1TNYA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a frekkffcail peptide derived from the heterotrimeric g protein gamma-2 subunit
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords geranylgeranyltransferase type I alpha subunit
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 124
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnyA00
1N9AA 1DCEA 3Q75A 4GTTA 1FPPA 1TNBA 1SA4A 3E37A 3HXCA 1QBQA 1N95A 1JCRA 4YDEA 3HXBA 3DSSA 4GTOA 3E32A 1KZOA 4GTMA 3DRAA 3KSLA 1LD8A 1TN6A 3E33A 2H6FA 3EUVA 1SA5A 2ZISA 4YDOA 3PZ4A 4LNBA 3DSWA 4GTPA 1N94A 1X81A 1TN8A 3Q7AA 1TN7A 1TNZA 3SFXA 1LTXA 1TNOA 4EHMA 1N4PA 1O1RA 1D8EA 1FT2A 3E30A 4GTVA 3DSTA 2H6IA 1TNUA 3KSQA 3EU5A 1KZPA 1O1TA 4LNGA 1O5MA 2BEDA 2F0YA 3C72A 1O1SA 4GTQA 4GTSA 3PZ2A 3E34A 3PZ3A 2R2LA 1MZCA 3Q7FA 1NL4A 1S64A 3Q78A 2ZIRA 3SFYA 1JCQA 1D8DA 1NI1A 3Q73A 3PZ1A 3DSUA 3HXEA 1N4RA 1N4QA 3HXDA 1S63A 3DPYA 4GTRA 2H6GA 2IEJA 4MBGA 4L9PA 3DSVA 1FT1A 1JCSA 1LD7A 1TNYA 3DSXA 1N4SA 3HXFA 3Q79A 2H6HA
chains in the Genus database with same CATH superfamily
3PNLB 2L9BA 4GTTA 2AXVA 4U95D 5ARFA 3TXNA 1P5QA 2J4BA 3FTSA 4CYMD 3QOUA 2WXJA 3UQ3A 4YDEA 4I17A 3AU4A 3CQGB 3DSSA 1DNPA 3LPZA 4BT9A 1JWGA 3ZUVB 4YDOA 3UKRG 3EIQC 4J8SA 3FH8A 4L2YA 3WG7E 3Q7AA 2P9PG 5FT9A 4HORA 3SI5A 2P9NG 1N0QA 3I4GA 3O48A 3FU6A 3JUEA 4FU3A 4GZ3A 4RVBA 4HOTA 2OVFA 3AG4E 3UUXA 1ELKA 1ELRA 1FVHA 3W9GA 3PEUB 1E8YA 3B7BA 3CHPA 3CVYA 1JPLA 2BKKB 1HG5A 2HYZA 1MX4A 4XX5A 5EX0A 1H0AA 4IRUA 4B94A 4IULA 2PQRA 2Y4UA 2AJAA 1D8DA 4U0SA 3PZ1A 3UM1A 5FIOA 3UMVA 3ZFWA 2XEHA 3HXEA 3G2TA 4ANWA 2QY7A 1OT8A 1S63A 4GTRA 2UWJG 1A5EA 4B93B 1BI8B 2DZNA 1OCCE 2XS1A 4U0UA 5JA4D 3R7QA 5IY5E 3DWLG 4JC8A 3FUJA 4AY6A 3FUHA 3KS2A 3RU0A 2X6IA 1JWFA 3AJIA 2MYOA 3ZXSA 4F6RD 3ZN3A 3RJVA 4BX8A 4LEUA 3UM0A 1TR4A 4UQZA 2WPVA 3F6QA 1TN7A 1OWPA 2IJGX 5ENTD 1H19A 1OWLA 4XI0A 4ATZD 3FTZA 2BKGA 1KZPA 4K5AB 3VLFA 3CHSA 3S7JA 4J0UA 4E85A 2Y4TA 5FQ7A 5G55A 3GZ2A 3CSFA 1BU9A 3PZ3A 3RRNB 5T3RA 2NXPA 4JHJA 2EIME 4J8FA 3MV3B 3ASHA 2ZIRA 3SFYA 2WMOA 2XCBA 3FFLA 3S7BA 3FDHA 1UG3A 4MLPA 3BUAA 2GRPB 4WAFA 2X6HA 3J5PA 4HLEA 2X6KA 3UINC 4LNUD 2ETBA 4UWHA 3D9KA 4MBGA 4Q94A 2ETAA 4AVXA 3DSXA 5EYLA 1E7VA 1QYMA 1MYOA 2OOEA 1NA0A 2LNIA 5CRUA 1QBQA 4Y6WA 3IHVA 2R03A 3RKVA 3ZRHA 3E4BA 3CVWA 3CK9A 3DRAA 4V3IA 4AM9A 2WXGA 4GTPA 3HYMB 2VSYA 1TJCA 3MKQB 1IHGA 4D10C 5D66A 5J90A 2XRZA 2WXQA 3FEXA 3D9PA 2GROB 3BEEA 4KVOA 3D9MA 5FWQA 4WWNA 4I1OB 3SBTB 2R2LA 5ANLA 4RSYA 3DBSA 2E0IA 3RRMB 2XCCA 3QNKA 2JEKA 4EZKA 5BUZA 3EIJA 4OVUA 3ZNGA 1ELWA 4EZLA 2VYIA 4PS8A 3UTMA 4BWRA 3PEVB 3B7RL 3HXDA 3ZU7B 3DPYA 1SZ9A 3PS6A 3QJZA 3TWSA 3ZGQA 3CKBA 2IOSA 4JHKA 3PZDA 4N39A 2J07A 1TNBA 4LRZA 1UOHA 3UT8A 4JVSA 1JCRA 2XGOA 4GU5A 4GTOA 2CHZA 1TEZA 4ME2A 4TV3A 2ILRA 2KZTB 4QFVA 5ENNA 4L2LA 2XPZA 3ABME 2KCLA 1TNZA 3AAAC 2LO6A 3FU0A 3KSQA 5ENPD 4GPMA 4XEIG 1L5JA 4YVQC 2BEDA 4UQYA 3PREA 5LP0A 2OEWA 4M3OA 2X6JA 1OWMA 4G25A 3SHFA 4F1PA 4U04A 3PZ2A 3MKRA 4C0EA 2CHWA 3ZYMA 3HVEA 4N3CA 5FJYA 3NZSA 4B89A 1H2TC 2EILE 2LAIA 3SNXA 1JUQA 2IF4A 2I9CA 1MJ0A 3MX3A 3D9LA 1N4QA 2EIJE 2XRYA 2XGSA 5CRVA 3CVUA 4U8VD 3TAXA 4BFRA 5LCWJ 4AP2A 1JCSA 2B6CA 4K03A 3FH7A 4GA2A 4PH4B 1RZ4A 3CEQA 1SVXA 3BG1B 3BU8A 2KCKA 2P2CP 3HXCA 3OXLA 4LUNU 3TXMA 2P9IG 3NOGD 2I1KA 3ZHEA 2WQ7A 2XZTG 3Q9UC 4KYOB 4DX5D 1N11A 4PS7A 1WAO1 3E33A 2C2LA 3AG1E 4OYSA 2RKKA 4AXHA 2GGFA 3V79K 3NOCD 3E30A 3JUIA 4BERA 3DSTA 1TNUA 3KEZA 1VDYA 3QDNA 4UI9C 5KWDA 3VTXA 2NSZA 3Q47B 4MS6A 3CSTA 4BTAA 5M72A 1PAQA 3LDZA 3ABLE 2UY1A 1N54A 2Y69E 4I2WA 1N52A 4URKA 1MHQA 2KXPC 2FBNA 3URZA 3NB2A 3C98A 3Q78A 3EHNA 2NYJA 3ZPJA 4CDNA 4GMRA 3Q73A 1Y6IA 3SQVA 2DIWA 3GZSA 2J8SD 3FP3A 3ZYQA 4WUYA 3AG2E 3D9NA 1QZ2A 4UWLA 1U2VG 3SY2A 4L9PA 1DVPA 1UJJA 3ZVVA 4XKBA 4YVOA 2WQ6A 5AENA 1LD7A 3FTVA 3Q79A 1ZU2A 4NIKA 3R9MA 2JLBA 4BTBA 5BV0A 3TWUA 4N3AA 2BUGA 2PL2A 3OTNA 2MOWA 2QYUA 3NF1A 1KLXA 1YYHA 3EUVA 1HU3A 5KJNA 4BX9A 3FH5A 5D0OD 3SO8A 2LAHA 3SFXA 4R7LA 4JEHA 3DEPA 3ULYA 4GTVA 3APDA 2FF4A 4Q69A 4I2ZA 4CZ2D 2WMNA 5BT1A 5CBNA 2YINA 4GPKA 4GTQA 3AG3E 3FUMA 3JQ0A 3SZ7A 1U3CA 5CEAA 3Q49B 1NL4A 3T8MA 3TWXA 4ANVA 4GA0A 5B3SE 1H2UA 3FUIA 5FQ8A 5B1AE 4G24A 5H7PA 4O60A 5KJLA 4RQIA 4JHRA 2PNNA 4W9RA 4N2QA 4H7XA 5DBKA 5G04J 4ANUA 4OAVB 3EHMA 4HNAD 3KD7A 4A3VA 3HIZA 2AVPA 4K5BA 1H6KA 3RO2A 5G05C 2PZIA 3FUDA 3MYVA 4RG9A 1KPSB 2A5EA 3ASOE 1UJKA 4GTMA 2RG8A 5JHAA 2LXLA 5ENSD 5E75A 4ANXA 4EECA 4HRMB 3PRZA 1SA5A 5CMWA 2VTBB 2J49A 5T8IA 3ZW3A 5C1DA 4F1SA 2QZAA 4CDMA 4XIFA 5KNGA 2WXFA 3TWTA 3CVNA 3CHQA 5FQ4A 1PC2A 5EN5D 5DIZA 4C9BB 2L0IA 3LVRE 3Q5MA 4PDXA 3B7TA 3EJNA 5EIDA 3IXEA 1K1BA 4ILHB 3U66A 3UT7A 5EIBE 3CK8A 2WXOA 2J4DA 2V5FA 2XENA 3OAWA 4NACA 2WXIA 4WNEA 1E8XA 1NFIE 4I1MA 3S2AA 5ITZF 3JYSA 3CR3A 2ZXWE 3PE4A 4FLBA 4GZCA 4FADA 1IQUA 3LCAA 3O4ZA 2H6GA 4DX6D 5AARA 1EPUA 2R59A 2KCVA 3IEGA 4MKTA 4JA9A 2IFUA 2GRNB 2H6HA 3MKQA 3TWWA 3EHQA 3LY7A 1PY1A 4ILGA 5A23A 5CCLA 1OXJA 4DLOA 4RLYA 5HRYA 2WVIA 4EZJA 4I6EA 4HOUA 3K9IA 4TRQA 3KSLA 3FTWA 4HBDA 2XQ0A 4U7EB 2RFMA 3DXKG 4GZ5A 3ML8A 3FEYA 2AXZA 3DSWA 1N94A 3RO3A 4DI3A 4EHMA 1D8EA 5KJKA 1QNFA 3QAQA 4JD2G 2IO3C 3QK0A 2NC9A 3B95A 4U0ZA 3DPDA 3BQOA 5G2NA 1HO8A 1O5MA 3ENEA 1UW4B 3D9HA 3CV0A 1A17A 2F0YA 5CERB 3GYZA 3IHYA 3APFA 1NZNA 3UXGA 3E34A 3N71A 4L7TA 1FVFA 3D3MA 4HFGA 3UT4A 2XPYA 4ILIA 4KBQA 2A4ZA 1Z5SC 1NA3A 4G2VA 1V55E 1Z6TA 2HR2A 3FHEA 2P9SG 1NP7A 4AY5A 3NAWA 3JCKC 3C3QA 2VSXE 2KZTA 4A1SA 3PE3A 5HQ8A 2FO1E 3EU9A 4APOA 4A55A 4DLQA 2FEZA 3FTUA 3QC1A 3ZIMA 3CVQA 4HOSA 3NZUA 4B0ZA 4CT4A 4HOQA 1TJFA 4AJWA 4QQIA 2XGMA 5ENRD 5LX8A 2C0LA 3ZYLA 1X81A 3L6AA 3UIOC 4GYYA 1TNOA 3RK6A 3D9OA 4H7YA 4N5QA 2MRIA 4CCAA 2GRLA 4M7CA 4XKCA 2B0OE 5LOZA 3AS4A 3U3WA 3HG0D 1SZAA 4CGVA 4MRUA 3C72A 1HX8A 3VTYA 3TWRA 3OXFA 3PVLA 1E8WA 3OXGA 2GRRB 2C0MA 3ZEFA 3JXIA 3QWPA 3ASFA 4NRHB 2WQHA 4EBAA 1INZA 5C2YA 4BSZB 4DX2A 5FINA 3W9FA 2VGEA 3FUFA 2J9QA 1YMPA 2BTDA 2XZDG 4GAAA 3ASNE 3CVXA 3U4TA 3IBEA 2ZGGA 4DX1A 3L16A 1FT1A 1TNYA 3LVQE 1N4SA 2ETCA 4EBAG 3LKUA 2OCCE 2WXLA 4I43A 3RIBA 3UX4A 1MX2A 4X8QA 1BPOA 3GZ1A 3BG0B 2ZGDA 1XNFA 3HHMA 4JEUA 4FHJA 2IO2C 4FP7A 4P29A 4WNFA 4HRNA 5EYPF 1H6PA 2P58C 4CEMA 1IYGA 4I9CA 1BLXB 1S70B 4N5CA 4GMLA 3T5VA 5G04C 5EX3A 1FT2A 3ESKA 2ONDA 2OV8A 2PQNA 1HS6A 1S0PA 2L0TB 4TXRA 1W3BA 2LUHA 2FULA 5JMND 3FULA 2WXRA 3I4RB 1WG0A 4CGWA 5JJ7A 2R5SA 4BT8A 2VGXB 4UI9K 1YA0A 2QFCA 2DYRE 4DK5A 1BD8A 2L6BA 1HXIA 2ZU6B 5FTPA 1Y8MA 2OVBA 2X38A 4FLHA 3C3RA 2LXMA 3FUKA 4GYWA 5HKPA 3U9WA 1N4RA 1V54E 1MX6A 2X3MA 2R05A 4HB5A 1AP7A 3NQPA 3B13A 3V2XA 3MA5A 5BNWA 3CVPA 3ONKA 5KBAA 3GW4A 4UWFA 5FZQA 5J08A 4WNGA 2J08A 4WNDA 2CFZA 3NBNB 3HXFA 4DJAA 5KJMA 1DCEA 3IKOB 1H2VC 4WWOA 3G2UA 4KT6B 3CVVA 4J8YA 4TUUA 1OCZE 2V8SE 3D9IA 4OAUC 1IKND 2A5UA 3EHRA 1N4PA 3PDNA 2XEVA 1BI7B 3FUNA 5ARGA 1HG2A 3FU3A 1EDUA 2Y3AA 3EU5A 3LY8A 1O1TA 4K0RA 2YNQA 4UQXA 4GA1A 2IY0C 2I1JA 3DXMG 4JL0A 2LSVA 4A1GA 2XPIA 5T4YA 5HI7A 3LJNA 5AQ9A 3HDXA 2DVWA 2YHEA 4RG6A 4U8YD 4EQFA 3QKYA 4PUCA 3CVLA 3UI2A 4LERA 1IXVA 1OCRE 3B7SA 3MGBA 1X5BA 2VTBA 1ZB1A 3SD5A 1K3ZD 1WY6A 3S7DA 4APFA 4N2SA 3ZXPA 2IOLA 4KXKB 3L22A 1LF8A 3E37A 4J8EA 5EILA 1K1AA 1N95A 3SBSA 1Z3XA 2WXHA 4ZFHA 5EDSA 4AV7A 4DI4A 2WB2A 1LD8A 3C5RA 5KNHD 3X2QE 3IV0A 3ZYKA 2YHCA 4HQDA 4KVMA 5ENOD 3R9AB 4KZCA 5AJLA 4YDYA 4J8DA 3TGOA 5ENQD 4DUIA 4G8LA 4I1AA 3L08A 3ASDA 3FWVA 4CT0A 2EIKE 4F7AA 4Q96A 2Y1LE 4G26A 2QC9A 4K5CA 3SGHA 4BEPA 4LCTA 3B7UX 4DX7D 4GTSA 5CECB 2JABA 2P9LG 3ULEG 4AEZC 1MZCA 5JHBA 2DYSE 2CG3A 2MHKA 2P9KG 3VLEA 4GCNA 4ABNA 1KT1A 2YQ8A 2E2EA 1E7UA 1XGWA 2HE0A 5AQ7A 5BPPA 4UI9J 2I6HA 3CLJA 2J09A 4F53A 2PM7A 5CHEE 1Q2ZA 2IEJA 4ACKA 4O1OA 4LSZE 2EQXA 1IHBA 4JPSA 4DRXE 4WWPA 2DWZA 3QARA 1SA4A 1SW6A 2FI7A 3SFZA 4IYPA 3V30A 3HXBA 3G2VA 4J6IA 5A7DB 5KCMA 2CG2A 3ASGA 3TJPA 3PZ4A 4PS3A 4G23A 3S7FA 5AAOA 3MJWA 4UUCA 1TN8A 5HS0A 1LTXA 1O1RA 3DEOA 3CGHA 1K8KG 2BF0X 3U64A 4XI9A 2V5QC 3PUKA 4GB9A 4LNGA 2WXNA 3JXJA 3LS8A 4G11A 2R02A 3TL5A 4AOFA 2DBAA 3KAEA 2Y0BG 5CEDB 2RFAA 1RW2A 3T8KA 1EF1C 3ABKE 5LCWC 4NURA 2RD0A 2P9UG 2X6FA 2LSUA 2GRQB 4LG6A 1OWNA 4JXTA 3SF4A 1HH8A 5AQAA 1HZ4A 5FZRA 5BXOA 1NI1A 3CQCB 3UM2A 3DSUA 4ATGA 3LY9A 2VQ2A 2XS8A 3TWQA 4CRWA 3FUEA 4FULA 2IU1A 4JA7A 1UN8A 3FY4A 3JQ1A 3I5PA 1GW6A 1OCOE 3HRAA 1OWOA 1E90A 5BW8C 1WDYA 3LEWA 1HE8A 4GZ6A 3E32A 4FA6A 2KM4A 1KT0A 3CHOA 2VJ8A 5B1BE 5CMYA 1U3DA 1DCQA 3L82A 4LNBA 3ONLA 4BETA 4ACLA 3PH0C 3APCA 4A3TA 1E8ZA 5ANRA 4B8AA 2WXPA 4UWKA 2HM8A 2AW6A 5G05J 3L54A 4HI8A 3C3OA 4UWGA 4O1PA 1O1SA 5CCMA 4GCOA 2F8YA 3T5XA 5EKQD 2XHEA 1TYQG 3MEKA 3FTYA 5D0QD 4DPRA 3Q9NC 1ZBPA 2F8XK 4JZYA 5AN8A 1JCQA 4A63B 1HF8A 1H6OA 3G2WA 4JW1A 3LXUX 3V2OA 1HFAA 4BESA 5FZSA 4I9EA 4TUMA 4NQ0A 4GYOA 1B89A 5A6CA 5AJDA 3AU5A 2FO7A 3L9TA 3P1UA 3J5QB 5D2MC 2VSNA 2R17C 4FC8A 5FQ6A 3Q75A 4TXPA 4XZ4A 5BV1A 4L23A 4Y6CA 5AQBA 2GRMA 1QQEA 4CDRA 1FCHA 3QWVA 3RAUA 2XEEA 4ZHBA 5BXUA 3QB2A 4BSXA 2DCPA 3VLDA 1TN6A 2H6FA 2L6JA 4U96D 2ZISA 4FJZA 3I3NA 4OVVA 5AYWD 2Q7FA 4L1BA 4C0MA 2VGXA 1N0RA 3TG4A 3AS5A 3G2SA 1WM5A 3ULQA 3LYAA 3R7RA 1Z3YA 3CKCA 3L13A 4KMOA 3ISMC 1AWCB 4TXQA 3RSEG 1D9SA 3QWWA 4EPZA 4HI9A 4I6GA 4FHKA 3KEAA 2CFUA 4U8HA 2F37A 3PUJA 2I2OA 2CHXA 2IONA 3FU5A 4JB8P 3UKUG 4GMJA 3L17A 3HVEB 2HO1A 2V4LA 3Q15A 1N9AA 1FPPA 3MV2B 4YNDA 3PNTB 3CK7A 4AIFA 2WXKA 2GW1A 2EINE 4B8CB 4YDWA 1UN9A 1YCSB 2IQCA 4FJYA 4Z68A 1KZOA 2AWIA 3EDTB 2KBXA 2OEVA 4XE0A 4HXIA 5AIJA 3D9JA 3CHRA 3ZKJA 3CHMA 4HS2A 2H6IA 2QYJA 1OY3D 2AXUA 2KC7A 2WXMA 1DC2A 4O6FA 1OUVA 3MZLB 3ZHEB 3Q4AB 2KATA 4J7WA 3ML9A 1IQRA 3MCXA 2PM6A 4C48B 1EYHA 3FTXA 4I6JA 4HRLA 4N3BA 1MQSA 3P2BA 1SQMA 3Q7FA 4U63A 5LFAA 4HLLA 4KZ0A 2V4HC 4BY6A 5JJTA 5CBOA 4G1TA 3UPVA 1S64A 1E96B 4IN3B 3WXXA 2VSOE 5JJ6A 2V0PA 1G3NB 3UIPC 3CIAA 3TWVA 3RRUA 4U07A 4E6HA 2VGYA 3UM3A 4GZDA 3V31A 3AS8A 3LJ3A 2DZOA 3ESLA 2WM9A 3DSVA 4HVBA 2UY1B 3TG5A 2M63A 4G8KA 4F3VA 5E76A 3T9KA
chains in the Genus database with same CATH topology
1N9AA 1DCEA 3Q75A 4GTTA 1FPPA 1TNBA 1SA4A 3E37A 3HXCA 1QBQA 1N95A 1JCRA 4YDEA 3HXBA 3DSSA 4GTOA 3E32A 1KZOA 4GTMA 3DRAA 3KSLA 1LD8A 1TN6A 3E33A 2H6FA 3EUVA 1SA5A 2ZISA 4YDOA 3PZ4A 4LNBA 3DSWA 4GTPA 1N94A 1X81A 1TN8A 3Q7AA 1TN7A 1TNZA 3SFXA 1LTXA 1TNOA 4EHMA 1N4PA 1O1RA 1D8EA 1FT2A 3E30A 4GTVA 3DSTA 2H6IA 1TNUA 3KSQA 3EU5A 1KZPA 1O1TA 4LNGA 1O5MA 2BEDA 2F0YA 3C72A 1O1SA 4GTQA 4GTSA 3PZ2A 3E34A 3PZ3A 2R2LA 1MZCA 3Q7FA 1NL4A 1S64A 3Q78A 2ZIRA 3SFYA 1JCQA 1D8DA 1NI1A 3Q73A 3PZ1A 3DSUA 3HXEA 1N4RA 1N4QA 3HXDA 1S63A 3DPYA 4GTRA 2H6GA 2IEJA 4MBGA 4L9PA 3DSVA 1FT1A 1JCSA 1LD7A 1TNYA 3DSXA 1N4SA 3HXFA 3Q79A 2H6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9A A;  1DCE A;  3Q75 A;  4GTT A;  1FPP A;  1TNB A;  1SA4 A;  3E37 A;  3HXC A;  1QBQ A;  1N95 A;  1JCR A;  4YDE A;  3HXB A;  3DSS A;  4GTO A;  3E32 A;  1KZO A;  4GTM A;  3DRA A;  3KSL A;  1LD8 A;  1TN6 A;  3E33 A;  2H6F A;  3EUV A;  1SA5 A;  2ZIS A;  4YDO A;  3PZ4 A;  4LNB A;  3DSW A;  4GTP A;  1N94 A;  1X81 A;  1TN8 A;  3Q7A A;  1TN7 A;  1TNZ A;  3SFX A;  1LTX A;  1TNO A;  4EHM A;  1N4P A;  1O1R A;  1D8E A;  1FT2 A;  3E30 A;  4GTV A;  3DST A;  2H6I A;  1TNU A;  3KSQ A;  3EU5 A;  1KZP A;  1O1T A;  4LNG A;  1O5M A;  2BED A;  2F0Y A;  3C72 A;  1O1S A;  4GTQ A;  4GTS A;  3PZ2 A;  3E34 A;  3PZ3 A;  2R2L A;  1MZC A;  3Q7F A;  1NL4 A;  1S64 A;  3Q78 A;  2ZIR A;  3SFY A;  1JCQ A;  1D8D A;  1NI1 A;  3Q73 A;  3PZ1 A;  3DSU A;  3HXE A;  1N4R A;  1N4Q A;  3HXD A;  1S63 A;  3DPY A;  4GTR A;  2H6G A;  2IEJ A;  4MBG A;  4L9P A;  3DSV A;  1FT1 A;  1JCS A;  1LD7 A;  1TNY A;  3DSX A;  1N4S A;  3HXF A;  3Q79 A;  2H6H A; 
#chains in the Genus database with same CATH topology
 3PNL B;  2L9B A;  4GTT A;  2AXV A;  4U95 D;  5ARF A;  3TXN A;  1P5Q A;  2J4B A;  3FTS A;  4CYM D;  3QOU A;  2WXJ A;  3UQ3 A;  4YDE A;  4I17 A;  3AU4 A;  3CQG B;  3DSS A;  1DNP A;  3LPZ A;  4BT9 A;  1JWG A;  3ZUV B;  4YDO A;  3UKR G;  3EIQ C;  4J8S A;  3FH8 A;  4L2Y A;  3WG7 E;  3Q7A A;  2P9P G;  5FT9 A;  4HOR A;  3SI5 A;  2P9N G;  1N0Q A;  3I4G A;  3O48 A;  3FU6 A;  3JUE A;  4FU3 A;  4GZ3 A;  4RVB A;  4HOT A;  2OVF A;  3AG4 E;  3UUX A;  1ELK A;  1ELR A;  1FVH A;  3W9G A;  3PEU B;  1E8Y A;  3B7B A;  3CHP A;  3CVY A;  1JPL A;  2BKK B;  1HG5 A;  2HYZ A;  1MX4 A;  4XX5 A;  5EX0 A;  1H0A A;  4IRU A;  4B94 A;  4IUL A;  2PQR A;  2Y4U A;  2AJA A;  1D8D A;  4U0S A;  3PZ1 A;  3UM1 A;  5FIO A;  3UMV A;  3ZFW A;  2XEH A;  3HXE A;  3G2T A;  4ANW A;  2QY7 A;  1OT8 A;  1S63 A;  4GTR A;  2UWJ G;  1A5E A;  4B93 B;  1BI8 B;  2DZN A;  1OCC E;  2XS1 A;  4U0U A;  5JA4 D;  3R7Q A;  5IY5 E;  3DWL G;  4JC8 A;  3FUJ A;  4AY6 A;  3FUH A;  3KS2 A;  3RU0 A;  2X6I A;  1JWF A;  3AJI A;  2MYO A;  3ZXS A;  4F6R D;  3ZN3 A;  3RJV A;  4BX8 A;  4LEU A;  3UM0 A;  1TR4 A;  4UQZ A;  2WPV A;  3F6Q A;  1TN7 A;  1OWP A;  2IJG X;  5ENT D;  1H19 A;  1OWL A;  4XI0 A;  4ATZ D;  3FTZ A;  2BKG A;  1KZP A;  4K5A B;  3VLF A;  3CHS A;  3S7J A;  4J0U A;  4E85 A;  2Y4T A;  5FQ7 A;  5G55 A;  3GZ2 A;  3CSF A;  1BU9 A;  3PZ3 A;  3RRN B;  5T3R A;  2NXP A;  4JHJ A;  2EIM E;  4J8F A;  3MV3 B;  3ASH A;  2ZIR A;  3SFY A;  2WMO A;  2XCB A;  3FFL A;  3S7B A;  3FDH A;  1UG3 A;  4MLP A;  3BUA A;  2GRP B;  4WAF A;  2X6H A;  3J5P A;  4HLE A;  2X6K A;  3UIN C;  4LNU D;  2ETB A;  4UWH A;  3D9K A;  4MBG A;  4Q94 A;  2ETA A;  4AVX A;  3DSX A;  5EYL A;  1E7V A;  1QYM A;  1MYO A;  2OOE A;  1NA0 A;  2LNI A;  5CRU A;  1QBQ A;  4Y6W A;  3IHV A;  2R03 A;  3RKV A;  3ZRH A;  3E4B A;  3CVW A;  3CK9 A;  3DRA A;  4V3I A;  4AM9 A;  2WXG A;  4GTP A;  3HYM B;  2VSY A;  1TJC A;  3MKQ B;  1IHG A;  4D10 C;  5D66 A;  5J90 A;  2XRZ A;  2WXQ A;  3FEX A;  3D9P A;  2GRO B;  3BEE A;  4KVO A;  3D9M A;  5FWQ A;  4WWN A;  4I1O B;  3SBT B;  2R2L A;  5ANL A;  4RSY A;  3DBS A;  2E0I A;  3RRM B;  2XCC A;  3QNK A;  2JEK A;  4EZK A;  5BUZ A;  3EIJ A;  4OVU A;  3ZNG A;  1ELW A;  4EZL A;  2VYI A;  4PS8 A;  3UTM A;  4BWR A;  3PEV B;  3B7R L;  3HXD A;  3ZU7 B;  3DPY A;  1SZ9 A;  3PS6 A;  3QJZ A;  3TWS A;  3ZGQ A;  3CKB A;  2IOS A;  4JHK A;  3PZD A;  4N39 A;  2J07 A;  1TNB A;  4LRZ A;  1UOH A;  3UT8 A;  4JVS A;  1JCR A;  2XGO A;  4GU5 A;  4GTO A;  2CHZ A;  1TEZ A;  4ME2 A;  4TV3 A;  2ILR A;  2KZT B;  4QFV A;  5ENN A;  4L2L A;  2XPZ A;  3ABM E;  2KCL A;  1TNZ A;  3AAA C;  2LO6 A;  3FU0 A;  3KSQ A;  5ENP D;  4GPM A;  4XEI G;  1L5J A;  4YVQ C;  2BED A;  4UQY A;  3PRE A;  5LP0 A;  2OEW A;  4M3O A;  2X6J A;  1OWM A;  4G25 A;  3SHF A;  4F1P A;  4U04 A;  3PZ2 A;  3MKR A;  4C0E A;  2CHW A;  3ZYM A;  3HVE A;  4N3C A;  5FJY A;  3NZS A;  4B89 A;  1H2T C;  2EIL E;  2LAI A;  3SNX A;  1JUQ A;  2IF4 A;  2I9C A;  1MJ0 A;  3MX3 A;  3D9L A;  1N4Q A;  2EIJ E;  2XRY A;  2XGS A;  5CRV A;  3CVU A;  4U8V D;  3TAX A;  4BFR A;  5LCW J;  4AP2 A;  1JCS A;  2B6C A;  4K03 A;  3FH7 A;  4GA2 A;  4PH4 B;  1RZ4 A;  3CEQ A;  1SVX A;  3BG1 B;  3BU8 A;  2KCK A;  2P2C P;  3HXC A;  3OXL A;  4LUN U;  3TXM A;  2P9I G;  3NOG D;  2I1K A;  3ZHE A;  2WQ7 A;  2XZT G;  3Q9U C;  4KYO B;  4DX5 D;  1N11 A;  4PS7 A;  1WAO 1;  3E33 A;  2C2L A;  3AG1 E;  4OYS A;  2RKK A;  4AXH A;  2GGF A;  3V79 K;  3NOC D;  3E30 A;  3JUI A;  4BER A;  3DST A;  1TNU A;  3KEZ A;  1VDY A;  3QDN A;  4UI9 C;  5KWD A;  3VTX A;  2NSZ A;  3Q47 B;  4MS6 A;  3CST A;  4BTA A;  5M72 A;  1PAQ A;  3LDZ A;  3ABL E;  2UY1 A;  1N54 A;  2Y69 E;  4I2W A;  1N52 A;  4URK A;  1MHQ A;  2KXP C;  2FBN A;  3URZ A;  3NB2 A;  3C98 A;  3Q78 A;  3EHN A;  2NYJ A;  3ZPJ A;  4CDN A;  4GMR A;  3Q73 A;  1Y6I A;  3SQV A;  2DIW A;  3GZS A;  2J8S D;  3FP3 A;  3ZYQ A;  4WUY A;  3AG2 E;  3D9N A;  1QZ2 A;  4UWL A;  1U2V G;  3SY2 A;  4L9P A;  1DVP A;  1UJJ A;  3ZVV A;  4XKB A;  4YVO A;  2WQ6 A;  5AEN A;  1LD7 A;  3FTV A;  3Q79 A;  1ZU2 A;  4NIK A;  3R9M A;  2JLB A;  4BTB A;  5BV0 A;  3TWU A;  4N3A A;  2BUG A;  2PL2 A;  3OTN A;  2MOW A;  2QYU A;  3NF1 A;  1KLX A;  1YYH A;  3EUV A;  1HU3 A;  5KJN A;  4BX9 A;  3FH5 A;  5D0O D;  3SO8 A;  2LAH A;  3SFX A;  4R7L A;  4JEH A;  3DEP A;  3ULY A;  4GTV A;  3APD A;  2FF4 A;  4Q69 A;  4I2Z A;  4CZ2 D;  2WMN A;  5BT1 A;  5CBN A;  2YIN A;  4GPK A;  4GTQ A;  3AG3 E;  3FUM A;  3JQ0 A;  3SZ7 A;  1U3C A;  5CEA A;  3Q49 B;  1NL4 A;  3T8M A;  3TWX A;  4ANV A;  4GA0 A;  5B3S E;  1H2U A;  3FUI A;  5FQ8 A;  5B1A E;  4G24 A;  5H7P A;  4O60 A;  5KJL A;  4RQI A;  4JHR A;  2PNN A;  4W9R A;  4N2Q A;  4H7X A;  5DBK A;  5G04 J;  4ANU A;  4OAV B;  3EHM A;  4HNA D;  3KD7 A;  4A3V A;  3HIZ A;  2AVP A;  4K5B A;  1H6K A;  3RO2 A;  5G05 C;  2PZI A;  3FUD A;  3MYV A;  4RG9 A;  1KPS B;  2A5E A;  3ASO E;  1UJK A;  4GTM A;  2RG8 A;  5JHA A;  2LXL A;  5ENS D;  5E75 A;  4ANX A;  4EEC A;  4HRM B;  3PRZ A;  1SA5 A;  5CMW A;  2VTB B;  2J49 A;  5T8I A;  3ZW3 A;  5C1D A;  4F1S A;  2QZA A;  4CDM A;  4XIF A;  5KNG A;  2WXF A;  3TWT A;  3CVN A;  3CHQ A;  5FQ4 A;  1PC2 A;  5EN5 D;  5DIZ A;  4C9B B;  2L0I A;  3LVR E;  3Q5M A;  4PDX A;  3B7T A;  3EJN A;  5EID A;  3IXE A;  1K1B A;  4ILH B;  3U66 A;  3UT7 A;  5EIB E;  3CK8 A;  2WXO A;  2J4D A;  2V5F A;  2XEN A;  3OAW A;  4NAC A;  2WXI A;  4WNE A;  1E8X A;  1NFI E;  4I1M A;  3S2A A;  5ITZ F;  3JYS A;  3CR3 A;  2ZXW E;  3PE4 A;  4FLB A;  4GZC A;  4FAD A;  1IQU A;  3LCA A;  3O4Z A;  2H6G A;  4DX6 D;  5AAR A;  1EPU A;  2R59 A;  2KCV A;  3IEG A;  4MKT A;  4JA9 A;  2IFU A;  2GRN B;  2H6H A;  3MKQ A;  3TWW A;  3EHQ A;  3LY7 A;  1PY1 A;  4ILG A;  5A23 A;  5CCL A;  1OXJ A;  4DLO A;  4RLY A;  5HRY A;  2WVI A;  4EZJ A;  4I6E A;  4HOU A;  3K9I A;  4TRQ A;  3KSL A;  3FTW A;  4HBD A;  2XQ0 A;  4U7E B;  2RFM A;  3DXK G;  4GZ5 A;  3ML8 A;  3FEY A;  2AXZ A;  3DSW A;  1N94 A;  3RO3 A;  4DI3 A;  4EHM A;  1D8E A;  5KJK A;  1QNF A;  3QAQ A;  4JD2 G;  2IO3 C;  3QK0 A;  2NC9 A;  3B95 A;  4U0Z A;  3DPD A;  3BQO A;  5G2N A;  1HO8 A;  1O5M A;  3ENE A;  1UW4 B;  3D9H A;  3CV0 A;  1A17 A;  2F0Y A;  5CER B;  3GYZ A;  3IHY A;  3APF A;  1NZN A;  3UXG A;  3E34 A;  3N71 A;  4L7T A;  1FVF A;  3D3M A;  4HFG A;  3UT4 A;  2XPY A;  4ILI A;  4KBQ A;  2A4Z A;  1Z5S C;  1NA3 A;  4G2V A;  1V55 E;  1Z6T A;  2HR2 A;  3FHE A;  2P9S G;  1NP7 A;  4AY5 A;  3NAW A;  3JCK C;  3C3Q A;  2VSX E;  2KZT A;  4A1S A;  3PE3 A;  5HQ8 A;  2FO1 E;  3EU9 A;  4APO A;  4A55 A;  4DLQ A;  2FEZ A;  3FTU A;  3QC1 A;  3ZIM A;  3CVQ A;  4HOS A;  3NZU A;  4B0Z A;  4CT4 A;  4HOQ A;  1TJF A;  4AJW A;  4QQI A;  2XGM A;  5ENR D;  5LX8 A;  2C0L A;  3ZYL A;  1X81 A;  3L6A A;  3UIO C;  4GYY A;  1TNO A;  3RK6 A;  3D9O A;  4H7Y A;  4N5Q A;  2MRI A;  4CCA A;  2GRL A;  4M7C A;  4XKC A;  2B0O E;  5LOZ A;  3AS4 A;  3U3W A;  3HG0 D;  1SZA A;  4CGV A;  4MRU A;  3C72 A;  1HX8 A;  3VTY A;  3TWR A;  3OXF A;  3PVL A;  1E8W A;  3OXG A;  2GRR B;  2C0M A;  3ZEF A;  3JXI A;  3QWP A;  3ASF A;  4NRH B;  2WQH A;  4EBA A;  1INZ A;  5C2Y A;  4BSZ B;  4DX2 A;  5FIN A;  3W9F A;  2VGE A;  3FUF A;  2J9Q A;  1YMP A;  2BTD A;  2XZD G;  4GAA A;  3ASN E;  3CVX A;  3U4T A;  3IBE A;  2ZGG A;  4DX1 A;  3L16 A;  1FT1 A;  1TNY A;  3LVQ E;  1N4S A;  2ETC A;  4EBA G;  3LKU A;  2OCC E;  2WXL A;  4I43 A;  3RIB A;  3UX4 A;  1MX2 A;  4X8Q A;  1BPO A;  3GZ1 A;  3BG0 B;  2ZGD A;  1XNF A;  3HHM A;  4JEU A;  4FHJ A;  2IO2 C;  4FP7 A;  4P29 A;  4WNF A;  4HRN A;  5EYP F;  1H6P A;  2P58 C;  4CEM A;  1IYG A;  4I9C A;  1BLX B;  1S70 B;  4N5C A;  4GML A;  3T5V A;  5G04 C;  5EX3 A;  1FT2 A;  3ESK A;  2OND A;  2OV8 A;  2PQN A;  1HS6 A;  1S0P A;  2L0T B;  4TXR A;  1W3B A;  2LUH A;  2FUL A;  5JMN D;  3FUL A;  2WXR A;  3I4R B;  1WG0 A;  4CGW A;  5JJ7 A;  2R5S A;  4BT8 A;  2VGX B;  4UI9 K;  1YA0 A;  2QFC A;  2DYR E;  4DK5 A;  1BD8 A;  2L6B A;  1HXI A;  2ZU6 B;  5FTP A;  1Y8M A;  2OVB A;  2X38 A;  4FLH A;  3C3R A;  2LXM A;  3FUK A;  4GYW A;  5HKP A;  3U9W A;  1N4R A;  1V54 E;  1MX6 A;  2X3M A;  2R05 A;  4HB5 A;  1AP7 A;  3NQP A;  3B13 A;  3V2X A;  3MA5 A;  5BNW A;  3CVP A;  3ONK A;  5KBA A;  3GW4 A;  4UWF A;  5FZQ A;  5J08 A;  4WNG A;  2J08 A;  4WND A;  2CFZ A;  3NBN B;  3HXF A;  4DJA A;  5KJM A;  1DCE A;  3IKO B;  1H2V C;  4WWO A;  3G2U A;  4KT6 B;  3CVV A;  4J8Y A;  4TUU A;  1OCZ E;  2V8S E;  3D9I A;  4OAU C;  1IKN D;  2A5U A;  3EHR A;  1N4P A;  3PDN A;  2XEV A;  1BI7 B;  3FUN A;  5ARG A;  1HG2 A;  3FU3 A;  1EDU A;  2Y3A A;  3EU5 A;  3LY8 A;  1O1T A;  4K0R A;  2YNQ A;  4UQX A;  4GA1 A;  2IY0 C;  2I1J A;  3DXM G;  4JL0 A;  2LSV A;  4A1G A;  2XPI A;  5T4Y A;  5HI7 A;  3LJN A;  5AQ9 A;  3HDX A;  2DVW A;  2YHE A;  4RG6 A;  4U8Y D;  4EQF A;  3QKY A;  4PUC A;  3CVL A;  3UI2 A;  4LER A;  1IXV A;  1OCR E;  3B7S A;  3MGB A;  1X5B A;  2VTB A;  1ZB1 A;  3SD5 A;  1K3Z D;  1WY6 A;  3S7D A;  4APF A;  4N2S A;  3ZXP A;  2IOL A;  4KXK B;  3L22 A;  1LF8 A;  3E37 A;  4J8E A;  5EIL A;  1K1A A;  1N95 A;  3SBS A;  1Z3X A;  2WXH A;  4ZFH A;  5EDS A;  4AV7 A;  4DI4 A;  2WB2 A;  1LD8 A;  3C5R A;  5KNH D;  3X2Q E;  3IV0 A;  3ZYK A;  2YHC A;  4HQD A;  4KVM A;  5ENO D;  3R9A B;  4KZC A;  5AJL A;  4YDY A;  4J8D A;  3TGO A;  5ENQ D;  4DUI A;  4G8L A;  4I1A A;  3L08 A;  3ASD A;  3FWV A;  4CT0 A;  2EIK E;  4F7A A;  4Q96 A;  2Y1L E;  4G26 A;  2QC9 A;  4K5C A;  3SGH A;  4BEP A;  4LCT A;  3B7U X;  4DX7 D;  4GTS A;  5CEC B;  2JAB A;  2P9L G;  3ULE G;  4AEZ C;  1MZC A;  5JHB A;  2DYS E;  2CG3 A;  2MHK A;  2P9K G;  3VLE A;  4GCN A;  4ABN A;  1KT1 A;  2YQ8 A;  2E2E A;  1E7U A;  1XGW A;  2HE0 A;  5AQ7 A;  5BPP A;  4UI9 J;  2I6H A;  3CLJ A;  2J09 A;  4F53 A;  2PM7 A;  5CHE E;  1Q2Z A;  2IEJ A;  4ACK A;  4O1O A;  4LSZ E;  2EQX A;  1IHB A;  4JPS A;  4DRX E;  4WWP A;  2DWZ A;  3QAR A;  1SA4 A;  1SW6 A;  2FI7 A;  3SFZ A;  4IYP A;  3V30 A;  3HXB A;  3G2V A;  4J6I A;  5A7D B;  5KCM A;  2CG2 A;  3ASG A;  3TJP A;  3PZ4 A;  4PS3 A;  4G23 A;  3S7F A;  5AAO A;  3MJW A;  4UUC A;  1TN8 A;  5HS0 A;  1LTX A;  1O1R A;  3DEO A;  3CGH A;  1K8K G;  2BF0 X;  3U64 A;  4XI9 A;  2V5Q C;  3PUK A;  4GB9 A;  4LNG A;  2WXN A;  3JXJ A;  3LS8 A;  4G11 A;  2R02 A;  3TL5 A;  4AOF A;  2DBA A;  3KAE A;  2Y0B G;  5CED B;  2RFA A;  1RW2 A;  3T8K A;  1EF1 C;  3ABK E;  5LCW C;  4NUR A;  2RD0 A;  2P9U G;  2X6F A;  2LSU A;  2GRQ B;  4LG6 A;  1OWN A;  4JXT A;  3SF4 A;  1HH8 A;  5AQA A;  1HZ4 A;  5FZR A;  5BXO A;  1NI1 A;  3CQC B;  3UM2 A;  3DSU A;  4ATG A;  3LY9 A;  2VQ2 A;  2XS8 A;  3TWQ A;  4CRW A;  3FUE A;  4FUL A;  2IU1 A;  4JA7 A;  1UN8 A;  3FY4 A;  3JQ1 A;  3I5P A;  1GW6 A;  1OCO E;  3HRA A;  1OWO A;  1E90 A;  5BW8 C;  1WDY A;  3LEW A;  1HE8 A;  4GZ6 A;  3E32 A;  4FA6 A;  2KM4 A;  1KT0 A;  3CHO A;  2VJ8 A;  5B1B E;  5CMY A;  1U3D A;  1DCQ A;  3L82 A;  4LNB A;  3ONL A;  4BET A;  4ACL A;  3PH0 C;  3APC A;  4A3T A;  1E8Z A;  5ANR A;  4B8A A;  2WXP A;  4UWK A;  2HM8 A;  2AW6 A;  5G05 J;  3L54 A;  4HI8 A;  3C3O A;  4UWG A;  4O1P A;  1O1S A;  5CCM A;  4GCO A;  2F8Y A;  3T5X A;  5EKQ D;  2XHE A;  1TYQ G;  3MEK A;  3FTY A;  5D0Q D;  4DPR A;  3Q9N C;  1ZBP A;  2F8X K;  4JZY A;  5AN8 A;  1JCQ A;  4A63 B;  1HF8 A;  1H6O A;  3G2W A;  4JW1 A;  3LXU X;  3V2O A;  1HFA A;  4BES A;  5FZS A;  4I9E A;  4TUM A;  4NQ0 A;  4GYO A;  1B89 A;  5A6C A;  5AJD A;  3AU5 A;  2FO7 A;  3L9T A;  3P1U A;  3J5Q B;  5D2M C;  2VSN A;  2R17 C;  4FC8 A;  5FQ6 A;  3Q75 A;  4TXP A;  4XZ4 A;  5BV1 A;  4L23 A;  4Y6C A;  5AQB A;  2GRM A;  1QQE A;  4CDR A;  1FCH A;  3QWV A;  3RAU A;  2XEE A;  4ZHB A;  5BXU A;  3QB2 A;  4BSX A;  2DCP A;  3VLD A;  1TN6 A;  2H6F A;  2L6J A;  4U96 D;  2ZIS A;  4FJZ A;  3I3N A;  4OVV A;  5AYW D;  2Q7F A;  4L1B A;  4C0M A;  2VGX A;  1N0R A;  3TG4 A;  3AS5 A;  3G2S A;  1WM5 A;  3ULQ A;  3LYA A;  3R7R A;  1Z3Y A;  3CKC A;  3L13 A;  4KMO A;  3ISM C;  1AWC B;  4TXQ A;  3RSE G;  1D9S A;  3QWW A;  4EPZ A;  4HI9 A;  4I6G A;  4FHK A;  3KEA A;  2CFU A;  4U8H A;  2F37 A;  3PUJ A;  2I2O A;  2CHX A;  2ION A;  3FU5 A;  4JB8 P;  3UKU G;  4GMJ A;  3L17 A;  3HVE B;  2HO1 A;  2V4L A;  3Q15 A;  1N9A A;  1FPP A;  3MV2 B;  4YND A;  3PNT B;  3CK7 A;  4AIF A;  2WXK A;  2GW1 A;  2EIN E;  4B8C B;  4YDW A;  1UN9 A;  1YCS B;  2IQC A;  4FJY A;  4Z68 A;  1KZO A;  2AWI A;  3EDT B;  2KBX A;  2OEV A;  4XE0 A;  4HXI A;  5AIJ A;  3D9J A;  3CHR A;  3ZKJ A;  3CHM A;  4HS2 A;  2H6I A;  2QYJ A;  1OY3 D;  2AXU A;  2KC7 A;  2WXM A;  1DC2 A;  4O6F A;  1OUV A;  3MZL B;  3ZHE B;  3Q4A B;  2KAT A;  4J7W A;  3ML9 A;  1IQR A;  3MCX A;  2PM6 A;  4C48 B;  1EYH A;  3FTX A;  4I6J A;  4HRL A;  4N3B A;  1MQS A;  3P2B A;  1SQM A;  3Q7F A;  4U63 A;  5LFA A;  4HLL A;  4KZ0 A;  2V4H C;  4BY6 A;  5JJT A;  5CBO A;  4G1T A;  3UPV A;  1S64 A;  1E96 B;  4IN3 B;  3WXX A;  2VSO E;  5JJ6 A;  2V0P A;  1G3N B;  3UIP C;  3CIA A;  3TWV A;  3RRU A;  4U07 A;  4E6H A;  2VGY A;  3UM3 A;  4GZD A;  3V31 A;  3AS8 A;  3LJ3 A;  2DZO A;  3ESL A;  2WM9 A;  3DSV A;  4HVB A;  2UY1 B;  3TG5 A;  2M63 A;  4G8K A;  4F3V A;  5E76 A;  3T9K A; 
#chains in the Genus database with same CATH homology
 1N9A A;  1DCE A;  3Q75 A;  4GTT A;  1FPP A;  1TNB A;  1SA4 A;  3E37 A;  3HXC A;  1QBQ A;  1N95 A;  1JCR A;  4YDE A;  3HXB A;  3DSS A;  4GTO A;  3E32 A;  1KZO A;  4GTM A;  3DRA A;  3KSL A;  1LD8 A;  1TN6 A;  3E33 A;  2H6F A;  3EUV A;  1SA5 A;  2ZIS A;  4YDO A;  3PZ4 A;  4LNB A;  3DSW A;  4GTP A;  1N94 A;  1X81 A;  1TN8 A;  3Q7A A;  1TN7 A;  1TNZ A;  3SFX A;  1LTX A;  1TNO A;  4EHM A;  1N4P A;  1O1R A;  1D8E A;  1FT2 A;  3E30 A;  4GTV A;  3DST A;  2H6I A;  1TNU A;  3KSQ A;  3EU5 A;  1KZP A;  1O1T A;  4LNG A;  1O5M A;  2BED A;  2F0Y A;  3C72 A;  1O1S A;  4GTQ A;  4GTS A;  3PZ2 A;  3E34 A;  3PZ3 A;  2R2L A;  1MZC A;  3Q7F A;  1NL4 A;  1S64 A;  3Q78 A;  2ZIR A;  3SFY A;  1JCQ A;  1D8D A;  1NI1 A;  3Q73 A;  3PZ1 A;  3DSU A;  3HXE A;  1N4R A;  1N4Q A;  3HXD A;  1S63 A;  3DPY A;  4GTR A;  2H6G A;  2IEJ A;  4MBG A;  4L9P A;  3DSV A;  1FT1 A;  1JCS A;  1LD7 A;  1TNY A;  3DSX A;  1N4S A;  3HXF A;  3Q79 A;  2H6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...