4HS2A

Crystal structure of the human spop c-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
64
structure length
64
Chain Sequence
NLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Speckle-type POZ protein
publication title Structural basis of high-order oligomerization of the cullin-3 adaptor SPOP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 23
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2012-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4hs2A00
4AP2A 3I3NA 4HXIA 4APFA 2EQXA 3HVEA 3HVEB 4HS2A
chains in the Genus database with same CATH superfamily
3X2QE 3FUDA 4B89A 3OXFA 3KSQA 5HI7A 2PM7A 4R7LA 4AEZC 1OWLA 3FH7A 5ENTD 3EIJA 3ABLE 3JYSA 3LJ3A 2IF4A 4J0UA 4P29A 3IKOB 2V8SE 4DRXE 1HF8A 3FY4A 1MX6A 4U0UA 3CVUA 4UWGA 1N0QA 3S7BA 5FINA 4I6GA 3E30A 1N94A 5AJLA 3FFLA 2DIWA 4GTTA 5A6CA 3D9JA 3G2UA 3OXGA 1MX4A 2IFUA 2VGYA 4L1BA 4UWHA 3QJZA 3S7DA 4U8YD 3UI2A 2EIJE 5CRVA 3Q5MA 1N52A 2WQHA 4YDWA 2J08A 2NC9A 3SBSA 3AG1E 4BY6A 3EU9A 4N5CA 3ASOE 5G05J 3L9TA 4LUNU 1MQSA 4G1TA 4JL0A 4I43A 3O48A 4WWPA 2DBAA 3HYMB 3C3OA 4GZ6A 1TN7A 2UY1B 1BU9A 3HG0D 4IN3B 2V5FA 3ASHA 5FQ7A 5EIDA 2HO1A 3B7UX 3ZYQA 3ABME 5ENQD 1RW2A 4FLHA 2YINA 4ATGA 2F0YA 4AY5A 5FIOA 1AP7A 4EZJA 2J07A 2R17C 5CMYA 2GRPB 1OY3D 3EHMA 4KBQA 2IOLA 5EKQD 4FP7A 4U8HA 4GZCA 2UY1A 2GW1A 3PRZA 4GZ5A 3PDNA 3VLFA 5AARA 2ZGGA 3C3RA 2V4LA 3PEUB 5FWQA 1H6PA 2IO3C 1TNOA 3CR3A 2H6FA 1QNFA 5BXUA 3FDHA 3ZIMA 1K1AA 4GTOA 3E34A 3EDTB 2WXGA 4GTVA 2HR2A 5LX8A 2CFUA 5AQ9A 5J90A 3FUIA 3D9NA 1O1SA 2B0OE 3Q73A 2J4DA 3PZ1A 4CYMD 1O1RA 2Y4TA 2V0PA 3UMVA 2X6HA 4WAFA 3U64A 1N95A 2OVBA 3B7TA 1B89A 3V2XA 2AWIA 4GA1A 2WXHA 4XI0A 4URKA 4G2VA 4L2YA 1MX2A 5JA4D 2VSXE 1E8ZA 5D0QD 2XS1A 1TYQG 4EZKA 2OV8A 3ENEA 4HORA 3KD7A 3UT7A 4TXQA 1L5JA 3RIBA 4HVBA 4ATZD 2R5SA 4J6IA 5KNHD 1RZ4A 3RU0A 4JW1A 5JHAA 2FF4A 4YDEA 5BT1A 3CVQA 3TXMA 1N11A 4DX1A 1JPLA 2OCCE 3ULYA 4U7EB 2F8YA 2B6CA 3KSLA 2XGSA 4JHJA 1TN6A 1HH8A 1OWOA 1SZAA 5FTPA 2F8XK 1SZ9A 4KZCA 4N2SA 4B94A 4HOSA 3QDNA 1UG3A 3CHSA 4N2QA 3I4RB 3FTZA 4K5AB 2I9CA 1FT1A 4KT6B 1U2VG 5EX0A 2XCBA 4ILGA 2MOWA 3ULQA 1SW6A 3TWRA 3UPVA 4MKTA 3P1UA 3T9KA 3W9FA 3RO2A 2R05A 3DSVA 3D9IA 3HXBA 4DX5D 3F6QA 5HQ8A 3MJWA 4ACLA 1HXIA 5LCWC 4U04A 1TJCA 1D9SA 2PNNA 4FULA 4GYYA 1ELRA 4LNBA 3LXUX 3UM0A 1S0PA 2WXRA 4I1MA 4HI9A 4JEUA 2PL2A 2Y4UA 4DI4A 3LKUA 5FZSA 5FQ8A 4U0SA 1DVPA 3UM1A 4O60A 3SHFA 4BFRA 2A5EA 1H6KA 4ME2A 4CT0A 3FTUA 4RSYA 1K3ZD 3TWWA 5G55A 1E7VA 2PQRA 4WWNA 2FO7A 4UI9J 3NQPA 3JQ1A 5HS0A 4K0RA 5T4YA 2VTBB 2JEKA 4BSXA 5AQAA 3FULA 3UXGA 3LVQE 2VGEA 4BSZB 1UOHA 4HS2A 3QB2A 4BT9A 2F37A 4LRZA 1ELKA 2CG3A 4GYOA 4RG6A 3CHOA 3HHMA 1FT2A 4BWRA 4OAUC 1K8KG 5B3SE 4Z68A 3SFZA 4FJYA 3C3QA 4G25A 1X81A 3CVLA 5HRYA 1SVXA 3W9GA 3NB2A 4GA2A 1E8XA 3MA5A 2Q7FA 1INZA 2XQ0A 1KZPA 2VTBA 4HI8A 5CBOA 2AVPA 5KCMA 2I6HA 3CHRA 3GZSA 5EX3A 3L6AA 1UW4B 1N9AA 2XGMA 2LUHA 5ENSD 5JJTA 4U95D 3R9AB 2V4HC 3EU5A 2XEHA 1ZU2A 5JJ6A 2ETBA 3GZ1A 4UWKA 2WXLA 3N71A 2GRMA 3TWVA 3LY7A 1HFAA 4F1SA 5AENA 2X6FA 4GB9A 3KS2A 2IO2C 3EJNA 1A5EA 4LSZE 3ZYMA 4M7CA 2CHZA 4EZLA 2FI7A 4XIFA 3LY9A 3C5RA 3MZLB 5CHEE 3JCKC 3PE4A 3TWTA 1OCRE 2X6JA 3IBEA 2YNQA 3ESLA 3ML8A 3R7QA 3C72A 3FWVA 4JEHA 4GZDA 3C98A 5FT9A 2ETAA 3CGHA 4U63A 5H7PA 4O1PA 1NFIE 4Y6WA 4TXRA 3BEEA 3MX3A 5LFAA 3I4GA 3KAEA 1V55E 1TNZA 3SGHA 3FUMA 3T5XA 5G04C 3HXDA 2L9BA 2LXMA 3CQGB 2Y3AA 3UM2A 1TR4A 1OUVA 4FC8A 3VLEA 1DNPA 3PZ4A 5CBNA 5AQ7A 5ENRD 3DBSA 3D9KA 2QZAA 1FPPA 1LD7A 4A1SA 3QKYA 4MRUA 2CHWA 1LF8A 5KJKA 3Q47B 1Q2ZA 1DC2A 3HVEB 1N4RA 1OWNA 5CMWA 2OVFA 4GAAA 1H2VC 3MV3B 3LEWA 3ZPJA 3DSUA 3BQOA 2P9NG 2I2OA 4AP2A 4CDMA 2GROB 2BF0X 3NZSA 4FHJA 3QARA 4DI3A 2H6IA 1JCSA 2AXVA 4XKBA 3GZ2A 3SI5A 2LSUA 3D9HA 1DCEA 2Y1LE 4YVOA 3J5PA 4AV7A 4ANUA 1TNUA 3SNXA 3AG2E 2J8SD 5JMND 3FH5A 3UIOC 2H6HA 1JWFA 3ASNE 3HVEA 4B8AA 3PE3A 4GCOA 3VTYA 4I1OB 1EF1C 2XPIA 3ML9A 4GTQA 2KM4A 2KCVA 2DWZA 3BG0B 3JXJA 4U8VD 4HOUA 1WM5A 4BTBA 3CSFA 2J4BA 4CCAA 3G2WA 4U96D 3UQ3A 3RAUA 4A63B 4HRMB 3MYVA 2GRRB 3PVLA 2I1KA 3B7BA 5B1AE 5DIZA 3RKVA 1H2TC 5KJLA 1XNFA 4DX6D 3VTXA 3Q78A 3CK8A 5A7DB 2KC7A 2KCKA 2IY0C 4J8EA 1DCQA 2WVIA 2A5UA 2MHKA 3CHPA 3V2OA 3ZKJA 4UQYA 1O1TA 4IRUA 3UT8A 5C1DA 4JD2G 4L2LA 1TNBA 1S70B 4NURA 3EHRA 3SZ7A 4ACKA 1A17A 3D9MA 4K03A 4UWFA 1N4SA 1P5QA 1KT0A 5G05C 1HS6A 1GW6A 2HYZA 5ENPD 2L0TB 3UKUG 5CECB 4CDRA 4DLQA 2VSYA 1Y8MA 2ZGDA 3JXIA 4G8LA 5JHBA 3S7JA 3QOUA 4YDYA 1E8YA 4HB5A 5FQ4A 4QQIA 2J9QA 2WXQA 3UM3A 3HXCA 3B7SA 3TG4A 5D66A 5CERB 1FVHA 2WXFA 2OOEA 3PNLB 4F53A 1JCRA 1HO8A 2V5QC 3L17A 5DBKA 2OEVA 2ZXWE 3PUJA 5EIBE 1NI1A 2Y69E 3TGOA 2GRNB 5ENNA 1WG0A 1KT1A 4N5QA 3EUVA 4H7YA 3TL5A 5AQBA 5J08A 4JHKA 3IXEA 2NYJA 4G23A 5BPPA 4HNAD 1HG5A 2ETCA 2E0IA 4UI9K 4Q96A 4KVMA 3MKQA 1LTXA 1MHQA 1MZCA 3BU8A 5LCWJ 1K1BA 3CK7A 4EPZA 2DYSE 3Q9UC 2FULA 3Q79A 3FTVA 2RKKA 4KMOA 4FLBA 4LCTA 2WQ6A 4ABNA 3R7RA 3LY8A 5KJNA 2BTDA 3DPYA 4MBGA 3HIZA 3ZVVA 1NL4A 3AAAC 2J09A 3QWPA 2XZDG 4BERA 3TXNA 1U3CA 3I3NA 4X8QA 3PZ2A 1SQMA 3DEOA 2VGXB 3JQ0A 5AAOA 2WXMA 1NA0A 3DWLG 4JA9A 1OCCE 2P2CP 4G8KA 4FA6A 2P58C 3FEXA 4HXIA 3I5PA 3L13A 3BUAA 4DLOA 5BNWA 2OEWA 2P9KG 4E85A 4JA7A 3UTMA 3L82A 5FQ6A 5EYPF 4L9PA 3JUEA 3ZXPA 1O5MA 3LVRE 2XZTG 4OVUA 3FTSA 1QQEA 3HXFA 3SD5A 5BUZA 4GZ3A 4F7AA 4IULA 3ESKA 3D9LA 2R02A 4LNUD 4L7TA 4QFVA 2PZIA 1V54E 2VGXA 4TV3A 3CVNA 3D9OA 1N54A 3Q7AA 4ZHBA 2DCPA 4KVOA 4JZYA 2VSNA 2VJ8A 1H19A 1ELWA 4RLYA 1NP7A 3FTWA 1Z6TA 1WAO1 1SA5A 2LNIA 5BV1A 4ANWA 1H0AA 3APCA 5ANRA 1AWCB 4HOQA 2UWJG 4PH4B 3T8MA 1HE8A 4RG9A 1EDUA 2XEVA 5IY5E 3V79K 4D10C 5ITZF 3AS4A 2R2LA 3DXKG 3UX4A 4OVVA 2YHEA 5E76A 4HRLA 3RSEG 5CEAA 3FTXA 2WB2A 1JWGA 1E7UA 4EECA 2XPZA 2IJGX 3ZU7B 3APFA 5D0OD 4J8YA 2YHCA 2WXOA 1SA4A 3ZUVB 3IV0A 3G2VA 3ZXSA 5ENOD 3JUIA 4AVXA 3T5VA 3URZA 1HX8A 5G2NA 3OAWA 1TEZA 2P9IG 3Q4AB 3FUJA 3RRUA 4B0ZA 3ULEG 1ZBPA 4FHKA 1W3BA 3QWVA 1H2UA 4XE0A 4I9EA 1PAQA 3DSXA 4UI9C 2KZTB 1OWPA 3B13A 5E75A 2XENA 3TJPA 4BX8A 1YA0A 3IHVA 4EBAG 5FZRA 4TRQA 3Q15A 3ONKA 4MS6A 1Y6IA 3CKBA 2BKKB 3FP3A 3CLJA 4Q94A 1N4PA 3PS6A 2WPVA 2AW6A 4CGWA 4F6RD 1BI7B 3E33A 1Z5SC 2RFAA 3AJIA 4OYSA 2KZTA 4U07A 4HQDA 4DX2A 2NSZA 4Y6CA 1IQUA 3RRNB 2LAIA 3OXLA 2KXPC 3ZNGA 1Z3YA 4GCNA 2MRIA 5AIJA 3CSTA 3IEGA 3LDZA 4XEIG 3QNKA 1FVFA 1EYHA 3PH0C 1U3DA 3TWSA 2KATA 4NACA 2EIME 4CT4A 1JUQA 4BX9A 1PY1A 4RVBA 1OT8A 3SF4A 4UQZA 4XKCA 2LSVA 3CVWA 3ZHEB 5FZQA 1E96B 3DSSA 3DPDA 4APFA 4IYPA 3PNTB 3S2AA 2VQ2A 2GRLA 4FADA 3ASGA 3NOGD 3ZW3A 1NZNA 1Z3XA 4CGVA 4M3OA 1IHGA 4AIFA 2WMNA 4PS3A 2C0LA 3EHQA 4I2ZA 3NZUA 5ANLA 4GA0A 4ILIA 4U0ZA 3ZHEA 4GMRA 1HZ4A 1UN9A 4WUYA 4AJWA 4K5BA 4ILHB 3V30A 2EILE 3AU4A 3FU5A 4DUIA 1D8DA 3ZYLA 1IHBA 3AU5A 3J5QB 4BETA 3LS8A 4JHRA 2P9PG 1OCOE 4BESA 4UWLA 2MYOA 3U66A 3IHYA 5JJ7A 4GMLA 3UIPC 4G24A 2P9UG 3FUHA 1N0RA 1XGWA 3CVXA 4J8DA 3ZRHA 3PEVB 5A23A 2BUGA 1E8WA 3ASFA 2JLBA 2L6BA 5BW8C 4J8FA 4WNDA 2HM8A 1WDYA 4PDXA 3FU6A 3QK0A 5CRUA 1N4QA 1TN8A 4N39A 2KBXA 2HE0A 3U3WA 3HXEA 2LAHA 3GW4A 1EPUA 2XS8A 3S7FA 4RQIA 4UQXA 4JC8A 4YVQC 2ILRA 1HU3A 5LOZA 3QWWA 3PZ3A 1PC2A 2EINE 4J7WA 4AY6A 2P9SG 3FH8A 3CHQA 4CDNA 1BD8A 2ZIRA 3DRAA 3ZN3A 2I1JA 4HLLA 2LO6A 3DEPA 3G2TA 3FTYA 3B95A 3TG5A 2WQ7A 4AXHA 3QC1A 3U9WA 5BXOA 2RFMA 2WXNA 4HFGA 4I6EA 3PZDA 4EBAA 4FU3A 4WNGA 4G11A 4L23A 2M63A 3D3MA 1MYOA 3AS8A 4E6HA 3ZGQA 3MGBA 5CEDB 2FBNA 1BI8B 4KZ0A 3ABKE 3EHNA 4LG6A 1KPSB 4B93B 3QAQA 3WXXA 4I9CA 4GPMA 4PUCA 2NXPA 2DVWA 4HRNA 5HKPA 4YDOA 5LP0A 2R59A 2X6IA 4N3CA 1QZ2A 4GYWA 4GTMA 2ONDA 3Q7FA 1KZOA 3LPZA 4GTSA 1UN8A 3MKQB 2X3MA 3B7RL 1JCQA 3NOCD 1IYGA 3SFXA 3TWUA 1X5BA 2XGOA 2QY7A 4FJZA 3T8KA 4AOFA 4BTAA 3UINC 2EIKE 2XCCA 3NAWA 4CEMA 2CG2A 2ZISA 2A4ZA 3Q49B 4I17A 3PREA 3HDXA 4J8SA 4DX7D 2XHEA 1YMPA 3D9PA 2RD0A 3GYZA 2WMOA 3AG3E 3RO3A 4JB8P 3G2SA 3DSWA 4KXKB 1UJJA 5B1BE 3APDA 1UJKA 3FUNA 4CRWA 2WXJA 4V3IA 3Q9NC 1QBQA 1TNYA 1YCSB 3ZYKA 4PS8A 4WNFA 2VSOE 2XPYA 3PUKA 3CK9A 4A3VA 4H7XA 4TUMA 1BLXB 2AXUA 4UUCA 2QFCA 3CHMA 5EN5D 1OCZE 5ARGA 3L22A 5KBAA 2IONA 3RK6A 3AS5A 4O6FA 3TWXA 2DZNA 4AM9A 3DSTA 3L16A 5KJMA 1OXJA 4BEPA 3L54A 2DZOA 2WXPA 2JABA 4ANXA 3ZFWA 3NBNB 2WM9A 4A3TA 2KCLA 5AN8A 5BV0A 4GU5A 2BKGA 3LYAA 4N3BA 2CHXA 2P9LG 4GPKA 2GRQB 2QYUA 3WG7E 2FEZA 5KWDA 3CQCB 3CV0A 4DJAA 3MCXA 4HOTA 2VYIA 3RRMB 1FCHA 4I1AA 3V31A 3R9MA 4HBDA 4XX5A 2BEDA 3NF1A 4MLPA 2WXIA 4LNGA 1VDYA 2J49A 3TWQA 4N3AA 2R03A 4B8CB 4Q69A 3O4ZA 3MV2B 3BG1B 1NA3A 5KNGA 5AYWD 3CVYA 3LCAA 4GTPA 4LEUA 2IOSA 4WNEA 3DXMG 2DYRE 2XEEA 1E90A 4CZ2D 2X38A 5CCLA 5CCMA 3L08A 3U4TA 4NRHB 4O1OA 3E4BA 4YNDA 3OTNA 5EILA 5C2YA 3ISMC 1ZB1A 3Q75A 4JPSA 2LXLA 3FUKA 2AXZA 1D8EA 1TJFA 2FO1E 5ARFA 1S63A 4EQFA 3KEZA 4I6JA 3CVPA 4G26A 4APOA 4DK5A 5T3RA 2E2EA 3AG4E 3EIQC 2C0MA 2X6KA 3CKCA 2C2LA 2L0IA 2AJAA 4C0EA 5EYLA 3SO8A 3KEAA 1IXVA 3CEQA 3CVVA 1QYMA 2QC9A 3E37A 4XZ4A 4HLEA 4ANVA 4TXPA 4C9BB 3UKRG 4I2WA 3SBTB 5D2MC 5EDSA 3ZEFA 1MJ0A 3ONLA 2PM6A 2WXKA 4ZFHA 4XI9A 1G3NB 3UUXA 2IEJA 3MKRA 4C0MA 4A55A 1WY6A 2H6GA 1KLXA 2RG8A 2XRYA 2CFZA 5G04J 4F1PA 2IQCA 4A1GA 2QYJA 4C48B 1IKND 5M72A 2GGFA 5AJDA 4BT8A 3ASDA 1H6OA 3FUFA 3FHEA 3P2BA 3LJNA 3UT4A 3SFYA 5FJYA 2PQNA 4WWOA 3FU3A 4F3VA 3E32A 1OWMA 1S64A 3CIAA 5T8IA 3SY2A 2XRZA 4W9RA 2YQ8A 3SQVA 3MEKA 4JVSA 4K5CA 1YYHA 4EHMA 4OAVB 4LERA 4NIKA 4KYOB 2EQXA 3HRAA 3K9IA 1BPOA 3FEYA 2IU1A 4TUUA 4PS7A 3TAXA 2Y0BG 3FUEA 4GTRA 1HG2A 1LD8A 2ZU6B 4JXTA 4DPRA 3VLDA 3FU0A 4NQ0A 3RJVA 4GMJA 2L6JA 1IQRA
chains in the Genus database with same CATH topology
3CVLA 4KMOA 4FLBA 3FUDA 4LCTA 4B89A 2WQ6A 3OXFA 4ABNA 3R7RA 3ZN3A 2I1JA 5HI7A 3LY8A 2PM7A 4GA2A 1E8XA 5KJNA 2BTDA 2LO6A 4R7LA 3MA5A 3HIZA 3ZVVA 2Q7FA 1INZA 4AEZC 1OWLA 3G2TA 2XQ0A 3FTYA 2J09A 3TG5A 3FH7A 3QWPA 3TXNA 2WQ7A 2VTBA 4AXHA 3EIJA 1U3CA 3JYSA 3QC1A 3U9WA 3LJ3A 3I3NA 2IF4A 4J0UA 1SQMA 2WXNA 2VGXB 4HFGA 4P29A 4I6EA 3PZDA 4EBAA 3JQ0A 3IKOB 2WXMA 4FU3A 2V8SE 1NA0A 4WNGA 2AVPA 4G11A 4L23A 4JA9A 5KCMA 2M63A 2I6HA 3D3MA 3AS8A 4E6HA 4FA6A 3ZGQA 2P58C 3MGBA 3CHRA 2FBNA 3FEXA 1HF8A 3GZSA 4KZ0A 5EX3A 3EHNA 3FY4A 3L6AA 4HXIA 1UW4B 3I5PA 2XGMA 3L13A 4U0UA 4DLOA 5BNWA 3CVUA 4E85A 4UWGA 4JA7A 5JJTA 5FQ6A 3QAQA 3WXXA 3S7BA 3R9AB 4I9CA 4PUCA 2NXPA 3LVRE 1ZU2A 4I6GA 4OVUA 3GZ1A 5JJ6A 4UWKA 3FTSA 1QQEA 2WXLA 3SD5A 5BUZA 5AJLA 3FFLA 4GZ3A 5LP0A 4F7AA 3N71A 2GRMA 2DIWA 2R59A 2X6IA 3LY7A 4IULA 1HFAA 3ESKA 3D9LA 5A6CA 4F1SA 5AENA 3D9JA 2X6FA 1QZ2A 4N3CA 3G2UA 4GYWA 3OXGA 4L7TA 2IFUA 2VGYA 4L1BA 4GB9A 4QFVA 4UWHA 2ONDA 2PZIA 3QJZA 3KS2A 2VGXA 3EJNA 3LPZA 1UN8A 4TV3A 3CVNA 3D9OA 3MKQB 2CHZA 3S7DA 3ZYMA 4EZLA 1N54A 2FI7A 4XIFA 2X3MA 3B7RL 3LY9A 3Q5MA 1N52A 3MZLB 1IYGA 2DCPA 4KVOA 4JZYA 2VSNA 2VJ8A 1X5BA 2WQHA 5CHEE 1H19A 3JCKC 2J08A 2QY7A 2XGOA 4FJZA 2NC9A 3PE4A 1ELWA 3SBSA 4AOFA 4BTAA 4BY6A 1NP7A 3FTWA 1Z6TA 4N5CA 5G05J 1WAO1 2X6JA 3IBEA 2YNQA 3ESLA 3ML8A 2LNIA 3R7QA 5BV1A 4LUNU 3FWVA 1MQSA 4JEHA 4ANWA 4G1TA 2XCCA 4GZDA 1H0AA 4CEMA 3C98A 3APCA 4I43A 4JL0A 5FT9A 2CG2A 5ANRA 3O48A 3CGHA 4HOQA 2A4ZA 2UWJG 4U63A 3Q49B 4PH4B 4WWPA 3T8MA 4I17A 1HE8A 2DBAA 3HYMB 3PREA 1EDUA 4RG9A 3HDXA 2XEVA 4J8SA 4GZ6A 2XHEA 3D9PA 2RD0A 3GYZA 4Y6WA 2WMOA 4D10C 2UY1B 3RO3A 3G2SA 3BEEA 4IN3B 3MX3A 2V5FA 3ASHA 4KXKB 1UJJA 5FQ7A 3APDA 5LFAA 1UJKA 3AS4A 3FUNA 3I4GA 2HO1A 3B7UX 3KAEA 3ZYQA 4CRWA 2WXJA 4V3IA 3UX4A 4FLHA 4OVVA 2YHEA 3SGHA 3FUMA 3T5XA 5E76A 5G04C 2YINA 2L9BA 3ZYKA 3CQGB 2Y3AA 4PS8A 4WNFA 4ATGA 2VSOE 3FTXA 2XPYA 4AY5A 3PUKA 3CK9A 2WB2A 1OUVA 4A3VA 1JWGA 1E7UA 4FC8A 4H7XA 4EECA 2XPZA 3VLEA 4EZJA 1DNPA 2IJGX 2J07A 2R17C 3APFA 5CMYA 2AXUA 5D0OD 3EHMA 2QFCA 3CHMA 4KBQA 2YHCA 2WXOA 2IOLA 5EKQD 3IV0A 3L22A 3G2VA 5ARGA 2IONA 3DBSA 3ZXSA 3D9KA 3RK6A 4FP7A 3JUIA 4AVXA 3T5VA 3AS5A 4O6FA 4U8HA 4AM9A 4GZCA 1HX8A 5G2NA 3URZA 4A1SA 2UY1A 2GW1A 3OAWA 3PRZA 3QKYA 1TEZA 3L16A 4GZ5A 3PDNA 3Q4AB 3VLFA 4MRUA 2CHWA 3FUJA 1LF8A 3RRUA 2V4LA 4B0ZA 5KJMA 3PEUB 5FWQA 1ZBPA 5KJKA 3Q47B 3L54A 4FHKA 3CR3A 1W3BA 1QNFA 3HVEB 2WXPA 1OWNA 3QWVA 3FDHA 3ZIMA 5CMWA 2OVFA 1H2UA 4XE0A 3ZFWA 4ANXA 4GAAA 1H2VC 2WM9A 4A3TA 4I9EA 2KCLA 3MV3B 5BV0A 1PAQA 4GU5A 3LEWA 3EDTB 3ZPJA 2WXGA 5LX8A 2HR2A 3LYAA 2CHXA 4N3BA 4GPKA 4UI9C 2KZTB 2CFUA 1OWPA 2I2OA 3B13A 4AP2A 5J90A 4CDMA 3FUIA 5E75A 2BF0X 3D9NA 3NZSA 2FEZA 4FHJA 3TJPA 3QARA 4BX8A 1YA0A 3CQCB 4DI3A 3CV0A 3IHVA 4DJAA 4EBAG 3MCXA 5FZRA 4HOTA 2VYIA 4TRQA 2J4DA 3RRMB 3Q15A 1FCHA 4I1AA 2AXVA 4XKBA 3ONKA 4MS6A 3GZ2A 1Y6IA 3SI5A 4XX5A 3CKBA 3FP3A 3CLJA 3NF1A 2Y4TA 4Q94A 4MLPA 2LSUA 2WXIA 4YVOA 1VDYA 2V0PA 3PS6A 3UMVA 2J49A 2WPVA 4N3AA 2AW6A 4B8CB 4AV7A 4Q69A 4CGWA 3O4ZA 4ANUA 3MV2B 3SNXA 3BG1B 1NA3A 2X6HA 5AYWD 4WAFA 3FH5A 3CVYA 1JWFA 3HVEA 3U64A 3LCAA 4B8AA 2OVBA 3B7TA 2IOSA 4LEUA 1B89A 4WNEA 3PE3A 4GCOA 1E90A 2AWIA 4GA1A 3VTYA 2X38A 2WXHA 4I1OB 1EF1C 5CCLA 4XI0A 4URKA 2XPIA 3ML9A 4G2VA 4L2YA 4OYSA 2KM4A 2KZTA 5CCMA 2KCVA 3L08A 4U07A 3U4TA 4NRHB 2NSZA 3BG0B 3E4BA 4Y6CA 4HOUA 4YNDA 1IQUA 2VSXE 3OTNA 3RRNB 1WM5A 4BTBA 2LAIA 3CSFA 5C2YA 3OXLA 1E8ZA 5D0QD 2J4BA 4CCAA 2OV8A 3G2WA 3ENEA 4EZKA 4HORA 3UQ3A 1Z3YA 4GCNA 2MRIA 3KD7A 3UT7A 5AIJA 3CSTA 3IEGA 3LDZA 3QNKA 1FVFA 4JPSA 1EYHA 3FUKA 1L5JA 3PH0C 3RIBA 4HVBA 1U3DA 2R5SA 2KATA 4NACA 2AXZA 1TJFA 4J6IA 3MYVA 4CT4A 1JUQA 5ARFA 4BX9A 3PVLA 2I1KA 4EQFA 1PY1A 4RVBA 3RU0A 3SF4A 3KEZA 4UQZA 4JW1A 4XKCA 5JHAA 2LSVA 5DIZA 3ZHEB 3CVWA 2FF4A 5FZQA 3RKVA 1E96B 5BT1A 3CVQA 1H2TC 5KJLA 4I6JA 3TXMA 1XNFA 1JPLA 3DPDA 4APFA 3VTXA 3CVPA 4IYPA 2XGSA 4G26A 4APOA 4DK5A 3PNTB 3CK8A 4JHJA 1HH8A 1OWOA 1SZAA 2VQ2A 5FTPA 2E2EA 5T3RA 3S2AA 2GRLA 4FADA 3ASGA 3EIQC 5A7DB 2C0MA 2X6KA 3ZW3A 1SZ9A 2KC7A 4KZCA 2KCKA 3CKCA 4N2SA 1NZNA 1Z3XA 4CGVA 2C2LA 4J8EA 2L0IA 4M3OA 1IHGA 4B94A 4AIFA 4C0EA 2WMNA 4HOSA 2C0LA 3QDNA 2WVIA 1UG3A 2A5UA 2MHKA 3CHSA 3CHPA 4PS3A 3CEQA 4UQYA 4N2QA 3I4RB 3CVVA 4IRUA 3FTZA 2I9CA 3UT8A 5C1DA 4I2ZA 4XZ4A 4KT6B 4HLEA 4L2LA 4ANVA 3NZUA 5ANLA 4NURA 4C9BB 3SZ7A 4ACKA 4GA0A 1A17A 4ILIA 4I2WA 5EX0A 3D9MA 4K03A 4UWFA 3SBTB 2XCBA 5EDSA 4U0ZA 3ZEFA 4ILGA 1P5QA 1KT0A 2MOWA 3ONLA 5G05C 3ULQA 3ZHEA 2PM6A 2WXKA 3UPVA 1HZ4A 4MKTA 4XI9A 1HS6A 1GW6A 3UUXA 2HYZA 3MKRA 1UN9A 4C0MA 2L0TB 3P1UA 4WUYA 1WY6A 4A55A 4AJWA 1KLXA 2RG8A 2XRYA 4CDRA 4ILHB 4DLQA 2VSYA 1Y8MA 2CFZA 3RO2A 5G04J 5JHBA 2IQCA 3AU4A 4A1GA 3S7JA 3FU5A 3D9IA 3QOUA 5M72A 5HQ8A 2GGFA 5AJDA 4BT8A 3MJWA 3ZYLA 1HXIA 4ACLA 1E8YA 3ASDA 3AU5A 3FUFA 5FQ4A 2J9QA 5LCWC 2WXQA 3FHEA 3P2BA 4U04A 1TJCA 3LS8A 4JHRA 3UT4A 3B7SA 3TG4A 4FULA 4UWLA 4GYYA 5FJYA 1FVHA 2PQNA 4WWOA 2WXFA 1ELRA 3FU3A 2OOEA 3PNLB 3LXUX 4F3VA 3U66A 1OWMA 3IHYA 1S0PA 2WXRA 4I1MA 5JJ7A 4GMLA 4F53A 4JEUA 1HO8A 2PL2A 2Y4UA 3CIAA 4G24A 4DI4A 3FUHA 3LKUA 5FZSA 5T8IA 1XGWA 3L17A 5DBKA 5FQ8A 3CVXA 2XRZA 4U0SA 1DVPA 4W9RA 2YQ8A 4J8DA 3SHFA 3PUJA 3MEKA 4BFRA 3ZRHA 3PEVB 5A23A 2BUGA 1E8WA 3ASFA 4JVSA 4ME2A 1H6KA 2JLBA 5ENNA 4CT0A 3TGOA 3FTUA 4RSYA 5G55A 5BW8C 1KT1A 4J8FA 1E7VA 2PQRA 4WNDA 4WWNA 4LERA 4H7YA 2FO7A 4KYOB 3TL5A 2HM8A 4UI9J 4JHKA 5J08A 3NQPA 3JQ1A 4K0RA 4PDXA 3FU6A 2EQXA 5T4YA 2VTBB 3QK0A 4G23A 2JEKA 4BSXA 3K9IA 3FULA 4N39A 5BPPA 3U3WA 1BPOA 3FEYA 2IU1A 3LVQE 4TUUA 2LAHA 3GW4A 1HG5A 4HS2A 3QB2A 4PS7A 3TAXA 1EPUA 4BT9A 3FUEA 2E0IA 4LRZA 4UI9K 1ELKA 2CG3A 3S7FA 4GYOA 4RG6A 4UQXA 4Q96A 4JC8A 4YVQC 4KVMA 2ILRA 3CHOA 1HU3A 3MKQA 5LOZA 3HHMA 1MHQA 1HG2A 2ZU6B 4JXTA 4DPRA 3QWWA 5LCWJ 4EPZA 3CK7A 4BWRA 1PC2A 3VLDA 3FU0A 2FULA 4AY6A 4NQ0A 4FJYA 3RJVA 3FH8A 4GMJA 3CHQA 3SFZA 2L6JA 4G25A 4CDNA 1IQRA 3FTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AP2 A;  3I3N A;  4HXI A;  4APF A;  2EQX A;  3HVE A;  3HVE B;  4HS2 A; 
#chains in the Genus database with same CATH topology
 3X2Q E;  3FUD A;  4B89 A;  3OXF A;  3KSQ A;  5HI7 A;  2PM7 A;  4R7L A;  4AEZ C;  1OWL A;  3FH7 A;  5ENT D;  3EIJ A;  3ABL E;  3JYS A;  3LJ3 A;  2IF4 A;  4J0U A;  4P29 A;  3IKO B;  2V8S E;  4DRX E;  1HF8 A;  3FY4 A;  1MX6 A;  4U0U A;  3CVU A;  4UWG A;  1N0Q A;  3S7B A;  5FIN A;  4I6G A;  3E30 A;  1N94 A;  5AJL A;  3FFL A;  2DIW A;  4GTT A;  5A6C A;  3D9J A;  3G2U A;  3OXG A;  1MX4 A;  2IFU A;  2VGY A;  4L1B A;  4UWH A;  3QJZ A;  3S7D A;  4U8Y D;  3UI2 A;  2EIJ E;  5CRV A;  3Q5M A;  1N52 A;  2WQH A;  4YDW A;  2J08 A;  2NC9 A;  3SBS A;  3AG1 E;  4BY6 A;  3EU9 A;  4N5C A;  3ASO E;  5G05 J;  3L9T A;  4LUN U;  1MQS A;  4G1T A;  4JL0 A;  4I43 A;  3O48 A;  4WWP A;  2DBA A;  3HYM B;  3C3O A;  4GZ6 A;  1TN7 A;  2UY1 B;  1BU9 A;  3HG0 D;  4IN3 B;  2V5F A;  3ASH A;  5FQ7 A;  5EID A;  2HO1 A;  3B7U X;  3ZYQ A;  3ABM E;  5ENQ D;  1RW2 A;  4FLH A;  2YIN A;  4ATG A;  2F0Y A;  4AY5 A;  5FIO A;  1AP7 A;  4EZJ A;  2J07 A;  2R17 C;  5CMY A;  2GRP B;  1OY3 D;  3EHM A;  4KBQ A;  2IOL A;  5EKQ D;  4FP7 A;  4U8H A;  4GZC A;  2UY1 A;  2GW1 A;  3PRZ A;  4GZ5 A;  3PDN A;  3VLF A;  5AAR A;  2ZGG A;  3C3R A;  2V4L A;  3PEU B;  5FWQ A;  1H6P A;  2IO3 C;  1TNO A;  3CR3 A;  2H6F A;  1QNF A;  5BXU A;  3FDH A;  3ZIM A;  1K1A A;  4GTO A;  3E34 A;  3EDT B;  2WXG A;  4GTV A;  2HR2 A;  5LX8 A;  2CFU A;  5AQ9 A;  5J90 A;  3FUI A;  3D9N A;  1O1S A;  2B0O E;  3Q73 A;  2J4D A;  3PZ1 A;  4CYM D;  1O1R A;  2Y4T A;  2V0P A;  3UMV A;  2X6H A;  4WAF A;  3U64 A;  1N95 A;  2OVB A;  3B7T A;  1B89 A;  3V2X A;  2AWI A;  4GA1 A;  2WXH A;  4XI0 A;  4URK A;  4G2V A;  4L2Y A;  1MX2 A;  5JA4 D;  2VSX E;  1E8Z A;  5D0Q D;  2XS1 A;  1TYQ G;  4EZK A;  2OV8 A;  3ENE A;  4HOR A;  3KD7 A;  3UT7 A;  4TXQ A;  1L5J A;  3RIB A;  4HVB A;  4ATZ D;  2R5S A;  4J6I A;  5KNH D;  1RZ4 A;  3RU0 A;  4JW1 A;  5JHA A;  2FF4 A;  4YDE A;  5BT1 A;  3CVQ A;  3TXM A;  1N11 A;  4DX1 A;  1JPL A;  2OCC E;  3ULY A;  4U7E B;  2F8Y A;  2B6C A;  3KSL A;  2XGS A;  4JHJ A;  1TN6 A;  1HH8 A;  1OWO A;  1SZA A;  5FTP A;  2F8X K;  1SZ9 A;  4KZC A;  4N2S A;  4B94 A;  4HOS A;  3QDN A;  1UG3 A;  3CHS A;  4N2Q A;  3I4R B;  3FTZ A;  4K5A B;  2I9C A;  1FT1 A;  4KT6 B;  1U2V G;  5EX0 A;  2XCB A;  4ILG A;  2MOW A;  3ULQ A;  1SW6 A;  3TWR A;  3UPV A;  4MKT A;  3P1U A;  3T9K A;  3W9F A;  3RO2 A;  2R05 A;  3DSV A;  3D9I A;  3HXB A;  4DX5 D;  3F6Q A;  5HQ8 A;  3MJW A;  4ACL A;  1HXI A;  5LCW C;  4U04 A;  1TJC A;  1D9S A;  2PNN A;  4FUL A;  4GYY A;  1ELR A;  4LNB A;  3LXU X;  3UM0 A;  1S0P A;  2WXR A;  4I1M A;  4HI9 A;  4JEU A;  2PL2 A;  2Y4U A;  4DI4 A;  3LKU A;  5FZS A;  5FQ8 A;  4U0S A;  1DVP A;  3UM1 A;  4O60 A;  3SHF A;  4BFR A;  2A5E A;  1H6K A;  4ME2 A;  4CT0 A;  3FTU A;  4RSY A;  1K3Z D;  3TWW A;  5G55 A;  1E7V A;  2PQR A;  4WWN A;  2FO7 A;  4UI9 J;  3NQP A;  3JQ1 A;  5HS0 A;  4K0R A;  5T4Y A;  2VTB B;  2JEK A;  4BSX A;  5AQA A;  3FUL A;  3UXG A;  3LVQ E;  2VGE A;  4BSZ B;  1UOH A;  4HS2 A;  3QB2 A;  4BT9 A;  2F37 A;  4LRZ A;  1ELK A;  2CG3 A;  4GYO A;  4RG6 A;  3CHO A;  3HHM A;  1FT2 A;  4BWR A;  4OAU C;  1K8K G;  5B3S E;  4Z68 A;  3SFZ A;  4FJY A;  3C3Q A;  4G25 A;  1X81 A;  3CVL A;  5HRY A;  1SVX A;  3W9G A;  3NB2 A;  4GA2 A;  1E8X A;  3MA5 A;  2Q7F A;  1INZ A;  2XQ0 A;  1KZP A;  2VTB A;  4HI8 A;  5CBO A;  2AVP A;  5KCM A;  2I6H A;  3CHR A;  3GZS A;  5EX3 A;  3L6A A;  1UW4 B;  1N9A A;  2XGM A;  2LUH A;  5ENS D;  5JJT A;  4U95 D;  3R9A B;  2V4H C;  3EU5 A;  2XEH A;  1ZU2 A;  5JJ6 A;  2ETB A;  3GZ1 A;  4UWK A;  2WXL A;  3N71 A;  2GRM A;  3TWV A;  3LY7 A;  1HFA A;  4F1S A;  5AEN A;  2X6F A;  4GB9 A;  3KS2 A;  2IO2 C;  3EJN A;  1A5E A;  4LSZ E;  3ZYM A;  4M7C A;  2CHZ A;  4EZL A;  2FI7 A;  4XIF A;  3LY9 A;  3C5R A;  3MZL B;  5CHE E;  3JCK C;  3PE4 A;  3TWT A;  1OCR E;  2X6J A;  3IBE A;  2YNQ A;  3ESL A;  3ML8 A;  3R7Q A;  3C72 A;  3FWV A;  4JEH A;  4GZD A;  3C98 A;  5FT9 A;  2ETA A;  3CGH A;  4U63 A;  5H7P A;  4O1P A;  1NFI E;  4Y6W A;  4TXR A;  3BEE A;  3MX3 A;  5LFA A;  3I4G A;  3KAE A;  1V55 E;  1TNZ A;  3SGH A;  3FUM A;  3T5X A;  5G04 C;  3HXD A;  2L9B A;  2LXM A;  3CQG B;  2Y3A A;  3UM2 A;  1TR4 A;  1OUV A;  4FC8 A;  3VLE A;  1DNP A;  3PZ4 A;  5CBN A;  5AQ7 A;  5ENR D;  3DBS A;  3D9K A;  2QZA A;  1FPP A;  1LD7 A;  4A1S A;  3QKY A;  4MRU A;  2CHW A;  1LF8 A;  5KJK A;  3Q47 B;  1Q2Z A;  1DC2 A;  3HVE B;  1N4R A;  1OWN A;  5CMW A;  2OVF A;  4GAA A;  1H2V C;  3MV3 B;  3LEW A;  3ZPJ A;  3DSU A;  3BQO A;  2P9N G;  2I2O A;  4AP2 A;  4CDM A;  2GRO B;  2BF0 X;  3NZS A;  4FHJ A;  3QAR A;  4DI3 A;  2H6I A;  1JCS A;  2AXV A;  4XKB A;  3GZ2 A;  3SI5 A;  2LSU A;  3D9H A;  1DCE A;  2Y1L E;  4YVO A;  3J5P A;  4AV7 A;  4ANU A;  1TNU A;  3SNX A;  3AG2 E;  2J8S D;  5JMN D;  3FH5 A;  3UIO C;  2H6H A;  1JWF A;  3ASN E;  3HVE A;  4B8A A;  3PE3 A;  4GCO A;  3VTY A;  4I1O B;  1EF1 C;  2XPI A;  3ML9 A;  4GTQ A;  2KM4 A;  2KCV A;  2DWZ A;  3BG0 B;  3JXJ A;  4U8V D;  4HOU A;  1WM5 A;  4BTB A;  3CSF A;  2J4B A;  4CCA A;  3G2W A;  4U96 D;  3UQ3 A;  3RAU A;  4A63 B;  4HRM B;  3MYV A;  2GRR B;  3PVL A;  2I1K A;  3B7B A;  5B1A E;  5DIZ A;  3RKV A;  1H2T C;  5KJL A;  1XNF A;  4DX6 D;  3VTX A;  3Q78 A;  3CK8 A;  5A7D B;  2KC7 A;  2KCK A;  2IY0 C;  4J8E A;  1DCQ A;  2WVI A;  2A5U A;  2MHK A;  3CHP A;  3V2O A;  3ZKJ A;  4UQY A;  1O1T A;  4IRU A;  3UT8 A;  5C1D A;  4JD2 G;  4L2L A;  1TNB A;  1S70 B;  4NUR A;  3EHR A;  3SZ7 A;  4ACK A;  1A17 A;  3D9M A;  4K03 A;  4UWF A;  1N4S A;  1P5Q A;  1KT0 A;  5G05 C;  1HS6 A;  1GW6 A;  2HYZ A;  5ENP D;  2L0T B;  3UKU G;  5CEC B;  4CDR A;  4DLQ A;  2VSY A;  1Y8M A;  2ZGD A;  3JXI A;  4G8L A;  5JHB A;  3S7J A;  3QOU A;  4YDY A;  1E8Y A;  4HB5 A;  5FQ4 A;  4QQI A;  2J9Q A;  2WXQ A;  3UM3 A;  3HXC A;  3B7S A;  3TG4 A;  5D66 A;  5CER B;  1FVH A;  2WXF A;  2OOE A;  3PNL B;  4F53 A;  1JCR A;  1HO8 A;  2V5Q C;  3L17 A;  5DBK A;  2OEV A;  2ZXW E;  3PUJ A;  5EIB E;  1NI1 A;  2Y69 E;  3TGO A;  2GRN B;  5ENN A;  1WG0 A;  1KT1 A;  4N5Q A;  3EUV A;  4H7Y A;  3TL5 A;  5AQB A;  5J08 A;  4JHK A;  3IXE A;  2NYJ A;  4G23 A;  5BPP A;  4HNA D;  1HG5 A;  2ETC A;  2E0I A;  4UI9 K;  4Q96 A;  4KVM A;  3MKQ A;  1LTX A;  1MHQ A;  1MZC A;  3BU8 A;  5LCW J;  1K1B A;  3CK7 A;  4EPZ A;  2DYS E;  3Q9U C;  2FUL A;  3Q79 A;  3FTV A;  2RKK A;  4KMO A;  4FLB A;  4LCT A;  2WQ6 A;  4ABN A;  3R7R A;  3LY8 A;  5KJN A;  2BTD A;  3DPY A;  4MBG A;  3HIZ A;  3ZVV A;  1NL4 A;  3AAA C;  2J09 A;  3QWP A;  2XZD G;  4BER A;  3TXN A;  1U3C A;  3I3N A;  4X8Q A;  3PZ2 A;  1SQM A;  3DEO A;  2VGX B;  3JQ0 A;  5AAO A;  2WXM A;  1NA0 A;  3DWL G;  4JA9 A;  1OCC E;  2P2C P;  4G8K A;  4FA6 A;  2P58 C;  3FEX A;  4HXI A;  3I5P A;  3L13 A;  3BUA A;  4DLO A;  5BNW A;  2OEW A;  2P9K G;  4E85 A;  4JA7 A;  3UTM A;  3L82 A;  5FQ6 A;  5EYP F;  4L9P A;  3JUE A;  3ZXP A;  1O5M A;  3LVR E;  2XZT G;  4OVU A;  3FTS A;  1QQE A;  3HXF A;  3SD5 A;  5BUZ A;  4GZ3 A;  4F7A A;  4IUL A;  3ESK A;  3D9L A;  2R02 A;  4LNU D;  4L7T A;  4QFV A;  2PZI A;  1V54 E;  2VGX A;  4TV3 A;  3CVN A;  3D9O A;  1N54 A;  3Q7A A;  4ZHB A;  2DCP A;  4KVO A;  4JZY A;  2VSN A;  2VJ8 A;  1H19 A;  1ELW A;  4RLY A;  1NP7 A;  3FTW A;  1Z6T A;  1WAO 1;  1SA5 A;  2LNI A;  5BV1 A;  4ANW A;  1H0A A;  3APC A;  5ANR A;  1AWC B;  4HOQ A;  2UWJ G;  4PH4 B;  3T8M A;  1HE8 A;  4RG9 A;  1EDU A;  2XEV A;  5IY5 E;  3V79 K;  4D10 C;  5ITZ F;  3AS4 A;  2R2L A;  3DXK G;  3UX4 A;  4OVV A;  2YHE A;  5E76 A;  4HRL A;  3RSE G;  5CEA A;  3FTX A;  2WB2 A;  1JWG A;  1E7U A;  4EEC A;  2XPZ A;  2IJG X;  3ZU7 B;  3APF A;  5D0O D;  4J8Y A;  2YHC A;  2WXO A;  1SA4 A;  3ZUV B;  3IV0 A;  3G2V A;  3ZXS A;  5ENO D;  3JUI A;  4AVX A;  3T5V A;  3URZ A;  1HX8 A;  5G2N A;  3OAW A;  1TEZ A;  2P9I G;  3Q4A B;  3FUJ A;  3RRU A;  4B0Z A;  3ULE G;  1ZBP A;  4FHK A;  1W3B A;  3QWV A;  1H2U A;  4XE0 A;  4I9E A;  1PAQ A;  3DSX A;  4UI9 C;  2KZT B;  1OWP A;  3B13 A;  5E75 A;  2XEN A;  3TJP A;  4BX8 A;  1YA0 A;  3IHV A;  4EBA G;  5FZR A;  4TRQ A;  3Q15 A;  3ONK A;  4MS6 A;  1Y6I A;  3CKB A;  2BKK B;  3FP3 A;  3CLJ A;  4Q94 A;  1N4P A;  3PS6 A;  2WPV A;  2AW6 A;  4CGW A;  4F6R D;  1BI7 B;  3E33 A;  1Z5S C;  2RFA A;  3AJI A;  4OYS A;  2KZT A;  4U07 A;  4HQD A;  4DX2 A;  2NSZ A;  4Y6C A;  1IQU A;  3RRN B;  2LAI A;  3OXL A;  2KXP C;  3ZNG A;  1Z3Y A;  4GCN A;  2MRI A;  5AIJ A;  3CST A;  3IEG A;  3LDZ A;  4XEI G;  3QNK A;  1FVF A;  1EYH A;  3PH0 C;  1U3D A;  3TWS A;  2KAT A;  4NAC A;  2EIM E;  4CT4 A;  1JUQ A;  4BX9 A;  1PY1 A;  4RVB A;  1OT8 A;  3SF4 A;  4UQZ A;  4XKC A;  2LSV A;  3CVW A;  3ZHE B;  5FZQ A;  1E96 B;  3DSS A;  3DPD A;  4APF A;  4IYP A;  3PNT B;  3S2A A;  2VQ2 A;  2GRL A;  4FAD A;  3ASG A;  3NOG D;  3ZW3 A;  1NZN A;  1Z3X A;  4CGV A;  4M3O A;  1IHG A;  4AIF A;  2WMN A;  4PS3 A;  2C0L A;  3EHQ A;  4I2Z A;  3NZU A;  5ANL A;  4GA0 A;  4ILI A;  4U0Z A;  3ZHE A;  4GMR A;  1HZ4 A;  1UN9 A;  4WUY A;  4AJW A;  4K5B A;  4ILH B;  3V30 A;  2EIL E;  3AU4 A;  3FU5 A;  4DUI A;  1D8D A;  3ZYL A;  1IHB A;  3AU5 A;  3J5Q B;  4BET A;  3LS8 A;  4JHR A;  2P9P G;  1OCO E;  4BES A;  4UWL A;  2MYO A;  3U66 A;  3IHY A;  5JJ7 A;  4GML A;  3UIP C;  4G24 A;  2P9U G;  3FUH A;  1N0R A;  1XGW A;  3CVX A;  4J8D A;  3ZRH A;  3PEV B;  5A23 A;  2BUG A;  1E8W A;  3ASF A;  2JLB A;  2L6B A;  5BW8 C;  4J8F A;  4WND A;  2HM8 A;  1WDY A;  4PDX A;  3FU6 A;  3QK0 A;  5CRU A;  1N4Q A;  1TN8 A;  4N39 A;  2KBX A;  2HE0 A;  3U3W A;  3HXE A;  2LAH A;  3GW4 A;  1EPU A;  2XS8 A;  3S7F A;  4RQI A;  4UQX A;  4JC8 A;  4YVQ C;  2ILR A;  1HU3 A;  5LOZ A;  3QWW A;  3PZ3 A;  1PC2 A;  2EIN E;  4J7W A;  4AY6 A;  2P9S G;  3FH8 A;  3CHQ A;  4CDN A;  1BD8 A;  2ZIR A;  3DRA A;  3ZN3 A;  2I1J A;  4HLL A;  2LO6 A;  3DEP A;  3G2T A;  3FTY A;  3B95 A;  3TG5 A;  2WQ7 A;  4AXH A;  3QC1 A;  3U9W A;  5BXO A;  2RFM A;  2WXN A;  4HFG A;  4I6E A;  3PZD A;  4EBA A;  4FU3 A;  4WNG A;  4G11 A;  4L23 A;  2M63 A;  3D3M A;  1MYO A;  3AS8 A;  4E6H A;  3ZGQ A;  3MGB A;  5CED B;  2FBN A;  1BI8 B;  4KZ0 A;  3ABK E;  3EHN A;  4LG6 A;  1KPS B;  4B93 B;  3QAQ A;  3WXX A;  4I9C A;  4GPM A;  4PUC A;  2NXP A;  2DVW A;  4HRN A;  5HKP A;  4YDO A;  5LP0 A;  2R59 A;  2X6I A;  4N3C A;  1QZ2 A;  4GYW A;  4GTM A;  2OND A;  3Q7F A;  1KZO A;  3LPZ A;  4GTS A;  1UN8 A;  3MKQ B;  2X3M A;  3B7R L;  1JCQ A;  3NOC D;  1IYG A;  3SFX A;  3TWU A;  1X5B A;  2XGO A;  2QY7 A;  4FJZ A;  3T8K A;  4AOF A;  4BTA A;  3UIN C;  2EIK E;  2XCC A;  3NAW A;  4CEM A;  2CG2 A;  2ZIS A;  2A4Z A;  3Q49 B;  4I17 A;  3PRE A;  3HDX A;  4J8S A;  4DX7 D;  2XHE A;  1YMP A;  3D9P A;  2RD0 A;  3GYZ A;  2WMO A;  3AG3 E;  3RO3 A;  4JB8 P;  3G2S A;  3DSW A;  4KXK B;  1UJJ A;  5B1B E;  3APD A;  1UJK A;  3FUN A;  4CRW A;  2WXJ A;  4V3I A;  3Q9N C;  1QBQ A;  1TNY A;  1YCS B;  3ZYK A;  4PS8 A;  4WNF A;  2VSO E;  2XPY A;  3PUK A;  3CK9 A;  4A3V A;  4H7X A;  4TUM A;  1BLX B;  2AXU A;  4UUC A;  2QFC A;  3CHM A;  5EN5 D;  1OCZ E;  5ARG A;  3L22 A;  5KBA A;  2ION A;  3RK6 A;  3AS5 A;  4O6F A;  3TWX A;  2DZN A;  4AM9 A;  3DST A;  3L16 A;  5KJM A;  1OXJ A;  4BEP A;  3L54 A;  2DZO A;  2WXP A;  2JAB A;  4ANX A;  3ZFW A;  3NBN B;  2WM9 A;  4A3T A;  2KCL A;  5AN8 A;  5BV0 A;  4GU5 A;  2BKG A;  3LYA A;  4N3B A;  2CHX A;  2P9L G;  4GPK A;  2GRQ B;  2QYU A;  3WG7 E;  2FEZ A;  5KWD A;  3CQC B;  3CV0 A;  4DJA A;  3MCX A;  4HOT A;  2VYI A;  3RRM B;  1FCH A;  4I1A A;  3V31 A;  3R9M A;  4HBD A;  4XX5 A;  2BED A;  3NF1 A;  4MLP A;  2WXI A;  4LNG A;  1VDY A;  2J49 A;  3TWQ A;  4N3A A;  2R03 A;  4B8C B;  4Q69 A;  3O4Z A;  3MV2 B;  3BG1 B;  1NA3 A;  5KNG A;  5AYW D;  3CVY A;  3LCA A;  4GTP A;  4LEU A;  2IOS A;  4WNE A;  3DXM G;  2DYR E;  2XEE A;  1E90 A;  4CZ2 D;  2X38 A;  5CCL A;  5CCM A;  3L08 A;  3U4T A;  4NRH B;  4O1O A;  3E4B A;  4YND A;  3OTN A;  5EIL A;  5C2Y A;  3ISM C;  1ZB1 A;  3Q75 A;  4JPS A;  2LXL A;  3FUK A;  2AXZ A;  1D8E A;  1TJF A;  2FO1 E;  5ARF A;  1S63 A;  4EQF A;  3KEZ A;  4I6J A;  3CVP A;  4G26 A;  4APO A;  4DK5 A;  5T3R A;  2E2E A;  3AG4 E;  3EIQ C;  2C0M A;  2X6K A;  3CKC A;  2C2L A;  2L0I A;  2AJA A;  4C0E A;  5EYL A;  3SO8 A;  3KEA A;  1IXV A;  3CEQ A;  3CVV A;  1QYM A;  2QC9 A;  3E37 A;  4XZ4 A;  4HLE A;  4ANV A;  4TXP A;  4C9B B;  3UKR G;  4I2W A;  3SBT B;  5D2M C;  5EDS A;  3ZEF A;  1MJ0 A;  3ONL A;  2PM6 A;  2WXK A;  4ZFH A;  4XI9 A;  1G3N B;  3UUX A;  2IEJ A;  3MKR A;  4C0M A;  4A55 A;  1WY6 A;  2H6G A;  1KLX A;  2RG8 A;  2XRY A;  2CFZ A;  5G04 J;  4F1P A;  2IQC A;  4A1G A;  2QYJ A;  4C48 B;  1IKN D;  5M72 A;  2GGF A;  5AJD A;  4BT8 A;  3ASD A;  1H6O A;  3FUF A;  3FHE A;  3P2B A;  3LJN A;  3UT4 A;  3SFY A;  5FJY A;  2PQN A;  4WWO A;  3FU3 A;  4F3V A;  3E32 A;  1OWM A;  1S64 A;  3CIA A;  5T8I A;  3SY2 A;  2XRZ A;  4W9R A;  2YQ8 A;  3SQV A;  3MEK A;  4JVS A;  4K5C A;  1YYH A;  4EHM A;  4OAV B;  4LER A;  4NIK A;  4KYO B;  2EQX A;  3HRA A;  3K9I A;  1BPO A;  3FEY A;  2IU1 A;  4TUU A;  4PS7 A;  3TAX A;  2Y0B G;  3FUE A;  4GTR A;  1HG2 A;  1LD8 A;  2ZU6 B;  4JXT A;  4DPR A;  3VLD A;  3FU0 A;  4NQ0 A;  3RJV A;  4GMJ A;  2L6J A;  1IQR A; 
#chains in the Genus database with same CATH homology
 3CVL A;  4KMO A;  4FLB A;  3FUD A;  4LCT A;  4B89 A;  2WQ6 A;  3OXF A;  4ABN A;  3R7R A;  3ZN3 A;  2I1J A;  5HI7 A;  3LY8 A;  2PM7 A;  4GA2 A;  1E8X A;  5KJN A;  2BTD A;  2LO6 A;  4R7L A;  3MA5 A;  3HIZ A;  3ZVV A;  2Q7F A;  1INZ A;  4AEZ C;  1OWL A;  3G2T A;  2XQ0 A;  3FTY A;  2J09 A;  3TG5 A;  3FH7 A;  3QWP A;  3TXN A;  2WQ7 A;  2VTB A;  4AXH A;  3EIJ A;  1U3C A;  3JYS A;  3QC1 A;  3U9W A;  3LJ3 A;  3I3N A;  2IF4 A;  4J0U A;  1SQM A;  2WXN A;  2VGX B;  4HFG A;  4P29 A;  4I6E A;  3PZD A;  4EBA A;  3JQ0 A;  3IKO B;  2WXM A;  4FU3 A;  2V8S E;  1NA0 A;  4WNG A;  2AVP A;  4G11 A;  4L23 A;  4JA9 A;  5KCM A;  2M63 A;  2I6H A;  3D3M A;  3AS8 A;  4E6H A;  4FA6 A;  3ZGQ A;  2P58 C;  3MGB A;  3CHR A;  2FBN A;  3FEX A;  1HF8 A;  3GZS A;  4KZ0 A;  5EX3 A;  3EHN A;  3FY4 A;  3L6A A;  4HXI A;  1UW4 B;  3I5P A;  2XGM A;  3L13 A;  4U0U A;  4DLO A;  5BNW A;  3CVU A;  4E85 A;  4UWG A;  4JA7 A;  5JJT A;  5FQ6 A;  3QAQ A;  3WXX A;  3S7B A;  3R9A B;  4I9C A;  4PUC A;  2NXP A;  3LVR E;  1ZU2 A;  4I6G A;  4OVU A;  3GZ1 A;  5JJ6 A;  4UWK A;  3FTS A;  1QQE A;  2WXL A;  3SD5 A;  5BUZ A;  5AJL A;  3FFL A;  4GZ3 A;  5LP0 A;  4F7A A;  3N71 A;  2GRM A;  2DIW A;  2R59 A;  2X6I A;  3LY7 A;  4IUL A;  1HFA A;  3ESK A;  3D9L A;  5A6C A;  4F1S A;  5AEN A;  3D9J A;  2X6F A;  1QZ2 A;  4N3C A;  3G2U A;  4GYW A;  3OXG A;  4L7T A;  2IFU A;  2VGY A;  4L1B A;  4GB9 A;  4QFV A;  4UWH A;  2OND A;  2PZI A;  3QJZ A;  3KS2 A;  2VGX A;  3EJN A;  3LPZ A;  1UN8 A;  4TV3 A;  3CVN A;  3D9O A;  3MKQ B;  2CHZ A;  3S7D A;  3ZYM A;  4EZL A;  1N54 A;  2FI7 A;  4XIF A;  2X3M A;  3B7R L;  3LY9 A;  3Q5M A;  1N52 A;  3MZL B;  1IYG A;  2DCP A;  4KVO A;  4JZY A;  2VSN A;  2VJ8 A;  1X5B A;  2WQH A;  5CHE E;  1H19 A;  3JCK C;  2J08 A;  2QY7 A;  2XGO A;  4FJZ A;  2NC9 A;  3PE4 A;  1ELW A;  3SBS A;  4AOF A;  4BTA A;  4BY6 A;  1NP7 A;  3FTW A;  1Z6T A;  4N5C A;  5G05 J;  1WAO 1;  2X6J A;  3IBE A;  2YNQ A;  3ESL A;  3ML8 A;  2LNI A;  3R7Q A;  5BV1 A;  4LUN U;  3FWV A;  1MQS A;  4JEH A;  4ANW A;  4G1T A;  2XCC A;  4GZD A;  1H0A A;  4CEM A;  3C98 A;  3APC A;  4I43 A;  4JL0 A;  5FT9 A;  2CG2 A;  5ANR A;  3O48 A;  3CGH A;  4HOQ A;  2A4Z A;  2UWJ G;  4U63 A;  3Q49 B;  4PH4 B;  4WWP A;  3T8M A;  4I17 A;  1HE8 A;  2DBA A;  3HYM B;  3PRE A;  1EDU A;  4RG9 A;  3HDX A;  2XEV A;  4J8S A;  4GZ6 A;  2XHE A;  3D9P A;  2RD0 A;  3GYZ A;  4Y6W A;  2WMO A;  4D10 C;  2UY1 B;  3RO3 A;  3G2S A;  3BEE A;  4IN3 B;  3MX3 A;  2V5F A;  3ASH A;  4KXK B;  1UJJ A;  5FQ7 A;  3APD A;  5LFA A;  1UJK A;  3AS4 A;  3FUN A;  3I4G A;  2HO1 A;  3B7U X;  3KAE A;  3ZYQ A;  4CRW A;  2WXJ A;  4V3I A;  3UX4 A;  4FLH A;  4OVV A;  2YHE A;  3SGH A;  3FUM A;  3T5X A;  5E76 A;  5G04 C;  2YIN A;  2L9B A;  3ZYK A;  3CQG B;  2Y3A A;  4PS8 A;  4WNF A;  4ATG A;  2VSO E;  3FTX A;  2XPY A;  4AY5 A;  3PUK A;  3CK9 A;  2WB2 A;  1OUV A;  4A3V A;  1JWG A;  1E7U A;  4FC8 A;  4H7X A;  4EEC A;  2XPZ A;  3VLE A;  4EZJ A;  1DNP A;  2IJG X;  2J07 A;  2R17 C;  3APF A;  5CMY A;  2AXU A;  5D0O D;  3EHM A;  2QFC A;  3CHM A;  4KBQ A;  2YHC A;  2WXO A;  2IOL A;  5EKQ D;  3IV0 A;  3L22 A;  3G2V A;  5ARG A;  2ION A;  3DBS A;  3ZXS A;  3D9K A;  3RK6 A;  4FP7 A;  3JUI A;  4AVX A;  3T5V A;  3AS5 A;  4O6F A;  4U8H A;  4AM9 A;  4GZC A;  1HX8 A;  5G2N A;  3URZ A;  4A1S A;  2UY1 A;  2GW1 A;  3OAW A;  3PRZ A;  3QKY A;  1TEZ A;  3L16 A;  4GZ5 A;  3PDN A;  3Q4A B;  3VLF A;  4MRU A;  2CHW A;  3FUJ A;  1LF8 A;  3RRU A;  2V4L A;  4B0Z A;  5KJM A;  3PEU B;  5FWQ A;  1ZBP A;  5KJK A;  3Q47 B;  3L54 A;  4FHK A;  3CR3 A;  1W3B A;  1QNF A;  3HVE B;  2WXP A;  1OWN A;  3QWV A;  3FDH A;  3ZIM A;  5CMW A;  2OVF A;  1H2U A;  4XE0 A;  3ZFW A;  4ANX A;  4GAA A;  1H2V C;  2WM9 A;  4A3T A;  4I9E A;  2KCL A;  3MV3 B;  5BV0 A;  1PAQ A;  4GU5 A;  3LEW A;  3EDT B;  3ZPJ A;  2WXG A;  5LX8 A;  2HR2 A;  3LYA A;  2CHX A;  4N3B A;  4GPK A;  4UI9 C;  2KZT B;  2CFU A;  1OWP A;  2I2O A;  3B13 A;  4AP2 A;  5J90 A;  4CDM A;  3FUI A;  5E75 A;  2BF0 X;  3D9N A;  3NZS A;  2FEZ A;  4FHJ A;  3TJP A;  3QAR A;  4BX8 A;  1YA0 A;  3CQC B;  4DI3 A;  3CV0 A;  3IHV A;  4DJA A;  4EBA G;  3MCX A;  5FZR A;  4HOT A;  2VYI A;  4TRQ A;  2J4D A;  3RRM B;  3Q15 A;  1FCH A;  4I1A A;  2AXV A;  4XKB A;  3ONK A;  4MS6 A;  3GZ2 A;  1Y6I A;  3SI5 A;  4XX5 A;  3CKB A;  3FP3 A;  3CLJ A;  3NF1 A;  2Y4T A;  4Q94 A;  4MLP A;  2LSU A;  2WXI A;  4YVO A;  1VDY A;  2V0P A;  3PS6 A;  3UMV A;  2J49 A;  2WPV A;  4N3A A;  2AW6 A;  4B8C B;  4AV7 A;  4Q69 A;  4CGW A;  3O4Z A;  4ANU A;  3MV2 B;  3SNX A;  3BG1 B;  1NA3 A;  2X6H A;  5AYW D;  4WAF A;  3FH5 A;  3CVY A;  1JWF A;  3HVE A;  3U64 A;  3LCA A;  4B8A A;  2OVB A;  3B7T A;  2IOS A;  4LEU A;  1B89 A;  4WNE A;  3PE3 A;  4GCO A;  1E90 A;  2AWI A;  4GA1 A;  3VTY A;  2X38 A;  2WXH A;  4I1O B;  1EF1 C;  5CCL A;  4XI0 A;  4URK A;  2XPI A;  3ML9 A;  4G2V A;  4L2Y A;  4OYS A;  2KM4 A;  2KZT A;  5CCM A;  2KCV A;  3L08 A;  4U07 A;  3U4T A;  4NRH B;  2NSZ A;  3BG0 B;  3E4B A;  4Y6C A;  4HOU A;  4YND A;  1IQU A;  2VSX E;  3OTN A;  3RRN B;  1WM5 A;  4BTB A;  2LAI A;  3CSF A;  5C2Y A;  3OXL A;  1E8Z A;  5D0Q D;  2J4B A;  4CCA A;  2OV8 A;  3G2W A;  3ENE A;  4EZK A;  4HOR A;  3UQ3 A;  1Z3Y A;  4GCN A;  2MRI A;  3KD7 A;  3UT7 A;  5AIJ A;  3CST A;  3IEG A;  3LDZ A;  3QNK A;  1FVF A;  4JPS A;  1EYH A;  3FUK A;  1L5J A;  3PH0 C;  3RIB A;  4HVB A;  1U3D A;  2R5S A;  2KAT A;  4NAC A;  2AXZ A;  1TJF A;  4J6I A;  3MYV A;  4CT4 A;  1JUQ A;  5ARF A;  4BX9 A;  3PVL A;  2I1K A;  4EQF A;  1PY1 A;  4RVB A;  3RU0 A;  3SF4 A;  3KEZ A;  4UQZ A;  4JW1 A;  4XKC A;  5JHA A;  2LSV A;  5DIZ A;  3ZHE B;  3CVW A;  2FF4 A;  5FZQ A;  3RKV A;  1E96 B;  5BT1 A;  3CVQ A;  1H2T C;  5KJL A;  4I6J A;  3TXM A;  1XNF A;  1JPL A;  3DPD A;  4APF A;  3VTX A;  3CVP A;  4IYP A;  2XGS A;  4G26 A;  4APO A;  4DK5 A;  3PNT B;  3CK8 A;  4JHJ A;  1HH8 A;  1OWO A;  1SZA A;  2VQ2 A;  5FTP A;  2E2E A;  5T3R A;  3S2A A;  2GRL A;  4FAD A;  3ASG A;  3EIQ C;  5A7D B;  2C0M A;  2X6K A;  3ZW3 A;  1SZ9 A;  2KC7 A;  4KZC A;  2KCK A;  3CKC A;  4N2S A;  1NZN A;  1Z3X A;  4CGV A;  2C2L A;  4J8E A;  2L0I A;  4M3O A;  1IHG A;  4B94 A;  4AIF A;  4C0E A;  2WMN A;  4HOS A;  2C0L A;  3QDN A;  2WVI A;  1UG3 A;  2A5U A;  2MHK A;  3CHS A;  3CHP A;  4PS3 A;  3CEQ A;  4UQY A;  4N2Q A;  3I4R B;  3CVV A;  4IRU A;  3FTZ A;  2I9C A;  3UT8 A;  5C1D A;  4I2Z A;  4XZ4 A;  4KT6 B;  4HLE A;  4L2L A;  4ANV A;  3NZU A;  5ANL A;  4NUR A;  4C9B B;  3SZ7 A;  4ACK A;  4GA0 A;  1A17 A;  4ILI A;  4I2W A;  5EX0 A;  3D9M A;  4K03 A;  4UWF A;  3SBT B;  2XCB A;  5EDS A;  4U0Z A;  3ZEF A;  4ILG A;  1P5Q A;  1KT0 A;  2MOW A;  3ONL A;  5G05 C;  3ULQ A;  3ZHE A;  2PM6 A;  2WXK A;  3UPV A;  1HZ4 A;  4MKT A;  4XI9 A;  1HS6 A;  1GW6 A;  3UUX A;  2HYZ A;  3MKR A;  1UN9 A;  4C0M A;  2L0T B;  3P1U A;  4WUY A;  1WY6 A;  4A55 A;  4AJW A;  1KLX A;  2RG8 A;  2XRY A;  4CDR A;  4ILH B;  4DLQ A;  2VSY A;  1Y8M A;  2CFZ A;  3RO2 A;  5G04 J;  5JHB A;  2IQC A;  3AU4 A;  4A1G A;  3S7J A;  3FU5 A;  3D9I A;  3QOU A;  5M72 A;  5HQ8 A;  2GGF A;  5AJD A;  4BT8 A;  3MJW A;  3ZYL A;  1HXI A;  4ACL A;  1E8Y A;  3ASD A;  3AU5 A;  3FUF A;  5FQ4 A;  2J9Q A;  5LCW C;  2WXQ A;  3FHE A;  3P2B A;  4U04 A;  1TJC A;  3LS8 A;  4JHR A;  3UT4 A;  3B7S A;  3TG4 A;  4FUL A;  4UWL A;  4GYY A;  5FJY A;  1FVH A;  2PQN A;  4WWO A;  2WXF A;  1ELR A;  3FU3 A;  2OOE A;  3PNL B;  3LXU X;  4F3V A;  3U66 A;  1OWM A;  3IHY A;  1S0P A;  2WXR A;  4I1M A;  5JJ7 A;  4GML A;  4F53 A;  4JEU A;  1HO8 A;  2PL2 A;  2Y4U A;  3CIA A;  4G24 A;  4DI4 A;  3FUH A;  3LKU A;  5FZS A;  5T8I A;  1XGW A;  3L17 A;  5DBK A;  5FQ8 A;  3CVX A;  2XRZ A;  4U0S A;  1DVP A;  4W9R A;  2YQ8 A;  4J8D A;  3SHF A;  3PUJ A;  3MEK A;  4BFR A;  3ZRH A;  3PEV B;  5A23 A;  2BUG A;  1E8W A;  3ASF A;  4JVS A;  4ME2 A;  1H6K A;  2JLB A;  5ENN A;  4CT0 A;  3TGO A;  3FTU A;  4RSY A;  5G55 A;  5BW8 C;  1KT1 A;  4J8F A;  1E7V A;  2PQR A;  4WND A;  4WWN A;  4LER A;  4H7Y A;  2FO7 A;  4KYO B;  3TL5 A;  2HM8 A;  4UI9 J;  4JHK A;  5J08 A;  3NQP A;  3JQ1 A;  4K0R A;  4PDX A;  3FU6 A;  2EQX A;  5T4Y A;  2VTB B;  3QK0 A;  4G23 A;  2JEK A;  4BSX A;  3K9I A;  3FUL A;  4N39 A;  5BPP A;  3U3W A;  1BPO A;  3FEY A;  2IU1 A;  3LVQ E;  4TUU A;  2LAH A;  3GW4 A;  1HG5 A;  4HS2 A;  3QB2 A;  4PS7 A;  3TAX A;  1EPU A;  4BT9 A;  3FUE A;  2E0I A;  4LRZ A;  4UI9 K;  1ELK A;  2CG3 A;  3S7F A;  4GYO A;  4RG6 A;  4UQX A;  4Q96 A;  4JC8 A;  4YVQ C;  4KVM A;  2ILR A;  3CHO A;  1HU3 A;  3MKQ A;  5LOZ A;  3HHM A;  1MHQ A;  1HG2 A;  2ZU6 B;  4JXT A;  4DPR A;  3QWW A;  5LCW J;  4EPZ A;  3CK7 A;  4BWR A;  1PC2 A;  3VLD A;  3FU0 A;  2FUL A;  4AY6 A;  4NQ0 A;  4FJY A;  3RJV A;  3FH8 A;  4GMJ A;  3CHQ A;  3SFZ A;  2L6J A;  4G25 A;  4CDN A;  1IQR A;  3FTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...