5FZSA

Designed tpr protein m4n delta c (cf ii)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
107
structure length
107
Chain Sequence
NSIKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNNIKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNNIKTLSNLAVLLAQEGKAEEAIKYMRKAVSLIDKAAKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Origin of a folded repeat protein from an intrinsically disordered ancestor.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Unknown function
molecule keywords DESIGNED TPR PROTEIN
total genus 43
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5fzsA00
4WNEA 5ARGA 3ULQA 2WQHA 2PQNA 4GYOA 3KD7A 4U0SA 1WM5A 2VGXA 5D0QD 3SZ7A 4CGVA 4CGWA 3RKVA 3TAXA 2FBNA 4GCNA 2KCVA 2HR2A 5FZSA 2R5SA 3SF4A 4BT8A 1WAO1 4UQXA 5BT1A 5CCLA 4N3AA 4XIFA 3Q4AB 4ABNA 2DBAA 3ASFA 3ZN3A 2UWJG 2C0LA 3VTXA 2WPVA 4A1SA 3PDNA 3CVPA 3ASGA 2HYZA 2ONDA 3MKRA 4N3BA 3RU0A 5CHEE 3UQ3A 2IFUA 4XI0A 1W3BA 4H7XA 2XGMA 3GYZA 4I2WA 3CKCA 4ME2A 1HZ4A 1P5QA 2I6HA 5DIZA 4HORA 2XCCA 1HH8A 1IHGA 2UY1A 3URZA 4JHRA 5LCWJ 2VSYA 4I1AA 2LNIA 2P58C 3LKUA 3GZ1A 3PE4A 1ELWA 4G2VA 1KT0A 3GW4A 4UQZA 4JA7A 3LYAA 5FJYA 3LY8A 4HOUA 5G04C 5BNWA 2YQ8A 1TJCA 3ZFWA 3LCAA 4AM9A 3CK7A 2PZIA 4JA9A 5HQ8A 1A17A 2FF4A 2VSNA 2V5FA 3LPZA 1OUVA 2Y4TA 4YNDA 5HI7A 3ZGQA 1ZBPA 4WNFA 3S7JA 4I17A 4HOSA 2NC9A 3VTYA 3ZHEB 3QWWA 5EX0A 1E96B 3U3WA 1IYGA 2XCBA 2KCLA 4JL0A 4G24A 3R9AB 3UUXA 4J0UA 5A7DB 2VYIA 2YHCA 2E2EA 5KJMA 3TGOA 3CVNA 4U04A 4N2SA 1KLXA 4N39A 2HO1A 3AS8A 4N2QA 1NZNA 4BT9A 3Q47B 3NF1A 3AS5A 3CKBA 1ZU2A 2KATA 5ARFA 3JYSA 3LY7A 3FP3A 1ELRA 2FO7A 3QKYA 4GA0A 4B94A 2LSUA 1QZ2A 4XI9A 4EQFA 3OXGA 5A6CA 3UPVA 4N3CA 5FZRA 3RJVA 4YVOA 5KJLA 3Q49B 3MV3B 4G26A 3MEKA 5M72A 4GYYA 5D0OD 3GZ2A 3IEGA 1YA0A 4WNGA 2C0MA 3ZPJA 3QWPA 4G25A 3ASHA 3K9IA 2OOEA 4UQYA 3EDTB 5AYWD 3RO2A 3CV0A 3LY9A 1NA0A 3BEEA 2Q7FA 4H7YA 4I2ZA 3CVQA 4F3VA 1XNFA 4N5CA 3AS4A 5FZQA 3TG5A 3OXFA 3MA5A 5LCWC 3E4BA 3WXXA 5CCMA 3HYMB 4BWRA 2LSVA 5KJKA 1FCHA 4BTBA 3CVLA 3MV2B 4HOTA 4UI9C 2C2LA 3O48A 5FTPA 3OXLA 3Q15A 3S7BA 4GPKA 5C1DA 4IN3B 4U07A 4WUYA 4Y6CA 5BW8C 4LEUA 3ZHEA 3QWVA 4GA2A 5JJ6A 2XGOA 2AVPA 4GCOA 4KBQA 2VQ2A 1Y8MA 2PQRA 4J8EA 4KYOB 2BUGA 5DBKA 4YVQC 2J9QA 3FFLA 2Y4UA 2XPIA 4KXKB 1PC2A 2IF4A 4J8DA 3KAEA 4RG9A 5G04J 3TG4A 4GZ5A 1QQEA 4UI9K 5FT9A 3RIBA 2VGXB 4W9RA 4G1TA 4I9CA 4U0ZA 3S7DA 2MHKA 2XGSA 4GYWA 3N71A 4CDRA 4G23A 4HOQA 5KJNA 2UY1B 4I9EA 4NQ0A 4U0UA 3CEQA 2L6JA 3QDNA 4Y6WA 2JLBA 2XEVA 4GA1A 4NRHB 5EX3A 3QOUA 5JJTA 4AY6A 5JJ7A 5G05J 4APOA 2FI7A 4UI9J 4BTAA 1NA3A 2FEZA 3PE3A 3FWVA 1B89A 3CK9A 4GZ3A 3ESKA 4O6FA 4AIFA 5G05C 2VGYA 3ASDA 3KS2A 5EKQD 1HXIA 3U4TA 3RO3A 4AY5A 2GW1A 3CK8A 4J8FA 3S7FA 2KCKA 4RG6A 2QFCA 3Q5MA 4GZ6A 4WNDA 2PL2A 2KC7A 1KT1A
chains in the Genus database with same CATH superfamily
5G2NA 3RKVA 3NZUA 3DSTA 4EPZA 4V3IA 3V30A 3RRNB 2J8SD 1V54E 3ASFA 4MRUA 3HXCA 3IKOB 4DPRA 4AEZC 2I6HA 2XCCA 4K0RA 5AQBA 2P58C 4HOUA 4ATGA 3Q7AA 3B95A 2KBXA 1TNYA 3LPZA 3TJPA 3V2OA 3FUNA 4KMOA 3DWLG 4IYPA 3TL5A 4U04A 4GTMA 4JPSA 4I6JA 3TWVA 2P9UG 4YVOA 3SI5A 3CVWA 3PS6A 2GRLA 2RFMA 3ZNGA 3CV0A 2WXRA 4F3VA 1O1RA 4HS2A 1N0QA 5T8IA 3QARA 5ENOD 4QQIA 4AOFA 3FH5A 4TUMA 5EDSA 2CHZA 4PS3A 3HXFA 4IN3B 2IQCA 2LXLA 3MGBA 1UOHA 3U9WA 2VTBA 4YDYA 4UI9K 4UWHA 2VGXB 3EHRA 2H6GA 4HOQA 4I9EA 4U0UA 3CEQA 2P9IG 5FQ6A 3FULA 3LDZA 5BXUA 2FEZA 3PRZA 4XZ4A 2JABA 3TWQA 3U4TA 2V8SE 4XE0A 2GW1A 4YDOA 4GYOA 2PQNA 1SW6A 3B13A 2DZNA 4CRWA 1MX2A 1TYQG 2ONDA 2RD0A 2X6HA 3UQ3A 2IFUA 3ZYMA 2L0TB 4ME2A 5DIZA 2VSYA 3E34A 4I43A 3NQPA 4FC8A 2EIME 2DCPA 5HI7A 5CMYA 4PS7A 2NC9A 4EECA 2J07A 1ZB1A 4ANXA 3D9IA 2CG2A 4J0UA 5A7DB 5D66A 2XZDG 3CVXA 3AG1E 3CHOA 1QZ2A 2F8YA 1Y6IA 4DLQA 3CGHA 4MKTA 1WDYA 3E30A 3DPYA 4R7LA 4CT4A 3F6QA 5LCWC 3B7UX 3MV2B 4UI9C 3R7QA 3UINC 2DZOA 3EJNA 4UUCA 4DI4A 4J8EA 2QC9A 3FFLA 1TN8A 3KAEA 1MJ0A 4G1TA 4UWGA 3EU5A 3CQGB 4FP7A 2QY7A 4O1OA 4O6FA 1XGWA 2KZTB 5JA4D 4L2LA 5KJLA 3CVVA 1KT1A 4UQXA 1A5EA 2FULA 1FT2A 3C72A 1WM5A 2VGXA 3HDXA 5HKPA 4GMLA 3TWSA 1N11A 3VTXA 3ZU7B 2WXHA 3AG4E 2OCCE 2IONA 5FQ8A 3RAUA 2F8XK 2YQ8A 4EBAA 5HQ8A 2V5FA 3HVEB 2YHCA 5CBNA 2RKKA 1N4QA 3TGOA 2AJAA 2LSUA 4DK5A 4G11A 5FZRA 3ULYA 3CHPA 5D0OD 3ABKE 1YA0A 1MZCA 4HVBA 4H7YA 1Q2ZA 4BX9A 2J09A 4A55A 4FULA 2XRZA 3MX3A 4GMJA 2IF4A 2PNNA 5JHAA 2XGSA 3DEOA 4UWLA 2JLBA 1BLXB 4MS6A 3PZ4A 3RSEG 5FQ4A 3ASOE 1BI8B 4DX6D 4UI9J 4G8LA 3FWVA 5AN8A 3RO3A 3SY2A 1D8EA 3QAQA 3BG1B 3SFYA 2GRQB 5ARGA 2BTDA 2VSOE 4GCNA 2MOWA 3FU6A 1WAO1 5BT1A 4XIFA 4A1GA 3DSVA 2YINA 4C0EA 3RU0A 5G55A 4K5CA 5CEAA 3ONKA 2XEHA 4JHRA 3U66A 4AM9A 2PZIA 3ZUVB 4B89A 3APCA 5ANLA 2B6CA 3DSWA 2E2EA 1HO8A 3JUIA 5EN5D 3TWWA 2IEJA 4BT9A 2WB2A 4ANUA 2IO2C 2ETAA 4OYSA 4ZHBA 4N3CA 1DCEA 3FEXA 2BKKB 3R9MA 4B0ZA 5M72A 5CRVA 3SO8A 5AYWD 2GRPB 2NYJA 1SVXA 2XEEA 2XS8A 2OVFA 1JPLA 3UTMA 2KM4A 1WG0A 5B1AE 2R2LA 2ETBA 3TXNA 3B7RL 4U07A 4UWKA 3LEWA 3UKUG 2R05A 4DI3A 3J5PA 1PC2A 4JEHA 2CFZA 3IHVA 4W9RA 3C3RA 4O1PA 4EBAG 3KEAA 4APOA 1B89A 5AQ9A 4J8FA 2DYSE 2XQ0A 3OAWA 3JXJA 3KD7A 1EF1C 2VGEA 2R5SA 4HLLA 2X6JA 3ZN3A 4DLOA 3FY4A 3L82A 2X6FA 4N3BA 2WMNA 3SGHA 4GMRA 3GYZA 3DBSA 3LKUA 4G2VA 2L0IA 5G04C 1TJCA 4JA9A 3PUKA 3ZHEB 4G24A 3V2XA 4K5BA 4GU5A 3BG0B 2WXNA 4DRXE 2FO7A 2WXFA 1RW2A 3GZ2A 3FU0A 4UQYA 5KWDA 3PNLB 3LY9A 1PY1A 3CVQA 2MRIA 2IO3C 3EHMA 5KJKA 4C48B 3FUFA 5C1DA 4Y6CA 4KZ0A 5BW8C 1O5MA 4TXRA 4GA2A 4FADA 2BUGA 1FVHA 4NACA 4HRLA 4BFRA 1QQEA 3S7DA 2MHKA 4ACKA 3N71A 1Z3YA 2A5UA 2XEVA 4NRHB 2ZISA 1H19A 3Q9NC 5CEDB 3Q73A 3PE3A 3ULEG 5E75A 4ILGA 4LNGA 3ASDA 4E85A 4HI8A 4TRQA 1JCSA 3L9TA 4HOTA 3L22A 4LRZA 3FEYA 4CCAA 3Q9UC 3FTVA 1DCQA 5ENQD 2CHWA 2WPVA 3PDNA 5ENRD 2H6IA 2R03A 3EHNA 2DWZA 1H0AA 2OVBA 3URZA 4I1AA 3NZSA 3TWUA 5BV1A 3UM1A 3QJZA 4JHKA 1FVFA 2VSNA 1OUVA 1KPSB 3ZYLA 2VJ8A 4N39A 2IOLA 3E37A 5LX8A 3ZXPA 2WMOA 3LY7A 4GA0A 3ASNE 4WWOA 3OXGA 5BV0A 2EIKE 4GTTA 2C0MA 3FH8A 3DSSA 3SBTB 1BPOA 3T8MA 1E8ZA 3MJWA 4EZJA 5HRYA 4ANWA 4WUYA 4A3TA 3RRUA 4PUCA 1OWOA 3FUIA 4F1PA 5G04J 2IJGX 5JJTA 1E90A 4CYMD 4XEIG 5G05J 4JW1A 2DYRE 2XENA 4M3OA 1TNZA 2P9SG 4DUIA 1EYHA 2JEKA 3FTWA 3Q5MA 3JUEA 2EILE 2KC7A 3G2WA 3O4ZA 4KT6B 4TXPA 4OVVA 4JEUA 1UJJA 2RG8A 4FLHA 4JC8A 1DVPA 2IOSA 4H7XA 3L17A 5CECB 5A23A 3W9FA 3DXKG 2Y3AA 1ELWA 1G3NB 2YNQA 3FU5A 2YHEA 4YNDA 3D9KA 1JUQA 2WM9A 3R9AB 2WQ6A 1N0RA 1H6OA 3FUDA 2L6BA 1JWGA 3B7TA 4YDEA 3Q47B 3PZ1A 3ZKJA 1INZA 2P9LG 2H6HA 3Q49B 1X81A 1AP7A 2DVWA 3FTYA 2EQXA 1OWPA 5BXOA 5CBOA 3UT4A 4GPKA 3OTNA 2VQ2A 3QNKA 1K8KG 2Y4UA 3UT8A 2KXPC 3UXGA 3RIBA 3QDNA 2QYJA 5EX3A 3MZLB 2VTBB 4BERA 5EKQD 2AXUA 4I6GA 3UMVA 3ULQA 1DNPA 1LD7A 4LNUD 2HM8A 3Q75A 2QYUA 5E76A 4HORA 1BI7B 1HH8A 3PEVB 4JA7A 5FJYA 3T9KA 4WNFA 1D8DA 2OV8A 3VLEA 4YDWA 3U3WA 4JL0A 4BSZB 4L9PA 3G2VA 3CVNA 2LUHA 3AS8A 4ILIA 3AS5A 4N5QA 4C9BB 3APFA 3CVUA 4EQFA 2AXZA 1YYHA 3TWXA 3FTSA 4ACLA 1LD8A 3ASHA 3K9IA 3D9OA 2XRYA 5FZQA 4A63B 5B1BE 5CERB 4G8KA 2P2CP 4BTBA 3CVLA 3L54A 1HF8A 3LS8A 3D3MA 4LEUA 2ZU6B 4KYOB 3JXIA 1HG2A 3C98A 4GYWA 5LOZA 2XZTG 4RVBA 4E6HA 1U2VG 1PAQA 1UG3A 3ZW3A 3PUJA 3FTZA 1OCCE 3JCKC 1FT1A 4Q69A 2ZXWE 1N94A 4JZYA 4PDXA 4AY5A 4FJZA 2WQHA 4L7TA 3Q78A 4CEMA 4EHMA 3EU9A 1H6PA 4K03A 3MKQB 1K1AA 1E8WA 4HLEA 3KEZA 4I17A 4LUNU 3VTYA 3QWWA 4ZFHA 4MLPA 4N2SA 1NP7A 3FHEA 2HO1A 3LJNA 3LVQE 2KATA 3Q79A 3QKYA 3RRMB 4O60A 1OT8A 1OWNA 3C3OA 3SHFA 2MYOA 4OAVB 3HG0D 3AS4A 3MA5A 4WAFA 1N4PA 3T8KA 3IBEA 1JCRA 1H2TC 2NSZA 3QWVA 3HHMA 4KBQA 3UIOC 1O1SA 2AWIA 5DBKA 5AARA 3MCXA 3SD5A 2WXGA 4XKBA 2GRNB 1NL4A 3AU4A 3TXMA 3ZXSA 2WXQA 4NQ0A 2L6JA 4GA1A 3PNTB 4LNBA 3LJ3A 1NA3A 4AP2A 3KS2A 3FTXA 3S7FA 3QK0A 4GZ6A 4U0SA 3ABME 3TAXA 2KCVA 5EILA 4HFGA 4EZKA 2P9KG 2A5EA 1TEZA 1HE8A 4MBGA 5JMND 2HYZA 3MKRA 2GROB 4U95D 4C0MA 5CHEE 1W3BA 4IULA 3U64A 4GTQA 2Y1LE 4NURA 5BNWA 2P9NG 3UKRG 3FU3A 1EPUA 5ENTD 3PVLA 4GZDA 2PM6A 3X2QE 1UN9A 1OXJA 1OWLA 4FHJA 3FH7A 1NZNA 4RLYA 4A3VA 1SQMA 3C3QA 3NF1A 4B94A 5A6CA 4XI9A 4ANVA 3JQ0A 4AXHA 3DSUA 2ETCA 1TNUA 4L2YA 3EDTB 1NA0A 2V4HC 2B0OE 2XHEA 3BEEA 1XNFA 4IRUA 4U96D 3WXXA 1Z5SC 3G2TA 5FIOA 1FCHA 2XS1A 3S7BA 3Q15A 4L1BA 4D10C 2I9CA 3NB2A 4YVQC 2J9QA 2F37A 2NXPA 4I9CA 2LO6A 4CDRA 3ISMC 4G23A 1S64A 3PZDA 1TN7A 1QBQA 1UN8A 1AWCB 2X6IA 4UWFA 3NOGD 4BTAA 3ENEA 3IV0A 3HIZA 1FPPA 3Q7FA 4LCTA 5KCMA 4WNDA 4WNEA 3SZ7A 1NFIE 3CSTA 5IY5E 4TUUA 2CG3A 1K3ZD 3D9MA 4J8YA 5ENNA 2KZTA 4A1SA 2BKGA 1SA5A 2XGMA 5LFAA 2AXVA 4GTOA 1P5QA 1IHGA 3CQCB 1KT0A 3P1UA 5AIJA 1YMPA 3ZFWA 1H2UA 1OCRE 2FF4A 1S70B 2ZGDA 1ZBPA 2X38A 5KBAA 1E96B 3UUXA 3AU5A 2VYIA 1WY6A 5LP0A 4GTSA 4U7EB 2GGFA 5ARFA 1DC2A 4FLBA 3TWTA 3MV3B 1IXVA 3AAAC 4OAUC 3W9GA 4TXQA 4BSXA 3LXUX 4I2ZA 4N5CA 4JXTA 4WWNA 3OXFA 4BWRA 3O48A 3J5QB 5FTPA 1D9SA 3P2BA 4OVUA 4HNAD 4GCOA 1OWMA 2I1KA 3D9LA 4J6IA 4GZ5A 3PEUB 3EIJA 5T3RA 2LAHA 4B8AA 4Y6WA 5JJ7A 4K5AB 1HU3A 1TNBA 1U3CA 4AIFA 2AW6A 3PZ2A 5G05C 2WVIA 1KZOA 1N4RA 3V31A 5AJLA 5FZSA 4BT8A 5CRUA 2WXKA 2Y0BG 4GPMA 4I2WA 1JWFA 1MX4A 3CSFA 3UX4A 5FQ7A 5EIBE 4F6RD 1N95A 3BU8A 4UQZA 2Y69E 3FUHA 3PREA 2LAIA 1MHQA 5H7PA 3SQVA 2XCBA 3EIQC 3S2AA 2FO1E 4N2QA 4FJYA 3L6AA 1O1TA 2WXOA 4BEPA 2DIWA 2OEVA 5AENA 2J4DA 3UM2A 5T4YA 4XX5A 2P9PG 2WXIA 3CHMA 1KZPA 3HRAA 3HXBA 3RO2A 3APDA 3LVRE 4NIKA 1JCQA 1QNFA 4TV3A 5CCMA 1UJKA 1BD8A 1TNOA 3WG7E 5C2YA 1UW4B 3ZHEA 5JJ6A 2J4BA 3L08A 2GRMA 3G2UA 4Z68A 1BU9A 4J8DA 3TG4A 1OCZE 3ESLA 5EYLA 3B7BA 4B8CB 4BESA 2J08A 4KVOA 2QFCA 1LTXA 1IQRA 4CGWA 5D0QD 1Z3XA 4FA6A 3Q4AB 1TR4A 2I1JA 2WXPA 4AJWA 2IU1A 4I1MA 1SZ9A 3G2SA 3UM0A 3UI2A 3LYAA 4GTVA 3ZIMA 4WWPA 3SNXA 1E8XA 4QFVA 1HS6A 3CK7A 5ENSD 3RK6A 2EIJE 1A17A 3ZGQA 4EZLA 2R17C 2Y4TA 3E33A 4LG6A 4HOSA 3S7JA 3CHRA 2KCLA 3CHQA 3MYVA 4ILHB 1N9AA 5KNHD 4U8HA 3CHSA 3D9PA 4HBDA 1OCOE 3UPVA 4DX2A 3MKQA 2A4ZA 4GYYA 3ZPJA 3CR3A 4HRNA 3D9HA 3FDHA 4LERA 2BEDA 4BX8A 2RFAA 4HXIA 4FHKA 4HI9A 4Q96A 3AG3E 4GB9A 4RG9A 4GTPA 1LF8A 1N4SA 1E7VA 3DSXA 3TG5A 1MX6A 5AQ7A 5EIDA 4J8SA 1HFAA 3L13A 3AG2E 3CK9A 3ESKA 1ELKA 1OY3D 2WQ7A 3CK8A 3I5PA 4GZCA 4CDMA 4AY6A 4GAAA 1N52A 2GRRB 5CCLA 2DBAA 4U8VD 2XPYA 2C0LA 4JVSA 3IXEA 2BF0X 3PH0C 1Z6TA 1QYMA 3ASGA 4FU3A 3ZYQA 3VLFA 1EDUA 2F0YA 4XI0A 5AAOA 1HZ4A 2V5QC 4RSYA 3NOCD 2LNIA 3PE4A 3GZ1A 3GW4A 1TJFA 1U3DA 3T5XA 1V55E 3HXDA 3SBSA 4KVMA 1NI1A 1S0PA 1HX8A 4GTRA 5BUZA 4URKA 1E8YA 3E32A 5J08A 3CKBA 1ZU2A 2V4LA 1IKND 4CDNA 1ELRA 1YCSB 3D9NA 2VSXE 2CHXA 1X5BA 2H6FA 4JB8P 4G25A 4HRMB 2Q7FA 5ANRA 3HYMB 2C2LA 3OXLA 3ML9A 3UT7A 3HXEA 2OEWA 3KSQA 3ABLE 2ZGGA 1MQSA 2X3MA 4U0ZA 1VDYA 3ONLA 4GZ3A 3DPDA 5JHBA 1IQUA 1N54A 3AJIA 3VLDA 4HB5A 4PH4B 1SZAA 2FBNA 2HR2A 3SF4A 4N3AA 3GZSA 4JD2G 3NAWA 3CKCA 3ZRHA 2UY1A 3NBNB 4M7CA 4P29A 5D2MC 3FUJA 4PS8A 3ZEFA 2HE0A 3LCAA 3QC1A 3TWRA 3FUMA 5EX0A 1IYGA 5KJMA 1KLXA 5EYPF 3QB2A 4RQIA 3FP3A 4AV7A 2L9BA 3PZ3A 3DXMG 3RJVA 5ITZF 4G26A 2IY0C 3MEKA 4WNGA 3QWPA 2OOEA 2X6KA 5AQAA 2V0PA 2WXJA 4DJAA 3L16A 5CMWA 1E7UA 3E4BA 1IHBA 2LSVA 3ZYKA 4HQDA 4XKCA 4I1OB 1MYOA 3UIPC 4F1SA 3ZVVA 2AVPA 3EUVA 4Q94A 2XPZA 3EHQA 3T5VA 3BQOA 3BUAA 4KZCA 3IHYA 5KJNA 2UY1B 1RZ4A 1HG5A 3FUKA 3QOUA 4CT0A 5B3SE 4F53A 2VGYA 4X8QA 3V79K 1HXIA 3DRAA 2ILRA 2WXLA 2PL2A 3KSLA 4CGVA 4ABNA 2UWJG 4U63A 4DX7D 2WXMA 3CVPA 2PM7A 3FUEA 3FTUA 5J90A 1H2VC 3UM3A 2QZAA 3SFZA 5LCWJ 2E0IA 3LY8A 2J49A 4JHJA 4DX5D 5BPPA 5AJDA 1SA4A 3DEPA 2R02A 3CLJA 3R7RA 4I6EA 4B93B 2LXMA 1S63A 1GW6A 1L5JA 3I3NA 2ZIRA 4CZ2D 3CVYA 4AVXA 3JQ1A 3JYSA 3D9JA 4BETA 2R59A 4DX1A 4LSZE 3IEGA 3B7SA 3ML8A 4L23A 1K1BA 4BY6A 4APFA 2I2OA 5FINA 2CFUA 2XGOA 3CIAA 1Y8MA 2PQRA 1TN6A 2XPIA 3C5RA 4KXKB 4U8YD 5FT9A 3I4RB 2M63A 5ENPD 3HVEA 4J7WA 2FI7A 4F7AA 5KNGA 5HS0A 2EINE 4ATZD 3I4GA 2KCKA 4RG6A 3SFXA 5FWQA 1H6KA
chains in the Genus database with same CATH topology
1IQRA 2WQHA 4CGWA 3KD7A 5D0QD 5G2NA 1EF1C 3RKVA 1Z3XA 3NZUA 2R5SA 4EPZA 4V3IA 4FA6A 4L7TA 2X6JA 3RRNB 3Q4AB 3ASFA 3ZN3A 4CEMA 4DLOA 2I1JA 3FY4A 2X6FA 2WXPA 4N3BA 2WMNA 4MRUA 4AJWA 2IU1A 4I1MA 3SGHA 3IKOB 3GYZA 4DPRA 4AEZC 2I6HA 1SZ9A 4K03A 3MKQB 2XCCA 3G2SA 3DBSA 4K0RA 2P58C 3LKUA 4G2VA 3LYAA 2L0IA 4HOUA 3ZIMA 5G04C 4WWPA 3SNXA 1E8XA 4ATGA 1TJCA 4QFVA 1E8WA 1HS6A 3CK7A 4HLEA 4JA9A 3RK6A 1A17A 3LPZA 3KEZA 3ZGQA 3PUKA 2R17C 2Y4TA 4EZLA 3TJPA 3S7JA 4HOSA 4I17A 4LUNU 3VTYA 3ZHEB 3QWWA 3FUNA 4KMOA 3CHRA 2KCLA 3CHQA 3MYVA 4G24A 4ILHB 4IYPA 4MLPA 3TL5A 1NP7A 4N2SA 4U04A 3FHEA 4GU5A 2HO1A 3LVQE 3BG0B 4U8HA 3CHSA 4JPSA 2WXNA 4I6JA 2KATA 3D9PA 2FO7A 3QKYA 2WXFA 3UPVA 3RRMB 4YVOA 3SI5A 3CVWA 3MKQA 1OWNA 2A4ZA 4GYYA 3PS6A 3GZ2A 3FU0A 2GRLA 3ZPJA 3CR3A 4UQYA 3SHFA 3CV0A 3PNLB 3LY9A 1PY1A 2WXRA 3CVQA 4HS2A 4F3VA 3AS4A 2MRIA 3MA5A 5T8IA 3QARA 3FDHA 3EHMA 4WAFA 4AOFA 3FH5A 5KJKA 4LERA 3FUFA 5EDSA 2CHZA 3IBEA 4BX8A 4PS3A 5C1DA 4IN3B 4Y6CA 4KZ0A 1H2TC 5BW8C 2IQCA 2NSZA 3QWVA 3HHMA 4GA2A 3MGBA 4HXIA 4FHKA 4KBQA 4Q96A 4FADA 2AWIA 2BUGA 5DBKA 3SD5A 3MCXA 3U9WA 1FVHA 2WXGA 4NACA 2VTBA 4XKBA 4GB9A 4RG9A 4BFRA 4UI9K 1QQEA 4UWHA 3S7DA 2VGXB 3AU4A 2MHKA 3TXMA 4ACKA 1LF8A 3N71A 4HOQA 3ZXSA 2WXQA 4NQ0A 1E7VA 4I9EA 1Z3YA 3CEQA 2L6JA 2A5UA 4U0UA 3TG5A 2XEVA 4GA1A 4NRHB 1H19A 3PNTB 4J8SA 1HFAA 3LJ3A 3FULA 5FQ6A 3LDZA 1NA3A 3L13A 4AP2A 2FEZA 3PE3A 3CK9A 3PRZA 3ESKA 4XZ4A 1ELKA 4ILGA 5E75A 3ASDA 3KS2A 3U4TA 2V8SE 4E85A 2WQ7A 4XE0A 3FTXA 2GW1A 3CK8A 3I5PA 3QK0A 4TRQA 3S7FA 4GZCA 4GZ6A 4CDMA 4AY6A 4GYOA 2PQNA 4U0SA 4HOTA 3L22A 4GAAA 3TAXA 4LRZA 2KCVA 3B13A 3FEYA 1N52A 4HFGA 4CCAA 4EZKA 5CCLA 3FTVA 1TEZA 1HE8A 2DBAA 4CRWA 2XPYA 2C0LA 4JVSA 2CHWA 2WPVA 2BF0X 3PH0C 3PDNA 1Z6TA 3ASGA 4FU3A 2HYZA 2ONDA 3MKRA 3VLFA 2RD0A 2X6HA 5CHEE 1EDUA 3ZYQA 4C0MA 3UQ3A 2IFUA 3ZYMA 4XI0A 1W3BA 4IULA 2L0TB 3EHNA 4ME2A 1HZ4A 3U64A 4RSYA 1H0AA 5DIZA 2OVBA 3URZA 2VSYA 4I1AA 2LNIA 3NZSA 3PE4A 3GZ1A 5BV1A 3GW4A 3QJZA 1TJFA 4NURA 5BNWA 1U3DA 4I43A 4JHKA 3T5XA 3FU3A 3NQPA 1EPUA 4FC8A 1FVFA 2DCPA 2VSNA 1OUVA 5HI7A 3PVLA 4GZDA 2PM6A 4PS7A 2NC9A 5CMYA 4EECA 2J07A 3ZYLA 4ANXA 2VJ8A 1UN9A 3D9IA 2CG2A 4J0UA 5A7DB 3SBSA 1OWLA 4KVMA 1S0PA 4N39A 1HX8A 4FHJA 3FH7A 1NZNA 2IOLA 1E8YA 1SQMA 4A3VA 5BUZA 4URKA 5J08A 3CVXA 5LX8A 3NF1A 3CHOA 3CKBA 1ZU2A 2V4LA 2WMOA 3LY7A 4CDNA 1ELRA 4GA0A 4B94A 5A6CA 1QZ2A 4WWOA 4XI9A 3OXGA 4ANVA 5BV0A 3D9NA 3JQ0A 4AXHA 1Y6IA 2VSXE 2CHXA 1X5BA 4DLQA 2C0MA 3FH8A 4G25A 3CGHA 4L2YA 3EDTB 4MKTA 3SBTB 1NA0A 3BEEA 2Q7FA 2XHEA 1XNFA 4CT4A 4R7LA 5ANRA 4IRUA 5LCWC 3B7UX 1BPOA 3T8MA 3HYMB 3WXXA 3G2TA 1E8ZA 1FCHA 3MJWA 3MV2B 4EZJA 4UI9C 2C2LA 3R7QA 3S7BA 3OXLA 3Q15A 3ML9A 3UT7A 4ANWA 4WUYA 3EJNA 4DI4A 4L1BA 4D10C 2I9CA 4A3TA 4J8EA 3RRUA 4YVQC 2J9QA 3FFLA 1OWOA 3FUIA 1MQSA 4PUCA 3KAEA 5G04J 2X3MA 2NXPA 4G1TA 4I9CA 4U0ZA 4UWGA 1VDYA 2LO6A 4CDRA 4G23A 2IJGX 3CQGB 3PZDA 4FP7A 1UN8A 1E90A 5JJTA 3ONLA 5G05J 4JW1A 2X6IA 4M3OA 4UWFA 4BTAA 2QY7A 4GZ3A 3ENEA 3IV0A 3HIZA 3DPDA 4O6FA 5JHBA 1IQUA 1EYHA 1N54A 2JEKA 1XGWA 4LCTA 5KCMA 3VLDA 3FTWA 2KZTB 3Q5MA 4L2LA 4WNDA 5KJLA 3CVVA 2KC7A 1KT1A 4UQXA 4WNEA 2FULA 4PH4B 1SZAA 3SZ7A 1WM5A 2VGXA 3G2WA 3O4ZA 3HDXA 4KT6B 2FBNA 3CSTA 2HR2A 3SF4A 4GMLA 4TUUA 2CG3A 4N3AA 4OVVA 4JEUA 3D9MA 1UJJA 2RG8A 3GZSA 4FLHA 4JC8A 5ENNA 2KZTA 3VTXA 4A1SA 1DVPA 2IOSA 2WXHA 4H7XA 2XGMA 5LFAA 3L17A 3CKCA 2AXVA 5A23A 1P5QA 3ZRHA 1IHGA 2UY1A 3CQCB 4P29A 2Y3AA 1ELWA 1KT0A 3FUJA 4PS8A 2IONA 3ZEFA 3P1UA 5FQ8A 5AIJA 2YQ8A 2YNQA 3ZFWA 4EBAA 3LCAA 1H2UA 5HQ8A 3QC1A 2FF4A 2YHEA 2V5FA 3FU5A 4YNDA 1ZBPA 2X38A 3D9KA 3HVEB 3FUMA 5EX0A 1E96B 1JUQA 1IYGA 2WM9A 3R9AB 3UUXA 2WQ6A 3AU5A 2VYIA 1WY6A 2YHCA 5KJMA 5LP0A 1KLXA 2GGFA 3QB2A 3FUDA 1JWGA 3B7TA 3Q47B 5ARFA 3FP3A 3TGOA 4AV7A 2L9BA 2LSUA 4DK5A 4G11A 5FZRA 1INZA 3RJVA 4FLBA 3Q49B 3MV3B 4G26A 3MEKA 3CHPA 5D0OD 1YA0A 4WNGA 3QWPA 3FTYA 2EQXA 2OOEA 2X6KA 4BSXA 4HVBA 2V0PA 3LXUX 4H7YA 4I2ZA 2WXJA 4DJAA 4N5CA 4BX9A 4JXTA 3L16A 5CMWA 4WWNA 3OXFA 2J09A 4A55A 1E7UA 3E4BA 4BWRA 2LSVA 3ZYKA 4XKCA 4FULA 4I1OB 1OWPA 3O48A 5FTPA 3UT4A 4GPKA 2XRZA 3P2BA 4OVUA 4F1SA 3ZVVA 4GCOA 2AVPA 1OWMA 3MX3A 3OTNA 2VQ2A 3QNKA 4Q94A 2I1KA 2Y4UA 3UT8A 4GMJA 2IF4A 2XPZA 3D9LA 4J6IA 4GZ5A 3RIBA 3T5VA 3PEUB 5JHAA 4KZCA 3EIJA 3IHYA 5KJNA 5T3RA 2XGSA 4UWLA 2UY1B 2LAHA 3QDNA 4Y6WA 4B8AA 2JLBA 5EX3A 1HG5A 3FUKA 3QOUA 4MS6A 5JJ7A 5FQ4A 4CT0A 1HU3A 3MZLB 4UI9J 2VTBB 1U3CA 4F53A 3FWVA 4AIFA 2AW6A 5G05C 2VGYA 5EKQD 1HXIA 2AXUA 2WVIA 3RO3A 3QAQA 2ILRA 2WXLA 4I6GA 3BG1B 3UMVA 2PL2A 3ULQA 5ARGA 1DNPA 2BTDA 4CGVA 5AJLA 2VSOE 4GCNA 2MOWA 5FZSA 4BT8A 3FU6A 1WAO1 5BT1A 4XIFA 4ABNA 4A1GA 2HM8A 2UWJG 2WXKA 2YINA 4U63A 4C0EA 3CVPA 2WXMA 3RU0A 2PM7A 5G55A 3FUEA 3FTUA 5J90A 4I2WA 1JWFA 1H2VC 3ONKA 3CSFA 3UX4A 5E76A 4HORA 3SFZA 1HH8A 5FQ7A 4JHRA 3PEVB 5LCWJ 4UQZA 2E0IA 4JA7A 5FJYA 3LY8A 2J49A 4JHJA 5BPPA 3FUHA 3U66A 3PREA 2LAIA 4AM9A 5AJDA 1MHQA 2PZIA 4B89A 4WNFA 3CLJA 2OV8A 3VLEA 3R7RA 3APCA 3U3WA 5ANLA 2XCBA 4JL0A 3EIQC 3G2VA 4I6EA 3S2AA 2E2EA 1HO8A 3JUIA 3CVNA 3AS8A 4N2QA 4FJYA 4BT9A 1GW6A 1L5JA 3I3NA 3L6AA 2WB2A 4ANUA 3CVYA 4ILIA 2WXOA 3AS5A 4AVXA 4C9BB 3APFA 3JQ1A 3JYSA 4OYSA 3CVUA 3D9JA 4EQFA 2AXZA 2R59A 4N3CA 2DIWA 3FEXA 5AENA 4B0ZA 2J4DA 5M72A 3FTSA 5T4YA 4XX5A 3IEGA 2WXIA 3CHMA 3B7SA 4ACLA 3ASHA 3K9IA 3ML8A 4L23A 5AYWD 3RO2A 3APDA 3LVRE 3D9OA 4BY6A 1QNFA 2XRYA 4APFA 2OVFA 5FZQA 1JPLA 2KM4A 4TV3A 5CCMA 1UJKA 4BTBA 2I2OA 3CVLA 5C2YA 2CFUA 3L54A 1HF8A 1UW4B 3LS8A 3TXNA 3B7RL 4U07A 4UWKA 3D3MA 4LEUA 3ZHEA 5JJ6A 2XGOA 3LEWA 2ZU6B 3CIAA 1Y8MA 2PQRA 4KYOB 4DI3A 2J4BA 3L08A 2GRMA 3G2UA 2XPIA 4KXKB 1HG2A 1PC2A 4JEHA 3C98A 2CFZA 4J8DA 3IHVA 3TG4A 5FT9A 4W9RA 3I4RB 4GYWA 5LOZA 4RVBA 3ESLA 4EBAG 4E6HA 1PAQA 2M63A 1UG3A 3ZW3A 3HVEA 3PUJA 4B8CB 3FTZA 4APOA 2FI7A 4F7AA 2J08A 1B89A 3JCKC 4Q69A 4KVOA 3I4GA 4JZYA 4PDXA 4AY5A 4FJZA 4J8FA 2KCKA 2XQ0A 2QFCA 4RG6A 5FWQA 3OAWA 1H6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNE A;  5ARG A;  3ULQ A;  2WQH A;  2PQN A;  4GYO A;  3KD7 A;  4U0S A;  1WM5 A;  2VGX A;  5D0Q D;  3SZ7 A;  4CGV A;  4CGW A;  3RKV A;  3TAX A;  2FBN A;  4GCN A;  2KCV A;  2HR2 A;  5FZS A;  2R5S A;  3SF4 A;  4BT8 A;  1WAO 1;  4UQX A;  5BT1 A;  5CCL A;  4N3A A;  4XIF A;  3Q4A B;  4ABN A;  2DBA A;  3ASF A;  3ZN3 A;  2UWJ G;  2C0L A;  3VTX A;  2WPV A;  4A1S A;  3PDN A;  3CVP A;  3ASG A;  2HYZ A;  2OND A;  3MKR A;  4N3B A;  3RU0 A;  5CHE E;  3UQ3 A;  2IFU A;  4XI0 A;  1W3B A;  4H7X A;  2XGM A;  3GYZ A;  4I2W A;  3CKC A;  4ME2 A;  1HZ4 A;  1P5Q A;  2I6H A;  5DIZ A;  4HOR A;  2XCC A;  1HH8 A;  1IHG A;  2UY1 A;  3URZ A;  4JHR A;  5LCW J;  2VSY A;  4I1A A;  2LNI A;  2P58 C;  3LKU A;  3GZ1 A;  3PE4 A;  1ELW A;  4G2V A;  1KT0 A;  3GW4 A;  4UQZ A;  4JA7 A;  3LYA A;  5FJY A;  3LY8 A;  4HOU A;  5G04 C;  5BNW A;  2YQ8 A;  1TJC A;  3ZFW A;  3LCA A;  4AM9 A;  3CK7 A;  2PZI A;  4JA9 A;  5HQ8 A;  1A17 A;  2FF4 A;  2VSN A;  2V5F A;  3LPZ A;  1OUV A;  2Y4T A;  4YND A;  5HI7 A;  3ZGQ A;  1ZBP A;  4WNF A;  3S7J A;  4I17 A;  4HOS A;  2NC9 A;  3VTY A;  3ZHE B;  3QWW A;  5EX0 A;  1E96 B;  3U3W A;  1IYG A;  2XCB A;  2KCL A;  4JL0 A;  4G24 A;  3R9A B;  3UUX A;  4J0U A;  5A7D B;  2VYI A;  2YHC A;  2E2E A;  5KJM A;  3TGO A;  3CVN A;  4U04 A;  4N2S A;  1KLX A;  4N39 A;  2HO1 A;  3AS8 A;  4N2Q A;  1NZN A;  4BT9 A;  3Q47 B;  3NF1 A;  3AS5 A;  3CKB A;  1ZU2 A;  2KAT A;  5ARF A;  3JYS A;  3LY7 A;  3FP3 A;  1ELR A;  2FO7 A;  3QKY A;  4GA0 A;  4B94 A;  2LSU A;  1QZ2 A;  4XI9 A;  4EQF A;  3OXG A;  5A6C A;  3UPV A;  4N3C A;  5FZR A;  3RJV A;  4YVO A;  5KJL A;  3Q49 B;  3MV3 B;  4G26 A;  3MEK A;  5M72 A;  4GYY A;  5D0O D;  3GZ2 A;  3IEG A;  1YA0 A;  4WNG A;  2C0M A;  3ZPJ A;  3QWP A;  4G25 A;  3ASH A;  3K9I A;  2OOE A;  4UQY A;  3EDT B;  5AYW D;  3RO2 A;  3CV0 A;  3LY9 A;  1NA0 A;  3BEE A;  2Q7F A;  4H7Y A;  4I2Z A;  3CVQ A;  4F3V A;  1XNF A;  4N5C A;  3AS4 A;  5FZQ A;  3TG5 A;  3OXF A;  3MA5 A;  5LCW C;  3E4B A;  3WXX A;  5CCM A;  3HYM B;  4BWR A;  2LSV A;  5KJK A;  1FCH A;  4BTB A;  3CVL A;  3MV2 B;  4HOT A;  4UI9 C;  2C2L A;  3O48 A;  5FTP A;  3OXL A;  3Q15 A;  3S7B A;  4GPK A;  5C1D A;  4IN3 B;  4U07 A;  4WUY A;  4Y6C A;  5BW8 C;  4LEU A;  3ZHE A;  3QWV A;  4GA2 A;  5JJ6 A;  2XGO A;  2AVP A;  4GCO A;  4KBQ A;  2VQ2 A;  1Y8M A;  2PQR A;  4J8E A;  4KYO B;  2BUG A;  5DBK A;  4YVQ C;  2J9Q A;  3FFL A;  2Y4U A;  2XPI A;  4KXK B;  1PC2 A;  2IF4 A;  4J8D A;  3KAE A;  4RG9 A;  5G04 J;  3TG4 A;  4GZ5 A;  1QQE A;  4UI9 K;  5FT9 A;  3RIB A;  2VGX B;  4W9R A;  4G1T A;  4I9C A;  4U0Z A;  3S7D A;  2MHK A;  2XGS A;  4GYW A;  3N71 A;  4CDR A;  4G23 A;  4HOQ A;  5KJN A;  2UY1 B;  4I9E A;  4NQ0 A;  4U0U A;  3CEQ A;  2L6J A;  3QDN A;  4Y6W A;  2JLB A;  2XEV A;  4GA1 A;  4NRH B;  5EX3 A;  3QOU A;  5JJT A;  4AY6 A;  5JJ7 A;  5G05 J;  4APO A;  2FI7 A;  4UI9 J;  4BTA A;  1NA3 A;  2FEZ A;  3PE3 A;  3FWV A;  1B89 A;  3CK9 A;  4GZ3 A;  3ESK A;  4O6F A;  4AIF A;  5G05 C;  2VGY A;  3ASD A;  3KS2 A;  5EKQ D;  1HXI A;  3U4T A;  3RO3 A;  4AY5 A;  2GW1 A;  3CK8 A;  4J8F A;  3S7F A;  2KCK A;  4RG6 A;  2QFC A;  3Q5M A;  4GZ6 A;  4WND A;  2PL2 A;  2KC7 A;  1KT1 A; 
#chains in the Genus database with same CATH topology
 5G2N A;  3RKV A;  3NZU A;  3DST A;  4EPZ A;  4V3I A;  3V30 A;  3RRN B;  2J8S D;  1V54 E;  3ASF A;  4MRU A;  3HXC A;  3IKO B;  4DPR A;  4AEZ C;  2I6H A;  2XCC A;  4K0R A;  5AQB A;  2P58 C;  4HOU A;  4ATG A;  3Q7A A;  3B95 A;  2KBX A;  1TNY A;  3LPZ A;  3TJP A;  3V2O A;  3FUN A;  4KMO A;  3DWL G;  4IYP A;  3TL5 A;  4U04 A;  4GTM A;  4JPS A;  4I6J A;  3TWV A;  2P9U G;  4YVO A;  3SI5 A;  3CVW A;  3PS6 A;  2GRL A;  2RFM A;  3ZNG A;  3CV0 A;  2WXR A;  4F3V A;  1O1R A;  4HS2 A;  1N0Q A;  5T8I A;  3QAR A;  5ENO D;  4QQI A;  4AOF A;  3FH5 A;  4TUM A;  5EDS A;  2CHZ A;  4PS3 A;  3HXF A;  4IN3 B;  2IQC A;  2LXL A;  3MGB A;  1UOH A;  3U9W A;  2VTB A;  4YDY A;  4UI9 K;  4UWH A;  2VGX B;  3EHR A;  2H6G A;  4HOQ A;  4I9E A;  4U0U A;  3CEQ A;  2P9I G;  5FQ6 A;  3FUL A;  3LDZ A;  5BXU A;  2FEZ A;  3PRZ A;  4XZ4 A;  2JAB A;  3TWQ A;  3U4T A;  2V8S E;  4XE0 A;  2GW1 A;  4YDO A;  4GYO A;  2PQN A;  1SW6 A;  3B13 A;  2DZN A;  4CRW A;  1MX2 A;  1TYQ G;  2OND A;  2RD0 A;  2X6H A;  3UQ3 A;  2IFU A;  3ZYM A;  2L0T B;  4ME2 A;  5DIZ A;  2VSY A;  3E34 A;  4I43 A;  3NQP A;  4FC8 A;  2EIM E;  2DCP A;  5HI7 A;  5CMY A;  4PS7 A;  2NC9 A;  4EEC A;  2J07 A;  1ZB1 A;  4ANX A;  3D9I A;  2CG2 A;  4J0U A;  5A7D B;  5D66 A;  2XZD G;  3CVX A;  3AG1 E;  3CHO A;  1QZ2 A;  2F8Y A;  1Y6I A;  4DLQ A;  3CGH A;  4MKT A;  1WDY A;  3E30 A;  3DPY A;  4R7L A;  4CT4 A;  3F6Q A;  5LCW C;  3B7U X;  3MV2 B;  4UI9 C;  3R7Q A;  3UIN C;  2DZO A;  3EJN A;  4UUC A;  4DI4 A;  4J8E A;  2QC9 A;  3FFL A;  1TN8 A;  3KAE A;  1MJ0 A;  4G1T A;  4UWG A;  3EU5 A;  3CQG B;  4FP7 A;  2QY7 A;  4O1O A;  4O6F A;  1XGW A;  2KZT B;  5JA4 D;  4L2L A;  5KJL A;  3CVV A;  1KT1 A;  4UQX A;  1A5E A;  2FUL A;  1FT2 A;  3C72 A;  1WM5 A;  2VGX A;  3HDX A;  5HKP A;  4GML A;  3TWS A;  1N11 A;  3VTX A;  3ZU7 B;  2WXH A;  3AG4 E;  2OCC E;  2ION A;  5FQ8 A;  3RAU A;  2F8X K;  2YQ8 A;  4EBA A;  5HQ8 A;  2V5F A;  3HVE B;  2YHC A;  5CBN A;  2RKK A;  1N4Q A;  3TGO A;  2AJA A;  2LSU A;  4DK5 A;  4G11 A;  5FZR A;  3ULY A;  3CHP A;  5D0O D;  3ABK E;  1YA0 A;  1MZC A;  4HVB A;  4H7Y A;  1Q2Z A;  4BX9 A;  2J09 A;  4A55 A;  4FUL A;  2XRZ A;  3MX3 A;  4GMJ A;  2IF4 A;  2PNN A;  5JHA A;  2XGS A;  3DEO A;  4UWL A;  2JLB A;  1BLX B;  4MS6 A;  3PZ4 A;  3RSE G;  5FQ4 A;  3ASO E;  1BI8 B;  4DX6 D;  4UI9 J;  4G8L A;  3FWV A;  5AN8 A;  3RO3 A;  3SY2 A;  1D8E A;  3QAQ A;  3BG1 B;  3SFY A;  2GRQ B;  5ARG A;  2BTD A;  2VSO E;  4GCN A;  2MOW A;  3FU6 A;  1WAO 1;  5BT1 A;  4XIF A;  4A1G A;  3DSV A;  2YIN A;  4C0E A;  3RU0 A;  5G55 A;  4K5C A;  5CEA A;  3ONK A;  2XEH A;  4JHR A;  3U66 A;  4AM9 A;  2PZI A;  3ZUV B;  4B89 A;  3APC A;  5ANL A;  2B6C A;  3DSW A;  2E2E A;  1HO8 A;  3JUI A;  5EN5 D;  3TWW A;  2IEJ A;  4BT9 A;  2WB2 A;  4ANU A;  2IO2 C;  2ETA A;  4OYS A;  4ZHB A;  4N3C A;  1DCE A;  3FEX A;  2BKK B;  3R9M A;  4B0Z A;  5M72 A;  5CRV A;  3SO8 A;  5AYW D;  2GRP B;  2NYJ A;  1SVX A;  2XEE A;  2XS8 A;  2OVF A;  1JPL A;  3UTM A;  2KM4 A;  1WG0 A;  5B1A E;  2R2L A;  2ETB A;  3TXN A;  3B7R L;  4U07 A;  4UWK A;  3LEW A;  3UKU G;  2R05 A;  4DI3 A;  3J5P A;  1PC2 A;  4JEH A;  2CFZ A;  3IHV A;  4W9R A;  3C3R A;  4O1P A;  4EBA G;  3KEA A;  4APO A;  1B89 A;  5AQ9 A;  4J8F A;  2DYS E;  2XQ0 A;  3OAW A;  3JXJ A;  3KD7 A;  1EF1 C;  2VGE A;  2R5S A;  4HLL A;  2X6J A;  3ZN3 A;  4DLO A;  3FY4 A;  3L82 A;  2X6F A;  4N3B A;  2WMN A;  3SGH A;  4GMR A;  3GYZ A;  3DBS A;  3LKU A;  4G2V A;  2L0I A;  5G04 C;  1TJC A;  4JA9 A;  3PUK A;  3ZHE B;  4G24 A;  3V2X A;  4K5B A;  4GU5 A;  3BG0 B;  2WXN A;  4DRX E;  2FO7 A;  2WXF A;  1RW2 A;  3GZ2 A;  3FU0 A;  4UQY A;  5KWD A;  3PNL B;  3LY9 A;  1PY1 A;  3CVQ A;  2MRI A;  2IO3 C;  3EHM A;  5KJK A;  4C48 B;  3FUF A;  5C1D A;  4Y6C A;  4KZ0 A;  5BW8 C;  1O5M A;  4TXR A;  4GA2 A;  4FAD A;  2BUG A;  1FVH A;  4NAC A;  4HRL A;  4BFR A;  1QQE A;  3S7D A;  2MHK A;  4ACK A;  3N71 A;  1Z3Y A;  2A5U A;  2XEV A;  4NRH B;  2ZIS A;  1H19 A;  3Q9N C;  5CED B;  3Q73 A;  3PE3 A;  3ULE G;  5E75 A;  4ILG A;  4LNG A;  3ASD A;  4E85 A;  4HI8 A;  4TRQ A;  1JCS A;  3L9T A;  4HOT A;  3L22 A;  4LRZ A;  3FEY A;  4CCA A;  3Q9U C;  3FTV A;  1DCQ A;  5ENQ D;  2CHW A;  2WPV A;  3PDN A;  5ENR D;  2H6I A;  2R03 A;  3EHN A;  2DWZ A;  1H0A A;  2OVB A;  3URZ A;  4I1A A;  3NZS A;  3TWU A;  5BV1 A;  3UM1 A;  3QJZ A;  4JHK A;  1FVF A;  2VSN A;  1OUV A;  1KPS B;  3ZYL A;  2VJ8 A;  4N39 A;  2IOL A;  3E37 A;  5LX8 A;  3ZXP A;  2WMO A;  3LY7 A;  4GA0 A;  3ASN E;  4WWO A;  3OXG A;  5BV0 A;  2EIK E;  4GTT A;  2C0M A;  3FH8 A;  3DSS A;  3SBT B;  1BPO A;  3T8M A;  1E8Z A;  3MJW A;  4EZJ A;  5HRY A;  4ANW A;  4WUY A;  4A3T A;  3RRU A;  4PUC A;  1OWO A;  3FUI A;  4F1P A;  5G04 J;  2IJG X;  5JJT A;  1E90 A;  4CYM D;  4XEI G;  5G05 J;  4JW1 A;  2DYR E;  2XEN A;  4M3O A;  1TNZ A;  2P9S G;  4DUI A;  1EYH A;  2JEK A;  3FTW A;  3Q5M A;  3JUE A;  2EIL E;  2KC7 A;  3G2W A;  3O4Z A;  4KT6 B;  4TXP A;  4OVV A;  4JEU A;  1UJJ A;  2RG8 A;  4FLH A;  4JC8 A;  1DVP A;  2IOS A;  4H7X A;  3L17 A;  5CEC B;  5A23 A;  3W9F A;  3DXK G;  2Y3A A;  1ELW A;  1G3N B;  2YNQ A;  3FU5 A;  2YHE A;  4YND A;  3D9K A;  1JUQ A;  2WM9 A;  3R9A B;  2WQ6 A;  1N0R A;  1H6O A;  3FUD A;  2L6B A;  1JWG A;  3B7T A;  4YDE A;  3Q47 B;  3PZ1 A;  3ZKJ A;  1INZ A;  2P9L G;  2H6H A;  3Q49 B;  1X81 A;  1AP7 A;  2DVW A;  3FTY A;  2EQX A;  1OWP A;  5BXO A;  5CBO A;  3UT4 A;  4GPK A;  3OTN A;  2VQ2 A;  3QNK A;  1K8K G;  2Y4U A;  3UT8 A;  2KXP C;  3UXG A;  3RIB A;  3QDN A;  2QYJ A;  5EX3 A;  3MZL B;  2VTB B;  4BER A;  5EKQ D;  2AXU A;  4I6G A;  3UMV A;  3ULQ A;  1DNP A;  1LD7 A;  4LNU D;  2HM8 A;  3Q75 A;  2QYU A;  5E76 A;  4HOR A;  1BI7 B;  1HH8 A;  3PEV B;  4JA7 A;  5FJY A;  3T9K A;  4WNF A;  1D8D A;  2OV8 A;  3VLE A;  4YDW A;  3U3W A;  4JL0 A;  4BSZ B;  4L9P A;  3G2V A;  3CVN A;  2LUH A;  3AS8 A;  4ILI A;  3AS5 A;  4N5Q A;  4C9B B;  3APF A;  3CVU A;  4EQF A;  2AXZ A;  1YYH A;  3TWX A;  3FTS A;  4ACL A;  1LD8 A;  3ASH A;  3K9I A;  3D9O A;  2XRY A;  5FZQ A;  4A63 B;  5B1B E;  5CER B;  4G8K A;  2P2C P;  4BTB A;  3CVL A;  3L54 A;  1HF8 A;  3LS8 A;  3D3M A;  4LEU A;  2ZU6 B;  4KYO B;  3JXI A;  1HG2 A;  3C98 A;  4GYW A;  5LOZ A;  2XZT G;  4RVB A;  4E6H A;  1U2V G;  1PAQ A;  1UG3 A;  3ZW3 A;  3PUJ A;  3FTZ A;  1OCC E;  3JCK C;  1FT1 A;  4Q69 A;  2ZXW E;  1N94 A;  4JZY A;  4PDX A;  4AY5 A;  4FJZ A;  2WQH A;  4L7T A;  3Q78 A;  4CEM A;  4EHM A;  3EU9 A;  1H6P A;  4K03 A;  3MKQ B;  1K1A A;  1E8W A;  4HLE A;  3KEZ A;  4I17 A;  4LUN U;  3VTY A;  3QWW A;  4ZFH A;  4MLP A;  4N2S A;  1NP7 A;  3FHE A;  2HO1 A;  3LJN A;  3LVQ E;  2KAT A;  3Q79 A;  3QKY A;  3RRM B;  4O60 A;  1OT8 A;  1OWN A;  3C3O A;  3SHF A;  2MYO A;  4OAV B;  3HG0 D;  3AS4 A;  3MA5 A;  4WAF A;  1N4P A;  3T8K A;  3IBE A;  1JCR A;  1H2T C;  2NSZ A;  3QWV A;  3HHM A;  4KBQ A;  3UIO C;  1O1S A;  2AWI A;  5DBK A;  5AAR A;  3MCX A;  3SD5 A;  2WXG A;  4XKB A;  2GRN B;  1NL4 A;  3AU4 A;  3TXM A;  3ZXS A;  2WXQ A;  4NQ0 A;  2L6J A;  4GA1 A;  3PNT B;  4LNB A;  3LJ3 A;  1NA3 A;  4AP2 A;  3KS2 A;  3FTX A;  3S7F A;  3QK0 A;  4GZ6 A;  4U0S A;  3ABM E;  3TAX A;  2KCV A;  5EIL A;  4HFG A;  4EZK A;  2P9K G;  2A5E A;  1TEZ A;  1HE8 A;  4MBG A;  5JMN D;  2HYZ A;  3MKR A;  2GRO B;  4U95 D;  4C0M A;  5CHE E;  1W3B A;  4IUL A;  3U64 A;  4GTQ A;  2Y1L E;  4NUR A;  5BNW A;  2P9N G;  3UKR G;  3FU3 A;  1EPU A;  5ENT D;  3PVL A;  4GZD A;  2PM6 A;  3X2Q E;  1UN9 A;  1OXJ A;  1OWL A;  4FHJ A;  3FH7 A;  1NZN A;  4RLY A;  4A3V A;  1SQM A;  3C3Q A;  3NF1 A;  4B94 A;  5A6C A;  4XI9 A;  4ANV A;  3JQ0 A;  4AXH A;  3DSU A;  2ETC A;  1TNU A;  4L2Y A;  3EDT B;  1NA0 A;  2V4H C;  2B0O E;  2XHE A;  3BEE A;  1XNF A;  4IRU A;  4U96 D;  3WXX A;  1Z5S C;  3G2T A;  5FIO A;  1FCH A;  2XS1 A;  3S7B A;  3Q15 A;  4L1B A;  4D10 C;  2I9C A;  3NB2 A;  4YVQ C;  2J9Q A;  2F37 A;  2NXP A;  4I9C A;  2LO6 A;  4CDR A;  3ISM C;  4G23 A;  1S64 A;  3PZD A;  1TN7 A;  1QBQ A;  1UN8 A;  1AWC B;  2X6I A;  4UWF A;  3NOG D;  4BTA A;  3ENE A;  3IV0 A;  3HIZ A;  1FPP A;  3Q7F A;  4LCT A;  5KCM A;  4WND A;  4WNE A;  3SZ7 A;  1NFI E;  3CST A;  5IY5 E;  4TUU A;  2CG3 A;  1K3Z D;  3D9M A;  4J8Y A;  5ENN A;  2KZT A;  4A1S A;  2BKG A;  1SA5 A;  2XGM A;  5LFA A;  2AXV A;  4GTO A;  1P5Q A;  1IHG A;  3CQC B;  1KT0 A;  3P1U A;  5AIJ A;  1YMP A;  3ZFW A;  1H2U A;  1OCR E;  2FF4 A;  1S70 B;  2ZGD A;  1ZBP A;  2X38 A;  5KBA A;  1E96 B;  3UUX A;  3AU5 A;  2VYI A;  1WY6 A;  5LP0 A;  4GTS A;  4U7E B;  2GGF A;  5ARF A;  1DC2 A;  4FLB A;  3TWT A;  3MV3 B;  1IXV A;  3AAA C;  4OAU C;  3W9G A;  4TXQ A;  4BSX A;  3LXU X;  4I2Z A;  4N5C A;  4JXT A;  4WWN A;  3OXF A;  4BWR A;  3O48 A;  3J5Q B;  5FTP A;  1D9S A;  3P2B A;  4OVU A;  4HNA D;  4GCO A;  1OWM A;  2I1K A;  3D9L A;  4J6I A;  4GZ5 A;  3PEU B;  3EIJ A;  5T3R A;  2LAH A;  4B8A A;  4Y6W A;  5JJ7 A;  4K5A B;  1HU3 A;  1TNB A;  1U3C A;  4AIF A;  2AW6 A;  3PZ2 A;  5G05 C;  2WVI A;  1KZO A;  1N4R A;  3V31 A;  5AJL A;  5FZS A;  4BT8 A;  5CRU A;  2WXK A;  2Y0B G;  4GPM A;  4I2W A;  1JWF A;  1MX4 A;  3CSF A;  3UX4 A;  5FQ7 A;  5EIB E;  4F6R D;  1N95 A;  3BU8 A;  4UQZ A;  2Y69 E;  3FUH A;  3PRE A;  2LAI A;  1MHQ A;  5H7P A;  3SQV A;  2XCB A;  3EIQ C;  3S2A A;  2FO1 E;  4N2Q A;  4FJY A;  3L6A A;  1O1T A;  2WXO A;  4BEP A;  2DIW A;  2OEV A;  5AEN A;  2J4D A;  3UM2 A;  5T4Y A;  4XX5 A;  2P9P G;  2WXI A;  3CHM A;  1KZP A;  3HRA A;  3HXB A;  3RO2 A;  3APD A;  3LVR E;  4NIK A;  1JCQ A;  1QNF A;  4TV3 A;  5CCM A;  1UJK A;  1BD8 A;  1TNO A;  3WG7 E;  5C2Y A;  1UW4 B;  3ZHE A;  5JJ6 A;  2J4B A;  3L08 A;  2GRM A;  3G2U A;  4Z68 A;  1BU9 A;  4J8D A;  3TG4 A;  1OCZ E;  3ESL A;  5EYL A;  3B7B A;  4B8C B;  4BES A;  2J08 A;  4KVO A;  2QFC A;  1LTX A;  1IQR A;  4CGW A;  5D0Q D;  1Z3X A;  4FA6 A;  3Q4A B;  1TR4 A;  2I1J A;  2WXP A;  4AJW A;  2IU1 A;  4I1M A;  1SZ9 A;  3G2S A;  3UM0 A;  3UI2 A;  3LYA A;  4GTV A;  3ZIM A;  4WWP A;  3SNX A;  1E8X A;  4QFV A;  1HS6 A;  3CK7 A;  5ENS D;  3RK6 A;  2EIJ E;  1A17 A;  3ZGQ A;  4EZL A;  2R17 C;  2Y4T A;  3E33 A;  4LG6 A;  4HOS A;  3S7J A;  3CHR A;  2KCL A;  3CHQ A;  3MYV A;  4ILH B;  1N9A A;  5KNH D;  4U8H A;  3CHS A;  3D9P A;  4HBD A;  1OCO E;  3UPV A;  4DX2 A;  3MKQ A;  2A4Z A;  4GYY A;  3ZPJ A;  3CR3 A;  4HRN A;  3D9H A;  3FDH A;  4LER A;  2BED A;  4BX8 A;  2RFA A;  4HXI A;  4FHK A;  4HI9 A;  4Q96 A;  3AG3 E;  4GB9 A;  4RG9 A;  4GTP A;  1LF8 A;  1N4S A;  1E7V A;  3DSX A;  3TG5 A;  1MX6 A;  5AQ7 A;  5EID A;  4J8S A;  1HFA A;  3L13 A;  3AG2 E;  3CK9 A;  3ESK A;  1ELK A;  1OY3 D;  2WQ7 A;  3CK8 A;  3I5P A;  4GZC A;  4CDM A;  4AY6 A;  4GAA A;  1N52 A;  2GRR B;  5CCL A;  2DBA A;  4U8V D;  2XPY A;  2C0L A;  4JVS A;  3IXE A;  2BF0 X;  3PH0 C;  1Z6T A;  1QYM A;  3ASG A;  4FU3 A;  3ZYQ A;  3VLF A;  1EDU A;  2F0Y A;  4XI0 A;  5AAO A;  1HZ4 A;  2V5Q C;  4RSY A;  3NOC D;  2LNI A;  3PE4 A;  3GZ1 A;  3GW4 A;  1TJF A;  1U3D A;  3T5X A;  1V55 E;  3HXD A;  3SBS A;  4KVM A;  1NI1 A;  1S0P A;  1HX8 A;  4GTR A;  5BUZ A;  4URK A;  1E8Y A;  3E32 A;  5J08 A;  3CKB A;  1ZU2 A;  2V4L A;  1IKN D;  4CDN A;  1ELR A;  1YCS B;  3D9N A;  2VSX E;  2CHX A;  1X5B A;  2H6F A;  4JB8 P;  4G25 A;  4HRM B;  2Q7F A;  5ANR A;  3HYM B;  2C2L A;  3OXL A;  3ML9 A;  3UT7 A;  3HXE A;  2OEW A;  3KSQ A;  3ABL E;  2ZGG A;  1MQS A;  2X3M A;  4U0Z A;  1VDY A;  3ONL A;  4GZ3 A;  3DPD A;  5JHB A;  1IQU A;  1N54 A;  3AJI A;  3VLD A;  4HB5 A;  4PH4 B;  1SZA A;  2FBN A;  2HR2 A;  3SF4 A;  4N3A A;  3GZS A;  4JD2 G;  3NAW A;  3CKC A;  3ZRH A;  2UY1 A;  3NBN B;  4M7C A;  4P29 A;  5D2M C;  3FUJ A;  4PS8 A;  3ZEF A;  2HE0 A;  3LCA A;  3QC1 A;  3TWR A;  3FUM A;  5EX0 A;  1IYG A;  5KJM A;  1KLX A;  5EYP F;  3QB2 A;  4RQI A;  3FP3 A;  4AV7 A;  2L9B A;  3PZ3 A;  3DXM G;  3RJV A;  5ITZ F;  4G26 A;  2IY0 C;  3MEK A;  4WNG A;  3QWP A;  2OOE A;  2X6K A;  5AQA A;  2V0P A;  2WXJ A;  4DJA A;  3L16 A;  5CMW A;  1E7U A;  3E4B A;  1IHB A;  2LSV A;  3ZYK A;  4HQD A;  4XKC A;  4I1O B;  1MYO A;  3UIP C;  4F1S A;  3ZVV A;  2AVP A;  3EUV A;  4Q94 A;  2XPZ A;  3EHQ A;  3T5V A;  3BQO A;  3BUA A;  4KZC A;  3IHY A;  5KJN A;  2UY1 B;  1RZ4 A;  1HG5 A;  3FUK A;  3QOU A;  4CT0 A;  5B3S E;  4F53 A;  2VGY A;  4X8Q A;  3V79 K;  1HXI A;  3DRA A;  2ILR A;  2WXL A;  2PL2 A;  3KSL A;  4CGV A;  4ABN A;  2UWJ G;  4U63 A;  4DX7 D;  2WXM A;  3CVP A;  2PM7 A;  3FUE A;  3FTU A;  5J90 A;  1H2V C;  3UM3 A;  2QZA A;  3SFZ A;  5LCW J;  2E0I A;  3LY8 A;  2J49 A;  4JHJ A;  4DX5 D;  5BPP A;  5AJD A;  1SA4 A;  3DEP A;  2R02 A;  3CLJ A;  3R7R A;  4I6E A;  4B93 B;  2LXM A;  1S63 A;  1GW6 A;  1L5J A;  3I3N A;  2ZIR A;  4CZ2 D;  3CVY A;  4AVX A;  3JQ1 A;  3JYS A;  3D9J A;  4BET A;  2R59 A;  4DX1 A;  4LSZ E;  3IEG A;  3B7S A;  3ML8 A;  4L23 A;  1K1B A;  4BY6 A;  4APF A;  2I2O A;  5FIN A;  2CFU A;  2XGO A;  3CIA A;  1Y8M A;  2PQR A;  1TN6 A;  2XPI A;  3C5R A;  4KXK B;  4U8Y D;  5FT9 A;  3I4R B;  2M63 A;  5ENP D;  3HVE A;  4J7W A;  2FI7 A;  4F7A A;  5KNG A;  5HS0 A;  2EIN E;  4ATZ D;  3I4G A;  2KCK A;  4RG6 A;  3SFX A;  5FWQ A;  1H6K A; 
#chains in the Genus database with same CATH homology
 1IQR A;  2WQH A;  4CGW A;  3KD7 A;  5D0Q D;  5G2N A;  1EF1 C;  3RKV A;  1Z3X A;  3NZU A;  2R5S A;  4EPZ A;  4V3I A;  4FA6 A;  4L7T A;  2X6J A;  3RRN B;  3Q4A B;  3ASF A;  3ZN3 A;  4CEM A;  4DLO A;  2I1J A;  3FY4 A;  2X6F A;  2WXP A;  4N3B A;  2WMN A;  4MRU A;  4AJW A;  2IU1 A;  4I1M A;  3SGH A;  3IKO B;  3GYZ A;  4DPR A;  4AEZ C;  2I6H A;  1SZ9 A;  4K03 A;  3MKQ B;  2XCC A;  3G2S A;  3DBS A;  4K0R A;  2P58 C;  3LKU A;  4G2V A;  3LYA A;  2L0I A;  4HOU A;  3ZIM A;  5G04 C;  4WWP A;  3SNX A;  1E8X A;  4ATG A;  1TJC A;  4QFV A;  1E8W A;  1HS6 A;  3CK7 A;  4HLE A;  4JA9 A;  3RK6 A;  1A17 A;  3LPZ A;  3KEZ A;  3ZGQ A;  3PUK A;  2R17 C;  2Y4T A;  4EZL A;  3TJP A;  3S7J A;  4HOS A;  4I17 A;  4LUN U;  3VTY A;  3ZHE B;  3QWW A;  3FUN A;  4KMO A;  3CHR A;  2KCL A;  3CHQ A;  3MYV A;  4G24 A;  4ILH B;  4IYP A;  4MLP A;  3TL5 A;  1NP7 A;  4N2S A;  4U04 A;  3FHE A;  4GU5 A;  2HO1 A;  3LVQ E;  3BG0 B;  4U8H A;  3CHS A;  4JPS A;  2WXN A;  4I6J A;  2KAT A;  3D9P A;  2FO7 A;  3QKY A;  2WXF A;  3UPV A;  3RRM B;  4YVO A;  3SI5 A;  3CVW A;  3MKQ A;  1OWN A;  2A4Z A;  4GYY A;  3PS6 A;  3GZ2 A;  3FU0 A;  2GRL A;  3ZPJ A;  3CR3 A;  4UQY A;  3SHF A;  3CV0 A;  3PNL B;  3LY9 A;  1PY1 A;  2WXR A;  3CVQ A;  4HS2 A;  4F3V A;  3AS4 A;  2MRI A;  3MA5 A;  5T8I A;  3QAR A;  3FDH A;  3EHM A;  4WAF A;  4AOF A;  3FH5 A;  5KJK A;  4LER A;  3FUF A;  5EDS A;  2CHZ A;  3IBE A;  4BX8 A;  4PS3 A;  5C1D A;  4IN3 B;  4Y6C A;  4KZ0 A;  1H2T C;  5BW8 C;  2IQC A;  2NSZ A;  3QWV A;  3HHM A;  4GA2 A;  3MGB A;  4HXI A;  4FHK A;  4KBQ A;  4Q96 A;  4FAD A;  2AWI A;  2BUG A;  5DBK A;  3SD5 A;  3MCX A;  3U9W A;  1FVH A;  2WXG A;  4NAC A;  2VTB A;  4XKB A;  4GB9 A;  4RG9 A;  4BFR A;  4UI9 K;  1QQE A;  4UWH A;  3S7D A;  2VGX B;  3AU4 A;  2MHK A;  3TXM A;  4ACK A;  1LF8 A;  3N71 A;  4HOQ A;  3ZXS A;  2WXQ A;  4NQ0 A;  1E7V A;  4I9E A;  1Z3Y A;  3CEQ A;  2L6J A;  2A5U A;  4U0U A;  3TG5 A;  2XEV A;  4GA1 A;  4NRH B;  1H19 A;  3PNT B;  4J8S A;  1HFA A;  3LJ3 A;  3FUL A;  5FQ6 A;  3LDZ A;  1NA3 A;  3L13 A;  4AP2 A;  2FEZ A;  3PE3 A;  3CK9 A;  3PRZ A;  3ESK A;  4XZ4 A;  1ELK A;  4ILG A;  5E75 A;  3ASD A;  3KS2 A;  3U4T A;  2V8S E;  4E85 A;  2WQ7 A;  4XE0 A;  3FTX A;  2GW1 A;  3CK8 A;  3I5P A;  3QK0 A;  4TRQ A;  3S7F A;  4GZC A;  4GZ6 A;  4CDM A;  4AY6 A;  4GYO A;  2PQN A;  4U0S A;  4HOT A;  3L22 A;  4GAA A;  3TAX A;  4LRZ A;  2KCV A;  3B13 A;  3FEY A;  1N52 A;  4HFG A;  4CCA A;  4EZK A;  5CCL A;  3FTV A;  1TEZ A;  1HE8 A;  2DBA A;  4CRW A;  2XPY A;  2C0L A;  4JVS A;  2CHW A;  2WPV A;  2BF0 X;  3PH0 C;  3PDN A;  1Z6T A;  3ASG A;  4FU3 A;  2HYZ A;  2OND A;  3MKR A;  3VLF A;  2RD0 A;  2X6H A;  5CHE E;  1EDU A;  3ZYQ A;  4C0M A;  3UQ3 A;  2IFU A;  3ZYM A;  4XI0 A;  1W3B A;  4IUL A;  2L0T B;  3EHN A;  4ME2 A;  1HZ4 A;  3U64 A;  4RSY A;  1H0A A;  5DIZ A;  2OVB A;  3URZ A;  2VSY A;  4I1A A;  2LNI A;  3NZS A;  3PE4 A;  3GZ1 A;  5BV1 A;  3GW4 A;  3QJZ A;  1TJF A;  4NUR A;  5BNW A;  1U3D A;  4I43 A;  4JHK A;  3T5X A;  3FU3 A;  3NQP A;  1EPU A;  4FC8 A;  1FVF A;  2DCP A;  2VSN A;  1OUV A;  5HI7 A;  3PVL A;  4GZD A;  2PM6 A;  4PS7 A;  2NC9 A;  5CMY A;  4EEC A;  2J07 A;  3ZYL A;  4ANX A;  2VJ8 A;  1UN9 A;  3D9I A;  2CG2 A;  4J0U A;  5A7D B;  3SBS A;  1OWL A;  4KVM A;  1S0P A;  4N39 A;  1HX8 A;  4FHJ A;  3FH7 A;  1NZN A;  2IOL A;  1E8Y A;  1SQM A;  4A3V A;  5BUZ A;  4URK A;  5J08 A;  3CVX A;  5LX8 A;  3NF1 A;  3CHO A;  3CKB A;  1ZU2 A;  2V4L A;  2WMO A;  3LY7 A;  4CDN A;  1ELR A;  4GA0 A;  4B94 A;  5A6C A;  1QZ2 A;  4WWO A;  4XI9 A;  3OXG A;  4ANV A;  5BV0 A;  3D9N A;  3JQ0 A;  4AXH A;  1Y6I A;  2VSX E;  2CHX A;  1X5B A;  4DLQ A;  2C0M A;  3FH8 A;  4G25 A;  3CGH A;  4L2Y A;  3EDT B;  4MKT A;  3SBT B;  1NA0 A;  3BEE A;  2Q7F A;  2XHE A;  1XNF A;  4CT4 A;  4R7L A;  5ANR A;  4IRU A;  5LCW C;  3B7U X;  1BPO A;  3T8M A;  3HYM B;  3WXX A;  3G2T A;  1E8Z A;  1FCH A;  3MJW A;  3MV2 B;  4EZJ A;  4UI9 C;  2C2L A;  3R7Q A;  3S7B A;  3OXL A;  3Q15 A;  3ML9 A;  3UT7 A;  4ANW A;  4WUY A;  3EJN A;  4DI4 A;  4L1B A;  4D10 C;  2I9C A;  4A3T A;  4J8E A;  3RRU A;  4YVQ C;  2J9Q A;  3FFL A;  1OWO A;  3FUI A;  1MQS A;  4PUC A;  3KAE A;  5G04 J;  2X3M A;  2NXP A;  4G1T A;  4I9C A;  4U0Z A;  4UWG A;  1VDY A;  2LO6 A;  4CDR A;  4G23 A;  2IJG X;  3CQG B;  3PZD A;  4FP7 A;  1UN8 A;  1E90 A;  5JJT A;  3ONL A;  5G05 J;  4JW1 A;  2X6I A;  4M3O A;  4UWF A;  4BTA A;  2QY7 A;  4GZ3 A;  3ENE A;  3IV0 A;  3HIZ A;  3DPD A;  4O6F A;  5JHB A;  1IQU A;  1EYH A;  1N54 A;  2JEK A;  1XGW A;  4LCT A;  5KCM A;  3VLD A;  3FTW A;  2KZT B;  3Q5M A;  4L2L A;  4WND A;  5KJL A;  3CVV A;  2KC7 A;  1KT1 A;  4UQX A;  4WNE A;  2FUL A;  4PH4 B;  1SZA A;  3SZ7 A;  1WM5 A;  2VGX A;  3G2W A;  3O4Z A;  3HDX A;  4KT6 B;  2FBN A;  3CST A;  2HR2 A;  3SF4 A;  4GML A;  4TUU A;  2CG3 A;  4N3A A;  4OVV A;  4JEU A;  3D9M A;  1UJJ A;  2RG8 A;  3GZS A;  4FLH A;  4JC8 A;  5ENN A;  2KZT A;  3VTX A;  4A1S A;  1DVP A;  2IOS A;  2WXH A;  4H7X A;  2XGM A;  5LFA A;  3L17 A;  3CKC A;  2AXV A;  5A23 A;  1P5Q A;  3ZRH A;  1IHG A;  2UY1 A;  3CQC B;  4P29 A;  2Y3A A;  1ELW A;  1KT0 A;  3FUJ A;  4PS8 A;  2ION A;  3ZEF A;  3P1U A;  5FQ8 A;  5AIJ A;  2YQ8 A;  2YNQ A;  3ZFW A;  4EBA A;  3LCA A;  1H2U A;  5HQ8 A;  3QC1 A;  2FF4 A;  2YHE A;  2V5F A;  3FU5 A;  4YND A;  1ZBP A;  2X38 A;  3D9K A;  3HVE B;  3FUM A;  5EX0 A;  1E96 B;  1JUQ A;  1IYG A;  2WM9 A;  3R9A B;  3UUX A;  2WQ6 A;  3AU5 A;  2VYI A;  1WY6 A;  2YHC A;  5KJM A;  5LP0 A;  1KLX A;  2GGF A;  3QB2 A;  3FUD A;  1JWG A;  3B7T A;  3Q47 B;  5ARF A;  3FP3 A;  3TGO A;  4AV7 A;  2L9B A;  2LSU A;  4DK5 A;  4G11 A;  5FZR A;  1INZ A;  3RJV A;  4FLB A;  3Q49 B;  3MV3 B;  4G26 A;  3MEK A;  3CHP A;  5D0O D;  1YA0 A;  4WNG A;  3QWP A;  3FTY A;  2EQX A;  2OOE A;  2X6K A;  4BSX A;  4HVB A;  2V0P A;  3LXU X;  4H7Y A;  4I2Z A;  2WXJ A;  4DJA A;  4N5C A;  4BX9 A;  4JXT A;  3L16 A;  5CMW A;  4WWN A;  3OXF A;  2J09 A;  4A55 A;  1E7U A;  3E4B A;  4BWR A;  2LSV A;  3ZYK A;  4XKC A;  4FUL A;  4I1O B;  1OWP A;  3O48 A;  5FTP A;  3UT4 A;  4GPK A;  2XRZ A;  3P2B A;  4OVU A;  4F1S A;  3ZVV A;  4GCO A;  2AVP A;  1OWM A;  3MX3 A;  3OTN A;  2VQ2 A;  3QNK A;  4Q94 A;  2I1K A;  2Y4U A;  3UT8 A;  4GMJ A;  2IF4 A;  2XPZ A;  3D9L A;  4J6I A;  4GZ5 A;  3RIB A;  3T5V A;  3PEU B;  5JHA A;  4KZC A;  3EIJ A;  3IHY A;  5KJN A;  5T3R A;  2XGS A;  4UWL A;  2UY1 B;  2LAH A;  3QDN A;  4Y6W A;  4B8A A;  2JLB A;  5EX3 A;  1HG5 A;  3FUK A;  3QOU A;  4MS6 A;  5JJ7 A;  5FQ4 A;  4CT0 A;  1HU3 A;  3MZL B;  4UI9 J;  2VTB B;  1U3C A;  4F53 A;  3FWV A;  4AIF A;  2AW6 A;  5G05 C;  2VGY A;  5EKQ D;  1HXI A;  2AXU A;  2WVI A;  3RO3 A;  3QAQ A;  2ILR A;  2WXL A;  4I6G A;  3BG1 B;  3UMV A;  2PL2 A;  3ULQ A;  5ARG A;  1DNP A;  2BTD A;  4CGV A;  5AJL A;  2VSO E;  4GCN A;  2MOW A;  5FZS A;  4BT8 A;  3FU6 A;  1WAO 1;  5BT1 A;  4XIF A;  4ABN A;  4A1G A;  2HM8 A;  2UWJ G;  2WXK A;  2YIN A;  4U63 A;  4C0E A;  3CVP A;  2WXM A;  3RU0 A;  2PM7 A;  5G55 A;  3FUE A;  3FTU A;  5J90 A;  4I2W A;  1JWF A;  1H2V C;  3ONK A;  3CSF A;  3UX4 A;  5E76 A;  4HOR A;  3SFZ A;  1HH8 A;  5FQ7 A;  4JHR A;  3PEV B;  5LCW J;  4UQZ A;  2E0I A;  4JA7 A;  5FJY A;  3LY8 A;  2J49 A;  4JHJ A;  5BPP A;  3FUH A;  3U66 A;  3PRE A;  2LAI A;  4AM9 A;  5AJD A;  1MHQ A;  2PZI A;  4B89 A;  4WNF A;  3CLJ A;  2OV8 A;  3VLE A;  3R7R A;  3APC A;  3U3W A;  5ANL A;  2XCB A;  4JL0 A;  3EIQ C;  3G2V A;  4I6E A;  3S2A A;  2E2E A;  1HO8 A;  3JUI A;  3CVN A;  3AS8 A;  4N2Q A;  4FJY A;  4BT9 A;  1GW6 A;  1L5J A;  3I3N A;  3L6A A;  2WB2 A;  4ANU A;  3CVY A;  4ILI A;  2WXO A;  3AS5 A;  4AVX A;  4C9B B;  3APF A;  3JQ1 A;  3JYS A;  4OYS A;  3CVU A;  3D9J A;  4EQF A;  2AXZ A;  2R59 A;  4N3C A;  2DIW A;  3FEX A;  5AEN A;  4B0Z A;  2J4D A;  5M72 A;  3FTS A;  5T4Y A;  4XX5 A;  3IEG A;  2WXI A;  3CHM A;  3B7S A;  4ACL A;  3ASH A;  3K9I A;  3ML8 A;  4L23 A;  5AYW D;  3RO2 A;  3APD A;  3LVR E;  3D9O A;  4BY6 A;  1QNF A;  2XRY A;  4APF A;  2OVF A;  5FZQ A;  1JPL A;  2KM4 A;  4TV3 A;  5CCM A;  1UJK A;  4BTB A;  2I2O A;  3CVL A;  5C2Y A;  2CFU A;  3L54 A;  1HF8 A;  1UW4 B;  3LS8 A;  3TXN A;  3B7R L;  4U07 A;  4UWK A;  3D3M A;  4LEU A;  3ZHE A;  5JJ6 A;  2XGO A;  3LEW A;  2ZU6 B;  3CIA A;  1Y8M A;  2PQR A;  4KYO B;  4DI3 A;  2J4B A;  3L08 A;  2GRM A;  3G2U A;  2XPI A;  4KXK B;  1HG2 A;  1PC2 A;  4JEH A;  3C98 A;  2CFZ A;  4J8D A;  3IHV A;  3TG4 A;  5FT9 A;  4W9R A;  3I4R B;  4GYW A;  5LOZ A;  4RVB A;  3ESL A;  4EBA G;  4E6H A;  1PAQ A;  2M63 A;  1UG3 A;  3ZW3 A;  3HVE A;  3PUJ A;  4B8C B;  3FTZ A;  4APO A;  2FI7 A;  4F7A A;  2J08 A;  1B89 A;  3JCK C;  4Q69 A;  4KVO A;  3I4G A;  4JZY A;  4PDX A;  4AY5 A;  4FJZ A;  4J8F A;  2KCK A;  2XQ0 A;  2QFC A;  4RG6 A;  5FWQ A;  3OAW A;  1H6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...