1TNYA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a frekkffcail peptide derived from the heterotrimeric g protein gamma-2 subunit
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords geranylgeranyltransferase type I alpha subunit
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 124
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnyA00
1N94A 3Q7FA 3DSSA 2ZISA 1JCSA 1TN8A 3KSQA 1LD8A 1LD7A 1N4RA 3E33A 2IEJA 2F0YA 1KZPA 1O5MA 1KZOA 4YDOA 3PZ2A 4GTSA 3Q73A 1D8DA 1TNZA 4GTVA 1FT1A 1X81A 3HXEA 2BEDA 4LNBA 3HXBA 3SFXA 1D8EA 1TNUA 1QBQA 1JCRA 1O1SA 1SA5A 4GTTA 1N95A 4GTRA 1TNOA 4EHMA 2H6GA 2H6FA 3DRAA 1TNBA 4GTPA 1NL4A 3E30A 4GTMA 3DPYA 3DSXA 4GTQA 3KSLA 1JCQA 4YDEA 3E37A 1TN7A 3Q79A 3Q75A 1N4QA 2R2LA 3DSVA 2H6IA 3Q78A 1FT2A 3E34A 2H6HA 3EU5A 1LTXA 3DSWA 3DSUA 3Q7AA 1DCEA 4MBGA 4GTOA 3HXFA 1O1TA 3E32A 2ZIRA 3C72A 1SA4A 3PZ1A 1S64A 1MZCA 1NI1A 1O1RA 3HXCA 4LNGA 3PZ3A 1N9AA 1N4PA 4L9PA 3DSTA 1FPPA 3EUVA 1TN6A 3HXDA 1S63A 3SFYA 1TNYA 3PZ4A 1N4SA
chains in the Genus database with same CATH superfamily
2P9IG 5HQ8A 2GRQB 3MZLB 2BKKB 5J90A 4TV3A 2WQ6A 4UWFA 2FF4A 2P9KG 3URZA 5AYWD 2P9LG 4EPZA 2RKKA 1KLXA 3QWWA 2A4ZA 2XS8A 4IYPA 4U7EB 4B93B 3UKUG 1X81A 2NXPA 3EHMA 3JUIA 3CVVA 1O1SA 4G8KA 4N2SA 2WXPA 3FU6A 4Q96A 5EDSA 4AM9A 1TNOA 3PH0C 5D0OD 3TXMA 2CHZA 3TG5A 4LSZE 2B6CA 4WNFA 3IV0A 3IXEA 3B13A 3R7RA 3C5RA 1KT0A 1V55E 2FI7A 2UWJG 3JQ1A 5G04J 3MCXA 3NZUA 4K5CA 3MYVA 3CVYA 4HI9A 4CT0A 3FH7A 4FP7A 1OCOE 3B7RL 3FUKA 4FJZA 2DCPA 2YHCA 4DLQA 4DPRA 2F8XK 3PZ4A 4G23A 2VSXE 3DSSA 1S0PA 3S2AA 3UPVA 1WAO1 4JC8A 1N54A 2Y3AA 5T4YA 1HG5A 3DEOA 2XQ0A 1H6OA 3R9MA 3G2SA 3ZN3A 4C0MA 3KAEA 5BXOA 4B0ZA 4HBDA 4U0ZA 1KZOA 2YNQA 4EBAA 1INZA 3B7TA 4N3CA 3CK9A 3CVLA 4G25A 2XRYA 4O1PA 3AS5A 2GW1A 3QK0A 4G8LA 2KM4A 2AVPA 2BUGA 2WQ7A 4U8HA 4AXHA 1Z3YA 1BI7B 3ZUVB 1K8KG 4AVXA 4Z68A 3CHPA 3DSXA 3CEQA 4CRWA 3LJ3A 4Y6WA 3W9FA 4JA9A 4UWKA 3APDA 4I6JA 2YINA 4N3BA 3KEZA 5KCMA 3FUJA 3S7BA 2HO1A 3JQ0A 1AP7A 2CFZA 3QOUA 5AJDA 4AP2A 2DIWA 3CHMA 4GPKA 3EU9A 4W9RA 3UT7A 5KJLA 1H19A 3UIPC 2LXMA 4BEPA 2OVFA 4NRHB 4N5QA 2X38A 2L0IA 3NAWA 3L6AA 5AQ7A 1BPOA 1TN6A 3CK7A 1N4SA 1RW2A 3OXLA 4CEMA 3L54A 1LD8A 1HG2A 4RSYA 3TWRA 4F7AA 1EF1C 4U0UA 3EJNA 5ITZF 3U3WA 4NURA 5B1BE 1IHGA 4UWLA 4JW1A 3CSFA 4PS7A 2IY0C 5AQBA 3T5XA 1NA0A 3RIBA 1E7UA 5A7DB 4ACKA 4FA6A 4E85A 4E6HA 3TG4A 1OY3D 4JA7A 2X6IA 3ZFWA 2XZTG 3E30A 2QFCA 4J8YA 5CCMA 2RFAA 3ASNE 4MKTA 4CCAA 3Q79A 5ARFA 3ZKJA 4EZLA 3IBEA 4J8FA 2DBAA 4UQXA 4U95D 4I6EA 4WWNA 2KZTA 3K9IA 4DI3A 1H2VC 1E90A 3E32A 1HF8A 1K3ZD 2CHXA 5BV1A 4AV7A 2AXUA 3UMVA 1SA4A 3FTZA 2Y69E 3HYMB 4WUYA 3HXCA 3RKVA 4LNGA 2FEZA 4BESA 5EX3A 3LS8A 5HI7A 2J9QA 3ONKA 4GA1A 2WM9A 4OVVA 4OVUA 4AIFA 1HU3A 3SY2A 3RU0A 3ASHA 3C3QA 5KBAA 4HB5A 1BI8B 2J8SD 2MRIA 1K1BA 3TWWA 2P9UG 2LAIA 4GAAA 4G24A 4BT8A 2AXZA 3FEYA 5LCWC 4J0UA 4OAUC 3ZIMA 4WNEA 5EKQD 1D8EA 1KPSB 3FU3A 1VDYA 2GROB 3VLEA 2MYOA 4LG6A 3EIJA 2R5SA 3CVUA 3CLJA 4EHMA 4FLBA 2H6FA 3DRAA 3KD7A 4B8CB 2XEVA 3KS2A 3FTWA 3IKOB 5FZSA 1NZNA 3Q4AB 4TXPA 3D3MA 1OWNA 4PS3A 4N39A 2LO6A 4F1SA 4GZ5A 3LY7A 2R2LA 4I1AA 4ME2A 4ILGA 3PVLA 1U3CA 1YMPA 2H6IA 3Q78A 1ZU2A 3FY4A 3MJWA 3DSUA 1DCEA 2LSVA 3AG1E 2V8SE 4HOQA 5ENRD 1IQRA 1K1AA 1Z6TA 3NOGD 4CDNA 4XKCA 4C0EA 2L0TB 1S64A 3VTXA 3CHSA 1LF8A 5T8IA 4ATZD 3TAXA 2V4HC 3TWSA 4JB8P 1N0RA 3MA5A 3W9GA 5FTPA 3EUVA 2CG2A 3E4BA 3O4ZA 4DJAA 3LPZA 2KXPC 3KSQA 2X6JA 3G2WA 3RK6A 4G26A 2ONDA 1N4RA 2GRRB 3E33A 3AG4E 4RVBA 5FT9A 3CKBA 3U64A 3FU5A 2R05A 3QB2A 4I6GA 3R7QA 1D8DA 2J49A 1HE8A 3HRAA 5M72A 5G55A 2MOWA 3I4GA 4FADA 3V30A 2IOSA 3C3OA 1DCQA 1KT1A 2WXGA 4BERA 1GW6A 3HVEA 1E8XA 2KCKA 3BG1B 1E96B 4UWHA 3HG0D 1TN7A 3FDHA 3ZYLA 4Q94A 3X2QE 5EYPF 4GMJA 3HDXA 2H6HA 4NQ0A 4P29A 3ESKA 2WMOA 4TUUA 4TRQA 3ENEA 4GTOA 1UW4B 3LKUA 3L9TA 5LCWJ 1E7VA 3DWLG 3LEWA 4H7XA 3MKRA 1TJFA 4TXRA 3SF4A 4GB9A 1O1RA 2XS1A 4PDXA 3CIAA 3QAQA 2X6FA 2OCCE 2KZTB 4XE0A 3Q7FA 5EIDA 3SD5A 2ZGGA 3ZU7B 4EZJA 4URKA 3FUEA 3NZSA 3LXUX 2LXLA 2QYJA 4HI8A 5KWDA 3TJPA 3S7FA 3D9HA 4C9BB 3CVWA 4YDOA 5FQ7A 3OXFA 1OUVA 4GTSA 1TNZA 4WNDA 3ML9A 1PY1A 2LAHA 2I1JA 2OEVA 4I1MA 4K0RA 4FHKA 2M63A 4JZYA 2PL2A 1IQUA 3PE3A 4L23A 4JVSA 3TWQA 4JEHA 2IQCA 4GTTA 4LEUA 1UG3A 4KMOA 1S70B 1IXVA 3FHEA 5A23A 1NL4A 5AQ9A 1MJ0A 1TR4A 1Z5SC 4ZFHA 1FVFA 3FU0A 4GTQA 3DXMG 4L2YA 4KXKB 1RZ4A 3MKQA 5C1DA 3FTXA 3PUKA 3AU4A 2WB2A 3DEPA 2A5UA 3ZHEA 1U3DA 3DSWA 3FUMA 2GRLA 3MV3B 2GRMA 2DYSE 3AS8A 1JWGA 3ULQA 3RRUA 2ZIRA 4DX1A 4HLLA 3D9KA 2GRPB 4HS2A 1QZ2A 5BPPA 2KBXA 3UXGA 4L9PA 2ZXWE 3HXDA 2VGXA 1OWOA 2ZISA 4FLHA 3CQCB 4V3IA 3WG7E 3UT8A 3PNLB 4UUCA 4K5BA 1SZAA 3O48A 2P9NG 3ZXSA 3UQ3A 2J07A 1X5BA 4DK5A 3HIZA 3T8KA 4L1BA 4F53A 3QWPA 4A55A 3LJNA 2RD0A 5FIOA 3CGHA 4CT4A 4YNDA 3CVNA 4U07A 4J8EA 4U96D 3D9LA 5H7PA 4Q69A 2J09A 3BEEA 3N71A 3FUNA 4ZHBA 3BU8A 4A1SA 3UI2A 3Q75A 1N4QA 4G11A 4XI9A 2IJGX 4NACA 5ENSD 3EU5A 5AJLA 3ASOE 4NIKA 4CZ2D 3Q7AA 4DI4A 5CRVA 3L22A 3HVEB 4DX7D 1O1TA 1D9SA 4JEUA 4RG6A 5CERB 1XGWA 4M3OA 4GYYA 3FWVA 4F6RD 5LX8A 4JHKA 2X6HA 2VSNA 4XZ4A 4KT6B 3KEAA 1N9AA 2IO2C 2J08A 3DSTA 4EZKA 1HX8A 3V79K 2UY1A 3SFYA 3MX3A 2ETCA 2HYZA 4AOFA 4IRUA 1MYOA 1E8WA 2XZDG 2X6KA 2HR2A 2BF0X 2WPVA 2VJ8A 4UI9C 5HS0A 3CR3A 4I9CA 1N11A 3B7UX 5HKPA 4ANXA 3FH8A 3CVQA 3ZYKA 4JD2G 3CVXA 1JCRA 3ZRHA 4BY6A 4ABNA 1SA5A 4BFRA 1N95A 4GTRA 2J4DA 3QARA 4ILHB 3EHNA 4MLPA 2WXKA 3KSLA 4U8YD 3L16A 2DZNA 1MX2A 4KZCA 4BSXA 3D9OA 4BWRA 4GZ3A 4EQFA 2VSYA 2ETBA 2IU1A 1OXJA 2PZIA 3TL5A 3C72A 2EILE 3QDNA 5BUZA 3WXXA 1E8YA 4ACLA 2WXIA 1YA0A 1XNFA 3SO8A 4HOUA 2KATA 2IOLA 5FZQA 3U66A 3MKQB 3PZ3A 4XKBA 2I2OA 3ZHEB 4XIFA 4BSZB 3CSTA 1MHQA 1TN8A 2R02A 4KYOB 3ASGA 1OCCE 3BUAA 3AG3E 3TXNA 2V5FA 4KBQA 1IYGA 3V2OA 3V2XA 4F1PA 2AW6A 3MGBA 5CBOA 1NA3A 3B95A 4HORA 4H7YA 2VGXB 1BLXB 4CDRA 3SGHA 2YQ8A 3VLFA 1A5EA 5EN5D 3Q9UC 5EYLA 5FQ8A 4I9EA 3R9AB 1QNFA 1UN9A 3Q15A 4HNAD 4G2VA 4BETA 4GCOA 2MHKA 4MS6A 4APFA 5JHAA 1OWLA 3T8MA 1H6PA 3ZEFA 2P9SG 1FT2A 2AJAA 4UI9J 2ZU6B 3AU5A 2Y0BG 2EIKE 5B3SE 4MRUA 4OYSA 4J6IA 4RG9A 4AY6A 4B89A 3J5QB 3FUDA 3FTUA 2B0OE 3EHRA 4UQYA 3S7JA 1S63A 4LCTA 2AXVA 2PM7A 2OV8A 2R03A 1YYHA 5JJ6A 1JCSA 3TGOA 1QQEA 3OTNA 3FP3A 2XHEA 3PUJA 4FC8A 5D66A 2E2EA 2L6BA 2F0YA 3APFA 4ANWA 3Q73A 2UY1B 4HFGA 5JJTA 3UM2A 2QC9A 4I2WA 4APOA 2VSOE 2HE0A 3S7DA 3D9IA 2DZOA 5BXUA 4I1OB 3IHYA 1NP7A 4HLEA 5C2YA 3B7BA 2H6GA 5JJ7A 5ENTD 3ZW3A 1HH8A 3JCKC 4LERA 3U9WA 1IKND 2DVWA 3T9KA 4FU3A 1HXIA 3G2UA 4JPSA 5KJMA 4N5CA 5B1AE 4CDMA 1WG0A 3P2BA 4WAFA 4AY5A 4KVOA 3VTYA 4MBGA 3RSEG 2JEKA 4J8DA 2L9BA 2P2CP 5BNWA 1G3NB 2OVBA 3PDNA 2VGYA 1H2TC 2QYUA 3ZYQA 4CYMD 3CK8A 1HZ4A 2P9PG 2EIJE 1N94A 3G2VA 5ANLA 1WDYA 4QQIA 2L6JA 1BD8A 2Y1LE 4F3VA 2PNNA 2WXOA 3JXIA 3ONLA 4R7LA 3UINC 4GCNA 4PS8A 3AAAC 2I9CA 5ARGA 4KVMA 1O5MA 3UX4A 3PZ2A 4JXTA 3SBSA 5EILA 4J7WA 4GU5A 3P1UA 4GZ6A 2XPIA 3QC1A 3HXEA 3HXBA 2XRZA 4UQZA 1TNUA 4TXQA 1JPLA 1EDUA 5FZRA 4C48B 3IEGA 2LSUA 4IULA 3DBSA 3PE4A 4O6FA 2J4BA 4WWPA 4IN3B 2IONA 1TNBA 2FULA 4LNUD 1L5JA 2RFMA 4GTMA 1ELRA 3DPYA 2YHEA 4ATGA 1JCQA 3ABKE 4HQDA 4YDEA 3E37A 3UIOC 3D9NA 4GPMA 3TWTA 1W3BA 2VQ2A 3ZGQA 4PH4B 3PS6A 4G1TA 2R59A 3DSVA 1OCZE 1HS6A 3C3RA 3E34A 3EHQA 1JUQA 5ENQD 4O60A 1PC2A 3SHFA 2JLBA 4UI9K 3HXFA 2C0MA 4YVOA 4CGWA 3QWVA 5CMYA 5FQ4A 2WVIA 4U63A 3PZ1A 1MZCA 2IF4A 1TEZA 4GA0A 1UOHA 1N4PA 5JA4D 4I2ZA 1MX6A 1Y8MA 5ENOD 1ELKA 3I4RB 5EIBE 2DWZA 2X3MA 3MEKA 1N0QA 2V4LA 4DX5D 5ENPD 4K03A 1YCSB 3PNTB 3AG2E 2XEEA 3GZSA 4AJWA 5KJNA 1ZBPA 5KNHD 4EECA 3NOCD 1ZB1A 4WWOA 5LOZA 2BKGA 4GYOA 2NSZA 3FTSA 4N2QA 3EDTB 3QJZA 3CVPA 5D2MC 4L2LA 1UJKA 2Y4UA 4YDYA 3T5VA 2F37A 3NQPA 3PZDA 4GZDA 1A17A 2BTDA 3HHMA 4FHJA 4N3AA 1PAQA 3PEUB 4HXIA 3GYZA 4B8AA 5KJKA 1DC2A 2WXFA 1UN8A 3FEXA 4D10C 2EINE 4KZ0A 1IHBA 4A3TA 4FJYA 3Q49B 2GRNB 2VTBA 5T3RA 3EIQC 5DIZA 2WXQA 3ABLE 1OWPA 1FPPA 3L82A 5FINA 4HOSA 4EBAG 4BTAA 2FBNA 2CG3A 1U2VG 2XEHA 2RG8A 1MQSA 4DRXE 4QFVA 4ANUA 2QZAA 5KNGA 4DLOA 2EQXA 1DVPA 1WM5A 2CHWA 2XCBA 3BG0B 3D9JA 4GYWA 3GZ2A 1Q2ZA 1NFIE 2I6HA 3UT4A 4I43A 3ZNGA 4HRLA 3RO3A 3CQGB 3F6QA 2XPZA 2V0PA 2A5EA 3AS4A 3PEVB 2V5QC 1EYHA 4HRMB 5AIJA 3RRMB 1WY6A 4AEZC 5G05C 2VYIA 3LY9A 4XX5A 4B94A 4M7CA 3ABME 3UM3A 2R17C 3DXKG 3UM1A 3UUXA 2QY7A 1LTXA 3U4TA 5AARA 5CEDB 2XGOA 5LP0A 2F8YA 2FO7A 3FH5A 3LVRE 2KC7A 3FFLA 1FVHA 4RQIA 3NBNB 3OXGA 2AWIA 2WXLA 4JHJA 2Y4TA 1EPUA 3Q5MA 1OT8A 3L08A 4HVBA 1P5QA 3ZVVA 3I5PA 3G2TA 4YVQC 4FULA 2NC9A 2WXMA 2IEJA 4XEIG 5E76A 2PM6A 1KZPA 4WNGA 2I1KA 4A1GA 3SQVA 1SZ9A 1B89A 4LUNU 5AN8A 1FT1A 4A3VA 3LY8A 5CBNA 2DYRE 3SFXA 5LFAA 3D9MA 1HO8A 1UJJA 5CECB 2ETAA 4GTPA 5CCLA 3C98A 4JL0A 4U8VD 3JUEA 1SQMA 5JMND 5FQ6A 2XCCA 1Z3XA 2WMNA 2ZGDA 3FTVA 3CHRA 3NF1A 3CHQA 5EX0A 3Q47B 3LCAA 4GMRA 3QNKA 2C0LA 1SW6A 4GZCA 5D0QD 3UM0A 5BW8C 2IFUA 5IY5E 3ISMC 1TNYA 2OEWA 2C2LA 5E75A 3MV2B 4RLYA 3ULEG 4UWGA 3JXJA 4YDWA 3ULYA 5G05J 2VTBB 4CGVA 3Q9NC 3ML8A 1OWMA 4LRZA 1TJCA 4U04A 3UKRG 3J5PA 3CKCA 1DNPA 4ILIA 5G2NA 3PREA 3FTYA 3LDZA 4J8SA 3CHOA 4GMLA 2WXHA 5ANRA 2BEDA 4LNBA 3FUFA 4O1OA 3CV0A 5DBKA 1QBQA 3SZ7A 3GW4A 3QKYA 4TUMA 2GGFA 5AQAA 4BX9A 1SVXA 3FUHA 2FO1E 2IO3C 4GA2A 2WXNA 2WXJA 2PQRA 5CHEE 3ZPJA 2ILRA 2XENA 3JYSA 5HRYA 4K5AB 3NB2A 1MX4A 1QYMA 3ESLA 2NYJA 4ANVA 3OAWA 4HOTA 1AWCB 1FCHA 1H2UA 3B7SA 1H0AA 3RO2A 3L13A 3DPDA 5A6CA 1Y6IA 2P58C 1TYQG 5AENA 4HRNA 2OOEA 4BT9A 4X8QA 3ASFA 4BTBA 2WXRA 2XGMA 5BV0A 3PRZA 3ZYMA 3D9PA 1LD7A 3VLDA 2KCLA 3SBTB 3TWUA 5FJYA 1E8ZA 3RRNB 3LYAA 4A63B 1V54E 3RJVA 3GZ1A 1BU9A 5G04C 1H6KA 5CMWA 2VGEA 3L17A 5AAOA 4Y6CA 4GTVA 2EIME 2LUHA 4DX2A 3FULA 5JHBA 4DUIA 5CRUA 3SI5A 2CFUA 3IHVA 3TWVA 5CEAA 4JHRA 4BX8A 1ELWA 3AJIA 3BQOA 5ENNA 3LVQE 3FUIA 1OCRE 2JABA 3TWXA 3V31A 2HM8A 1JWFA 4U0SA 3APCA 2KCVA 5J08A 4I17A 3ZXPA 4PUCA 1HFAA 1N52A 2PQNA 4DX6D 2Q7FA 2WQHA 3RAUA 4L7TA 2LNIA 2E0IA 3I3NA 3UTMA 2XPYA 4XI0A 3SNXA 4OAVB 2XGSA 3ASDA 5BT1A 1NI1A 5FWQA 3SFZA
chains in the Genus database with same CATH topology
1N94A 3Q7FA 3DSSA 2ZISA 1JCSA 1TN8A 3KSQA 1LD8A 1LD7A 1N4RA 3E33A 2IEJA 2F0YA 1KZPA 1O5MA 1KZOA 4YDOA 3PZ2A 4GTSA 3Q73A 1D8DA 1TNZA 4GTVA 1FT1A 1X81A 3HXEA 2BEDA 4LNBA 3HXBA 3SFXA 1D8EA 1TNUA 1QBQA 1JCRA 1O1SA 1SA5A 4GTTA 1N95A 4GTRA 1TNOA 4EHMA 2H6GA 2H6FA 3DRAA 1TNBA 4GTPA 1NL4A 3E30A 4GTMA 3DPYA 3DSXA 4GTQA 3KSLA 1JCQA 4YDEA 3E37A 1TN7A 3Q79A 3Q75A 1N4QA 2R2LA 3DSVA 2H6IA 3Q78A 1FT2A 3E34A 2H6HA 3EU5A 1LTXA 3DSWA 3DSUA 3Q7AA 1DCEA 4MBGA 4GTOA 3HXFA 1O1TA 3E32A 2ZIRA 3C72A 1SA4A 3PZ1A 1S64A 1MZCA 1NI1A 1O1RA 3HXCA 4LNGA 3PZ3A 1N9AA 1N4PA 4L9PA 3DSTA 1FPPA 3EUVA 1TN6A 3HXDA 1S63A 3SFYA 1TNYA 3PZ4A 1N4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N94 A;  3Q7F A;  3DSS A;  2ZIS A;  1JCS A;  1TN8 A;  3KSQ A;  1LD8 A;  1LD7 A;  1N4R A;  3E33 A;  2IEJ A;  2F0Y A;  1KZP A;  1O5M A;  1KZO A;  4YDO A;  3PZ2 A;  4GTS A;  3Q73 A;  1D8D A;  1TNZ A;  4GTV A;  1FT1 A;  1X81 A;  3HXE A;  2BED A;  4LNB A;  3HXB A;  3SFX A;  1D8E A;  1TNU A;  1QBQ A;  1JCR A;  1O1S A;  1SA5 A;  4GTT A;  1N95 A;  4GTR A;  1TNO A;  4EHM A;  2H6G A;  2H6F A;  3DRA A;  1TNB A;  4GTP A;  1NL4 A;  3E30 A;  4GTM A;  3DPY A;  3DSX A;  4GTQ A;  3KSL A;  1JCQ A;  4YDE A;  3E37 A;  1TN7 A;  3Q79 A;  3Q75 A;  1N4Q A;  2R2L A;  3DSV A;  2H6I A;  3Q78 A;  1FT2 A;  3E34 A;  2H6H A;  3EU5 A;  1LTX A;  3DSW A;  3DSU A;  3Q7A A;  1DCE A;  4MBG A;  4GTO A;  3HXF A;  1O1T A;  3E32 A;  2ZIR A;  3C72 A;  1SA4 A;  3PZ1 A;  1S64 A;  1MZC A;  1NI1 A;  1O1R A;  3HXC A;  4LNG A;  3PZ3 A;  1N9A A;  1N4P A;  4L9P A;  3DST A;  1FPP A;  3EUV A;  1TN6 A;  3HXD A;  1S63 A;  3SFY A;  1TNY A;  3PZ4 A;  1N4S A; 
#chains in the Genus database with same CATH topology
 2P9I G;  5HQ8 A;  2GRQ B;  3MZL B;  2BKK B;  5J90 A;  4TV3 A;  2WQ6 A;  4UWF A;  2FF4 A;  2P9K G;  3URZ A;  5AYW D;  2P9L G;  4EPZ A;  2RKK A;  1KLX A;  3QWW A;  2A4Z A;  2XS8 A;  4IYP A;  4U7E B;  4B93 B;  3UKU G;  1X81 A;  2NXP A;  3EHM A;  3JUI A;  3CVV A;  1O1S A;  4G8K A;  4N2S A;  2WXP A;  3FU6 A;  4Q96 A;  5EDS A;  4AM9 A;  1TNO A;  3PH0 C;  5D0O D;  3TXM A;  2CHZ A;  3TG5 A;  4LSZ E;  2B6C A;  4WNF A;  3IV0 A;  3IXE A;  3B13 A;  3R7R A;  3C5R A;  1KT0 A;  1V55 E;  2FI7 A;  2UWJ G;  3JQ1 A;  5G04 J;  3MCX A;  3NZU A;  4K5C A;  3MYV A;  3CVY A;  4HI9 A;  4CT0 A;  3FH7 A;  4FP7 A;  1OCO E;  3B7R L;  3FUK A;  4FJZ A;  2DCP A;  2YHC A;  4DLQ A;  4DPR A;  2F8X K;  3PZ4 A;  4G23 A;  2VSX E;  3DSS A;  1S0P A;  3S2A A;  3UPV A;  1WAO 1;  4JC8 A;  1N54 A;  2Y3A A;  5T4Y A;  1HG5 A;  3DEO A;  2XQ0 A;  1H6O A;  3R9M A;  3G2S A;  3ZN3 A;  4C0M A;  3KAE A;  5BXO A;  4B0Z A;  4HBD A;  4U0Z A;  1KZO A;  2YNQ A;  4EBA A;  1INZ A;  3B7T A;  4N3C A;  3CK9 A;  3CVL A;  4G25 A;  2XRY A;  4O1P A;  3AS5 A;  2GW1 A;  3QK0 A;  4G8L A;  2KM4 A;  2AVP A;  2BUG A;  2WQ7 A;  4U8H A;  4AXH A;  1Z3Y A;  1BI7 B;  3ZUV B;  1K8K G;  4AVX A;  4Z68 A;  3CHP A;  3DSX A;  3CEQ A;  4CRW A;  3LJ3 A;  4Y6W A;  3W9F A;  4JA9 A;  4UWK A;  3APD A;  4I6J A;  2YIN A;  4N3B A;  3KEZ A;  5KCM A;  3FUJ A;  3S7B A;  2HO1 A;  3JQ0 A;  1AP7 A;  2CFZ A;  3QOU A;  5AJD A;  4AP2 A;  2DIW A;  3CHM A;  4GPK A;  3EU9 A;  4W9R A;  3UT7 A;  5KJL A;  1H19 A;  3UIP C;  2LXM A;  4BEP A;  2OVF A;  4NRH B;  4N5Q A;  2X38 A;  2L0I A;  3NAW A;  3L6A A;  5AQ7 A;  1BPO A;  1TN6 A;  3CK7 A;  1N4S A;  1RW2 A;  3OXL A;  4CEM A;  3L54 A;  1LD8 A;  1HG2 A;  4RSY A;  3TWR A;  4F7A A;  1EF1 C;  4U0U A;  3EJN A;  5ITZ F;  3U3W A;  4NUR A;  5B1B E;  1IHG A;  4UWL A;  4JW1 A;  3CSF A;  4PS7 A;  2IY0 C;  5AQB A;  3T5X A;  1NA0 A;  3RIB A;  1E7U A;  5A7D B;  4ACK A;  4FA6 A;  4E85 A;  4E6H A;  3TG4 A;  1OY3 D;  4JA7 A;  2X6I A;  3ZFW A;  2XZT G;  3E30 A;  2QFC A;  4J8Y A;  5CCM A;  2RFA A;  3ASN E;  4MKT A;  4CCA A;  3Q79 A;  5ARF A;  3ZKJ A;  4EZL A;  3IBE A;  4J8F A;  2DBA A;  4UQX A;  4U95 D;  4I6E A;  4WWN A;  2KZT A;  3K9I A;  4DI3 A;  1H2V C;  1E90 A;  3E32 A;  1HF8 A;  1K3Z D;  2CHX A;  5BV1 A;  4AV7 A;  2AXU A;  3UMV A;  1SA4 A;  3FTZ A;  2Y69 E;  3HYM B;  4WUY A;  3HXC A;  3RKV A;  4LNG A;  2FEZ A;  4BES A;  5EX3 A;  3LS8 A;  5HI7 A;  2J9Q A;  3ONK A;  4GA1 A;  2WM9 A;  4OVV A;  4OVU A;  4AIF A;  1HU3 A;  3SY2 A;  3RU0 A;  3ASH A;  3C3Q A;  5KBA A;  4HB5 A;  1BI8 B;  2J8S D;  2MRI A;  1K1B A;  3TWW A;  2P9U G;  2LAI A;  4GAA A;  4G24 A;  4BT8 A;  2AXZ A;  3FEY A;  5LCW C;  4J0U A;  4OAU C;  3ZIM A;  4WNE A;  5EKQ D;  1D8E A;  1KPS B;  3FU3 A;  1VDY A;  2GRO B;  3VLE A;  2MYO A;  4LG6 A;  3EIJ A;  2R5S A;  3CVU A;  3CLJ A;  4EHM A;  4FLB A;  2H6F A;  3DRA A;  3KD7 A;  4B8C B;  2XEV A;  3KS2 A;  3FTW A;  3IKO B;  5FZS A;  1NZN A;  3Q4A B;  4TXP A;  3D3M A;  1OWN A;  4PS3 A;  4N39 A;  2LO6 A;  4F1S A;  4GZ5 A;  3LY7 A;  2R2L A;  4I1A A;  4ME2 A;  4ILG A;  3PVL A;  1U3C A;  1YMP A;  2H6I A;  3Q78 A;  1ZU2 A;  3FY4 A;  3MJW A;  3DSU A;  1DCE A;  2LSV A;  3AG1 E;  2V8S E;  4HOQ A;  5ENR D;  1IQR A;  1K1A A;  1Z6T A;  3NOG D;  4CDN A;  4XKC A;  4C0E A;  2L0T B;  1S64 A;  3VTX A;  3CHS A;  1LF8 A;  5T8I A;  4ATZ D;  3TAX A;  2V4H C;  3TWS A;  4JB8 P;  1N0R A;  3MA5 A;  3W9G A;  5FTP A;  3EUV A;  2CG2 A;  3E4B A;  3O4Z A;  4DJA A;  3LPZ A;  2KXP C;  3KSQ A;  2X6J A;  3G2W A;  3RK6 A;  4G26 A;  2OND A;  1N4R A;  2GRR B;  3E33 A;  3AG4 E;  4RVB A;  5FT9 A;  3CKB A;  3U64 A;  3FU5 A;  2R05 A;  3QB2 A;  4I6G A;  3R7Q A;  1D8D A;  2J49 A;  1HE8 A;  3HRA A;  5M72 A;  5G55 A;  2MOW A;  3I4G A;  4FAD A;  3V30 A;  2IOS A;  3C3O A;  1DCQ A;  1KT1 A;  2WXG A;  4BER A;  1GW6 A;  3HVE A;  1E8X A;  2KCK A;  3BG1 B;  1E96 B;  4UWH A;  3HG0 D;  1TN7 A;  3FDH A;  3ZYL A;  4Q94 A;  3X2Q E;  5EYP F;  4GMJ A;  3HDX A;  2H6H A;  4NQ0 A;  4P29 A;  3ESK A;  2WMO A;  4TUU A;  4TRQ A;  3ENE A;  4GTO A;  1UW4 B;  3LKU A;  3L9T A;  5LCW J;  1E7V A;  3DWL G;  3LEW A;  4H7X A;  3MKR A;  1TJF A;  4TXR A;  3SF4 A;  4GB9 A;  1O1R A;  2XS1 A;  4PDX A;  3CIA A;  3QAQ A;  2X6F A;  2OCC E;  2KZT B;  4XE0 A;  3Q7F A;  5EID A;  3SD5 A;  2ZGG A;  3ZU7 B;  4EZJ A;  4URK A;  3FUE A;  3NZS A;  3LXU X;  2LXL A;  2QYJ A;  4HI8 A;  5KWD A;  3TJP A;  3S7F A;  3D9H A;  4C9B B;  3CVW A;  4YDO A;  5FQ7 A;  3OXF A;  1OUV A;  4GTS A;  1TNZ A;  4WND A;  3ML9 A;  1PY1 A;  2LAH A;  2I1J A;  2OEV A;  4I1M A;  4K0R A;  4FHK A;  2M63 A;  4JZY A;  2PL2 A;  1IQU A;  3PE3 A;  4L23 A;  4JVS A;  3TWQ A;  4JEH A;  2IQC A;  4GTT A;  4LEU A;  1UG3 A;  4KMO A;  1S70 B;  1IXV A;  3FHE A;  5A23 A;  1NL4 A;  5AQ9 A;  1MJ0 A;  1TR4 A;  1Z5S C;  4ZFH A;  1FVF A;  3FU0 A;  4GTQ A;  3DXM G;  4L2Y A;  4KXK B;  1RZ4 A;  3MKQ A;  5C1D A;  3FTX A;  3PUK A;  3AU4 A;  2WB2 A;  3DEP A;  2A5U A;  3ZHE A;  1U3D A;  3DSW A;  3FUM A;  2GRL A;  3MV3 B;  2GRM A;  2DYS E;  3AS8 A;  1JWG A;  3ULQ A;  3RRU A;  2ZIR A;  4DX1 A;  4HLL A;  3D9K A;  2GRP B;  4HS2 A;  1QZ2 A;  5BPP A;  2KBX A;  3UXG A;  4L9P A;  2ZXW E;  3HXD A;  2VGX A;  1OWO A;  2ZIS A;  4FLH A;  3CQC B;  4V3I A;  3WG7 E;  3UT8 A;  3PNL B;  4UUC A;  4K5B A;  1SZA A;  3O48 A;  2P9N G;  3ZXS A;  3UQ3 A;  2J07 A;  1X5B A;  4DK5 A;  3HIZ A;  3T8K A;  4L1B A;  4F53 A;  3QWP A;  4A55 A;  3LJN A;  2RD0 A;  5FIO A;  3CGH A;  4CT4 A;  4YND A;  3CVN A;  4U07 A;  4J8E A;  4U96 D;  3D9L A;  5H7P A;  4Q69 A;  2J09 A;  3BEE A;  3N71 A;  3FUN A;  4ZHB A;  3BU8 A;  4A1S A;  3UI2 A;  3Q75 A;  1N4Q A;  4G11 A;  4XI9 A;  2IJG X;  4NAC A;  5ENS D;  3EU5 A;  5AJL A;  3ASO E;  4NIK A;  4CZ2 D;  3Q7A A;  4DI4 A;  5CRV A;  3L22 A;  3HVE B;  4DX7 D;  1O1T A;  1D9S A;  4JEU A;  4RG6 A;  5CER B;  1XGW A;  4M3O A;  4GYY A;  3FWV A;  4F6R D;  5LX8 A;  4JHK A;  2X6H A;  2VSN A;  4XZ4 A;  4KT6 B;  3KEA A;  1N9A A;  2IO2 C;  2J08 A;  3DST A;  4EZK A;  1HX8 A;  3V79 K;  2UY1 A;  3SFY A;  3MX3 A;  2ETC A;  2HYZ A;  4AOF A;  4IRU A;  1MYO A;  1E8W A;  2XZD G;  2X6K A;  2HR2 A;  2BF0 X;  2WPV A;  2VJ8 A;  4UI9 C;  5HS0 A;  3CR3 A;  4I9C A;  1N11 A;  3B7U X;  5HKP A;  4ANX A;  3FH8 A;  3CVQ A;  3ZYK A;  4JD2 G;  3CVX A;  1JCR A;  3ZRH A;  4BY6 A;  4ABN A;  1SA5 A;  4BFR A;  1N95 A;  4GTR A;  2J4D A;  3QAR A;  4ILH B;  3EHN A;  4MLP A;  2WXK A;  3KSL A;  4U8Y D;  3L16 A;  2DZN A;  1MX2 A;  4KZC A;  4BSX A;  3D9O A;  4BWR A;  4GZ3 A;  4EQF A;  2VSY A;  2ETB A;  2IU1 A;  1OXJ A;  2PZI A;  3TL5 A;  3C72 A;  2EIL E;  3QDN A;  5BUZ A;  3WXX A;  1E8Y A;  4ACL A;  2WXI A;  1YA0 A;  1XNF A;  3SO8 A;  4HOU A;  2KAT A;  2IOL A;  5FZQ A;  3U66 A;  3MKQ B;  3PZ3 A;  4XKB A;  2I2O A;  3ZHE B;  4XIF A;  4BSZ B;  3CST A;  1MHQ A;  1TN8 A;  2R02 A;  4KYO B;  3ASG A;  1OCC E;  3BUA A;  3AG3 E;  3TXN A;  2V5F A;  4KBQ A;  1IYG A;  3V2O A;  3V2X A;  4F1P A;  2AW6 A;  3MGB A;  5CBO A;  1NA3 A;  3B95 A;  4HOR A;  4H7Y A;  2VGX B;  1BLX B;  4CDR A;  3SGH A;  2YQ8 A;  3VLF A;  1A5E A;  5EN5 D;  3Q9U C;  5EYL A;  5FQ8 A;  4I9E A;  3R9A B;  1QNF A;  1UN9 A;  3Q15 A;  4HNA D;  4G2V A;  4BET A;  4GCO A;  2MHK A;  4MS6 A;  4APF A;  5JHA A;  1OWL A;  3T8M A;  1H6P A;  3ZEF A;  2P9S G;  1FT2 A;  2AJA A;  4UI9 J;  2ZU6 B;  3AU5 A;  2Y0B G;  2EIK E;  5B3S E;  4MRU A;  4OYS A;  4J6I A;  4RG9 A;  4AY6 A;  4B89 A;  3J5Q B;  3FUD A;  3FTU A;  2B0O E;  3EHR A;  4UQY A;  3S7J A;  1S63 A;  4LCT A;  2AXV A;  2PM7 A;  2OV8 A;  2R03 A;  1YYH A;  5JJ6 A;  1JCS A;  3TGO A;  1QQE A;  3OTN A;  3FP3 A;  2XHE A;  3PUJ A;  4FC8 A;  5D66 A;  2E2E A;  2L6B A;  2F0Y A;  3APF A;  4ANW A;  3Q73 A;  2UY1 B;  4HFG A;  5JJT A;  3UM2 A;  2QC9 A;  4I2W A;  4APO A;  2VSO E;  2HE0 A;  3S7D A;  3D9I A;  2DZO A;  5BXU A;  4I1O B;  3IHY A;  1NP7 A;  4HLE A;  5C2Y A;  3B7B A;  2H6G A;  5JJ7 A;  5ENT D;  3ZW3 A;  1HH8 A;  3JCK C;  4LER A;  3U9W A;  1IKN D;  2DVW A;  3T9K A;  4FU3 A;  1HXI A;  3G2U A;  4JPS A;  5KJM A;  4N5C A;  5B1A E;  4CDM A;  1WG0 A;  3P2B A;  4WAF A;  4AY5 A;  4KVO A;  3VTY A;  4MBG A;  3RSE G;  2JEK A;  4J8D A;  2L9B A;  2P2C P;  5BNW A;  1G3N B;  2OVB A;  3PDN A;  2VGY A;  1H2T C;  2QYU A;  3ZYQ A;  4CYM D;  3CK8 A;  1HZ4 A;  2P9P G;  2EIJ E;  1N94 A;  3G2V A;  5ANL A;  1WDY A;  4QQI A;  2L6J A;  1BD8 A;  2Y1L E;  4F3V A;  2PNN A;  2WXO A;  3JXI A;  3ONL A;  4R7L A;  3UIN C;  4GCN A;  4PS8 A;  3AAA C;  2I9C A;  5ARG A;  4KVM A;  1O5M A;  3UX4 A;  3PZ2 A;  4JXT A;  3SBS A;  5EIL A;  4J7W A;  4GU5 A;  3P1U A;  4GZ6 A;  2XPI A;  3QC1 A;  3HXE A;  3HXB A;  2XRZ A;  4UQZ A;  1TNU A;  4TXQ A;  1JPL A;  1EDU A;  5FZR A;  4C48 B;  3IEG A;  2LSU A;  4IUL A;  3DBS A;  3PE4 A;  4O6F A;  2J4B A;  4WWP A;  4IN3 B;  2ION A;  1TNB A;  2FUL A;  4LNU D;  1L5J A;  2RFM A;  4GTM A;  1ELR A;  3DPY A;  2YHE A;  4ATG A;  1JCQ A;  3ABK E;  4HQD A;  4YDE A;  3E37 A;  3UIO C;  3D9N A;  4GPM A;  3TWT A;  1W3B A;  2VQ2 A;  3ZGQ A;  4PH4 B;  3PS6 A;  4G1T A;  2R59 A;  3DSV A;  1OCZ E;  1HS6 A;  3C3R A;  3E34 A;  3EHQ A;  1JUQ A;  5ENQ D;  4O60 A;  1PC2 A;  3SHF A;  2JLB A;  4UI9 K;  3HXF A;  2C0M A;  4YVO A;  4CGW A;  3QWV A;  5CMY A;  5FQ4 A;  2WVI A;  4U63 A;  3PZ1 A;  1MZC A;  2IF4 A;  1TEZ A;  4GA0 A;  1UOH A;  1N4P A;  5JA4 D;  4I2Z A;  1MX6 A;  1Y8M A;  5ENO D;  1ELK A;  3I4R B;  5EIB E;  2DWZ A;  2X3M A;  3MEK A;  1N0Q A;  2V4L A;  4DX5 D;  5ENP D;  4K03 A;  1YCS B;  3PNT B;  3AG2 E;  2XEE A;  3GZS A;  4AJW A;  5KJN A;  1ZBP A;  5KNH D;  4EEC A;  3NOC D;  1ZB1 A;  4WWO A;  5LOZ A;  2BKG A;  4GYO A;  2NSZ A;  3FTS A;  4N2Q A;  3EDT B;  3QJZ A;  3CVP A;  5D2M C;  4L2L A;  1UJK A;  2Y4U A;  4YDY A;  3T5V A;  2F37 A;  3NQP A;  3PZD A;  4GZD A;  1A17 A;  2BTD A;  3HHM A;  4FHJ A;  4N3A A;  1PAQ A;  3PEU B;  4HXI A;  3GYZ A;  4B8A A;  5KJK A;  1DC2 A;  2WXF A;  1UN8 A;  3FEX A;  4D10 C;  2EIN E;  4KZ0 A;  1IHB A;  4A3T A;  4FJY A;  3Q49 B;  2GRN B;  2VTB A;  5T3R A;  3EIQ C;  5DIZ A;  2WXQ A;  3ABL E;  1OWP A;  1FPP A;  3L82 A;  5FIN A;  4HOS A;  4EBA G;  4BTA A;  2FBN A;  2CG3 A;  1U2V G;  2XEH A;  2RG8 A;  1MQS A;  4DRX E;  4QFV A;  4ANU A;  2QZA A;  5KNG A;  4DLO A;  2EQX A;  1DVP A;  1WM5 A;  2CHW A;  2XCB A;  3BG0 B;  3D9J A;  4GYW A;  3GZ2 A;  1Q2Z A;  1NFI E;  2I6H A;  3UT4 A;  4I43 A;  3ZNG A;  4HRL A;  3RO3 A;  3CQG B;  3F6Q A;  2XPZ A;  2V0P A;  2A5E A;  3AS4 A;  3PEV B;  2V5Q C;  1EYH A;  4HRM B;  5AIJ A;  3RRM B;  1WY6 A;  4AEZ C;  5G05 C;  2VYI A;  3LY9 A;  4XX5 A;  4B94 A;  4M7C A;  3ABM E;  3UM3 A;  2R17 C;  3DXK G;  3UM1 A;  3UUX A;  2QY7 A;  1LTX A;  3U4T A;  5AAR A;  5CED B;  2XGO A;  5LP0 A;  2F8Y A;  2FO7 A;  3FH5 A;  3LVR E;  2KC7 A;  3FFL A;  1FVH A;  4RQI A;  3NBN B;  3OXG A;  2AWI A;  2WXL A;  4JHJ A;  2Y4T A;  1EPU A;  3Q5M A;  1OT8 A;  3L08 A;  4HVB A;  1P5Q A;  3ZVV A;  3I5P A;  3G2T A;  4YVQ C;  4FUL A;  2NC9 A;  2WXM A;  2IEJ A;  4XEI G;  5E76 A;  2PM6 A;  1KZP A;  4WNG A;  2I1K A;  4A1G A;  3SQV A;  1SZ9 A;  1B89 A;  4LUN U;  5AN8 A;  1FT1 A;  4A3V A;  3LY8 A;  5CBN A;  2DYR E;  3SFX A;  5LFA A;  3D9M A;  1HO8 A;  1UJJ A;  5CEC B;  2ETA A;  4GTP A;  5CCL A;  3C98 A;  4JL0 A;  4U8V D;  3JUE A;  1SQM A;  5JMN D;  5FQ6 A;  2XCC A;  1Z3X A;  2WMN A;  2ZGD A;  3FTV A;  3CHR A;  3NF1 A;  3CHQ A;  5EX0 A;  3Q47 B;  3LCA A;  4GMR A;  3QNK A;  2C0L A;  1SW6 A;  4GZC A;  5D0Q D;  3UM0 A;  5BW8 C;  2IFU A;  5IY5 E;  3ISM C;  1TNY A;  2OEW A;  2C2L A;  5E75 A;  3MV2 B;  4RLY A;  3ULE G;  4UWG A;  3JXJ A;  4YDW A;  3ULY A;  5G05 J;  2VTB B;  4CGV A;  3Q9N C;  3ML8 A;  1OWM A;  4LRZ A;  1TJC A;  4U04 A;  3UKR G;  3J5P A;  3CKC A;  1DNP A;  4ILI A;  5G2N A;  3PRE A;  3FTY A;  3LDZ A;  4J8S A;  3CHO A;  4GML A;  2WXH A;  5ANR A;  2BED A;  4LNB A;  3FUF A;  4O1O A;  3CV0 A;  5DBK A;  1QBQ A;  3SZ7 A;  3GW4 A;  3QKY A;  4TUM A;  2GGF A;  5AQA A;  4BX9 A;  1SVX A;  3FUH A;  2FO1 E;  2IO3 C;  4GA2 A;  2WXN A;  2WXJ A;  2PQR A;  5CHE E;  3ZPJ A;  2ILR A;  2XEN A;  3JYS A;  5HRY A;  4K5A B;  3NB2 A;  1MX4 A;  1QYM A;  3ESL A;  2NYJ A;  4ANV A;  3OAW A;  4HOT A;  1AWC B;  1FCH A;  1H2U A;  3B7S A;  1H0A A;  3RO2 A;  3L13 A;  3DPD A;  5A6C A;  1Y6I A;  2P58 C;  1TYQ G;  5AEN A;  4HRN A;  2OOE A;  4BT9 A;  4X8Q A;  3ASF A;  4BTB A;  2WXR A;  2XGM A;  5BV0 A;  3PRZ A;  3ZYM A;  3D9P A;  1LD7 A;  3VLD A;  2KCL A;  3SBT B;  3TWU A;  5FJY A;  1E8Z A;  3RRN B;  3LYA A;  4A63 B;  1V54 E;  3RJV A;  3GZ1 A;  1BU9 A;  5G04 C;  1H6K A;  5CMW A;  2VGE A;  3L17 A;  5AAO A;  4Y6C A;  4GTV A;  2EIM E;  2LUH A;  4DX2 A;  3FUL A;  5JHB A;  4DUI A;  5CRU A;  3SI5 A;  2CFU A;  3IHV A;  3TWV A;  5CEA A;  4JHR A;  4BX8 A;  1ELW A;  3AJI A;  3BQO A;  5ENN A;  3LVQ E;  3FUI A;  1OCR E;  2JAB A;  3TWX A;  3V31 A;  2HM8 A;  1JWF A;  4U0S A;  3APC A;  2KCV A;  5J08 A;  4I17 A;  3ZXP A;  4PUC A;  1HFA A;  1N52 A;  2PQN A;  4DX6 D;  2Q7F A;  2WQH A;  3RAU A;  4L7T A;  2LNI A;  2E0I A;  3I3N A;  3UTM A;  2XPY A;  4XI0 A;  3SNX A;  4OAV B;  2XGS A;  3ASD A;  5BT1 A;  1NI1 A;  5FWQ A;  3SFZ A; 
#chains in the Genus database with same CATH homology
 1N94 A;  3Q7F A;  3DSS A;  2ZIS A;  1JCS A;  1TN8 A;  3KSQ A;  1LD8 A;  1LD7 A;  1N4R A;  3E33 A;  2IEJ A;  2F0Y A;  1KZP A;  1O5M A;  1KZO A;  4YDO A;  3PZ2 A;  4GTS A;  3Q73 A;  1D8D A;  1TNZ A;  4GTV A;  1FT1 A;  1X81 A;  3HXE A;  2BED A;  4LNB A;  3HXB A;  3SFX A;  1D8E A;  1TNU A;  1QBQ A;  1JCR A;  1O1S A;  1SA5 A;  4GTT A;  1N95 A;  4GTR A;  1TNO A;  4EHM A;  2H6G A;  2H6F A;  3DRA A;  1TNB A;  4GTP A;  1NL4 A;  3E30 A;  4GTM A;  3DPY A;  3DSX A;  4GTQ A;  3KSL A;  1JCQ A;  4YDE A;  3E37 A;  1TN7 A;  3Q79 A;  3Q75 A;  1N4Q A;  2R2L A;  3DSV A;  2H6I A;  3Q78 A;  1FT2 A;  3E34 A;  2H6H A;  3EU5 A;  1LTX A;  3DSW A;  3DSU A;  3Q7A A;  1DCE A;  4MBG A;  4GTO A;  3HXF A;  1O1T A;  3E32 A;  2ZIR A;  3C72 A;  1SA4 A;  3PZ1 A;  1S64 A;  1MZC A;  1NI1 A;  1O1R A;  3HXC A;  4LNG A;  3PZ3 A;  1N9A A;  1N4P A;  4L9P A;  3DST A;  1FPP A;  3EUV A;  1TN6 A;  3HXD A;  1S63 A;  3SFY A;  1TNY A;  3PZ4 A;  1N4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...