A;  3QC1 A;  3RSE G;  2V8S E;  4U63 A;  4BT9 A;  3D9K A;  3SHF A;  2A5E A;  3EIJ A;  5D0O D;  2P2C P;  4PS7 A;  3FH8 A;  2RFM A;  4UI9 K;  5B3S E;  4CCA A;  3U64 A;  4BX9 A;  3I3N A;  1FVH A;  4AVX A;  5ARG A;  4GZC A;  4L1B A;  1SQM A;  2GRL A;  2PM6 A;  3D9H A;  3SZ7 A;  1S63 A;  1NP7 A;  4L7T A;  2WQ7 A;  3UIN C;  5FZQ A;  3MJW A;  2J4B A;  4CEM A;  1NA3 A;  1YCS B;  4G8K A;  1H19 A;  4F1S A;  1EYH A;  4AP2 A;  1GW6 A;  2DYR E;  1E8Y A;  2IEJ A;  3BUA A;  4UWK A;  3WG7 E;  5CBN A;  5ARF A;  3LYA A;  4C0E A;  5EID A;  3J5P A;  1BD8 A;  1H6P A;  3CVY A;  1HS6 A;  1D8E A;  4B0Z A;  4N5C A;  2J09 A;  3RRN B;  3LCA A;  4LUN U;  3PH0 C;  5CMY A;  3OXG A;  2H6F A;  3ML9 A;  4PDX A;  4CZ2 D;  4IUL A;  5FIO A;  2RD0 A;  3PRZ A;  2IOL A;  3IBE A;  2XEV A;  3CSF A;  4XIF A;  3DXK G;  2IOS A;  3D3M A;  2RG8 A;  3Q9N C;  4HFG A;  2WXQ A;  1YA0 A;  2E2E A;  2AXZ A;  3FH7 A;  1NL4 A;  1H2U A;  2IF4 A;  4ME2 A;  5C1D A;  2V4H C;  1YMP A;  2P9P G;  4I6E A;  2BF0 X;  3U4T A;  3ASF A;  3FUF A;  3ZIM A;  3HXD A;  4RG6 A;  3V2X A;  4J8Y A;  2B0O E;  2GRN B;  2ILR A;  2QYJ A;  4GYO A;  1BU9 A;  2PM7 A;  3AS4 A;  3CK8 A;  2P9N G;  4I2Z A;  4I9E A;  3UM2 A;  4HOS A;  2FF4 A;  3FU3 A;  5HI7 A;  5FWQ A;  3RIB A;  3Q79 A;  1N54 A;  1YYH A;  2AXU A;  1N11 A;  5AQ9 A;  3FEX A;  2OEW A;  3GZS A;  2DZO A;  1JCR A;  4B89 A;  4M7C A;  3IV0 A;  2V4L A;  3HVE A;  3CHS A;  4OYS A;  3DSX A;  4RG9 A;  3EHQ A;  5LP0 A;  4W9R A;  4HOT A;  2JAB A;  4HXI A;  2KZT A;  3PVL A;  4DK5 A;  1SVX A;  4GPM A;  2ZGD A;  2Y0B G;  5J90 A;  4A55 A;  3FEY A;  3DRA A;  1K3Z D;  3Q15 A;  3QWW A;  5T3R A;  4K5A B;  3HG0 D;  3HXE A;  3KEZ A;  3UT4 A;  5ENS D;  3SFY A;  3UQ3 A;  3U66 A;  5KCM A;  1MJ0 A;  4TV3 A;  4GCN A;  4GYY A;  1O1R A;  4J7W A;  4AIF A;  1HF8 A;  3JXJ A;  4APF A;  2LO6 A;  3I4R B;  4N39 A;  3WXX A;  5BT1 A;  1U3D A;  3UXG A;  5ANL A;  3PUJ A;  2MRI A;  2GRP B;  1IYG A;  3T8M A;  3CR3 A;  2PQR A;  3OXL A;  5BV1 A;  3G2W A;  3UT8 A;  4H7X A;  4I2W A;  2EQX A;  4N3C A;  4HBD A;  1UJK A;  4EBA G;  1N9A A;  3MV2 B;  2UWJ G;  3NAW A;  1A5E A;  3ASN E;  4URK A;  3NF1 A;  2CHW A;  4K5C A;  3EHM A;  3UT7 A;  1D9S A;  2YIN A;  4QFV A;  3N71 A;  4HS2 A;  3L54 A;  2BKK B;  1VDY A;  3TGO A;  2WXO A;  1AP7 A;  3CHO A;  5HQ8 A;  4JW1 A;  2OOE A;  4L9P A;  2EIK E;  3PS6 A;  4DX1 A;  3URZ A;  2QFC A;  3LEW A;  1MX4 A;  5A23 A;  2A5U A;  3CHM A;  3LVQ E;  2R05 A;  3DBS A;  2XEE A;  3O48 A;  3OAW A;  4JB8 P;  2XRZ A;  3SF4 A;  4BX8 A;  2WXI A;  4IRU A;  5LFA A;  4AV7 A;  4JEH A;  3AG4 E;  3UI2 A;  4GCO A;  5KNG A;  4GYW A;  1Z5S C;  2XQ0 A;  3DSS A;  4XI9 A;  4AM9 A;  2XS1 A;  3CVQ A;  1SZA A;  4APO A;  3UX4 A;  2H6I A;  3Q4A B;  4GTQ A;  1NFI E;  3FH5 A;  2J9Q A;  3ML8 A;  5AJL A;  4PS3 A;  1INZ A;  4A3T A;  2EIJ E;  3CQG B;  1LTX A;  3P1U A;  4Y6W A;  2OV8 A;  4B93 B;  2R5S A;  4BSZ B;  3PZ4 A;  2OVF A;  2WXJ A;  3K9I A;  4TXP A;  3ABM E;  1IQR A;  4WUY A;  4EZL A;  2FBN A;  4GTO A;  4TUM A;  2CFZ A;  3MYV A;  3CVN A;  1S70 B;  1DNP A;  3FUH A;  3SFZ A;  2ZGG A;  5JA4 D;  4R7L A;  4KBQ A;  2VGX A;  4GTT A;  2FEZ A;  2L0I A;  3G2S A;  3TAX A;  3L17 A;  3NQP A;  3DSV A;  4FJZ A;  1KT0 A;  2MYO A;  4CRW A;  4JVS A;  3CIA A;  2IY0 C;  2NC9 A;  4GTR A;  4F6R D;  3Q78 A;  5FQ7 A;  4DX2 A;  2LAH A;  3FP3 A;  2X6J A;  4AOF A;  2R03 A;  3JUI A;  2L6J A;  1E90 A;  2GRR B;  3D9J A;  2XZD G;  1B89 A;  2L9B A;  4U96 D;  4NQ0 A;  4C48 B;  3Q49 B;  1O1S A;  1N0Q A;  3EHN A;  4CDR A;  5T8I A;  4GB9 A;  3CVP A;  4U07 A;  3MGB A;  4JHR A;  3ZXS A;  3FU0 A;  1TNO A;  1NI1 A;  2VQ2 A;  4UWH A;  2OND A;  3C3O A;  4CGV A;  5J08 A;  3ABL E;  3LXU X;  4CDN A;  2ZIR A;  3B95 A;  1JUQ A;  3UIP C;  2VTB A;  2H6G A;  5EYL A;  3ABK E;  4HRL A;  5JJ7 A;  5AN8 A;  1TNZ A;  1JWF A;  4FHK A;  4DX5 D;  3SBS A;  2X6K A;  4AJW A;  4G1T A;  3HVE B;  2XHE A;  2I9C A;  2GRM A;  3E4B A;  5CER B;  3PUK A;  2WXG A;  2LAI A;  2KZT B;  5CMW A;  5M72 A;  3KSL A;  3ZUV B;  1U3C A;  3S7D A;  4U0U A;  4WWN A;  1KT1 A;  3ULY A;  3JYS A;  4A63 B;  2XCC A;  2DBA A;  4NAC A;  1IXV A;  2GGF A;  1OCC E;  2Y3A A;  2V0P A;  4N2Q A;  2IJG X;  2ETA A;  3AAA C;  2XZT G;  2I2O A;  3TJP A;  3UM0 A;  3UPV A;  1UG3 A;  1K1B A;  3TXN A;  3EJN A;  4Q94 A;  1MHQ A;  4JA7 A;  3SD5 A;  5EX0 A;  2HYZ A;  4BES A;  2QY7 A;  3QWV A;  3I5P A;  2Y69 E;  4GTS A;  3SI5 A;  5EN5 D;  2J49 A;  2FO7 A;  3FTS A;  4FJY A;  4NRH B;  3PZ1 A;  4FUL A;  1H0A A;  3FU5 A;  1ZBP A;  3APC A;  4JHJ A;  3TWS A;  2WXR A;  2X6I A;  4DPR A;  3EHR A;  3FU6 A;  3L22 A;  4UWF A;  4WWP A;  3CGH A;  4G26 A;  3OXF A;  4KZ0 A;  3RK6 A;  3LDZ A;  1QYM A;  4L2Y A; 
#chains in the Genus database with same CATH homology
 3L6A A;  1HFA A;  2X6F A;  3FEX A;  2M63 A;  3GZS A;  4GA1 A;  1QNF A;  4K0R A;  4WNG A;  4B89 A;  4UWL A;  3AU5 A;  3FUK A;  3IV0 A;  3QNK A;  2V4L A;  3HVE A;  3JCK C;  3CHS A;  4OYS A;  1TEZ A;  4RG9 A;  1Y6I A;  3CHQ A;  3MX3 A;  3QAR A;  4Y6C A;  5DIZ A;  5G05 C;  4HLE A;  5KJL A;  1ELK A;  4EBA A;  5LP0 A;  4W9R A;  3LPZ A;  4I9C A;  4WWO A;  4K03 A;  4HOT A;  2OVB A;  4PH4 B;  4B94 A;  3I4G A;  1OWL A;  4HXI A;  4TUU A;  2MHK A;  5KJN A;  3HIZ A;  1SZ9 A;  4EZJ A;  4J6I A;  2E0I A;  3O4Z A;  2KZT A;  4I43 A;  1HH8 A;  4PUC A;  3PVL A;  4DK5 A;  3OTN A;  4LEU A;  3L16 A;  5G05 J;  1HZ4 A;  3L08 A;  3MV3 B;  1OWO A;  5J90 A;  3L13 A;  4I1A A;  3MKR A;  4A55 A;  5ENN A;  1JPL A;  3FEY A;  4KZC A;  3IEG A;  4AY6 A;  2Y4U A;  4BT8 A;  2XPI A;  3Q15 A;  3QWW A;  5T3R A;  2WXM A;  4ANX A;  3FWV A;  1HXI A;  3KEZ A;  3UT4 A;  5BUZ A;  2WB2 A;  3UQ3 A;  3U66 A;  1UN9 A;  2WMN A;  3LVR E;  4GA2 A;  4ILH B;  5KCM A;  4ACL A;  1ELW A;  3P2B A;  4GCN A;  4HOU A;  4TV3 A;  2WQ6 A;  1ZU2 A;  3MA5 A;  1UJJ A;  2KAT A;  4P29 A;  3LKU A;  4GYY A;  3AS8 A;  3S7J A;  4XKB A;  3SNX A;  1BPO A;  1ELR A;  4U0S A;  2PQN A;  4AEZ C;  4ANU A;  3VLF A;  4AIF A;  1HF8 A;  4APF A;  3FTW A;  2LO6 A;  3I4R B;  3FTV A;  4N39 A;  2YHC A;  3WXX A;  5BT1 A;  1OWM A;  4U8H A;  3ZYQ A;  1U3D A;  5ANL A;  4WAF A;  3MZL B;  3PUJ A;  2MRI A;  2YQ8 A;  4HVB A;  1E8Z A;  3T8M A;  1IYG A;  1TJC A;  3HYM B;  3QKY A;  5EDS A;  1QQE A;  5BV0 A;  4JL0 A;  3ASH A;  3CR3 A;  3T5X A;  2V5F A;  1PAQ A;  2PQR A;  1E8W A;  3OXL A;  3D9P A;  3GZ2 A;  4ANV A;  4D10 C;  1DVP A;  1HE8 A;  3RO3 A;  3KD7 A;  5BV1 A;  4EZK A;  3VTX A;  3G2W A;  3UT8 A;  4H7X A;  1H2V C;  4I2W A;  1HX8 A;  2EQX A;  3Q47 B;  4N3C A;  1UJK A;  1N52 A;  2HO1 A;  3RO2 A;  4EBA G;  2R59 A;  5E75 A;  5EKQ D;  3G2U A;  3MV2 B;  3ZW3 A;  4XI0 A;  2UWJ G;  3PEU B;  4KVM A;  4URK A;  3VLD A;  4N2S A;  2CHX A;  2CHW A;  3NF1 A;  3ONL A;  3APD A;  4A1S A;  4B8A A;  2YNQ A;  3TG4 A;  1EPU A;  2AW6 A;  3EHM A;  4GAA A;  3RJV A;  5CCM A;  3JQ0 A;  3UT7 A;  4JZY A;  4H7Y A;  2YIN A;  2PZI A;  4CGW A;  3ZEF A;  4QFV A;  2C0L A;  3D9M A;  3L54 A;  3N71 A;  2UY1 B;  4HS2 A;  1VDY A;  3D9L A;  1L5J A;  4IN3 B;  4LRZ A;  2WXO A;  2C0M A;  3TGO A;  5AIJ A;  5C2Y A;  4L2L A;  3CHO A;  4N3B A;  2CG3 A;  3CVL A;  3NZU A;  2XRY A;  4Q96 A;  5HQ8 A;  4JW1 A;  2OOE A;  4PS8 A;  3CKC A;  2WXF A;  1HG2 A;  2J4D A;  2FUL A;  5FZR A;  1Y8M A;  3PS6 A;  3URZ A;  2QFC A;  2IQC A;  3AS5 A;  5FJY A;  5LOZ A;  4RSY A;  3LEW A;  5D0Q D;  3QWP A;  4MRU A;  4G25 A;  4LCT A;  4LER A;  4UI9 C;  2CHZ A;  3ONK A;  5A23 A;  3ZHE A;  4AXH A;  2A5U A;  1PY1 A;  1S0P A;  3CHM A;  4YND A;  4ACK A;  2XPZ A;  2ZU6 B;  5KJM A;  3LVQ E;  3C98 A;  2J07 A;  3PE4 A;  3S7B A;  3DBS A;  3QDN A;  3LY8 A;  4UI9 J;  3O48 A;  3OAW A;  2XRZ A;  4FA6 A;  4GMJ A;  3FTU A;  3SF4 A;  4BX8 A;  4HOQ A;  2KM4 A;  2I6H A;  5LX8 A;  3ZHE B;  5CCL A;  2WXI A;  4N3A A;  3G2T A;  4IRU A;  4GZ3 A;  5LFA A;  1P5Q A;  4C9B B;  2VSN A;  2WXN A;  2GW1 A;  3TG5 A;  5FT9 A;  3EDT B;  2CFU A;  4AV7 A;  4KXK B;  3UUX A;  3LY7 A;  4GPK A;  2J08 A;  2L0T B;  2WXP A;  4JEH A;  4GCO A;  4ILI A;  5AYW D;  4EQF A;  1KLX A;  1HO8 A;  4GYW A;  4UWG A;  2XQ0 A;  3MEK A;  4FHJ A;  4JC8 A;  3ZVV A;  4XX5 A;  1H2T C;  4GU5 A;  3PZD A;  4JXT A;  4XI9 A;  3VTY A;  3QOU A;  4AM9 A;  3CVQ A;  5A6C A;  4BWR A;  1SZA A;  4APO A;  3SBT B;  4B8C B;  3UX4 A;  3GW4 A;  3Q4A B;  4HOR A;  3PNL B;  3IKO B;  3Q5M A;  3FH5 A;  3PDN A;  3FUM A;  2J9Q A;  2PL2 A;  3ML8 A;  4PS3 A;  5AJL A;  1INZ A;  2VTB B;  3CHP A;  3FY4 A;  4A3T A;  1Z3X A;  3IHV A;  5EX3 A;  2BUG A;  3VLE A;  3S2A A;  4BSX A;  3CQG B;  4ABN A;  3NZS A;  3ZYL A;  1WY6 A;  3RKV A;  4I1M A;  3FTX A;  3P1U A;  1QZ2 A;  2WXL A;  4Y6W A;  3EIQ C;  5G04 C;  2OV8 A;  2R5S A;  3D9N A;  2OVF A;  3SGH A;  2BTD A;  2WXJ A;  3K9I A;  3MKQ B;  4J8F A;  5FZS A;  2DCP A;  4E6H A;  4I6G A;  3FUN A;  3ZFW A;  1OWN A;  2WVI A;  4MKT A;  4TRQ A;  3JQ1 A;  3BG0 B;  1IQR A;  1UW4 B;  2DIW A;  4WUY A;  5G04 J;  3FHE A;  4BFR A;  2WQH A;  4I6J A;  4EZL A;  5T4Y A;  4MLP A;  2FBN A;  4RVB A;  2CFZ A;  1HG5 A;  3B13 A;  2LNI A;  3B7U X;  3MYV A;  3CVN A;  4O6F A;  4ANW A;  2AWI A;  4KMO A;  1E8X A;  1W3B A;  1LF8 A;  1DNP A;  3PRE A;  4G24 A;  1OWP A;  4AY5 A;  2UY1 A;  3ASD A;  3FUH A;  3G2V A;  3SFZ A;  5ANR A;  5G2N A;  1JWG A;  4R7L A;  4KBQ A;  4A3V A;  2VGX A;  3CLJ A;  3LY9 A;  2FEZ A;  2VJ8 A;  2L0I A;  4GZD A;  5JHA A;  2XGM A;  3G2S A;  5JJ6 A;  3R7R A;  3TAX A;  2XPY A;  3R9A B;  3L17 A;  5FQ8 A;  3NQP A;  4FJZ A;  1KT0 A;  3CVX A;  3B7S A;  4OVV A;  1E96 B;  4CRW A;  2VSO E;  4JVS A;  3PEV B;  2X38 A;  4Q69 A;  1OUV A;  5LCW J;  5KJK A;  2WXK A;  3CKB A;  3ENE A;  2VYI A;  2JLB A;  1A17 A;  2X3M A;  2NC9 A;  3CIA A;  3LS8 A;  5JJT A;  2VGX B;  4YVO A;  4BTA A;  4FAD A;  3D9O A;  3APF A;  1WM5 A;  4EPZ A;  5FQ7 A;  3CST A;  4KT6 B;  2LAH A;  4A1G A;  3FFL A;  2X6J A;  2XGO A;  3FP3 A;  4FU3 A;  4GZ6 A;  1FCH A;  1EF1 C;  1XGW A;  2LSU A;  4CT0 A;  4AOF A;  3HDX A;  2KCV A;  1TJF A;  3JUI A;  2L6J A;  2CG2 A;  3FUL A;  1E90 A;  4GA0 A;  3R7Q A;  3ULQ A;  3D9J A;  3ESL A;  4F53 A;  1B89 A;  2L9B A;  4I17 A;  3FUD A;  4YVQ C;  3FTZ A;  5BPP A;  3QC1 A;  4NQ0 A;  2V8S E;  3S7F A;  4XKC A;  3Q49 B;  4U63 A;  4BT9 A;  3D9K A;  3SHF A;  2VSY A;  2ION A;  2LSV A;  3CHR A;  2KCL A;  3PNT B;  3EIJ A;  4EEC A;  5D0O D;  2KC7 A;  3EHN A;  4PS7 A;  3FH8 A;  2WMO A;  3GZ1 A;  2P58 C;  4WNF A;  3ASG A;  3LJ3 A;  4UI9 K;  4CDR A;  5T8I A;  4GB9 A;  4U0Z A;  4CCA A;  3U64 A;  3CVP A;  4BX9 A;  4U07 A;  2I1K A;  3I3N A;  3MGB A;  4JHR A;  4U04 A;  3T5V A;  5FQ4 A;  3UMV A;  5E76 A;  3B7R L;  1FVH A;  3ZXS A;  3FU0 A;  3CK7 A;  4AVX A;  2VQ2 A;  5ARG A;  4GZC A;  4L1B A;  1SQM A;  4UWH A;  2GRL A;  5G55 A;  4CDM A;  2OND A;  4KYO B;  4CGV A;  5J08 A;  3CQC B;  2FI7 A;  3LXU X;  5BW8 C;  3FDH A;  2PM6 A;  4V3I A;  4CDN A;  3QK0 A;  1JUQ A;  2VTB A;  1NZN A;  3SZ7 A;  1X5B A;  3FUE A;  5JJ7 A;  1NP7 A;  3D9I A;  3CVV A;  1JWF A;  4FHK A;  4KVO A;  4L7T A;  2WQ7 A;  4DLQ A;  1Z3Y A;  3SBS A;  2C2L A;  3CV0 A;  5FZQ A;  4FP7 A;  3MJW A;  2J4B A;  2X6K A;  3TXM A;  4CEM A;  1NA3 A;  4AJW A;  4DJA A;  1H19 A;  4F1S A;  1EYH A;  4G1T A;  3HVE B;  4AP2 A;  2WXH A;  4G2V A;  3MKQ A;  3MCX A;  2XHE A;  1GW6 A;  4I1O B;  4XE0 A;  3FUI A;  3RRU A;  4MS6 A;  1FVF A;  2I9C A;  2A4Z A;  2AVP A;  3B7T A;  4ILG A;  2GRM A;  1E8Y A;  3E4B A;  1IHG A;  3PUK A;  1PC2 A;  2WXG A;  3TL5 A;  4DLO A;  4UWK A;  5JHB A;  2LAI A;  5FQ6 A;  5ARF A;  3LYA A;  2NXP A;  4C0E A;  2KZT B;  3RRM B;  1E7U A;  4FLH A;  5CMW A;  2WPV A;  5FTP A;  5M72 A;  3U3W A;  1U3C A;  3S7D A;  4U0U A;  3CVY A;  3FTY A;  1KT1 A;  4WWN A;  1HS6 A;  3JYS A;  4JPS A;  2XCC A;  2AXV A;  2DBA A;  4JHK A;  4NAC A;  3ZYM A;  4B0Z A;  2GGF A;  4N5C A;  3PE3 A;  2J09 A;  3RRN B;  3LCA A;  2JEK A;  2Y3A A;  4LUN U;  2I1J A;  2V0P A;  3PH0 C;  4WNE A;  4UQX A;  4N2Q A;  2IJG X;  4CT4 A;  1WAO 1;  2R17 C;  5CMY A;  3HHM A;  4F3V A;  2I2O A;  3CEQ A;  3OXG A;  3AU4 A;  3ML9 A;  4PDX A;  4ATG A;  3TJP A;  3QAQ A;  4OVU A;  3UPV A;  4IUL A;  1UG3 A;  2RD0 A;  3TXN A;  3PRZ A;  2XGS A;  3EJN A;  4Q94 A;  2IOL A;  5LCW C;  1MHQ A;  3IBE A;  3KS2 A;  2XEV A;  3CSF A;  3BEE A;  5DBK A;  4G23 A;  5AJD A;  4XIF A;  3RU0 A;  3ZYK A;  2IOS A;  3D3M A;  1IQU A;  4JA7 A;  5A7D B;  2RG8 A;  3SD5 A;  2IU1 A;  2XCB A;  5EX0 A;  4HFG A;  2HYZ A;  3ZRH A;  2HR2 A;  3ZPJ A;  2VGY A;  3U9W A;  2QY7 A;  3QWV A;  2WXQ A;  4J8D A;  1YA0 A;  2E2E A;  2Y4T A;  3I5P A;  4IYP A;  3GYZ A;  5CHE E;  3BG1 B;  2AXZ A;  3FH7 A;  1EDU A;  3KAE A;  4M3O A;  4C0M A;  3SI5 A;  4BTB A;  1UN8 A;  5AEN A;  1H2U A;  2IF4 A;  4ME2 A;  4JEU A;  5C1D A;  1NA0 A;  4DI4 A;  2KCK A;  2J49 A;  2Q7F A;  4I6E A;  3CVW A;  2FO7 A;  2BF0 X;  4J8S A;  3FTS A;  4FJY A;  4WND A;  5BNW A;  4NRH B;  3U4T A;  4BY6 A;  4FUL A;  2NSZ A;  1H0A A;  2X6H A;  3ASF A;  4E85 A;  3FUF A;  3ZIM A;  3FU5 A;  2MOW A;  1ZBP A;  4RG6 A;  4JA9 A;  3CK9 A;  1E7V A;  4GYO A;  2ILR A;  3FUJ A;  2PM7 A;  3APC A;  3IHY A;  3AS4 A;  3CK8 A;  4FC8 A;  4FLB A;  3QJZ A;  4NUR A;  4F7A A;  2YHE A;  3ZN3 A;  3CVU A;  4XZ4 A;  1H6K A;  4I2Z A;  4UQZ A;  4I9E A;  2VSX E;  4JHJ A;  2WXR A;  2X6I A;  1XNF A;  4DPR A;  4J8E A;  2WM9 A;  4HOS A;  2IFU A;  3DPD A;  2FF4 A;  3FU3 A;  3FU6 A;  1HU3 A;  4GZ5 A;  3L22 A;  4UWF A;  5FWQ A;  4WWP A;  5HI7 A;  3CGH A;  3RIB A;  4G26 A;  1Z6T A;  4UQY A;  3OXF A;  4KZ0 A;  3RK6 A;  1MQS A;  4J0U A;  3LDZ A;  2HM8 A;  3QB2 A;  1N54 A;  3ESK A;  4G11 A;  4DI3 A;  2AXU A;  4L2Y A;  4L23 A;  4GML A;  3ZGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...