5FZSA

Designed tpr protein m4n delta c (cf ii)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
107
structure length
107
Chain Sequence
NSIKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNNIKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNNIKTLSNLAVLLAQEGKAEEAIKYMRKAVSLIDKAAKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DESIGNED TPR PROTEIN
publication title Origin of a folded repeat protein from an intrinsically disordered ancestor.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Unknown function
total genus 43
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5fzsA00
2UWJG 4U04A 3S7JA 2VGXB 2WPVA 3CEQA 1OUVA 1ELRA 1HZ4A 4AM9A 2L6JA 4GPKA 2XGMA 2PQRA 3RO2A 3ZGQA 2KCVA 3MV3B 3Q5MA 2BUGA 2IF4A 4GA0A 4BT8A 4AY6A 4APOA 3R9AB 2HO1A 3E4BA 3ZHEA 5CHEE 5HI7A 3LYAA 3MV2B 3O48A 5JJTA 4HOUA 4I9EA 4YNDA 4WNDA 3ASDA 3UUXA 4B94A 2V5FA 4UI9C 3LKUA 5EKQD 1B89A 5FZQA 4G26A 2P58C 4J0UA 2FO7A 2XEVA 4HOTA 3QWPA 1KLXA 1WM5A 4KBQA 4G23A 2UY1A 2LSVA 2XGSA 1XNFA 3ASHA 3AS4A 2KC7A 2LSUA 1PC2A 5BW8C 3FFLA 4CGVA 1Y8MA 5EX0A 3U4TA 1FCHA 4JL0A 5KJKA 1QQEA 3FP3A 2MHKA 3GZ1A 2I6HA 2FI7A 3UPVA 4F3VA 3LY9A 1NA0A 3MKRA 4HOSA 4AY5A 1YA0A 4GZ3A 2C0LA 4JHRA 5KJMA 1IYGA 1WAO1 3S7DA 4N39A 5BNWA 3CK7A 5A7DB 2GW1A 4I17A 1W3BA 5ARGA 5C1DA 3CVLA 4N3AA 5G05J 3CV0A 4O6FA 4YVOA 5G04J 2VSNA 4UI9K 3QWVA 5ARFA 3RU0A 5D0QD 4HOQA 3CKBA 4HORA 4ME2A 5LCWJ 4N2SA 3LY7A 5BT1A 4GYYA 3ZHEB 4UQXA 2DBAA 3BEEA 3IEGA 3QDNA 1QZ2A 3JYSA 4NRHB 2VGYA 3N71A 4JA9A 3PDNA 2C0MA 4H7XA 3ASGA 3CVPA 2PQNA 2Q7FA 4I1AA 4N2QA 1A17A 2QFCA 4GZ6A 4XI9A 2Y4TA 3U3WA 3CK9A 1HH8A 2VSYA 2OOEA 2YQ8A 5CCMA 4GZ5A 5CCLA 4U0ZA 3Q47B 3Q15A 5EX3A 5FZRA 1P5QA 5JJ7A 3NF1A 4UQYA 2Y4UA 2UY1B 1KT1A 4KYOB 5M72A 4W9RA 3LCAA 3PE4A 5HQ8A 3URZA 4GCOA 4JA7A 2ONDA 3OXLA 3Q4AB 5DIZA 1ZBPA 4LEUA 3ZPJA 5FJYA 2C2LA 4G24A 2YHCA 4ABNA 3S7FA 4IN3B 5DBKA 4H7YA 4CGWA 2E2EA 2WQHA 5FTPA 2HYZA 4N3BA 4UQZA 3KAEA 4U0SA 3TAXA 4YVQC 4BTBA 3LPZA 2XCBA 3ESKA 4AIFA 3TG5A 3CVQA 2FF4A 4GYOA 4J8DA 2IFUA 3QKYA 2KATA 3RKVA 3S7BA 3UQ3A 3K9IA 3HYMB 4BT9A 1HXIA 1KT0A 3LY8A 2FBNA 4U07A 4NQ0A 1IHGA 2VGXA 3CVNA 4WNGA 3QWWA 2XPIA 3VTYA 3FWVA 3WXXA 3QOUA 3VTXA 2R5SA 3CK8A 4RG9A 2KCKA 4G2VA 4GA2A 3GYZA 3AS5A 4WUYA 2NC9A 4UI9J 4KXKB 5G05C 3GZ2A 2VQ2A 2J9QA 2XGOA 3SZ7A 4I2WA 4WNEA 2PL2A 5G04C 5FZSA 4GYWA 1ZU2A 4N3CA 4G1TA 4EQFA 5LCWC 3Q49B 3TGOA 1NZNA 5JJ6A 2FEZA 5KJLA 4GA1A 2PZIA 5KJNA 3MA5A 4GCNA 4CDRA 3CKCA 3EDTB 3KS2A 3ULQA 2KCLA 4J8FA 4A1SA 1E96B 4J8EA 4WNFA 3OXGA 5AYWD 1NA3A 2AVPA 4G25A 2XCCA 4BTAA 4Y6CA 4BWRA 4U0UA 4I9CA 4I2ZA 4Y6WA 3AS8A 3PE3A 4N5CA 3SF4A 3MEKA 3GW4A 5A6CA 3ZN3A 3KD7A 3RIBA 5FT9A 2JLBA 4RG6A 3RO3A 2HR2A 1TJCA 1ELWA 3RJVA 3ZFWA 4XIFA 2LNIA 3ASFA 5D0OD 4XI0A 2VYIA 3TG4A 3OXFA
chains in the Genus database with same CATH superfamily
3CQGB 4U04A 4K5BA 4NACA 1HFAA 1N4PA 2F8YA 3KSQA 5FINA 4GTQA 4I43A 1LD7A 5BPPA 2EIJE 3EUVA 2V0PA 3HDXA 4B0ZA 4DLOA 2AW6A 1N4RA 1DCEA 4DRXE 3ZRHA 2KCVA 5CBOA 1IHBA 1OCZE 1XGWA 5BV1A 2IF4A 3Q75A 4GA0A 2DCPA 5AENA 1YMPA 4U8YD 3TWVA 3X2QE 5EYPF 2BF0X 2P9PG 4B89A 4F7AA 5HI7A 4ANXA 1WDYA 1MYOA 1S64A 3Q73A 1MX4A 3LYAA 2NYJA 3EU5A 1Z3YA 4OAVB 3PEVB 3DRAA 2WXKA 4HS2A 3UUXA 4B94A 3B95A 4EZJA 3EHQA 5BUZA 3UT4A 4LCTA 1B89A 5CMYA 4KVOA 4PDXA 5AQAA 1S70B 2BKKB 3ZIMA 2RFMA 3MX3A 5HRYA 1KLXA 3PUKA 1H2UA 1TNYA 2XEEA 5CMWA 4YDYA 2LSVA 1ELKA 3F6QA 4LUNU 1PC2A 3FH7A 2YNQA 4GU5A 1Y8MA 3U4TA 1FCHA 4HFGA 3PZ3A 1JWFA 4CDMA 3CHOA 1O1RA 4ILGA 4LG6A 4ACKA 2I2OA 5LOZA 2GRLA 1N4SA 4PS3A 4AY5A 4LRZA 2R2LA 1YA0A 4X8QA 4BEPA 1OY3D 1IYGA 4GAAA 4FJZA 5BNWA 3CK7A 2GW1A 3DEOA 1RZ4A 2RD0A 5ARGA 4A55A 4FULA 4CEMA 5CEDB 5G04J 1H6KA 3JUIA 4JB8P 3R7RA 2DYSE 2V4LA 5AN8A 5BT1A 1UJKA 5D66A 3BEEA 3D3MA 3IEGA 4JHJA 5B3SE 2XPYA 4LSZE 4P29A 4GTPA 3L13A 3PDNA 1X5BA 3ASGA 2Q7FA 2AXUA 4I1AA 1SQMA 3SY2A 3MCXA 1HH8A 3D9NA 2YQ8A 5CRUA 4GTSA 5ITZF 2ZISA 2A5EA 4EBAG 1D8EA 3DSWA 3ZU7B 3SFXA 3OTNA 3FU6A 3MZLB 4BX9A 3FUJA 2BKGA 1QNFA 3UTMA 3CVUA 4HB5A 3PEUB 3LCAA 3PE4A 4A3VA 3OAWA 3FEYA 3OXLA 1G3NB 3Q4AB 1X81A 1N0RA 4L2YA 4GB9A 2QZAA 4EZKA 2NXPA 2OVFA 3I4RB 1OWPA 3ZPJA 3MGBA 4UWHA 1K3ZD 5ENTD 5IY5E 4L9PA 2C2LA 2WMNA 3TWWA 3CIAA 4GMRA 4H7YA 3DSTA 5AJDA 2E2EA 2MOWA 4JVSA 4UQZA 4C0EA 3DPYA 3ESKA 3DPDA 3SHFA 4AIFA 4UUCA 4BETA 4YDOA 3T8KA 5ENNA 1IQRA 1FVHA 4U07A 1QBQA 4FHJA 1OCCE 2VGXA 3D9OA 4CRWA 4K03A 3VTYA 3WXXA 3FWVA 4UWLA 3U64A 3G2TA 2R5SA 3NBNB 2B6CA 3CK8A 3UKUG 2RG8A 4GA2A 3G2VA 2R59A 5CERB 2NC9A 2F37A 2AXZA 3FTSA 5G05C 1H6OA 5FIOA 4GZCA 2PL2A 4GTRA 3V2OA 4GYWA 3KEAA 4O1PA 2XHEA 1O1TA 2ZGDA 3TGOA 1NZNA 3EIQC 4HNAD 4I6EA 2FEZA 3FULA 2E0IA 3AJIA 3FY4A 3CVVA 1K1BA 5KJNA 2QY7A 3D9IA 3EDTB 3ZNGA 2H6GA 3WG7E 2IQCA 3Q9NC 1E96B 3HXBA 5AYWD 3FTVA 4Y6CA 2GRMA 2ZXWE 4I9CA 4K5CA 3FH5A 3SFYA 4N5CA 1A5EA 1DNPA 5A6CA 3SO8A 3PZ4A 3KD7A 4G8KA 3RIBA 4ILHB 3DXKG 3IHYA 2IJGX 2JLBA 5AIJA 4EECA 1TJCA 3FTXA 1BD8A 3RJVA 5JHAA 3CSFA 2OEWA 5D0OD 1V54E 4XI0A 2VYIA 3TG4A 3UIPC 3OXFA 2UWJG 3C5RA 3SNXA 5D2MC 4BESA 3LDZA 2VGXB 2WPVA 3ZUVB 3UINC 5CRVA 4K0RA 3CVWA 1OUVA 3P2BA 1HZ4A 1MZCA 4AM9A 2L6JA 3QJZA 5ENQD 4DPRA 4L23A 4B93B 3AAAC 2LO6A 3IKOB 3DXMG 4XKCA 3MV3B 2AXVA 3W9FA 3IXEA 2BUGA 4GTVA 4CCAA 1Y6IA 4BT8A 4AY6A 4APOA 3ABKE 2HO1A 2XRYA 3L17A 5ENOD 4BX8A 3MV2B 5JJTA 4HOUA 3RRMB 1TNUA 4TUUA 2JEKA 3HVEA 3SFZA 3DWLG 1UN8A 3G2WA 3FTZA 4TXPA 3TWSA 4UI9C 5EILA 2P9NG 2Y0BG 3HXEA 3PH0C 4G8LA 3PZ1A 2P58C 1SW6A 2XEVA 1HG2A 3EHRA 5HS0A 5E75A 3CGHA 3J5QB 3LJNA 3AU4A 4RQIA 5FQ4A 1H2VC 2X38A 3ASHA 3AS4A 2KC7A 1AP7A 2LAHA 5EX0A 4JL0A 1QQEA 2J4DA 2WVIA 3PUJA 3PZ2A 3J5PA 2I6HA 4F3VA 4C0MA 4HLLA 2GRRB 4HOSA 1BLXB 1E8WA 3QNKA 4ANVA 3ULYA 3L08A 2B0OE 3KSLA 1ZB1A 5KJMA 4L7TA 3Q78A 1WAO1 4PUCA 3D9KA 3V79K 3SBSA 4DX6D 2XENA 4U8HA 1W3BA 3BU8A 3S2AA 5H7PA 1E8XA 2P9UG 4N3AA 2BEDA 3CV0A 3SI5A 3EIJA 4YVOA 4URKA 2VSNA 3QWVA 5ARFA 3RU0A 4JPSA 4JC8A 4HORA 4ME2A 3UM0A 1OXJA 2Y1LE 5LCWJ 2H6IA 2RKKA 1Q2ZA 4UQXA 2DBAA 2DZOA 4GTMA 1QZ2A 3PNLB 3CR3A 1BPOA 4O60A 4N2QA 1A17A 2QFCA 1NI1A 3ZKJA 4FC8A 2KXPC 2IO3C 2VSYA 2RFAA 4YDWA 5FQ7A 4GMJA 4U0ZA 2WXFA 2XS8A 3V30A 3NF1A 3DSUA 2V4HC 2J08A 4JHKA 5KWDA 1N95A 3EHNA 1WG0A 4XE0A 4GTOA 5M72A 2F0YA 4R7LA 1DVPA 1SA5A 3ASOE 3Q7FA 4DI4A 4F1SA 2XQ0A 4IYPA 3BG0B 3CHMA 3IV0A 5HQ8A 3AG1E 2XS1A 3URZA 4GCOA 4JA7A 1DCQA 2DZNA 2WQ7A 2ZU6B 1PAQA 1TJFA 4UWKA 4EHMA 1EF1C 2YHCA 2WXJA 3AG4E 3JUEA 3FTYA 4IN3B 2IEJA 4YDEA 3PRZA 3L82A 3PREA 4DJAA 4K5AB 4EPZA 1TR4A 5FTPA 4ZFHA 5BXUA 4U0SA 4BTBA 2XCBA 2AWIA 4Q96A 1BI8B 2XZDG 3RAUA 3FU0A 3E30A 3FUHA 3RKVA 4F53A 3APFA 3UQ3A 3DEPA 1OCRE 3LY8A 3TXMA 2X6IA 3E37A 2P9IG 2XPZA 3QOUA 5T8IA 3I4GA 3VLFA 4WWNA 2KCKA 5J08A 4G2VA 1S63A 4L1BA 3C98A 4WUYA 4Q94A 5KCMA 2VQ2A 2J9QA 2XGOA 3SBTB 5G04C 5FZSA 1E8YA 3QARA 2F8XK 1ZU2A 3UX4A 1TNZA 4Z68A 1EYHA 3ABLE 3Q49B 2A5UA 1OWLA 3QC1A 2P9KG 4GA1A 1H6PA 3B7SA 5AAOA 4U96D 4DX7D 1IKND 5B1AE 3KS2A 1U3CA 3ULQA 3QAQA 2KCLA 3HG0D 3ISMC 4KMOA 4A1SA 4MBGA 4HRNA 1NA3A 3HRAA 2HE0A 2OCCE 4FP7A 2XCCA 3R9MA 4N5QA 4BWRA 5AQ7A 4ILIA 4IULA 3PE3A 3B7UX 3JXJA 1GW6A 1N0QA 2X6KA 3ZN3A 1O5MA 3V2XA 1TYQG 4HQDA 2IU1A 3RO3A 2GRPB 4XIFA 2LNIA 3ASFA 1MHQA 1Z5SC 2Y3AA 3MKQA 1SVXA 3E33A 3ZYQA 5AARA 1HE8A 2A4ZA 3CVYA 2LXMA 3CEQA 4XX5A 1IQUA 2L6BA 2R02A 2WXQA 2IONA 4J6IA 2ZIRA 4GPKA 2XGMA 3KEZA 3IHVA 3FU3A 3LVQE 3RO2A 2WXIA 4UWFA 1JUQA 3E34A 3FTUA 3Q5MA 3LJ3A 5KNHD 3Q9UC 3E4BA 4ATGA 1HU3A 3SGHA 2XZTG 1TNOA 4GPMA 4CDNA 4GZDA 5FWQA 5CBNA 5A23A 3ASDA 3FU5A 2V5FA 2JABA 3CSTA 5FZQA 4G26A 2PM7A 2PM6A 2VSXE 1JPLA 4J8YA 1OCOE 2FO7A 4MRUA 4HOTA 5CECB 1HG5A 4HRMB 2KBXA 4OYSA 2I1KA 4G23A 2XGSA 1XNFA 3AU5A 2LSUA 3ESLA 5BW8C 4CGVA 3UMVA 1NFIE 2L9BA 4I1MA 3JQ0A 5KJKA 4JD2G 3NOCD 3FP3A 2BTDA 3TWRA 1E90A 2GRNB 2MHKA 4AXHA 2YINA 3FUKA 3MKQB 5EYLA 3ZXSA 1NA0A 5HKPA 3MKRA 1Z6TA 2HM8A 5ENRD 4JHRA 4OAUC 4DX5D 3S7DA 4M7CA 4HXIA 5JMND 4I17A 3AG2E 2CHWA 3CVLA 4HBDA 4M3OA 2I1JA 3BQOA 5T4YA 1LF8A 1UOHA 2NSZA 3L16A 1JWGA 4UI9K 4FJYA 4E85A 1BI7B 3CKBA 2OV8A 4OVUA 4MLPA 3CVXA 3LY7A 4GYYA 3QDNA 4NRHB 4DK5A 2VGYA 3B7TA 4JA9A 2WXNA 3CVPA 2PQNA 4XI9A 1OWMA 3UIOC 1V55E 2Y4TA 3U3WA 1PY1A 3CK9A 4AP2A 1NP7A 2R03A 3HXDA 4CYMD 2J07A 2OOEA 5CCMA 4GZ5A 5E76A 5C2YA 1DC2A 1N9AA 3B13A 4E6HA 3Q47B 1FT2A 3BG1B 5EX3A 4CZ2D 3LS8A 1P5QA 4UQYA 2PNNA 5ANLA 4U8VD 2L0TB 3GZSA 1KT1A 1LD8A 4G11A 2KZTA 4AEZC 3NAWA 4ATZD 4XKBA 2VSOE 3ZYLA 4LERA 4HI9A 2YHEA 1FVFA 4U7EB 2X6JA 1N54A 5EN5D 4LEUA 3Q79A 3B7RL 3L9TA 1SZAA 4FLHA 4RVBA 3ZW3A 3FUIA 3ZEFA 1U3DA 4ABNA 4CT4A 1D9SA 2OEVA 3E32A 3DSSA 4GMLA 3VLDA 3U9WA 4N3BA 2IO2C 3KAEA 4KZ0A 4YVQC 3LPZA 3CLJA 5AQBA 3CVQA 3UT8A 4GYOA 2IFUA 2R17C 2QYUA 3L6AA 4A63B 2KATA 3S7BA 1KZPA 3HYMB 3K9IA 4DX2A 1HXIA 1HS6A 4NQ0A 2WXGA 3QWWA 2XPIA 4LNBA 3VTXA 5JHBA 2WXLA 4J7WA 2MRIA 3MJWA 4RG9A 4KT6B 5FQ8A 1VDYA 3GYZA 5JA4D 3HVEB 3HIZA 4BY6A 2GRQB 5J90A 2I9CA 3R7QA 3TWTA 3SZ7A 4I2WA 4KVMA 4WNEA 5FQ6A 4FADA 2WXOA 4G1TA 3TWXA 5LCWC 5KJLA 3FEXA 3TWUA 2KZTB 3VLEA 5AQ9A 1SA4A 4GCNA 2J4BA 3CKCA 3TJPA 3D9HA 3RRNB 1N4QA 1UW4B 4U63A 3RSEG 3ZYKA 1HO8A 1TEZA 4JW1A 4J8EA 1INZA 3PZDA 4FLBA 3C72A 2IY0C 1FPPA 3TL5A 4BTAA 1TN8A 2X6HA 3UI2A 4WAFA 3FHEA 1H0AA 5T3RA 4Y6WA 4AV7A 3SF4A 3C3QA 1OWOA 3GW4A 3C3RA 3EU9A 4A3TA 2LXLA 1RW2A 3PVLA 2EINE 1SZ9A 2CFUA 2GGFA 3QB2A 5FT9A 4RG6A 2IOLA 3D9LA 3I3NA 1ELWA 4B8AA 2VJ8A 4DLQA 3JQ1A 1N11A 2ZGGA 4MS6A 4XEIG 5EIBE 3UM2A 4JXTA 3CHSA 3B7BA 2QC9A 3S7JA 1EPUA 2EQXA 3ASNE 3FDHA 2WB2A 1ELRA 4BSXA 2WMOA 4HRLA 2EILE 2M63A 2PQRA 4I1OB 3ZGQA 3ZVVA 2QYJA 1S0PA 4F1PA 3C3OA 4BSZB 4I6JA 3MYVA 2H6HA 2WM9A 1LTXA 4TV3A 4WWPA 3FUNA 3R9AB 5G55A 4C48B 1E8ZA 3ZXPA 3ZHEA 1MX2A 2KM4A 5CHEE 5EIDA 4RLYA 3O48A 2VTBA 4I6GA 4I9EA 4XZ4A 1E7UA 1WY6A 3SQVA 3TXNA 4YNDA 4WNDA 4D10C 4FHKA 4DX1A 3NQPA 4MKTA 1K1AA 3LKUA 5EKQD 2CG3A 4NIKA 4TUMA 3FUEA 2J09A 3FUMA 3RRUA 4J0UA 3QWPA 1WM5A 2WQ6A 5ANRA 4KBQA 2P9LG 2UY1A 3L54A 4PH4B 1OT8A 3FFLA 1H2TC 3NZSA 4IRUA 3LXUX 2V5QC 2ETCA 2X6FA 1IXVA 3GZ1A 2FI7A 1FT1A 3UPVA 1D8DA 3LY9A 3CQCB 4JZYA 2FO1E 4KZCA 5LFAA 4GZ3A 2C0LA 1TNBA 1OWNA 3W9GA 1Z3XA 4J8SA 4V3IA 5EDSA 4N39A 5A7DB 3PNTB 4WWOA 5C1DA 1KPSB 3P1UA 5G05J 3ML9A 1TN6A 4O6FA 3EHMA 1YCSB 2FULA 2P9SG 4PS7A 3UM3A 3FTWA 5D0QD 3ONKA 5ENPD 4HOQA 3SD5A 1EDUA 4N2SA 1TN7A 3ZHEB 3JYSA 1UG3A 3N71A 3APDA 4DI3A 2X3MA 1U2VG 2C0MA 4FA6A 4FU3A 4H7XA 1KZOA 2VTBB 1BU9A 2XEHA 3BUAA 4GZ6A 3G2SA 1YYHA 1E7VA 2EIKE 5AJLA 2EIME 3TWQA 4EZLA 5CCLA 2Y69E 3V31A 1JCRA 3Q15A 5FZRA 3G2UA 1UJJA 4C9BB 5JJ7A 2XRZA 3Q7AA 3CHQA 3FUFA 1H19A 2WXPA 3DSVA 2Y4UA 2UY1B 2WXMA 4PS8A 4KYOB 3RK6A 4W9RA 4ANWA 4AVXA 2J8SD 3HHMA 3APCA 3O4ZA 4O1OA 1JCQA 2ONDA 2DIWA 3JXIA 3T8MA 5KNGA 5DIZA 1ZBPA 5LP0A 3U66A 4BFRA 4ANUA 2ETAA 1N52A 3D9PA 5FJYA 3IBEA 4L2LA 3T5XA 5LX8A 4G24A 2GROB 4QFVA 3S7FA 2CG2A 2VGEA 5DBKA 4LNGA 4CGWA 2WQHA 2HYZA 3PS6A 4U95D 3ABME 5BXOA 4TXQA 3TAXA 3ZYMA 1O1SA 3AG3E 3TG5A 2FF4A 2DYRE 4J8DA 3QK0A 3NB2A 3QKYA 3UXGA 4JEHA 4DUIA 3LVRE 4BT9A 1KT0A 2LAIA 4APFA 2FBNA 1IHGA 1HF8A 3CVNA 4WNGA 3HXCA 2P2CP 2ETBA 1N94A 2ILRA 5CEAA 1MQSA 4AOFA 1QYMA 3FH8A 3ENEA 3AS5A 1NL4A 2WXRA 4UI9J 3L22A 4KXKB 4HVBA 3GZ2A 3UT7A 2AJAA 4F6RD 3D9JA 4OVVA 1HX8A 3NOGD 4BERA 4EBAA 5B1BE 2IOSA 4N3CA 2LUHA 5KBAA 4EQFA 2OVBA 3LEWA 2CFZA 5JJ6A 4LNUD 2H6FA 2PZIA 4Q69A 2DVWA 1JCSA 4AJWA 4ZHBA 3MA5A 2MYOA 2CHXA 4CDRA 4HLEA 3D9MA 4HI8A 2J49A 4ACLA 2R05A 4J8FA 3UM1A 2DWZA 3DSXA 5BV0A 4WNFA 3OXGA 1UN9A 3T9KA 3NZUA 2AVPA 3FUDA 4G25A 4GTTA 3EJNA 5ENSD 3UKRG 4JEUA 2V8SE 4QQIA 3DBSA 3T5VA 3ULEG 4A1GA 4U0UA 4I2ZA 3AS8A 4RSYA 4B8CB 1K8KG 3MEKA 3JCKC 4CT0A 3ML8A 4TRQA 3HXFA 2CHZA 2WXHA 2HR2A 1MJ0A 4UWGA 1AWCB 2L0IA 3ZFWA 3CHPA 3CHRA 4NURA 3I5PA 1MX6A 1L5JA 3ONLA 5G2NA 4TXRA
chains in the Genus database with same CATH topology
3CHSA 2UWJG 3MKQA 3SNXA 3CQGB 4U04A 3S7JA 3ZYQA 3LDZA 1EPUA 2EQXA 1HE8A 2A4ZA 3CVYA 4NACA 1HFAA 2VGXB 2WPVA 3CEQA 4XX5A 3FDHA 2WB2A 4I43A 4K0RA 3CVWA 1IQUA 1OUVA 5BPPA 1ELRA 3P2BA 2WXQA 2IONA 2V0PA 3HDXA 1HZ4A 4J6IA 4B0ZA 4AM9A 2L6JA 4GPKA 3QJZA 4BSXA 4DLOA 2WMOA 2XGMA 3KEZA 2AW6A 4DPRA 4L23A 3IHVA 2M63A 2PQRA 3FU3A 3LVQE 3RO2A 2WXIA 4I1OB 4UWFA 2LO6A 3ZGQA 3ZRHA 3ZVVA 1JUQA 1S0PA 2KCVA 3FTUA 3IKOB 4XKCA 3MV3B 2AXVA 4I6JA 1XGWA 3MYVA 5BV1A 3Q5MA 2BUGA 2IF4A 2WM9A 3LJ3A 4GA0A 4CCAA 4TV3A 1Y6IA 4BT8A 2DCPA 4WWPA 4AY6A 4APOA 3FUNA 3R9AB 5AENA 5G55A 2HO1A 1E8ZA 2XRYA 3E4BA 2BF0X 3L17A 3ZHEA 4ATGA 4B89A 2KM4A 5CHEE 5HI7A 4F7AA 4ANXA 1HU3A 3SGHA 4BX8A 3LYAA 3MV2B 3O48A 5JJTA 2VTBA 4HOUA 3RRMB 4I6GA 4CDNA 4I9EA 1Z3YA 4GZDA 4TUUA 4XZ4A 1E7UA 1WY6A 5FWQA 3TXNA 2JEKA 3HVEA 4YNDA 3SFZA 4WNDA 5A23A 3ASDA 3PEVB 2WXKA 4HS2A 3UUXA 3FU5A 4D10C 1UN8A 4B94A 4FHKA 2V5FA 3G2WA 4EZJA 3NQPA 3FTZA 4MKTA 5BUZA 3UT4A 4LCTA 4UI9C 3LKUA 5EKQD 2CG3A 1B89A 3CSTA 5CMYA 5FZQA 4KVOA 3FUEA 4G26A 2PM7A 4PDXA 2J09A 3PH0C 2PM6A 3FUMA 2VSXE 1JPLA 3RRUA 2P58C 4J0UA 3ZIMA 2FO7A 3MX3A 2XEVA 1HG2A 4MRUA 3QWPA 1KLXA 4HOTA 1HG5A 5E75A 1WM5A 2WQ6A 5ANRA 3PUKA 1H2UA 4KBQA 3CGHA 4OYSA 2I1KA 2UY1A 3AU4A 4G23A 5CMWA 5FQ4A 2LSVA 1H2VC 2XGSA 1XNFA 3L54A 1ELKA 2X38A 4PH4B 3ASHA 3AS4A 3AU5A 4LUNU 2KC7A 2LSUA 1PC2A 3ESLA 5BW8C 3FFLA 3FH7A 4CGVA 2YNQA 4GU5A 1H2TC 3UMVA 2LAHA 1Y8MA 5EX0A 3U4TA 1FCHA 2L9BA 4I1MA 3JQ0A 4HFGA 4JL0A 1QQEA 5KJKA 3NZSA 3FP3A 4IRUA 3LXUX 2BTDA 1JWFA 2J4DA 4CDMA 2WVIA 3PUJA 3CHOA 2X6FA 1E90A 4AXHA 2MHKA 3GZ1A 2YINA 3FUKA 3MKQB 4ILGA 2I6HA 2FI7A 3UPVA 4ACKA 4F3VA 3ZXSA 4C0MA 2I2OA 3LY9A 1NA0A 3CQCB 4JZYA 3MKRA 5LOZA 4KZCA 4HOSA 2GRLA 5LFAA 4PS3A 4AY5A 4LRZA 1E8WA 1YA0A 3QNKA 4GZ3A 1Z6TA 4ANVA 2C0LA 2HM8A 3L08A 4JHRA 5KJMA 4L7TA 1OWNA 1Z3XA 4J8SA 4V3IA 1IYGA 5EDSA 1WAO1 4GAAA 3D9KA 4N39A 4PUCA 4FJZA 3S7DA 5G2NA 3CK7A 5A7DB 2GW1A 5BNWA 3SBSA 4HXIA 2RD0A 4I17A 3PNTB 1W3BA 4U8HA 5ARGA 2CHWA 3S2AA 4A55A 4WWOA 5C1DA 1E8XA 3CVLA 4M3OA 4FULA 4N3AA 2I1JA 5T4YA 3P1UA 1LF8A 5G05J 4CEMA 3CV0A 3ML9A 3SI5A 3TG4A 4O6FA 2NSZA 3EHMA 3EIJA 3L16A 4YVOA 4URKA 2FULA 1JWGA 4PS7A 2VSNA 3FTWA 4UI9K 5G04J 3QWVA 1H6KA 3JUIA 4FJYA 5ARFA 3RU0A 4E85A 4JPSA 3R7RA 5D0QD 3ONKA 4JC8A 4HOQA 3CKBA 4HORA 4ME2A 2OV8A 4OVUA 2V4LA 3SD5A 5LCWJ 4MLPA 1EDUA 4N2SA 3CVXA 3LY7A 5BT1A 1UJKA 4GYYA 3ZHEB 4UQXA 2DBAA 3BEEA 3D3MA 3IEGA 3QDNA 4JHJA 1QZ2A 2XPYA 3JYSA 4NRHB 1UG3A 2VGYA 3N71A 4P29A 4DK5A 3B7TA 3APDA 3L13A 3PNLB 3PDNA 1X5BA 2X3MA 3CR3A 4JA9A 2C0MA 4DI3A 2WXNA 4FU3A 4H7XA 4FA6A 3ASGA 1BPOA 2PQNA 3CVPA 2Q7FA 2VTBB 2AXUA 4I1AA 4N2QA 1A17A 2QFCA 1SQMA 4GZ6A 4XI9A 3G2SA 1OWMA 4FC8A 2Y4TA 3U3WA 3MCXA 1E7VA 4JXTA 1PY1A 5AJLA 3CK9A 1HH8A 2VSYA 4AP2A 1NP7A 2J07A 3D9NA 2OOEA 2YQ8A 5FQ7A 4EZLA 5CCMA 4GZ5A 5E76A 4GMJA 5CCLA 5C2YA 4U0ZA 3B13A 4E6HA 3Q47B 3BG1B 3Q15A 5EX3A 4EBAG 5FZRA 2WXFA 3G2UA 3LS8A 1UJJA 1P5QA 4C9BB 5JJ7A 3NF1A 2XRZA 3OTNA 4UQYA 3FU6A 5ANLA 3MZLB 4BX9A 3FUJA 2J08A 3CHQA 3FUFA 4JHKA 1H19A 1QNFA 2L0TB 3CVUA 2WXPA 3EHNA 3GZSA 2Y4UA 2UY1B 1KT1A 4XE0A 2WXMA 4PS8A 4KYOB 5M72A 4G11A 3RK6A 4W9RA 3PEUB 4ANWA 2KZTA 4R7LA 3LCAA 4AVXA 1DVPA 4AEZC 3PE4A 3HHMA 4DI4A 3APCA 4XKBA 4F1SA 2VSOE 2XQ0A 4A3VA 3O4ZA 4IYPA 3BG0B 3CHMA 4LERA 3IV0A 3ZYLA 5HQ8A 3URZA 4GCOA 3OAWA 3FEYA 2ONDA 2DIWA 2YHEA 3OXLA 4JA7A 3Q4AB 3T8MA 1FVFA 4L2YA 5DIZA 4GB9A 2X6JA 1ZBPA 4EZKA 2WQ7A 2ZU6B 1N54A 2NXPA 5LP0A 3U66A 2OVFA 4BFRA 1PAQA 3I4RB 4ANUA 4LEUA 1OWPA 1TJFA 3B7RL 3ZPJA 1SZAA 4UWKA 4FLHA 1N52A 3D9PA 4RVBA 5FJYA 3ZW3A 3MGBA 3FUIA 3IBEA 4UWHA 4L2LA 3T5XA 3ZEFA 1EF1C 1U3DA 5LX8A 2C2LA 4G24A 2YHCA 2WXJA 2WMNA 4QFVA 3S7FA 4ABNA 4CT4A 2CG2A 3FTYA 3CIAA 4IN3B 5DBKA 4H7YA 5AJDA 3PRZA 3PREA 2E2EA 4CGWA 2WQHA 2MOWA 4GMLA 4JVSA 3VLDA 4DJAA 4EPZA 3U9WA 5FTPA 2HYZA 3PS6A 4N3BA 4UQZA 3KAEA 4C0EA 4U0SA 3TAXA 4KZ0A 4YVQC 3ZYMA 4BTBA 3LPZA 2XCBA 3CLJA 2AWIA 3DPDA 3ESKA 4Q96A 3SHFA 4AIFA 3TG5A 3CVQA 2FF4A 3UT8A 4GYOA 4J8DA 2IFUA 3QK0A 2R17C 3L6AA 3QKYA 3FU0A 3FUHA 2KATA 4JEHA 3RKVA 3LVRE 3APFA 3S7BA 4F53A 3UQ3A 3K9IA 3HYMB 4BT9A 1HXIA 1HS6A 1KT0A 1IQRA 5ENNA 2LAIA 4APFA 3LY8A 1FVHA 2FBNA 4U07A 4NQ0A 3TXMA 1IHGA 4FHJA 1HF8A 2VGXA 2X6IA 3CVNA 3D9OA 4WNGA 4CRWA 2WXGA 3QWWA 4K03A 2XPIA 3VTYA 3FWVA 2XPZA 4UWLA 3U64A 3WXXA 3G2TA 3QOUA 3VTXA 2R5SA 5JHBA 5T8IA 2WXLA 2ILRA 2MRIA 3CK8A 3MJWA 4RG9A 3I4GA 4KT6B 1MQSA 3VLFA 5FQ8A 4WWNA 2KCKA 4AOFA 1VDYA 2RG8A 5J08A 3FH8A 4G2VA 4GA2A 3GYZA 3G2VA 4L1BA 3ENEA 3AS5A 2R59A 3HVEB 3HIZA 3C98A 4BY6A 4WUYA 2NC9A 2WXRA 2AXZA 3FTSA 3L22A 4Q94A 4UI9J 5J90A 4KXKB 5G05C 2I9CA 2VQ2A 3GZ2A 5KCMA 3R7QA 3UT7A 4HVBA 2J9QA 2XGOA 3SZ7A 4I2WA 4KVMA 4GZCA 3SBTB 4WNEA 3D9JA 2PL2A 4OVVA 1HX8A 5FQ6A 5FZSA 5G04C 4FADA 1E8YA 4EBAA 4GYWA 3QARA 1ZU2A 2WXOA 2IOSA 3UX4A 4N3CA 2XHEA 4G1TA 4EQFA 1EYHA 5LCWC 3Q49B 3TGOA 1NZNA 2OVBA 3EIQC 3LEWA 2A5UA 1OWLA 2CFZA 3QC1A 4I6EA 5JJ6A 2FEZA 3FULA 2E0IA 5KJLA 3FEXA 4GA1A 3FY4A 2PZIA 4Q69A 3CVVA 4AJWA 2KZTB 3B7SA 3VLEA 5KJNA 3MA5A 2CHXA 4GCNA 2QY7A 4CDRA 2J4BA 3CKCA 3TJPA 3D9IA 4HLEA 3D9MA 3EDTB 2J49A 3RRNB 3KS2A 1U3CA 1UW4B 3ULQA 4U63A 3QAQA 2KCLA 4J8FA 4ACLA 2IQCA 3ZYKA 4KMOA 1HO8A 4A1SA 1TEZA 4JW1A 5BV0A 1E96B 4J8EA 4WNFA 3OXGA 1INZA 1UN9A 3PZDA 5AYWD 3NZUA 4FLBA 1NA3A 2AVPA 3FUDA 4G25A 3EJNA 4FP7A 2XCCA 4JEUA 2V8SE 3TL5A 4BTAA 3FTVA 3DBSA 4Y6CA 2X6HA 3T5VA 2GRMA 4BWRA 4WAFA 4A1GA 3FHEA 4U0UA 1H0AA 5T3RA 4I9CA 4I2ZA 4Y6WA 4ILIA 4IULA 3AS8A 4RSYA 3PE3A 3FH5A 4N5CA 4B8CB 3SF4A 4AV7A 1DNPA 3MEKA 1OWOA 3B7UX 3JCKC 4CT0A 3GW4A 1GW6A 5A6CA 3ML8A 4A3TA 4TRQA 2X6KA 3ZN3A 3PVLA 1SZ9A 2CFUA 3KD7A 2GGFA 3QB2A 2CHZA 4ILHB 2WXHA 5FT9A 3IHYA 2IJGX 2IU1A 2JLBA 3RIBA 4RG6A 5AIJA 3RO3A 2HR2A 2IOLA 1TJCA 3D9LA 4EECA 3I3NA 1ELWA 3FTXA 4UWGA 4B8AA 2VJ8A 4DLQA 3RJVA 3JQ1A 2L0IA 5JHAA 3ZFWA 4MS6A 4XIFA 2LNIA 3CSFA 3CHPA 3CHRA 4NURA 3ASFA 5D0OD 3I5PA 4XI0A 1MHQA 1L5JA 2VYIA 3ONLA 3OXFA 2Y3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWJ G;  4U04 A;  3S7J A;  2VGX B;  2WPV A;  3CEQ A;  1OUV A;  1ELR A;  1HZ4 A;  4AM9 A;  2L6J A;  4GPK A;  2XGM A;  2PQR A;  3RO2 A;  3ZGQ A;  2KCV A;  3MV3 B;  3Q5M A;  2BUG A;  2IF4 A;  4GA0 A;  4BT8 A;  4AY6 A;  4APO A;  3R9A B;  2HO1 A;  3E4B A;  3ZHE A;  5CHE E;  5HI7 A;  3LYA A;  3MV2 B;  3O48 A;  5JJT A;  4HOU A;  4I9E A;  4YND A;  4WND A;  3ASD A;  3UUX A;  4B94 A;  2V5F A;  4UI9 C;  3LKU A;  5EKQ D;  1B89 A;  5FZQ A;  4G26 A;  2P58 C;  4J0U A;  2FO7 A;  2XEV A;  4HOT A;  3QWP A;  1KLX A;  1WM5 A;  4KBQ A;  4G23 A;  2UY1 A;  2LSV A;  2XGS A;  1XNF A;  3ASH A;  3AS4 A;  2KC7 A;  2LSU A;  1PC2 A;  5BW8 C;  3FFL A;  4CGV A;  1Y8M A;  5EX0 A;  3U4T A;  1FCH A;  4JL0 A;  5KJK A;  1QQE A;  3FP3 A;  2MHK A;  3GZ1 A;  2I6H A;  2FI7 A;  3UPV A;  4F3V A;  3LY9 A;  1NA0 A;  3MKR A;  4HOS A;  4AY5 A;  1YA0 A;  4GZ3 A;  2C0L A;  4JHR A;  5KJM A;  1IYG A;  1WAO 1;  3S7D A;  4N39 A;  5BNW A;  3CK7 A;  5A7D B;  2GW1 A;  4I17 A;  1W3B A;  5ARG A;  5C1D A;  3CVL A;  4N3A A;  5G05 J;  3CV0 A;  4O6F A;  4YVO A;  5G04 J;  2VSN A;  4UI9 K;  3QWV A;  5ARF A;  3RU0 A;  5D0Q D;  4HOQ A;  3CKB A;  4HOR A;  4ME2 A;  5LCW J;  4N2S A;  3LY7 A;  5BT1 A;  4GYY A;  3ZHE B;  4UQX A;  2DBA A;  3BEE A;  3IEG A;  3QDN A;  1QZ2 A;  3JYS A;  4NRH B;  2VGY A;  3N71 A;  4JA9 A;  3PDN A;  2C0M A;  4H7X A;  3ASG A;  3CVP A;  2PQN A;  2Q7F A;  4I1A A;  4N2Q A;  1A17 A;  2QFC A;  4GZ6 A;  4XI9 A;  2Y4T A;  3U3W A;  3CK9 A;  1HH8 A;  2VSY A;  2OOE A;  2YQ8 A;  5CCM A;  4GZ5 A;  5CCL A;  4U0Z A;  3Q47 B;  3Q15 A;  5EX3 A;  5FZR A;  1P5Q A;  5JJ7 A;  3NF1 A;  4UQY A;  2Y4U A;  2UY1 B;  1KT1 A;  4KYO B;  5M72 A;  4W9R A;  3LCA A;  3PE4 A;  5HQ8 A;  3URZ A;  4GCO A;  4JA7 A;  2OND A;  3OXL A;  3Q4A B;  5DIZ A;  1ZBP A;  4LEU A;  3ZPJ A;  5FJY A;  2C2L A;  4G24 A;  2YHC A;  4ABN A;  3S7F A;  4IN3 B;  5DBK A;  4H7Y A;  4CGW A;  2E2E A;  2WQH A;  5FTP A;  2HYZ A;  4N3B A;  4UQZ A;  3KAE A;  4U0S A;  3TAX A;  4YVQ C;  4BTB A;  3LPZ A;  2XCB A;  3ESK A;  4AIF A;  3TG5 A;  3CVQ A;  2FF4 A;  4GYO A;  4J8D A;  2IFU A;  3QKY A;  2KAT A;  3RKV A;  3S7B A;  3UQ3 A;  3K9I A;  3HYM B;  4BT9 A;  1HXI A;  1KT0 A;  3LY8 A;  2FBN A;  4U07 A;  4NQ0 A;  1IHG A;  2VGX A;  3CVN A;  4WNG A;  3QWW A;  2XPI A;  3VTY A;  3FWV A;  3WXX A;  3QOU A;  3VTX A;  2R5S A;  3CK8 A;  4RG9 A;  2KCK A;  4G2V A;  4GA2 A;  3GYZ A;  3AS5 A;  4WUY A;  2NC9 A;  4UI9 J;  4KXK B;  5G05 C;  3GZ2 A;  2VQ2 A;  2J9Q A;  2XGO A;  3SZ7 A;  4I2W A;  4WNE A;  2PL2 A;  5G04 C;  5FZS A;  4GYW A;  1ZU2 A;  4N3C A;  4G1T A;  4EQF A;  5LCW C;  3Q49 B;  3TGO A;  1NZN A;  5JJ6 A;  2FEZ A;  5KJL A;  4GA1 A;  2PZI A;  5KJN A;  3MA5 A;  4GCN A;  4CDR A;  3CKC A;  3EDT B;  3KS2 A;  3ULQ A;  2KCL A;  4J8F A;  4A1S A;  1E96 B;  4J8E A;  4WNF A;  3OXG A;  5AYW D;  1NA3 A;  2AVP A;  4G25 A;  2XCC A;  4BTA A;  4Y6C A;  4BWR A;  4U0U A;  4I9C A;  4I2Z A;  4Y6W A;  3AS8 A;  3PE3 A;  4N5C A;  3SF4 A;  3MEK A;  3GW4 A;  5A6C A;  3ZN3 A;  3KD7 A;  3RIB A;  5FT9 A;  2JLB A;  4RG6 A;  3RO3 A;  2HR2 A;  1TJC A;  1ELW A;  3RJV A;  3ZFW A;  4XIF A;  2LNI A;  3ASF A;  5D0O D;  4XI0 A;  2VYI A;  3TG4 A;  3OXF A; 
#chains in the Genus database with same CATH topology
 3CQG B;  4U04 A;  4K5B A;  4NAC A;  1HFA A;  1N4P A;  2F8Y A;  3KSQ A;  5FIN A;  4GTQ A;  4I43 A;  1LD7 A;  5BPP A;  2EIJ E;  3EUV A;  2V0P A;  3HDX A;  4B0Z A;  4DLO A;  2AW6 A;  1N4R A;  1DCE A;  4DRX E;  3ZRH A;  2KCV A;  5CBO A;  1IHB A;  1OCZ E;  1XGW A;  5BV1 A;  2IF4 A;  3Q75 A;  4GA0 A;  2DCP A;  5AEN A;  1YMP A;  4U8Y D;  3TWV A;  3X2Q E;  5EYP F;  2BF0 X;  2P9P G;  4B89 A;  4F7A A;  5HI7 A;  4ANX A;  1WDY A;  1MYO A;  1S64 A;  3Q73 A;  1MX4 A;  3LYA A;  2NYJ A;  3EU5 A;  1Z3Y A;  4OAV B;  3PEV B;  3DRA A;  2WXK A;  4HS2 A;  3UUX A;  4B94 A;  3B95 A;  4EZJ A;  3EHQ A;  5BUZ A;  3UT4 A;  4LCT A;  1B89 A;  5CMY A;  4KVO A;  4PDX A;  5AQA A;  1S70 B;  2BKK B;  3ZIM A;  2RFM A;  3MX3 A;  5HRY A;  1KLX A;  3PUK A;  1H2U A;  1TNY A;  2XEE A;  5CMW A;  4YDY A;  2LSV A;  1ELK A;  3F6Q A;  4LUN U;  1PC2 A;  3FH7 A;  2YNQ A;  4GU5 A;  1Y8M A;  3U4T A;  1FCH A;  4HFG A;  3PZ3 A;  1JWF A;  4CDM A;  3CHO A;  1O1R A;  4ILG A;  4LG6 A;  4ACK A;  2I2O A;  5LOZ A;  2GRL A;  1N4S A;  4PS3 A;  4AY5 A;  4LRZ A;  2R2L A;  1YA0 A;  4X8Q A;  4BEP A;  1OY3 D;  1IYG A;  4GAA A;  4FJZ A;  5BNW A;  3CK7 A;  2GW1 A;  3DEO A;  1RZ4 A;  2RD0 A;  5ARG A;  4A55 A;  4FUL A;  4CEM A;  5CED B;  5G04 J;  1H6K A;  3JUI A;  4JB8 P;  3R7R A;  2DYS E;  2V4L A;  5AN8 A;  5BT1 A;  1UJK A;  5D66 A;  3BEE A;  3D3M A;  3IEG A;  4JHJ A;  5B3S E;  2XPY A;  4LSZ E;  4P29 A;  4GTP A;  3L13 A;  3PDN A;  1X5B A;  3ASG A;  2Q7F A;  2AXU A;  4I1A A;  1SQM A;  3SY2 A;  3MCX A;  1HH8 A;  3D9N A;  2YQ8 A;  5CRU A;  4GTS A;  5ITZ F;  2ZIS A;  2A5E A;  4EBA G;  1D8E A;  3DSW A;  3ZU7 B;  3SFX A;  3OTN A;  3FU6 A;  3MZL B;  4BX9 A;  3FUJ A;  2BKG A;  1QNF A;  3UTM A;  3CVU A;  4HB5 A;  3PEU B;  3LCA A;  3PE4 A;  4A3V A;  3OAW A;  3FEY A;  3OXL A;  1G3N B;  3Q4A B;  1X81 A;  1N0R A;  4L2Y A;  4GB9 A;  2QZA A;  4EZK A;  2NXP A;  2OVF A;  3I4R B;  1OWP A;  3ZPJ A;  3MGB A;  4UWH A;  1K3Z D;  5ENT D;  5IY5 E;  4L9P A;  2C2L A;  2WMN A;  3TWW A;  3CIA A;  4GMR A;  4H7Y A;  3DST A;  5AJD A;  2E2E A;  2MOW A;  4JVS A;  4UQZ A;  4C0E A;  3DPY A;  3ESK A;  3DPD A;  3SHF A;  4AIF A;  4UUC A;  4BET A;  4YDO A;  3T8K A;  5ENN A;  1IQR A;  1FVH A;  4U07 A;  1QBQ A;  4FHJ A;  1OCC E;  2VGX A;  3D9O A;  4CRW A;  4K03 A;  3VTY A;  3WXX A;  3FWV A;  4UWL A;  3U64 A;  3G2T A;  2R5S A;  3NBN B;  2B6C A;  3CK8 A;  3UKU G;  2RG8 A;  4GA2 A;  3G2V A;  2R59 A;  5CER B;  2NC9 A;  2F37 A;  2AXZ A;  3FTS A;  5G05 C;  1H6O A;  5FIO A;  4GZC A;  2PL2 A;  4GTR A;  3V2O A;  4GYW A;  3KEA A;  4O1P A;  2XHE A;  1O1T A;  2ZGD A;  3TGO A;  1NZN A;  3EIQ C;  4HNA D;  4I6E A;  2FEZ A;  3FUL A;  2E0I A;  3AJI A;  3FY4 A;  3CVV A;  1K1B A;  5KJN A;  2QY7 A;  3D9I A;  3EDT B;  3ZNG A;  2H6G A;  3WG7 E;  2IQC A;  3Q9N C;  1E96 B;  3HXB A;  5AYW D;  3FTV A;  4Y6C A;  2GRM A;  2ZXW E;  4I9C A;  4K5C A;  3FH5 A;  3SFY A;  4N5C A;  1A5E A;  1DNP A;  5A6C A;  3SO8 A;  3PZ4 A;  3KD7 A;  4G8K A;  3RIB A;  4ILH B;  3DXK G;  3IHY A;  2IJG X;  2JLB A;  5AIJ A;  4EEC A;  1TJC A;  3FTX A;  1BD8 A;  3RJV A;  5JHA A;  3CSF A;  2OEW A;  5D0O D;  1V54 E;  4XI0 A;  2VYI A;  3TG4 A;  3UIP C;  3OXF A;  2UWJ G;  3C5R A;  3SNX A;  5D2M C;  4BES A;  3LDZ A;  2VGX B;  2WPV A;  3ZUV B;  3UIN C;  5CRV A;  4K0R A;  3CVW A;  1OUV A;  3P2B A;  1HZ4 A;  1MZC A;  4AM9 A;  2L6J A;  3QJZ A;  5ENQ D;  4DPR A;  4L23 A;  4B93 B;  3AAA C;  2LO6 A;  3IKO B;  3DXM G;  4XKC A;  3MV3 B;  2AXV A;  3W9F A;  3IXE A;  2BUG A;  4GTV A;  4CCA A;  1Y6I A;  4BT8 A;  4AY6 A;  4APO A;  3ABK E;  2HO1 A;  2XRY A;  3L17 A;  5ENO D;  4BX8 A;  3MV2 B;  5JJT A;  4HOU A;  3RRM B;  1TNU A;  4TUU A;  2JEK A;  3HVE A;  3SFZ A;  3DWL G;  1UN8 A;  3G2W A;  3FTZ A;  4TXP A;  3TWS A;  4UI9 C;  5EIL A;  2P9N G;  2Y0B G;  3HXE A;  3PH0 C;  4G8L A;  3PZ1 A;  2P58 C;  1SW6 A;  2XEV A;  1HG2 A;  3EHR A;  5HS0 A;  5E75 A;  3CGH A;  3J5Q B;  3LJN A;  3AU4 A;  4RQI A;  5FQ4 A;  1H2V C;  2X38 A;  3ASH A;  3AS4 A;  2KC7 A;  1AP7 A;  2LAH A;  5EX0 A;  4JL0 A;  1QQE A;  2J4D A;  2WVI A;  3PUJ A;  3PZ2 A;  3J5P A;  2I6H A;  4F3V A;  4C0M A;  4HLL A;  2GRR B;  4HOS A;  1BLX B;  1E8W A;  3QNK A;  4ANV A;  3ULY A;  3L08 A;  2B0O E;  3KSL A;  1ZB1 A;  5KJM A;  4L7T A;  3Q78 A;  1WAO 1;  4PUC A;  3D9K A;  3V79 K;  3SBS A;  4DX6 D;  2XEN A;  4U8H A;  1W3B A;  3BU8 A;  3S2A A;  5H7P A;  1E8X A;  2P9U G;  4N3A A;  2BED A;  3CV0 A;  3SI5 A;  3EIJ A;  4YVO A;  4URK A;  2VSN A;  3QWV A;  5ARF A;  3RU0 A;  4JPS A;  4JC8 A;  4HOR A;  4ME2 A;  3UM0 A;  1OXJ A;  2Y1L E;  5LCW J;  2H6I A;  2RKK A;  1Q2Z A;  4UQX A;  2DBA A;  2DZO A;  4GTM A;  1QZ2 A;  3PNL B;  3CR3 A;  1BPO A;  4O60 A;  4N2Q A;  1A17 A;  2QFC A;  1NI1 A;  3ZKJ A;  4FC8 A;  2KXP C;  2IO3 C;  2VSY A;  2RFA A;  4YDW A;  5FQ7 A;  4GMJ A;  4U0Z A;  2WXF A;  2XS8 A;  3V30 A;  3NF1 A;  3DSU A;  2V4H C;  2J08 A;  4JHK A;  5KWD A;  1N95 A;  3EHN A;  1WG0 A;  4XE0 A;  4GTO A;  5M72 A;  2F0Y A;  4R7L A;  1DVP A;  1SA5 A;  3ASO E;  3Q7F A;  4DI4 A;  4F1S A;  2XQ0 A;  4IYP A;  3BG0 B;  3CHM A;  3IV0 A;  5HQ8 A;  3AG1 E;  2XS1 A;  3URZ A;  4GCO A;  4JA7 A;  1DCQ A;  2DZN A;  2WQ7 A;  2ZU6 B;  1PAQ A;  1TJF A;  4UWK A;  4EHM A;  1EF1 C;  2YHC A;  2WXJ A;  3AG4 E;  3JUE A;  3FTY A;  4IN3 B;  2IEJ A;  4YDE A;  3PRZ A;  3L82 A;  3PRE A;  4DJA A;  4K5A B;  4EPZ A;  1TR4 A;  5FTP A;  4ZFH A;  5BXU A;  4U0S A;  4BTB A;  2XCB A;  2AWI A;  4Q96 A;  1BI8 B;  2XZD G;  3RAU A;  3FU0 A;  3E30 A;  3FUH A;  3RKV A;  4F53 A;  3APF A;  3UQ3 A;  3DEP A;  1OCR E;  3LY8 A;  3TXM A;  2X6I A;  3E37 A;  2P9I G;  2XPZ A;  3QOU A;  5T8I A;  3I4G A;  3VLF A;  4WWN A;  2KCK A;  5J08 A;  4G2V A;  1S63 A;  4L1B A;  3C98 A;  4WUY A;  4Q94 A;  5KCM A;  2VQ2 A;  2J9Q A;  2XGO A;  3SBT B;  5G04 C;  5FZS A;  1E8Y A;  3QAR A;  2F8X K;  1ZU2 A;  3UX4 A;  1TNZ A;  4Z68 A;  1EYH A;  3ABL E;  3Q49 B;  2A5U A;  1OWL A;  3QC1 A;  2P9K G;  4GA1 A;  1H6P A;  3B7S A;  5AAO A;  4U96 D;  4DX7 D;  1IKN D;  5B1A E;  3KS2 A;  1U3C A;  3ULQ A;  3QAQ A;  2KCL A;  3HG0 D;  3ISM C;  4KMO A;  4A1S A;  4MBG A;  4HRN A;  1NA3 A;  3HRA A;  2HE0 A;  2OCC E;  4FP7 A;  2XCC A;  3R9M A;  4N5Q A;  4BWR A;  5AQ7 A;  4ILI A;  4IUL A;  3PE3 A;  3B7U X;  3JXJ A;  1GW6 A;  1N0Q A;  2X6K A;  3ZN3 A;  1O5M A;  3V2X A;  1TYQ G;  4HQD A;  2IU1 A;  3RO3 A;  2GRP B;  4XIF A;  2LNI A;  3ASF A;  1MHQ A;  1Z5S C;  2Y3A A;  3MKQ A;  1SVX A;  3E33 A;  3ZYQ A;  5AAR A;  1HE8 A;  2A4Z A;  3CVY A;  2LXM A;  3CEQ A;  4XX5 A;  1IQU A;  2L6B A;  2R02 A;  2WXQ A;  2ION A;  4J6I A;  2ZIR A;  4GPK A;  2XGM A;  3KEZ A;  3IHV A;  3FU3 A;  3LVQ E;  3RO2 A;  2WXI A;  4UWF A;  1JUQ A;  3E34 A;  3FTU A;  3Q5M A;  3LJ3 A;  5KNH D;  3Q9U C;  3E4B A;  4ATG A;  1HU3 A;  3SGH A;  2XZT G;  1TNO A;  4GPM A;  4CDN A;  4GZD A;  5FWQ A;  5CBN A;  5A23 A;  3ASD A;  3FU5 A;  2V5F A;  2JAB A;  3CST A;  5FZQ A;  4G26 A;  2PM7 A;  2PM6 A;  2VSX E;  1JPL A;  4J8Y A;  1OCO E;  2FO7 A;  4MRU A;  4HOT A;  5CEC B;  1HG5 A;  4HRM B;  2KBX A;  4OYS A;  2I1K A;  4G23 A;  2XGS A;  1XNF A;  3AU5 A;  2LSU A;  3ESL A;  5BW8 C;  4CGV A;  3UMV A;  1NFI E;  2L9B A;  4I1M A;  3JQ0 A;  5KJK A;  4JD2 G;  3NOC D;  3FP3 A;  2BTD A;  3TWR A;  1E90 A;  2GRN B;  2MHK A;  4AXH A;  2YIN A;  3FUK A;  3MKQ B;  5EYL A;  3ZXS A;  1NA0 A;  5HKP A;  3MKR A;  1Z6T A;  2HM8 A;  5ENR D;  4JHR A;  4OAU C;  4DX5 D;  3S7D A;  4M7C A;  4HXI A;  5JMN D;  4I17 A;  3AG2 E;  2CHW A;  3CVL A;  4HBD A;  4M3O A;  2I1J A;  3BQO A;  5T4Y A;  1LF8 A;  1UOH A;  2NSZ A;  3L16 A;  1JWG A;  4UI9 K;  4FJY A;  4E85 A;  1BI7 B;  3CKB A;  2OV8 A;  4OVU A;  4MLP A;  3CVX A;  3LY7 A;  4GYY A;  3QDN A;  4NRH B;  4DK5 A;  2VGY A;  3B7T A;  4JA9 A;  2WXN A;  3CVP A;  2PQN A;  4XI9 A;  1OWM A;  3UIO C;  1V55 E;  2Y4T A;  3U3W A;  1PY1 A;  3CK9 A;  4AP2 A;  1NP7 A;  2R03 A;  3HXD A;  4CYM D;  2J07 A;  2OOE A;  5CCM A;  4GZ5 A;  5E76 A;  5C2Y A;  1DC2 A;  1N9A A;  3B13 A;  4E6H A;  3Q47 B;  1FT2 A;  3BG1 B;  5EX3 A;  4CZ2 D;  3LS8 A;  1P5Q A;  4UQY A;  2PNN A;  5ANL A;  4U8V D;  2L0T B;  3GZS A;  1KT1 A;  1LD8 A;  4G11 A;  2KZT A;  4AEZ C;  3NAW A;  4ATZ D;  4XKB A;  2VSO E;  3ZYL A;  4LER A;  4HI9 A;  2YHE A;  1FVF A;  4U7E B;  2X6J A;  1N54 A;  5EN5 D;  4LEU A;  3Q79 A;  3B7R L;  3L9T A;  1SZA A;  4FLH A;  4RVB A;  3ZW3 A;  3FUI A;  3ZEF A;  1U3D A;  4ABN A;  4CT4 A;  1D9S A;  2OEV A;  3E32 A;  3DSS A;  4GML A;  3VLD A;  3U9W A;  4N3B A;  2IO2 C;  3KAE A;  4KZ0 A;  4YVQ C;  3LPZ A;  3CLJ A;  5AQB A;  3CVQ A;  3UT8 A;  4GYO A;  2IFU A;  2R17 C;  2QYU A;  3L6A A;  4A63 B;  2KAT A;  3S7B A;  1KZP A;  3HYM B;  3K9I A;  4DX2 A;  1HXI A;  1HS6 A;  4NQ0 A;  2WXG A;  3QWW A;  2XPI A;  4LNB A;  3VTX A;  5JHB A;  2WXL A;  4J7W A;  2MRI A;  3MJW A;  4RG9 A;  4KT6 B;  5FQ8 A;  1VDY A;  3GYZ A;  5JA4 D;  3HVE B;  3HIZ A;  4BY6 A;  2GRQ B;  5J90 A;  2I9C A;  3R7Q A;  3TWT A;  3SZ7 A;  4I2W A;  4KVM A;  4WNE A;  5FQ6 A;  4FAD A;  2WXO A;  4G1T A;  3TWX A;  5LCW C;  5KJL A;  3FEX A;  3TWU A;  2KZT B;  3VLE A;  5AQ9 A;  1SA4 A;  4GCN A;  2J4B A;  3CKC A;  3TJP A;  3D9H A;  3RRN B;  1N4Q A;  1UW4 B;  4U63 A;  3RSE G;  3ZYK A;  1HO8 A;  1TEZ A;  4JW1 A;  4J8E A;  1INZ A;  3PZD A;  4FLB A;  3C72 A;  2IY0 C;  1FPP A;  3TL5 A;  4BTA A;  1TN8 A;  2X6H A;  3UI2 A;  4WAF A;  3FHE A;  1H0A A;  5T3R A;  4Y6W A;  4AV7 A;  3SF4 A;  3C3Q A;  1OWO A;  3GW4 A;  3C3R A;  3EU9 A;  4A3T A;  2LXL A;  1RW2 A;  3PVL A;  2EIN E;  1SZ9 A;  2CFU A;  2GGF A;  3QB2 A;  5FT9 A;  4RG6 A;  2IOL A;  3D9L A;  3I3N A;  1ELW A;  4B8A A;  2VJ8 A;  4DLQ A;  3JQ1 A;  1N11 A;  2ZGG A;  4MS6 A;  4XEI G;  5EIB E;  3UM2 A;  4JXT A;  3CHS A;  3B7B A;  2QC9 A;  3S7J A;  1EPU A;  2EQX A;  3ASN E;  3FDH A;  2WB2 A;  1ELR A;  4BSX A;  2WMO A;  4HRL A;  2EIL E;  2M63 A;  2PQR A;  4I1O B;  3ZGQ A;  3ZVV A;  2QYJ A;  1S0P A;  4F1P A;  3C3O A;  4BSZ B;  4I6J A;  3MYV A;  2H6H A;  2WM9 A;  1LTX A;  4TV3 A;  4WWP A;  3FUN A;  3R9A B;  5G55 A;  4C48 B;  1E8Z A;  3ZXP A;  3ZHE A;  1MX2 A;  2KM4 A;  5CHE E;  5EID A;  4RLY A;  3O48 A;  2VTB A;  4I6G A;  4I9E A;  4XZ4 A;  1E7U A;  1WY6 A;  3SQV A;  3TXN A;  4YND A;  4WND A;  4D10 C;  4FHK A;  4DX1 A;  3NQP A;  4MKT A;  1K1A A;  3LKU A;  5EKQ D;  2CG3 A;  4NIK A;  4TUM A;  3FUE A;  2J09 A;  3FUM A;  3RRU A;  4J0U A;  3QWP A;  1WM5 A;  2WQ6 A;  5ANR A;  4KBQ A;  2P9L G;  2UY1 A;  3L54 A;  4PH4 B;  1OT8 A;  3FFL A;  1H2T C;  3NZS A;  4IRU A;  3LXU X;  2V5Q C;  2ETC A;  2X6F A;  1IXV A;  3GZ1 A;  2FI7 A;  1FT1 A;  3UPV A;  1D8D A;  3LY9 A;  3CQC B;  4JZY A;  2FO1 E;  4KZC A;  5LFA A;  4GZ3 A;  2C0L A;  1TNB A;  1OWN A;  3W9G A;  1Z3X A;  4J8S A;  4V3I A;  5EDS A;  4N39 A;  5A7D B;  3PNT B;  4WWO A;  5C1D A;  1KPS B;  3P1U A;  5G05 J;  3ML9 A;  1TN6 A;  4O6F A;  3EHM A;  1YCS B;  2FUL A;  2P9S G;  4PS7 A;  3UM3 A;  3FTW A;  5D0Q D;  3ONK A;  5ENP D;  4HOQ A;  3SD5 A;  1EDU A;  4N2S A;  1TN7 A;  3ZHE B;  3JYS A;  1UG3 A;  3N71 A;  3APD A;  4DI3 A;  2X3M A;  1U2V G;  2C0M A;  4FA6 A;  4FU3 A;  4H7X A;  1KZO A;  2VTB B;  1BU9 A;  2XEH A;  3BUA A;  4GZ6 A;  3G2S A;  1YYH A;  1E7V A;  2EIK E;  5AJL A;  2EIM E;  3TWQ A;  4EZL A;  5CCL A;  2Y69 E;  3V31 A;  1JCR A;  3Q15 A;  5FZR A;  3G2U A;  1UJJ A;  4C9B B;  5JJ7 A;  2XRZ A;  3Q7A A;  3CHQ A;  3FUF A;  1H19 A;  2WXP A;  3DSV A;  2Y4U A;  2UY1 B;  2WXM A;  4PS8 A;  4KYO B;  3RK6 A;  4W9R A;  4ANW A;  4AVX A;  2J8S D;  3HHM A;  3APC A;  3O4Z A;  4O1O A;  1JCQ A;  2OND A;  2DIW A;  3JXI A;  3T8M A;  5KNG A;  5DIZ A;  1ZBP A;  5LP0 A;  3U66 A;  4BFR A;  4ANU A;  2ETA A;  1N52 A;  3D9P A;  5FJY A;  3IBE A;  4L2L A;  3T5X A;  5LX8 A;  4G24 A;  2GRO B;  4QFV A;  3S7F A;  2CG2 A;  2VGE A;  5DBK A;  4LNG A;  4CGW A;  2WQH A;  2HYZ A;  3PS6 A;  4U95 D;  3ABM E;  5BXO A;  4TXQ A;  3TAX A;  3ZYM A;  1O1S A;  3AG3 E;  3TG5 A;  2FF4 A;  2DYR E;  4J8D A;  3QK0 A;  3NB2 A;  3QKY A;  3UXG A;  4JEH A;  4DUI A;  3LVR E;  4BT9 A;  1KT0 A;  2LAI A;  4APF A;  2FBN A;  1IHG A;  1HF8 A;  3CVN A;  4WNG A;  3HXC A;  2P2C P;  2ETB A;  1N94 A;  2ILR A;  5CEA A;  1MQS A;  4AOF A;  1QYM A;  3FH8 A;  3ENE A;  3AS5 A;  1NL4 A;  2WXR A;  4UI9 J;  3L22 A;  4KXK B;  4HVB A;  3GZ2 A;  3UT7 A;  2AJA A;  4F6R D;  3D9J A;  4OVV A;  1HX8 A;  3NOG D;  4BER A;  4EBA A;  5B1B E;  2IOS A;  4N3C A;  2LUH A;  5KBA A;  4EQF A;  2OVB A;  3LEW A;  2CFZ A;  5JJ6 A;  4LNU D;  2H6F A;  2PZI A;  4Q69 A;  2DVW A;  1JCS A;  4AJW A;  4ZHB A;  3MA5 A;  2MYO A;  2CHX A;  4CDR A;  4HLE A;  3D9M A;  4HI8 A;  2J49 A;  4ACL A;  2R05 A;  4J8F A;  3UM1 A;  2DWZ A;  3DSX A;  5BV0 A;  4WNF A;  3OXG A;  1UN9 A;  3T9K A;  3NZU A;  2AVP A;  3FUD A;  4G25 A;  4GTT A;  3EJN A;  5ENS D;  3UKR G;  4JEU A;  2V8S E;  4QQI A;  3DBS A;  3T5V A;  3ULE G;  4A1G A;  4U0U A;  4I2Z A;  3AS8 A;  4RSY A;  4B8C B;  1K8K G;  3MEK A;  3JCK C;  4CT0 A;  3ML8 A;  4TRQ A;  3HXF A;  2CHZ A;  2WXH A;  2HR2 A;  1MJ0 A;  4UWG A;  1AWC B;  2L0I A;  3ZFW A;  3CHP A;  3CHR A;  4NUR A;  3I5P A;  1MX6 A;  1L5J A;  3ONL A;  5G2N A;  4TXR A; 
#chains in the Genus database with same CATH homology
 3CHS A;  2UWJ G;  3MKQ A;  3SNX A;  3CQG B;  4U04 A;  3S7J A;  3ZYQ A;  3LDZ A;  1EPU A;  2EQX A;  1HE8 A;  2A4Z A;  3CVY A;  4NAC A;  1HFA A;  2VGX B;  2WPV A;  3CEQ A;  4XX5 A;  3FDH A;  2WB2 A;  4I43 A;  4K0R A;  3CVW A;  1IQU A;  1OUV A;  5BPP A;  1ELR A;  3P2B A;  2WXQ A;  2ION A;  2V0P A;  3HDX A;  1HZ4 A;  4J6I A;  4B0Z A;  4AM9 A;  2L6J A;  4GPK A;  3QJZ A;  4BSX A;  4DLO A;  2WMO A;  2XGM A;  3KEZ A;  2AW6 A;  4DPR A;  4L23 A;  3IHV A;  2M63 A;  2PQR A;  3FU3 A;  3LVQ E;  3RO2 A;  2WXI A;  4I1O B;  4UWF A;  2LO6 A;  3ZGQ A;  3ZRH A;  3ZVV A;  1JUQ A;  1S0P A;  2KCV A;  3FTU A;  3IKO B;  4XKC A;  3MV3 B;  2AXV A;  4I6J A;  1XGW A;  3MYV A;  5BV1 A;  3Q5M A;  2BUG A;  2IF4 A;  2WM9 A;  3LJ3 A;  4GA0 A;  4CCA A;  4TV3 A;  1Y6I A;  4BT8 A;  2DCP A;  4WWP A;  4AY6 A;  4APO A;  3FUN A;  3R9A B;  5AEN A;  5G55 A;  2HO1 A;  1E8Z A;  2XRY A;  3E4B A;  2BF0 X;  3L17 A;  3ZHE A;  4ATG A;  4B89 A;  2KM4 A;  5CHE E;  5HI7 A;  4F7A A;  4ANX A;  1HU3 A;  3SGH A;  4BX8 A;  3LYA A;  3MV2 B;  3O48 A;  5JJT A;  2VTB A;  4HOU A;  3RRM B;  4I6G A;  4CDN A;  4I9E A;  1Z3Y A;  4GZD A;  4TUU A;  4XZ4 A;  1E7U A;  1WY6 A;  5FWQ A;  3TXN A;  2JEK A;  3HVE A;  4YND A;  3SFZ A;  4WND A;  5A23 A;  3ASD A;  3PEV B;  2WXK A;  4HS2 A;  3UUX A;  3FU5 A;  4D10 C;  1UN8 A;  4B94 A;  4FHK A;  2V5F A;  3G2W A;  4EZJ A;  3NQP A;  3FTZ A;  4MKT A;  5BUZ A;  3UT4 A;  4LCT A;  4UI9 C;  3LKU A;  5EKQ D;  2CG3 A;  1B89 A;  3CST A;  5CMY A;  5FZQ A;  4KVO A;  3FUE A;  4G26 A;  2PM7 A;  4PDX A;  2J09 A;  3PH0 C;  2PM6 A;  3FUM A;  2VSX E;  1JPL A;  3RRU A;  2P58 C;  4J0U A;  3ZIM A;  2FO7 A;  3MX3 A;  2XEV A;  1HG2 A;  4MRU A;  3QWP A;  1KLX A;  4HOT A;  1HG5 A;  5E75 A;  1WM5 A;  2WQ6 A;  5ANR A;  3PUK A;  1H2U A;  4KBQ A;  3CGH A;  4OYS A;  2I1K A;  2UY1 A;  3AU4 A;  4G23 A;  5CMW A;  5FQ4 A;  2LSV A;  1H2V C;  2XGS A;  1XNF A;  3L54 A;  1ELK A;  2X38 A;  4PH4 B;  3ASH A;  3AS4 A;  3AU5 A;  4LUN U;  2KC7 A;  2LSU A;  1PC2 A;  3ESL A;  5BW8 C;  3FFL A;  3FH7 A;  4CGV A;  2YNQ A;  4GU5 A;  1H2T C;  3UMV A;  2LAH A;  1Y8M A;  5EX0 A;  3U4T A;  1FCH A;  2L9B A;  4I1M A;  3JQ0 A;  4HFG A;  4JL0 A;  1QQE A;  5KJK A;  3NZS A;  3FP3 A;  4IRU A;  3LXU X;  2BTD A;  1JWF A;  2J4D A;  4CDM A;  2WVI A;  3PUJ A;  3CHO A;  2X6F A;  1E90 A;  4AXH A;  2MHK A;  3GZ1 A;  2YIN A;  3FUK A;  3MKQ B;  4ILG A;  2I6H A;  2FI7 A;  3UPV A;  4ACK A;  4F3V A;  3ZXS A;  4C0M A;  2I2O A;  3LY9 A;  1NA0 A;  3CQC B;  4JZY A;  3MKR A;  5LOZ A;  4KZC A;  4HOS A;  2GRL A;  5LFA A;  4PS3 A;  4AY5 A;  4LRZ A;  1E8W A;  1YA0 A;  3QNK A;  4GZ3 A;  1Z6T A;  4ANV A;  2C0L A;  2HM8 A;  3L08 A;  4JHR A;  5KJM A;  4L7T A;  1OWN A;  1Z3X A;  4J8S A;  4V3I A;  1IYG A;  5EDS A;  1WAO 1;  4GAA A;  3D9K A;  4N39 A;  4PUC A;  4FJZ A;  3S7D A;  5G2N A;  3CK7 A;  5A7D B;  2GW1 A;  5BNW A;  3SBS A;  4HXI A;  2RD0 A;  4I17 A;  3PNT B;  1W3B A;  4U8H A;  5ARG A;  2CHW A;  3S2A A;  4A55 A;  4WWO A;  5C1D A;  1E8X A;  3CVL A;  4M3O A;  4FUL A;  4N3A A;  2I1J A;  5T4Y A;  3P1U A;  1LF8 A;  5G05 J;  4CEM A;  3CV0 A;  3ML9 A;  3SI5 A;  3TG4 A;  4O6F A;  2NSZ A;  3EHM A;  3EIJ A;  3L16 A;  4YVO A;  4URK A;  2FUL A;  1JWG A;  4PS7 A;  2VSN A;  3FTW A;  4UI9 K;  5G04 J;  3QWV A;  1H6K A;  3JUI A;  4FJY A;  5ARF A;  3RU0 A;  4E85 A;  4JPS A;  3R7R A;  5D0Q D;  3ONK A;  4JC8 A;  4HOQ A;  3CKB A;  4HOR A;  4ME2 A;  2OV8 A;  4OVU A;  2V4L A;  3SD5 A;  5LCW J;  4MLP A;  1EDU A;  4N2S A;  3CVX A;  3LY7 A;  5BT1 A;  1UJK A;  4GYY A;  3ZHE B;  4UQX A;  2DBA A;  3BEE A;  3D3M A;  3IEG A;  3QDN A;  4JHJ A;  1QZ2 A;  2XPY A;  3JYS A;  4NRH B;  1UG3 A;  2VGY A;  3N71 A;  4P29 A;  4DK5 A;  3B7T A;  3APD A;  3L13 A;  3PNL B;  3PDN A;  1X5B A;  2X3M A;  3CR3 A;  4JA9 A;  2C0M A;  4DI3 A;  2WXN A;  4FU3 A;  4H7X A;  4FA6 A;  3ASG A;  1BPO A;  2PQN A;  3CVP A;  2Q7F A;  2VTB B;  2AXU A;  4I1A A;  4N2Q A;  1A17 A;  2QFC A;  1SQM A;  4GZ6 A;  4XI9 A;  3G2S A;  1OWM A;  4FC8 A;  2Y4T A;  3U3W A;  3MCX A;  1E7V A;  4JXT A;  1PY1 A;  5AJL A;  3CK9 A;  1HH8 A;  2VSY A;  4AP2 A;  1NP7 A;  2J07 A;  3D9N A;  2OOE A;  2YQ8 A;  5FQ7 A;  4EZL A;  5CCM A;  4GZ5 A;  5E76 A;  4GMJ A;  5CCL A;  5C2Y A;  4U0Z A;  3B13 A;  4E6H A;  3Q47 B;  3BG1 B;  3Q15 A;  5EX3 A;  4EBA G;  5FZR A;  2WXF A;  3G2U A;  3LS8 A;  1UJJ A;  1P5Q A;  4C9B B;  5JJ7 A;  3NF1 A;  2XRZ A;  3OTN A;  4UQY A;  3FU6 A;  5ANL A;  3MZL B;  4BX9 A;  3FUJ A;  2J08 A;  3CHQ A;  3FUF A;  4JHK A;  1H19 A;  1QNF A;  2L0T B;  3CVU A;  2WXP A;  3EHN A;  3GZS A;  2Y4U A;  2UY1 B;  1KT1 A;  4XE0 A;  2WXM A;  4PS8 A;  4KYO B;  5M72 A;  4G11 A;  3RK6 A;  4W9R A;  3PEU B;  4ANW A;  2KZT A;  4R7L A;  3LCA A;  4AVX A;  1DVP A;  4AEZ C;  3PE4 A;  3HHM A;  4DI4 A;  3APC A;  4XKB A;  4F1S A;  2VSO E;  2XQ0 A;  4A3V A;  3O4Z A;  4IYP A;  3BG0 B;  3CHM A;  4LER A;  3IV0 A;  3ZYL A;  5HQ8 A;  3URZ A;  4GCO A;  3OAW A;  3FEY A;  2OND A;  2DIW A;  2YHE A;  3OXL A;  4JA7 A;  3Q4A B;  3T8M A;  1FVF A;  4L2Y A;  5DIZ A;  4GB9 A;  2X6J A;  1ZBP A;  4EZK A;  2WQ7 A;  2ZU6 B;  1N54 A;  2NXP A;  5LP0 A;  3U66 A;  2OVF A;  4BFR A;  1PAQ A;  3I4R B;  4ANU A;  4LEU A;  1OWP A;  1TJF A;  3B7R L;  3ZPJ A;  1SZA A;  4UWK A;  4FLH A;  1N52 A;  3D9P A;  4RVB A;  5FJY A;  3ZW3 A;  3MGB A;  3FUI A;  3IBE A;  4UWH A;  4L2L A;  3T5X A;  3ZEF A;  1EF1 C;  1U3D A;  5LX8 A;  2C2L A;  4G24 A;  2YHC A;  2WXJ A;  2WMN A;  4QFV A;  3S7F A;  4ABN A;  4CT4 A;  2CG2 A;  3FTY A;  3CIA A;  4IN3 B;  5DBK A;  4H7Y A;  5AJD A;  3PRZ A;  3PRE A;  2E2E A;  4CGW A;  2WQH A;  2MOW A;  4GML A;  4JVS A;  3VLD A;  4DJA A;  4EPZ A;  3U9W A;  5FTP A;  2HYZ A;  3PS6 A;  4N3B A;  4UQZ A;  3KAE A;  4C0E A;  4U0S A;  3TAX A;  4KZ0 A;  4YVQ C;  3ZYM A;  4BTB A;  3LPZ A;  2XCB A;  3CLJ A;  2AWI A;  3DPD A;  3ESK A;  4Q96 A;  3SHF A;  4AIF A;  3TG5 A;  3CVQ A;  2FF4 A;  3UT8 A;  4GYO A;  4J8D A;  2IFU A;  3QK0 A;  2R17 C;  3L6A A;  3QKY A;  3FU0 A;  3FUH A;  2KAT A;  4JEH A;  3RKV A;  3LVR E;  3APF A;  3S7B A;  4F53 A;  3UQ3 A;  3K9I A;  3HYM B;  4BT9 A;  1HXI A;  1HS6 A;  1KT0 A;  1IQR A;  5ENN A;  2LAI A;  4APF A;  3LY8 A;  1FVH A;  2FBN A;  4U07 A;  4NQ0 A;  3TXM A;  1IHG A;  4FHJ A;  1HF8 A;  2VGX A;  2X6I A;  3CVN A;  3D9O A;  4WNG A;  4CRW A;  2WXG A;  3QWW A;  4K03 A;  2XPI A;  3VTY A;  3FWV A;  2XPZ A;  4UWL A;  3U64 A;  3WXX A;  3G2T A;  3QOU A;  3VTX A;  2R5S A;  5JHB A;  5T8I A;  2WXL A;  2ILR A;  2MRI A;  3CK8 A;  3MJW A;  4RG9 A;  3I4G A;  4KT6 B;  1MQS A;  3VLF A;  5FQ8 A;  4WWN A;  2KCK A;  4AOF A;  1VDY A;  2RG8 A;  5J08 A;  3FH8 A;  4G2V A;  4GA2 A;  3GYZ A;  3G2V A;  4L1B A;  3ENE A;  3AS5 A;  2R59 A;  3HVE B;  3HIZ A;  3C98 A;  4BY6 A;  4WUY A;  2NC9 A;  2WXR A;  2AXZ A;  3FTS A;  3L22 A;  4Q94 A;  4UI9 J;  5J90 A;  4KXK B;  5G05 C;  2I9C A;  2VQ2 A;  3GZ2 A;  5KCM A;  3R7Q A;  3UT7 A;  4HVB A;  2J9Q A;  2XGO A;  3SZ7 A;  4I2W A;  4KVM A;  4GZC A;  3SBT B;  4WNE A;  3D9J A;  2PL2 A;  4OVV A;  1HX8 A;  5FQ6 A;  5FZS A;  5G04 C;  4FAD A;  1E8Y A;  4EBA A;  4GYW A;  3QAR A;  1ZU2 A;  2WXO A;  2IOS A;  3UX4 A;  4N3C A;  2XHE A;  4G1T A;  4EQF A;  1EYH A;  5LCW C;  3Q49 B;  3TGO A;  1NZN A;  2OVB A;  3EIQ C;  3LEW A;  2A5U A;  1OWL A;  2CFZ A;  3QC1 A;  4I6E A;  5JJ6 A;  2FEZ A;  3FUL A;  2E0I A;  5KJL A;  3FEX A;  4GA1 A;  3FY4 A;  2PZI A;  4Q69 A;  3CVV A;  4AJW A;  2KZT B;  3B7S A;  3VLE A;  5KJN A;  3MA5 A;  2CHX A;  4GCN A;  2QY7 A;  4CDR A;  2J4B A;  3CKC A;  3TJP A;  3D9I A;  4HLE A;  3D9M A;  3EDT B;  2J49 A;  3RRN B;  3KS2 A;  1U3C A;  1UW4 B;  3ULQ A;  4U63 A;  3QAQ A;  2KCL A;  4J8F A;  4ACL A;  2IQC A;  3ZYK A;  4KMO A;  1HO8 A;  4A1S A;  1TEZ A;  4JW1 A;  5BV0 A;  1E96 B;  4J8E A;  4WNF A;  3OXG A;  1INZ A;  1UN9 A;  3PZD A;  5AYW D;  3NZU A;  4FLB A;  1NA3 A;  2AVP A;  3FUD A;  4G25 A;  3EJN A;  4FP7 A;  2XCC A;  4JEU A;  2V8S E;  3TL5 A;  4BTA A;  3FTV A;  3DBS A;  4Y6C A;  2X6H A;  3T5V A;  2GRM A;  4BWR A;  4WAF A;  4A1G A;  3FHE A;  4U0U A;  1H0A A;  5T3R A;  4I9C A;  4I2Z A;  4Y6W A;  4ILI A;  4IUL A;  3AS8 A;  4RSY A;  3PE3 A;  3FH5 A;  4N5C A;  4B8C B;  3SF4 A;  4AV7 A;  1DNP A;  3MEK A;  1OWO A;  3B7U X;  3JCK C;  4CT0 A;  3GW4 A;  1GW6 A;  5A6C A;  3ML8 A;  4A3T A;  4TRQ A;  2X6K A;  3ZN3 A;  3PVL A;  1SZ9 A;  2CFU A;  3KD7 A;  2GGF A;  3QB2 A;  2CHZ A;  4ILH B;  2WXH A;  5FT9 A;  3IHY A;  2IJG X;  2IU1 A;  2JLB A;  3RIB A;  4RG6 A;  5AIJ A;  3RO3 A;  2HR2 A;  2IOL A;  1TJC A;  3D9L A;  4EEC A;  3I3N A;  1ELW A;  3FTX A;  4UWG A;  4B8A A;  2VJ8 A;  4DLQ A;  3RJV A;  3JQ1 A;  2L0I A;  5JHA A;  3ZFW A;  4MS6 A;  4XIF A;  2LNI A;  3CSF A;  3CHP A;  3CHR A;  4NUR A;  3ASF A;  5D0O D;  3I5P A;  4XI0 A;  1MHQ A;  1L5J A;  2VYI A;  3ONL A;  3OXF A;  2Y3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...