4HS2A

Crystal structure of the human spop c-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
64
structure length
64
Chain Sequence
NLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Speckle-type POZ protein
publication title Structural basis of high-order oligomerization of the cullin-3 adaptor SPOP.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2012-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4hs2A00
3HVEA 3HVEB 2EQXA 4HS2A 4APFA 3I3NA 4AP2A 4HXIA
chains in the Genus database with same CATH superfamily
3CVWA 4HRNA 3QB2A 3URZA 1MZCA 1UW4B 2WXJA 3UX4A 3MGBA 2IY0C 2DBAA 2V4LA 4F1PA 3UM3A 2LNIA 2DYSE 4GPKA 3BUAA 1JUQA 1OWLA 4U0ZA 1QQEA 3ONKA 4XIFA 2XCCA 1D9SA 4B8CB 1HG5A 4J8SA 4HRLA 2Y3AA 2H6IA 2X6FA 3DPYA 1H2VC 1U2VG 3ZHEA 3HXEA 5CBOA 1G3NB 1Y8MA 3MZLB 2EIME 3JXIA 3ZFWA 2AWIA 2FEZA 3L16A 2QFCA 4OYSA 3Q49B 3D9IA 3PREA 4HS2A 1MX4A 4B0ZA 3DXKG 2GW1A 3FTWA 3RO3A 4HXIA 3LPZA 3PZ2A 3C3OA 3S2AA 2WVIA 4GB9A 3UIOC 2LAIA 2QY7A 3SO8A 1KT0A 2KZTB 4K5BA 4JHKA 2J49A 4N3CA 4UWHA 3VLFA 1U3CA 4Y6CA 3HRAA 2NC9A 2OEWA 4BEPA 2EQXA 3KSLA 3CKCA 3LY7A 4A3VA 1EF1C 1V54E 2H6GA 3CIAA 4I43A 2VTBB 3CK9A 3Q73A 1DCQA 4U04A 1BI7B 5JJTA 4ATZD 3B95A 2J4BA 3P2BA 2PZIA 5KNHD 1N4SA 4JB8P 3ZU7B 3SGHA 5B1BE 1NA3A 2P2CP 5B1AE 3FU3A 3LXUX 4O1OA 3S7JA 5HQ8A 3V31A 2HE0A 3E4BA 5KCMA 5AQ9A 3HHMA 3T9KA 4RLYA 3EUVA 3BEEA 5AJDA 1S64A 3ULYA 3FWVA 4LG6A 4AJWA 5C1DA 3CVNA 3ASHA 1TJFA 4GMJA 5FZSA 2Y4UA 2IQCA 4H7YA 3I4RB 4ATGA 5KBAA 4HOUA 3ZHEB 4BX8A 3FULA 2GROB 3IBEA 3RKVA 3SI5A 3B7BA 4UQXA 4EBAG 1MYOA 4DLQA 5DIZA 3D9KA 2XZTG 3LCAA 5HS0A 1OT8A 5KJKA 2KATA 2VSOE 3FU5A 5G2NA 4TRQA 3FU0A 3PS6A 3AG3E 3U64A 3PVLA 4DX7D 4I1OB 3CQGB 3LYAA 3UINC 3UUXA 1TEZA 3C3QA 2C0LA 3LVRE 3FTYA 4U0UA 2VSYA 3MV3B 3TXMA 5KJLA 4A1GA 3CEQA 3PE3A 5EDSA 4BSZB 2I6HA 2XS8A 3UT8A 1HU3A 2YHEA 4DK5A 3LEWA 4Q69A 2ILRA 3SFYA 2ZXWE 4TUUA 3ZRHA 1YCSB 3B7UX 4HLEA 4I2WA 1N4PA 2P9IG 3AJIA 3SY2A 2OCCE 3ZKJA 5FTPA 4HVBA 2UWJG 4AEZC 4A3TA 4U7EB 3B7SA 4HNAD 1TJCA 3DWLG 5EIBE 5D0OD 1V55E 4C9BB 5EILA 1FVFA 3FTXA 3JYSA 3JCKC 4V3IA 4FLBA 4L23A 4A63B 1JCRA 3EU9A 4XKBA 1LF8A 3VLEA 5B3SE 2J09A 4GYOA 2WXMA 3CHRA 4CDNA 5BUZA 2CG2A 3ASNE 3FH8A 1WDYA 1N94A 3G2TA 2UY1A 5DBKA 2PM6A 4ILGA 4JVSA 1E90A 2WPVA 3PRZA 3AS5A 3FTVA 2X6KA 4ACLA 3MJWA 1FT2A 2WMNA 2XGSA 4OAVB 3UT4A 2C2LA 4AXHA 4AV7A 1X5BA 4UI9J 3KEAA 3MX3A 5LCWJ 3TGOA 4G8LA 4O60A 3D9OA 1SA4A 2WQ7A 1NA0A 4RSYA 3FUHA 3IV0A 2DCPA 4RG6A 4G24A 2DWZA 4XZ4A 5ENQD 3S7DA 1GW6A 2VSNA 3SD5A 4G1TA 3UM0A 4E85A 3EHRA 2PQRA 4BESA 3C72A 4H7XA 4YVOA 4I9CA 3S7FA 1E96B 3PNLB 4XX5A 2AXZA 1E8YA 3I5PA 4J8EA 3ZYKA 3EHNA 1TNUA 3CR3A 4EZJA 2GRPB 4KXKB 3TG5A 2A5EA 4UWFA 1TNOA 3FH5A 1HZ4A 3DEPA 5EIDA 3FH7A 4JC8A 2J07A 2FO7A 3IHVA 4ANUA 1WG0A 4J0UA 2I1KA 3ML9A 5ANRA 3OAWA 3NOGD 3CK7A 3PUKA 4C0EA 3LJNA 2IEJA 1RW2A 4GZ3A 5KNGA 5CMYA 3V30A 5ENSD 1O1RA 3OTNA 2XHEA 3O4ZA 4WAFA 3K9IA 4TV3A 3CLJA 1YMPA 3D9MA 3B7RL 3CVLA 5FQ7A 1QNFA 4WUYA 4D10C 3AG2E 4HORA 4A55A 1B89A 1OCCE 5JHAA 3D3MA 3E30A 5D66A 4XEIG 3QKYA 4HI8A 2EILE 4G23A 5T3RA 2P58C 2UY1B 2LO6A 3ZN3A 1P5QA 3QDNA 5G04J 2MRIA 2IO3C 3R9MA 1TN6A 3HDXA 2XEVA 2FBNA 4PS3A 3QNKA 4CDMA 4RVBA 4B8AA 3T8MA 3E37A 3QARA 4WWOA 3GZ1A 1PY1A 2B0OE 3MA5A 2XENA 4JPSA 3MV2B 3N71A 2HO1A 3TAXA 4LNBA 2DZNA 3EDTB 4K5CA 3CHQA 4NACA 4BY6A 4FLHA 1L5JA 2R03A 3VTXA 4HRMB 4U95D 3FUFA 4BT9A 1BLXB 4DPRA 2YNQA 4KZ0A 2XPYA 4GCNA 3NBNB 5A23A 1WY6A 1O1TA 4CDRA 3JUIA 4ANVA 4L9PA 2F8XK 3Q15A 5FZQA 1O5MA 3PDNA 4GZDA 3MKQA 3ZVVA 4J8FA 3JQ1A 3DSXA 4UQZA 2IO2C 3ENEA 3RO2A 2OVBA 4YVQC 1SQMA 3ZGQA 4YDYA 1HXIA 1K1AA 3EU5A 3RK6A 3AS4A 3PEVB 3TXNA 3QWPA 4LERA 3FDHA 4JL0A 5BW8C 2I1JA 2JABA 1Z3YA 5FINA 1SVXA 1ELWA 3FUKA 4HBDA 3CVPA 4X8QA 2KBXA 4CEMA 4N39A 2ZGGA 4N5CA 2E0IA 3TWRA 2LSVA 1N11A 3Q79A 3UIPC 4FJZA 3RU0A 2BTDA 1ELKA 3UQ3A 2VGEA 4B93B 3C3RA 1LD8A 3MKRA 1IKND 2BKGA 3Q78A 2VGXA 2OV8A 2CHZA 3SQVA 1K3ZD 4BT8A 1E8XA 2ETCA 2V4HC 3ASGA 3KD7A 2YHCA 3AU4A 1UOHA 3R7QA 3T5VA 2M63A 3RRMB 2L6JA 2J4DA 5D0QD 2F8YA 3DSUA 3C98A 1OWPA 4O1PA 5ITZF 2P9UG 3Q9NC 5ENTD 2XZDG 2E2EA 5ARGA 3SFZA 3EIQC 2VGYA 4WNGA 3BQOA 1UJJA 4DI3A 3G2SA 4GMLA 1OWMA 2BF0X 4URKA 4PS7A 3JXJA 1N52A 4HLLA 3EHQA 1IQUA 3QWWA 5A6CA 3SBTB 2Y4TA 4BFRA 2XGMA 4OVUA 1LD7A 4GTVA 4BERA 1HF8A 1LTXA 2WXHA 3MKQB 4A1SA 3Q9UC 5E75A 3FP3A 3D9HA 3E33A 1E8WA 5BNWA 5CERB 4CYMD 3V79K 5A7DB 3AU5A 1N4RA 5ENPD 4DJAA 1TYQG 1S70B 4GYWA 4YDWA 3CVVA 3APCA 4GPMA 1KT1A 1N95A 3TWWA 1OWNA 5G05C 3GW4A 4TUMA 3T8KA 5G55A 4HOTA 3F6QA 1N54A 4U96D 5EYLA 1DNPA 1EDUA 1HG2A 1JCQA 1WM5A 2PNNA 3HXFA 3FUIA 3Q7AA 1K1BA 4EECA 4GMRA 4JHRA 3CHMA 2VGXB 2GRMA 4MKTA 4NRHB 2EIJE 4WNDA 4RG9A 2WXOA 2LAHA 5HI7A 1O1SA 4DLOA 4GA2A 3DSVA 2R2LA 4BX9A 4CRWA 1MX2A 3L08A 2XEHA 3EIJA 3CHPA 3BG0B 4U0SA 1BPOA 5ENRD 3DRAA 2WB2A 2IF4A 3ULEG 3DBSA 3PUJA 3FU6A 5BXOA 4LCTA 1S63A 4G25A 4AY5A 4LUNU 3FEYA 5AAOA 2LXLA 3E34A 3UT7A 4EHMA 3CSFA 4ZFHA 1A17A 3PNTB 5M72A 3CHSA 1UG3A 3U9WA 4FP7A 1YA0A 4UWLA 2WXRA 3FHEA 2J9QA 2GRLA 5G04C 1TNZA 3MEKA 2XCBA 4P29A 3RJVA 3G2VA 4KMOA 4EQFA 1H2TC 1KLXA 3HXDA 2RG8A 2IU1A 3CQCB 3B7TA 3D9JA 3D9LA 1BU9A 2WXLA 3EJNA 2WXNA 1SW6A 3QAQA 4JZYA 1E7VA 4LRZA 5BT1A 3RRNB 3FUDA 3APDA 1UN9A 5ANLA 5CECB 2BUGA 4W9RA 3LKUA 5IY5E 4GYYA 4U8HA 1YYHA 4FHKA 3PE4A 4YNDA 1QYMA 1NZNA 2FI7A 4GTRA 2QC9A 1QBQA 4HFGA 1FT1A 5J90A 1OWOA 4TXRA 4OAUC 3UTMA 3DSSA 3SZ7A 4ANXA 1XNFA 2ZU6B 2AJAA 1QZ2A 1TN7A 2RFMA 2KCLA 4AM9A 4GTSA 3GZ2A 2WM9A 2XS1A 1FVHA 4DX6D 3ASFA 5EN5D 2XEEA 4XKCA 1A5EA 3Q75A 5BV0A 3ASOE 5CCMA 5AQ7A 3ZXPA 4WNEA 3AS8A 1E8ZA 3PZ3A 5HKPA 5AIJA 1MX6A 1TNYA 4C0MA 2R5SA 5FT9A 2PM7A 2F37A 4YDEA 3G2WA 4ACKA 3HXCA 1WAO1 2BKKB 3MCXA 4F6RD 1OXJA 2B6CA 5AENA 3HG0D 2KCVA 5FZRA 2XQ0A 1IXVA 3S7BA 2XGOA 3Q47B 3NZSA 3CVUA 4F53A 5JMND 2P9KG 1RZ4A 2WXGA 2R02A 5CRVA 3T5XA 4NIKA 4EPZA 2PQNA 1BD8A 5FJYA 2ZISA 1JWFA 3LJ3A 1UN8A 2I9CA 2XPZA 4OVVA 4MBGA 1OUVA 5EX3A 1K8KG 3MYVA 1EYHA 4AP2A 3DSTA 1Z3XA 4EZLA 4GTTA 4G8KA 3TWXA 5CBNA 3KAEA 1D8DA 2H6HA 4EZKA 3ZNGA 3APFA 1ELRA 5EX0A 1IYGA 3UXGA 2XRZA 4WWPA 5D2MC 1BI8B 2H6FA 1E7UA 3DXMG 4MS6A 3PZ1A 3OXLA 2KC7A 4GTMA 5CHEE 3ZYQA 3ASDA 3CHOA 5AJLA 4Z68A 4G2VA 1N9AA 5T4YA 3ABKE 3QWVA 2GRQB 4UQYA 3TJPA 5BPPA 1ZB1A 3ZW3A 4ME2A 1Z5SC 3IEGA 4FU3A 4BTBA 3O48A 1PAQA 2CG3A 4HOQA 4J7WA 3FUEA 4I2ZA 2AW6A 3R7RA 1JCSA 1H6OA 2EIKE 2WMOA 3V2XA 2VQ2A 3HVEA 2GGFA 3D9NA 2X6IA 1IQRA 4AVXA 1HFAA 3RRUA 4PUCA 3UM1A 2X6JA 3TG4A 3L22A 2WXKA 2ONDA 4WNFA 4I1MA 3CVXA 2R59A 1ZBPA 3FUJA 1DVPA 4TXQA 4J8DA 4G11A 3BU8A 4PDXA 5E76A 4JW1A 3TWTA 2LSUA 3VLDA 2L0TB 1FCHA 3FUMA 4U8YD 3CVQA 3RIBA 2X38A 5EYPF 4UI9K 2WQHA 1HH8A 4F3VA 1N0RA 4B89A 3ZPJA 5J08A 3R9AB 4KVMA 4DRXE 3CKBA 5FWQA 3UKRG 4FULA 3UM2A 2V0PA 3E32A 4L1BA 4N2QA 3KSQA 3I4GA 1KZPA 5FQ8A 3AG4E 1AWCB 2XPIA 4ABNA 1TN8A 3LY8A 1H6PA 2VSXE 5LFAA 2NXPA 4APOA 2NSZA 4JEUA 5CRUA 2YQ8A 4LNUD 1XGWA 1PC2A 3WG7E 2PL2A 4N3BA 2MYOA 1NP7A 4Q94A 3QOUA 3LVQE 1KPSB 4N5QA 3UMVA 4GAAA 4PS8A 1N0QA 1N4QA 5JA4D 4JD2G 4BTAA 4UI9C 5LCWC 3ZYLA 3U66A 3CV0A 4GA1A 3ISMC 3AG1E 4DX5D 3ZEFA 2QYJA 3TWUA 4KBQA 5C2YA 4EBAA 2AXVA 4G26A 3LDZA 4ILHB 4TXPA 1Q2ZA 3U3WA 2OEVA 4AOFA 3HVEB 3HYMB 4IRUA 1HO8A 2V5FA 3JQ0A 3QJZA 4JEHA 1W3BA 2VYIA 4XE0A 3V2OA 2GRRB 2V8SE 2ZGDA 5T8IA 3CSTA 2J08A 2J8SD 4QFVA 2FULA 4J6IA 4L7TA 2VJ8A 4DX2A 3Q5MA 3NQPA 1VDYA 4K5AB 3SBSA 4HI9A 1ZU2A 3B13A 4I6EA 4HOSA 3Q7FA 3EHMA 3G2UA 4AIFA 4CGWA 3UPVA 3FFLA 3KS2A 1DCEA 3HXBA 3Q4AB 3IKOB 1OCZE 4I9EA 2RKKA 3ZUVB 4CT0A 4CCAA 4BETA 3ABLE 2RFAA 2KM4A 4JA7A 1H6KA 4Y6WA 4FHJA 1OY3D 3ONLA 4I1AA 4UWGA 2A4ZA 1S0PA 5LP0A 4XI9A 5FIOA 3FTUA 1H0AA 3X2QE 3QK0A 5JHBA 3DPDA 3L17A 4BWRA 4KZCA 3HIZA 2P9SG 2OVFA 2AVPA 3C5RA 2WXPA 4GZ6A 1AP7A 3TWSA 3L6AA 2JLBA 4F7AA 3ESLA 1FPPA 1EPUA 4L2YA 2NYJA 5JJ6A 4IULA 5BXUA 1NI1A 4LNGA 1U3DA 1X81A 3SF4A 4B94A 1IHGA 2I2OA 4JHJA 4U63A 1OCOE 4L2LA 2DIWA 2KCKA 3ZXSA 1OCRE 5BV1A 2CFUA 3J5PA 4MLPA 3SNXA 2Y1LE 4FA6A 1H2UA 3DEOA 3QC1A 2Y69E 1NFIE 4E6HA 4PH4B 4GU5A 5JJ7A 4GCOA 3L82A 4MRUA 2HM8A 3FTZA 3ULQA 4Q96A 1HS6A 3RAUA 3W9GA 2FF4A 3UI2A 4LEUA 5EKQD 5KJMA 3OXFA 4IYPA 4DX1A 2HR2A 3GZSA 2MOWA 2IOSA 3AAAC 4JA9A 5CEAA 2YINA 3L54A 3D9PA 1DC2A 5FQ6A 4CT4A 5AN8A 3LS8A 1IHBA 4UWKA 4KYOB 3ESKA 4BSXA 2L9BA 3TL5A 2KXPC 2LUHA 1MQSA 2WQ6A 2MHKA 2JEKA 5HRYA 2P9PG 3J5QB 2XRYA 4I6JA 3P1UA 4M3OA 4XI0A 4FADA 4KVOA 3PZDA 3FY4A 2ZIRA 1Y6IA 2X3MA 3NZUA 4DUIA 1SZ9A 2P9NG 5ENOD 3L9TA 4K03A 4LSZE 5LX8A 2F0YA 4GTOA 5G05J 3NOCD 4QQIA 2LXMA 3CVYA 1TR4A 3ZYMA 2R05A 2IONA 4K0RA 1D8EA 3TWQA 2DYRE 1HE8A 2QZAA 4C48B 2IJGX 5AARA 5AYWD 4N3AA 5FQ4A 1UJKA 5AQBA 3FTSA 3W9FA 5CMWA 2WXIA 4GZCA 2CHWA 2R17C 3NAWA 4ILIA 3NF1A 3I3NA 2ETBA 3OXGA 3GYZA 2L6BA 4ANWA 4GZ5A 1SA5A 2C0MA 3LY9A 3ABME 1MHQA 4WWNA 3WXXA 2GRNB 5KJNA 5H7PA 2IFUA 2CFZA 2Q7FA 4N2SA 2L0IA 4RQIA 4O6FA 3FUNA 1H19A 4UUCA 4CZ2D 4APFA 3CK8A 2ETAA 3CGHA 1SZAA 3SFXA 2DVWA 3PEUB 2A5UA 5CCLA 1MJ0A 4J8YA 4M7CA 4DI4A 2OOEA 5CEDB 4HB5A 3IHYA 2QYUA 2BEDA 4I17A 4JXTA 3BG1B 4GA0A 4FJYA 3RSEG 2FO1E 4I6GA 3PH0C 1INZA 2AXUA 4NURA 1NL4A 3ZIMA 3IXEA 3FEXA 4YDOA 5KWDA 1KZOA 3L13A 1Z6TA 2IOLA 2P9LG 4U8VD 2EINE 2CHXA 5ARFA 4GTPA 2HYZA 4U07A 3ML8A 3SHFA 2KZTA 5ENNA 4AY6A 5LOZA 2WXFA 4IN3B 3VTYA 1TNBA 3PZ4A 4NQ0A 4HQDA 3TWVA 3DSWA 4CGVA 4KT6B 4GTQA 2VTBA 3KEZA 2X6HA 1JPLA 3JUEA 3UKUG 2RD0A 4R7LA 4FC8A 3NB2A 5AQAA 4F1SA 4ZHBA 1JWGA 2DZOA 1HX8A 2Y0BG 3U4TA 2V5QC 2WXQA
chains in the Genus database with same CATH topology
3CVWA 4GA1A 3G2VA 3CK7A 3PUKA 3ZEFA 4C0EA 3QB2A 4KMOA 3URZA 4GZ3A 4KBQA 4EQFA 1H2TC 1UW4B 2WXJA 5CMYA 2AXVA 4G26A 1KLXA 5C2YA 3UX4A 3LDZA 4ILHB 3MGBA 2XHEA 3O4ZA 2RG8A 3OTNA 4WAFA 3K9IA 2IU1A 2DBAA 4TV3A 3CLJA 3U3WA 2V4LA 3CQCB 3B7TA 3D9MA 3B7RL 3CVLA 5FQ7A 1QNFA 4AOFA 3HVEB 3HYMB 4IRUA 4WUYA 2LNIA 3D9JA 4EBAA 1HO8A 2V5FA 3D9LA 3JQ0A 3QJZA 4JEHA 4D10C 1W3BA 2WXLA 3EJNA 2VYIA 2WXNA 4XE0A 3QAQA 4GPKA 2V8SE 1JUQA 4HORA 1OWLA 4U0ZA 1QQEA 4A55A 5T8IA 1B89A 1E7VA 4JZYA 5JHAA 3CSTA 4LRZA 3ONKA 2J08A 3D3MA 5BT1A 4XIFA 4QFVA 2FULA 2XCCA 4J6IA 2VJ8A 4L7TA 3RRNB 4B8CB 3Q5MA 3NQPA 1HG5A 4J8SA 3FUDA 1VDYA 3APDA 3SBSA 2Y3AA 1UN9A 5ANLA 1ZU2A 3B13A 2X6FA 4I6EA 1H2VC 4HOSA 3EHMA 2BUGA 3QKYA 3ZHEA 3G2UA 4AIFA 4W9RA 3LKUA 4G23A 4CGWA 3UPVA 3FFLA 3KS2A 5T3RA 2P58C 2UY1B 2LO6A 3Q4AB 4GYYA 3ZN3A 1P5QA 1Y8MA 3MZLB 4U8HA 3IKOB 3QDNA 5G04J 2MRIA 3ZFWA 2AWIA 4FHKA 3PE4A 4YNDA 4I9EA 2FI7A 1NZNA 4CT0A 2FEZA 3HDXA 2XEVA 2QFCA 2FBNA 3L16A 4OYSA 4PS3A 4CCAA 2KM4A 3Q49B 3QNKA 1H6KA 4JA7A 4RVBA 4B8AA 4CDMA 3T8MA 4Y6WA 4FHJA 4HFGA 3QARA 3D9IA 5J90A 3PREA 1OWOA 4HS2A 4WWOA 3ONLA 4I1AA 4UWGA 3GZ1A 1PY1A 4B0ZA 2A4ZA 1S0PA 3MA5A 5LP0A 2GW1A 4XI9A 4JPSA 3SZ7A 3FTUA 1H0AA 4ANXA 3MV2B 3N71A 1XNFA 2HO1A 3FTWA 2ZU6B 3QK0A 3DPDA 1QZ2A 4HXIA 3RO3A 3LPZA 3TAXA 5JHBA 3L17A 2KCLA 3EDTB 3S2AA 4BWRA 2WVIA 4GB9A 4KZCA 3CHQA 4NACA 4AM9A 4BY6A 3HIZA 2LAIA 4FLHA 1L5JA 2OVFA 2QY7A 3GZ2A 2AVPA 3VTXA 2WXPA 2WM9A 4GZ6A 1FVHA 3FUFA 3L6AA 2JLBA 3ASFA 1KT0A 4XKCA 4F7AA 3ESLA 2KZTB 4JHKA 2J49A 4N3CA 4UWHA 3VLFA 4BT9A 1EPUA 4L2YA 1U3CA 4DPRA 5BV0A 4Y6CA 5CCMA 5JJ6A 4IULA 2NC9A 2YNQA 4KZ0A 2XPYA 4GCNA 1U3DA 2EQXA 3SF4A 3CKCA 3LY7A 5A23A 4WNEA 3AS8A 4A3VA 1EF1C 1E8ZA 3CIAA 1WY6A 4B94A 4I43A 1IHGA 2I2OA 4CDRA 3JUIA 4ANVA 5AIJA 2VTBB 3CK9A 4C0MA 4U04A 3Q15A 5FZQA 5JJTA 2R5SA 4JHJA 4U63A 5FT9A 2PM7A 2J4BA 3PDNA 4GZDA 3MKQA 4L2LA 3P2BA 3ZVVA 2PZIA 4J8FA 2DIWA 2KCKA 3ZXSA 5BV1A 3JQ1A 2CFUA 4MLPA 4UQZA 3ENEA 3SNXA 3RO2A 3SGHA 2OVBA 3G2WA 4YVQC 4FA6A 1SQMA 3ZGQA 1HXIA 1NA3A 4ACKA 3RK6A 3AS4A 1H2UA 1WAO1 3PEVB 3MCXA 3FU3A 3TXNA 3LXUX 3QC1A 3S7JA 5HQ8A 3QWPA 5AENA 4LERA 4E6HA 3FDHA 3E4BA 4PH4B 4JL0A 5KCMA 2KCVA 5BW8C 2I1JA 3HHMA 4GU5A 5FZRA 5JJ7A 2XQ0A 4GCOA 1Z3YA 3S7BA 3BEEA 4MRUA 5AJDA 2XGOA 3Q47B 2HM8A 3NZSA 1ELWA 3FWVA 3FTZA 3ULQA 3CVUA 3FUKA 4Q96A 4F53A 1HS6A 3CVPA 4AJWA 3CVNA 5C1DA 5KJMA 2FF4A 4LEUA 5EKQD 3OXFA 4CEMA 4IYPA 4N39A 2WXGA 4N5CA 2E0IA 3ASHA 2HR2A 1TJFA 4GMJA 3GZSA 5FZSA 2Y4UA 3T5XA 4EPZA 2PQNA 2MOWA 2LSVA 2IOSA 5FJYA 4JA9A 2YINA 1JWFA 2IQCA 3L54A 3LJ3A 4H7YA 1UN8A 4FJZA 3D9PA 3I4RB 2I9CA 4ATGA 2XPZA 4HOUA 4OVVA 3ZHEB 3RU0A 5FQ6A 1OUVA 2BTDA 4BX8A 4CT4A 1ELKA 3FULA 3IBEA 3UQ3A 5EX3A 3RKVA 3SI5A 3LS8A 3U66A 4UQXA 4UWKA 4EBAG 3MYVA 3MKRA 1EYHA 4KYOB 4F1SA 3ESKA 4BSXA 4AP2A 4DLQA 2L9BA 3TL5A 5DIZA 2VGXA 2OV8A 2CHZA 3D9KA 5LFAA 1Z3XA 4BT8A 3ASGA 1E8XA 4EZLA 3KD7A 1MQSA 2YHCA 3LCAA 2WQ6A 3AU4A 3R7QA 5KJKA 3T5VA 2M63A 3KAEA 3RRMB 2KATA 2MHKA 2JEKA 2VSOE 3FU5A 5G2NA 4TRQA 3FU0A 2L6JA 2XRYA 4I6JA 4EZKA 2J4DA 3P1UA 4M3OA 4XI0A 5D0QD 4FADA 3APFA 4KVOA 3PS6A 3PZDA 1ELRA 3C98A 3FY4A 1OWPA 5EX0A 3U64A 1IYGA 1Y6IA 2X3MA 3PVLA 3NZUA 2XRZA 1SZ9A 4WWPA 4I1OB 2E2EA 3CQGB 3LYAA 4K03A 5LX8A 5ARGA 3SFZA 3UUXA 1E7UA 1TEZA 3EIQC 5G05J 2VGYA 4MS6A 3UMVA 4WNGA 3CVYA 3ZYMA 1UJJA 2C0LA 3OXLA 2KC7A 5CHEE 3ZYQA 3LVRE 3FTYA 2IONA 3ASDA 4K0RA 4DI3A 4U0UA 2VSYA 3G2SA 3MV3B 4GMLA 3TXMA 1OWMA 2BF0X 4URKA 3CHOA 5KJLA 4A1GA 3CEQA 4PS7A 5AJLA 4G2VA 1N52A 1HE8A 5T4YA 3PE3A 2IJGX 5EDSA 2I6HA 3QWVA 5AYWD 4N3AA 3UT8A 1HU3A 5FQ4A 1UJKA 1IQUA 3QWWA 3FTSA 4UQYA 2YHEA 3TJPA 5BPPA 5A6CA 4DK5A 5CMWA 3SBTB 2WXIA 3ZW3A 4GZCA 3LEWA 2CHWA 4ME2A 2R17C 4ILIA 2Y4TA 3IEGA 3NF1A 4BFRA 3I3NA 4FU3A 4BTBA 2XGMA 4Q69A 2ILRA 3O48A 4OVUA 1PAQA 2CG3A 4HOQA 4TUUA 3OXGA 3GYZA 3ZRHA 3B7UX 3FUEA 4HLEA 4I2WA 4ANWA 4I2ZA 1HF8A 2AW6A 3R7RA 2WXHA 3MKQB 4A1SA 5E75A 4GZ5A 2C0MA 5FTPA 3FP3A 3LY9A 4HVBA 2UWJG 4WWNA 1MHQA 3WXXA 4AEZC 1E8WA 4A3TA 5BNWA 3B7SA 5KJNA 1TJCA 2WMOA 2IFUA 2VQ2A 2CFZA 2Q7FA 3HVEA 5D0OD 4N2SA 2GGFA 3D9NA 2X6IA 5A7DB 3AU5A 1IQRA 1FVFA 3FTXA 4C9BB 2L0IA 3JYSA 3JCKC 4O6FA 4V3IA 4DJAA 3FUNA 1H19A 4FLBA 4GYWA 4L23A 4AVXA 1HFAA 4XKBA 3RRUA 4APFA 3CV0A 3CVVA 3APCA 4PUCA 1LF8A 3VLEA 3CK8A 1KT1A 2X6JA 3CGHA 1SZAA 2J09A 3TG4A 3L22A 1OWNA 2ONDA 2WXKA 3PEUB 4GYOA 4WNFA 5G05C 3GW4A 2WXMA 3CHRA 4I1MA 4CDNA 3CVXA 2A5UA 5BUZA 2CG2A 5CCLA 5G55A 3FH8A 2R59A 1ZBPA 3FUJA 1DVPA 4HOTA 4J8DA 4G11A 1N54A 3G2TA 2UY1A 4PDXA 2PM6A 4ILGA 5DBKA 4JVSA 1EDUA 1E90A 1DNPA 1HG2A 4DI4A 5E76A 2OOEA 4JW1A 2WPVA 3IHYA 2LSUA 2L0TB 1WM5A 3PRZA 3AS5A 3FTVA 3VLDA 2X6KA 3FUIA 1FCHA 4I17A 3FUMA 3MJWA 4ACLA 4JXTA 3BG1B 2WMNA 2XGSA 3CVQA 3RIBA 2X38A 4EECA 3UT4A 2C2LA 4AXHA 4GA0A 4UI9K 2WQHA 4FJYA 4AV7A 4I6GA 4JHRA 3CHMA 1HH8A 1X5BA 4UI9J 3PH0C 4F3VA 2VGXB 3MX3A 2GRMA 5LCWJ 3TGOA 1INZA 2AXUA 4B89A 4MKTA 3D9OA 4NRHB 3ZPJA 4WNDA 4RG9A 2WQ7A 5J08A 2WXOA 3R9AB 1NA0A 4RSYA 4KVMA 4NURA 2LAHA 3FUHA 5HI7A 3ZIMA 4DLOA 3IV0A 2DCPA 3FEXA 4GA2A 3CKBA 4RG6A 4G24A 5FWQA 4XZ4A 3S7DA 4BX9A 1GW6A 4CRWA 4FULA 2V0PA 3EIJA 3L08A 4L1BA 4N2QA 3L13A 1Z6TA 2IOLA 2VSNA 3I4GA 3SD5A 2CHXA 5ARFA 3CHPA 4G1TA 3BG0B 5FQ8A 4U0SA 1BPOA 4E85A 2HYZA 4U07A 2PQRA 2WB2A 3ML8A 3SHFA 2XPIA 2IF4A 2KZTA 5ENNA 4ABNA 3LY8A 4H7XA 3DBSA 5LOZA 2VSXE 4AY6A 3PUJA 2WXFA 2NXPA 3FU6A 4IN3B 4YVOA 4I9CA 4LCTA 3S7FA 4APOA 1E96B 3PNLB 4XX5A 2NSZA 2AXZA 3VTYA 1E8YA 4G25A 3I5PA 4J8EA 4JEUA 3ZYKA 2YQ8A 4NQ0A 4AY5A 4LUNU 3FEYA 3EHNA 1XGWA 3CR3A 1PC2A 4EZJA 4KXKB 3TG5A 3UT7A 2PL2A 4CGVA 4KT6B 4N3BA 2VTBA 3KEZA 3CSFA 2X6HA 1A17A 4UWFA 3FH5A 1JPLA 1NP7A 1HZ4A 4Q94A 2RD0A 3PNTB 5M72A 3QOUA 4R7LA 3LVQE 4FC8A 3CHSA 1UG3A 3U9WA 4FP7A 4GAAA 1YA0A 3FH7A 2WXRA 4PS8A 4JC8A 3FHEA 4UWLA 2J07A 2FO7A 3IHVA 2J9QA 4ANUA 1JWGA 2GRLA 5G04C 3MEKA 2XCBA 4J0UA 4P29A 2I1KA 3ML9A 5ANRA 3RJVA 3OAWA 1HX8A 4BTAA 3U4TA 4UI9C 5LCWC 3ZYLA 2WXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HVE A;  3HVE B;  2EQX A;  4HS2 A;  4APF A;  3I3N A;  4AP2 A;  4HXI A; 
#chains in the Genus database with same CATH topology
 3CVW A;  4HRN A;  3QB2 A;  3URZ A;  1MZC A;  1UW4 B;  2WXJ A;  3UX4 A;  3MGB A;  2IY0 C;  2DBA A;  2V4L A;  4F1P A;  3UM3 A;  2LNI A;  2DYS E;  4GPK A;  3BUA A;  1JUQ A;  1OWL A;  4U0Z A;  1QQE A;  3ONK A;  4XIF A;  2XCC A;  1D9S A;  4B8C B;  1HG5 A;  4J8S A;  4HRL A;  2Y3A A;  2H6I A;  2X6F A;  3DPY A;  1H2V C;  1U2V G;  3ZHE A;  3HXE A;  5CBO A;  1G3N B;  1Y8M A;  3MZL B;  2EIM E;  3JXI A;  3ZFW A;  2AWI A;  2FEZ A;  3L16 A;  2QFC A;  4OYS A;  3Q49 B;  3D9I A;  3PRE A;  4HS2 A;  1MX4 A;  4B0Z A;  3DXK G;  2GW1 A;  3FTW A;  3RO3 A;  4HXI A;  3LPZ A;  3PZ2 A;  3C3O A;  3S2A A;  2WVI A;  4GB9 A;  3UIO C;  2LAI A;  2QY7 A;  3SO8 A;  1KT0 A;  2KZT B;  4K5B A;  4JHK A;  2J49 A;  4N3C A;  4UWH A;  3VLF A;  1U3C A;  4Y6C A;  3HRA A;  2NC9 A;  2OEW A;  4BEP A;  2EQX A;  3KSL A;  3CKC A;  3LY7 A;  4A3V A;  1EF1 C;  1V54 E;  2H6G A;  3CIA A;  4I43 A;  2VTB B;  3CK9 A;  3Q73 A;  1DCQ A;  4U04 A;  1BI7 B;  5JJT A;  4ATZ D;  3B95 A;  2J4B A;  3P2B A;  2PZI A;  5KNH D;  1N4S A;  4JB8 P;  3ZU7 B;  3SGH A;  5B1B E;  1NA3 A;  2P2C P;  5B1A E;  3FU3 A;  3LXU X;  4O1O A;  3S7J A;  5HQ8 A;  3V31 A;  2HE0 A;  3E4B A;  5KCM A;  5AQ9 A;  3HHM A;  3T9K A;  4RLY A;  3EUV A;  3BEE A;  5AJD A;  1S64 A;  3ULY A;  3FWV A;  4LG6 A;  4AJW A;  5C1D A;  3CVN A;  3ASH A;  1TJF A;  4GMJ A;  5FZS A;  2Y4U A;  2IQC A;  4H7Y A;  3I4R B;  4ATG A;  5KBA A;  4HOU A;  3ZHE B;  4BX8 A;  3FUL A;  2GRO B;  3IBE A;  3RKV A;  3SI5 A;  3B7B A;  4UQX A;  4EBA G;  1MYO A;  4DLQ A;  5DIZ A;  3D9K A;  2XZT G;  3LCA A;  5HS0 A;  1OT8 A;  5KJK A;  2KAT A;  2VSO E;  3FU5 A;  5G2N A;  4TRQ A;  3FU0 A;  3PS6 A;  3AG3 E;  3U64 A;  3PVL A;  4DX7 D;  4I1O B;  3CQG B;  3LYA A;  3UIN C;  3UUX A;  1TEZ A;  3C3Q A;  2C0L A;  3LVR E;  3FTY A;  4U0U A;  2VSY A;  3MV3 B;  3TXM A;  5KJL A;  4A1G A;  3CEQ A;  3PE3 A;  5EDS A;  4BSZ B;  2I6H A;  2XS8 A;  3UT8 A;  1HU3 A;  2YHE A;  4DK5 A;  3LEW A;  4Q69 A;  2ILR A;  3SFY A;  2ZXW E;  4TUU A;  3ZRH A;  1YCS B;  3B7U X;  4HLE A;  4I2W A;  1N4P A;  2P9I G;  3AJI A;  3SY2 A;  2OCC E;  3ZKJ A;  5FTP A;  4HVB A;  2UWJ G;  4AEZ C;  4A3T A;  4U7E B;  3B7S A;  4HNA D;  1TJC A;  3DWL G;  5EIB E;  5D0O D;  1V55 E;  4C9B B;  5EIL A;  1FVF A;  3FTX A;  3JYS A;  3JCK C;  4V3I A;  4FLB A;  4L23 A;  4A63 B;  1JCR A;  3EU9 A;  4XKB A;  1LF8 A;  3VLE A;  5B3S E;  2J09 A;  4GYO A;  2WXM A;  3CHR A;  4CDN A;  5BUZ A;  2CG2 A;  3ASN E;  3FH8 A;  1WDY A;  1N94 A;  3G2T A;  2UY1 A;  5DBK A;  2PM6 A;  4ILG A;  4JVS A;  1E90 A;  2WPV A;  3PRZ A;  3AS5 A;  3FTV A;  2X6K A;  4ACL A;  3MJW A;  1FT2 A;  2WMN A;  2XGS A;  4OAV B;  3UT4 A;  2C2L A;  4AXH A;  4AV7 A;  1X5B A;  4UI9 J;  3KEA A;  3MX3 A;  5LCW J;  3TGO A;  4G8L A;  4O60 A;  3D9O A;  1SA4 A;  2WQ7 A;  1NA0 A;  4RSY A;  3FUH A;  3IV0 A;  2DCP A;  4RG6 A;  4G24 A;  2DWZ A;  4XZ4 A;  5ENQ D;  3S7D A;  1GW6 A;  2VSN A;  3SD5 A;  4G1T A;  3UM0 A;  4E85 A;  3EHR A;  2PQR A;  4BES A;  3C72 A;  4H7X A;  4YVO A;  4I9C A;  3S7F A;  1E96 B;  3PNL B;  4XX5 A;  2AXZ A;  1E8Y A;  3I5P A;  4J8E A;  3ZYK A;  3EHN A;  1TNU A;  3CR3 A;  4EZJ A;  2GRP B;  4KXK B;  3TG5 A;  2A5E A;  4UWF A;  1TNO A;  3FH5 A;  1HZ4 A;  3DEP A;  5EID A;  3FH7 A;  4JC8 A;  2J07 A;  2FO7 A;  3IHV A;  4ANU A;  1WG0 A;  4J0U A;  2I1K A;  3ML9 A;  5ANR A;  3OAW A;  3NOG D;  3CK7 A;  3PUK A;  4C0E A;  3LJN A;  2IEJ A;  1RW2 A;  4GZ3 A;  5KNG A;  5CMY A;  3V30 A;  5ENS D;  1O1R A;  3OTN A;  2XHE A;  3O4Z A;  4WAF A;  3K9I A;  4TV3 A;  3CLJ A;  1YMP A;  3D9M A;  3B7R L;  3CVL A;  5FQ7 A;  1QNF A;  4WUY A;  4D10 C;  3AG2 E;  4HOR A;  4A55 A;  1B89 A;  1OCC E;  5JHA A;  3D3M A;  3E30 A;  5D66 A;  4XEI G;  3QKY A;  4HI8 A;  2EIL E;  4G23 A;  5T3R A;  2P58 C;  2UY1 B;  2LO6 A;  3ZN3 A;  1P5Q A;  3QDN A;  5G04 J;  2MRI A;  2IO3 C;  3R9M A;  1TN6 A;  3HDX A;  2XEV A;  2FBN A;  4PS3 A;  3QNK A;  4CDM A;  4RVB A;  4B8A A;  3T8M A;  3E37 A;  3QAR A;  4WWO A;  3GZ1 A;  1PY1 A;  2B0O E;  3MA5 A;  2XEN A;  4JPS A;  3MV2 B;  3N71 A;  2HO1 A;  3TAX A;  4LNB A;  2DZN A;  3EDT B;  4K5C A;  3CHQ A;  4NAC A;  4BY6 A;  4FLH A;  1L5J A;  2R03 A;  3VTX A;  4HRM B;  4U95 D;  3FUF A;  4BT9 A;  1BLX B;  4DPR A;  2YNQ A;  4KZ0 A;  2XPY A;  4GCN A;  3NBN B;  5A23 A;  1WY6 A;  1O1T A;  4CDR A;  3JUI A;  4ANV A;  4L9P A;  2F8X K;  3Q15 A;  5FZQ A;  1O5M A;  3PDN A;  4GZD A;  3MKQ A;  3ZVV A;  4J8F A;  3JQ1 A;  3DSX A;  4UQZ A;  2IO2 C;  3ENE A;  3RO2 A;  2OVB A;  4YVQ C;  1SQM A;  3ZGQ A;  4YDY A;  1HXI A;  1K1A A;  3EU5 A;  3RK6 A;  3AS4 A;  3PEV B;  3TXN A;  3QWP A;  4LER A;  3FDH A;  4JL0 A;  5BW8 C;  2I1J A;  2JAB A;  1Z3Y A;  5FIN A;  1SVX A;  1ELW A;  3FUK A;  4HBD A;  3CVP A;  4X8Q A;  2KBX A;  4CEM A;  4N39 A;  2ZGG A;  4N5C A;  2E0I A;  3TWR A;  2LSV A;  1N11 A;  3Q79 A;  3UIP C;  4FJZ A;  3RU0 A;  2BTD A;  1ELK A;  3UQ3 A;  2VGE A;  4B93 B;  3C3R A;  1LD8 A;  3MKR A;  1IKN D;  2BKG A;  3Q78 A;  2VGX A;  2OV8 A;  2CHZ A;  3SQV A;  1K3Z D;  4BT8 A;  1E8X A;  2ETC A;  2V4H C;  3ASG A;  3KD7 A;  2YHC A;  3AU4 A;  1UOH A;  3R7Q A;  3T5V A;  2M63 A;  3RRM B;  2L6J A;  2J4D A;  5D0Q D;  2F8Y A;  3DSU A;  3C98 A;  1OWP A;  4O1P A;  5ITZ F;  2P9U G;  3Q9N C;  5ENT D;  2XZD G;  2E2E A;  5ARG A;  3SFZ A;  3EIQ C;  2VGY A;  4WNG A;  3BQO A;  1UJJ A;  4DI3 A;  3G2S A;  4GML A;  1OWM A;  2BF0 X;  4URK A;  4PS7 A;  3JXJ A;  1N52 A;  4HLL A;  3EHQ A;  1IQU A;  3QWW A;  5A6C A;  3SBT B;  2Y4T A;  4BFR A;  2XGM A;  4OVU A;  1LD7 A;  4GTV A;  4BER A;  1HF8 A;  1LTX A;  2WXH A;  3MKQ B;  4A1S A;  3Q9U C;  5E75 A;  3FP3 A;  3D9H A;  3E33 A;  1E8W A;  5BNW A;  5CER B;  4CYM D;  3V79 K;  5A7D B;  3AU5 A;  1N4R A;  5ENP D;  4DJA A;  1TYQ G;  1S70 B;  4GYW A;  4YDW A;  3CVV A;  3APC A;  4GPM A;  1KT1 A;  1N95 A;  3TWW A;  1OWN A;  5G05 C;  3GW4 A;  4TUM A;  3T8K A;  5G55 A;  4HOT A;  3F6Q A;  1N54 A;  4U96 D;  5EYL A;  1DNP A;  1EDU A;  1HG2 A;  1JCQ A;  1WM5 A;  2PNN A;  3HXF A;  3FUI A;  3Q7A A;  1K1B A;  4EEC A;  4GMR A;  4JHR A;  3CHM A;  2VGX B;  2GRM A;  4MKT A;  4NRH B;  2EIJ E;  4WND A;  4RG9 A;  2WXO A;  2LAH A;  5HI7 A;  1O1S A;  4DLO A;  4GA2 A;  3DSV A;  2R2L A;  4BX9 A;  4CRW A;  1MX2 A;  3L08 A;  2XEH A;  3EIJ A;  3CHP A;  3BG0 B;  4U0S A;  1BPO A;  5ENR D;  3DRA A;  2WB2 A;  2IF4 A;  3ULE G;  3DBS A;  3PUJ A;  3FU6 A;  5BXO A;  4LCT A;  1S63 A;  4G25 A;  4AY5 A;  4LUN U;  3FEY A;  5AAO A;  2LXL A;  3E34 A;  3UT7 A;  4EHM A;  3CSF A;  4ZFH A;  1A17 A;  3PNT B;  5M72 A;  3CHS A;  1UG3 A;  3U9W A;  4FP7 A;  1YA0 A;  4UWL A;  2WXR A;  3FHE A;  2J9Q A;  2GRL A;  5G04 C;  1TNZ A;  3MEK A;  2XCB A;  4P29 A;  3RJV A;  3G2V A;  4KMO A;  4EQF A;  1H2T C;  1KLX A;  3HXD A;  2RG8 A;  2IU1 A;  3CQC B;  3B7T A;  3D9J A;  3D9L A;  1BU9 A;  2WXL A;  3EJN A;  2WXN A;  1SW6 A;  3QAQ A;  4JZY A;  1E7V A;  4LRZ A;  5BT1 A;  3RRN B;  3FUD A;  3APD A;  1UN9 A;  5ANL A;  5CEC B;  2BUG A;  4W9R A;  3LKU A;  5IY5 E;  4GYY A;  4U8H A;  1YYH A;  4FHK A;  3PE4 A;  4YND A;  1QYM A;  1NZN A;  2FI7 A;  4GTR A;  2QC9 A;  1QBQ A;  4HFG A;  1FT1 A;  5J90 A;  1OWO A;  4TXR A;  4OAU C;  3UTM A;  3DSS A;  3SZ7 A;  4ANX A;  1XNF A;  2ZU6 B;  2AJA A;  1QZ2 A;  1TN7 A;  2RFM A;  2KCL A;  4AM9 A;  4GTS A;  3GZ2 A;  2WM9 A;  2XS1 A;  1FVH A;  4DX6 D;  3ASF A;  5EN5 D;  2XEE A;  4XKC A;  1A5E A;  3Q75 A;  5BV0 A;  3ASO E;  5CCM A;  5AQ7 A;  3ZXP A;  4WNE A;  3AS8 A;  1E8Z A;  3PZ3 A;  5HKP A;  5AIJ A;  1MX6 A;  1TNY A;  4C0M A;  2R5S A;  5FT9 A;  2PM7 A;  2F37 A;  4YDE A;  3G2W A;  4ACK A;  3HXC A;  1WAO 1;  2BKK B;  3MCX A;  4F6R D;  1OXJ A;  2B6C A;  5AEN A;  3HG0 D;  2KCV A;  5FZR A;  2XQ0 A;  1IXV A;  3S7B A;  2XGO A;  3Q47 B;  3NZS A;  3CVU A;  4F53 A;  5JMN D;  2P9K G;  1RZ4 A;  2WXG A;  2R02 A;  5CRV A;  3T5X A;  4NIK A;  4EPZ A;  2PQN A;  1BD8 A;  5FJY A;  2ZIS A;  1JWF A;  3LJ3 A;  1UN8 A;  2I9C A;  2XPZ A;  4OVV A;  4MBG A;  1OUV A;  5EX3 A;  1K8K G;  3MYV A;  1EYH A;  4AP2 A;  3DST A;  1Z3X A;  4EZL A;  4GTT A;  4G8K A;  3TWX A;  5CBN A;  3KAE A;  1D8D A;  2H6H A;  4EZK A;  3ZNG A;  3APF A;  1ELR A;  5EX0 A;  1IYG A;  3UXG A;  2XRZ A;  4WWP A;  5D2M C;  1BI8 B;  2H6F A;  1E7U A;  3DXM G;  4MS6 A;  3PZ1 A;  3OXL A;  2KC7 A;  4GTM A;  5CHE E;  3ZYQ A;  3ASD A;  3CHO A;  5AJL A;  4Z68 A;  4G2V A;  1N9A A;  5T4Y A;  3ABK E;  3QWV A;  2GRQ B;  4UQY A;  3TJP A;  5BPP A;  1ZB1 A;  3ZW3 A;  4ME2 A;  1Z5S C;  3IEG A;  4FU3 A;  4BTB A;  3O48 A;  1PAQ A;  2CG3 A;  4HOQ A;  4J7W A;  3FUE A;  4I2Z A;  2AW6 A;  3R7R A;  1JCS A;  1H6O A;  2EIK E;  2WMO A;  3V2X A;  2VQ2 A;  3HVE A;  2GGF A;  3D9N A;  2X6I A;  1IQR A;  4AVX A;  1HFA A;  3RRU A;  4PUC A;  3UM1 A;  2X6J A;  3TG4 A;  3L22 A;  2WXK A;  2OND A;  4WNF A;  4I1M A;  3CVX A;  2R59 A;  1ZBP A;  3FUJ A;  1DVP A;  4TXQ A;  4J8D A;  4G11 A;  3BU8 A;  4PDX A;  5E76 A;  4JW1 A;  3TWT A;  2LSU A;  3VLD A;  2L0T B;  1FCH A;  3FUM A;  4U8Y D;  3CVQ A;  3RIB A;  2X38 A;  5EYP F;  4UI9 K;  2WQH A;  1HH8 A;  4F3V A;  1N0R A;  4B89 A;  3ZPJ A;  5J08 A;  3R9A B;  4KVM A;  4DRX E;  3CKB A;  5FWQ A;  3UKR G;  4FUL A;  3UM2 A;  2V0P A;  3E32 A;  4L1B A;  4N2Q A;  3KSQ A;  3I4G A;  1KZP A;  5FQ8 A;  3AG4 E;  1AWC B;  2XPI A;  4ABN A;  1TN8 A;  3LY8 A;  1H6P A;  2VSX E;  5LFA A;  2NXP A;  4APO A;  2NSZ A;  4JEU A;  5CRU A;  2YQ8 A;  4LNU D;  1XGW A;  1PC2 A;  3WG7 E;  2PL2 A;  4N3B A;  2MYO A;  1NP7 A;  4Q94 A;  3QOU A;  3LVQ E;  1KPS B;  4N5Q A;  3UMV A;  4GAA A;  4PS8 A;  1N0Q A;  1N4Q A;  5JA4 D;  4JD2 G;  4BTA A;  4UI9 C;  5LCW C;  3ZYL A;  3U66 A;  3CV0 A;  4GA1 A;  3ISM C;  3AG1 E;  4DX5 D;  3ZEF A;  2QYJ A;  3TWU A;  4KBQ A;  5C2Y A;  4EBA A;  2AXV A;  4G26 A;  3LDZ A;  4ILH B;  4TXP A;  1Q2Z A;  3U3W A;  2OEV A;  4AOF A;  3HVE B;  3HYM B;  4IRU A;  1HO8 A;  2V5F A;  3JQ0 A;  3QJZ A;  4JEH A;  1W3B A;  2VYI A;  4XE0 A;  3V2O A;  2GRR B;  2V8S E;  2ZGD A;  5T8I A;  3CST A;  2J08 A;  2J8S D;  4QFV A;  2FUL A;  4J6I A;  4L7T A;  2VJ8 A;  4DX2 A;  3Q5M A;  3NQP A;  1VDY A;  4K5A B;  3SBS A;  4HI9 A;  1ZU2 A;  3B13 A;  4I6E A;  4HOS A;  3Q7F A;  3EHM A;  3G2U A;  4AIF A;  4CGW A;  3UPV A;  3FFL A;  3KS2 A;  1DCE A;  3HXB A;  3Q4A B;  3IKO B;  1OCZ E;  4I9E A;  2RKK A;  3ZUV B;  4CT0 A;  4CCA A;  4BET A;  3ABL E;  2RFA A;  2KM4 A;  4JA7 A;  1H6K A;  4Y6W A;  4FHJ A;  1OY3 D;  3ONL A;  4I1A A;  4UWG A;  2A4Z A;  1S0P A;  5LP0 A;  4XI9 A;  5FIO A;  3FTU A;  1H0A A;  3X2Q E;  3QK0 A;  5JHB A;  3DPD A;  3L17 A;  4BWR A;  4KZC A;  3HIZ A;  2P9S G;  2OVF A;  2AVP A;  3C5R A;  2WXP A;  4GZ6 A;  1AP7 A;  3TWS A;  3L6A A;  2JLB A;  4F7A A;  3ESL A;  1FPP A;  1EPU A;  4L2Y A;  2NYJ A;  5JJ6 A;  4IUL A;  5BXU A;  1NI1 A;  4LNG A;  1U3D A;  1X81 A;  3SF4 A;  4B94 A;  1IHG A;  2I2O A;  4JHJ A;  4U63 A;  1OCO E;  4L2L A;  2DIW A;  2KCK A;  3ZXS A;  1OCR E;  5BV1 A;  2CFU A;  3J5P A;  4MLP A;  3SNX A;  2Y1L E;  4FA6 A;  1H2U A;  3DEO A;  3QC1 A;  2Y69 E;  1NFI E;  4E6H A;  4PH4 B;  4GU5 A;  5JJ7 A;  4GCO A;  3L82 A;  4MRU A;  2HM8 A;  3FTZ A;  3ULQ A;  4Q96 A;  1HS6 A;  3RAU A;  3W9G A;  2FF4 A;  3UI2 A;  4LEU A;  5EKQ D;  5KJM A;  3OXF A;  4IYP A;  4DX1 A;  2HR2 A;  3GZS A;  2MOW A;  2IOS A;  3AAA C;  4JA9 A;  5CEA A;  2YIN A;  3L54 A;  3D9P A;  1DC2 A;  5FQ6 A;  4CT4 A;  5AN8 A;  3LS8 A;  1IHB A;  4UWK A;  4KYO B;  3ESK A;  4BSX A;  2L9B A;  3TL5 A;  2KXP C;  2LUH A;  1MQS A;  2WQ6 A;  2MHK A;  2JEK A;  5HRY A;  2P9P G;  3J5Q B;  2XRY A;  4I6J A;  3P1U A;  4M3O A;  4XI0 A;  4FAD A;  4KVO A;  3PZD A;  3FY4 A;  2ZIR A;  1Y6I A;  2X3M A;  3NZU A;  4DUI A;  1SZ9 A;  2P9N G;  5ENO D;  3L9T A;  4K03 A;  4LSZ E;  5LX8 A;  2F0Y A;  4GTO A;  5G05 J;  3NOC D;  4QQI A;  2LXM A;  3CVY A;  1TR4 A;  3ZYM A;  2R05 A;  2ION A;  4K0R A;  1D8E A;  3TWQ A;  2DYR E;  1HE8 A;  2QZA A;  4C48 B;  2IJG X;  5AAR A;  5AYW D;  4N3A A;  5FQ4 A;  1UJK A;  5AQB A;  3FTS A;  3W9F A;  5CMW A;  2WXI A;  4GZC A;  2CHW A;  2R17 C;  3NAW A;  4ILI A;  3NF1 A;  3I3N A;  2ETB A;  3OXG A;  3GYZ A;  2L6B A;  4ANW A;  4GZ5 A;  1SA5 A;  2C0M A;  3LY9 A;  3ABM E;  1MHQ A;  4WWN A;  3WXX A;  2GRN B;  5KJN A;  5H7P A;  2IFU A;  2CFZ A;  2Q7F A;  4N2S A;  2L0I A;  4RQI A;  4O6F A;  3FUN A;  1H19 A;  4UUC A;  4CZ2 D;  4APF A;  3CK8 A;  2ETA A;  3CGH A;  1SZA A;  3SFX A;  2DVW A;  3PEU B;  2A5U A;  5CCL A;  1MJ0 A;  4J8Y A;  4M7C A;  4DI4 A;  2OOE A;  5CED B;  4HB5 A;  3IHY A;  2QYU A;  2BED A;  4I17 A;  4JXT A;  3BG1 B;  4GA0 A;  4FJY A;  3RSE G;  2FO1 E;  4I6G A;  3PH0 C;  1INZ A;  2AXU A;  4NUR A;  1NL4 A;  3ZIM A;  3IXE A;  3FEX A;  4YDO A;  5KWD A;  1KZO A;  3L13 A;  1Z6T A;  2IOL A;  2P9L G;  4U8V D;  2EIN E;  2CHX A;  5ARF A;  4GTP A;  2HYZ A;  4U07 A;  3ML8 A;  3SHF A;  2KZT A;  5ENN A;  4AY6 A;  5LOZ A;  2WXF A;  4IN3 B;  3VTY A;  1TNB A;  3PZ4 A;  4NQ0 A;  4HQD A;  3TWV A;  3DSW A;  4CGV A;  4KT6 B;  4GTQ A;  2VTB A;  3KEZ A;  2X6H A;  1JPL A;  3JUE A;  3UKU G;  2RD0 A;  4R7L A;  4FC8 A;  3NB2 A;  5AQA A;  4F1S A;  4ZHB A;  1JWG A;  2DZO A;  1HX8 A;  2Y0B G;  3U4T A;  2V5Q C;  2WXQ A; 
#chains in the Genus database with same CATH homology
 3CVW A;  4GA1 A;  3G2V A;  3CK7 A;  3PUK A;  3ZEF A;  4C0E A;  3QB2 A;  4KMO A;  3URZ A;  4GZ3 A;  4KBQ A;  4EQF A;  1H2T C;  1UW4 B;  2WXJ A;  5CMY A;  2AXV A;  4G26 A;  1KLX A;  5C2Y A;  3UX4 A;  3LDZ A;  4ILH B;  3MGB A;  2XHE A;  3O4Z A;  2RG8 A;  3OTN A;  4WAF A;  3K9I A;  2IU1 A;  2DBA A;  4TV3 A;  3CLJ A;  3U3W A;  2V4L A;  3CQC B;  3B7T A;  3D9M A;  3B7R L;  3CVL A;  5FQ7 A;  1QNF A;  4AOF A;  3HVE B;  3HYM B;  4IRU A;  4WUY A;  2LNI A;  3D9J A;  4EBA A;  1HO8 A;  2V5F A;  3D9L A;  3JQ0 A;  3QJZ A;  4JEH A;  4D10 C;  1W3B A;  2WXL A;  3EJN A;  2VYI A;  2WXN A;  4XE0 A;  3QAQ A;  4GPK A;  2V8S E;  1JUQ A;  4HOR A;  1OWL A;  4U0Z A;  1QQE A;  4A55 A;  5T8I A;  1B89 A;  1E7V A;  4JZY A;  5JHA A;  3CST A;  4LRZ A;  3ONK A;  2J08 A;  3D3M A;  5BT1 A;  4XIF A;  4QFV A;  2FUL A;  2XCC A;  4J6I A;  2VJ8 A;  4L7T A;  3RRN B;  4B8C B;  3Q5M A;  3NQP A;  1HG5 A;  4J8S A;  3FUD A;  1VDY A;  3APD A;  3SBS A;  2Y3A A;  1UN9 A;  5ANL A;  1ZU2 A;  3B13 A;  2X6F A;  4I6E A;  1H2V C;  4HOS A;  3EHM A;  2BUG A;  3QKY A;  3ZHE A;  3G2U A;  4AIF A;  4W9R A;  3LKU A;  4G23 A;  4CGW A;  3UPV A;  3FFL A;  3KS2 A;  5T3R A;  2P58 C;  2UY1 B;  2LO6 A;  3Q4A B;  4GYY A;  3ZN3 A;  1P5Q A;  1Y8M A;  3MZL B;  4U8H A;  3IKO B;  3QDN A;  5G04 J;  2MRI A;  3ZFW A;  2AWI A;  4FHK A;  3PE4 A;  4YND A;  4I9E A;  2FI7 A;  1NZN A;  4CT0 A;  2FEZ A;  3HDX A;  2XEV A;  2QFC A;  2FBN A;  3L16 A;  4OYS A;  4PS3 A;  4CCA A;  2KM4 A;  3Q49 B;  3QNK A;  1H6K A;  4JA7 A;  4RVB A;  4B8A A;  4CDM A;  3T8M A;  4Y6W A;  4FHJ A;  4HFG A;  3QAR A;  3D9I A;  5J90 A;  3PRE A;  1OWO A;  4HS2 A;  4WWO A;  3ONL A;  4I1A A;  4UWG A;  3GZ1 A;  1PY1 A;  4B0Z A;  2A4Z A;  1S0P A;  3MA5 A;  5LP0 A;  2GW1 A;  4XI9 A;  4JPS A;  3SZ7 A;  3FTU A;  1H0A A;  4ANX A;  3MV2 B;  3N71 A;  1XNF A;  2HO1 A;  3FTW A;  2ZU6 B;  3QK0 A;  3DPD A;  1QZ2 A;  4HXI A;  3RO3 A;  3LPZ A;  3TAX A;  5JHB A;  3L17 A;  2KCL A;  3EDT B;  3S2A A;  4BWR A;  2WVI A;  4GB9 A;  4KZC A;  3CHQ A;  4NAC A;  4AM9 A;  4BY6 A;  3HIZ A;  2LAI A;  4FLH A;  1L5J A;  2OVF A;  2QY7 A;  3GZ2 A;  2AVP A;  3VTX A;  2WXP A;  2WM9 A;  4GZ6 A;  1FVH A;  3FUF A;  3L6A A;  2JLB A;  3ASF A;  1KT0 A;  4XKC A;  4F7A A;  3ESL A;  2KZT B;  4JHK A;  2J49 A;  4N3C A;  4UWH A;  3VLF A;  4BT9 A;  1EPU A;  4L2Y A;  1U3C A;  4DPR A;  5BV0 A;  4Y6C A;  5CCM A;  5JJ6 A;  4IUL A;  2NC9 A;  2YNQ A;  4KZ0 A;  2XPY A;  4GCN A;  1U3D A;  2EQX A;  3SF4 A;  3CKC A;  3LY7 A;  5A23 A;  4WNE A;  3AS8 A;  4A3V A;  1EF1 C;  1E8Z A;  3CIA A;  1WY6 A;  4B94 A;  4I43 A;  1IHG A;  2I2O A;  4CDR A;  3JUI A;  4ANV A;  5AIJ A;  2VTB B;  3CK9 A;  4C0M A;  4U04 A;  3Q15 A;  5FZQ A;  5JJT A;  2R5S A;  4JHJ A;  4U63 A;  5FT9 A;  2PM7 A;  2J4B A;  3PDN A;  4GZD A;  3MKQ A;  4L2L A;  3P2B A;  3ZVV A;  2PZI A;  4J8F A;  2DIW A;  2KCK A;  3ZXS A;  5BV1 A;  3JQ1 A;  2CFU A;  4MLP A;  4UQZ A;  3ENE A;  3SNX A;  3RO2 A;  3SGH A;  2OVB A;  3G2W A;  4YVQ C;  4FA6 A;  1SQM A;  3ZGQ A;  1HXI A;  1NA3 A;  4ACK A;  3RK6 A;  3AS4 A;  1H2U A;  1WAO 1;  3PEV B;  3MCX A;  3FU3 A;  3TXN A;  3LXU X;  3QC1 A;  3S7J A;  5HQ8 A;  3QWP A;  5AEN A;  4LER A;  4E6H A;  3FDH A;  3E4B A;  4PH4 B;  4JL0 A;  5KCM A;  2KCV A;  5BW8 C;  2I1J A;  3HHM A;  4GU5 A;  5FZR A;  5JJ7 A;  2XQ0 A;  4GCO A;  1Z3Y A;  3S7B A;  3BEE A;  4MRU A;  5AJD A;  2XGO A;  3Q47 B;  2HM8 A;  3NZS A;  1ELW A;  3FWV A;  3FTZ A;  3ULQ A;  3CVU A;  3FUK A;  4Q96 A;  4F53 A;  1HS6 A;  3CVP A;  4AJW A;  3CVN A;  5C1D A;  5KJM A;  2FF4 A;  4LEU A;  5EKQ D;  3OXF A;  4CEM A;  4IYP A;  4N39 A;  2WXG A;  4N5C A;  2E0I A;  3ASH A;  2HR2 A;  1TJF A;  4GMJ A;  3GZS A;  5FZS A;  2Y4U A;  3T5X A;  4EPZ A;  2PQN A;  2MOW A;  2LSV A;  2IOS A;  5FJY A;  4JA9 A;  2YIN A;  1JWF A;  2IQC A;  3L54 A;  3LJ3 A;  4H7Y A;  1UN8 A;  4FJZ A;  3D9P A;  3I4R B;  2I9C A;  4ATG A;  2XPZ A;  4HOU A;  4OVV A;  3ZHE B;  3RU0 A;  5FQ6 A;  1OUV A;  2BTD A;  4BX8 A;  4CT4 A;  1ELK A;  3FUL A;  3IBE A;  3UQ3 A;  5EX3 A;  3RKV A;  3SI5 A;  3LS8 A;  3U66 A;  4UQX A;  4UWK A;  4EBA G;  3MYV A;  3MKR A;  1EYH A;  4KYO B;  4F1S A;  3ESK A;  4BSX A;  4AP2 A;  4DLQ A;  2L9B A;  3TL5 A;  5DIZ A;  2VGX A;  2OV8 A;  2CHZ A;  3D9K A;  5LFA A;  1Z3X A;  4BT8 A;  3ASG A;  1E8X A;  4EZL A;  3KD7 A;  1MQS A;  2YHC A;  3LCA A;  2WQ6 A;  3AU4 A;  3R7Q A;  5KJK A;  3T5V A;  2M63 A;  3KAE A;  3RRM B;  2KAT A;  2MHK A;  2JEK A;  2VSO E;  3FU5 A;  5G2N A;  4TRQ A;  3FU0 A;  2L6J A;  2XRY A;  4I6J A;  4EZK A;  2J4D A;  3P1U A;  4M3O A;  4XI0 A;  5D0Q D;  4FAD A;  3APF A;  4KVO A;  3PS6 A;  3PZD A;  1ELR A;  3C98 A;  3FY4 A;  1OWP A;  5EX0 A;  3U64 A;  1IYG A;  1Y6I A;  2X3M A;  3PVL A;  3NZU A;  2XRZ A;  1SZ9 A;  4WWP A;  4I1O B;  2E2E A;  3CQG B;  3LYA A;  4K03 A;  5LX8 A;  5ARG A;  3SFZ A;  3UUX A;  1E7U A;  1TEZ A;  3EIQ C;  5G05 J;  2VGY A;  4MS6 A;  3UMV A;  4WNG A;  3CVY A;  3ZYM A;  1UJJ A;  2C0L A;  3OXL A;  2KC7 A;  5CHE E;  3ZYQ A;  3LVR E;  3FTY A;  2ION A;  3ASD A;  4K0R A;  4DI3 A;  4U0U A;  2VSY A;  3G2S A;  3MV3 B;  4GML A;  3TXM A;  1OWM A;  2BF0 X;  4URK A;  3CHO A;  5KJL A;  4A1G A;  3CEQ A;  4PS7 A;  5AJL A;  4G2V A;  1N52 A;  1HE8 A;  5T4Y A;  3PE3 A;  2IJG X;  5EDS A;  2I6H A;  3QWV A;  5AYW D;  4N3A A;  3UT8 A;  1HU3 A;  5FQ4 A;  1UJK A;  1IQU A;  3QWW A;  3FTS A;  4UQY A;  2YHE A;  3TJP A;  5BPP A;  5A6C A;  4DK5 A;  5CMW A;  3SBT B;  2WXI A;  3ZW3 A;  4GZC A;  3LEW A;  2CHW A;  4ME2 A;  2R17 C;  4ILI A;  2Y4T A;  3IEG A;  3NF1 A;  4BFR A;  3I3N A;  4FU3 A;  4BTB A;  2XGM A;  4Q69 A;  2ILR A;  3O48 A;  4OVU A;  1PAQ A;  2CG3 A;  4HOQ A;  4TUU A;  3OXG A;  3GYZ A;  3ZRH A;  3B7U X;  3FUE A;  4HLE A;  4I2W A;  4ANW A;  4I2Z A;  1HF8 A;  2AW6 A;  3R7R A;  2WXH A;  3MKQ B;  4A1S A;  5E75 A;  4GZ5 A;  2C0M A;  5FTP A;  3FP3 A;  3LY9 A;  4HVB A;  2UWJ G;  4WWN A;  1MHQ A;  3WXX A;  4AEZ C;  1E8W A;  4A3T A;  5BNW A;  3B7S A;  5KJN A;  1TJC A;  2WMO A;  2IFU A;  2VQ2 A;  2CFZ A;  2Q7F A;  3HVE A;  5D0O D;  4N2S A;  2GGF A;  3D9N A;  2X6I A;  5A7D B;  3AU5 A;  1IQR A;  1FVF A;  3FTX A;  4C9B B;  2L0I A;  3JYS A;  3JCK C;  4O6F A;  4V3I A;  4DJA A;  3FUN A;  1H19 A;  4FLB A;  4GYW A;  4L23 A;  4AVX A;  1HFA A;  4XKB A;  3RRU A;  4APF A;  3CV0 A;  3CVV A;  3APC A;  4PUC A;  1LF8 A;  3VLE A;  3CK8 A;  1KT1 A;  2X6J A;  3CGH A;  1SZA A;  2J09 A;  3TG4 A;  3L22 A;  1OWN A;  2OND A;  2WXK A;  3PEU B;  4GYO A;  4WNF A;  5G05 C;  3GW4 A;  2WXM A;  3CHR A;  4I1M A;  4CDN A;  3CVX A;  2A5U A;  5BUZ A;  2CG2 A;  5CCL A;  5G55 A;  3FH8 A;  2R59 A;  1ZBP A;  3FUJ A;  1DVP A;  4HOT A;  4J8D A;  4G11 A;  1N54 A;  3G2T A;  2UY1 A;  4PDX A;  2PM6 A;  4ILG A;  5DBK A;  4JVS A;  1EDU A;  1E90 A;  1DNP A;  1HG2 A;  4DI4 A;  5E76 A;  2OOE A;  4JW1 A;  2WPV A;  3IHY A;  2LSU A;  2L0T B;  1WM5 A;  3PRZ A;  3AS5 A;  3FTV A;  3VLD A;  2X6K A;  3FUI A;  1FCH A;  4I17 A;  3FUM A;  3MJW A;  4ACL A;  4JXT A;  3BG1 B;  2WMN A;  2XGS A;  3CVQ A;  3RIB A;  2X38 A;  4EEC A;  3UT4 A;  2C2L A;  4AXH A;  4GA0 A;  4UI9 K;  2WQH A;  4FJY A;  4AV7 A;  4I6G A;  4JHR A;  3CHM A;  1HH8 A;  1X5B A;  4UI9 J;  3PH0 C;  4F3V A;  2VGX B;  3MX3 A;  2GRM A;  5LCW J;  3TGO A;  1INZ A;  2AXU A;  4B89 A;  4MKT A;  3D9O A;  4NRH B;  3ZPJ A;  4WND A;  4RG9 A;  2WQ7 A;  5J08 A;  2WXO A;  3R9A B;  1NA0 A;  4RSY A;  4KVM A;  4NUR A;  2LAH A;  3FUH A;  5HI7 A;  3ZIM A;  4DLO A;  3IV0 A;  2DCP A;  3FEX A;  4GA2 A;  3CKB A;  4RG6 A;  4G24 A;  5FWQ A;  4XZ4 A;  3S7D A;  4BX9 A;  1GW6 A;  4CRW A;  4FUL A;  2V0P A;  3EIJ A;  3L08 A;  4L1B A;  4N2Q A;  3L13 A;  1Z6T A;  2IOL A;  2VSN A;  3I4G A;  3SD5 A;  2CHX A;  5ARF A;  3CHP A;  4G1T A;  3BG0 B;  5FQ8 A;  4U0S A;  1BPO A;  4E85 A;  2HYZ A;  4U07 A;  2PQR A;  2WB2 A;  3ML8 A;  3SHF A;  2XPI A;  2IF4 A;  2KZT A;  5ENN A;  4ABN A;  3LY8 A;  4H7X A;  3DBS A;  5LOZ A;  2VSX E;  4AY6 A;  3PUJ A;  2WXF A;  2NXP A;  3FU6 A;  4IN3 B;  4YVO A;  4I9C A;  4LCT A;  3S7F A;  4APO A;  1E96 B;  3PNL B;  4XX5 A;  2NSZ A;  2AXZ A;  3VTY A;  1E8Y A;  4G25 A;  3I5P A;  4J8E A;  4JEU A;  3ZYK A;  2YQ8 A;  4NQ0 A;  4AY5 A;  4LUN U;  3FEY A;  3EHN A;  1XGW A;  3CR3 A;  1PC2 A;  4EZJ A;  4KXK B;  3TG5 A;  3UT7 A;  2PL2 A;  4CGV A;  4KT6 B;  4N3B A;  2VTB A;  3KEZ A;  3CSF A;  2X6H A;  1A17 A;  4UWF A;  3FH5 A;  1JPL A;  1NP7 A;  1HZ4 A;  4Q94 A;  2RD0 A;  3PNT B;  5M72 A;  3QOU A;  4R7L A;  3LVQ E;  4FC8 A;  3CHS A;  1UG3 A;  3U9W A;  4FP7 A;  4GAA A;  1YA0 A;  3FH7 A;  2WXR A;  4PS8 A;  4JC8 A;  3FHE A;  4UWL A;  2J07 A;  2FO7 A;  3IHV A;  2J9Q A;  4ANU A;  1JWG A;  2GRL A;  5G04 C;  3MEK A;  2XCB A;  4J0U A;  4P29 A;  2I1K A;  3ML9 A;  5ANR A;  3RJV A;  3OAW A;  1HX8 A;  4BTA A;  3U4T A;  4UI9 C;  5LCW C;  3ZYL A;  2WXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...