5FZSA

Designed tpr protein m4n delta c (cf ii)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
107
structure length
107
Chain Sequence
NSIKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNNIKTLSNLANLLAQEGKAEEAIKYMRKAVSLDPNNIKTLSNLAVLLAQEGKAEEAIKYMRKAVSLIDKAAKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DESIGNED TPR PROTEIN
publication title Origin of a folded repeat protein from an intrinsically disordered ancestor.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Unknown function
total genus 43
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5fzsA00
2FBNA 5G05J 1HH8A 4N2SA 3UPVA 4J8DA 5ARGA 1A17A 3S7FA 5C1DA 3SF4A 4LEUA 3RO2A 3AS8A 2LNIA 3SZ7A 2ONDA 2WPVA 2HO1A 2PZIA 5D0QD 4N3CA 3ASDA 4HORA 3S7JA 2R5SA 2HR2A 4CGWA 3QDNA 3QWWA 5G05C 4NRHB 4BTAA 3UUXA 2KATA 4YVOA 3URZA 4XIFA 5CCLA 4U04A 1ZU2A 3CVPA 3LYAA 3MV2B 3UQ3A 2NC9A 4HOTA 3LCAA 3CK8A 4GA1A 4AIFA 4HOSA 3NF1A 4AM9A 2P58C 4J8EA 2FF4A 4WNEA 4UI9C 3QKYA 4GA0A 5FJYA 3FWVA 2Q7FA 4G23A 5DIZA 1NA0A 3ASGA 3E4BA 2GW1A 3S7BA 3PE4A 5CCMA 5FTPA 4H7XA 4O6FA 4BT9A 4I2ZA 2I6HA 2VYIA 2VSYA 2Y4TA 4GCOA 5LCWC 4U0ZA 3MV3B 2LSVA 1WM5A 3CEQA 2XCBA 2VQ2A 5FZSA 5ARFA 1FCHA 4Y6CA 5EKQD 4N5CA 3QWVA 5BNWA 4GZ6A 3Q47B 4N39A 3U4TA 3QWPA 2QFCA 2C0LA 5EX0A 4G1TA 1IHGA 4BTBA 3Q5MA 3RKVA 3GYZA 2AVPA 2VGXA 2E2EA 5A7DB 4WNFA 4AY6A 1QZ2A 4JHRA 4UI9J 4I9CA 2FI7A 2VGXB 3ASFA 4GZ3A 1YA0A 2XCCA 3CVLA 3O48A 5G04C 3TG5A 1KT1A 4BWRA 3ULQA 2C0MA 4YVQC 2KC7A 2LSUA 2IF4A 3LKUA 3AS4A 3OXFA 4KBQA 3IEGA 3RU0A 3N71A 5LCWJ 3KAEA 3WXXA 4W9RA 3FP3A 2JLBA 3EDTB 4APOA 4U0UA 2MHKA 5BW8C 4XI9A 3K9IA 3ESKA 3ZFWA 1HXIA 3VTYA 1PC2A 4KYOB 2FO7A 3OXLA 5KJLA 4IN3B 4N2QA 3RJVA 3TAXA 1IYGA 4CDRA 3GZ1A 2PL2A 1HZ4A 4UQYA 5FZQA 4WNGA 4GYWA 3MKRA 3OXGA 4N3BA 3BEEA 4I9EA 3MEKA 4JA9A 3CVQA 4UI9K 4U07A 4BT8A 1KT0A 5M72A 4Y6WA 4ME2A 1KLXA 4GZ5A 4YNDA 2KCKA 3KD7A 5A6CA 4A1SA 4NQ0A 5KJKA 3CK7A 3CKBA 4U0SA 1E96B 3TGOA 5JJ7A 3MA5A 4I2WA 2Y4UA 5G04J 3R9AB 3ZPJA 4I17A 1TJCA 5KJMA 4HOUA 3QOUA 4UQXA 4RG9A 2XPIA 3CK9A 1ELWA 1ELRA 3ZHEA 1P5QA 1B89A 1NA3A 4WUYA 3S7DA 2L6JA 2C2LA 3ZHEB 5EX3A 3GW4A 4JA7A 2XGSA 1WAO1 3Q4AB 4N3AA 5HI7A 4CGVA 2KCLA 4G24A 4I1AA 2XEVA 2YQ8A 3AS5A 2PQRA 4GYYA 1ZBPA 3LY9A 3TG4A 4H7YA 2V5FA 4EQFA 2UWJG 3ZGQA 4ABNA 4GCNA 3RO3A 4G2VA 4WNDA 2VSNA 4HOQA 1XNFA 5D0OD 2BUGA 2UY1A 4AY5A 3PDNA 1Y8MA 5BT1A 3CVNA 1QQEA 3CKCA 2HYZA 2UY1B 4G26A 5HQ8A 1W3BA 2J9QA 2YHCA 2IFUA 3JYSA 2FEZA 2OOEA 2XGOA 4XI0A 3Q15A 5CHEE 3Q49B 2PQNA 3LY7A 3ZN3A 5AYWD 2WQHA 3FFLA 5KJNA 3KS2A 5FZRA 2VGYA 5DBKA 4GPKA 4G25A 3PE3A 5FT9A 3ASHA 3LY8A 2KCVA 2XGMA 2DBAA 4KXKB 4J0UA 4RG6A 3HYMB 3RIBA 3LPZA 1OUVA 4GYOA 5JJ6A 3CV0A 4GA2A 4UQZA 3U3WA 4JL0A 5JJTA 3GZ2A 3VTXA 1NZNA 4F3VA 4J8FA 4B94A
chains in the Genus database with same CATH superfamily
2FBNA 3UPVA 3CVWA 4EPZA 1A17A 3CVUA 4YDWA 3FUKA 3L22A 3AS8A 4BSZB 2LNIA 5B1AE 1UN8A 1ZB1A 3UIPC 3UT4A 2ILRA 4DX2A 1MZCA 2HO1A 1V55E 1VDYA 3ISMC 4GTPA 5ENTD 3QC1A 4N3CA 5AQAA 2JEKA 2NYJA 3S7JA 3D3MA 3DSVA 3J5PA 4PUCA 3U66A 4UWLA 4BSXA 1O1RA 5G05C 1X81A 2P9KG 3QJZA 2XRYA 2ZGGA 1Z6TA 2RD0A 2WXJA 5FQ6A 4XIFA 5CCLA 2VJ8A 3TWTA 3ML8A 1OCZE 5FIOA 3MV2B 2X6IA 1E8WA 3L13A 1OCCE 4HOSA 3T9KA 4AM9A 4J8EA 3ONLA 4IYPA 2BKKB 4UI9C 1N95A 4BERA 2DYSE 3AG4E 4WAFA 3G2WA 2ETBA 2X6KA 2Q7FA 3PZDA 5DIZA 2PM6A 3QB2A 2GW1A 5FQ7A 3HXDA 1BPOA 2MRIA 2WXMA 3MZLB 2R03A 5D2MC 5FTPA 3ZXPA 4H7XA 4I2ZA 2I6HA 4MS6A 2ZIRA 4F1PA 1NFIE 4O1PA 3FDHA 2OCCE 3LVRE 2LSVA 1EF1C 3HRAA 3CEQA 3FTZA 4JVSA 5T4YA 4PS3A 4OYSA 2QY7A 3ZIMA 4ANXA 1TNOA 4FHKA 4GTVA 4AEZC 3EIQC 4N39A 1MYOA 3SFXA 4AVXA 4G1TA 3ONKA 2I1KA 3R7QA 1JPLA 2EIME 1SA5A 4WNFA 4ACKA 2FI7A 2WXFA 2EIKE 3G2VA 2VGXB 3UM2A 2H6HA 1YA0A 5LFAA 3CR3A 1N4SA 4I6JA 4G11A 4CYMD 3B7UX 4GB9A 2XZTG 1TN6A 2C0MA 2P9LG 4F1SA 2LSUA 1H2UA 3SHFA 3AS4A 3OXFA 1PAQA 4GZDA 2ZISA 3JUIA 5EDSA 1SZ9A 1TYQG 3RSEG 3UINC 1AWCB 4LNBA 3RU0A 1G3NB 1DVPA 5LCWJ 4J6IA 1FT2A 1HX8A 4I1MA 4APOA 3FUFA 1MJ0A 3ZYQA 4KVOA 4U0UA 5BW8C 4EZJA 1MHQA 2IOSA 4DX6D 2NSZA 1HXIA 4PS8A 3VTYA 3C5RA 4HS2A 3NAWA 5KJLA 2F8XK 3RJVA 4JW1A 1LF8A 1EDUA 1IYGA 2PL2A 4WNGA 3TWRA 3BEEA 1NP7A 2XZDG 3MEKA 4GTRA 3FUHA 3I3NA 3CVXA 3UM3A 4I6EA 1KLXA 4YNDA 1BD8A 2WQ6A 3X2QE 2QYJA 3E32A 4ANVA 2IU1A 1UG3A 3SNXA 1WY6A 5JJ7A 4LCTA 2KZTA 5ENSD 2WXRA 3T5VA 3L16A 5ENQD 4I43A 3AG3E 5KJMA 3QOUA 4UQXA 5FINA 1XGWA 1FVHA 3CK9A 5AIJA 3ZHEA 3FUNA 1P5QA 1B89A 1NA3A 4WUYA 1HO8A 3B7TA 1O1SA 3E34A 3FU5A 3BU8A 4IRUA 2DIWA 2IY0C 1IXVA 4UWHA 3PZ4A 4BFRA 2YQ8A 4I1AA 1S63A 1ZBPA 3LY9A 1S0PA 3FU6A 4B0ZA 3LXUX 3DSWA 4MLPA 4EBAA 3D9NA 4GCNA 4G2VA 4AV7A 5ENOD 1UW4B 3ZRHA 2GRRB 5EYLA 1NI1A 3CGHA 1E8ZA 4KT6B 2I1JA 4Q96A 1Y8MA 4Q69A 1QQEA 3ZW3A 1NL4A 2GRQB 2L9BA 4APFA 4O60A 5HQ8A 2XS1A 3FUDA 3JYSA 5JA4D 1JCSA 4HNAD 3TXMA 2J08A 4BEPA 3HVEA 5CHEE 3U64A 2IONA 4EZKA 4NIKA 4ANWA 2QZAA 2DYRE 5AYWD 2WQHA 2YNQA 5G2NA 4LNGA 4XZ4A 4TXPA 4G25A 3L17A 3PE3A 2XEHA 5CMYA 3ZYLA 4FHJA 3ASHA 1HG5A 3E33A 2F37A 3LS8A 3FEXA 4J0UA 3UT7A 3HYMB 5JHBA 3V79K 3LPZA 3QARA 3ZNGA 3RAUA 2DCPA 2PNNA 4FLBA 4GA2A 4KMOA 4YDEA 3CIAA 3U3WA 1E8YA 2P9NG 3P2BA 5FQ8A 2J49A 3CSTA 1V54E 3GZ2A 4F3VA 1HG2A 2M63A 1HH8A 1OCOE 4IULA 1H6OA 2CG2A 4PH4B 5C1DA 4LEUA 3ENEA 4BETA 3DPYA 2Y1LE 3NOCD 2ONDA 3MYVA 1U3DA 2ZGDA 4BX8A 2KXPC 4O1OA 2BF0X 5ENPD 2LUHA 4RQIA 2A5EA 2R5SA 2L6BA 3ABME 4JB8P 4FADA 4CGWA 1H0AA 1K1BA 3UM0A 4CZ2D 5J08A 4NRHB 3C3QA 2KATA 3TWWA 4AXHA 3PUKA 4U04A 3CVPA 5BXOA 4JHJA 2WMOA 4A3TA 1QYMA 4NURA 3UKRG 3NOGD 4GTTA 3UQ3A 4HOTA 1MX6A 2LXMA 3LCAA 2MYOA 3FH5A 4CCAA 4NACA 4GA1A 3JUEA 3CHSA 3NF1A 2P58C 2J07A 3D9PA 2FF4A 2R17C 2RFMA 3ESLA 3MKQB 3QKYA 2WXQA 4GA0A 2R05A 5FJYA 2EILE 4G23A 3E4BA 2J4DA 4HRLA 3D9KA 3PE4A 4ZHBA 1N9AA 1JCRA 5CCMA 3IV0A 5LX8A 3ABKE 3R7RA 4V3IA 4XE0A 2OEWA 4U8VD 4F7AA 2WXLA 2Y4TA 5LCWC 3SBTB 3V31A 5KCMA 2GGFA 2XPZA 3CHOA 5CEDB 3ULYA 2QC9A 3TWXA 2VQ2A 5CERB 3G2TA 5FZSA 5ARFA 1FCHA 3NZSA 4ILGA 1H2VC 3FU3A 1A5EA 3J5QB 4GTOA 3QWVA 5HRYA 4HFGA 3ZVVA 2RKKA 5BNWA 4TRQA 3TWQA 3U4TA 4HLEA 2C0LA 3FTXA 2V4HC 1IHGA 4BTBA 3CQCB 3Q5MA 3I4RB 4BESA 5AARA 4JC8A 2IO3C 3PREA 2CFZA 2VGXA 2E2EA 2DWZA 4L23A 4DX7D 4I9CA 4P29A 1K8KG 2GROB 1U3CA 5E75A 1MX2A 3ZU7B 2AXZA 3B95A 3TG5A 4BWRA 1D8EA 3PZ3A 2KC7A 3LKUA 2GRNB 3HXEA 3VLFA 3D9HA 3IEGA 3VLEA 5EN5D 1KZOA 4Z68A 2AXUA 3HIZA 1N0RA 3FP3A 1FPPA 2JLBA 4FJYA 4U63A 1DC2A 3QNKA 2GRPB 4HRMB 2WXNA 3ESKA 1OXJA 4KYOB 2FO7A 4UQYA 3L82A 4GYWA 1N52A 4L1BA 4I9EA 4JA9A 3B7BA 5A23A 3FULA 3B7RL 3D9LA 4Y6WA 1OWNA 4ME2A 2KCKA 3SY2A 3KD7A 5KNHD 5A6CA 3L9TA 4A1SA 4NQ0A 3JQ1A 1TNZA 1H19A 4U0SA 2H6FA 3DSUA 3TGOA 2LXLA 3C3OA 1Y6IA 2A4ZA 5CMWA 2Y4UA 2XQ0A 5G04J 3MCXA 2WB2A 5CBNA 3R9AB 3ZPJA 4I17A 3APCA 3R9MA 4HOUA 4RG9A 4DRXE 4RVBA 1UN9A 4G8KA 3GW4A 1WAO1 5BV1A 2AW6A 4BY6A 3PEUB 2I2OA 2P9UG 4C9BB 4G24A 2PQRA 3CLJA 4H7YA 3FH7A 1FT1A 4UWGA 3RO3A 4WNDA 4HOQA 1JWGA 1XNFA 1OWPA 4JD2G 4L7TA 1TJFA 2H6IA 4LSZE 4AY5A 3PDNA 5BT1A 2UY1B 2PM7A 4G26A 4I1OB 4J8YA 5HS0A 2FEZA 4CT0A 3TWVA 2FO1E 2B0OE 3Q15A 3SQVA 4MBGA 1PY1A 2WQ7A 3Q49B 3AU4A 4U7EB 5LOZA 3SBSA 4DI4A 3ZN3A 5BUZA 4FU3A 1INZA 5FT9A 3DEOA 4HI8A 1TN7A 4HI9A 2DBAA 3UM1A 3RIBA 1OUVA 3MJWA 2V8SE 3IBEA 2XRZA 2CHXA 4JL0A 3RRNB 2X3MA 2HM8A 4OAVB 3D9OA 4GTQA 5JJTA 3V2XA 3APFA 3PEVB 5CRUA 2Y69E 3UX4A 1LD7A 5G05J 2B6CA 3ABLE 4N2SA 4GTMA 3Q73A 4J8DA 4U8YD 4MRUA 5ARGA 3S7FA 3RO2A 3CHPA 3DXMG 1N0QA 1N4PA 3RRUA 1DCQA 3SZ7A 1D8DA 3FTVA 4OVVA 5D0QD 3LDZA 1BI7B 3SO8A 4HORA 4LRZA 3Q78A 4EZLA 3QDNA 4UWKA 3FTSA 3KEZA 1ELKA 3QWWA 5AJDA 4HVBA 3ASNE 5JMND 2VTBB 3U9WA 3D9MA 3Q9UC 2GRLA 1ZU2A 4L2LA 3LYAA 2NC9A 1H2TC 3CK8A 4A55A 5HKPA 4YDOA 3MKQA 4AIFA 5ENRD 4G8LA 3ZUVB 3BQOA 1Z3YA 3PUJA 1UOHA 3PS6A 4FULA 3DEPA 4DK5A 3FWVA 2QYUA 4XX5A 5CBOA 1RW2A 1NA0A 1TR4A 4CRWA 4GZCA 2WXOA 3PVLA 5E76A 1L5JA 3S2AA 3TL5A 5FQ4A 2WXIA 3DSTA 3ULEG 4C48B 4BT9A 2VYIA 3CQGB 2VSYA 3ZYKA 1WG0A 4GCOA 3B7SA 5B1BE 4ACLA 3JXIA 3MV3B 4TXRA 5KNGA 5AJLA 3DPDA 3T8MA 2OVFA 1WM5A 4JHKA 1KPSB 2IOLA 3I4GA 1YYHA 4E85A 1OWOA 1EPUA 4N5CA 1SQMA 5FWQA 1IQUA 3SI5A 4GZ6A 4XKCA 3Q47B 4A3VA 1E7VA 1O5MA 3QWPA 2EQXA 3L08A 5EX0A 3AU5A 4DLQA 2AJAA 2X6JA 3AAAC 3CVVA 4DUIA 3ASFA 2XHEA 3APDA 3C3RA 3O48A 3DWLG 4DPRA 3RRMB 4X8QA 1Z3XA 1O1TA 5G04C 1KT1A 3ULQA 4E6HA 2H6GA 2LAIA 1E7UA 4FA6A 3DSXA 4KBQA 3HXFA 2IO2C 1DCEA 3IHYA 3N71A 4PDXA 4R7LA 4AJWA 3KAEA 3WXXA 2LO6A 3UI2A 4W9RA 1D9SA 4DJAA 2VSOE 2RG8A 5EIDA 4D10C 3DSSA 1U2VG 3UMVA 3ZFWA 1OWMA 3JCKC 4YDYA 2YHEA 3QAQA 2IEJA 1JCQA 1TN8A 2AWIA 5ITZF 2CG3A 4IN3B 4N2QA 5ANRA 3MKRA 2EINE 2HE0A 1OWLA 2GRMA 1DNPA 4UI9K 1SW6A 1E90A 4U07A 3D9JA 5M72A 4F6RD 3OTNA 4RLYA 4GPMA 3F6QA 1S70B 4K5BA 2L0TB 5KWDA 2WXGA 5KJKA 2RFAA 1N4QA 3CK7A 3CKBA 5T3RA 1E96B 3UKUG 4GMRA 2CHZA 3MA5A 4I2WA 3IHVA 3OAWA 3Q7AA 3ZEFA 3UTMA 2XPIA 4F53A 1ELWA 1ELRA 4J8SA 4TUMA 1TEZA 5BPPA 2L6JA 4U8HA 1IKND 2C2LA 4J7WA 3ML9A 3Q4AB 3FH8A 3DRAA 4N3AA 4JZYA 5HI7A 4CGVA 2KCLA 3NZUA 4K5AB 2X6HA 2XEVA 5T8IA 4ILIA 3UIOC 4KZ0A 3LEWA 3TG4A 3W9FA 2V5FA 1S64A 1MX4A 4EQFA 3ZGQA 3DBSA 1RZ4A 1JWFA 3HDXA 4ABNA 4UWFA 3SFZA 3RK6A 3FTYA 3PRZA 4HB5A 2IQCA 2OVBA 2UY1A 3CHMA 4ILHB 4DX1A 1FVFA 3CKCA 2J9QA 5EYPF 2IFUA 3CHQA 1OY3D 2OOEA 2WMNA 4L2YA 4B93B 2XGOA 3VLDA 4HLLA 2V4LA 4XI0A 3HXBA 3G2UA 5J90A 1BLXB 3MX3A 3MGBA 1K3ZD 4JEUA 4FJZA 4M7CA 3FFLA 3KS2A 5FZRA 4GPKA 1OCRE 3AG1E 4ZFHA 2IJGX 4GAAA 1N54A 5H7PA 1OT8A 2KCVA 4B8AA 4KXKB 4K0RA 3LVQE 4Q94A 3ZXSA 4GMJA 5JJ6A 3CV0A 3DXKG 3UXGA 3JXJA 3O4ZA 4A63B 4AOFA 1KZPA 4FC8A 2Y3AA 3P1UA 4B94A 4GU5A 3Q9NC 5AAOA 4DX5D 1BU9A 1EYHA 4CDMA 3SF4A 3G2SA 3TWSA 2WPVA 5BV0A 2Y0BG 4JXTA 2FULA 3D9IA 1LTXA 2J8SD 2PZIA 1SZAA 3NB2A 3ASDA 3BUAA 3EU5A 1QBQA 2KM4A 2HR2A 3TWUA 2VTBA 2L0IA 2XEEA 4TUUA 3FUJA 4HBDA 4WWPA 1SA4A 1UJKA 4BTAA 3UUXA 4L9PA 4YVOA 3URZA 1X5BA 4A1GA 3PNTB 2R59A 4RSYA 3WG7E 5LP0A 2J4BA 2OV8A 4UUCA 3I5PA 2AXVA 5AN8A 4I6GA 1JUQA 1H6PA 3AG2E 4WNEA 4M3OA 2R2LA 5AQBA 2WVIA 3EHRA 2WM9A 2YINA 3EHQA 3PZ2A 4LG6A 2P9PG 4TXQA 5EIBE 3ASGA 4ATZD 3S7BA 1QNFA 3NQPA 2WXPA 1IHBA 2XS8A 4LUNU 4EECA 2DZOA 3IXEA 3ZYMA 4O6FA 2F8YA 3HHMA 4U0ZA 3PH0C 3AJIA 2CFUA 3L6AA 2XCBA 4Y6CA 5EKQD 4B8CB 2DZNA 2OEVA 4LNUD 1N11A 4C0EA 2QFCA 3EIJA 3T5XA 1HS6A 4K5CA 3RKVA 3GYZA 3L54A 2AVPA 1WDYA 2F0YA 2ETCA 2X6FA 1LD8A 5A7DB 1HU3A 2JABA 4GMLA 4AY6A 4URKA 1QZ2A 4BX9A 4JHRA 4UI9J 3QK0A 3SGHA 5JHAA 5G55A 4GTSA 4GZ3A 3LJNA 2XCCA 3CVLA 5KBAA 3PZ1A 2WXHA 2LAHA 1BI8B 2VGEA 3HG0D 3ASOE 4OAUC 5D66A 4YVQC 2IF4A 3KEAA 4TV3A 1GW6A 5CRVA 4XEIG 1HFAA 3W9GA 5CECB 1TNYA 2R02A 4HRNA 4C0MA 3E37A 2XPYA 3EDTB 4OVUA 2X38A 2MHKA 4B89A 1MQSA 4XI9A 4HXIA 1HE8A 3K9IA 4CEMA 1PC2A 2J09A 2MOWA 5BXUA 4DI3A 3SFYA 3OXLA 3TAXA 2A5UA 4EHMA 4CDRA 3GZ1A 1HZ4A 5FZQA 4U96D 2P9IG 4WWOA 2I9CA 3ZKJA 3OXGA 4N3BA 1Z5SC 3CVQA 1K1AA 3EU9A 2BTDA 3EHNA 5EILA 3IKOB 5IY5E 3FUIA 4BT8A 1KT0A 3C72A 5ANLA 4GZ5A 4QFVA 4K03A 3B13A 3FHEA 1YCSB 2BKGA 2ZXWE 5B3SE 4AP2A 5C2YA 3EHMA 4FP7A 3V30A 4ANUA 1SVXA 3GZSA 2KZTB 2V5QC 1TJCA 3CVYA 1Q2ZA 3Q79A 4FLHA 4LERA 1HF8A 4PS7A 4CDNA 2KBXA 3BG0B 3FU0A 3SD5A 3JQ0A 3FTUA 3NBNB 3CHRA 3FUEA 3FEYA 3S7DA 3ZHEB 5AQ9A 5EX3A 4JA7A 2XGSA 5ENNA 3PNLB 2NXPA 5CEAA 3TXNA 1H6KA 2XENA 3E30A 3AS5A 4GYYA 2ETAA 2V0PA 3V2OA 2UWJG 2VSNA 4KZCA 5D0OD 2BUGA 3UT8A 4EBAG 5AQ7A 4HQDA 2DVWA 3CVNA 1TNUA 2HYZA 1E8XA 4CT4A 4JEHA 1W3BA 4QQIA 2YHCA 3Q75A 1TNBA 4N5QA 1N94A 2WXKA 1IQRA 2PQNA 4DLOA 3BG1B 3FUMA 3HVEB 3LY7A 3LJ3A 4WWNA 5KJNA 3EJNA 2VGYA 5DBKA 3TJPA 3KSLA 1N4RA 2EIJE 3LY8A 2XGMA 3HXCA 3FY4A 4RG6A 2BEDA 3T8KA 4MKTA 4GYOA 2E0IA 3CSFA 4KVMA 4UQZA 4U95D 1AP7A 2ZU6B 3EUVA 3C98A 4JPSA 2P2CP 1YMPA 1UJJA 3FTWA 2VSXE 3Q7FA 4XKBA 5AENA 3VTXA 2P9SG 1NZNA 4ATGA 4J8FA 2CHWA 3KSQA
chains in the Genus database with same CATH topology
3UX4A 2FBNA 5G05J 1HH8A 4IULA 4N2SA 3UPVA 3CVWA 4EPZA 4J8DA 4MRUA 5ARGA 1A17A 3CVUA 2CG2A 4PH4B 1EYHA 3S7FA 4CDMA 5C1DA 3SF4A 4LEUA 3G2SA 3ENEA 3RO2A 3CHPA 3FUKA 3RRUA 3L22A 3AS8A 2LNIA 3SZ7A 2ONDA 3MYVA 2WPVA 1U3DA 5BV0A 3FTVA 1UN8A 4OVVA 3UT4A 4BX8A 2ILRA 2HO1A 2FULA 4JXTA 3D9IA 2BF0X 1VDYA 2PZIA 5D0QD 3QC1A 3LDZA 1SZAA 4N3CA 3ASDA 4HORA 2JEKA 2KM4A 4LRZA 3S7JA 2R5SA 3D3MA 2HR2A 2VTBA 2L0IA 4FADA 4CGWA 4EZLA 1H0AA 3QDNA 4UWKA 4PUCA 3FTSA 3KEZA 4TUUA 3FUJA 1ELKA 3QWWA 3U66A 4UWLA 5AJDA 4BSXA 4HVBA 5G05C 4WWPA 2VTBB 3QJZA 5J08A 2XRYA 1UJKA 1Z6TA 4NRHB 4BTAA 2RD0A 2WXJA 3UUXA 2KATA 4YVOA 5FQ6A 3U9WA 3URZA 1X5BA 4A1GA 4AXHA 3PUKA 3PNTB 4XIFA 3D9MA 2R59A 2GRLA 5CCLA 4RSYA 4U04A 5LP0A 1ZU2A 2VJ8A 3CVPA 2J4BA 3ML8A 4JHJA 4L2LA 2OV8A 2WMOA 3LYAA 4A3TA 3MV2B 4NURA 3I5PA 3UQ3A 2NC9A 2X6IA 4HOTA 2AXVA 1E8WA 1H2TC 3LCAA 3CK8A 4A55A 3L13A 3FH5A 4CCAA 4NACA 4I6GA 4GA1A 3MKQA 4AIFA 4HOSA 1JUQA 3CHSA 3NF1A 4AM9A 2P58C 2J07A 4J8EA 3ONLA 3D9PA 2FF4A 2R17C 3ESLA 4IYPA 4WNEA 4UI9C 3MKQB 1Z3YA 3QKYA 4M3OA 3PUJA 2WXQA 4GA0A 2WVIA 4WAFA 2WM9A 3PS6A 4FULA 3G2WA 2YINA 5FJYA 4DK5A 3FWVA 2X6KA 2Q7FA 4XX5A 4G23A 3PZDA 5DIZA 1NA0A 2PM6A 3ASGA 4CRWA 3QB2A 3E4BA 2J4DA 2GW1A 5FQ7A 3S7BA 1QNFA 3D9KA 3PE4A 3NQPA 1BPOA 4GZCA 2MRIA 2WXOA 2WXPA 3PVLA 2WXMA 4LUNU 5E76A 4EECA 3MZLB 5CCMA 3IV0A 1L5JA 3S2AA 5LX8A 3TL5A 5FQ4A 2WXIA 5FTPA 3ZYMA 3R7RA 4H7XA 4O6FA 4V3IA 4I2ZA 4XE0A 4BT9A 4F7AA 2I6HA 2VYIA 2WXLA 3CQGB 2VSYA 3HHMA 2Y4TA 3ZYKA 4MS6A 4GCOA 3B7SA 5LCWC 3SBTB 4U0ZA 3PH0C 4ACLA 3FDHA 3MV3B 5KCMA 2GGFA 3LVRE 5AJLA 2LSVA 2XPZA 3CHOA 2CFUA 1EF1C 3DPDA 3T8MA 2OVFA 1WM5A 3CEQA 3FTZA 4JVSA 5T4YA 4JHKA 2IOLA 4PS3A 3I4GA 3L6AA 2XCBA 2QY7A 2VQ2A 4OYSA 3G2TA 5FZSA 4E85A 5ARFA 1FCHA 3NZSA 4ILGA 1H2VC 3ZIMA 4ANXA 3FU3A 1OWOA 4Y6CA 5EKQD 4B94A 1EPUA 4FHKA 4N5CA 4B8CB 1SQMA 5FWQA 1IQUA 3QWVA 3SI5A 4HFGA 3ZVVA 4AEZC 3EIQC 5BNWA 4GZ6A 4XKCA 3Q47B 4N39A 4TRQA 3U4TA 4A3VA 1E7VA 4HLEA 4C0EA 3QWPA 2QFCA 2EQXA 2C0LA 3FTXA 3L08A 5EX0A 4AVXA 3EIJA 3T5XA 1HS6A 4G1TA 3AU5A 1IHGA 4BTBA 3CQCB 3Q5MA 3ONKA 3RKVA 3GYZA 3I4RB 3L54A 2AVPA 4DLQA 4JC8A 3PREA 2CFZA 2I1KA 2VGXA 1JPLA 2X6JA 3R7QA 2E2EA 2X6FA 5A7DB 4WNFA 1HU3A 4GMLA 4L23A 3CVVA 4URKA 4ACKA 4AY6A 1QZ2A 4BX9A 4JHRA 4UI9J 4I9CA 2FI7A 2WXFA 3QK0A 3SGHA 3G2VA 5JHAA 2VGXB 4P29A 3ASFA 5G55A 2XHEA 4GZ3A 1YA0A 5LFAA 3APDA 3CR3A 4I6JA 2XCCA 3CVLA 1U3CA 5E75A 4G11A 3O48A 2WXHA 4DPRA 3RRMB 1Z3XA 3B7UX 2AXZA 2LAHA 4GB9A 5G04C 3TG5A 1KT1A 4BWRA 3ULQA 2C0MA 4E6HA 4F1SA 4YVQC 2KC7A 2LSUA 2LAIA 2IF4A 1H2UA 3LKUA 3SHFA 1E7UA 4FA6A 4TV3A 3AS4A 3OXFA 4KBQA 1PAQA 4GZDA 1GW6A 3JUIA 3VLFA 5EDSA 1HFAA 1SZ9A 3IEGA 3VLEA 3RU0A 3IHYA 3N71A 4PDXA 1DVPA 4R7LA 5LCWJ 2AXUA 3KAEA 4J6IA 3HIZA 4AJWA 3WXXA 2LO6A 4W9RA 4C0MA 3FP3A 2JLBA 1HX8A 3EDTB 2XPYA 4FJYA 4I1MA 4OVUA 4U63A 4APOA 3FUFA 3ZYQA 2X38A 3QNKA 4KVOA 2MHKA 4U0UA 5BW8C 4B89A 4DJAA 1MQSA 2VSOE 4EZJA 4XI9A 2RG8A 4D10C 1MHQA 4HXIA 2IOSA 2NSZA 1HE8A 2WXNA 3K9IA 3ESKA 3UMVA 3ZFWA 1HXIA 4PS8A 1OWMA 3VTYA 3JCKC 1PC2A 2J09A 4CEMA 2YHEA 3QAQA 2MOWA 4HS2A 4KYOB 4DI3A 2FO7A 2AWIA 3OXLA 5KJLA 2CG3A 4IN3B 4N2QA 3RJVA 4JW1A 1LF8A 3TAXA 1EDUA 2A5UA 1IYGA 4CDRA 3GZ1A 2PL2A 1HZ4A 4UQYA 5FZQA 4WNGA 4GYWA 5ANRA 4WWOA 2I9CA 3MKRA 1N52A 4L1BA 3OXGA 1OWLA 4N3BA 3BEEA 1NP7A 2GRMA 4I9EA 3MEKA 4JA9A 3CVQA 1DNPA 4UI9K 3FUHA 2BTDA 3EHNA 5A23A 3I3NA 3CVXA 1E90A 4U07A 3IKOB 3FUIA 3D9JA 3FULA 3B7RL 1KT0A 3D9LA 4Y6WA 1OWNA 4BT8A 5ANLA 5M72A 4I6EA 4ME2A 1KLXA 4GZ5A 4K03A 4QFVA 2KCKA 3OTNA 4YNDA 2WQ6A 3KD7A 3B13A 5A6CA 3FHEA 2L0TB 4A1SA 4ANVA 4NQ0A 3JQ1A 2WXGA 1H19A 5KJKA 2IU1A 1UG3A 3CK7A 3CKBA 5T3RA 4U0SA 3SNXA 1E96B 1WY6A 3TGOA 4AP2A 5JJ7A 4LCTA 2KZTA 2WXRA 2CHZA 5C2YA 3T5VA 3EHMA 1Y6IA 3MA5A 3L16A 4FP7A 2A4ZA 4I2WA 2Y4UA 4ANUA 5CMWA 2XQ0A 5G04J 4I43A 3MCXA 2WB2A 3IHVA 3GZSA 3R9AB 2KZTB 3ZPJA 4I17A 3APCA 1TJCA 3CVYA 4FLHA 5KJMA 4LERA 3OAWA 3ZEFA 1HF8A 4HOUA 4PS7A 3QOUA 4UQXA 4RG9A 4CDNA 2XPIA 1XGWA 4F53A 1FVHA 3CK9A 5AIJA 1ELWA 1ELRA 3ZHEA 3FUNA 3BG0B 3FU0A 4J8SA 4RVBA 3JQ0A 3FTUA 1P5QA 1B89A 1UN9A 3SD5A 3CHRA 3FUEA 1NA3A 3FEYA 4WUYA 1TEZA 3S7DA 1HO8A 5BPPA 2L6JA 4U8HA 2C2LA 3ZHEB 5EX3A 3GW4A 3ML9A 3B7TA 4JA7A 2XGSA 5ENNA 1WAO1 3Q4AB 5BV1A 2AW6A 3FU5A 3FH8A 3PEUB 3PNLB 4IRUA 2NXPA 4BY6A 2DIWA 2I2OA 3TXNA 4N3AA 4JZYA 5HI7A 4CGVA 4UWHA 1H6KA 2KCLA 4BFRA 3NZUA 4C9BB 2XEVA 2YQ8A 2X6HA 4G24A 4I1AA 5T8IA 3AS5A 2PQRA 4ILIA 4GYYA 1ZBPA 3LY9A 1S0PA 3FU6A 2V0PA 3CLJA 4B0ZA 4KZ0A 3LEWA 3TG4A 3LXUX 4H7YA 2V5FA 3FH7A 4EQFA 2UWJG 4MLPA 3DBSA 3ZGQA 4EBAA 1JWFA 3D9NA 3HDXA 4GCNA 4ABNA 4UWGA 4UWFA 3RO3A 3SFZA 4G2VA 4WNDA 2VSNA 4AV7A 4HOQA 3RK6A 1JWGA 1XNFA 3FTYA 1UW4B 3PRZA 3ZRHA 4KZCA 2IQCA 5D0OD 2BUGA 1OWPA 2OVBA 3CGHA 2UY1A 1E8ZA 3UT8A 4KT6B 2I1JA 4EBAG 3CHMA 4L7TA 1TJFA 4AY5A 4Q96A 3PDNA 4ILHB 1Y8MA 1FVFA 4Q69A 5BT1A 3CVNA 1QQEA 3CKCA 2HYZA 2L9BA 2UY1B 3ZW3A 1E8XA 4APFA 2PM7A 4G26A 4CT4A 4JEHA 4I1OB 5HQ8A 1W3BA 2J9QA 2YHCA 3FUDA 2IFUA 3JYSA 2FEZA 4CT0A 3CHQA 2OOEA 4L2YA 2WMNA 2XGOA 3VLDA 2V4LA 4XI0A 3TXMA 2J08A 3Q15A 3G2UA 3HVEA 5CHEE 3U64A 1PY1A 2WQ7A 2WXKA 4EZKA 1IQRA 4ANWA 3Q49B 3AU4A 5J90A 2PQNA 3MX3A 5LOZA 4DLOA 3BG1B 3MGBA 3SBSA 3FUMA 3HVEB 3LY7A 4DI4A 3ZN3A 4JEUA 5BUZA 4FJZA 5AYWD 2WQHA 2YNQA 3LJ3A 3FFLA 4WWNA 5KJNA 3EJNA 3KS2A 5G2NA 5FZRA 2VGYA 5DBKA 4GPKA 4FU3A 4XZ4A 2IJGX 3L17A 3PE3A 4G25A 5CMYA 5FT9A 3TJPA 3ZYLA 1INZA 4FHJA 4GAAA 1N54A 3ASHA 1HG5A 3LY8A 2KCVA 2XGMA 2DBAA 4B8AA 3LS8A 4KXKB 3FEXA 4J0UA 3FY4A 4K0RA 4RG6A 3UT7A 3HYMB 3LVQE 4Q94A 5JHBA 3RIBA 3ZXSA 4GMJA 3LPZA 3QARA 1OUVA 4MKTA 4GYOA 2DCPA 2E0IA 3MJWA 5JJ6A 3CV0A 3CSFA 4FLBA 4GA2A 4KMOA 2V8SE 4KVMA 4UQZA 3IBEA 2XRZA 2CHXA 3O4ZA 2ZU6B 3CIAA 3C98A 1E8YA 3U3WA 4JPSA 3P2BA 5FQ8A 4JL0A 3RRNB 2J49A 2X3MA 1UJJA 2HM8A 2VSXE 3FTWA 3D9OA 4AOFA 3CSTA 4XKBA 5JJTA 3GZ2A 5AENA 4FC8A 3VTXA 2Y3AA 3P1UA 1NZNA 3APFA 3PEVB 4ATGA 4F3VA 4J8FA 1HG2A 2CHWA 4GU5A 2M63A 2IONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBN A;  5G05 J;  1HH8 A;  4N2S A;  3UPV A;  4J8D A;  5ARG A;  1A17 A;  3S7F A;  5C1D A;  3SF4 A;  4LEU A;  3RO2 A;  3AS8 A;  2LNI A;  3SZ7 A;  2OND A;  2WPV A;  2HO1 A;  2PZI A;  5D0Q D;  4N3C A;  3ASD A;  4HOR A;  3S7J A;  2R5S A;  2HR2 A;  4CGW A;  3QDN A;  3QWW A;  5G05 C;  4NRH B;  4BTA A;  3UUX A;  2KAT A;  4YVO A;  3URZ A;  4XIF A;  5CCL A;  4U04 A;  1ZU2 A;  3CVP A;  3LYA A;  3MV2 B;  3UQ3 A;  2NC9 A;  4HOT A;  3LCA A;  3CK8 A;  4GA1 A;  4AIF A;  4HOS A;  3NF1 A;  4AM9 A;  2P58 C;  4J8E A;  2FF4 A;  4WNE A;  4UI9 C;  3QKY A;  4GA0 A;  5FJY A;  3FWV A;  2Q7F A;  4G23 A;  5DIZ A;  1NA0 A;  3ASG A;  3E4B A;  2GW1 A;  3S7B A;  3PE4 A;  5CCM A;  5FTP A;  4H7X A;  4O6F A;  4BT9 A;  4I2Z A;  2I6H A;  2VYI A;  2VSY A;  2Y4T A;  4GCO A;  5LCW C;  4U0Z A;  3MV3 B;  2LSV A;  1WM5 A;  3CEQ A;  2XCB A;  2VQ2 A;  5FZS A;  5ARF A;  1FCH A;  4Y6C A;  5EKQ D;  4N5C A;  3QWV A;  5BNW A;  4GZ6 A;  3Q47 B;  4N39 A;  3U4T A;  3QWP A;  2QFC A;  2C0L A;  5EX0 A;  4G1T A;  1IHG A;  4BTB A;  3Q5M A;  3RKV A;  3GYZ A;  2AVP A;  2VGX A;  2E2E A;  5A7D B;  4WNF A;  4AY6 A;  1QZ2 A;  4JHR A;  4UI9 J;  4I9C A;  2FI7 A;  2VGX B;  3ASF A;  4GZ3 A;  1YA0 A;  2XCC A;  3CVL A;  3O48 A;  5G04 C;  3TG5 A;  1KT1 A;  4BWR A;  3ULQ A;  2C0M A;  4YVQ C;  2KC7 A;  2LSU A;  2IF4 A;  3LKU A;  3AS4 A;  3OXF A;  4KBQ A;  3IEG A;  3RU0 A;  3N71 A;  5LCW J;  3KAE A;  3WXX A;  4W9R A;  3FP3 A;  2JLB A;  3EDT B;  4APO A;  4U0U A;  2MHK A;  5BW8 C;  4XI9 A;  3K9I A;  3ESK A;  3ZFW A;  1HXI A;  3VTY A;  1PC2 A;  4KYO B;  2FO7 A;  3OXL A;  5KJL A;  4IN3 B;  4N2Q A;  3RJV A;  3TAX A;  1IYG A;  4CDR A;  3GZ1 A;  2PL2 A;  1HZ4 A;  4UQY A;  5FZQ A;  4WNG A;  4GYW A;  3MKR A;  3OXG A;  4N3B A;  3BEE A;  4I9E A;  3MEK A;  4JA9 A;  3CVQ A;  4UI9 K;  4U07 A;  4BT8 A;  1KT0 A;  5M72 A;  4Y6W A;  4ME2 A;  1KLX A;  4GZ5 A;  4YND A;  2KCK A;  3KD7 A;  5A6C A;  4A1S A;  4NQ0 A;  5KJK A;  3CK7 A;  3CKB A;  4U0S A;  1E96 B;  3TGO A;  5JJ7 A;  3MA5 A;  4I2W A;  2Y4U A;  5G04 J;  3R9A B;  3ZPJ A;  4I17 A;  1TJC A;  5KJM A;  4HOU A;  3QOU A;  4UQX A;  4RG9 A;  2XPI A;  3CK9 A;  1ELW A;  1ELR A;  3ZHE A;  1P5Q A;  1B89 A;  1NA3 A;  4WUY A;  3S7D A;  2L6J A;  2C2L A;  3ZHE B;  5EX3 A;  3GW4 A;  4JA7 A;  2XGS A;  1WAO 1;  3Q4A B;  4N3A A;  5HI7 A;  4CGV A;  2KCL A;  4G24 A;  4I1A A;  2XEV A;  2YQ8 A;  3AS5 A;  2PQR A;  4GYY A;  1ZBP A;  3LY9 A;  3TG4 A;  4H7Y A;  2V5F A;  4EQF A;  2UWJ G;  3ZGQ A;  4ABN A;  4GCN A;  3RO3 A;  4G2V A;  4WND A;  2VSN A;  4HOQ A;  1XNF A;  5D0O D;  2BUG A;  2UY1 A;  4AY5 A;  3PDN A;  1Y8M A;  5BT1 A;  3CVN A;  1QQE A;  3CKC A;  2HYZ A;  2UY1 B;  4G26 A;  5HQ8 A;  1W3B A;  2J9Q A;  2YHC A;  2IFU A;  3JYS A;  2FEZ A;  2OOE A;  2XGO A;  4XI0 A;  3Q15 A;  5CHE E;  3Q49 B;  2PQN A;  3LY7 A;  3ZN3 A;  5AYW D;  2WQH A;  3FFL A;  5KJN A;  3KS2 A;  5FZR A;  2VGY A;  5DBK A;  4GPK A;  4G25 A;  3PE3 A;  5FT9 A;  3ASH A;  3LY8 A;  2KCV A;  2XGM A;  2DBA A;  4KXK B;  4J0U A;  4RG6 A;  3HYM B;  3RIB A;  3LPZ A;  1OUV A;  4GYO A;  5JJ6 A;  3CV0 A;  4GA2 A;  4UQZ A;  3U3W A;  4JL0 A;  5JJT A;  3GZ2 A;  3VTX A;  1NZN A;  4F3V A;  4J8F A;  4B94 A; 
#chains in the Genus database with same CATH topology
 2FBN A;  3UPV A;  3CVW A;  4EPZ A;  1A17 A;  3CVU A;  4YDW A;  3FUK A;  3L22 A;  3AS8 A;  4BSZ B;  2LNI A;  5B1A E;  1UN8 A;  1ZB1 A;  3UIP C;  3UT4 A;  2ILR A;  4DX2 A;  1MZC A;  2HO1 A;  1V55 E;  1VDY A;  3ISM C;  4GTP A;  5ENT D;  3QC1 A;  4N3C A;  5AQA A;  2JEK A;  2NYJ A;  3S7J A;  3D3M A;  3DSV A;  3J5P A;  4PUC A;  3U66 A;  4UWL A;  4BSX A;  1O1R A;  5G05 C;  1X81 A;  2P9K G;  3QJZ A;  2XRY A;  2ZGG A;  1Z6T A;  2RD0 A;  2WXJ A;  5FQ6 A;  4XIF A;  5CCL A;  2VJ8 A;  3TWT A;  3ML8 A;  1OCZ E;  5FIO A;  3MV2 B;  2X6I A;  1E8W A;  3L13 A;  1OCC E;  4HOS A;  3T9K A;  4AM9 A;  4J8E A;  3ONL A;  4IYP A;  2BKK B;  4UI9 C;  1N95 A;  4BER A;  2DYS E;  3AG4 E;  4WAF A;  3G2W A;  2ETB A;  2X6K A;  2Q7F A;  3PZD A;  5DIZ A;  2PM6 A;  3QB2 A;  2GW1 A;  5FQ7 A;  3HXD A;  1BPO A;  2MRI A;  2WXM A;  3MZL B;  2R03 A;  5D2M C;  5FTP A;  3ZXP A;  4H7X A;  4I2Z A;  2I6H A;  4MS6 A;  2ZIR A;  4F1P A;  1NFI E;  4O1P A;  3FDH A;  2OCC E;  3LVR E;  2LSV A;  1EF1 C;  3HRA A;  3CEQ A;  3FTZ A;  4JVS A;  5T4Y A;  4PS3 A;  4OYS A;  2QY7 A;  3ZIM A;  4ANX A;  1TNO A;  4FHK A;  4GTV A;  4AEZ C;  3EIQ C;  4N39 A;  1MYO A;  3SFX A;  4AVX A;  4G1T A;  3ONK A;  2I1K A;  3R7Q A;  1JPL A;  2EIM E;  1SA5 A;  4WNF A;  4ACK A;  2FI7 A;  2WXF A;  2EIK E;  3G2V A;  2VGX B;  3UM2 A;  2H6H A;  1YA0 A;  5LFA A;  3CR3 A;  1N4S A;  4I6J A;  4G11 A;  4CYM D;  3B7U X;  4GB9 A;  2XZT G;  1TN6 A;  2C0M A;  2P9L G;  4F1S A;  2LSU A;  1H2U A;  3SHF A;  3AS4 A;  3OXF A;  1PAQ A;  4GZD A;  2ZIS A;  3JUI A;  5EDS A;  1SZ9 A;  1TYQ G;  3RSE G;  3UIN C;  1AWC B;  4LNB A;  3RU0 A;  1G3N B;  1DVP A;  5LCW J;  4J6I A;  1FT2 A;  1HX8 A;  4I1M A;  4APO A;  3FUF A;  1MJ0 A;  3ZYQ A;  4KVO A;  4U0U A;  5BW8 C;  4EZJ A;  1MHQ A;  2IOS A;  4DX6 D;  2NSZ A;  1HXI A;  4PS8 A;  3VTY A;  3C5R A;  4HS2 A;  3NAW A;  5KJL A;  2F8X K;  3RJV A;  4JW1 A;  1LF8 A;  1EDU A;  1IYG A;  2PL2 A;  4WNG A;  3TWR A;  3BEE A;  1NP7 A;  2XZD G;  3MEK A;  4GTR A;  3FUH A;  3I3N A;  3CVX A;  3UM3 A;  4I6E A;  1KLX A;  4YND A;  1BD8 A;  2WQ6 A;  3X2Q E;  2QYJ A;  3E32 A;  4ANV A;  2IU1 A;  1UG3 A;  3SNX A;  1WY6 A;  5JJ7 A;  4LCT A;  2KZT A;  5ENS D;  2WXR A;  3T5V A;  3L16 A;  5ENQ D;  4I43 A;  3AG3 E;  5KJM A;  3QOU A;  4UQX A;  5FIN A;  1XGW A;  1FVH A;  3CK9 A;  5AIJ A;  3ZHE A;  3FUN A;  1P5Q A;  1B89 A;  1NA3 A;  4WUY A;  1HO8 A;  3B7T A;  1O1S A;  3E34 A;  3FU5 A;  3BU8 A;  4IRU A;  2DIW A;  2IY0 C;  1IXV A;  4UWH A;  3PZ4 A;  4BFR A;  2YQ8 A;  4I1A A;  1S63 A;  1ZBP A;  3LY9 A;  1S0P A;  3FU6 A;  4B0Z A;  3LXU X;  3DSW A;  4MLP A;  4EBA A;  3D9N A;  4GCN A;  4G2V A;  4AV7 A;  5ENO D;  1UW4 B;  3ZRH A;  2GRR B;  5EYL A;  1NI1 A;  3CGH A;  1E8Z A;  4KT6 B;  2I1J A;  4Q96 A;  1Y8M A;  4Q69 A;  1QQE A;  3ZW3 A;  1NL4 A;  2GRQ B;  2L9B A;  4APF A;  4O60 A;  5HQ8 A;  2XS1 A;  3FUD A;  3JYS A;  5JA4 D;  1JCS A;  4HNA D;  3TXM A;  2J08 A;  4BEP A;  3HVE A;  5CHE E;  3U64 A;  2ION A;  4EZK A;  4NIK A;  4ANW A;  2QZA A;  2DYR E;  5AYW D;  2WQH A;  2YNQ A;  5G2N A;  4LNG A;  4XZ4 A;  4TXP A;  4G25 A;  3L17 A;  3PE3 A;  2XEH A;  5CMY A;  3ZYL A;  4FHJ A;  3ASH A;  1HG5 A;  3E33 A;  2F37 A;  3LS8 A;  3FEX A;  4J0U A;  3UT7 A;  3HYM B;  5JHB A;  3V79 K;  3LPZ A;  3QAR A;  3ZNG A;  3RAU A;  2DCP A;  2PNN A;  4FLB A;  4GA2 A;  4KMO A;  4YDE A;  3CIA A;  3U3W A;  1E8Y A;  2P9N G;  3P2B A;  5FQ8 A;  2J49 A;  3CST A;  1V54 E;  3GZ2 A;  4F3V A;  1HG2 A;  2M63 A;  1HH8 A;  1OCO E;  4IUL A;  1H6O A;  2CG2 A;  4PH4 B;  5C1D A;  4LEU A;  3ENE A;  4BET A;  3DPY A;  2Y1L E;  3NOC D;  2OND A;  3MYV A;  1U3D A;  2ZGD A;  4BX8 A;  2KXP C;  4O1O A;  2BF0 X;  5ENP D;  2LUH A;  4RQI A;  2A5E A;  2R5S A;  2L6B A;  3ABM E;  4JB8 P;  4FAD A;  4CGW A;  1H0A A;  1K1B A;  3UM0 A;  4CZ2 D;  5J08 A;  4NRH B;  3C3Q A;  2KAT A;  3TWW A;  4AXH A;  3PUK A;  4U04 A;  3CVP A;  5BXO A;  4JHJ A;  2WMO A;  4A3T A;  1QYM A;  4NUR A;  3UKR G;  3NOG D;  4GTT A;  3UQ3 A;  4HOT A;  1MX6 A;  2LXM A;  3LCA A;  2MYO A;  3FH5 A;  4CCA A;  4NAC A;  4GA1 A;  3JUE A;  3CHS A;  3NF1 A;  2P58 C;  2J07 A;  3D9P A;  2FF4 A;  2R17 C;  2RFM A;  3ESL A;  3MKQ B;  3QKY A;  2WXQ A;  4GA0 A;  2R05 A;  5FJY A;  2EIL E;  4G23 A;  3E4B A;  2J4D A;  4HRL A;  3D9K A;  3PE4 A;  4ZHB A;  1N9A A;  1JCR A;  5CCM A;  3IV0 A;  5LX8 A;  3ABK E;  3R7R A;  4V3I A;  4XE0 A;  2OEW A;  4U8V D;  4F7A A;  2WXL A;  2Y4T A;  5LCW C;  3SBT B;  3V31 A;  5KCM A;  2GGF A;  2XPZ A;  3CHO A;  5CED B;  3ULY A;  2QC9 A;  3TWX A;  2VQ2 A;  5CER B;  3G2T A;  5FZS A;  5ARF A;  1FCH A;  3NZS A;  4ILG A;  1H2V C;  3FU3 A;  1A5E A;  3J5Q B;  4GTO A;  3QWV A;  5HRY A;  4HFG A;  3ZVV A;  2RKK A;  5BNW A;  4TRQ A;  3TWQ A;  3U4T A;  4HLE A;  2C0L A;  3FTX A;  2V4H C;  1IHG A;  4BTB A;  3CQC B;  3Q5M A;  3I4R B;  4BES A;  5AAR A;  4JC8 A;  2IO3 C;  3PRE A;  2CFZ A;  2VGX A;  2E2E A;  2DWZ A;  4L23 A;  4DX7 D;  4I9C A;  4P29 A;  1K8K G;  2GRO B;  1U3C A;  5E75 A;  1MX2 A;  3ZU7 B;  2AXZ A;  3B95 A;  3TG5 A;  4BWR A;  1D8E A;  3PZ3 A;  2KC7 A;  3LKU A;  2GRN B;  3HXE A;  3VLF A;  3D9H A;  3IEG A;  3VLE A;  5EN5 D;  1KZO A;  4Z68 A;  2AXU A;  3HIZ A;  1N0R A;  3FP3 A;  1FPP A;  2JLB A;  4FJY A;  4U63 A;  1DC2 A;  3QNK A;  2GRP B;  4HRM B;  2WXN A;  3ESK A;  1OXJ A;  4KYO B;  2FO7 A;  4UQY A;  3L82 A;  4GYW A;  1N52 A;  4L1B A;  4I9E A;  4JA9 A;  3B7B A;  5A23 A;  3FUL A;  3B7R L;  3D9L A;  4Y6W A;  1OWN A;  4ME2 A;  2KCK A;  3SY2 A;  3KD7 A;  5KNH D;  5A6C A;  3L9T A;  4A1S A;  4NQ0 A;  3JQ1 A;  1TNZ A;  1H19 A;  4U0S A;  2H6F A;  3DSU A;  3TGO A;  2LXL A;  3C3O A;  1Y6I A;  2A4Z A;  5CMW A;  2Y4U A;  2XQ0 A;  5G04 J;  3MCX A;  2WB2 A;  5CBN A;  3R9A B;  3ZPJ A;  4I17 A;  3APC A;  3R9M A;  4HOU A;  4RG9 A;  4DRX E;  4RVB A;  1UN9 A;  4G8K A;  3GW4 A;  1WAO 1;  5BV1 A;  2AW6 A;  4BY6 A;  3PEU B;  2I2O A;  2P9U G;  4C9B B;  4G24 A;  2PQR A;  3CLJ A;  4H7Y A;  3FH7 A;  1FT1 A;  4UWG A;  3RO3 A;  4WND A;  4HOQ A;  1JWG A;  1XNF A;  1OWP A;  4JD2 G;  4L7T A;  1TJF A;  2H6I A;  4LSZ E;  4AY5 A;  3PDN A;  5BT1 A;  2UY1 B;  2PM7 A;  4G26 A;  4I1O B;  4J8Y A;  5HS0 A;  2FEZ A;  4CT0 A;  3TWV A;  2FO1 E;  2B0O E;  3Q15 A;  3SQV A;  4MBG A;  1PY1 A;  2WQ7 A;  3Q49 B;  3AU4 A;  4U7E B;  5LOZ A;  3SBS A;  4DI4 A;  3ZN3 A;  5BUZ A;  4FU3 A;  1INZ A;  5FT9 A;  3DEO A;  4HI8 A;  1TN7 A;  4HI9 A;  2DBA A;  3UM1 A;  3RIB A;  1OUV A;  3MJW A;  2V8S E;  3IBE A;  2XRZ A;  2CHX A;  4JL0 A;  3RRN B;  2X3M A;  2HM8 A;  4OAV B;  3D9O A;  4GTQ A;  5JJT A;  3V2X A;  3APF A;  3PEV B;  5CRU A;  2Y69 E;  3UX4 A;  1LD7 A;  5G05 J;  2B6C A;  3ABL E;  4N2S A;  4GTM A;  3Q73 A;  4J8D A;  4U8Y D;  4MRU A;  5ARG A;  3S7F A;  3RO2 A;  3CHP A;  3DXM G;  1N0Q A;  1N4P A;  3RRU A;  1DCQ A;  3SZ7 A;  1D8D A;  3FTV A;  4OVV A;  5D0Q D;  3LDZ A;  1BI7 B;  3SO8 A;  4HOR A;  4LRZ A;  3Q78 A;  4EZL A;  3QDN A;  4UWK A;  3FTS A;  3KEZ A;  1ELK A;  3QWW A;  5AJD A;  4HVB A;  3ASN E;  5JMN D;  2VTB B;  3U9W A;  3D9M A;  3Q9U C;  2GRL A;  1ZU2 A;  4L2L A;  3LYA A;  2NC9 A;  1H2T C;  3CK8 A;  4A55 A;  5HKP A;  4YDO A;  3MKQ A;  4AIF A;  5ENR D;  4G8L A;  3ZUV B;  3BQO A;  1Z3Y A;  3PUJ A;  1UOH A;  3PS6 A;  4FUL A;  3DEP A;  4DK5 A;  3FWV A;  2QYU A;  4XX5 A;  5CBO A;  1RW2 A;  1NA0 A;  1TR4 A;  4CRW A;  4GZC A;  2WXO A;  3PVL A;  5E76 A;  1L5J A;  3S2A A;  3TL5 A;  5FQ4 A;  2WXI A;  3DST A;  3ULE G;  4C48 B;  4BT9 A;  2VYI A;  3CQG B;  2VSY A;  3ZYK A;  1WG0 A;  4GCO A;  3B7S A;  5B1B E;  4ACL A;  3JXI A;  3MV3 B;  4TXR A;  5KNG A;  5AJL A;  3DPD A;  3T8M A;  2OVF A;  1WM5 A;  4JHK A;  1KPS B;  2IOL A;  3I4G A;  1YYH A;  4E85 A;  1OWO A;  1EPU A;  4N5C A;  1SQM A;  5FWQ A;  1IQU A;  3SI5 A;  4GZ6 A;  4XKC A;  3Q47 B;  4A3V A;  1E7V A;  1O5M A;  3QWP A;  2EQX A;  3L08 A;  5EX0 A;  3AU5 A;  4DLQ A;  2AJA A;  2X6J A;  3AAA C;  3CVV A;  4DUI A;  3ASF A;  2XHE A;  3APD A;  3C3R A;  3O48 A;  3DWL G;  4DPR A;  3RRM B;  4X8Q A;  1Z3X A;  1O1T A;  5G04 C;  1KT1 A;  3ULQ A;  4E6H A;  2H6G A;  2LAI A;  1E7U A;  4FA6 A;  3DSX A;  4KBQ A;  3HXF A;  2IO2 C;  1DCE A;  3IHY A;  3N71 A;  4PDX A;  4R7L A;  4AJW A;  3KAE A;  3WXX A;  2LO6 A;  3UI2 A;  4W9R A;  1D9S A;  4DJA A;  2VSO E;  2RG8 A;  5EID A;  4D10 C;  3DSS A;  1U2V G;  3UMV A;  3ZFW A;  1OWM A;  3JCK C;  4YDY A;  2YHE A;  3QAQ A;  2IEJ A;  1JCQ A;  1TN8 A;  2AWI A;  5ITZ F;  2CG3 A;  4IN3 B;  4N2Q A;  5ANR A;  3MKR A;  2EIN E;  2HE0 A;  1OWL A;  2GRM A;  1DNP A;  4UI9 K;  1SW6 A;  1E90 A;  4U07 A;  3D9J A;  5M72 A;  4F6R D;  3OTN A;  4RLY A;  4GPM A;  3F6Q A;  1S70 B;  4K5B A;  2L0T B;  5KWD A;  2WXG A;  5KJK A;  2RFA A;  1N4Q A;  3CK7 A;  3CKB A;  5T3R A;  1E96 B;  3UKU G;  4GMR A;  2CHZ A;  3MA5 A;  4I2W A;  3IHV A;  3OAW A;  3Q7A A;  3ZEF A;  3UTM A;  2XPI A;  4F53 A;  1ELW A;  1ELR A;  4J8S A;  4TUM A;  1TEZ A;  5BPP A;  2L6J A;  4U8H A;  1IKN D;  2C2L A;  4J7W A;  3ML9 A;  3Q4A B;  3FH8 A;  3DRA A;  4N3A A;  4JZY A;  5HI7 A;  4CGV A;  2KCL A;  3NZU A;  4K5A B;  2X6H A;  2XEV A;  5T8I A;  4ILI A;  3UIO C;  4KZ0 A;  3LEW A;  3TG4 A;  3W9F A;  2V5F A;  1S64 A;  1MX4 A;  4EQF A;  3ZGQ A;  3DBS A;  1RZ4 A;  1JWF A;  3HDX A;  4ABN A;  4UWF A;  3SFZ A;  3RK6 A;  3FTY A;  3PRZ A;  4HB5 A;  2IQC A;  2OVB A;  2UY1 A;  3CHM A;  4ILH B;  4DX1 A;  1FVF A;  3CKC A;  2J9Q A;  5EYP F;  2IFU A;  3CHQ A;  1OY3 D;  2OOE A;  2WMN A;  4L2Y A;  4B93 B;  2XGO A;  3VLD A;  4HLL A;  2V4L A;  4XI0 A;  3HXB A;  3G2U A;  5J90 A;  1BLX B;  3MX3 A;  3MGB A;  1K3Z D;  4JEU A;  4FJZ A;  4M7C A;  3FFL A;  3KS2 A;  5FZR A;  4GPK A;  1OCR E;  3AG1 E;  4ZFH A;  2IJG X;  4GAA A;  1N54 A;  5H7P A;  1OT8 A;  2KCV A;  4B8A A;  4KXK B;  4K0R A;  3LVQ E;  4Q94 A;  3ZXS A;  4GMJ A;  5JJ6 A;  3CV0 A;  3DXK G;  3UXG A;  3JXJ A;  3O4Z A;  4A63 B;  4AOF A;  1KZP A;  4FC8 A;  2Y3A A;  3P1U A;  4B94 A;  4GU5 A;  3Q9N C;  5AAO A;  4DX5 D;  1BU9 A;  1EYH A;  4CDM A;  3SF4 A;  3G2S A;  3TWS A;  2WPV A;  5BV0 A;  2Y0B G;  4JXT A;  2FUL A;  3D9I A;  1LTX A;  2J8S D;  2PZI A;  1SZA A;  3NB2 A;  3ASD A;  3BUA A;  3EU5 A;  1QBQ A;  2KM4 A;  2HR2 A;  3TWU A;  2VTB A;  2L0I A;  2XEE A;  4TUU A;  3FUJ A;  4HBD A;  4WWP A;  1SA4 A;  1UJK A;  4BTA A;  3UUX A;  4L9P A;  4YVO A;  3URZ A;  1X5B A;  4A1G A;  3PNT B;  2R59 A;  4RSY A;  3WG7 E;  5LP0 A;  2J4B A;  2OV8 A;  4UUC A;  3I5P A;  2AXV A;  5AN8 A;  4I6G A;  1JUQ A;  1H6P A;  3AG2 E;  4WNE A;  4M3O A;  2R2L A;  5AQB A;  2WVI A;  3EHR A;  2WM9 A;  2YIN A;  3EHQ A;  3PZ2 A;  4LG6 A;  2P9P G;  4TXQ A;  5EIB E;  3ASG A;  4ATZ D;  3S7B A;  1QNF A;  3NQP A;  2WXP A;  1IHB A;  2XS8 A;  4LUN U;  4EEC A;  2DZO A;  3IXE A;  3ZYM A;  4O6F A;  2F8Y A;  3HHM A;  4U0Z A;  3PH0 C;  3AJI A;  2CFU A;  3L6A A;  2XCB A;  4Y6C A;  5EKQ D;  4B8C B;  2DZN A;  2OEV A;  4LNU D;  1N11 A;  4C0E A;  2QFC A;  3EIJ A;  3T5X A;  1HS6 A;  4K5C A;  3RKV A;  3GYZ A;  3L54 A;  2AVP A;  1WDY A;  2F0Y A;  2ETC A;  2X6F A;  1LD8 A;  5A7D B;  1HU3 A;  2JAB A;  4GML A;  4AY6 A;  4URK A;  1QZ2 A;  4BX9 A;  4JHR A;  4UI9 J;  3QK0 A;  3SGH A;  5JHA A;  5G55 A;  4GTS A;  4GZ3 A;  3LJN A;  2XCC A;  3CVL A;  5KBA A;  3PZ1 A;  2WXH A;  2LAH A;  1BI8 B;  2VGE A;  3HG0 D;  3ASO E;  4OAU C;  5D66 A;  4YVQ C;  2IF4 A;  3KEA A;  4TV3 A;  1GW6 A;  5CRV A;  4XEI G;  1HFA A;  3W9G A;  5CEC B;  1TNY A;  2R02 A;  4HRN A;  4C0M A;  3E37 A;  2XPY A;  3EDT B;  4OVU A;  2X38 A;  2MHK A;  4B89 A;  1MQS A;  4XI9 A;  4HXI A;  1HE8 A;  3K9I A;  4CEM A;  1PC2 A;  2J09 A;  2MOW A;  5BXU A;  4DI3 A;  3SFY A;  3OXL A;  3TAX A;  2A5U A;  4EHM A;  4CDR A;  3GZ1 A;  1HZ4 A;  5FZQ A;  4U96 D;  2P9I G;  4WWO A;  2I9C A;  3ZKJ A;  3OXG A;  4N3B A;  1Z5S C;  3CVQ A;  1K1A A;  3EU9 A;  2BTD A;  3EHN A;  5EIL A;  3IKO B;  5IY5 E;  3FUI A;  4BT8 A;  1KT0 A;  3C72 A;  5ANL A;  4GZ5 A;  4QFV A;  4K03 A;  3B13 A;  3FHE A;  1YCS B;  2BKG A;  2ZXW E;  5B3S E;  4AP2 A;  5C2Y A;  3EHM A;  4FP7 A;  3V30 A;  4ANU A;  1SVX A;  3GZS A;  2KZT B;  2V5Q C;  1TJC A;  3CVY A;  1Q2Z A;  3Q79 A;  4FLH A;  4LER A;  1HF8 A;  4PS7 A;  4CDN A;  2KBX A;  3BG0 B;  3FU0 A;  3SD5 A;  3JQ0 A;  3FTU A;  3NBN B;  3CHR A;  3FUE A;  3FEY A;  3S7D A;  3ZHE B;  5AQ9 A;  5EX3 A;  4JA7 A;  2XGS A;  5ENN A;  3PNL B;  2NXP A;  5CEA A;  3TXN A;  1H6K A;  2XEN A;  3E30 A;  3AS5 A;  4GYY A;  2ETA A;  2V0P A;  3V2O A;  2UWJ G;  2VSN A;  4KZC A;  5D0O D;  2BUG A;  3UT8 A;  4EBA G;  5AQ7 A;  4HQD A;  2DVW A;  3CVN A;  1TNU A;  2HYZ A;  1E8X A;  4CT4 A;  4JEH A;  1W3B A;  4QQI A;  2YHC A;  3Q75 A;  1TNB A;  4N5Q A;  1N94 A;  2WXK A;  1IQR A;  2PQN A;  4DLO A;  3BG1 B;  3FUM A;  3HVE B;  3LY7 A;  3LJ3 A;  4WWN A;  5KJN A;  3EJN A;  2VGY A;  5DBK A;  3TJP A;  3KSL A;  1N4R A;  2EIJ E;  3LY8 A;  2XGM A;  3HXC A;  3FY4 A;  4RG6 A;  2BED A;  3T8K A;  4MKT A;  4GYO A;  2E0I A;  3CSF A;  4KVM A;  4UQZ A;  4U95 D;  1AP7 A;  2ZU6 B;  3EUV A;  3C98 A;  4JPS A;  2P2C P;  1YMP A;  1UJJ A;  3FTW A;  2VSX E;  3Q7F A;  4XKB A;  5AEN A;  3VTX A;  2P9S G;  1NZN A;  4ATG A;  4J8F A;  2CHW A;  3KSQ A; 
#chains in the Genus database with same CATH homology
 3UX4 A;  2FBN A;  5G05 J;  1HH8 A;  4IUL A;  4N2S A;  3UPV A;  3CVW A;  4EPZ A;  4J8D A;  4MRU A;  5ARG A;  1A17 A;  3CVU A;  2CG2 A;  4PH4 B;  1EYH A;  3S7F A;  4CDM A;  5C1D A;  3SF4 A;  4LEU A;  3G2S A;  3ENE A;  3RO2 A;  3CHP A;  3FUK A;  3RRU A;  3L22 A;  3AS8 A;  2LNI A;  3SZ7 A;  2OND A;  3MYV A;  2WPV A;  1U3D A;  5BV0 A;  3FTV A;  1UN8 A;  4OVV A;  3UT4 A;  4BX8 A;  2ILR A;  2HO1 A;  2FUL A;  4JXT A;  3D9I A;  2BF0 X;  1VDY A;  2PZI A;  5D0Q D;  3QC1 A;  3LDZ A;  1SZA A;  4N3C A;  3ASD A;  4HOR A;  2JEK A;  2KM4 A;  4LRZ A;  3S7J A;  2R5S A;  3D3M A;  2HR2 A;  2VTB A;  2L0I A;  4FAD A;  4CGW A;  4EZL A;  1H0A A;  3QDN A;  4UWK A;  4PUC A;  3FTS A;  3KEZ A;  4TUU A;  3FUJ A;  1ELK A;  3QWW A;  3U66 A;  4UWL A;  5AJD A;  4BSX A;  4HVB A;  5G05 C;  4WWP A;  2VTB B;  3QJZ A;  5J08 A;  2XRY A;  1UJK A;  1Z6T A;  4NRH B;  4BTA A;  2RD0 A;  2WXJ A;  3UUX A;  2KAT A;  4YVO A;  5FQ6 A;  3U9W A;  3URZ A;  1X5B A;  4A1G A;  4AXH A;  3PUK A;  3PNT B;  4XIF A;  3D9M A;  2R59 A;  2GRL A;  5CCL A;  4RSY A;  4U04 A;  5LP0 A;  1ZU2 A;  2VJ8 A;  3CVP A;  2J4B A;  3ML8 A;  4JHJ A;  4L2L A;  2OV8 A;  2WMO A;  3LYA A;  4A3T A;  3MV2 B;  4NUR A;  3I5P A;  3UQ3 A;  2NC9 A;  2X6I A;  4HOT A;  2AXV A;  1E8W A;  1H2T C;  3LCA A;  3CK8 A;  4A55 A;  3L13 A;  3FH5 A;  4CCA A;  4NAC A;  4I6G A;  4GA1 A;  3MKQ A;  4AIF A;  4HOS A;  1JUQ A;  3CHS A;  3NF1 A;  4AM9 A;  2P58 C;  2J07 A;  4J8E A;  3ONL A;  3D9P A;  2FF4 A;  2R17 C;  3ESL A;  4IYP A;  4WNE A;  4UI9 C;  3MKQ B;  1Z3Y A;  3QKY A;  4M3O A;  3PUJ A;  2WXQ A;  4GA0 A;  2WVI A;  4WAF A;  2WM9 A;  3PS6 A;  4FUL A;  3G2W A;  2YIN A;  5FJY A;  4DK5 A;  3FWV A;  2X6K A;  2Q7F A;  4XX5 A;  4G23 A;  3PZD A;  5DIZ A;  1NA0 A;  2PM6 A;  3ASG A;  4CRW A;  3QB2 A;  3E4B A;  2J4D A;  2GW1 A;  5FQ7 A;  3S7B A;  1QNF A;  3D9K A;  3PE4 A;  3NQP A;  1BPO A;  4GZC A;  2MRI A;  2WXO A;  2WXP A;  3PVL A;  2WXM A;  4LUN U;  5E76 A;  4EEC A;  3MZL B;  5CCM A;  3IV0 A;  1L5J A;  3S2A A;  5LX8 A;  3TL5 A;  5FQ4 A;  2WXI A;  5FTP A;  3ZYM A;  3R7R A;  4H7X A;  4O6F A;  4V3I A;  4I2Z A;  4XE0 A;  4BT9 A;  4F7A A;  2I6H A;  2VYI A;  2WXL A;  3CQG B;  2VSY A;  3HHM A;  2Y4T A;  3ZYK A;  4MS6 A;  4GCO A;  3B7S A;  5LCW C;  3SBT B;  4U0Z A;  3PH0 C;  4ACL A;  3FDH A;  3MV3 B;  5KCM A;  2GGF A;  3LVR E;  5AJL A;  2LSV A;  2XPZ A;  3CHO A;  2CFU A;  1EF1 C;  3DPD A;  3T8M A;  2OVF A;  1WM5 A;  3CEQ A;  3FTZ A;  4JVS A;  5T4Y A;  4JHK A;  2IOL A;  4PS3 A;  3I4G A;  3L6A A;  2XCB A;  2QY7 A;  2VQ2 A;  4OYS A;  3G2T A;  5FZS A;  4E85 A;  5ARF A;  1FCH A;  3NZS A;  4ILG A;  1H2V C;  3ZIM A;  4ANX A;  3FU3 A;  1OWO A;  4Y6C A;  5EKQ D;  4B94 A;  1EPU A;  4FHK A;  4N5C A;  4B8C B;  1SQM A;  5FWQ A;  1IQU A;  3QWV A;  3SI5 A;  4HFG A;  3ZVV A;  4AEZ C;  3EIQ C;  5BNW A;  4GZ6 A;  4XKC A;  3Q47 B;  4N39 A;  4TRQ A;  3U4T A;  4A3V A;  1E7V A;  4HLE A;  4C0E A;  3QWP A;  2QFC A;  2EQX A;  2C0L A;  3FTX A;  3L08 A;  5EX0 A;  4AVX A;  3EIJ A;  3T5X A;  1HS6 A;  4G1T A;  3AU5 A;  1IHG A;  4BTB A;  3CQC B;  3Q5M A;  3ONK A;  3RKV A;  3GYZ A;  3I4R B;  3L54 A;  2AVP A;  4DLQ A;  4JC8 A;  3PRE A;  2CFZ A;  2I1K A;  2VGX A;  1JPL A;  2X6J A;  3R7Q A;  2E2E A;  2X6F A;  5A7D B;  4WNF A;  1HU3 A;  4GML A;  4L23 A;  3CVV A;  4URK A;  4ACK A;  4AY6 A;  1QZ2 A;  4BX9 A;  4JHR A;  4UI9 J;  4I9C A;  2FI7 A;  2WXF A;  3QK0 A;  3SGH A;  3G2V A;  5JHA A;  2VGX B;  4P29 A;  3ASF A;  5G55 A;  2XHE A;  4GZ3 A;  1YA0 A;  5LFA A;  3APD A;  3CR3 A;  4I6J A;  2XCC A;  3CVL A;  1U3C A;  5E75 A;  4G11 A;  3O48 A;  2WXH A;  4DPR A;  3RRM B;  1Z3X A;  3B7U X;  2AXZ A;  2LAH A;  4GB9 A;  5G04 C;  3TG5 A;  1KT1 A;  4BWR A;  3ULQ A;  2C0M A;  4E6H A;  4F1S A;  4YVQ C;  2KC7 A;  2LSU A;  2LAI A;  2IF4 A;  1H2U A;  3LKU A;  3SHF A;  1E7U A;  4FA6 A;  4TV3 A;  3AS4 A;  3OXF A;  4KBQ A;  1PAQ A;  4GZD A;  1GW6 A;  3JUI A;  3VLF A;  5EDS A;  1HFA A;  1SZ9 A;  3IEG A;  3VLE A;  3RU0 A;  3IHY A;  3N71 A;  4PDX A;  1DVP A;  4R7L A;  5LCW J;  2AXU A;  3KAE A;  4J6I A;  3HIZ A;  4AJW A;  3WXX A;  2LO6 A;  4W9R A;  4C0M A;  3FP3 A;  2JLB A;  1HX8 A;  3EDT B;  2XPY A;  4FJY A;  4I1M A;  4OVU A;  4U63 A;  4APO A;  3FUF A;  3ZYQ A;  2X38 A;  3QNK A;  4KVO A;  2MHK A;  4U0U A;  5BW8 C;  4B89 A;  4DJA A;  1MQS A;  2VSO E;  4EZJ A;  4XI9 A;  2RG8 A;  4D10 C;  1MHQ A;  4HXI A;  2IOS A;  2NSZ A;  1HE8 A;  2WXN A;  3K9I A;  3ESK A;  3UMV A;  3ZFW A;  1HXI A;  4PS8 A;  1OWM A;  3VTY A;  3JCK C;  1PC2 A;  2J09 A;  4CEM A;  2YHE A;  3QAQ A;  2MOW A;  4HS2 A;  4KYO B;  4DI3 A;  2FO7 A;  2AWI A;  3OXL A;  5KJL A;  2CG3 A;  4IN3 B;  4N2Q A;  3RJV A;  4JW1 A;  1LF8 A;  3TAX A;  1EDU A;  2A5U A;  1IYG A;  4CDR A;  3GZ1 A;  2PL2 A;  1HZ4 A;  4UQY A;  5FZQ A;  4WNG A;  4GYW A;  5ANR A;  4WWO A;  2I9C A;  3MKR A;  1N52 A;  4L1B A;  3OXG A;  1OWL A;  4N3B A;  3BEE A;  1NP7 A;  2GRM A;  4I9E A;  3MEK A;  4JA9 A;  3CVQ A;  1DNP A;  4UI9 K;  3FUH A;  2BTD A;  3EHN A;  5A23 A;  3I3N A;  3CVX A;  1E90 A;  4U07 A;  3IKO B;  3FUI A;  3D9J A;  3FUL A;  3B7R L;  1KT0 A;  3D9L A;  4Y6W A;  1OWN A;  4BT8 A;  5ANL A;  5M72 A;  4I6E A;  4ME2 A;  1KLX A;  4GZ5 A;  4K03 A;  4QFV A;  2KCK A;  3OTN A;  4YND A;  2WQ6 A;  3KD7 A;  3B13 A;  5A6C A;  3FHE A;  2L0T B;  4A1S A;  4ANV A;  4NQ0 A;  3JQ1 A;  2WXG A;  1H19 A;  5KJK A;  2IU1 A;  1UG3 A;  3CK7 A;  3CKB A;  5T3R A;  4U0S A;  3SNX A;  1E96 B;  1WY6 A;  3TGO A;  4AP2 A;  5JJ7 A;  4LCT A;  2KZT A;  2WXR A;  2CHZ A;  5C2Y A;  3T5V A;  3EHM A;  1Y6I A;  3MA5 A;  3L16 A;  4FP7 A;  2A4Z A;  4I2W A;  2Y4U A;  4ANU A;  5CMW A;  2XQ0 A;  5G04 J;  4I43 A;  3MCX A;  2WB2 A;  3IHV A;  3GZS A;  3R9A B;  2KZT B;  3ZPJ A;  4I17 A;  3APC A;  1TJC A;  3CVY A;  4FLH A;  5KJM A;  4LER A;  3OAW A;  3ZEF A;  1HF8 A;  4HOU A;  4PS7 A;  3QOU A;  4UQX A;  4RG9 A;  4CDN A;  2XPI A;  1XGW A;  4F53 A;  1FVH A;  3CK9 A;  5AIJ A;  1ELW A;  1ELR A;  3ZHE A;  3FUN A;  3BG0 B;  3FU0 A;  4J8S A;  4RVB A;  3JQ0 A;  3FTU A;  1P5Q A;  1B89 A;  1UN9 A;  3SD5 A;  3CHR A;  3FUE A;  1NA3 A;  3FEY A;  4WUY A;  1TEZ A;  3S7D A;  1HO8 A;  5BPP A;  2L6J A;  4U8H A;  2C2L A;  3ZHE B;  5EX3 A;  3GW4 A;  3ML9 A;  3B7T A;  4JA7 A;  2XGS A;  5ENN A;  1WAO 1;  3Q4A B;  5BV1 A;  2AW6 A;  3FU5 A;  3FH8 A;  3PEU B;  3PNL B;  4IRU A;  2NXP A;  4BY6 A;  2DIW A;  2I2O A;  3TXN A;  4N3A A;  4JZY A;  5HI7 A;  4CGV A;  4UWH A;  1H6K A;  2KCL A;  4BFR A;  3NZU A;  4C9B B;  2XEV A;  2YQ8 A;  2X6H A;  4G24 A;  4I1A A;  5T8I A;  3AS5 A;  2PQR A;  4ILI A;  4GYY A;  1ZBP A;  3LY9 A;  1S0P A;  3FU6 A;  2V0P A;  3CLJ A;  4B0Z A;  4KZ0 A;  3LEW A;  3TG4 A;  3LXU X;  4H7Y A;  2V5F A;  3FH7 A;  4EQF A;  2UWJ G;  4MLP A;  3DBS A;  3ZGQ A;  4EBA A;  1JWF A;  3D9N A;  3HDX A;  4GCN A;  4ABN A;  4UWG A;  4UWF A;  3RO3 A;  3SFZ A;  4G2V A;  4WND A;  2VSN A;  4AV7 A;  4HOQ A;  3RK6 A;  1JWG A;  1XNF A;  3FTY A;  1UW4 B;  3PRZ A;  3ZRH A;  4KZC A;  2IQC A;  5D0O D;  2BUG A;  1OWP A;  2OVB A;  3CGH A;  2UY1 A;  1E8Z A;  3UT8 A;  4KT6 B;  2I1J A;  4EBA G;  3CHM A;  4L7T A;  1TJF A;  4AY5 A;  4Q96 A;  3PDN A;  4ILH B;  1Y8M A;  1FVF A;  4Q69 A;  5BT1 A;  3CVN A;  1QQE A;  3CKC A;  2HYZ A;  2L9B A;  2UY1 B;  3ZW3 A;  1E8X A;  4APF A;  2PM7 A;  4G26 A;  4CT4 A;  4JEH A;  4I1O B;  5HQ8 A;  1W3B A;  2J9Q A;  2YHC A;  3FUD A;  2IFU A;  3JYS A;  2FEZ A;  4CT0 A;  3CHQ A;  2OOE A;  4L2Y A;  2WMN A;  2XGO A;  3VLD A;  2V4L A;  4XI0 A;  3TXM A;  2J08 A;  3Q15 A;  3G2U A;  3HVE A;  5CHE E;  3U64 A;  1PY1 A;  2WQ7 A;  2WXK A;  4EZK A;  1IQR A;  4ANW A;  3Q49 B;  3AU4 A;  5J90 A;  2PQN A;  3MX3 A;  5LOZ A;  4DLO A;  3BG1 B;  3MGB A;  3SBS A;  3FUM A;  3HVE B;  3LY7 A;  4DI4 A;  3ZN3 A;  4JEU A;  5BUZ A;  4FJZ A;  5AYW D;  2WQH A;  2YNQ A;  3LJ3 A;  3FFL A;  4WWN A;  5KJN A;  3EJN A;  3KS2 A;  5G2N A;  5FZR A;  2VGY A;  5DBK A;  4GPK A;  4FU3 A;  4XZ4 A;  2IJG X;  3L17 A;  3PE3 A;  4G25 A;  5CMY A;  5FT9 A;  3TJP A;  3ZYL A;  1INZ A;  4FHJ A;  4GAA A;  1N54 A;  3ASH A;  1HG5 A;  3LY8 A;  2KCV A;  2XGM A;  2DBA A;  4B8A A;  3LS8 A;  4KXK B;  3FEX A;  4J0U A;  3FY4 A;  4K0R A;  4RG6 A;  3UT7 A;  3HYM B;  3LVQ E;  4Q94 A;  5JHB A;  3RIB A;  3ZXS A;  4GMJ A;  3LPZ A;  3QAR A;  1OUV A;  4MKT A;  4GYO A;  2DCP A;  2E0I A;  3MJW A;  5JJ6 A;  3CV0 A;  3CSF A;  4FLB A;  4GA2 A;  4KMO A;  2V8S E;  4KVM A;  4UQZ A;  3IBE A;  2XRZ A;  2CHX A;  3O4Z A;  2ZU6 B;  3CIA A;  3C98 A;  1E8Y A;  3U3W A;  4JPS A;  3P2B A;  5FQ8 A;  4JL0 A;  3RRN B;  2J49 A;  2X3M A;  1UJJ A;  2HM8 A;  2VSX E;  3FTW A;  3D9O A;  4AOF A;  3CST A;  4XKB A;  5JJT A;  3GZ2 A;  5AEN A;  4FC8 A;  3VTX A;  2Y3A A;  3P1U A;  1NZN A;  3APF A;  3PEV B;  4ATG A;  4F3V A;  4J8F A;  1HG2 A;  2CHW A;  4GU5 A;  2M63 A;  2ION A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...