4HS2A

Crystal structure of the human spop c-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
64
structure length
64
Chain Sequence
NLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of high-order oligomerization of the cullin-3 adaptor SPOP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Speckle-type POZ protein
total genus 23
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2012-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4hs2A00
4AP2A 2EQXA 4HXIA 3HVEB 4HS2A 4APFA 3I3NA 3HVEA
chains in the Genus database with same CATH superfamily
3RRNB 2LAHA 5FINA 2PQRA 2WXQA 2Y0BG 3ZPJA 4TXPA 5D66A 5BXUA 4I9EA 2F8XK 1K1BA 2P9LG 1TNOA 3B7UX 4F1SA 3GYZA 2V4HC 3L16A 1SA5A 2QFCA 3KD7A 3ZYQA 4J8FA 3FUNA 5BW8C 4O1PA 2XGOA 4GMJA 3UQ3A 2AXZA 5AQ9A 3S7FA 3ENEA 3PVLA 3NF1A 3JXJA 4HFGA 1D8DA 1OWLA 4RQIA 1UN8A 4JA7A 3QARA 3SO8A 1Z3YA 3ULQA 2I9CA 1TN8A 3TAXA 3SZ7A 3RIBA 4DPRA 2IU1A 3ABME 4GA2A 4HB5A 2YHEA 2VYIA 4XIFA 1K8KG 4L9PA 5D2MC 3FFLA 3C98A 2J4DA 4A1GA 2P9KG 2J07A 3DXKG 3PREA 1XGWA 1HX8A 4E6HA 3CVPA 2I1JA 2WXNA 4WAFA 3TG5A 5EIDA 1MX2A 3ASDA 4HLLA 5KWDA 3KEAA 4I9CA 3LVQE 1KT0A 3OXFA 5ANLA 4EBAA 5KNGA 3C5RA 4KMOA 2LAIA 2J8SD 3CKCA 1BD8A 2ZISA 4OYSA 2P9NG 1S63A 1UJKA 4WNEA 3T9KA 1K1AA 4KZCA 3ZEFA 4TUMA 4GTVA 2XCBA 3HG0D 5A23A 2L9BA 3ABLE 4J8DA 2AWIA 1V54E 1GW6A 5FQ6A 2AVPA 3MZLB 2EILE 4DK5A 3ISMC 1O1RA 4CCAA 4JL0A 4IN3B 4U0ZA 3EIJA 2WXHA 3CHRA 3MJWA 1S64A 1HG2A 4H7XA 4XKCA 4JW1A 4CZ2D 3DEPA 2VJ8A 4JXTA 3QNKA 3SF4A 1EF1C 5HI7A 4I6GA 2V4LA 3UI2A 3TJPA 2FO1E 4K5CA 3Q47B 1H6OA 3W9FA 2P9PG 3Q15A 3AS8A 2PL2A 4GYWA 3FH5A 4GTPA 3QWPA 2PQNA 5KJLA 1TNYA 2KM4A 5FQ4A 4C0MA 2QZAA 4KVOA 4BSXA 3UKUG 5CRVA 3W9GA 4B93B 4GPKA 3CV0A 3RRUA 5HS0A 2WXMA 3O48A 3Q73A 4WWNA 2XCCA 1KZPA 2OCCE 3RAUA 4XX5A 3AG4E 2F8YA 4G25A 3RU0A 3FUFA 4FJZA 3JQ1A 3HHMA 3Q78A 1BPOA 3OXGA 3I4GA 3VTYA 1D8EA 4NRHB 2X6JA 4EPZA 1IKND 4PS7A 2WXJA 1DVPA 4K5AB 2QYUA 5ENQD 2ONDA 5D0OD 4KXKB 4AVXA 3G2VA 3G2TA 1N0QA 3PNTB 4HOQA 4EZKA 3QK0A 3AU5A 3LYAA 1XNFA 3DBSA 5EIBE 2AXUA 1RZ4A 4CDRA 4UWKA 3G2SA 4XKBA 3CQGB 5LCWJ 3C3RA 3APCA 2KATA 2WVIA 5FT9A 3NQPA 3PRZA 4HI9A 1E8ZA 5CRUA 2X3MA 4CT0A 3CVQA 4MS6A 5FZSA 4GMLA 4AJWA 3HXEA 2XEEA 3IHVA 4AXHA 3Q5MA 1OY3D 4EQFA 1FVFA 5JJ7A 2LXLA 4U0UA 2J08A 1IYGA 2GRPB 4WWOA 5AN8A 1WAO1 2YQ8A 4GTMA 5G04J 1QBQA 3I5PA 4U7EB 4F1PA 2FI7A 3KS2A 4HQDA 4I2WA 5EKQD 3PE3A 3HXBA 2NXPA 3V31A 4N5QA 3AS5A 1DCEA 5EN5D 3AAAC 3MGBA 4JPSA 4GTQA 2WXFA 3D9OA 2P9IG 4U63A 2NC9A 3N71A 4CT4A 5FQ8A 5FTPA 5T4YA 1HO8A 3CQCB 4EZJA 3DSXA 5KBAA 4C0EA 3CK7A 4CYMD 5EYPF 4L23A 4U0SA 4G8LA 4G26A 4L1BA 3UT8A 1OXJA 2J9QA 2EIKE 3B95A 2UY1A 4PS3A 5JMND 4YDWA 3SI5A 1NZNA 1NP7A 2PNNA 3EJNA 2LSVA 5FWQA 5BNWA 1JUQA 2UY1B 4N3AA 5JA4D 3J5QB 1FPPA 3CHSA 2XQ0A 3CK9A 2XENA 3ONKA 3I4RB 3Q4AB 4CGWA 2GRMA 2MYOA 4BT9A 1PC2A 2EIME 3V2XA 5EILA 3V79K 2LXMA 4LNGA 4U8VD 1MHQA 5BUZA 4FHKA 4K03A 2GW1A 3KEZA 5A6CA 3TWTA 4DRXE 3X2QE 4J7WA 3L54A 3SQVA 4JC8A 3PE4A 4L2LA 3B7SA 2QYJA 2VGXA 1U2VG 4NURA 3EHNA 1OCCE 3VTXA 4HOSA 4G11A 4GTSA 3KAEA 3CHMA 4UI9J 3ZW3A 1IHGA 4B0ZA 2HYZA 1NA3A 4DI3A 3HRAA 4GA1A 1YMPA 2FULA 4EBAG 1E7VA 3C3OA 2V8SE 4F3VA 3KSQA 2DYRE 3UTMA 2M63A 4G24A 4ATZD 4BY6A 2R59A 3BG1B 3GW4A 2WXLA 4TV3A 3QC1A 3FHEA 2JLBA 3TG4A 3NAWA 3RSEG 1Z5SC 3LPZA 3ZXPA 2P58C 2WXPA 3ZKJA 4GB9A 4GPMA 3JYSA 2OEVA 3IEGA 2I1KA 5CEAA 1A17A 3LY9A 3U3WA 2V5FA 4RLYA 4KBQA 2F0YA 4GTTA 4GA0A 4TXQA 1EDUA 2NYJA 3CK8A 1HFAA 3NOCD 1TR4A 3E32A 2WMOA 4JEUA 1WDYA 4AP2A 4GU5A 5ENSD 4ACLA 3FULA 2IEJA 3FUIA 3BQOA 5CBNA 4U07A 4UI9K 4NACA 4ANWA 4D10C 3P2BA 5HKPA 2Y4TA 2WXOA 3DEOA 4HXIA 4H7YA 3VLEA 3SBSA 4PUCA 5LX8A 3CVWA 3WXXA 3AG3E 1MQSA 5LCWC 1UOHA 2DYSE 2CG2A 3ZUVB 2F37A 3GZ2A 4I1AA 2WXKA 4LNUD 2CG3A 3OTNA 3ZHEB 3FU6A 3UT7A 5J90A 4N2QA 1X81A 4KZ0A 2AXVA 1MZCA 1D9SA 2KC7A 4I17A 3L22A 4EHMA 4GCOA 4F53A 1ELRA 1HU3A 2CFUA 2X6FA 3SBTB 2L0TB 1IHBA 3D9MA 3AG2E 3QJZA 2ETAA 3UIOC 2WMNA 2RFMA 1SZAA 1ZU2A 4RVBA 1FCHA 4J8YA 4GZ5A 5DIZA 4B8AA 2OOEA 3NZUA 3FTYA 1HXIA 1TYQG 2Q7FA 4LERA 4IYPA 3FUKA 3FUDA 1U3CA 4J8SA 1N54A 2X38A 3D9JA 3APDA 4UWLA 5AAOA 5B1BE 3ULEG 4APOA 3DSTA 4HRLA 3TWRA 3IXEA 3NOGD 3TWWA 4TXRA 4HS2A 2WQ6A 1W3BA 1N4RA 4UI9C 4YDYA 1WG0A 2R02A 3CR3A 2XS8A 2XZDG 4G8KA 4HOUA 2L6BA 3E30A 5CERB 3DSVA 5KNHD 1JWGA 4I2ZA 5D0QD 3MV3B 1K3ZD 5ENOD 2GRRB 5CBOA 3MEKA 2X6KA 2E0IA 3B7BA 3D3MA 2IO3C 4DX7D 3FH7A 3TWSA 3PDNA 4GAAA 4F6RD 4LEUA 5AQBA 2J09A 3PZ3A 3PUKA 3PH0C 3UX4A 2QC9A 3ASNE 2FO7A 2R03A 2PM7A 2DZOA 3MYVA 4I6EA 4C48B 1HG5A 3R7RA 4U8YD 3HXFA 2YNQA 4ABNA 3C72A 2GRQB 4WNDA 1LTXA 1Q2ZA 4DX5D 1TEZA 4U95D 4MBGA 4FHJA 4J6IA 2J49A 1KZOA 4LNBA 1JCRA 4J8EA 3ZXSA 3ASFA 3QB2A 1VDYA 4FJYA 4I6JA 1H6PA 3Q9UC 5ENNA 3CVXA 2GRLA 3NB2A 2IY0C 3S7JA 4HOTA 3FU0A 4F7AA 1FVHA 4B8CB 1H0AA 3OAWA 1JCSA 3T8MA 2XEVA 3VLDA 1OWMA 3EU5A 3ZIMA 5G04C 3ZN3A 4X8QA 4BT8A 3D9PA 3IKOB 1QZ2A 2H6HA 3J5PA 4KVMA 4GTRA 2L6JA 4CGVA 5CMWA 4FU3A 3SFZA 1FT1A 4PDXA 3FH8A 3DSSA 3UM0A 2R2LA 2L0IA 3EDTB 1SZ9A 5ENTD 4ANUA 2EQXA 2AW6A 4RG9A 3R9MA 3LS8A 3TWVA 2WXGA 4BTAA 3E34A 3EIQC 5LOZA 1KPSB 4LRZA 2MRIA 3CVUA 2LNIA 1EYHA 3UIPC 1TNZA 1HF8A 1YYHA 3FWVA 3RRMB 3BUAA 3OXLA 5FQ7A 1X5BA 3ZVVA 4BEPA 4GTOA 2OVBA 4RSYA 1UJJA 4ME2A 4ILIA 3SNXA 2KZTB 2PZIA 5KCMA 3ULYA 2ETCA 5EDSA 2OV8A 1IQUA 3MKRA 4YVQC 3D9IA 3ZYLA 4JHKA 2XGMA 4AY5A 2LSUA 5FIOA 1PAQA 4L2YA 4A63B 3CHQA 5KJMA 4FLHA 4DJAA 3L6AA 4UUCA 3ZFWA 1HS6A 3ESLA 3BG0B 3DXMG 4DLQA 4N3BA 2XPYA 3QDNA 4LCTA 3TGOA 4DX6D 5E76A 5B3SE 1ELWA 4BFRA 4A3VA 3CHPA 1OCOE 1RW2A 4URKA 4O6FA 2CFZA 2OVFA 1IXVA 3SHFA 4O60A 3EUVA 3AG1E 4I43A 4Q69A 4HRMB 4B89A 2WM9A 2ZIRA 5ARFA 3EHMA 3E37A 4JHJA 2KXPC 4N39A 5FZRA 4B94A 2CHXA 4QFVA 3LJNA 1N52A 3UINC 4LSZE 4Y6CA 1N4QA 3RK6A 1U3DA 5EX0A 3FUHA 2XEHA 1MX6A 4YDEA 1E7UA 4OAVB 3TWQA 1N11A 2GROB 3NZSA 1WY6A 4KT6B 3Q79A 3Q7FA 3PUJA 5AJLA 3UMVA 5AQAA 2DWZA 5HQ8A 3CHOA 1G3NB 3PNLB 2DBAA 3FTWA 3CIAA 1O5MA 1E8WA 4YVOA 1JCQA 4CEMA 1DC2A 4ACKA 1N0RA 3UT4A 1N94A 4N2SA 4C9BB 4GYYA 4E85A 3FEYA 3UXGA 1BU9A 1H2VC 1LD8A 3L08A 5BXOA 3EHQA 3LCAA 3RO2A 2Y3AA 3JUIA 1HZ4A 2X6HA 3HVEA 3U4TA 5CCLA 3F6QA 4ILGA 4DUIA 3PZ4A 4FA6A 1E8XA 4IRUA 2IONA 1OCZE 4BSZB 3ZRHA 1N4PA 4UQXA 5G2NA 5JJTA 3UM1A 2RFAA 1TJCA 5EX3A 3G2UA 5M72A 5BV0A 1YA0A 4I1MA 1TN7A 3LVRE 4M7CA 4U04A 2WXRA 5G55A 3FUJA 2WPVA 2C0MA 3FU3A 4ZFHA 3TXNA 4BWRA 1OWNA 3ASHA 4JVSA 2C0LA 3PZ2A 1BI8B 3HIZA 3UKRG 3SGHA 1H2UA 4JB8P 3JUEA 4WWPA 4JHRA 3ZHEA 1KLXA 2VQ2A 4GYOA 1QYMA 3RKVA 3IV0A 2PM6A 3B7RL 3ZNGA 5J08A 2GRNB 2Y69E 2JEKA 2VGXB 2JABA 3QKYA 2XGSA 3V2OA 4XI9A 4GMRA 4HBDA 2RKKA 5ARGA 3ASGA 4UWFA 3VLFA 3I3NA 2CHWA 3Q75A 1S0PA 5T3RA 3TWUA 4KYOB 3MA5A 3D9LA 2UWJG 2NSZA 3FY4A 5A7DB 3QAQA 5E75A 3HYMB 3BU8A 3LDZA 3D9NA 3JXIA 2DVWA 1N9AA 3DWLG 5FJYA 1MJ0A 3FUMA 1SVXA 3LY7A 4UWGA 4AIFA 4A1SA 1E8YA 3SFXA 2VTBB 4HORA 2MOWA 4A3TA 2BTDA 4Q94A 4XEIG 4BX9A 3CVYA 4GCNA 3U64A 3TWXA 4HI8A 1OUVA 2A5UA 2IF4A 1UN9A 2B6CA 1IQRA 2WQHA 4ATGA 3PS6A 2KCVA 2XZTG 5HRYA 3CVNA 3KSLA 3PEVB 2FBNA 3ESKA 3R7QA 1QNFA 3PEUB 4FP7A 3MCXA 5ITZF 2IFUA 3FEXA 1N4SA 3FTXA 3L13A 2R05A 3ZU7B 5CECB 2R17C 3QWVA 4DX1A 4GZ3A 1A5EA 3LJ3A 3D9KA 3EU9A 1YCSB 1OWPA 2VSYA 3T8KA 4I1OB 2AJAA 4JD2G 3R9AB 2E2EA 1DCQA 2HM8A 5G05J 3LEWA 3P1UA 1OT8A 3Q9NC 4QQIA 2ILRA 2WQ7A 4YNDA 4K0RA 4JZYA 4MLPA 5LFAA 4BTBA 2J4BA 5JHAA 4MRUA 4K5BA 3ZYKA 3L9TA 3D9HA 3FDHA 4AV7A 1N95A 4MKTA 1JPLA 4OVUA 2Y1LE 2P2CP 4J0UA 3AU4A 3MKQB 3S2AA 5KJKA 2RG8A 1NA0A 3Q7AA 2KZTA 4DI4A 1ZB1A 4WUYA 3T5XA 5LP0A 4ANXA 2DIWA 4M3OA 3V30A 3LKUA 1INZA 4HLEA 4BX8A 1AWCB 1S70B 3O4ZA 2BUGA 2BEDA 2P9SG 3K9IA 4Z68A 4LG6A 5FZQA 4PH4B 1NI1A 2I6HA 2HR2A 4GZDA 1TJFA 2XHEA 2H6GA 1KT1A 2P9UG 3CVLA 5C1DA 3GZ1A 2GGFA 3CLJA 1BLXB 3T5VA 3FTVA 3NBNB 4AM9A 2MHKA 4ZHBA 3EHRA 2IOSA 2IJGX 2IO2C 3B13A 4RG6A 2VSXE 4G23A 4FLBA 3SY2A 4WNFA 4W9RA 2WXIA 1ELKA 2LO6A 2VGEA 2H6FA 2I2OA 3FTUA 2YHCA 5AYWD 2EIJE 1TN6A 3JCKC 2Y4UA 4XZ4A 2A4ZA 1WM5A 3MV2B 4YDOA 1L5JA 2VSOE 3UUXA 2EINE 3PZDA 2ZU6B 5CHEE 4N5CA 3HVEB 3RO3A 2KBXA 3DPYA 3DSWA 1Y8MA 3DSUA 2VGYA 1OCRE 2VSNA 1UW4B 5AQ7A 4JA9A 3IHYA 3TXMA 2OEWA 1O1SA 4CDNA 3CGHA 1E90A 4DX2A 2XRYA 3ZGQA 1JWFA 1P5QA 3CVVA 2BF0X 2A5EA 3QWWA 5JJ6A 4FULA 2B0OE 1V55E 2HE0A 1Z3XA 4AY6A 1B89A 4ANVA 4FADA 3U66A 2IQCA 2XPZA 5KJNA 1TNUA 1AP7A 5BT1A 4UWHA 3FTSA 1BI7B 3UPVA 1UG3A 2XRZA 4EECA 1E96B 3L17A 3AS4A 2ZGGA 4BERA 3QOUA 2VTBA 3IBEA 4UQZA 4R7LA 2ETBA 3AJIA 4XI0A 2YINA 2IOLA 3L82A 1MYOA 3SD5A 4FC8A 3FP3A 1H19A 5IY5E 4AEZC 4L7TA 3FTZA 1LD7A 2V0PA 3ASOE 3MX3A 1Z6TA 3FU5A 2QY7A 2KCLA 4TRQA 2DZNA 4HNAD 4LUNU 3DPDA 4CDMA 4EZLA 2KCKA 5B1AE 1PY1A 2ZXWE 3FUEA 2CHZA 4P29A 3CSFA 3G2WA 1NL4A 4Y6WA 2RD0A 3CKBA 4U96D 1LF8A 3ABKE 4OVVA 1O1TA 4DLOA 3ONLA 2WB2A 3S7BA 2H6IA 5C2YA 1NFIE 5CMYA 5BV1A 3BEEA 1QQEA 2FF4A 3ZYMA 3HXDA 5AIJA 1OWOA 4GZCA 2ZGDA 1SQMA 3CEQA 3RJVA 3U9WA 4ILHB 1ZBPA 2V5QC 4N3CA 5G05C 5CEDB 4WNGA 4TUUA 3CSTA 4Q96A 4NQ0A 5BPPA 1EPUA 2XS1A 3HDXA 5H7PA 3E4BA 4NIKA 1SW6A 5AARA 4BETA 2X6IA 3PZ1A 2LUHA 5EYLA 4APFA 4G2VA 4U8HA 4BESA 3HXCA 4IULA 1DNPA 4G1TA 5ANRA 3S7DA 4UQYA 1HH8A 3LXUX 4V3IA 5JHBA 1Y6IA 5DBKA 4AOFA 4A55A 3WG7E 4JEHA 3ML9A 2HO1A 2BKGA 3DRAA 5T8IA 3B7TA 1TNBA 3LY8A 5AJDA 3TL5A 1H2TC 3JQ0A 3URZA 3MKQA 1HE8A 5AENA 3SFYA 4OAUC 3APFA 3UM2A 3E33A 2DCPA 2FEZA 2BKKB 3ML8A 1FT2A 4HVBA 4HRNA 1SA4A 2C2LA 4CRWA 2R5SA 5ENRD 4O1OA 5CCMA 3UM3A 5ENPD 4PS8A 2XPIA 1MX4A 1H6KA 3GZSA 4XE0A 4GZ6A 3Q49B 3C3QA
chains in the Genus database with same CATH topology
3RRNB 2LNIA 2HM8A 5G05J 4GA1A 2LAHA 1EYHA 3LEWA 1HF8A 3FWVA 3RRMB 2FULA 3OXLA 2PQRA 2WXQA 3P1UA 4EBAG 5FQ7A 1X5BA 3ZPJA 1E7VA 3ZVVA 2ILRA 2WQ7A 4YNDA 2V8SE 4K0RA 4F3VA 4I9EA 2OVBA 4JZYA 4RSYA 1UJJA 4ME2A 4ILIA 4MLPA 3SNXA 5LFAA 2M63A 2KZTB 4BTBA 3B7UX 2PZIA 4G24A 5KCMA 4F1SA 2J4BA 5JHAA 4BY6A 5EDSA 2OV8A 2R59A 3BG1B 1IQUA 3GYZA 4MRUA 3GW4A 2WXLA 3MKRA 3ZYKA 4TV3A 3QC1A 4YVQC 3D9IA 3L16A 3FHEA 3FDHA 2JLBA 3TG4A 2QFCA 4AV7A 3KD7A 3ZYQA 3ZYLA 4JHKA 4J8FA 2XGMA 3FUNA 4MKTA 4AY5A 2LSUA 1JPLA 1PAQA 4L2YA 5BW8C 2XGOA 4OVUA 3LPZA 4GMJA 3CHQA 3UQ3A 5KJMA 4FLHA 4DJAA 3L6AA 4J0UA 2P58C 1HS6A 3AU4A 3ZFWA 3ESLA 2AXZA 3BG0B 4DLQA 3S7FA 4N3BA 3ENEA 2WXPA 3PVLA 3MKQB 3NF1A 4GB9A 2XPYA 3S2AA 5KJKA 3QDNA 4LCTA 3TGOA 3JYSA 4HFGA 2RG8A 1OWLA 1NA0A 3IEGA 5E76A 1ELWA 4BFRA 4A3VA 2I1KA 3CHPA 2KZTA 4DI4A 1UN8A 4URKA 4JA7A 3QARA 1A17A 4WUYA 1Z3YA 3LY9A 4O6FA 3U3WA 2CFZA 2OVFA 3ULQA 3SHFA 3T5XA 2I9CA 3TAXA 4I43A 5LP0A 3SZ7A 3RIBA 4ANXA 2V5FA 2DIWA 4M3OA 4DPRA 2IU1A 4Q69A 4KBQA 4B89A 3LKUA 1INZA 4GA2A 2WM9A 4GA0A 2YHEA 4HLEA 1EDUA 2VYIA 4BX8A 5ARFA 3CK8A 3EHMA 4XIFA 1HFAA 4JHJA 4N39A 5FZRA 3O4ZA 4B94A 2CHXA 2BUGA 2WMOA 4JEUA 4QFVA 3FFLA 3K9IA 3C98A 2J4DA 4A1GA 2J07A 3PREA 1XGWA 4AP2A 1N52A 4GU5A 5FZQA 3FULA 4ACLA 4PH4B 4GZ6A 4Y6CA 3FUIA 2I6HA 2HR2A 4GZDA 1HX8A 4E6HA 3CVPA 1TJFA 2I1JA 1U3DA 2WXNA 2XHEA 4WAFA 3RK6A 3TG5A 5EX0A 3ASDA 3FUHA 1KT1A 3CVLA 5JHBA 5C1DA 3GZ1A 1E7UA 2GGFA 3CLJA 4I9CA 3LVQE 1NA3A 3NZSA 1KT0A 3OXFA 4U07A 1WY6A 4UI9K 5ANLA 4NACA 4ANWA 4EBAA 3T5VA 4KT6B 3FTVA 4KMOA 4D10C 3PUJA 2LAIA 3CKCA 5AJLA 3UMVA 4AM9A 4OYSA 3P2BA 5HQ8A 2MHKA 3CHOA 2Y4TA 2IOSA 2IJGX 1UJKA 2WXOA 4WNEA 3PNLB 4KZCA 4HXIA 3CVUA 3ZEFA 3B13A 2DBAA 3FTWA 4H7YA 2VSXE 4RG6A 2XCBA 4G23A 4FLBA 3VLEA 3CIAA 5A23A 4WNFA 2L9BA 3SBSA 4W9RA 1E8WA 4YVOA 2WXIA 1ELKA 4J8DA 2LO6A 4PUCA 5LX8A 4CEMA 2AWIA 3CVWA 2I2OA 4ACKA 1GW6A 3UT4A 5FQ6A 3FTUA 3WXXA 2YHCA 5AYWD 4N2SA 4C9BB 2AVPA 4GYYA 4E85A 1MQSA 3FEYA 3MZLB 4DK5A 5LCWC 1H2VC 2Y4UA 3JCKC 2CG2A 2A4ZA 4XZ4A 4CCAA 1WM5A 3GZ2A 3MV2B 1L5JA 2VSOE 3UUXA 4JL0A 3L08A 4IN3B 4I1AA 2WXKA 4U0ZA 3PZDA 3EIJA 2WXHA 2ZU6B 3CHRA 5CHEE 2CG3A 3OTNA 3MJWA 3ZHEB 3FU6A 1HG2A 3UT7A 5J90A 4H7XA 4XKCA 4N5CA 3HVEB 3RO3A 4JW1A 4N2QA 1Y8MA 2VGYA 2VJ8A 4KZ0A 3RO2A 3LCAA 2VSNA 4JXTA 2AXVA 3QNKA 1UW4B 3SF4A 2KC7A 1EF1C 2Y3AA 3JUIA 3L22A 4GCOA 4I17A 4I6GA 1HZ4A 3IHYA 4JA9A 5HI7A 2V4LA 1ELRA 4F53A 3TXMA 3TJPA 2X6HA 4CDNA 1HU3A 2CFUA 3CGHA 1E90A 3HVEA 3Q47B 3U4TA 5CCLA 4ILGA 2XRYA 2X6FA 3Q15A 3ZGQA 1JWFA 3SBTB 1P5QA 3AS8A 2PL2A 2L0TB 3CVVA 4GYWA 2BF0X 3QWWA 3FH5A 4FA6A 3D9MA 3QJZA 5JJ6A 3QWPA 2PQNA 4FULA 1E8XA 4IRUA 2IONA 1Z3XA 5KJLA 3ZRHA 2WMNA 4UQXA 4AY6A 1B89A 4ANVA 1SZAA 5G2NA 4FADA 5JJTA 2KM4A 5FQ4A 4C0MA 1ZU2A 4RVBA 4KVOA 4BSXA 1FCHA 2IQCA 3U66A 2XPZA 4GZ5A 5DIZA 4B8AA 2OOEA 3NZUA 3FTYA 5KJNA 1HXIA 2Q7FA 1TJCA 4LERA 5EX3A 4IYPA 5BT1A 3FUKA 3FTSA 4UWHA 3G2UA 5M72A 5BV0A 4GPKA 3CV0A 3RRUA 3FUDA 1U3CA 1YA0A 3UPVA 2WXMA 1UG3A 2XRZA 3O48A 4EECA 4I1MA 1E96B 4J8SA 4WWNA 3L17A 2XCCA 3LVRE 4XX5A 3AS4A 1N54A 2X38A 4G25A 3RU0A 3D9JA 4U04A 2WXRA 3APDA 3FUFA 3QOUA 3FUJA 4FJZA 5G55A 2WPVA 3JQ1A 2VTBA 3HHMA 3IBEA 4UQZA 1BPOA 2C0MA 4R7LA 3OXGA 3FU3A 3I4GA 3VTYA 4NRHB 4UWLA 2X6JA 4EPZA 3TXNA 4APOA 4XI0A 4PS7A 4BWRA 2WXJA 1OWNA 1DVPA 2YINA 3ASHA 2IOLA 4JVSA 2C0LA 2ONDA 5D0OD 3HIZA 4KXKB 4AVXA 3G2VA 4HS2A 2WQ6A 3G2TA 3SD5A 1W3BA 3PNTB 4FC8A 3SGHA 4HOQA 3FP3A 1H19A 4EZKA 1H2UA 4UI9C 4WWPA 4JHRA 3ZHEA 3QK0A 4AEZC 1KLXA 2VQ2A 3AU5A 4L7TA 3FTZA 3LYAA 4GYOA 1XNFA 3DBSA 3RKVA 2V0PA 2AXUA 3IV0A 3CR3A 4CDRA 3MX3A 4UWKA 3G2SA 1Z6TA 3FU5A 4XKBA 3CQGB 2PM6A 2QY7A 2KCLA 4HOUA 4TRQA 3B7RL 5LCWJ 5J08A 2JEKA 3APCA 2KATA 2VGXB 1JWGA 2WVIA 5FT9A 4I2ZA 5D0QD 3NQPA 3QKYA 4LUNU 3MV3B 3PRZA 2XGSA 1E8ZA 3DPDA 4CDMA 4DI3A 4EZLA 2X3MA 3MEKA 4CT0A 2KCKA 2X6KA 2E0IA 4XI9A 3CVQA 1PY1A 4MS6A 5FZSA 3FUEA 4GMLA 4AJWA 2CHZA 3D3MA 3IHVA 4AXHA 3Q5MA 5ARGA 3ASGA 4P29A 1FVFA 3CSFA 3G2WA 4UWFA 4Y6WA 3FH7A 3I3NA 3VLFA 4EQFA 5JJ7A 2CHWA 2RD0A 3PDNA 4GAAA 4U0UA 2J08A 4LEUA 3CKBA 1IYGA 1LF8A 4OVVA 1S0PA 3ONLA 5T3RA 4DLOA 4KYOB 2WB2A 4WWOA 3S7BA 1WAO1 2J09A 3MA5A 2YQ8A 3D9LA 2UWJG 5C2YA 2NSZA 5G04J 5CMYA 3FY4A 3PUKA 3I5PA 5BV1A 3BEEA 5A7DB 2FI7A 1QQEA 2FF4A 3KS2A 3PH0C 3ZYMA 3UX4A 4I2WA 5EKQD 3QAQA 3PE3A 5E75A 2NXPA 2FO7A 3HYMB 3LDZA 2PM7A 1OWOA 5AIJA 3D9NA 3MYVA 4I6EA 4GZCA 3AS5A 1HG5A 1SQMA 3R7RA 3CEQA 3RJVA 3MGBA 3U9WA 4JPSA 5FJYA 3FUMA 4ILHB 2WXFA 1ZBPA 3D9OA 2YNQA 4ABNA 4U63A 4WNDA 2NC9A 3N71A 4N3CA 4CT4A 5FQ8A 5FTPA 5T4YA 1HO8A 3CQCB 5G05C 3LY7A 4UWGA 4AIFA 4WNGA 4A1SA 1TEZA 4TUUA 4EZJA 4FHJA 4J6IA 3CSTA 1E8YA 2J49A 2VTBB 4C0EA 4Q96A 3CK7A 4J8EA 3ZXSA 4NQ0A 5BPPA 1EPUA 4HORA 3HDXA 3ASFA 2MOWA 3E4BA 3QB2A 4A3TA 2BTDA 4L23A 4U0SA 2X6IA 4Q94A 1VDYA 4APFA 4G26A 4FJYA 4BX9A 4G2VA 4U8HA 3CVYA 4I6JA 4L1BA 4GCNA 3U64A 5ENNA 3CVXA 3UT8A 1OUVA 2GRLA 4IULA 2J9QA 3S7JA 4HOTA 3FU0A 2UY1A 1FVHA 2A5UA 4F7AA 2IF4A 4B8CB 1DNPA 1H0AA 3OAWA 4G1TA 1UN9A 4PS3A 3SI5A 5ANRA 1NZNA 3S7DA 1NP7A 4UQYA 1IQRA 1HH8A 3T8MA 2WQHA 3EJNA 2XEVA 2LSVA 3LXUX 1Y6IA 4V3IA 1OWMA 5DBKA 3VLDA 3PS6A 4ATGA 4AOFA 5FWQA 5BNWA 4A55A 1JUQA 4JEHA 2KCVA 3ML9A 2UY1B 4N3AA 3ZIMA 2HO1A 3CVNA 3CHSA 5G04C 2XQ0A 3ZN3A 3CK9A 3PEVB 5T8IA 3B7TA 4BT8A 3ONKA 2FBNA 3I4RB 3Q4AB 4CGWA 3ESKA 3LY8A 3R7QA 3D9PA 5AJDA 3IKOB 1QNFA 2GRMA 1QZ2A 3PEUB 3TL5A 4FP7A 4BT9A 1H2TC 1PC2A 3JQ0A 3URZA 3MCXA 4KVMA 3MKQA 2L6JA 4CGVA 1HE8A 5AENA 5CMWA 2IFUA 4FU3A 1MHQA 3APFA 3SFZA 4FHKA 4PDXA 3FEXA 3FH8A 5BUZA 3FTXA 4K03A 2GW1A 2DCPA 2FEZA 2L0IA 3KEZA 5A6CA 3EDTB 3L13A 1SZ9A 4ANUA 3ML8A 2EQXA 2AW6A 3L54A 4HVBA 4JC8A 3PE4A 4RG9A 2C2LA 4L2LA 3LS8A 4CRWA 2R5SA 2WXGA 3B7SA 5CCMA 2R17C 3QWVA 2VGXA 4BTAA 4NURA 4GZ3A 3EHNA 3LJ3A 3D9KA 4PS8A 3VTXA 4HOSA 2XPIA 3EIQC 1H6KA 3GZSA 4G11A 4XE0A 3KAEA 1OWPA 3CHMA 2VSYA 4I1OB 5LOZA 4UI9J 3ZW3A 1IHGA 4B0ZA 2HYZA 3R9AB 2E2EA 4LRZA 2MRIA 3Q49B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AP2 A;  2EQX A;  4HXI A;  3HVE B;  4HS2 A;  4APF A;  3I3N A;  3HVE A; 
#chains in the Genus database with same CATH topology
 3RRN B;  2LAH A;  5FIN A;  2PQR A;  2WXQ A;  2Y0B G;  3ZPJ A;  4TXP A;  5D66 A;  5BXU A;  4I9E A;  2F8X K;  1K1B A;  2P9L G;  1TNO A;  3B7U X;  4F1S A;  3GYZ A;  2V4H C;  3L16 A;  1SA5 A;  2QFC A;  3KD7 A;  3ZYQ A;  4J8F A;  3FUN A;  5BW8 C;  4O1P A;  2XGO A;  4GMJ A;  3UQ3 A;  2AXZ A;  5AQ9 A;  3S7F A;  3ENE A;  3PVL A;  3NF1 A;  3JXJ A;  4HFG A;  1D8D A;  1OWL A;  4RQI A;  1UN8 A;  4JA7 A;  3QAR A;  3SO8 A;  1Z3Y A;  3ULQ A;  2I9C A;  1TN8 A;  3TAX A;  3SZ7 A;  3RIB A;  4DPR A;  2IU1 A;  3ABM E;  4GA2 A;  4HB5 A;  2YHE A;  2VYI A;  4XIF A;  1K8K G;  4L9P A;  5D2M C;  3FFL A;  3C98 A;  2J4D A;  4A1G A;  2P9K G;  2J07 A;  3DXK G;  3PRE A;  1XGW A;  1HX8 A;  4E6H A;  3CVP A;  2I1J A;  2WXN A;  4WAF A;  3TG5 A;  5EID A;  1MX2 A;  3ASD A;  4HLL A;  5KWD A;  3KEA A;  4I9C A;  3LVQ E;  1KT0 A;  3OXF A;  5ANL A;  4EBA A;  5KNG A;  3C5R A;  4KMO A;  2LAI A;  2J8S D;  3CKC A;  1BD8 A;  2ZIS A;  4OYS A;  2P9N G;  1S63 A;  1UJK A;  4WNE A;  3T9K A;  1K1A A;  4KZC A;  3ZEF A;  4TUM A;  4GTV A;  2XCB A;  3HG0 D;  5A23 A;  2L9B A;  3ABL E;  4J8D A;  2AWI A;  1V54 E;  1GW6 A;  5FQ6 A;  2AVP A;  3MZL B;  2EIL E;  4DK5 A;  3ISM C;  1O1R A;  4CCA A;  4JL0 A;  4IN3 B;  4U0Z A;  3EIJ A;  2WXH A;  3CHR A;  3MJW A;  1S64 A;  1HG2 A;  4H7X A;  4XKC A;  4JW1 A;  4CZ2 D;  3DEP A;  2VJ8 A;  4JXT A;  3QNK A;  3SF4 A;  1EF1 C;  5HI7 A;  4I6G A;  2V4L A;  3UI2 A;  3TJP A;  2FO1 E;  4K5C A;  3Q47 B;  1H6O A;  3W9F A;  2P9P G;  3Q15 A;  3AS8 A;  2PL2 A;  4GYW A;  3FH5 A;  4GTP A;  3QWP A;  2PQN A;  5KJL A;  1TNY A;  2KM4 A;  5FQ4 A;  4C0M A;  2QZA A;  4KVO A;  4BSX A;  3UKU G;  5CRV A;  3W9G A;  4B93 B;  4GPK A;  3CV0 A;  3RRU A;  5HS0 A;  2WXM A;  3O48 A;  3Q73 A;  4WWN A;  2XCC A;  1KZP A;  2OCC E;  3RAU A;  4XX5 A;  3AG4 E;  2F8Y A;  4G25 A;  3RU0 A;  3FUF A;  4FJZ A;  3JQ1 A;  3HHM A;  3Q78 A;  1BPO A;  3OXG A;  3I4G A;  3VTY A;  1D8E A;  4NRH B;  2X6J A;  4EPZ A;  1IKN D;  4PS7 A;  2WXJ A;  1DVP A;  4K5A B;  2QYU A;  5ENQ D;  2OND A;  5D0O D;  4KXK B;  4AVX A;  3G2V A;  3G2T A;  1N0Q A;  3PNT B;  4HOQ A;  4EZK A;  3QK0 A;  3AU5 A;  3LYA A;  1XNF A;  3DBS A;  5EIB E;  2AXU A;  1RZ4 A;  4CDR A;  4UWK A;  3G2S A;  4XKB A;  3CQG B;  5LCW J;  3C3R A;  3APC A;  2KAT A;  2WVI A;  5FT9 A;  3NQP A;  3PRZ A;  4HI9 A;  1E8Z A;  5CRU A;  2X3M A;  4CT0 A;  3CVQ A;  4MS6 A;  5FZS A;  4GML A;  4AJW A;  3HXE A;  2XEE A;  3IHV A;  4AXH A;  3Q5M A;  1OY3 D;  4EQF A;  1FVF A;  5JJ7 A;  2LXL A;  4U0U A;  2J08 A;  1IYG A;  2GRP B;  4WWO A;  5AN8 A;  1WAO 1;  2YQ8 A;  4GTM A;  5G04 J;  1QBQ A;  3I5P A;  4U7E B;  4F1P A;  2FI7 A;  3KS2 A;  4HQD A;  4I2W A;  5EKQ D;  3PE3 A;  3HXB A;  2NXP A;  3V31 A;  4N5Q A;  3AS5 A;  1DCE A;  5EN5 D;  3AAA C;  3MGB A;  4JPS A;  4GTQ A;  2WXF A;  3D9O A;  2P9I G;  4U63 A;  2NC9 A;  3N71 A;  4CT4 A;  5FQ8 A;  5FTP A;  5T4Y A;  1HO8 A;  3CQC B;  4EZJ A;  3DSX A;  5KBA A;  4C0E A;  3CK7 A;  4CYM D;  5EYP F;  4L23 A;  4U0S A;  4G8L A;  4G26 A;  4L1B A;  3UT8 A;  1OXJ A;  2J9Q A;  2EIK E;  3B95 A;  2UY1 A;  4PS3 A;  5JMN D;  4YDW A;  3SI5 A;  1NZN A;  1NP7 A;  2PNN A;  3EJN A;  2LSV A;  5FWQ A;  5BNW A;  1JUQ A;  2UY1 B;  4N3A A;  5JA4 D;  3J5Q B;  1FPP A;  3CHS A;  2XQ0 A;  3CK9 A;  2XEN A;  3ONK A;  3I4R B;  3Q4A B;  4CGW A;  2GRM A;  2MYO A;  4BT9 A;  1PC2 A;  2EIM E;  3V2X A;  5EIL A;  3V79 K;  2LXM A;  4LNG A;  4U8V D;  1MHQ A;  5BUZ A;  4FHK A;  4K03 A;  2GW1 A;  3KEZ A;  5A6C A;  3TWT A;  4DRX E;  3X2Q E;  4J7W A;  3L54 A;  3SQV A;  4JC8 A;  3PE4 A;  4L2L A;  3B7S A;  2QYJ A;  2VGX A;  1U2V G;  4NUR A;  3EHN A;  1OCC E;  3VTX A;  4HOS A;  4G11 A;  4GTS A;  3KAE A;  3CHM A;  4UI9 J;  3ZW3 A;  1IHG A;  4B0Z A;  2HYZ A;  1NA3 A;  4DI3 A;  3HRA A;  4GA1 A;  1YMP A;  2FUL A;  4EBA G;  1E7V A;  3C3O A;  2V8S E;  4F3V A;  3KSQ A;  2DYR E;  3UTM A;  2M63 A;  4G24 A;  4ATZ D;  4BY6 A;  2R59 A;  3BG1 B;  3GW4 A;  2WXL A;  4TV3 A;  3QC1 A;  3FHE A;  2JLB A;  3TG4 A;  3NAW A;  3RSE G;  1Z5S C;  3LPZ A;  3ZXP A;  2P58 C;  2WXP A;  3ZKJ A;  4GB9 A;  4GPM A;  3JYS A;  2OEV A;  3IEG A;  2I1K A;  5CEA A;  1A17 A;  3LY9 A;  3U3W A;  2V5F A;  4RLY A;  4KBQ A;  2F0Y A;  4GTT A;  4GA0 A;  4TXQ A;  1EDU A;  2NYJ A;  3CK8 A;  1HFA A;  3NOC D;  1TR4 A;  3E32 A;  2WMO A;  4JEU A;  1WDY A;  4AP2 A;  4GU5 A;  5ENS D;  4ACL A;  3FUL A;  2IEJ A;  3FUI A;  3BQO A;  5CBN A;  4U07 A;  4UI9 K;  4NAC A;  4ANW A;  4D10 C;  3P2B A;  5HKP A;  2Y4T A;  2WXO A;  3DEO A;  4HXI A;  4H7Y A;  3VLE A;  3SBS A;  4PUC A;  5LX8 A;  3CVW A;  3WXX A;  3AG3 E;  1MQS A;  5LCW C;  1UOH A;  2DYS E;  2CG2 A;  3ZUV B;  2F37 A;  3GZ2 A;  4I1A A;  2WXK A;  4LNU D;  2CG3 A;  3OTN A;  3ZHE B;  3FU6 A;  3UT7 A;  5J90 A;  4N2Q A;  1X81 A;  4KZ0 A;  2AXV A;  1MZC A;  1D9S A;  2KC7 A;  4I17 A;  3L22 A;  4EHM A;  4GCO A;  4F53 A;  1ELR A;  1HU3 A;  2CFU A;  2X6F A;  3SBT B;  2L0T B;  1IHB A;  3D9M A;  3AG2 E;  3QJZ A;  2ETA A;  3UIO C;  2WMN A;  2RFM A;  1SZA A;  1ZU2 A;  4RVB A;  1FCH A;  4J8Y A;  4GZ5 A;  5DIZ A;  4B8A A;  2OOE A;  3NZU A;  3FTY A;  1HXI A;  1TYQ G;  2Q7F A;  4LER A;  4IYP A;  3FUK A;  3FUD A;  1U3C A;  4J8S A;  1N54 A;  2X38 A;  3D9J A;  3APD A;  4UWL A;  5AAO A;  5B1B E;  3ULE G;  4APO A;  3DST A;  4HRL A;  3TWR A;  3IXE A;  3NOG D;  3TWW A;  4TXR A;  4HS2 A;  2WQ6 A;  1W3B A;  1N4R A;  4UI9 C;  4YDY A;  1WG0 A;  2R02 A;  3CR3 A;  2XS8 A;  2XZD G;  4G8K A;  4HOU A;  2L6B A;  3E30 A;  5CER B;  3DSV A;  5KNH D;  1JWG A;  4I2Z A;  5D0Q D;  3MV3 B;  1K3Z D;  5ENO D;  2GRR B;  5CBO A;  3MEK A;  2X6K A;  2E0I A;  3B7B A;  3D3M A;  2IO3 C;  4DX7 D;  3FH7 A;  3TWS A;  3PDN A;  4GAA A;  4F6R D;  4LEU A;  5AQB A;  2J09 A;  3PZ3 A;  3PUK A;  3PH0 C;  3UX4 A;  2QC9 A;  3ASN E;  2FO7 A;  2R03 A;  2PM7 A;  2DZO A;  3MYV A;  4I6E A;  4C48 B;  1HG5 A;  3R7R A;  4U8Y D;  3HXF A;  2YNQ A;  4ABN A;  3C72 A;  2GRQ B;  4WND A;  1LTX A;  1Q2Z A;  4DX5 D;  1TEZ A;  4U95 D;  4MBG A;  4FHJ A;  4J6I A;  2J49 A;  1KZO A;  4LNB A;  1JCR A;  4J8E A;  3ZXS A;  3ASF A;  3QB2 A;  1VDY A;  4FJY A;  4I6J A;  1H6P A;  3Q9U C;  5ENN A;  3CVX A;  2GRL A;  3NB2 A;  2IY0 C;  3S7J A;  4HOT A;  3FU0 A;  4F7A A;  1FVH A;  4B8C B;  1H0A A;  3OAW A;  1JCS A;  3T8M A;  2XEV A;  3VLD A;  1OWM A;  3EU5 A;  3ZIM A;  5G04 C;  3ZN3 A;  4X8Q A;  4BT8 A;  3D9P A;  3IKO B;  1QZ2 A;  2H6H A;  3J5P A;  4KVM A;  4GTR A;  2L6J A;  4CGV A;  5CMW A;  4FU3 A;  3SFZ A;  1FT1 A;  4PDX A;  3FH8 A;  3DSS A;  3UM0 A;  2R2L A;  2L0I A;  3EDT B;  1SZ9 A;  5ENT D;  4ANU A;  2EQX A;  2AW6 A;  4RG9 A;  3R9M A;  3LS8 A;  3TWV A;  2WXG A;  4BTA A;  3E34 A;  3EIQ C;  5LOZ A;  1KPS B;  4LRZ A;  2MRI A;  3CVU A;  2LNI A;  1EYH A;  3UIP C;  1TNZ A;  1HF8 A;  1YYH A;  3FWV A;  3RRM B;  3BUA A;  3OXL A;  5FQ7 A;  1X5B A;  3ZVV A;  4BEP A;  4GTO A;  2OVB A;  4RSY A;  1UJJ A;  4ME2 A;  4ILI A;  3SNX A;  2KZT B;  2PZI A;  5KCM A;  3ULY A;  2ETC A;  5EDS A;  2OV8 A;  1IQU A;  3MKR A;  4YVQ C;  3D9I A;  3ZYL A;  4JHK A;  2XGM A;  4AY5 A;  2LSU A;  5FIO A;  1PAQ A;  4L2Y A;  4A63 B;  3CHQ A;  5KJM A;  4FLH A;  4DJA A;  3L6A A;  4UUC A;  3ZFW A;  1HS6 A;  3ESL A;  3BG0 B;  3DXM G;  4DLQ A;  4N3B A;  2XPY A;  3QDN A;  4LCT A;  3TGO A;  4DX6 D;  5E76 A;  5B3S E;  1ELW A;  4BFR A;  4A3V A;  3CHP A;  1OCO E;  1RW2 A;  4URK A;  4O6F A;  2CFZ A;  2OVF A;  1IXV A;  3SHF A;  4O60 A;  3EUV A;  3AG1 E;  4I43 A;  4Q69 A;  4HRM B;  4B89 A;  2WM9 A;  2ZIR A;  5ARF A;  3EHM A;  3E37 A;  4JHJ A;  2KXP C;  4N39 A;  5FZR A;  4B94 A;  2CHX A;  4QFV A;  3LJN A;  1N52 A;  3UIN C;  4LSZ E;  4Y6C A;  1N4Q A;  3RK6 A;  1U3D A;  5EX0 A;  3FUH A;  2XEH A;  1MX6 A;  4YDE A;  1E7U A;  4OAV B;  3TWQ A;  1N11 A;  2GRO B;  3NZS A;  1WY6 A;  4KT6 B;  3Q79 A;  3Q7F A;  3PUJ A;  5AJL A;  3UMV A;  5AQA A;  2DWZ A;  5HQ8 A;  3CHO A;  1G3N B;  3PNL B;  2DBA A;  3FTW A;  3CIA A;  1O5M A;  1E8W A;  4YVO A;  1JCQ A;  4CEM A;  1DC2 A;  4ACK A;  1N0R A;  3UT4 A;  1N94 A;  4N2S A;  4C9B B;  4GYY A;  4E85 A;  3FEY A;  3UXG A;  1BU9 A;  1H2V C;  1LD8 A;  3L08 A;  5BXO A;  3EHQ A;  3LCA A;  3RO2 A;  2Y3A A;  3JUI A;  1HZ4 A;  2X6H A;  3HVE A;  3U4T A;  5CCL A;  3F6Q A;  4ILG A;  4DUI A;  3PZ4 A;  4FA6 A;  1E8X A;  4IRU A;  2ION A;  1OCZ E;  4BSZ B;  3ZRH A;  1N4P A;  4UQX A;  5G2N A;  5JJT A;  3UM1 A;  2RFA A;  1TJC A;  5EX3 A;  3G2U A;  5M72 A;  5BV0 A;  1YA0 A;  4I1M A;  1TN7 A;  3LVR E;  4M7C A;  4U04 A;  2WXR A;  5G55 A;  3FUJ A;  2WPV A;  2C0M A;  3FU3 A;  4ZFH A;  3TXN A;  4BWR A;  1OWN A;  3ASH A;  4JVS A;  2C0L A;  3PZ2 A;  1BI8 B;  3HIZ A;  3UKR G;  3SGH A;  1H2U A;  4JB8 P;  3JUE A;  4WWP A;  4JHR A;  3ZHE A;  1KLX A;  2VQ2 A;  4GYO A;  1QYM A;  3RKV A;  3IV0 A;  2PM6 A;  3B7R L;  3ZNG A;  5J08 A;  2GRN B;  2Y69 E;  2JEK A;  2VGX B;  2JAB A;  3QKY A;  2XGS A;  3V2O A;  4XI9 A;  4GMR A;  4HBD A;  2RKK A;  5ARG A;  3ASG A;  4UWF A;  3VLF A;  3I3N A;  2CHW A;  3Q75 A;  1S0P A;  5T3R A;  3TWU A;  4KYO B;  3MA5 A;  3D9L A;  2UWJ G;  2NSZ A;  3FY4 A;  5A7D B;  3QAQ A;  5E75 A;  3HYM B;  3BU8 A;  3LDZ A;  3D9N A;  3JXI A;  2DVW A;  1N9A A;  3DWL G;  5FJY A;  1MJ0 A;  3FUM A;  1SVX A;  3LY7 A;  4UWG A;  4AIF A;  4A1S A;  1E8Y A;  3SFX A;  2VTB B;  4HOR A;  2MOW A;  4A3T A;  2BTD A;  4Q94 A;  4XEI G;  4BX9 A;  3CVY A;  4GCN A;  3U64 A;  3TWX A;  4HI8 A;  1OUV A;  2A5U A;  2IF4 A;  1UN9 A;  2B6C A;  1IQR A;  2WQH A;  4ATG A;  3PS6 A;  2KCV A;  2XZT G;  5HRY A;  3CVN A;  3KSL A;  3PEV B;  2FBN A;  3ESK A;  3R7Q A;  1QNF A;  3PEU B;  4FP7 A;  3MCX A;  5ITZ F;  2IFU A;  3FEX A;  1N4S A;  3FTX A;  3L13 A;  2R05 A;  3ZU7 B;  5CEC B;  2R17 C;  3QWV A;  4DX1 A;  4GZ3 A;  1A5E A;  3LJ3 A;  3D9K A;  3EU9 A;  1YCS B;  1OWP A;  2VSY A;  3T8K A;  4I1O B;  2AJA A;  4JD2 G;  3R9A B;  2E2E A;  1DCQ A;  2HM8 A;  5G05 J;  3LEW A;  3P1U A;  1OT8 A;  3Q9N C;  4QQI A;  2ILR A;  2WQ7 A;  4YND A;  4K0R A;  4JZY A;  4MLP A;  5LFA A;  4BTB A;  2J4B A;  5JHA A;  4MRU A;  4K5B A;  3ZYK A;  3L9T A;  3D9H A;  3FDH A;  4AV7 A;  1N95 A;  4MKT A;  1JPL A;  4OVU A;  2Y1L E;  2P2C P;  4J0U A;  3AU4 A;  3MKQ B;  3S2A A;  5KJK A;  2RG8 A;  1NA0 A;  3Q7A A;  2KZT A;  4DI4 A;  1ZB1 A;  4WUY A;  3T5X A;  5LP0 A;  4ANX A;  2DIW A;  4M3O A;  3V30 A;  3LKU A;  1INZ A;  4HLE A;  4BX8 A;  1AWC B;  1S70 B;  3O4Z A;  2BUG A;  2BED A;  2P9S G;  3K9I A;  4Z68 A;  4LG6 A;  5FZQ A;  4PH4 B;  1NI1 A;  2I6H A;  2HR2 A;  4GZD A;  1TJF A;  2XHE A;  2H6G A;  1KT1 A;  2P9U G;  3CVL A;  5C1D A;  3GZ1 A;  2GGF A;  3CLJ A;  1BLX B;  3T5V A;  3FTV A;  3NBN B;  4AM9 A;  2MHK A;  4ZHB A;  3EHR A;  2IOS A;  2IJG X;  2IO2 C;  3B13 A;  4RG6 A;  2VSX E;  4G23 A;  4FLB A;  3SY2 A;  4WNF A;  4W9R A;  2WXI A;  1ELK A;  2LO6 A;  2VGE A;  2H6F A;  2I2O A;  3FTU A;  2YHC A;  5AYW D;  2EIJ E;  1TN6 A;  3JCK C;  2Y4U A;  4XZ4 A;  2A4Z A;  1WM5 A;  3MV2 B;  4YDO A;  1L5J A;  2VSO E;  3UUX A;  2EIN E;  3PZD A;  2ZU6 B;  5CHE E;  4N5C A;  3HVE B;  3RO3 A;  2KBX A;  3DPY A;  3DSW A;  1Y8M A;  3DSU A;  2VGY A;  1OCR E;  2VSN A;  1UW4 B;  5AQ7 A;  4JA9 A;  3IHY A;  3TXM A;  2OEW A;  1O1S A;  4CDN A;  3CGH A;  1E90 A;  4DX2 A;  2XRY A;  3ZGQ A;  1JWF A;  1P5Q A;  3CVV A;  2BF0 X;  2A5E A;  3QWW A;  5JJ6 A;  4FUL A;  2B0O E;  1V55 E;  2HE0 A;  1Z3X A;  4AY6 A;  1B89 A;  4ANV A;  4FAD A;  3U66 A;  2IQC A;  2XPZ A;  5KJN A;  1TNU A;  1AP7 A;  5BT1 A;  4UWH A;  3FTS A;  1BI7 B;  3UPV A;  1UG3 A;  2XRZ A;  4EEC A;  1E96 B;  3L17 A;  3AS4 A;  2ZGG A;  4BER A;  3QOU A;  2VTB A;  3IBE A;  4UQZ A;  4R7L A;  2ETB A;  3AJI A;  4XI0 A;  2YIN A;  2IOL A;  3L82 A;  1MYO A;  3SD5 A;  4FC8 A;  3FP3 A;  1H19 A;  5IY5 E;  4AEZ C;  4L7T A;  3FTZ A;  1LD7 A;  2V0P A;  3ASO E;  3MX3 A;  1Z6T A;  3FU5 A;  2QY7 A;  2KCL A;  4TRQ A;  2DZN A;  4HNA D;  4LUN U;  3DPD A;  4CDM A;  4EZL A;  2KCK A;  5B1A E;  1PY1 A;  2ZXW E;  3FUE A;  2CHZ A;  4P29 A;  3CSF A;  3G2W A;  1NL4 A;  4Y6W A;  2RD0 A;  3CKB A;  4U96 D;  1LF8 A;  3ABK E;  4OVV A;  1O1T A;  4DLO A;  3ONL A;  2WB2 A;  3S7B A;  2H6I A;  5C2Y A;  1NFI E;  5CMY A;  5BV1 A;  3BEE A;  1QQE A;  2FF4 A;  3ZYM A;  3HXD A;  5AIJ A;  1OWO A;  4GZC A;  2ZGD A;  1SQM A;  3CEQ A;  3RJV A;  3U9W A;  4ILH B;  1ZBP A;  2V5Q C;  4N3C A;  5G05 C;  5CED B;  4WNG A;  4TUU A;  3CST A;  4Q96 A;  4NQ0 A;  5BPP A;  1EPU A;  2XS1 A;  3HDX A;  5H7P A;  3E4B A;  4NIK A;  1SW6 A;  5AAR A;  4BET A;  2X6I A;  3PZ1 A;  2LUH A;  5EYL A;  4APF A;  4G2V A;  4U8H A;  4BES A;  3HXC A;  4IUL A;  1DNP A;  4G1T A;  5ANR A;  3S7D A;  4UQY A;  1HH8 A;  3LXU X;  4V3I A;  5JHB A;  1Y6I A;  5DBK A;  4AOF A;  4A55 A;  3WG7 E;  4JEH A;  3ML9 A;  2HO1 A;  2BKG A;  3DRA A;  5T8I A;  3B7T A;  1TNB A;  3LY8 A;  5AJD A;  3TL5 A;  1H2T C;  3JQ0 A;  3URZ A;  3MKQ A;  1HE8 A;  5AEN A;  3SFY A;  4OAU C;  3APF A;  3UM2 A;  3E33 A;  2DCP A;  2FEZ A;  2BKK B;  3ML8 A;  1FT2 A;  4HVB A;  4HRN A;  1SA4 A;  2C2L A;  4CRW A;  2R5S A;  5ENR D;  4O1O A;  5CCM A;  3UM3 A;  5ENP D;  4PS8 A;  2XPI A;  1MX4 A;  1H6K A;  3GZS A;  4XE0 A;  4GZ6 A;  3Q49 B;  3C3Q A; 
#chains in the Genus database with same CATH homology
 3RRN B;  2LNI A;  2HM8 A;  5G05 J;  4GA1 A;  2LAH A;  1EYH A;  3LEW A;  1HF8 A;  3FWV A;  3RRM B;  2FUL A;  3OXL A;  2PQR A;  2WXQ A;  3P1U A;  4EBA G;  5FQ7 A;  1X5B A;  3ZPJ A;  1E7V A;  3ZVV A;  2ILR A;  2WQ7 A;  4YND A;  2V8S E;  4K0R A;  4F3V A;  4I9E A;  2OVB A;  4JZY A;  4RSY A;  1UJJ A;  4ME2 A;  4ILI A;  4MLP A;  3SNX A;  5LFA A;  2M63 A;  2KZT B;  4BTB A;  3B7U X;  2PZI A;  4G24 A;  5KCM A;  4F1S A;  2J4B A;  5JHA A;  4BY6 A;  5EDS A;  2OV8 A;  2R59 A;  3BG1 B;  1IQU A;  3GYZ A;  4MRU A;  3GW4 A;  2WXL A;  3MKR A;  3ZYK A;  4TV3 A;  3QC1 A;  4YVQ C;  3D9I A;  3L16 A;  3FHE A;  3FDH A;  2JLB A;  3TG4 A;  2QFC A;  4AV7 A;  3KD7 A;  3ZYQ A;  3ZYL A;  4JHK A;  4J8F A;  2XGM A;  3FUN A;  4MKT A;  4AY5 A;  2LSU A;  1JPL A;  1PAQ A;  4L2Y A;  5BW8 C;  2XGO A;  4OVU A;  3LPZ A;  4GMJ A;  3CHQ A;  3UQ3 A;  5KJM A;  4FLH A;  4DJA A;  3L6A A;  4J0U A;  2P58 C;  1HS6 A;  3AU4 A;  3ZFW A;  3ESL A;  2AXZ A;  3BG0 B;  4DLQ A;  3S7F A;  4N3B A;  3ENE A;  2WXP A;  3PVL A;  3MKQ B;  3NF1 A;  4GB9 A;  2XPY A;  3S2A A;  5KJK A;  3QDN A;  4LCT A;  3TGO A;  3JYS A;  4HFG A;  2RG8 A;  1OWL A;  1NA0 A;  3IEG A;  5E76 A;  1ELW A;  4BFR A;  4A3V A;  2I1K A;  3CHP A;  2KZT A;  4DI4 A;  1UN8 A;  4URK A;  4JA7 A;  3QAR A;  1A17 A;  4WUY A;  1Z3Y A;  3LY9 A;  4O6F A;  3U3W A;  2CFZ A;  2OVF A;  3ULQ A;  3SHF A;  3T5X A;  2I9C A;  3TAX A;  4I43 A;  5LP0 A;  3SZ7 A;  3RIB A;  4ANX A;  2V5F A;  2DIW A;  4M3O A;  4DPR A;  2IU1 A;  4Q69 A;  4KBQ A;  4B89 A;  3LKU A;  1INZ A;  4GA2 A;  2WM9 A;  4GA0 A;  2YHE A;  4HLE A;  1EDU A;  2VYI A;  4BX8 A;  5ARF A;  3CK8 A;  3EHM A;  4XIF A;  1HFA A;  4JHJ A;  4N39 A;  5FZR A;  3O4Z A;  4B94 A;  2CHX A;  2BUG A;  2WMO A;  4JEU A;  4QFV A;  3FFL A;  3K9I A;  3C98 A;  2J4D A;  4A1G A;  2J07 A;  3PRE A;  1XGW A;  4AP2 A;  1N52 A;  4GU5 A;  5FZQ A;  3FUL A;  4ACL A;  4PH4 B;  4GZ6 A;  4Y6C A;  3FUI A;  2I6H A;  2HR2 A;  4GZD A;  1HX8 A;  4E6H A;  3CVP A;  1TJF A;  2I1J A;  1U3D A;  2WXN A;  2XHE A;  4WAF A;  3RK6 A;  3TG5 A;  5EX0 A;  3ASD A;  3FUH A;  1KT1 A;  3CVL A;  5JHB A;  5C1D A;  3GZ1 A;  1E7U A;  2GGF A;  3CLJ A;  4I9C A;  3LVQ E;  1NA3 A;  3NZS A;  1KT0 A;  3OXF A;  4U07 A;  1WY6 A;  4UI9 K;  5ANL A;  4NAC A;  4ANW A;  4EBA A;  3T5V A;  4KT6 B;  3FTV A;  4KMO A;  4D10 C;  3PUJ A;  2LAI A;  3CKC A;  5AJL A;  3UMV A;  4AM9 A;  4OYS A;  3P2B A;  5HQ8 A;  2MHK A;  3CHO A;  2Y4T A;  2IOS A;  2IJG X;  1UJK A;  2WXO A;  4WNE A;  3PNL B;  4KZC A;  4HXI A;  3CVU A;  3ZEF A;  3B13 A;  2DBA A;  3FTW A;  4H7Y A;  2VSX E;  4RG6 A;  2XCB A;  4G23 A;  4FLB A;  3VLE A;  3CIA A;  5A23 A;  4WNF A;  2L9B A;  3SBS A;  4W9R A;  1E8W A;  4YVO A;  2WXI A;  1ELK A;  4J8D A;  2LO6 A;  4PUC A;  5LX8 A;  4CEM A;  2AWI A;  3CVW A;  2I2O A;  4ACK A;  1GW6 A;  3UT4 A;  5FQ6 A;  3FTU A;  3WXX A;  2YHC A;  5AYW D;  4N2S A;  4C9B B;  2AVP A;  4GYY A;  4E85 A;  1MQS A;  3FEY A;  3MZL B;  4DK5 A;  5LCW C;  1H2V C;  2Y4U A;  3JCK C;  2CG2 A;  2A4Z A;  4XZ4 A;  4CCA A;  1WM5 A;  3GZ2 A;  3MV2 B;  1L5J A;  2VSO E;  3UUX A;  4JL0 A;  3L08 A;  4IN3 B;  4I1A A;  2WXK A;  4U0Z A;  3PZD A;  3EIJ A;  2WXH A;  2ZU6 B;  3CHR A;  5CHE E;  2CG3 A;  3OTN A;  3MJW A;  3ZHE B;  3FU6 A;  1HG2 A;  3UT7 A;  5J90 A;  4H7X A;  4XKC A;  4N5C A;  3HVE B;  3RO3 A;  4JW1 A;  4N2Q A;  1Y8M A;  2VGY A;  2VJ8 A;  4KZ0 A;  3RO2 A;  3LCA A;  2VSN A;  4JXT A;  2AXV A;  3QNK A;  1UW4 B;  3SF4 A;  2KC7 A;  1EF1 C;  2Y3A A;  3JUI A;  3L22 A;  4GCO A;  4I17 A;  4I6G A;  1HZ4 A;  3IHY A;  4JA9 A;  5HI7 A;  2V4L A;  1ELR A;  4F53 A;  3TXM A;  3TJP A;  2X6H A;  4CDN A;  1HU3 A;  2CFU A;  3CGH A;  1E90 A;  3HVE A;  3Q47 B;  3U4T A;  5CCL A;  4ILG A;  2XRY A;  2X6F A;  3Q15 A;  3ZGQ A;  1JWF A;  3SBT B;  1P5Q A;  3AS8 A;  2PL2 A;  2L0T B;  3CVV A;  4GYW A;  2BF0 X;  3QWW A;  3FH5 A;  4FA6 A;  3D9M A;  3QJZ A;  5JJ6 A;  3QWP A;  2PQN A;  4FUL A;  1E8X A;  4IRU A;  2ION A;  1Z3X A;  5KJL A;  3ZRH A;  2WMN A;  4UQX A;  4AY6 A;  1B89 A;  4ANV A;  1SZA A;  5G2N A;  4FAD A;  5JJT A;  2KM4 A;  5FQ4 A;  4C0M A;  1ZU2 A;  4RVB A;  4KVO A;  4BSX A;  1FCH A;  2IQC A;  3U66 A;  2XPZ A;  4GZ5 A;  5DIZ A;  4B8A A;  2OOE A;  3NZU A;  3FTY A;  5KJN A;  1HXI A;  2Q7F A;  1TJC A;  4LER A;  5EX3 A;  4IYP A;  5BT1 A;  3FUK A;  3FTS A;  4UWH A;  3G2U A;  5M72 A;  5BV0 A;  4GPK A;  3CV0 A;  3RRU A;  3FUD A;  1U3C A;  1YA0 A;  3UPV A;  2WXM A;  1UG3 A;  2XRZ A;  3O48 A;  4EEC A;  4I1M A;  1E96 B;  4J8S A;  4WWN A;  3L17 A;  2XCC A;  3LVR E;  4XX5 A;  3AS4 A;  1N54 A;  2X38 A;  4G25 A;  3RU0 A;  3D9J A;  4U04 A;  2WXR A;  3APD A;  3FUF A;  3QOU A;  3FUJ A;  4FJZ A;  5G55 A;  2WPV A;  3JQ1 A;  2VTB A;  3HHM A;  3IBE A;  4UQZ A;  1BPO A;  2C0M A;  4R7L A;  3OXG A;  3FU3 A;  3I4G A;  3VTY A;  4NRH B;  4UWL A;  2X6J A;  4EPZ A;  3TXN A;  4APO A;  4XI0 A;  4PS7 A;  4BWR A;  2WXJ A;  1OWN A;  1DVP A;  2YIN A;  3ASH A;  2IOL A;  4JVS A;  2C0L A;  2OND A;  5D0O D;  3HIZ A;  4KXK B;  4AVX A;  3G2V A;  4HS2 A;  2WQ6 A;  3G2T A;  3SD5 A;  1W3B A;  3PNT B;  4FC8 A;  3SGH A;  4HOQ A;  3FP3 A;  1H19 A;  4EZK A;  1H2U A;  4UI9 C;  4WWP A;  4JHR A;  3ZHE A;  3QK0 A;  4AEZ C;  1KLX A;  2VQ2 A;  3AU5 A;  4L7T A;  3FTZ A;  3LYA A;  4GYO A;  1XNF A;  3DBS A;  3RKV A;  2V0P A;  2AXU A;  3IV0 A;  3CR3 A;  4CDR A;  3MX3 A;  4UWK A;  3G2S A;  1Z6T A;  3FU5 A;  4XKB A;  3CQG B;  2PM6 A;  2QY7 A;  2KCL A;  4HOU A;  4TRQ A;  3B7R L;  5LCW J;  5J08 A;  2JEK A;  3APC A;  2KAT A;  2VGX B;  1JWG A;  2WVI A;  5FT9 A;  4I2Z A;  5D0Q D;  3NQP A;  3QKY A;  4LUN U;  3MV3 B;  3PRZ A;  2XGS A;  1E8Z A;  3DPD A;  4CDM A;  4DI3 A;  4EZL A;  2X3M A;  3MEK A;  4CT0 A;  2KCK A;  2X6K A;  2E0I A;  4XI9 A;  3CVQ A;  1PY1 A;  4MS6 A;  5FZS A;  3FUE A;  4GML A;  4AJW A;  2CHZ A;  3D3M A;  3IHV A;  4AXH A;  3Q5M A;  5ARG A;  3ASG A;  4P29 A;  1FVF A;  3CSF A;  3G2W A;  4UWF A;  4Y6W A;  3FH7 A;  3I3N A;  3VLF A;  4EQF A;  5JJ7 A;  2CHW A;  2RD0 A;  3PDN A;  4GAA A;  4U0U A;  2J08 A;  4LEU A;  3CKB A;  1IYG A;  1LF8 A;  4OVV A;  1S0P A;  3ONL A;  5T3R A;  4DLO A;  4KYO B;  2WB2 A;  4WWO A;  3S7B A;  1WAO 1;  2J09 A;  3MA5 A;  2YQ8 A;  3D9L A;  2UWJ G;  5C2Y A;  2NSZ A;  5G04 J;  5CMY A;  3FY4 A;  3PUK A;  3I5P A;  5BV1 A;  3BEE A;  5A7D B;  2FI7 A;  1QQE A;  2FF4 A;  3KS2 A;  3PH0 C;  3ZYM A;  3UX4 A;  4I2W A;  5EKQ D;  3QAQ A;  3PE3 A;  5E75 A;  2NXP A;  2FO7 A;  3HYM B;  3LDZ A;  2PM7 A;  1OWO A;  5AIJ A;  3D9N A;  3MYV A;  4I6E A;  4GZC A;  3AS5 A;  1HG5 A;  1SQM A;  3R7R A;  3CEQ A;  3RJV A;  3MGB A;  3U9W A;  4JPS A;  5FJY A;  3FUM A;  4ILH B;  2WXF A;  1ZBP A;  3D9O A;  2YNQ A;  4ABN A;  4U63 A;  4WND A;  2NC9 A;  3N71 A;  4N3C A;  4CT4 A;  5FQ8 A;  5FTP A;  5T4Y A;  1HO8 A;  3CQC B;  5G05 C;  3LY7 A;  4UWG A;  4AIF A;  4WNG A;  4A1S A;  1TEZ A;  4TUU A;  4EZJ A;  4FHJ A;  4J6I A;  3CST A;  1E8Y A;  2J49 A;  2VTB B;  4C0E A;  4Q96 A;  3CK7 A;  4J8E A;  3ZXS A;  4NQ0 A;  5BPP A;  1EPU A;  4HOR A;  3HDX A;  3ASF A;  2MOW A;  3E4B A;  3QB2 A;  4A3T A;  2BTD A;  4L23 A;  4U0S A;  2X6I A;  4Q94 A;  1VDY A;  4APF A;  4G26 A;  4FJY A;  4BX9 A;  4G2V A;  4U8H A;  3CVY A;  4I6J A;  4L1B A;  4GCN A;  3U64 A;  5ENN A;  3CVX A;  3UT8 A;  1OUV A;  2GRL A;  4IUL A;  2J9Q A;  3S7J A;  4HOT A;  3FU0 A;  2UY1 A;  1FVH A;  2A5U A;  4F7A A;  2IF4 A;  4B8C B;  1DNP A;  1H0A A;  3OAW A;  4G1T A;  1UN9 A;  4PS3 A;  3SI5 A;  5ANR A;  1NZN A;  3S7D A;  1NP7 A;  4UQY A;  1IQR A;  1HH8 A;  3T8M A;  2WQH A;  3EJN A;  2XEV A;  2LSV A;  3LXU X;  1Y6I A;  4V3I A;  1OWM A;  5DBK A;  3VLD A;  3PS6 A;  4ATG A;  4AOF A;  5FWQ A;  5BNW A;  4A55 A;  1JUQ A;  4JEH A;  2KCV A;  3ML9 A;  2UY1 B;  4N3A A;  3ZIM A;  2HO1 A;  3CVN A;  3CHS A;  5G04 C;  2XQ0 A;  3ZN3 A;  3CK9 A;  3PEV B;  5T8I A;  3B7T A;  4BT8 A;  3ONK A;  2FBN A;  3I4R B;  3Q4A B;  4CGW A;  3ESK A;  3LY8 A;  3R7Q A;  3D9P A;  5AJD A;  3IKO B;  1QNF A;  2GRM A;  1QZ2 A;  3PEU B;  3TL5 A;  4FP7 A;  4BT9 A;  1H2T C;  1PC2 A;  3JQ0 A;  3URZ A;  3MCX A;  4KVM A;  3MKQ A;  2L6J A;  4CGV A;  1HE8 A;  5AEN A;  5CMW A;  2IFU A;  4FU3 A;  1MHQ A;  3APF A;  3SFZ A;  4FHK A;  4PDX A;  3FEX A;  3FH8 A;  5BUZ A;  3FTX A;  4K03 A;  2GW1 A;  2DCP A;  2FEZ A;  2L0I A;  3KEZ A;  5A6C A;  3EDT B;  3L13 A;  1SZ9 A;  4ANU A;  3ML8 A;  2EQX A;  2AW6 A;  3L54 A;  4HVB A;  4JC8 A;  3PE4 A;  4RG9 A;  2C2L A;  4L2L A;  3LS8 A;  4CRW A;  2R5S A;  2WXG A;  3B7S A;  5CCM A;  2R17 C;  3QWV A;  2VGX A;  4BTA A;  4NUR A;  4GZ3 A;  3EHN A;  3LJ3 A;  3D9K A;  4PS8 A;  3VTX A;  4HOS A;  2XPI A;  3EIQ C;  1H6K A;  3GZS A;  4G11 A;  4XE0 A;  3KAE A;  1OWP A;  3CHM A;  2VSY A;  4I1O B;  5LOZ A;  4UI9 J;  3ZW3 A;  1IHG A;  4B0Z A;  2HYZ A;  3R9A B;  2E2E A;  4LRZ A;  2MRI A;  3Q49 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...