5FZSA

Designed tpr protein m4n delta c (cf ii)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
107
structure length
107
Chain Sequence
NSIKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNNIKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNNIKTLSNLAVLLAQEGKAEEAIKYMRKAVSLIDKAAKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords DESIGNED TPR PROTEIN
publication title Origin of a folded repeat protein from an intrinsically disordered ancestor.
pubmed doi rcsb
source organism Synthetic construct
total genus 43
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5fzsA00
2MHKA 3U3WA 3QWVA 3ZGQA 4I2ZA 3SZ7A 5D0OD 4HORA 3RU0A 3AS4A 4U07A 4Y6WA 4J8EA 3QDNA 3MEKA 3UQ3A 3VTYA 3GZ1A 4N2SA 2XGSA 5FZRA 5JJ6A 3NF1A 1QZ2A 5DBKA 3RO3A 4JA9A 3Q15A 3S7BA 3HYMB 4GPKA 4G25A 2P58C 3ASGA 2XGOA 3CK8A 4BWRA 1W3BA 4G26A 1P5QA 3CK7A 1XNFA 1KT0A 5D0QD 4WNGA 4U0SA 4GZ6A 3IEGA 4APOA 3CVQA 1ELWA 2Y4UA 3ZN3A 5KJKA 3RIBA 4HOUA 2NC9A 4N3CA 4WNEA 3ESKA 3S7JA 4N3BA 1FCHA 3ZHEA 3ZHEB 3CVNA 3CVPA 5EX3A 3PE4A 2E2EA 4YVOA 4JL0A 3N71A 4GCOA 2LSVA 4G23A 4EQFA 3MV3B 2KATA 3U4TA 4NRHB 4U0ZA 1IHGA 3WXXA 3FWVA 4GA2A 4RG6A 4UQZA 5ARGA 1WAO1 2VGYA 1PC2A 3TAXA 4CDRA 4N3AA 3VTXA 5KJLA 3CV0A 1NZNA 3AS8A 4AY5A 4NQ0A 3QOUA 3K9IA 3ASFA 5ARFA 5HI7A 4IN3B 5BT1A 5KJNA 3QWWA 3Q49B 5BW8C 4HOTA 4HOSA 4GYOA 1IYGA 2OOEA 2L6JA 4GZ5A 2KC7A 4CGWA 5CHEE 3KD7A 4GCNA 3CKCA 3R9AB 3MA5A 2ONDA 3GYZA 3QKYA 3S7DA 3QWPA 3OXGA 4YNDA 2HO1A 4BT9A 2GW1A 4N39A 4UI9K 3LPZA 2HR2A 3Q4AB 4JHRA 5FT9A 2UY1A 4G2VA 2UY1B 3LY7A 4JA7A 5EX0A 2R5SA 2KCKA 4GYWA 4BTBA 4U04A 4G1TA 2Q7FA 2LSUA 2KCLA 4UI9C 3RO2A 2XEVA 1E96B 3FFLA 4A1SA 3LKUA 4GA0A 3GZ2A 3SF4A 1ELRA 5DIZA 4GYYA 4H7YA 2C2LA 3CK9A 2PL2A 4LEUA 4RG9A 4XI0A 3Q47B 4H7XA 4UQYA 5G05C 4W9RA 4BTAA 4ME2A 4N2QA 4J8FA 2VSNA 1TJCA 3LY8A 2XCCA 2PQNA 2UWJG 4KXKB 3PDNA 4I9CA 4WNDA 3ULQA 1WM5A 3E4BA 3LY9A 2JLBA 3O48A 5KJMA 4B94A 3LCAA 3RKVA 1ZU2A 3URZA 5JJTA 5CCMA 4I2WA 3CEQA 3TG5A 1QQEA 5JJ7A 5G04J 5HQ8A 2I6HA 4G24A 2VGXB 3LYAA 4F3VA 3JYSA 2IF4A 3GW4A 5BNWA 1NA0A 3MV2B 3MKRA 4XIFA 2VQ2A 4J8DA 2Y4TA 5C1DA 5A7DB 5A6CA 1Y8MA 3RJVA 4AY6A 4AM9A 4XI9A 5FZSA 3ZPJA 4WUYA 4AIFA 1YA0A 2QFCA 3S7FA 5LCWJ 2XGMA 3EDTB 2WPVA 4O6FA 4I17A 4KBQA 2XPIA 2IFUA 3TG4A 4Y6CA 4YVQC 3CVLA 5CCLA 1HZ4A 1KT1A 2FBNA 2VYIA 4KYOB 4BT8A 3CKBA 4ABNA 4I1AA 3AS5A 4GA1A 4I9EA 4WNFA 2C0MA 1A17A 5AYWD 2FF4A 2PZIA 5G04C 2XCBA 5FZQA 4CGVA 2HYZA 3ASHA 2J9QA 3UUXA 4GZ3A 2FI7A 5EKQD 5FTPA 2WQHA 2YQ8A 4J0UA 1OUVA 4UI9J 4N5CA 2FEZA 2VGXA 3PE3A 1NA3A 3KS2A 3BEEA 3OXLA 1HH8A 3OXFA 2AVPA 1ZBPA 3ZFWA 1B89A 4UQXA 4U0UA 3KAEA 5G05J 3TGOA 2V5FA 1HXIA 1KLXA 2C0LA 2KCVA 3Q5MA 5LCWC 2LNIA 3UPVA 2DBAA 2BUGA 3FP3A 2YHCA 2VSYA 4HOQA 5M72A 5FJYA 2PQRA 3ASDA 2FO7A
chains in the Genus database with same CATH superfamily
2V5QC 2MOWA 3ZGQA 3HXFA 5D0OD 3ZKJA 4K5AB 3TWUA 3FU5A 4A3TA 3FUFA 4I6JA 4AOFA 4MBGA 4TRQA 3MEKA 2QZAA 3LVRE 3Q9NC 3Q7AA 5AJLA 2J08A 4JA9A 4UWHA 3HYMB 3L54A 2BF0X 4J6IA 2GRRB 3CGHA 3IHYA 3JXIA 4JZYA 4FADA 3CK7A 1SA5A 5EN5D 1XNFA 5B3SE 4APOA 4LNUD 4EBAA 3ZN3A 3J5PA 1DCQA 4HOUA 1MX6A 3ABLE 4N3CA 2IONA 1HS6A 4R7LA 1X5BA 2F8YA 4N3BA 1HX8A 5CBOA 2XEEA 3ZHEA 3ZHEB 4FULA 3CVPA 4TUUA 1TN7A 2E2EA 4F53A 4YVOA 4ILIA 2WQ6A 2PM6A 3PUJA 5KCMA 4U63A 2LSVA 4G23A 3LS8A 2DYRE 3BU8A 3MV3B 2R02A 4AXHA 3WXXA 4XE0A 3JQ1A 4U95D 4UUCA 4KT6B 5CECB 1WAO1 1PC2A 3TAXA 1MHQA 4WAFA 1K1BA 2EINE 3TWXA 5KNHD 2FO1E 4AV7A 2WXPA 3QC1A 2B6CA 4NQ0A 1UN9A 4OVVA 5AARA 5ARFA 5HI7A 4IN3B 4HLEA 5AQAA 3Q49B 1Z6TA 1BD8A 4DI3A 5CBNA 1HFAA 2J4BA 1TNYA 1FT2A 4FHKA 1E8XA 4GTRA 3UT8A 4CRWA 3L9TA 5CHEE 3IHVA 4GCNA 2IOLA 3CKCA 3R9AB 3TWSA 2ONDA 3GYZA 1SZ9A 2X6KA 3QWPA 2HO1A 4IRUA 3U9WA 3RRMB 4HS2A 3ZYLA 4JHRA 3Q4AB 2JEKA 1MZCA 3SGHA 2UY1A 2QYJA 2UY1B 2IU1A 4EHMA 1NFIE 3LY7A 4JA7A 3DSXA 2Q7FA 3UM2A 2ZGGA 5AQ7A 3TWVA 2M63A 3FTUA 3LKUA 4RQIA 3ZYKA 2DWZA 3CHOA 5T4YA 3ZUVB 5ENPD 1ELRA 3L22A 1XGWA 3CK9A 2PL2A 2V0PA 5LX8A 2R05A 4XZ4A 5FQ7A 4ME2A 1OY3D 4EZLA 3KEZA 3I5PA 4WWNA 2LUHA 2PQNA 4CDMA 3EUVA 4I9CA 4ILGA 2JLBA 3MZLB 3LCAA 5JJTA 5CCMA 4HQDA 5JJ7A 2VGXB 4M7CA 4RLYA 2IO3C 3W9GA 4F1PA 4B8CB 3B7TA 4EECA 3G2VA 5BPPA 1U3DA 1O1RA 2P9NG 2VSXE 5HKPA 4ZFHA 4L2YA 3TJPA 3QJZA 4XIFA 2Y0BG 3ASNE 4AY6A 4XI9A 5FZSA 3FTYA 4AIFA 1UW4B 4YDEA 4BSZB 3MCXA 3R7RA 2WXHA 3R9MA 3EHNA 4J8SA 4BSXA 1OWNA 4JEUA 3G2UA 1JUQA 1TEZA 3B7BA 3EDTB 2CHZA 2WPVA 3RK6A 4I17A 4LG6A 3ASOE 2V4LA 2XPIA 2LAHA 4HVBA 4PUCA 1E90A 3MYVA 4A1GA 3TG4A 4DX5D 2OCCE 4Y6CA 3CVLA 1SA4A 2KZTA 4PH4B 2KZTB 1FVHA 2WQ7A 2BEDA 4CYMD 1Q2ZA 2CG2A 2A5UA 4BT8A 4BY6A 4HLLA 5EDSA 4I1AA 3AS5A 4GA1A 5HS0A 4C0MA 4WNFA 2C0MA 5AYWD 5G04C 5CRVA 2HYZA 1DVPA 4GAAA 3ONKA 2XQ0A 4OAUC 1H2VC 2WXKA 4J7WA 4J0UA 1K3ZD 4K5BA 1N0RA 1Z3YA 2F0YA 2EILE 4DI4A 1VDYA 4ACKA 5D66A 3BEEA 4XKCA 4U8HA 4GTTA 1HH8A 1SVXA 3GZSA 4U0UA 2WXJA 2V5FA 3HXEA 2C0LA 2DYSE 2KCVA 1MX2A 4X8QA 3PZ4A 1UJKA 2WXIA 2I2OA 4CCAA 3UPVA 4FLBA 3FUMA 1HG2A 4HOQA 4LCTA 5M72A 3J5QB 1TNZA 2MHKA 4F6RD 3NAWA 3ML8A 3SZ7A 3JCKC 5E75A 4U07A 3FDHA 2CFZA 2J09A 1RW2A 3QDNA 3UQ3A 2GROB 1JWFA 2L0TB 4MRUA 2BTDA 1QZ2A 3NF1A 3ONLA 2A5EA 3CHMA 4U7EB 4UWFA 4TXRA 3E30A 3P2BA 3B7UX 1D8DA 3PZ3A 4GPMA 3UINC 4L9PA 1E8WA 1P5QA 4GZ6A 3IEGA 2GRPB 3PZ2A 1NP7A 3CVQA 3PNTB 4ILHB 3ESKA 1N95A 3C3QA 3S7JA 4L1BA 4GTOA 3UTMA 2NSZA 4JD2G 1HG5A 3PE4A 3HVEA 3HVEB 4JL0A 3N71A 2L6BA 4GCOA 3QK0A 1OXJA 4ANXA 3APFA 4EQFA 2KATA 3ZYQA 4DX1A 4U0ZA 3FWVA 1OCOE 1U2VG 3UM0A 5ARGA 2DIWA 2VJ8A 4N3AA 3VTXA 3DPDA 3CV0A 4FJZA 2JABA 4Q69A 3D9KA 4I1MA 4B8AA 4C0EA 1HU3A 4UWGA 3EHMA 2KM4A 5BT1A 5KJNA 4FU3A 4DX7D 5BW8C 3B13A 1SQMA 2DCPA 4HOTA 1AP7A 1QBQA 4GYOA 3UKUG 5IY5E 1IXVA 5T8IA 1OCZE 4GZ5A 2KC7A 3DBSA 4CGWA 2IJGX 3KD7A 4DRXE 5CMWA 4AEZC 4ANWA 2OV8A 1Y6IA 3QKYA 4YNDA 3V79K 3HDXA 4AJWA 3BG0B 4UI9K 3LPZA 3WG7E 3NOCD 4XX5A 4G2VA 2H6FA 3SFYA 4MS6A 3EIJA 5BV0A 1TYQG 2L9BA 4U04A 4BTBA 5BXOA 3S2AA 3L16A 1NI1A 2AWIA 2I1KA 1SW6A 4N5QA 3SF4A 1Z5SC 3C5RA 3BQOA 3UX4A 5DIZA 2EIJE 4GYYA 3UM3A 4LEUA 3FU3A 4GZCA 1TN8A 5ENNA 5KBAA 3Q47B 1EPUA 4LNGA 4W9RA 4FJYA 2IEJA 1V54E 1S0PA 2VSNA 3LY8A 4CZ2D 1K8KG 3DSVA 4OAVB 2UWJG 3PEUB 5ENOD 3DWLG 4I6GA 4DK5A 1TJFA 3FTZA 2F8XK 4FA6A 4EZKA 1WM5A 2CHXA 4ATGA 3O48A 5KJMA 4B94A 3APCA 3HIZA 2VTBA 1ZU2A 2VTBB 4I6EA 4KVOA 4EPZA 3TG5A 4G24A 3E34A 1D8EA 1PAQA 3DXMG 5BXUA 1TNUA 4F3VA 3CLJA 3JYSA 2XENA 3G2SA 4GMLA 3GW4A 2P9IG 3ISMC 5HRYA 2LAIA 3AAAC 3FUIA 1NA0A 5C2YA 2PM7A 3MV2B 3DEPA 3FUNA 3SO8A 3PRZA 2VQ2A 5LOZA 3UI2A 3PS6A 3RAUA 3PREA 3OAWA 1Y8MA 3RJVA 3LXUX 3SI5A 2GRMA 4CT4A 1YA0A 3HXDA 1BI7B 3S7FA 2CG3A 3B7RL 2EIME 4GMRA 3RSEG 4QFVA 5LCWJ 2RG8A 2KXPC 2R59A 4JVSA 3P1UA 4KBQA 2ETCA 4K5CA 4PDXA 1N4SA 3JUIA 3FU0A 3I4GA 4LUNU 1O1SA 3I4RB 2ZIRA 1FPPA 1KT1A 2FBNA 3EHQA 4J8YA 4WWOA 3PUKA 2ETBA 1HF8A 3G2TA 4I9EA 4FLHA 3D9PA 3W9FA 3D9IA 1Z3XA 2FF4A 1JCRA 3DSSA 4CGVA 3L13A 3DEOA 1L5JA 3T5VA 3CQCB 3JQ0A 3PZDA 2FI7A 2WB2A 3AU4A 4GU5A 2MRIA 3PVLA 2YQ8A 3SQVA 5ENTD 1FVFA 2I1JA 1U3CA 5EYPF 5J08A 1DC2A 2VGXA 4LNBA 3DRAA 4NACA 3NBNB 3D9MA 3OXLA 4A55A 3OXFA 3QNKA 1QNFA 5ANRA 2PNNA 4UQXA 1JCQA 3KAEA 5ITZF 1KLXA 4YDWA 4Z68A 4V3IA 1DCEA 3TL5A 3IBEA 4U96D 2LNIA 2DVWA 4JC8A 2XRZA 2Y3AA 4HB5A 2VSYA 1S64A 2FO7A 5FINA 3QWVA 4XEIG 3AS4A 3FU6A 1UN8A 4G8LA 5AIJA 3SHFA 4Y6WA 4J8EA 5ENQD 3ZXPA 4GTMA 1ZB1A 2P9KG 5FZRA 5JJ6A 1E7UA 2OVFA 3CVXA 5CERB 3FUEA 3CHRA 3Q15A 4I43A 4LRZA 4LERA 3O4ZA 4G25A 2P58C 2B0OE 4CDNA 2XGOA 4F7AA 4PS7A 3CK8A 3I3NA 4G26A 3FTVA 4BFRA 2NYJA 5B1BE 1KT0A 5D0QD 4WNGA 4U0SA 5AENA 5G2NA 2BKGA 5KJKA 2GRQB 3RIBA 3FEXA 2NC9A 1LTXA 3LJ3A 3LJNA 4JHKA 2WXOA 2H6GA 4MLPA 5AN8A 3UT4A 3CVNA 5KNGA 5EX3A 2F37A 5A23A 5H7PA 2LO6A 3ZRHA 4B93B 3SFZA 3AG2E 2OVBA 2XS8A 4NRHB 1IHGA 4Q94A 2AJAA 1TN6A 2LXLA 1WG0A 4GA2A 4RG6A 4HNAD 4UQZA 1HE8A 4DUIA 1OT8A 4CDRA 1WY6A 1D9SA 3AU5A 3FHEA 3L82A 2R17C 3LVQE 3ZYMA 3CR3A 4APFA 1BLXB 1OCRE 4DLQA 1NZNA 5ANLA 1SZAA 3K9IA 4A3VA 4G8KA 3ML9A 3QWWA 3CHQA 3FUHA 3IV0A 3ZNGA 2XEHA 4KMOA 3IKOB 4HI9A 3EU9A 3R7QA 3FUKA 3U64A 4BEPA 1TNOA 2RD0A 2L6JA 4TXPA 3CVYA 1E7VA 4C48B 1N0QA 3QARA 3Q7FA 2WXGA 3DSUA 1G3NB 4ANVA 4DPRA 3Q73A 2P9SG 3S7DA 2YNQA 2DZOA 3DSTA 4BT9A 2AW6A 2VSOE 4BETA 1BU9A 2GW1A 4N39A 4Q96A 3L08A 4CEMA 2WXQA 1QYMA 3AG3E 5BV1A 4E6HA 5EX0A 2R5SA 2KCKA 3V31A 2IOSA 2P9LG 2LSUA 5EIBE 3APDA 4UI9C 3MKQA 3MKQB 5FQ4A 3SBTB 1EDUA 1E96B 2XEVA 3FFLA 3UT7A 4GA0A 4NURA 4NIKA 2ILRA 4B0ZA 3E32A 2WM9A 3EJNA 4RG9A 4XI0A 3NZUA 4UQYA 2XPYA 2IQCA 4F1SA 1OWLA 2CFUA 4BTAA 4N2QA 4J8FA 2WMNA 4JB8P 2RFMA 2WXMA 3KSQA 1H19A 4WNDA 3FH5A 4K03A 3E4BA 4GMJA 2EIKE 1JPLA 3URZA 1OWOA 1N11A 3CEQA 1QQEA 3CHPA 5G04J 2AXZA 5HQ8A 2I6HA 1MX4A 4ANUA 3C3OA 4C9BB 3IXEA 5LFAA 5LP0A 2IF4A 4IYPA 5BUZA 2XRYA 2RKKA 4ZHBA 5ENSD 4HI8A 3HG0D 3ZIMA 2ZISA 4DX6D 1FT1A 2H6IA 3ULEG 3AJIA 2Y4TA 5C1DA 5A6CA 3QAQA 4AM9A 2ZXWE 4WUYA 2A4ZA 1NL4A 4ACLA 3T8KA 2WXLA 3TWRA 2QFCA 4FP7A 3LDZA 3SD5A 2P9PG 2AXUA 1IQRA 2P9UG 4E85A 4D10C 1OWMA 4DX2A 2LXMA 2R2LA 4YVQC 3C72A 1BI8B 4L23A 4EBAG 1IKND 1KZOA 1EYHA 3T5XA 4KVMA 4YDYA 3PNLB 3KSLA 3UIOC 4TXQA 3CKBA 1H6PA 2P2CP 5JHBA 3FH7A 3HRAA 1UG3A 4M3OA 2CHWA 1S70B 2XCBA 3FTSA 2XPZA 3UMVA 3CSTA 2L0IA 2WXRA 3ASHA 4GZ3A 4JPSA 3ABKE 1N9AA 4OVUA 5CEDB 5FTPA 1H6OA 1OUVA 4UI9J 4BX9A 5JMND 3TXMA 1S63A 1UJJA 3PE3A 3V30A 5T3RA 1YCSB 1H2UA 3OTNA 1YYHA 2XS1A 5ENRD 2AVPA 1ZBPA 3SBSA 2I9CA 1A5EA 3Q79A 3G2WA 3NQPA 3TGOA 3TXNA 3AG1E 3ZXSA 3Q5MA 2QYUA 2X6HA 2PQRA 2E0IA 3CVWA 5JA4D 1INZA 2XZTG 3U3WA 4I2ZA 3CVVA 1GW6A 4HORA 3RU0A 3HHMA 1N4RA 4GTQA 2IO2C 3Q9UC 4HRNA 3NZSA 3VTYA 3GZ1A 2X38A 4N2SA 2XGSA 3AG4E 2WXFA 5DBKA 3RO3A 2HE0A 4AP2A 1N54A 4PS3A 4FHJA 3S7BA 2Y69E 3CVUA 4GPKA 1KZPA 2KBXA 4CT0A 3ASGA 5EYLA 4BWRA 1W3BA 4G11A 5E76A 3UXGA 2YHEA 1PY1A 4UWLA 4JEHA 2NXPA 1ELWA 2Y4UA 3C3RA 3VLFA 4U8YD 1E8ZA 4WNEA 4MKTA 1KPSB 1FCHA 1RZ4A 4BERA 2J49A 5AJDA 5AAOA 3BG1B 1H2TC 3V2XA 3DXKG 2BKKB 3PEVB 5FQ6A 3SFXA 4RSYA 3U4TA 4GTPA 3D9HA 3E33A 3HXCA 3FTXA 2VGYA 4PS8A 5KJLA 4JHJA 4WWPA 4QQIA 3AS8A 4AY5A 3QOUA 3ASFA 1WDYA 1O1TA 3ZW3A 1N4QA 4URKA 3TWTA 2XZDG 3TWWA 1EF1C 1JWGA 3FEYA 2ETAA 3BUAA 4HOSA 2GRLA 1IYGA 4ATZD 2OOEA 2RFAA 4GTSA 3HXBA 1H6KA 3UM1A 3EHRA 4KZCA 1O5MA 2X6FA 2X3MA 3MA5A 5EILA 4BESA 4XKBA 4EZJA 2Y1LE 1BPOA 4A63B 3OXGA 3U66A 4L7TA 5JHAA 2HM8A 2HR2A 4L2LA 5FT9A 1V55E 5FIOA 2QY7A 3EU5A 5FWQA 4KZ0A 3MX3A 3ZEFA 4TV3A 5EIDA 4GYWA 4G1TA 3EIQC 5B1AE 2KCLA 3RO2A 2OEVA 4A1SA 3JXJA 3T9KA 3ABME 3GZ2A 3V2OA 4H7YA 3T8MA 2C2LA 3JUEA 1MQSA 1OCCE 1IHBA 3SNXA 4H7XA 1N94A 3SY2A 5G05C 4JXTA 2J07A 3TWQA 2VGEA 3PZ1A 1IQUA 3FUJA 3L17A 1TJCA 3FY4A 3FUDA 2IY0C 2XCCA 4LSZE 2XHEA 3MGBA 4YDOA 4HBDA 4AVXA 3D9JA 4KXKB 3VLEA 3PDNA 3MJWA 3FH8A 4IULA 3ULQA 3CSFA 3LEWA 3LY9A 3C98A 3ENEA 1OWPA 1TR4A 5AQBA 2GGFA 3RKVA 2V8SE 1K1AA 3D9LA 4I2WA 4DLOA 1X81A 3LYAA 3KEAA 2H6HA 3PH0C 2MYOA 1ELKA 5BNWA 3D9NA 4UWKA 2J8SD 3CIAA 4FC8A 2QC9A 3MKRA 5D2MC 2GRNB 3RRNB 4J8DA 3NB2A 4U8VD 5A7DB 1YMPA 3ESLA 3ZPJA 4HFGA 3VLDA 3NOGD 3DPYA 2WXNA 3FTWA 2XGMA 1LF8A 4O6FA 1AWCB 1UOHA 2IFUA 4O60A 3DSWA 4TUMA 1DNPA 4GTVA 3CQGB 5CCLA 2DZNA 2EQXA 1HZ4A 2YINA 2VYIA 1N4PA 3L6AA 4KYOB 5AQ9A 3F6QA 4P29A 3X2QE 4ABNA 2R03A 5CEAA 5J90A 1A17A 3E37A 4B89A 2PZIA 5CRUA 5G55A 4HRMB 4RVBA 5FZQA 1E8YA 1H0AA 2FULA 4JW1A 3D3MA 1JCSA 4GB9A 3UUXA 2J9QA 4DJAA 2WMOA 4BX8A 4I1OB 5EKQD 4HRLA 3FULA 3B7SA 4O1PA 2WQHA 1MJ0A 5FQ8A 3B95A 1HO8A 3QB2A 4N5CA 2FEZA 3ULYA 2OEWA 1MYOA 2J4DA 3UKRG 1N52A 4HXIA 3D9OA 1NA3A 3KS2A 2AXVA 2ZGDA 2V4HC 1LD8A 5CMYA 5KWDA 3ZFWA 3Q78A 1B89A 3UIPC 4O1OA 3Q75A 4K0RA 5G05J 4OYSA 1HXIA 3ZVVA 3RRUA 2WVIA 4GZDA 1LD7A 5LCWC 3ZU7B 2X6JA 2X6IA 2DBAA 2ZU6B 1TNBA 2BUGA 3FP3A 2YHCA 5FJYA 3CHSA 3ASDA
chains in the Genus database with same CATH topology
2E0IA 3CVWA 1INZA 2MOWA 2MHKA 3U3WA 3ML8A 3QWVA 3ZGQA 4I2ZA 3SZ7A 3CVVA 1GW6A 5D0OD 3JCKC 3RU0A 4HORA 3AS4A 3HHMA 3FU6A 1UN8A 5AIJA 3SHFA 5E75A 3NZSA 3FDHA 3FU5A 2CFZA 4U07A 4Y6WA 4A3TA 3FUFA 4I6JA 4J8EA 4AOFA 2J09A 3QDNA 4TRQA 3MEKA 3UQ3A 3VTYA 3GZ1A 2X38A 4N2SA 2XGSA 2L0TB 1JWFA 5FZRA 5JJ6A 2WXFA 4MRUA 2BTDA 1QZ2A 3NF1A 3ONLA 5DBKA 3RO3A 3CHMA 3LVRE 4AP2A 5AJLA 1E7UA 2J08A 2OVFA 4JA9A 3CVXA 1N54A 4PS3A 4UWFA 3FUEA 4FHJA 4UWHA 3CHRA 3Q15A 4I43A 3S7BA 3HYMB 4LRZA 4LERA 3O4ZA 3CVUA 4GPKA 3L54A 2BF0X 4G25A 2P58C 3P2BA 4J6IA 4CDNA 4CT0A 3ASGA 2XGOA 4F7AA 3CGHA 4PS7A 3CK8A 3I3NA 3B7UX 3IHYA 4JZYA 4BWRA 1E8WA 1W3BA 1P5QA 3FTVA 4G26A 3CK7A 4G11A 4FADA 4BFRA 1XNFA 1KT0A 5D0QD 5E76A 4WNGA 4U0SA 5AENA 4GZ6A 3IEGA 5G2NA 4APOA 2YHEA 1PY1A 4UWLA 4EBAA 1NP7A 4JEHA 3CVQA 2NXPA 1ELWA 2Y4UA 3ZN3A 3VLFA 5KJKA 3RIBA 3FEXA 4HOUA 2NC9A 3PNTB 3LJ3A 4N3CA 1E8ZA 2IONA 3ESKA 4ILHB 4WNEA 1HS6A 3S7JA 4R7LA 4JHKA 4L1BA 1X5BA 2WXOA 4MKTA 4MLPA 4N3BA 1HX8A 1FCHA 2NSZA 2J49A 3UT4A 3ZHEA 5AJDA 3ZHEB 3CVNA 4FULA 3BG1B 1H2TC 3CVPA 1HG5A 5EX3A 3PE4A 2E2EA 4TUUA 4F53A 3HVEA 4YVOA 3HVEB 4ILIA 4JL0A 3N71A 5A23A 2PM6A 2WQ6A 2LO6A 4GCOA 3PUJA 3QK0A 3PEVB 5KCMA 4U63A 5FQ6A 3ZRHA 2LSVA 4G23A 3LS8A 4ANXA 3APFA 4EQFA 3MV3B 3SFZA 2KATA 4RSYA 3ZYQA 3U4TA 2OVBA 4NRHB 4U0ZA 4AXHA 1IHGA 4Q94A 3WXXA 4XE0A 3FWVA 3JQ1A 4KT6B 4GA2A 4RG6A 4UQZA 5ARGA 2DIWA 1HE8A 1WAO1 3FTXA 2VGYA 1PC2A 3TAXA 4CDRA 1MHQA 1WY6A 2VJ8A 3AU5A 4PS8A 3FHEA 4N3AA 3VTXA 2R17C 5KJLA 3LVQE 4WAFA 3ZYMA 4JHJA 3DPDA 4WWPA 3CR3A 3CV0A 4APFA 4FJZA 4AV7A 4Q69A 2WXPA 3QC1A 3D9KA 4DLQA 1NZNA 3AS8A 4I1MA 5ANLA 4AY5A 4NQ0A 1UN9A 3QOUA 1SZAA 4OVVA 4B8AA 3K9IA 4C0EA 3ASFA 1HU3A 4A3VA 5ARFA 5HI7A 4UWGA 3EHMA 4IN3B 2KM4A 3ZW3A 5BT1A 4HLEA 5KJNA 4FU3A 4URKA 3ML9A 3QWWA 3CHQA 3FUHA 3Q49B 1EF1C 3IV0A 4KMOA 5BW8C 1Z6TA 3B13A 1SQMA 1JWGA 3IKOB 2DCPA 3FEYA 4HOTA 4DI3A 4HOSA 2GRLA 4GYOA 1IYGA 1HFAA 3R7QA 2J4BA 2OOEA 3FUKA 3U64A 5T8IA 2RD0A 4FHKA 1E8XA 1H6KA 2L6JA 4GZ5A 3UT8A 3CVYA 1E7VA 4CRWA 2KC7A 3DBSA 4CGWA 2IJGX 3QARA 5CHEE 4KZCA 2WXGA 3IHVA 2X6FA 3KD7A 5CMWA 4GCNA 2IOLA 4ANVA 4DPRA 4AEZC 2X3MA 3CKCA 3R9AB 3MA5A 4ANWA 2ONDA 3GYZA 1SZ9A 2OV8A 4XKBA 2X6KA 4EZJA 1Y6IA 1BPOA 3QKYA 3S7DA 2YNQA 3QWPA 3OXGA 4YNDA 2HO1A 4IRUA 3HDXA 4BT9A 2AW6A 2VSOE 3U9WA 3RRMB 3U66A 4AJWA 4HS2A 4L7TA 2GW1A 3BG0B 4N39A 4Q96A 3L08A 4UI9K 3ZYLA 5JHAA 4CEMA 2WXQA 3LPZA 2HM8A 2HR2A 2JEKA 3Q4AB 4JHRA 4L2LA 5FT9A 2QY7A 3SGHA 5FWQA 4KZ0A 4XX5A 2UY1A 3MX3A 2UY1B 2IU1A 4G2VA 5BV1A 3LY7A 4JA7A 5EX0A 4E6HA 4MS6A 2R5SA 3ZEFA 2KCKA 3EIJA 4TV3A 5BV0A 4GYWA 2L9BA 4U04A 2IOSA 4G1TA 4BTBA 2Q7FA 3S2AA 3EIQC 2LSUA 2KCLA 3APDA 4UI9C 3L16A 3RO2A 3MKQA 2AWIA 3MKQB 2I1KA 5FQ4A 3SBTB 1EDUA 1E96B 2M63A 2XEVA 3FFLA 3FTUA 3UT7A 4A1SA 3LKUA 3ZYKA 3CHOA 4GA0A 3GZ2A 5T4YA 3SF4A 4NURA 1ELRA 3UX4A 2ILRA 3L22A 4B0ZA 5DIZA 4GYYA 1XGWA 4H7YA 3T8MA 2C2LA 3CK9A 2PL2A 4LEUA 3FU3A 4GZCA 1MQSA 2V0PA 2WM9A 3EJNA 4RG9A 5ENNA 4XI0A 3Q47B 1EPUA 5LX8A 3SNXA 3NZUA 4H7XA 4UQYA 5G05C 4JXTA 2XPYA 2IQCA 2J07A 4F1SA 4XZ4A 4W9RA 1OWLA 2CFUA 4FJYA 4ME2A 5FQ7A 4BTAA 4J8FA 4EZLA 3KEZA 1IQUA 3FUJA 4N2QA 3I5PA 1S0PA 1TJCA 2VSNA 3L17A 3LY8A 4WWNA 3FY4A 3FUDA 2XCCA 2WMNA 2PQNA 2XHEA 3MGBA 2UWJG 4CDMA 3PEUB 3D9JA 4AVXA 4KXKB 3PDNA 4I6GA 3MJWA 3VLEA 1TJFA 3FTZA 3FH8A 2WXMA 4IULA 4DK5A 1H19A 4I9CA 4WNDA 3ULQA 3CSFA 3FH5A 4FA6A 4K03A 4EZKA 3LEWA 1WM5A 3E4BA 2CHXA 4GMJA 3LY9A 4ILGA 4ATGA 2JLBA 3O48A 3C98A 3MZLB 3ENEA 5KJMA 4B94A 1OWPA 3APCA 3LCAA 3HIZA 2GGFA 3RKVA 1JPLA 1ZU2A 2V8SE 3D9LA 3URZA 5JJTA 5CCMA 2VTBB 2VTBA 4I2WA 1OWOA 4I6EA 4KVOA 4DLOA 3CEQA 3TG5A 1QQEA 4EPZA 5JJ7A 3CHPA 5G04J 2AXZA 5HQ8A 2I6HA 4ANUA 4G24A 2VGXB 3LYAA 4C9BB 1PAQA 4B8CB 5LFAA 4F3VA 5LP0A 3B7TA 3CLJA 3JYSA 4EECA 3G2VA 2IF4A 5BPPA 4IYPA 5BUZA 3PH0C 3G2SA 2XRYA 4GMLA 1U3DA 3GW4A 1ELKA 5BNWA 3D9NA 4UWKA 2VSXE 3CIAA 2LAIA 4FC8A 3FUIA 1NA0A 5C2YA 2PM7A 3MV2B 3MKRA 4L2YA 3TJPA 3ZIMA 3FUNA 3QJZA 4XIFA 3PRZA 3RRNB 2VQ2A 4J8DA 5LOZA 2Y4TA 5C1DA 3PS6A 5A7DB 5A6CA 3PREA 3OAWA 1Y8MA 3RJVA 4AY6A 3LXUX 3SI5A 3ESLA 3QAQA 4AM9A 4XI9A 5FZSA 3ZPJA 3FTYA 4HFGA 4WUYA 3VLDA 2A4ZA 4AIFA 2GRMA 4CT4A 1UW4B 4ACLA 3MCXA 2WXLA 3R7RA 1YA0A 2QFCA 2WXHA 3S7FA 2CG3A 3EHNA 3B7RL 2WXNA 4J8SA 4BSXA 4QFVA 1OWNA 2RG8A 3G2UA 1JUQA 2R59A 2XGMA 3FTWA 3EDTB 4FP7A 4JEUA 1TEZA 1LF8A 2CHZA 2WPVA 4JVSA 4O6FA 3P1UA 3RK6A 4I17A 4KBQA 3LDZA 3SD5A 2V4LA 2AXUA 1IQRA 2XPIA 2IFUA 4PDXA 2LAHA 4E85A 4PUCA 4HVBA 1E90A 3MYVA 3JUIA 4JW1A 3FU0A 1OWMA 4A1GA 4D10C 3TG4A 4Y6CA 1DNPA 4YVQC 3CVLA 3CQGB 2KZTA 3I4GA 2KZTB 4PH4B 1FVHA 5CCLA 4L23A 4EBAG 4LUNU 2WQ7A 3I4RB 2EQXA 1HZ4A 1KT1A 1EYHA 2YINA 2FBNA 2VYIA 2CG2A 4WWOA 3T5XA 4KVMA 2A5UA 3L6AA 3PNLB 3PUKA 4KYOB 4P29A 1HF8A 4BT8A 3CKBA 4ABNA 4BY6A 3G2TA 5EDSA 5JHBA 4I1AA 3AS5A 3FH7A 4GA1A 4C0MA 4I9EA 4FLHA 3D9PA 1UG3A 4M3OA 2C0MA 4WNFA 1A17A 5J90A 4B89A 2CHWA 3D9IA 5AYWD 5LCWJ 3T5VA 1Z3XA 2FF4A 2PZIA 5G55A 4RVBA 5G04C 2XCBA 5FZQA 3FTSA 2XPZA 4CGVA 3L13A 1E8YA 1H0AA 2HYZA 3UMVA 2FULA 3CSTA 2L0IA 1DVPA 1L5JA 3D3MA 2WXRA 4GB9A 3CQCB 3JQ0A 3ASHA 2J9QA 3UUXA 4DJAA 4GZ3A 4GAAA 3PZDA 3ONKA 4JPSA 2WMOA 2FI7A 2WB2A 2XQ0A 4BX8A 4I1OB 5EKQD 3AU4A 4GU5A 2MRIA 4OVUA 1H2VC 3PVLA 3FULA 3B7SA 2WXKA 5FTPA 2WQHA 2YQ8A 5FQ8A 1FVFA 4J0UA 1HO8A 1OUVA 3QB2A 4UI9J 2I1JA 2FEZA 4N5CA 4BX9A 1U3CA 3TXMA 1Z3YA 2J4DA 5J08A 1N52A 4HXIA 4DI4A 1VDYA 3D9OA 4ACKA 1UJJA 2VGXA 3PE3A 1NA3A 5T3RA 3KS2A 3BEEA 4NACA 1H2UA 4XKCA 2AXVA 3D9MA 3OTNA 3OXLA 4U8HA 1HH8A 3OXFA 3QNKA 4A55A 2AVPA 1QNFA 3GZSA 5CMYA 1ZBPA 5ANRA 3SBSA 3ZFWA 1B89A 4UQXA 2I9CA 4U0UA 3KAEA 2WXJA 4K0RA 3G2WA 3NQPA 4OYSA 5G05J 3TXNA 2V5FA 3TGOA 1HXIA 1KLXA 2C0LA 3ZXSA 3ZVVA 2KCVA 4V3IA 3RRUA 2WVIA 3TL5A 3IBEA 4GZDA 3Q5MA 5LCWC 4CCAA 1UJKA 2WXIA 2I2OA 2X6JA 2LNIA 3UPVA 4FLBA 2X6IA 2DBAA 3FUMA 2ZU6B 1HG2A 2X6HA 2BUGA 2Y3AA 3FP3A 4JC8A 2XRZA 2YHCA 2VSYA 4HOQA 4LCTA 5M72A 5FJYA 3CHSA 2PQRA 3ASDA 2FO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHK A;  3U3W A;  3QWV A;  3ZGQ A;  4I2Z A;  3SZ7 A;  5D0O D;  4HOR A;  3RU0 A;  3AS4 A;  4U07 A;  4Y6W A;  4J8E A;  3QDN A;  3MEK A;  3UQ3 A;  3VTY A;  3GZ1 A;  4N2S A;  2XGS A;  5FZR A;  5JJ6 A;  3NF1 A;  1QZ2 A;  5DBK A;  3RO3 A;  4JA9 A;  3Q15 A;  3S7B A;  3HYM B;  4GPK A;  4G25 A;  2P58 C;  3ASG A;  2XGO A;  3CK8 A;  4BWR A;  1W3B A;  4G26 A;  1P5Q A;  3CK7 A;  1XNF A;  1KT0 A;  5D0Q D;  4WNG A;  4U0S A;  4GZ6 A;  3IEG A;  4APO A;  3CVQ A;  1ELW A;  2Y4U A;  3ZN3 A;  5KJK A;  3RIB A;  4HOU A;  2NC9 A;  4N3C A;  4WNE A;  3ESK A;  3S7J A;  4N3B A;  1FCH A;  3ZHE A;  3ZHE B;  3CVN A;  3CVP A;  5EX3 A;  3PE4 A;  2E2E A;  4YVO A;  4JL0 A;  3N71 A;  4GCO A;  2LSV A;  4G23 A;  4EQF A;  3MV3 B;  2KAT A;  3U4T A;  4NRH B;  4U0Z A;  1IHG A;  3WXX A;  3FWV A;  4GA2 A;  4RG6 A;  4UQZ A;  5ARG A;  1WAO 1;  2VGY A;  1PC2 A;  3TAX A;  4CDR A;  4N3A A;  3VTX A;  5KJL A;  3CV0 A;  1NZN A;  3AS8 A;  4AY5 A;  4NQ0 A;  3QOU A;  3K9I A;  3ASF A;  5ARF A;  5HI7 A;  4IN3 B;  5BT1 A;  5KJN A;  3QWW A;  3Q49 B;  5BW8 C;  4HOT A;  4HOS A;  4GYO A;  1IYG A;  2OOE A;  2L6J A;  4GZ5 A;  2KC7 A;  4CGW A;  5CHE E;  3KD7 A;  4GCN A;  3CKC A;  3R9A B;  3MA5 A;  2OND A;  3GYZ A;  3QKY A;  3S7D A;  3QWP A;  3OXG A;  4YND A;  2HO1 A;  4BT9 A;  2GW1 A;  4N39 A;  4UI9 K;  3LPZ A;  2HR2 A;  3Q4A B;  4JHR A;  5FT9 A;  2UY1 A;  4G2V A;  2UY1 B;  3LY7 A;  4JA7 A;  5EX0 A;  2R5S A;  2KCK A;  4GYW A;  4BTB A;  4U04 A;  4G1T A;  2Q7F A;  2LSU A;  2KCL A;  4UI9 C;  3RO2 A;  2XEV A;  1E96 B;  3FFL A;  4A1S A;  3LKU A;  4GA0 A;  3GZ2 A;  3SF4 A;  1ELR A;  5DIZ A;  4GYY A;  4H7Y A;  2C2L A;  3CK9 A;  2PL2 A;  4LEU A;  4RG9 A;  4XI0 A;  3Q47 B;  4H7X A;  4UQY A;  5G05 C;  4W9R A;  4BTA A;  4ME2 A;  4N2Q A;  4J8F A;  2VSN A;  1TJC A;  3LY8 A;  2XCC A;  2PQN A;  2UWJ G;  4KXK B;  3PDN A;  4I9C A;  4WND A;  3ULQ A;  1WM5 A;  3E4B A;  3LY9 A;  2JLB A;  3O48 A;  5KJM A;  4B94 A;  3LCA A;  3RKV A;  1ZU2 A;  3URZ A;  5JJT A;  5CCM A;  4I2W A;  3CEQ A;  3TG5 A;  1QQE A;  5JJ7 A;  5G04 J;  5HQ8 A;  2I6H A;  4G24 A;  2VGX B;  3LYA A;  4F3V A;  3JYS A;  2IF4 A;  3GW4 A;  5BNW A;  1NA0 A;  3MV2 B;  3MKR A;  4XIF A;  2VQ2 A;  4J8D A;  2Y4T A;  5C1D A;  5A7D B;  5A6C A;  1Y8M A;  3RJV A;  4AY6 A;  4AM9 A;  4XI9 A;  5FZS A;  3ZPJ A;  4WUY A;  4AIF A;  1YA0 A;  2QFC A;  3S7F A;  5LCW J;  2XGM A;  3EDT B;  2WPV A;  4O6F A;  4I17 A;  4KBQ A;  2XPI A;  2IFU A;  3TG4 A;  4Y6C A;  4YVQ C;  3CVL A;  5CCL A;  1HZ4 A;  1KT1 A;  2FBN A;  2VYI A;  4KYO B;  4BT8 A;  3CKB A;  4ABN A;  4I1A A;  3AS5 A;  4GA1 A;  4I9E A;  4WNF A;  2C0M A;  1A17 A;  5AYW D;  2FF4 A;  2PZI A;  5G04 C;  2XCB A;  5FZQ A;  4CGV A;  2HYZ A;  3ASH A;  2J9Q A;  3UUX A;  4GZ3 A;  2FI7 A;  5EKQ D;  5FTP A;  2WQH A;  2YQ8 A;  4J0U A;  1OUV A;  4UI9 J;  4N5C A;  2FEZ A;  2VGX A;  3PE3 A;  1NA3 A;  3KS2 A;  3BEE A;  3OXL A;  1HH8 A;  3OXF A;  2AVP A;  1ZBP A;  3ZFW A;  1B89 A;  4UQX A;  4U0U A;  3KAE A;  5G05 J;  3TGO A;  2V5F A;  1HXI A;  1KLX A;  2C0L A;  2KCV A;  3Q5M A;  5LCW C;  2LNI A;  3UPV A;  2DBA A;  2BUG A;  3FP3 A;  2YHC A;  2VSY A;  4HOQ A;  5M72 A;  5FJY A;  2PQR A;  3ASD A;  2FO7 A; 
#chains in the Genus database with same CATH topology
 2V5Q C;  2MOW A;  3ZGQ A;  3HXF A;  5D0O D;  3ZKJ A;  4K5A B;  3TWU A;  3FU5 A;  4A3T A;  3FUF A;  4I6J A;  4AOF A;  4MBG A;  4TRQ A;  3MEK A;  2QZA A;  3LVR E;  3Q9N C;  3Q7A A;  5AJL A;  2J08 A;  4JA9 A;  4UWH A;  3HYM B;  3L54 A;  2BF0 X;  4J6I A;  2GRR B;  3CGH A;  3IHY A;  3JXI A;  4JZY A;  4FAD A;  3CK7 A;  1SA5 A;  5EN5 D;  1XNF A;  5B3S E;  4APO A;  4LNU D;  4EBA A;  3ZN3 A;  3J5P A;  1DCQ A;  4HOU A;  1MX6 A;  3ABL E;  4N3C A;  2ION A;  1HS6 A;  4R7L A;  1X5B A;  2F8Y A;  4N3B A;  1HX8 A;  5CBO A;  2XEE A;  3ZHE A;  3ZHE B;  4FUL A;  3CVP A;  4TUU A;  1TN7 A;  2E2E A;  4F53 A;  4YVO A;  4ILI A;  2WQ6 A;  2PM6 A;  3PUJ A;  5KCM A;  4U63 A;  2LSV A;  4G23 A;  3LS8 A;  2DYR E;  3BU8 A;  3MV3 B;  2R02 A;  4AXH A;  3WXX A;  4XE0 A;  3JQ1 A;  4U95 D;  4UUC A;  4KT6 B;  5CEC B;  1WAO 1;  1PC2 A;  3TAX A;  1MHQ A;  4WAF A;  1K1B A;  2EIN E;  3TWX A;  5KNH D;  2FO1 E;  4AV7 A;  2WXP A;  3QC1 A;  2B6C A;  4NQ0 A;  1UN9 A;  4OVV A;  5AAR A;  5ARF A;  5HI7 A;  4IN3 B;  4HLE A;  5AQA A;  3Q49 B;  1Z6T A;  1BD8 A;  4DI3 A;  5CBN A;  1HFA A;  2J4B A;  1TNY A;  1FT2 A;  4FHK A;  1E8X A;  4GTR A;  3UT8 A;  4CRW A;  3L9T A;  5CHE E;  3IHV A;  4GCN A;  2IOL A;  3CKC A;  3R9A B;  3TWS A;  2OND A;  3GYZ A;  1SZ9 A;  2X6K A;  3QWP A;  2HO1 A;  4IRU A;  3U9W A;  3RRM B;  4HS2 A;  3ZYL A;  4JHR A;  3Q4A B;  2JEK A;  1MZC A;  3SGH A;  2UY1 A;  2QYJ A;  2UY1 B;  2IU1 A;  4EHM A;  1NFI E;  3LY7 A;  4JA7 A;  3DSX A;  2Q7F A;  3UM2 A;  2ZGG A;  5AQ7 A;  3TWV A;  2M63 A;  3FTU A;  3LKU A;  4RQI A;  3ZYK A;  2DWZ A;  3CHO A;  5T4Y A;  3ZUV B;  5ENP D;  1ELR A;  3L22 A;  1XGW A;  3CK9 A;  2PL2 A;  2V0P A;  5LX8 A;  2R05 A;  4XZ4 A;  5FQ7 A;  4ME2 A;  1OY3 D;  4EZL A;  3KEZ A;  3I5P A;  4WWN A;  2LUH A;  2PQN A;  4CDM A;  3EUV A;  4I9C A;  4ILG A;  2JLB A;  3MZL B;  3LCA A;  5JJT A;  5CCM A;  4HQD A;  5JJ7 A;  2VGX B;  4M7C A;  4RLY A;  2IO3 C;  3W9G A;  4F1P A;  4B8C B;  3B7T A;  4EEC A;  3G2V A;  5BPP A;  1U3D A;  1O1R A;  2P9N G;  2VSX E;  5HKP A;  4ZFH A;  4L2Y A;  3TJP A;  3QJZ A;  4XIF A;  2Y0B G;  3ASN E;  4AY6 A;  4XI9 A;  5FZS A;  3FTY A;  4AIF A;  1UW4 B;  4YDE A;  4BSZ B;  3MCX A;  3R7R A;  2WXH A;  3R9M A;  3EHN A;  4J8S A;  4BSX A;  1OWN A;  4JEU A;  3G2U A;  1JUQ A;  1TEZ A;  3B7B A;  3EDT B;  2CHZ A;  2WPV A;  3RK6 A;  4I17 A;  4LG6 A;  3ASO E;  2V4L A;  2XPI A;  2LAH A;  4HVB A;  4PUC A;  1E90 A;  3MYV A;  4A1G A;  3TG4 A;  4DX5 D;  2OCC E;  4Y6C A;  3CVL A;  1SA4 A;  2KZT A;  4PH4 B;  2KZT B;  1FVH A;  2WQ7 A;  2BED A;  4CYM D;  1Q2Z A;  2CG2 A;  2A5U A;  4BT8 A;  4BY6 A;  4HLL A;  5EDS A;  4I1A A;  3AS5 A;  4GA1 A;  5HS0 A;  4C0M A;  4WNF A;  2C0M A;  5AYW D;  5G04 C;  5CRV A;  2HYZ A;  1DVP A;  4GAA A;  3ONK A;  2XQ0 A;  4OAU C;  1H2V C;  2WXK A;  4J7W A;  4J0U A;  1K3Z D;  4K5B A;  1N0R A;  1Z3Y A;  2F0Y A;  2EIL E;  4DI4 A;  1VDY A;  4ACK A;  5D66 A;  3BEE A;  4XKC A;  4U8H A;  4GTT A;  1HH8 A;  1SVX A;  3GZS A;  4U0U A;  2WXJ A;  2V5F A;  3HXE A;  2C0L A;  2DYS E;  2KCV A;  1MX2 A;  4X8Q A;  3PZ4 A;  1UJK A;  2WXI A;  2I2O A;  4CCA A;  3UPV A;  4FLB A;  3FUM A;  1HG2 A;  4HOQ A;  4LCT A;  5M72 A;  3J5Q B;  1TNZ A;  2MHK A;  4F6R D;  3NAW A;  3ML8 A;  3SZ7 A;  3JCK C;  5E75 A;  4U07 A;  3FDH A;  2CFZ A;  2J09 A;  1RW2 A;  3QDN A;  3UQ3 A;  2GRO B;  1JWF A;  2L0T B;  4MRU A;  2BTD A;  1QZ2 A;  3NF1 A;  3ONL A;  2A5E A;  3CHM A;  4U7E B;  4UWF A;  4TXR A;  3E30 A;  3P2B A;  3B7U X;  1D8D A;  3PZ3 A;  4GPM A;  3UIN C;  4L9P A;  1E8W A;  1P5Q A;  4GZ6 A;  3IEG A;  2GRP B;  3PZ2 A;  1NP7 A;  3CVQ A;  3PNT B;  4ILH B;  3ESK A;  1N95 A;  3C3Q A;  3S7J A;  4L1B A;  4GTO A;  3UTM A;  2NSZ A;  4JD2 G;  1HG5 A;  3PE4 A;  3HVE A;  3HVE B;  4JL0 A;  3N71 A;  2L6B A;  4GCO A;  3QK0 A;  1OXJ A;  4ANX A;  3APF A;  4EQF A;  2KAT A;  3ZYQ A;  4DX1 A;  4U0Z A;  3FWV A;  1OCO E;  1U2V G;  3UM0 A;  5ARG A;  2DIW A;  2VJ8 A;  4N3A A;  3VTX A;  3DPD A;  3CV0 A;  4FJZ A;  2JAB A;  4Q69 A;  3D9K A;  4I1M A;  4B8A A;  4C0E A;  1HU3 A;  4UWG A;  3EHM A;  2KM4 A;  5BT1 A;  5KJN A;  4FU3 A;  4DX7 D;  5BW8 C;  3B13 A;  1SQM A;  2DCP A;  4HOT A;  1AP7 A;  1QBQ A;  4GYO A;  3UKU G;  5IY5 E;  1IXV A;  5T8I A;  1OCZ E;  4GZ5 A;  2KC7 A;  3DBS A;  4CGW A;  2IJG X;  3KD7 A;  4DRX E;  5CMW A;  4AEZ C;  4ANW A;  2OV8 A;  1Y6I A;  3QKY A;  4YND A;  3V79 K;  3HDX A;  4AJW A;  3BG0 B;  4UI9 K;  3LPZ A;  3WG7 E;  3NOC D;  4XX5 A;  4G2V A;  2H6F A;  3SFY A;  4MS6 A;  3EIJ A;  5BV0 A;  1TYQ G;  2L9B A;  4U04 A;  4BTB A;  5BXO A;  3S2A A;  3L16 A;  1NI1 A;  2AWI A;  2I1K A;  1SW6 A;  4N5Q A;  3SF4 A;  1Z5S C;  3C5R A;  3BQO A;  3UX4 A;  5DIZ A;  2EIJ E;  4GYY A;  3UM3 A;  4LEU A;  3FU3 A;  4GZC A;  1TN8 A;  5ENN A;  5KBA A;  3Q47 B;  1EPU A;  4LNG A;  4W9R A;  4FJY A;  2IEJ A;  1V54 E;  1S0P A;  2VSN A;  3LY8 A;  4CZ2 D;  1K8K G;  3DSV A;  4OAV B;  2UWJ G;  3PEU B;  5ENO D;  3DWL G;  4I6G A;  4DK5 A;  1TJF A;  3FTZ A;  2F8X K;  4FA6 A;  4EZK A;  1WM5 A;  2CHX A;  4ATG A;  3O48 A;  5KJM A;  4B94 A;  3APC A;  3HIZ A;  2VTB A;  1ZU2 A;  2VTB B;  4I6E A;  4KVO A;  4EPZ A;  3TG5 A;  4G24 A;  3E34 A;  1D8E A;  1PAQ A;  3DXM G;  5BXU A;  1TNU A;  4F3V A;  3CLJ A;  3JYS A;  2XEN A;  3G2S A;  4GML A;  3GW4 A;  2P9I G;  3ISM C;  5HRY A;  2LAI A;  3AAA C;  3FUI A;  1NA0 A;  5C2Y A;  2PM7 A;  3MV2 B;  3DEP A;  3FUN A;  3SO8 A;  3PRZ A;  2VQ2 A;  5LOZ A;  3UI2 A;  3PS6 A;  3RAU A;  3PRE A;  3OAW A;  1Y8M A;  3RJV A;  3LXU X;  3SI5 A;  2GRM A;  4CT4 A;  1YA0 A;  3HXD A;  1BI7 B;  3S7F A;  2CG3 A;  3B7R L;  2EIM E;  4GMR A;  3RSE G;  4QFV A;  5LCW J;  2RG8 A;  2KXP C;  2R59 A;  4JVS A;  3P1U A;  4KBQ A;  2ETC A;  4K5C A;  4PDX A;  1N4S A;  3JUI A;  3FU0 A;  3I4G A;  4LUN U;  1O1S A;  3I4R B;  2ZIR A;  1FPP A;  1KT1 A;  2FBN A;  3EHQ A;  4J8Y A;  4WWO A;  3PUK A;  2ETB A;  1HF8 A;  3G2T A;  4I9E A;  4FLH A;  3D9P A;  3W9F A;  3D9I A;  1Z3X A;  2FF4 A;  1JCR A;  3DSS A;  4CGV A;  3L13 A;  3DEO A;  1L5J A;  3T5V A;  3CQC B;  3JQ0 A;  3PZD A;  2FI7 A;  2WB2 A;  3AU4 A;  4GU5 A;  2MRI A;  3PVL A;  2YQ8 A;  3SQV A;  5ENT D;  1FVF A;  2I1J A;  1U3C A;  5EYP F;  5J08 A;  1DC2 A;  2VGX A;  4LNB A;  3DRA A;  4NAC A;  3NBN B;  3D9M A;  3OXL A;  4A55 A;  3OXF A;  3QNK A;  1QNF A;  5ANR A;  2PNN A;  4UQX A;  1JCQ A;  3KAE A;  5ITZ F;  1KLX A;  4YDW A;  4Z68 A;  4V3I A;  1DCE A;  3TL5 A;  3IBE A;  4U96 D;  2LNI A;  2DVW A;  4JC8 A;  2XRZ A;  2Y3A A;  4HB5 A;  2VSY A;  1S64 A;  2FO7 A;  5FIN A;  3QWV A;  4XEI G;  3AS4 A;  3FU6 A;  1UN8 A;  4G8L A;  5AIJ A;  3SHF A;  4Y6W A;  4J8E A;  5ENQ D;  3ZXP A;  4GTM A;  1ZB1 A;  2P9K G;  5FZR A;  5JJ6 A;  1E7U A;  2OVF A;  3CVX A;  5CER B;  3FUE A;  3CHR A;  3Q15 A;  4I43 A;  4LRZ A;  4LER A;  3O4Z A;  4G25 A;  2P58 C;  2B0O E;  4CDN A;  2XGO A;  4F7A A;  4PS7 A;  3CK8 A;  3I3N A;  4G26 A;  3FTV A;  4BFR A;  2NYJ A;  5B1B E;  1KT0 A;  5D0Q D;  4WNG A;  4U0S A;  5AEN A;  5G2N A;  2BKG A;  5KJK A;  2GRQ B;  3RIB A;  3FEX A;  2NC9 A;  1LTX A;  3LJ3 A;  3LJN A;  4JHK A;  2WXO A;  2H6G A;  4MLP A;  5AN8 A;  3UT4 A;  3CVN A;  5KNG A;  5EX3 A;  2F37 A;  5A23 A;  5H7P A;  2LO6 A;  3ZRH A;  4B93 B;  3SFZ A;  3AG2 E;  2OVB A;  2XS8 A;  4NRH B;  1IHG A;  4Q94 A;  2AJA A;  1TN6 A;  2LXL A;  1WG0 A;  4GA2 A;  4RG6 A;  4HNA D;  4UQZ A;  1HE8 A;  4DUI A;  1OT8 A;  4CDR A;  1WY6 A;  1D9S A;  3AU5 A;  3FHE A;  3L82 A;  2R17 C;  3LVQ E;  3ZYM A;  3CR3 A;  4APF A;  1BLX B;  1OCR E;  4DLQ A;  1NZN A;  5ANL A;  1SZA A;  3K9I A;  4A3V A;  4G8K A;  3ML9 A;  3QWW A;  3CHQ A;  3FUH A;  3IV0 A;  3ZNG A;  2XEH A;  4KMO A;  3IKO B;  4HI9 A;  3EU9 A;  3R7Q A;  3FUK A;  3U64 A;  4BEP A;  1TNO A;  2RD0 A;  2L6J A;  4TXP A;  3CVY A;  1E7V A;  4C48 B;  1N0Q A;  3QAR A;  3Q7F A;  2WXG A;  3DSU A;  1G3N B;  4ANV A;  4DPR A;  3Q73 A;  2P9S G;  3S7D A;  2YNQ A;  2DZO A;  3DST A;  4BT9 A;  2AW6 A;  2VSO E;  4BET A;  1BU9 A;  2GW1 A;  4N39 A;  4Q96 A;  3L08 A;  4CEM A;  2WXQ A;  1QYM A;  3AG3 E;  5BV1 A;  4E6H A;  5EX0 A;  2R5S A;  2KCK A;  3V31 A;  2IOS A;  2P9L G;  2LSU A;  5EIB E;  3APD A;  4UI9 C;  3MKQ A;  3MKQ B;  5FQ4 A;  3SBT B;  1EDU A;  1E96 B;  2XEV A;  3FFL A;  3UT7 A;  4GA0 A;  4NUR A;  4NIK A;  2ILR A;  4B0Z A;  3E32 A;  2WM9 A;  3EJN A;  4RG9 A;  4XI0 A;  3NZU A;  4UQY A;  2XPY A;  2IQC A;  4F1S A;  1OWL A;  2CFU A;  4BTA A;  4N2Q A;  4J8F A;  2WMN A;  4JB8 P;  2RFM A;  2WXM A;  3KSQ A;  1H19 A;  4WND A;  3FH5 A;  4K03 A;  3E4B A;  4GMJ A;  2EIK E;  1JPL A;  3URZ A;  1OWO A;  1N11 A;  3CEQ A;  1QQE A;  3CHP A;  5G04 J;  2AXZ A;  5HQ8 A;  2I6H A;  1MX4 A;  4ANU A;  3C3O A;  4C9B B;  3IXE A;  5LFA A;  5LP0 A;  2IF4 A;  4IYP A;  5BUZ A;  2XRY A;  2RKK A;  4ZHB A;  5ENS D;  4HI8 A;  3HG0 D;  3ZIM A;  2ZIS A;  4DX6 D;  1FT1 A;  2H6I A;  3ULE G;  3AJI A;  2Y4T A;  5C1D A;  5A6C A;  3QAQ A;  4AM9 A;  2ZXW E;  4WUY A;  2A4Z A;  1NL4 A;  4ACL A;  3T8K A;  2WXL A;  3TWR A;  2QFC A;  4FP7 A;  3LDZ A;  3SD5 A;  2P9P G;  2AXU A;  1IQR A;  2P9U G;  4E85 A;  4D10 C;  1OWM A;  4DX2 A;  2LXM A;  2R2L A;  4YVQ C;  3C72 A;  1BI8 B;  4L23 A;  4EBA G;  1IKN D;  1KZO A;  1EYH A;  3T5X A;  4KVM A;  4YDY A;  3PNL B;  3KSL A;  3UIO C;  4TXQ A;  3CKB A;  1H6P A;  2P2C P;  5JHB A;  3FH7 A;  3HRA A;  1UG3 A;  4M3O A;  2CHW A;  1S70 B;  2XCB A;  3FTS A;  2XPZ A;  3UMV A;  3CST A;  2L0I A;  2WXR A;  3ASH A;  4GZ3 A;  4JPS A;  3ABK E;  1N9A A;  4OVU A;  5CED B;  5FTP A;  1H6O A;  1OUV A;  4UI9 J;  4BX9 A;  5JMN D;  3TXM A;  1S63 A;  1UJJ A;  3PE3 A;  3V30 A;  5T3R A;  1YCS B;  1H2U A;  3OTN A;  1YYH A;  2XS1 A;  5ENR D;  2AVP A;  1ZBP A;  3SBS A;  2I9C A;  1A5E A;  3Q79 A;  3G2W A;  3NQP A;  3TGO A;  3TXN A;  3AG1 E;  3ZXS A;  3Q5M A;  2QYU A;  2X6H A;  2PQR A;  2E0I A;  3CVW A;  5JA4 D;  1INZ A;  2XZT G;  3U3W A;  4I2Z A;  3CVV A;  1GW6 A;  4HOR A;  3RU0 A;  3HHM A;  1N4R A;  4GTQ A;  2IO2 C;  3Q9U C;  4HRN A;  3NZS A;  3VTY A;  3GZ1 A;  2X38 A;  4N2S A;  2XGS A;  3AG4 E;  2WXF A;  5DBK A;  3RO3 A;  2HE0 A;  4AP2 A;  1N54 A;  4PS3 A;  4FHJ A;  3S7B A;  2Y69 E;  3CVU A;  4GPK A;  1KZP A;  2KBX A;  4CT0 A;  3ASG A;  5EYL A;  4BWR A;  1W3B A;  4G11 A;  5E76 A;  3UXG A;  2YHE A;  1PY1 A;  4UWL A;  4JEH A;  2NXP A;  1ELW A;  2Y4U A;  3C3R A;  3VLF A;  4U8Y D;  1E8Z A;  4WNE A;  4MKT A;  1KPS B;  1FCH A;  1RZ4 A;  4BER A;  2J49 A;  5AJD A;  5AAO A;  3BG1 B;  1H2T C;  3V2X A;  3DXK G;  2BKK B;  3PEV B;  5FQ6 A;  3SFX A;  4RSY A;  3U4T A;  4GTP A;  3D9H A;  3E33 A;  3HXC A;  3FTX A;  2VGY A;  4PS8 A;  5KJL A;  4JHJ A;  4WWP A;  4QQI A;  3AS8 A;  4AY5 A;  3QOU A;  3ASF A;  1WDY A;  1O1T A;  3ZW3 A;  1N4Q A;  4URK A;  3TWT A;  2XZD G;  3TWW A;  1EF1 C;  1JWG A;  3FEY A;  2ETA A;  3BUA A;  4HOS A;  2GRL A;  1IYG A;  4ATZ D;  2OOE A;  2RFA A;  4GTS A;  3HXB A;  1H6K A;  3UM1 A;  3EHR A;  4KZC A;  1O5M A;  2X6F A;  2X3M A;  3MA5 A;  5EIL A;  4BES A;  4XKB A;  4EZJ A;  2Y1L E;  1BPO A;  4A63 B;  3OXG A;  3U66 A;  4L7T A;  5JHA A;  2HM8 A;  2HR2 A;  4L2L A;  5FT9 A;  1V55 E;  5FIO A;  2QY7 A;  3EU5 A;  5FWQ A;  4KZ0 A;  3MX3 A;  3ZEF A;  4TV3 A;  5EID A;  4GYW A;  4G1T A;  3EIQ C;  5B1A E;  2KCL A;  3RO2 A;  2OEV A;  4A1S A;  3JXJ A;  3T9K A;  3ABM E;  3GZ2 A;  3V2O A;  4H7Y A;  3T8M A;  2C2L A;  3JUE A;  1MQS A;  1OCC E;  1IHB A;  3SNX A;  4H7X A;  1N94 A;  3SY2 A;  5G05 C;  4JXT A;  2J07 A;  3TWQ A;  2VGE A;  3PZ1 A;  1IQU A;  3FUJ A;  3L17 A;  1TJC A;  3FY4 A;  3FUD A;  2IY0 C;  2XCC A;  4LSZ E;  2XHE A;  3MGB A;  4YDO A;  4HBD A;  4AVX A;  3D9J A;  4KXK B;  3VLE A;  3PDN A;  3MJW A;  3FH8 A;  4IUL A;  3ULQ A;  3CSF A;  3LEW A;  3LY9 A;  3C98 A;  3ENE A;  1OWP A;  1TR4 A;  5AQB A;  2GGF A;  3RKV A;  2V8S E;  1K1A A;  3D9L A;  4I2W A;  4DLO A;  1X81 A;  3LYA A;  3KEA A;  2H6H A;  3PH0 C;  2MYO A;  1ELK A;  5BNW A;  3D9N A;  4UWK A;  2J8S D;  3CIA A;  4FC8 A;  2QC9 A;  3MKR A;  5D2M C;  2GRN B;  3RRN B;  4J8D A;  3NB2 A;  4U8V D;  5A7D B;  1YMP A;  3ESL A;  3ZPJ A;  4HFG A;  3VLD A;  3NOG D;  3DPY A;  2WXN A;  3FTW A;  2XGM A;  1LF8 A;  4O6F A;  1AWC B;  1UOH A;  2IFU A;  4O60 A;  3DSW A;  4TUM A;  1DNP A;  4GTV A;  3CQG B;  5CCL A;  2DZN A;  2EQX A;  1HZ4 A;  2YIN A;  2VYI A;  1N4P A;  3L6A A;  4KYO B;  5AQ9 A;  3F6Q A;  4P29 A;  3X2Q E;  4ABN A;  2R03 A;  5CEA A;  5J90 A;  1A17 A;  3E37 A;  4B89 A;  2PZI A;  5CRU A;  5G55 A;  4HRM B;  4RVB A;  5FZQ A;  1E8Y A;  1H0A A;  2FUL A;  4JW1 A;  3D3M A;  1JCS A;  4GB9 A;  3UUX A;  2J9Q A;  4DJA A;  2WMO A;  4BX8 A;  4I1O B;  5EKQ D;  4HRL A;  3FUL A;  3B7S A;  4O1P A;  2WQH A;  1MJ0 A;  5FQ8 A;  3B95 A;  1HO8 A;  3QB2 A;  4N5C A;  2FEZ A;  3ULY A;  2OEW A;  1MYO A;  2J4D A;  3UKR G;  1N52 A;  4HXI A;  3D9O A;  1NA3 A;  3KS2 A;  2AXV A;  2ZGD A;  2V4H C;  1LD8 A;  5CMY A;  5KWD A;  3ZFW A;  3Q78 A;  1B89 A;  3UIP C;  4O1O A;  3Q75 A;  4K0R A;  5G05 J;  4OYS A;  1HXI A;  3ZVV A;  3RRU A;  2WVI A;  4GZD A;  1LD7 A;  5LCW C;  3ZU7 B;  2X6J A;  2X6I A;  2DBA A;  2ZU6 B;  1TNB A;  2BUG A;  3FP3 A;  2YHC A;  5FJY A;  3CHS A;  3ASD A; 
#chains in the Genus database with same CATH homology
 2E0I A;  3CVW A;  1INZ A;  2MOW A;  2MHK A;  3U3W A;  3ML8 A;  3QWV A;  3ZGQ A;  4I2Z A;  3SZ7 A;  3CVV A;  1GW6 A;  5D0O D;  3JCK C;  3RU0 A;  4HOR A;  3AS4 A;  3HHM A;  3FU6 A;  1UN8 A;  5AIJ A;  3SHF A;  5E75 A;  3NZS A;  3FDH A;  3FU5 A;  2CFZ A;  4U07 A;  4Y6W A;  4A3T A;  3FUF A;  4I6J A;  4J8E A;  4AOF A;  2J09 A;  3QDN A;  4TRQ A;  3MEK A;  3UQ3 A;  3VTY A;  3GZ1 A;  2X38 A;  4N2S A;  2XGS A;  2L0T B;  1JWF A;  5FZR A;  5JJ6 A;  2WXF A;  4MRU A;  2BTD A;  1QZ2 A;  3NF1 A;  3ONL A;  5DBK A;  3RO3 A;  3CHM A;  3LVR E;  4AP2 A;  5AJL A;  1E7U A;  2J08 A;  2OVF A;  4JA9 A;  3CVX A;  1N54 A;  4PS3 A;  4UWF A;  3FUE A;  4FHJ A;  4UWH A;  3CHR A;  3Q15 A;  4I43 A;  3S7B A;  3HYM B;  4LRZ A;  4LER A;  3O4Z A;  3CVU A;  4GPK A;  3L54 A;  2BF0 X;  4G25 A;  2P58 C;  3P2B A;  4J6I A;  4CDN A;  4CT0 A;  3ASG A;  2XGO A;  4F7A A;  3CGH A;  4PS7 A;  3CK8 A;  3I3N A;  3B7U X;  3IHY A;  4JZY A;  4BWR A;  1E8W A;  1W3B A;  1P5Q A;  3FTV A;  4G26 A;  3CK7 A;  4G11 A;  4FAD A;  4BFR A;  1XNF A;  1KT0 A;  5D0Q D;  5E76 A;  4WNG A;  4U0S A;  5AEN A;  4GZ6 A;  3IEG A;  5G2N A;  4APO A;  2YHE A;  1PY1 A;  4UWL A;  4EBA A;  1NP7 A;  4JEH A;  3CVQ A;  2NXP A;  1ELW A;  2Y4U A;  3ZN3 A;  3VLF A;  5KJK A;  3RIB A;  3FEX A;  4HOU A;  2NC9 A;  3PNT B;  3LJ3 A;  4N3C A;  1E8Z A;  2ION A;  3ESK A;  4ILH B;  4WNE A;  1HS6 A;  3S7J A;  4R7L A;  4JHK A;  4L1B A;  1X5B A;  2WXO A;  4MKT A;  4MLP A;  4N3B A;  1HX8 A;  1FCH A;  2NSZ A;  2J49 A;  3UT4 A;  3ZHE A;  5AJD A;  3ZHE B;  3CVN A;  4FUL A;  3BG1 B;  1H2T C;  3CVP A;  1HG5 A;  5EX3 A;  3PE4 A;  2E2E A;  4TUU A;  4F53 A;  3HVE A;  4YVO A;  3HVE B;  4ILI A;  4JL0 A;  3N71 A;  5A23 A;  2PM6 A;  2WQ6 A;  2LO6 A;  4GCO A;  3PUJ A;  3QK0 A;  3PEV B;  5KCM A;  4U63 A;  5FQ6 A;  3ZRH A;  2LSV A;  4G23 A;  3LS8 A;  4ANX A;  3APF A;  4EQF A;  3MV3 B;  3SFZ A;  2KAT A;  4RSY A;  3ZYQ A;  3U4T A;  2OVB A;  4NRH B;  4U0Z A;  4AXH A;  1IHG A;  4Q94 A;  3WXX A;  4XE0 A;  3FWV A;  3JQ1 A;  4KT6 B;  4GA2 A;  4RG6 A;  4UQZ A;  5ARG A;  2DIW A;  1HE8 A;  1WAO 1;  3FTX A;  2VGY A;  1PC2 A;  3TAX A;  4CDR A;  1MHQ A;  1WY6 A;  2VJ8 A;  3AU5 A;  4PS8 A;  3FHE A;  4N3A A;  3VTX A;  2R17 C;  5KJL A;  3LVQ E;  4WAF A;  3ZYM A;  4JHJ A;  3DPD A;  4WWP A;  3CR3 A;  3CV0 A;  4APF A;  4FJZ A;  4AV7 A;  4Q69 A;  2WXP A;  3QC1 A;  3D9K A;  4DLQ A;  1NZN A;  3AS8 A;  4I1M A;  5ANL A;  4AY5 A;  4NQ0 A;  1UN9 A;  3QOU A;  1SZA A;  4OVV A;  4B8A A;  3K9I A;  4C0E A;  3ASF A;  1HU3 A;  4A3V A;  5ARF A;  5HI7 A;  4UWG A;  3EHM A;  4IN3 B;  2KM4 A;  3ZW3 A;  5BT1 A;  4HLE A;  5KJN A;  4FU3 A;  4URK A;  3ML9 A;  3QWW A;  3CHQ A;  3FUH A;  3Q49 B;  1EF1 C;  3IV0 A;  4KMO A;  5BW8 C;  1Z6T A;  3B13 A;  1SQM A;  1JWG A;  3IKO B;  2DCP A;  3FEY A;  4HOT A;  4DI3 A;  4HOS A;  2GRL A;  4GYO A;  1IYG A;  1HFA A;  3R7Q A;  2J4B A;  2OOE A;  3FUK A;  3U64 A;  5T8I A;  2RD0 A;  4FHK A;  1E8X A;  1H6K A;  2L6J A;  4GZ5 A;  3UT8 A;  3CVY A;  1E7V A;  4CRW A;  2KC7 A;  3DBS A;  4CGW A;  2IJG X;  3QAR A;  5CHE E;  4KZC A;  2WXG A;  3IHV A;  2X6F A;  3KD7 A;  5CMW A;  4GCN A;  2IOL A;  4ANV A;  4DPR A;  4AEZ C;  2X3M A;  3CKC A;  3R9A B;  3MA5 A;  4ANW A;  2OND A;  3GYZ A;  1SZ9 A;  2OV8 A;  4XKB A;  2X6K A;  4EZJ A;  1Y6I A;  1BPO A;  3QKY A;  3S7D A;  2YNQ A;  3QWP A;  3OXG A;  4YND A;  2HO1 A;  4IRU A;  3HDX A;  4BT9 A;  2AW6 A;  2VSO E;  3U9W A;  3RRM B;  3U66 A;  4AJW A;  4HS2 A;  4L7T A;  2GW1 A;  3BG0 B;  4N39 A;  4Q96 A;  3L08 A;  4UI9 K;  3ZYL A;  5JHA A;  4CEM A;  2WXQ A;  3LPZ A;  2HM8 A;  2HR2 A;  2JEK A;  3Q4A B;  4JHR A;  4L2L A;  5FT9 A;  2QY7 A;  3SGH A;  5FWQ A;  4KZ0 A;  4XX5 A;  2UY1 A;  3MX3 A;  2UY1 B;  2IU1 A;  4G2V A;  5BV1 A;  3LY7 A;  4JA7 A;  5EX0 A;  4E6H A;  4MS6 A;  2R5S A;  3ZEF A;  2KCK A;  3EIJ A;  4TV3 A;  5BV0 A;  4GYW A;  2L9B A;  4U04 A;  2IOS A;  4G1T A;  4BTB A;  2Q7F A;  3S2A A;  3EIQ C;  2LSU A;  2KCL A;  3APD A;  4UI9 C;  3L16 A;  3RO2 A;  3MKQ A;  2AWI A;  3MKQ B;  2I1K A;  5FQ4 A;  3SBT B;  1EDU A;  1E96 B;  2M63 A;  2XEV A;  3FFL A;  3FTU A;  3UT7 A;  4A1S A;  3LKU A;  3ZYK A;  3CHO A;  4GA0 A;  3GZ2 A;  5T4Y A;  3SF4 A;  4NUR A;  1ELR A;  3UX4 A;  2ILR A;  3L22 A;  4B0Z A;  5DIZ A;  4GYY A;  1XGW A;  4H7Y A;  3T8M A;  2C2L A;  3CK9 A;  2PL2 A;  4LEU A;  3FU3 A;  4GZC A;  1MQS A;  2V0P A;  2WM9 A;  3EJN A;  4RG9 A;  5ENN A;  4XI0 A;  3Q47 B;  1EPU A;  5LX8 A;  3SNX A;  3NZU A;  4H7X A;  4UQY A;  5G05 C;  4JXT A;  2XPY A;  2IQC A;  2J07 A;  4F1S A;  4XZ4 A;  4W9R A;  1OWL A;  2CFU A;  4FJY A;  4ME2 A;  5FQ7 A;  4BTA A;  4J8F A;  4EZL A;  3KEZ A;  1IQU A;  3FUJ A;  4N2Q A;  3I5P A;  1S0P A;  1TJC A;  2VSN A;  3L17 A;  3LY8 A;  4WWN A;  3FY4 A;  3FUD A;  2XCC A;  2WMN A;  2PQN A;  2XHE A;  3MGB A;  2UWJ G;  4CDM A;  3PEU B;  3D9J A;  4AVX A;  4KXK B;  3PDN A;  4I6G A;  3MJW A;  3VLE A;  1TJF A;  3FTZ A;  3FH8 A;  2WXM A;  4IUL A;  4DK5 A;  1H19 A;  4I9C A;  4WND A;  3ULQ A;  3CSF A;  3FH5 A;  4FA6 A;  4K03 A;  4EZK A;  3LEW A;  1WM5 A;  3E4B A;  2CHX A;  4GMJ A;  3LY9 A;  4ILG A;  4ATG A;  2JLB A;  3O48 A;  3C98 A;  3MZL B;  3ENE A;  5KJM A;  4B94 A;  1OWP A;  3APC A;  3LCA A;  3HIZ A;  2GGF A;  3RKV A;  1JPL A;  1ZU2 A;  2V8S E;  3D9L A;  3URZ A;  5JJT A;  5CCM A;  2VTB B;  2VTB A;  4I2W A;  1OWO A;  4I6E A;  4KVO A;  4DLO A;  3CEQ A;  3TG5 A;  1QQE A;  4EPZ A;  5JJ7 A;  3CHP A;  5G04 J;  2AXZ A;  5HQ8 A;  2I6H A;  4ANU A;  4G24 A;  2VGX B;  3LYA A;  4C9B B;  1PAQ A;  4B8C B;  5LFA A;  4F3V A;  5LP0 A;  3B7T A;  3CLJ A;  3JYS A;  4EEC A;  3G2V A;  2IF4 A;  5BPP A;  4IYP A;  5BUZ A;  3PH0 C;  3G2S A;  2XRY A;  4GML A;  1U3D A;  3GW4 A;  1ELK A;  5BNW A;  3D9N A;  4UWK A;  2VSX E;  3CIA A;  2LAI A;  4FC8 A;  3FUI A;  1NA0 A;  5C2Y A;  2PM7 A;  3MV2 B;  3MKR A;  4L2Y A;  3TJP A;  3ZIM A;  3FUN A;  3QJZ A;  4XIF A;  3PRZ A;  3RRN B;  2VQ2 A;  4J8D A;  5LOZ A;  2Y4T A;  5C1D A;  3PS6 A;  5A7D B;  5A6C A;  3PRE A;  3OAW A;  1Y8M A;  3RJV A;  4AY6 A;  3LXU X;  3SI5 A;  3ESL A;  3QAQ A;  4AM9 A;  4XI9 A;  5FZS A;  3ZPJ A;  3FTY A;  4HFG A;  4WUY A;  3VLD A;  2A4Z A;  4AIF A;  2GRM A;  4CT4 A;  1UW4 B;  4ACL A;  3MCX A;  2WXL A;  3R7R A;  1YA0 A;  2QFC A;  2WXH A;  3S7F A;  2CG3 A;  3EHN A;  3B7R L;  2WXN A;  4J8S A;  4BSX A;  4QFV A;  1OWN A;  2RG8 A;  3G2U A;  1JUQ A;  2R59 A;  2XGM A;  3FTW A;  3EDT B;  4FP7 A;  4JEU A;  1TEZ A;  1LF8 A;  2CHZ A;  2WPV A;  4JVS A;  4O6F A;  3P1U A;  3RK6 A;  4I17 A;  4KBQ A;  3LDZ A;  3SD5 A;  2V4L A;  2AXU A;  1IQR A;  2XPI A;  2IFU A;  4PDX A;  2LAH A;  4E85 A;  4PUC A;  4HVB A;  1E90 A;  3MYV A;  3JUI A;  4JW1 A;  3FU0 A;  1OWM A;  4A1G A;  4D10 C;  3TG4 A;  4Y6C A;  1DNP A;  4YVQ C;  3CVL A;  3CQG B;  2KZT A;  3I4G A;  2KZT B;  4PH4 B;  1FVH A;  5CCL A;  4L23 A;  4EBA G;  4LUN U;  2WQ7 A;  3I4R B;  2EQX A;  1HZ4 A;  1KT1 A;  1EYH A;  2YIN A;  2FBN A;  2VYI A;  2CG2 A;  4WWO A;  3T5X A;  4KVM A;  2A5U A;  3L6A A;  3PNL B;  3PUK A;  4KYO B;  4P29 A;  1HF8 A;  4BT8 A;  3CKB A;  4ABN A;  4BY6 A;  3G2T A;  5EDS A;  5JHB A;  4I1A A;  3AS5 A;  3FH7 A;  4GA1 A;  4C0M A;  4I9E A;  4FLH A;  3D9P A;  1UG3 A;  4M3O A;  2C0M A;  4WNF A;  1A17 A;  5J90 A;  4B89 A;  2CHW A;  3D9I A;  5AYW D;  5LCW J;  3T5V A;  1Z3X A;  2FF4 A;  2PZI A;  5G55 A;  4RVB A;  5G04 C;  2XCB A;  5FZQ A;  3FTS A;  2XPZ A;  4CGV A;  3L13 A;  1E8Y A;  1H0A A;  2HYZ A;  3UMV A;  2FUL A;  3CST A;  2L0I A;  1DVP A;  1L5J A;  3D3M A;  2WXR A;  4GB9 A;  3CQC B;  3JQ0 A;  3ASH A;  2J9Q A;  3UUX A;  4DJA A;  4GZ3 A;  4GAA A;  3PZD A;  3ONK A;  4JPS A;  2WMO A;  2FI7 A;  2WB2 A;  2XQ0 A;  4BX8 A;  4I1O B;  5EKQ D;  3AU4 A;  4GU5 A;  2MRI A;  4OVU A;  1H2V C;  3PVL A;  3FUL A;  3B7S A;  2WXK A;  5FTP A;  2WQH A;  2YQ8 A;  5FQ8 A;  1FVF A;  4J0U A;  1HO8 A;  1OUV A;  3QB2 A;  4UI9 J;  2I1J A;  2FEZ A;  4N5C A;  4BX9 A;  1U3C A;  3TXM A;  1Z3Y A;  2J4D A;  5J08 A;  1N52 A;  4HXI A;  4DI4 A;  1VDY A;  3D9O A;  4ACK A;  1UJJ A;  2VGX A;  3PE3 A;  1NA3 A;  5T3R A;  3KS2 A;  3BEE A;  4NAC A;  1H2U A;  4XKC A;  2AXV A;  3D9M A;  3OTN A;  3OXL A;  4U8H A;  1HH8 A;  3OXF A;  3QNK A;  4A55 A;  2AVP A;  1QNF A;  3GZS A;  5CMY A;  1ZBP A;  5ANR A;  3SBS A;  3ZFW A;  1B89 A;  4UQX A;  2I9C A;  4U0U A;  3KAE A;  2WXJ A;  4K0R A;  3G2W A;  3NQP A;  4OYS A;  5G05 J;  3TXN A;  2V5F A;  3TGO A;  1HXI A;  1KLX A;  2C0L A;  3ZXS A;  3ZVV A;  2KCV A;  4V3I A;  3RRU A;  2WVI A;  3TL5 A;  3IBE A;  4GZD A;  3Q5M A;  5LCW C;  4CCA A;  1UJK A;  2WXI A;  2I2O A;  2X6J A;  2LNI A;  3UPV A;  4FLB A;  2X6I A;  2DBA A;  3FUM A;  2ZU6 B;  1HG2 A;  2X6H A;  2BUG A;  2Y3A A;  3FP3 A;  4JC8 A;  2XRZ A;  2YHC A;  2VSY A;  4HOQ A;  4LCT A;  5M72 A;  5FJY A;  3CHS A;  2PQR A;  3ASD A;  2FO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...