3TWTA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human mcl1 (chimeric peptide)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
156
structure length
156
Chain Sequence
NSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
molecule keywords Tankyrase-2
total genus 47
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twtA00
2XENA 5CECB 1MX6A 4NIKA 4DUIA 3B95A 2L6BA 3B7BA 4K5BA 5EYLA 4HB5A 4ATZD 2ETAA 4UUCA 4C48B 2DZOA 1YMPA 3TWSA 3J5PA 3AJIA 5CEAA 1IHBA 5ENTD 2V5QC 5HS0A 4DX7D 2B0OE 1MJ0A 2XEEA 3NOCD 3UI2A 3UXGA 4N5QA 4A63B 2FO1E 4HI9A 1N0RA 4HRNA 5ENRD 5EN5D 3ZKJA 2DVWA 1QYMA 3UTMA 2XZDG 4K5CA 1UOHA 2QC9A 4LSZE 3NBNB 1A5EA 1NFIE 2ETBA 1TR4A 3C5RA 1IXVA 3V2XA 2RFAA 5KBAA 3EHRA 2ETCA 1BLXB 3Q9UC 4HNAD 4DX1A 5KNHD 1D9SA 1YCSB 5JMND 1DC2A 2PNNA 5ENQD 4YDWA 2NYJA 5CBOA 5ITZF 3JXIA 2Y1LE 5EYPF 3DEOA 2J8SD 3TWRA 4ZHBA 4O60A 5CERB 4U96D 3SO8A 2MYOA 2V4HC 5EIDA 2KXPC 5ENOD 3TWXA 3V30A 2P2CP 4OAVB 1IKND 5FINA 4U95D 5BXUA 1K1BA 4BERA 3F6QA 1AWCB 1N0QA 4HRMB 5EIBE 3ZU7B 4U8YD 5D66A 2A5EA 4LG6A 4GMRA 5AQBA 2Y0BG 4HRLA 4HLLA 4K5AB 1BD8A 4HBDA 1SW6A 2BKKB 4JB8P 4LNUD 3D9HA 1S70B 3HRAA 3TWTA 4DX5D 4O1PA 1MX4A 3V2OA 4U8VD 4HI8A 3DEPA 4G8LA 4CYMD 5BXOA 1BI8B 5AARA 3TWUA 5AAOA 1K3ZD 2F8XK 2DZNA 2XEHA 1BI7B 5JA4D 3KEAA 1YYHA 3T9KA 2KBXA 4DX6D 2RFMA 3AAAC 4J7WA 4BESA 3ZNGA 3IXEA 4BSZB 4DX2A 1MYOA 5FIOA 5AQ7A 1OY3D 5CEDB 4O1OA 3TWVA 1G3NB 5ENSD 5AQ9A 2XZTG 1MX2A 3JXJA 3V79K 4GPMA 1K1AA 4HQDA 3JUEA 5KWDA 5CBNA 3EU9A 4TUMA 4F1PA 4RLYA 1OT8A 4B93B 1WDYA 1WG0A 4BEPA 2QYJA 3HG0D 3EHQA 2F37A 3T8KA 1DCQA 3J5QB 5HKPA 3LJNA 4J8YA 1BU9A 2BKGA 5ENPD 3W9FA 4DRXE 2F8YA 3ZUVB 4G8KA 3TWQA 3NOGD 2DWZA 5EILA 2VGEA 2ZGDA 4BETA 1SVXA 3Q9NC 4OAUC 2AJAA 5HRYA 4YDYA 4QFVA 4QQIA 3TWWA 2JABA 1AP7A 3V31A 2ZGGA 5AN8A 4Z68A 4ZFHA 5AQAA 2HE0A 4CZ2D 3W9GA 4F6RD 1N11A 5KNGA
chains in the Genus database with same CATH superfamily
5BW8C 1MX6A 4FULA 2R02A 3CK8A 3PH0C 1MQSA 4E85A 1IYGA 4HOTA 2VSXE 4IYPA 1Y8MA 3AJIA 5FZSA 3IHYA 2XGSA 4X8QA 3FHEA 4RG9A 1N0RA 3ZKJA 4KYOB 3KAEA 2DIWA 1FVFA 3JCKC 3DPYA 4TV3A 4UQYA 2I1KA 1HG5A 2PM7A 1BLXB 3IEGA 4GZDA 2XCBA 3MYVA 4JD2G 2VYIA 4O60A 3TWXA 5FINA 3SGHA 1NL4A 2WXOA 4V3IA 1JCSA 4GMRA 4GTQA 3AU4A 3DBSA 2WQ7A 4N39A 4G26A 4DUIA 1S70B 4I6EA 2OVFA 1A17A 2J07A 2P9IG 2GGFA 2WXPA 1H2TC 1TNBA 1LD7A 4ANXA 4BESA 5E76A 4JHRA 3Q5MA 1X5BA 3SQVA 1D8DA 2I1JA 4L7TA 3HXCA 5ARFA 5KWDA 1N52A 1OCOE 2Y69E 1DNPA 1WDYA 2C0MA 2WXMA 4AM9A 2F37A 4EPZA 3FUJA 1XNFA 4FC8A 4GB9A 3NOGD 3FTZA 4MKTA 2ZIRA 5HRYA 1N4SA 3PNTB 4QFVA 1E8XA 3GZSA 5FJYA 3LKUA 1V55E 5C2YA 3T8MA 3AU5A 3CSFA 1HE8A 4APOA 2P9LG 4C48B 4N3AA 2V5QC 4DX7D 3PZDA 5AJDA 2JEKA 3LY8A 3ABKE 3QB2A 5ENRD 3LEWA 3CKCA 4CT0A 3RAUA 3ZXPA 4U0SA 3FDHA 3D9OA 4P29A 4DX1A 3RK6A 1OWNA 3QKYA 5CBOA 3JXIA 4U96D 3FTVA 1SZAA 1IKND 1N0QA 3UM2A 5AQBA 3NQPA 3Q7AA 4WUYA 2KM4A 4HVBA 1KPSB 4HI8A 3G2UA 4KMOA 1BI8B 2WVIA 4AEZC 3ZHEB 2WXIA 4JHJA 4GZ5A 1TEZA 4JHKA 4HS2A 1MX2A 3D9IA 5D0QD 3CHPA 2ZXWE 1DCQA 3Q49B 5LCWJ 2YINA 1K8KG 3URZA 3RRUA 4PH4B 5JJTA 4M7CA 3FH5A 3TJPA 3HHMA 2BTDA 3ONLA 4LUNU 3TXMA 5CECB 3RU0A 1RW2A 4XE0A 2J9QA 4NACA 4TUUA 3FP3A 3NF1A 5G05C 3MZLB 2IU1A 3MKQB 3QWPA 2VTBA 4K5CA 4EHMA 1KZPA 1FT2A 4I2WA 3NBNB 3FTWA 3C5RA 2J08A 5FZRA 4JC8A 5KBAA 1DC2A 2Y4TA 1N4QA 4JW1A 1Z5SC 5EYPF 3ASGA 3PREA 3ABLE 1ZBPA 3UX4A 4GU5A 1N95A 2RKKA 3FU0A 3AG1E 4GTSA 3R7RA 4Q69A 3TWTA 3LCAA 2IEJA 4XEIG 3OTNA 3SFZA 3FEYA 3ESLA 2F8XK 1H6PA 4J7WA 4ME2A 3N71A 4LNBA 4YDEA 5G05J 3SBTB 2WXFA 2M63A 4BX8A 4HXIA 2CFZA 4J8YA 1BU9A 4PDXA 4XX5A 5ENPD 2QYUA 3LPZA 1KLXA 2L0IA 3FUEA 1LF8A 2IJGX 3B95A 3SNXA 5CCLA 3DSXA 3UT4A 2I6HA 3GZ2A 2IOSA 1FPPA 2WXGA 1ZU2A 3L08A 3UM0A 2UWJG 3RRNB 4KZ0A 2I2OA 4C9BB 2WXKA 2WQ6A 2H6HA 1E7UA 4PS7A 3KS2A 5KJKA 3CGHA 3TAXA 2XGOA 4G23A 4NRHB 3PVLA 1NA3A 5C1DA 2LNIA 2KZTB 3FTYA 3UIPC 4ABNA 5BXUA 3ISMC 4J8SA 3LJ3A 5AIJA 3DSUA 2PQRA 3LY7A 4Y6WA 4C0EA 3KSQA 4G8LA 4F53A 3ZXSA 1BPOA 1K3ZD 1YYHA 2KBXA 2IQCA 2XS1A 4ACKA 5EX0A 3SZ7A 4YVQC 4HOQA 3CV0A 2GRRB 3ZYMA 3HYMB 4FJZA 4FA6A 4ATGA 3L54A 3G2WA 4GZ3A 3MA5A 3Q9NC 4RG6A 3ENEA 3U3WA 3U9WA 3FH7A 4NIKA 2AWIA 3FUFA 1HFAA 2R2LA 1NI1A 4L2LA 2ETAA 3G2TA 5BT1A 3LS8A 4JEUA 2YHCA 2DBAA 5T4YA 3D9MA 5G04C 4I43A 2XPIA 2QC9A 4LSZE 3Q15A 1NFIE 4AVXA 2WM9A 4WWNA 2VSYA 1N54A 3LVQE 2GRNB 3Q9UC 5KNHD 2VSOE 2WMOA 1Z3YA 4JZYA 4N5CA 1MZCA 4W9RA 5JJ6A 5AENA 4HBDA 4DX5D 3D9HA 3ASNE 3EIQC 4U07A 3I4RB 4KVMA 3Q7FA 2XS8A 3HXBA 4N2SA 3CLJA 4GA0A 2XPYA 4DLQA 3V79K 5BV1A 3CVNA 1Y6IA 2X38A 3VLDA 4HORA 1O5MA 4R7LA 1U3DA 3TWQA 1WM5A 1PY1A 1UJJA 4UWHA 2EINE 3TL5A 3I4GA 2BUGA 4HOUA 1OWPA 2PZIA 2XHEA 3X2QE 3TWWA 2ZGGA 1OWLA 2H6IA 1V54E 1S0PA 5KJMA 2VGXB 3T5XA 3TG5A 1OWOA 4G24A 3E34A 2X6KA 3QDNA 5HI7A 4EQFA 4A63B 1TN8A 3HIZA 2OVBA 5CRVA 2H6FA 1QQEA 3R9MA 2PL2A 3CHSA 4FLBA 3UT7A 2X3MA 4I2ZA 3AS8A 2NYJA 3EJNA 1EF1C 5FQ7A 2Y1LE 2KCLA 4C0MA 3S7DA 4JL0A 2A5EA 4B89A 2LSVA 3RSEG 2KCVA 2KATA 4RSYA 3E4BA 1DCEA 4LNUD 2VJ8A 3SF4A 2J4BA 4U0ZA 3CKBA 4ANWA 3UIOC 3KEAA 5B1AE 3O48A 4DPRA 4WWOA 2IO2C 1D8EA 1UG3A 4LEUA 4FP7A 4BTAA 3VLFA 1K1AA 3FTUA 3ZRHA 2VGYA 2LUHA 1WG0A 3TG4A 2IOLA 2YHEA 3DSSA 2OCCE 2P9NG 1JCRA 3FULA 4N2QA 4DRXE 2Y3AA 5EILA 4L1BA 5J90A 3ZN3A 3APCA 2NC9A 1N9AA 5AQAA 2H6GA 4LNGA 1ELWA 2NXPA 4K5BA 3AG3E 4ACLA 3NB2A 4GMLA 4U63A 3J5PA 5ENTD 3L16A 5HQ8A 4XI0A 3UXGA 2FO1E 2UY1B 1IHGA 5EN5D 4EZKA 2DVWA 3L22A 4LERA 2CFUA 3MKRA 1A5EA 1E8YA 4MBGA 2WXLA 2R03A 3CQCB 2X6HA 2YNQA 4ZHBA 5CERB 2A5UA 4B8CB 4GZ6A 3V30A 5D0OD 3U66A 4DI3A 4CCAA 4DK5A 1SW6A 3HVEB 3LDZA 4GTMA 5A6CA 3GZ1A 2IFUA 1HH8A 3JUIA 2A4ZA 2CG2A 1QNFA 3K9IA 4GPKA 1EPUA 1OY3D 3IBEA 2XQ0A 4GPMA 4ANUA 3PUKA 5CBNA 3L6AA 1OT8A 4K03A 3DPDA 5HKPA 3LJNA 1FT1A 3W9FA 2WB2A 4IRUA 3Q75A 4BETA 1SQMA 3FFLA 3ULYA 3CK7A 4CZ2D 5E75A 4HB5A 2XPZA 3LVRE 4GCNA 1X81A 2FF4A 1MJ0A 1O1RA 3NOCD 3HXEA 4N5QA 5DIZA 4A3TA 3BG1B 4G1TA 1QYMA 3RIBA 2V8SE 5LCWC 3ZEFA 3U4TA 3QNKA 5DBKA 2WPVA 2DCPA 3ASFA 1K1BA 4A3VA 5JHBA 4B8AA 5EIBE 5G2NA 1HX8A 4HLLA 4EECA 4GMJA 2GRPB 4JB8P 2OEVA 3OXGA 3P2BA 3TWUA 5AAOA 2IY0C 5JA4D 5LFAA 3ESKA 2FBNA 3OXLA 3RKVA 3UPVA 3L17A 2Y4UA 3CVLA 2J4DA 2OV8A 3TWVA 2V5FA 3ML9A 1L5JA 1VDYA 3ULQA 3FEXA 4GTRA 4F1SA 2LO6A 4RLYA 1EYHA 3J5QB 1TYQG 1S63A 2KCKA 4MRUA 1U2VG 3E30A 4B0ZA 3VTXA 2R59A 3ZYKA 5FZQA 5KNGA 4CDRA 3BUAA 1HXIA 5CCMA 3FH8A 3B7TA 4JEHA 2E0IA 2HM8A 3NZSA 4J0UA 3QC1A 1O1SA 4I6JA 4BX9A 4KVOA 2HO1A 3UMVA 4AIFA 3I3NA 3LYAA 4CGVA 3PEVB 4IN3B 4UI9K 3Q4AB 2R5SA 2LXMA 5JMND 1KT0A 4UWLA 3TWRA 3MKQA 1W3BA 3FUMA 3DSVA 2I9CA 3S7FA 4ILGA 3FUIA 4E6HA 4CYMD 2R05A 2EIJE 4ILIA 4FLHA 2F0YA 2ZISA 1OCZE 3DRAA 3IXEA 2GROB 4BFRA 5KJLA 4I9CA 3VTYA 3LY9A 3PZ4A 3U64A 3EU9A 3UUXA 1ELKA 4CDNA 3ZYLA 4BEPA 1HO8A 3T8KA 4YVOA 2F8YA 3OAWA 3GW4A 4G25A 4MS6A 1UN8A 1NZNA 3PE3A 3CHQA 3RO2A 3MV3B 3ZHEA 3MEKA 1AP7A 4BT9A 4BTBA 3L13A 5EYLA 2GRLA 3FUDA 3RJVA 4B94A 1NA0A 2XGMA 4I6GA 3EHNA 2B6CA 2GRMA 4Y6CA 3QAQA 1HS6A 4HI9A 3L9TA 1IQUA 3RRMB 4CT4A 2V0PA 5CHEE 3APDA 2P9SG 2PQNA 5ENOD 3RO3A 4JXTA 4GTOA 3ZVVA 3Q47B 5BNWA 5FQ4A 3HRAA 3UM1A 4TXQA 4URKA 3DEPA 2AXVA 3E32A 4A1SA 3QWWA 2VTBB 4KXKB 3MCXA 4DX6D 3ZNGA 4F7AA 2NSZA 3SD5A 3S7JA 5A23A 1E90A 2HYZA 2J09A 2P9KG 5LP0A 3EU5A 4OVUA 4KZCA 3CVYA 2HR2A 4JA7A 1TJCA 2AVPA 3HDXA 3HVEA 3D9KA 4TRQA 4YDYA 4XI9A 4BY6A 1XGWA 3ULEG 4A1GA 3V31A 1ZB1A 1Z6TA 4AV7A 4AY6A 3ASOE 1FVHA 4AP2A 1TNOA 4M3OA 2DZOA 2QZAA 3C72A 1KZOA 4PS3A 3FTSA 2X6FA 4A55A 3UT8A 4WNFA 3DXMG 4L9PA 3CVWA 1EDUA 4GCOA 2OEWA 4G2VA 3B7SA 3PDNA 2FI7A 3UTMA 2ONDA 5CMYA 1B89A 4TXRA 1HF8A 4JPSA 2L9BA 1MHQA 4GAAA 3FWVA 3AG2E 1JWGA 3B7RL 3SO8A 5KCMA 2P2CP 4J8EA 4UI9C 3JQ0A 3S7BA 4DLOA 5D66A 4LG6A 3ZGQA 5H7PA 2BKKB 5T3RA 5BV0A 3WXXA 2P58C 3ZFWA 1OCRE 1N4PA 5AARA 3FUKA 4HOSA 2XEHA 2JLBA 4XKCA 4GTPA 3PZ3A 4BSZB 3O4ZA 3E37A 3EHMA 5FQ6A 5AQ7A 3UM3A 5AQ9A 3CEQA 4F1PA 4U8HA 4WNEA 3FU5A 1OWMA 2QYJA 1OXJA 4H7XA 2AW6A 3P1UA 3TXNA 1E96B 3JYSA 3D9JA 3ML8A 4ZFHA 4F6RD 3W9GA 2MRIA 2P9UG 4WAFA 3C98A 5T8IA 1INZA 3CQGB 4J8FA 3QOUA 3UKUG 4UUCA 2X6IA 3TWSA 3QARA 1LD8A 1IHBA 2WXRA 5HS0A 3CHOA 1SA5A 4FHJA 3PRZA 4U7EB 4MLPA 5J08A 5ANRA 2VGXA 5CRUA 1H6OA 4YDWA 4AXHA 3BG0B 3MX3A 3CVPA 3CHMA 1HG2A 5G55A 2DYRE 2IO3C 3B13A 3ZU7B 4EZLA 3C3OA 4N3CA 3AG4E 3FUHA 1JUQA 2DZNA 3AAAC 2J49A 3HXDA 2QFCA 1LTXA 3D9NA 3C3QA 4OYSA 3DXKG 1SA4A 5KJNA 3PNLB 3JUEA 3QWVA 2WXNA 3PS6A 4FHKA 4B93B 3HG0D 3ABME 1JWFA 3EHQA 3Q73A 2Q7FA 4IULA 1S64A 3QJZA 2X6JA 2EIKE 4YDOA 2ZGDA 3DSWA 1PAQA 1YA0A 3IV0A 1TNUA 2CHWA 2AXUA 5G04J 3PE4A 5IY5E 2LAIA 4ATZD 1YMPA 4EBAG 5CEAA 2C0LA 4GA1A 2B0OE 1OUVA 2E2EA 1N4RA 3MGBA 4CEMA 3T5VA 1QBQA 2XZDG 2C2LA 4UWGA 4YNDA 2KZTA 1TR4A 2ZU6B 4EZJA 5JHAA 2LAHA 3EHRA 2YQ8A 4HNAD 5ENQD 3ZIMA 2WMNA 4U04A 2J8SD 3SFYA 2MYOA 4GYYA 3WG7E 2V4HC 2KXPC 1H2VC 4BERA 4UQXA 4U8YD 2WXJA 3PZ2A 2CG3A 3CSTA 4G11A 4K5AB 1BD8A 3EUVA 5M72A 1MX4A 3V2OA 2VQ2A 1FCHA 3C3RA 3CVVA 2WQHA 4N3BA 3T9KA 1Q2ZA 4APFA 1TN7A 1U3CA 1MYOA 5FIOA 4FJYA 3CHRA 3VLEA 4BT8A 4LCTA 3JXJA 3UKRG 2LXLA 3ZPJA 3CVUA 3D3MA 4U0UA 1PC2A 2L6JA 4UI9J 4CDMA 2DYSE 2WXQA 5JJ7A 4G8KA 5LOZA 3KEZA 2FEZA 4GTVA 3NAWA 1H6KA 2AJAA 1E8WA 4QQIA 1N11A 4UWFA 1E8ZA 3OXFA 3B7UX 2PM6A 3UQ3A 2ILRA 4HRNA 1HU3A 3R7QA 3NZUA 5AYWD 3PUJA 4FADA 1UN9A 3AS5A 3V2XA 3UINC 4JA9A 3MJWA 1N94A 3QK0A 5ITZF 4GYOA 5BUZA 4D10C 4AY5A 4DJAA 4I9EA 3G2SA 2WXHA 2XRZA 4K0RA 4HRLA 1H2UA 2CHZA 4GTTA 4U8VD 2BF0X 4J6IA 3D9PA 5BXOA 3BEEA 5FWQA 2V4LA 3AS4A 5FTPA 5LX8A 1G3NB 1RZ4A 3FU6A 4I17A 4HQDA 3HXFA 1UJKA 2BEDA 1TNYA 4L2YA 4GA2A 4EBAA 2MHKA 1HZ4A 4UWKA 3SHFA 4F3VA 2XEVA 3CVQA 3DWLG 3G2VA 1OCCE 3ZW3A 4ANVA 4BSXA 3TGOA 2VGEA 1SVXA 2AXZA 4OAUC 1NP7A 3Q78A 4I1OB 4HFGA 1TJFA 2RD0A 5B3SE 4DI4A 3B7BA 4WNDA 2CHXA 3KD7A 4GYWA 4KT6B 4H7YA 5EKQD 4NQ0A 3APFA 3FU3A 4PUCA 2XEEA 4TXPA 2R17C 4BWRA 1Z3XA 3CR3A 4GZCA 3FTXA 4CRWA 4KBQA 4Q96A 5B1BE 1IQRA 1IXVA 2RFAA 5EDSA 2ETCA 2LSUA 1YCSB 3KSLA 1WAO1 4J8DA 3SI5A 2GRQB 3EDTB 3E33A 1AWCB 4I1AA 3SFXA 4LRZA 2FO7A 2GW1A 5ARGA 5EX3A 2MOWA 3ASHA 2FULA 2RFMA 4WNGA 3S2AA 1GW6A 3SY2A 3IKOB 4CGWA 3CIAA 3Q79A 5FQ8A 3R9AB 1UW4B 4XKBA 2UY1A 4PS8A 1JCQA 3FY4A 4XIFA 1ELRA 3IHVA 1JPLA 2EILE 2RG8A 4RQIA 2JABA 4Z68A 2EIME 4L23A 1O1TA 2XENA 3I5PA 2L6BA 1H0AA 4O6FA 4AJWA 3FUNA 2OOEA 2P9PG 1DVPA 1WY6A 2XCCA 4NURA 3UI2A 5BPPA 5CMWA 1TN6A 1UOHA 3BU8A 3GYZA 2ETBA 4Q94A 1TNZA 4OVVA 4UQZA 1D9SA 2PNNA 3CVXA 2QY7A 3CK9A 4JVSA 3DEOA 3D9LA 5AJLA 5EIDA 4OAVB 3BQOA 4WWPA 4U95D 3F6QA 5ANLA 4HRMB 4RVBA 3ONKA 2Y0BG 1P5QA 4I1MA 5ENNA 2XRYA 5D2MC 4O1PA 3EIJA 3ASDA 3ZYQA 5FT9A 1BI7B 1E7VA 2L0TB 2IF4A 4DX2A 3PEUB 3JQ1A 2EQXA 5CEDB 4O1OA 5ENSD 2IONA 3LXUX 2XZTG 4AOFA 3MV2B 1SZ9A 4TUMA 1QZ2A 3PZ1A 2VSNA 3L82A 4ILHB 4XZ4A 4FU3A 5A7DB 2BKGA 1KT1A 3DSTA 3ZUVB 3SBSA 2DWZA 2KC7A 4HLEA 1H19A 5AN8A 2HE0A
chains in the Genus database with same CATH topology
2XENA 5CECB 1MX6A 4NIKA 4DUIA 3B95A 2L6BA 3B7BA 4K5BA 5EYLA 4HB5A 4ATZD 2ETAA 4UUCA 4C48B 2DZOA 1YMPA 3TWSA 3J5PA 3AJIA 5CEAA 1IHBA 5ENTD 2V5QC 5HS0A 4DX7D 2B0OE 1MJ0A 2XEEA 3NOCD 3UI2A 3UXGA 4N5QA 4A63B 2FO1E 4HI9A 1N0RA 4HRNA 5ENRD 5EN5D 3ZKJA 2DVWA 1QYMA 3UTMA 2XZDG 4K5CA 1UOHA 2QC9A 4LSZE 3NBNB 1A5EA 1NFIE 2ETBA 1TR4A 3C5RA 1IXVA 3V2XA 2RFAA 5KBAA 3EHRA 2ETCA 1BLXB 3Q9UC 4HNAD 4DX1A 5KNHD 1D9SA 1YCSB 5JMND 1DC2A 2PNNA 5ENQD 4YDWA 2NYJA 5CBOA 5ITZF 3JXIA 2Y1LE 5EYPF 3DEOA 2J8SD 3TWRA 4ZHBA 4O60A 5CERB 4U96D 3SO8A 2MYOA 2V4HC 5EIDA 2KXPC 5ENOD 3TWXA 3V30A 2P2CP 4OAVB 1IKND 5FINA 4U95D 5BXUA 1K1BA 4BERA 3F6QA 1AWCB 1N0QA 4HRMB 5EIBE 3ZU7B 4U8YD 5D66A 2A5EA 4LG6A 4GMRA 5AQBA 2Y0BG 4HRLA 4HLLA 4K5AB 1BD8A 4HBDA 1SW6A 2BKKB 4JB8P 4LNUD 3D9HA 1S70B 3HRAA 3TWTA 4DX5D 4O1PA 1MX4A 3V2OA 4U8VD 4HI8A 3DEPA 4G8LA 4CYMD 5BXOA 1BI8B 5AARA 3TWUA 5AAOA 1K3ZD 2F8XK 2DZNA 2XEHA 1BI7B 5JA4D 3KEAA 1YYHA 3T9KA 2KBXA 4DX6D 2RFMA 3AAAC 4J7WA 4BESA 3ZNGA 3IXEA 4BSZB 4DX2A 1MYOA 5FIOA 5AQ7A 1OY3D 5CEDB 4O1OA 3TWVA 1G3NB 5ENSD 5AQ9A 2XZTG 1MX2A 3JXJA 3V79K 4GPMA 1K1AA 4HQDA 3JUEA 5KWDA 5CBNA 3EU9A 4TUMA 4F1PA 4RLYA 1OT8A 4B93B 1WDYA 1WG0A 4BEPA 2QYJA 3HG0D 3EHQA 2F37A 3T8KA 1DCQA 3J5QB 5HKPA 3LJNA 4J8YA 1BU9A 2BKGA 5ENPD 3W9FA 4DRXE 2F8YA 3ZUVB 4G8KA 3TWQA 3NOGD 2DWZA 5EILA 2VGEA 2ZGDA 4BETA 1SVXA 3Q9NC 4OAUC 2AJAA 5HRYA 4YDYA 4QFVA 4QQIA 3TWWA 2JABA 1AP7A 3V31A 2ZGGA 5AN8A 4Z68A 4ZFHA 5AQAA 2HE0A 4CZ2D 3W9GA 4F6RD 1N11A 5KNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEN A;  5CEC B;  1MX6 A;  4NIK A;  4DUI A;  3B95 A;  2L6B A;  3B7B A;  4K5B A;  5EYL A;  4HB5 A;  4ATZ D;  2ETA A;  4UUC A;  4C48 B;  2DZO A;  1YMP A;  3TWS A;  3J5P A;  3AJI A;  5CEA A;  1IHB A;  5ENT D;  2V5Q C;  5HS0 A;  4DX7 D;  2B0O E;  1MJ0 A;  2XEE A;  3NOC D;  3UI2 A;  3UXG A;  4N5Q A;  4A63 B;  2FO1 E;  4HI9 A;  1N0R A;  4HRN A;  5ENR D;  5EN5 D;  3ZKJ A;  2DVW A;  1QYM A;  3UTM A;  2XZD G;  4K5C A;  1UOH A;  2QC9 A;  4LSZ E;  3NBN B;  1A5E A;  1NFI E;  2ETB A;  1TR4 A;  3C5R A;  1IXV A;  3V2X A;  2RFA A;  5KBA A;  3EHR A;  2ETC A;  1BLX B;  3Q9U C;  4HNA D;  4DX1 A;  5KNH D;  1D9S A;  1YCS B;  5JMN D;  1DC2 A;  2PNN A;  5ENQ D;  4YDW A;  2NYJ A;  5CBO A;  5ITZ F;  3JXI A;  2Y1L E;  5EYP F;  3DEO A;  2J8S D;  3TWR A;  4ZHB A;  4O60 A;  5CER B;  4U96 D;  3SO8 A;  2MYO A;  2V4H C;  5EID A;  2KXP C;  5ENO D;  3TWX A;  3V30 A;  2P2C P;  4OAV B;  1IKN D;  5FIN A;  4U95 D;  5BXU A;  1K1B A;  4BER A;  3F6Q A;  1AWC B;  1N0Q A;  4HRM B;  5EIB E;  3ZU7 B;  4U8Y D;  5D66 A;  2A5E A;  4LG6 A;  4GMR A;  5AQB A;  2Y0B G;  4HRL A;  4HLL A;  4K5A B;  1BD8 A;  4HBD A;  1SW6 A;  2BKK B;  4JB8 P;  4LNU D;  3D9H A;  1S70 B;  3HRA A;  3TWT A;  4DX5 D;  4O1P A;  1MX4 A;  3V2O A;  4U8V D;  4HI8 A;  3DEP A;  4G8L A;  4CYM D;  5BXO A;  1BI8 B;  5AAR A;  3TWU A;  5AAO A;  1K3Z D;  2F8X K;  2DZN A;  2XEH A;  1BI7 B;  5JA4 D;  3KEA A;  1YYH A;  3T9K A;  2KBX A;  4DX6 D;  2RFM A;  3AAA C;  4J7W A;  4BES A;  3ZNG A;  3IXE A;  4BSZ B;  4DX2 A;  1MYO A;  5FIO A;  5AQ7 A;  1OY3 D;  5CED B;  4O1O A;  3TWV A;  1G3N B;  5ENS D;  5AQ9 A;  2XZT G;  1MX2 A;  3JXJ A;  3V79 K;  4GPM A;  1K1A A;  4HQD A;  3JUE A;  5KWD A;  5CBN A;  3EU9 A;  4TUM A;  4F1P A;  4RLY A;  1OT8 A;  4B93 B;  1WDY A;  1WG0 A;  4BEP A;  2QYJ A;  3HG0 D;  3EHQ A;  2F37 A;  3T8K A;  1DCQ A;  3J5Q B;  5HKP A;  3LJN A;  4J8Y A;  1BU9 A;  2BKG A;  5ENP D;  3W9F A;  4DRX E;  2F8Y A;  3ZUV B;  4G8K A;  3TWQ A;  3NOG D;  2DWZ A;  5EIL A;  2VGE A;  2ZGD A;  4BET A;  1SVX A;  3Q9N C;  4OAU C;  2AJA A;  5HRY A;  4YDY A;  4QFV A;  4QQI A;  3TWW A;  2JAB A;  1AP7 A;  3V31 A;  2ZGG A;  5AN8 A;  4Z68 A;  4ZFH A;  5AQA A;  2HE0 A;  4CZ2 D;  3W9G A;  4F6R D;  1N11 A;  5KNG A; 
#chains in the Genus database with same CATH topology
 5BW8 C;  1MX6 A;  4FUL A;  2R02 A;  3CK8 A;  3PH0 C;  1MQS A;  4E85 A;  1IYG A;  4HOT A;  2VSX E;  4IYP A;  1Y8M A;  3AJI A;  5FZS A;  3IHY A;  2XGS A;  4X8Q A;  3FHE A;  4RG9 A;  1N0R A;  3ZKJ A;  4KYO B;  3KAE A;  2DIW A;  1FVF A;  3JCK C;  3DPY A;  4TV3 A;  4UQY A;  2I1K A;  1HG5 A;  2PM7 A;  1BLX B;  3IEG A;  4GZD A;  2XCB A;  3MYV A;  4JD2 G;  2VYI A;  4O60 A;  3TWX A;  5FIN A;  3SGH A;  1NL4 A;  2WXO A;  4V3I A;  1JCS A;  4GMR A;  4GTQ A;  3AU4 A;  3DBS A;  2WQ7 A;  4N39 A;  4G26 A;  4DUI A;  1S70 B;  4I6E A;  2OVF A;  1A17 A;  2J07 A;  2P9I G;  2GGF A;  2WXP A;  1H2T C;  1TNB A;  1LD7 A;  4ANX A;  4BES A;  5E76 A;  4JHR A;  3Q5M A;  1X5B A;  3SQV A;  1D8D A;  2I1J A;  4L7T A;  3HXC A;  5ARF A;  5KWD A;  1N52 A;  1OCO E;  2Y69 E;  1DNP A;  1WDY A;  2C0M A;  2WXM A;  4AM9 A;  2F37 A;  4EPZ A;  3FUJ A;  1XNF A;  4FC8 A;  4GB9 A;  3NOG D;  3FTZ A;  4MKT A;  2ZIR A;  5HRY A;  1N4S A;  3PNT B;  4QFV A;  1E8X A;  3GZS A;  5FJY A;  3LKU A;  1V55 E;  5C2Y A;  3T8M A;  3AU5 A;  3CSF A;  1HE8 A;  4APO A;  2P9L G;  4C48 B;  4N3A A;  2V5Q C;  4DX7 D;  3PZD A;  5AJD A;  2JEK A;  3LY8 A;  3ABK E;  3QB2 A;  5ENR D;  3LEW A;  3CKC A;  4CT0 A;  3RAU A;  3ZXP A;  4U0S A;  3FDH A;  3D9O A;  4P29 A;  4DX1 A;  3RK6 A;  1OWN A;  3QKY A;  5CBO A;  3JXI A;  4U96 D;  3FTV A;  1SZA A;  1IKN D;  1N0Q A;  3UM2 A;  5AQB A;  3NQP A;  3Q7A A;  4WUY A;  2KM4 A;  4HVB A;  1KPS B;  4HI8 A;  3G2U A;  4KMO A;  1BI8 B;  2WVI A;  4AEZ C;  3ZHE B;  2WXI A;  4JHJ A;  4GZ5 A;  1TEZ A;  4JHK A;  4HS2 A;  1MX2 A;  3D9I A;  5D0Q D;  3CHP A;  2ZXW E;  1DCQ A;  3Q49 B;  5LCW J;  2YIN A;  1K8K G;  3URZ A;  3RRU A;  4PH4 B;  5JJT A;  4M7C A;  3FH5 A;  3TJP A;  3HHM A;  2BTD A;  3ONL A;  4LUN U;  3TXM A;  5CEC B;  3RU0 A;  1RW2 A;  4XE0 A;  2J9Q A;  4NAC A;  4TUU A;  3FP3 A;  3NF1 A;  5G05 C;  3MZL B;  2IU1 A;  3MKQ B;  3QWP A;  2VTB A;  4K5C A;  4EHM A;  1KZP A;  1FT2 A;  4I2W A;  3NBN B;  3FTW A;  3C5R A;  2J08 A;  5FZR A;  4JC8 A;  5KBA A;  1DC2 A;  2Y4T A;  1N4Q A;  4JW1 A;  1Z5S C;  5EYP F;  3ASG A;  3PRE A;  3ABL E;  1ZBP A;  3UX4 A;  4GU5 A;  1N95 A;  2RKK A;  3FU0 A;  3AG1 E;  4GTS A;  3R7R A;  4Q69 A;  3TWT A;  3LCA A;  2IEJ A;  4XEI G;  3OTN A;  3SFZ A;  3FEY A;  3ESL A;  2F8X K;  1H6P A;  4J7W A;  4ME2 A;  3N71 A;  4LNB A;  4YDE A;  5G05 J;  3SBT B;  2WXF A;  2M63 A;  4BX8 A;  4HXI A;  2CFZ A;  4J8Y A;  1BU9 A;  4PDX A;  4XX5 A;  5ENP D;  2QYU A;  3LPZ A;  1KLX A;  2L0I A;  3FUE A;  1LF8 A;  2IJG X;  3B95 A;  3SNX A;  5CCL A;  3DSX A;  3UT4 A;  2I6H A;  3GZ2 A;  2IOS A;  1FPP A;  2WXG A;  1ZU2 A;  3L08 A;  3UM0 A;  2UWJ G;  3RRN B;  4KZ0 A;  2I2O A;  4C9B B;  2WXK A;  2WQ6 A;  2H6H A;  1E7U A;  4PS7 A;  3KS2 A;  5KJK A;  3CGH A;  3TAX A;  2XGO A;  4G23 A;  4NRH B;  3PVL A;  1NA3 A;  5C1D A;  2LNI A;  2KZT B;  3FTY A;  3UIP C;  4ABN A;  5BXU A;  3ISM C;  4J8S A;  3LJ3 A;  5AIJ A;  3DSU A;  2PQR A;  3LY7 A;  4Y6W A;  4C0E A;  3KSQ A;  4G8L A;  4F53 A;  3ZXS A;  1BPO A;  1K3Z D;  1YYH A;  2KBX A;  2IQC A;  2XS1 A;  4ACK A;  5EX0 A;  3SZ7 A;  4YVQ C;  4HOQ A;  3CV0 A;  2GRR B;  3ZYM A;  3HYM B;  4FJZ A;  4FA6 A;  4ATG A;  3L54 A;  3G2W A;  4GZ3 A;  3MA5 A;  3Q9N C;  4RG6 A;  3ENE A;  3U3W A;  3U9W A;  3FH7 A;  4NIK A;  2AWI A;  3FUF A;  1HFA A;  2R2L A;  1NI1 A;  4L2L A;  2ETA A;  3G2T A;  5BT1 A;  3LS8 A;  4JEU A;  2YHC A;  2DBA A;  5T4Y A;  3D9M A;  5G04 C;  4I43 A;  2XPI A;  2QC9 A;  4LSZ E;  3Q15 A;  1NFI E;  4AVX A;  2WM9 A;  4WWN A;  2VSY A;  1N54 A;  3LVQ E;  2GRN B;  3Q9U C;  5KNH D;  2VSO E;  2WMO A;  1Z3Y A;  4JZY A;  4N5C A;  1MZC A;  4W9R A;  5JJ6 A;  5AEN A;  4HBD A;  4DX5 D;  3D9H A;  3ASN E;  3EIQ C;  4U07 A;  3I4R B;  4KVM A;  3Q7F A;  2XS8 A;  3HXB A;  4N2S A;  3CLJ A;  4GA0 A;  2XPY A;  4DLQ A;  3V79 K;  5BV1 A;  3CVN A;  1Y6I A;  2X38 A;  3VLD A;  4HOR A;  1O5M A;  4R7L A;  1U3D A;  3TWQ A;  1WM5 A;  1PY1 A;  1UJJ A;  4UWH A;  2EIN E;  3TL5 A;  3I4G A;  2BUG A;  4HOU A;  1OWP A;  2PZI A;  2XHE A;  3X2Q E;  3TWW A;  2ZGG A;  1OWL A;  2H6I A;  1V54 E;  1S0P A;  5KJM A;  2VGX B;  3T5X A;  3TG5 A;  1OWO A;  4G24 A;  3E34 A;  2X6K A;  3QDN A;  5HI7 A;  4EQF A;  4A63 B;  1TN8 A;  3HIZ A;  2OVB A;  5CRV A;  2H6F A;  1QQE A;  3R9M A;  2PL2 A;  3CHS A;  4FLB A;  3UT7 A;  2X3M A;  4I2Z A;  3AS8 A;  2NYJ A;  3EJN A;  1EF1 C;  5FQ7 A;  2Y1L E;  2KCL A;  4C0M A;  3S7D A;  4JL0 A;  2A5E A;  4B89 A;  2LSV A;  3RSE G;  2KCV A;  2KAT A;  4RSY A;  3E4B A;  1DCE A;  4LNU D;  2VJ8 A;  3SF4 A;  2J4B A;  4U0Z A;  3CKB A;  4ANW A;  3UIO C;  3KEA A;  5B1A E;  3O48 A;  4DPR A;  4WWO A;  2IO2 C;  1D8E A;  1UG3 A;  4LEU A;  4FP7 A;  4BTA A;  3VLF A;  1K1A A;  3FTU A;  3ZRH A;  2VGY A;  2LUH A;  1WG0 A;  3TG4 A;  2IOL A;  2YHE A;  3DSS A;  2OCC E;  2P9N G;  1JCR A;  3FUL A;  4N2Q A;  4DRX E;  2Y3A A;  5EIL A;  4L1B A;  5J90 A;  3ZN3 A;  3APC A;  2NC9 A;  1N9A A;  5AQA A;  2H6G A;  4LNG A;  1ELW A;  2NXP A;  4K5B A;  3AG3 E;  4ACL A;  3NB2 A;  4GML A;  4U63 A;  3J5P A;  5ENT D;  3L16 A;  5HQ8 A;  4XI0 A;  3UXG A;  2FO1 E;  2UY1 B;  1IHG A;  5EN5 D;  4EZK A;  2DVW A;  3L22 A;  4LER A;  2CFU A;  3MKR A;  1A5E A;  1E8Y A;  4MBG A;  2WXL A;  2R03 A;  3CQC B;  2X6H A;  2YNQ A;  4ZHB A;  5CER B;  2A5U A;  4B8C B;  4GZ6 A;  3V30 A;  5D0O D;  3U66 A;  4DI3 A;  4CCA A;  4DK5 A;  1SW6 A;  3HVE B;  3LDZ A;  4GTM A;  5A6C A;  3GZ1 A;  2IFU A;  1HH8 A;  3JUI A;  2A4Z A;  2CG2 A;  1QNF A;  3K9I A;  4GPK A;  1EPU A;  1OY3 D;  3IBE A;  2XQ0 A;  4GPM A;  4ANU A;  3PUK A;  5CBN A;  3L6A A;  1OT8 A;  4K03 A;  3DPD A;  5HKP A;  3LJN A;  1FT1 A;  3W9F A;  2WB2 A;  4IRU A;  3Q75 A;  4BET A;  1SQM A;  3FFL A;  3ULY A;  3CK7 A;  4CZ2 D;  5E75 A;  4HB5 A;  2XPZ A;  3LVR E;  4GCN A;  1X81 A;  2FF4 A;  1MJ0 A;  1O1R A;  3NOC D;  3HXE A;  4N5Q A;  5DIZ A;  4A3T A;  3BG1 B;  4G1T A;  1QYM A;  3RIB A;  2V8S E;  5LCW C;  3ZEF A;  3U4T A;  3QNK A;  5DBK A;  2WPV A;  2DCP A;  3ASF A;  1K1B A;  4A3V A;  5JHB A;  4B8A A;  5EIB E;  5G2N A;  1HX8 A;  4HLL A;  4EEC A;  4GMJ A;  2GRP B;  4JB8 P;  2OEV A;  3OXG A;  3P2B A;  3TWU A;  5AAO A;  2IY0 C;  5JA4 D;  5LFA A;  3ESK A;  2FBN A;  3OXL A;  3RKV A;  3UPV A;  3L17 A;  2Y4U A;  3CVL A;  2J4D A;  2OV8 A;  3TWV A;  2V5F A;  3ML9 A;  1L5J A;  1VDY A;  3ULQ A;  3FEX A;  4GTR A;  4F1S A;  2LO6 A;  4RLY A;  1EYH A;  3J5Q B;  1TYQ G;  1S63 A;  2KCK A;  4MRU A;  1U2V G;  3E30 A;  4B0Z A;  3VTX A;  2R59 A;  3ZYK A;  5FZQ A;  5KNG A;  4CDR A;  3BUA A;  1HXI A;  5CCM A;  3FH8 A;  3B7T A;  4JEH A;  2E0I A;  2HM8 A;  3NZS A;  4J0U A;  3QC1 A;  1O1S A;  4I6J A;  4BX9 A;  4KVO A;  2HO1 A;  3UMV A;  4AIF A;  3I3N A;  3LYA A;  4CGV A;  3PEV B;  4IN3 B;  4UI9 K;  3Q4A B;  2R5S A;  2LXM A;  5JMN D;  1KT0 A;  4UWL A;  3TWR A;  3MKQ A;  1W3B A;  3FUM A;  3DSV A;  2I9C A;  3S7F A;  4ILG A;  3FUI A;  4E6H A;  4CYM D;  2R05 A;  2EIJ E;  4ILI A;  4FLH A;  2F0Y A;  2ZIS A;  1OCZ E;  3DRA A;  3IXE A;  2GRO B;  4BFR A;  5KJL A;  4I9C A;  3VTY A;  3LY9 A;  3PZ4 A;  3U64 A;  3EU9 A;  3UUX A;  1ELK A;  4CDN A;  3ZYL A;  4BEP A;  1HO8 A;  3T8K A;  4YVO A;  2F8Y A;  3OAW A;  3GW4 A;  4G25 A;  4MS6 A;  1UN8 A;  1NZN A;  3PE3 A;  3CHQ A;  3RO2 A;  3MV3 B;  3ZHE A;  3MEK A;  1AP7 A;  4BT9 A;  4BTB A;  3L13 A;  5EYL A;  2GRL A;  3FUD A;  3RJV A;  4B94 A;  1NA0 A;  2XGM A;  4I6G A;  3EHN A;  2B6C A;  2GRM A;  4Y6C A;  3QAQ A;  1HS6 A;  4HI9 A;  3L9T A;  1IQU A;  3RRM B;  4CT4 A;  2V0P A;  5CHE E;  3APD A;  2P9S G;  2PQN A;  5ENO D;  3RO3 A;  4JXT A;  4GTO A;  3ZVV A;  3Q47 B;  5BNW A;  5FQ4 A;  3HRA A;  3UM1 A;  4TXQ A;  4URK A;  3DEP A;  2AXV A;  3E32 A;  4A1S A;  3QWW A;  2VTB B;  4KXK B;  3MCX A;  4DX6 D;  3ZNG A;  4F7A A;  2NSZ A;  3SD5 A;  3S7J A;  5A23 A;  1E90 A;  2HYZ A;  2J09 A;  2P9K G;  5LP0 A;  3EU5 A;  4OVU A;  4KZC A;  3CVY A;  2HR2 A;  4JA7 A;  1TJC A;  2AVP A;  3HDX A;  3HVE A;  3D9K A;  4TRQ A;  4YDY A;  4XI9 A;  4BY6 A;  1XGW A;  3ULE G;  4A1G A;  3V31 A;  1ZB1 A;  1Z6T A;  4AV7 A;  4AY6 A;  3ASO E;  1FVH A;  4AP2 A;  1TNO A;  4M3O A;  2DZO A;  2QZA A;  3C72 A;  1KZO A;  4PS3 A;  3FTS A;  2X6F A;  4A55 A;  3UT8 A;  4WNF A;  3DXM G;  4L9P A;  3CVW A;  1EDU A;  4GCO A;  2OEW A;  4G2V A;  3B7S A;  3PDN A;  2FI7 A;  3UTM A;  2OND A;  5CMY A;  1B89 A;  4TXR A;  1HF8 A;  4JPS A;  2L9B A;  1MHQ A;  4GAA A;  3FWV A;  3AG2 E;  1JWG A;  3B7R L;  3SO8 A;  5KCM A;  2P2C P;  4J8E A;  4UI9 C;  3JQ0 A;  3S7B A;  4DLO A;  5D66 A;  4LG6 A;  3ZGQ A;  5H7P A;  2BKK B;  5T3R A;  5BV0 A;  3WXX A;  2P58 C;  3ZFW A;  1OCR E;  1N4P A;  5AAR A;  3FUK A;  4HOS A;  2XEH A;  2JLB A;  4XKC A;  4GTP A;  3PZ3 A;  4BSZ B;  3O4Z A;  3E37 A;  3EHM A;  5FQ6 A;  5AQ7 A;  3UM3 A;  5AQ9 A;  3CEQ A;  4F1P A;  4U8H A;  4WNE A;  3FU5 A;  1OWM A;  2QYJ A;  1OXJ A;  4H7X A;  2AW6 A;  3P1U A;  3TXN A;  1E96 B;  3JYS A;  3D9J A;  3ML8 A;  4ZFH A;  4F6R D;  3W9G A;  2MRI A;  2P9U G;  4WAF A;  3C98 A;  5T8I A;  1INZ A;  3CQG B;  4J8F A;  3QOU A;  3UKU G;  4UUC A;  2X6I A;  3TWS A;  3QAR A;  1LD8 A;  1IHB A;  2WXR A;  5HS0 A;  3CHO A;  1SA5 A;  4FHJ A;  3PRZ A;  4U7E B;  4MLP A;  5J08 A;  5ANR A;  2VGX A;  5CRU A;  1H6O A;  4YDW A;  4AXH A;  3BG0 B;  3MX3 A;  3CVP A;  3CHM A;  1HG2 A;  5G55 A;  2DYR E;  2IO3 C;  3B13 A;  3ZU7 B;  4EZL A;  3C3O A;  4N3C A;  3AG4 E;  3FUH A;  1JUQ A;  2DZN A;  3AAA C;  2J49 A;  3HXD A;  2QFC A;  1LTX A;  3D9N A;  3C3Q A;  4OYS A;  3DXK G;  1SA4 A;  5KJN A;  3PNL B;  3JUE A;  3QWV A;  2WXN A;  3PS6 A;  4FHK A;  4B93 B;  3HG0 D;  3ABM E;  1JWF A;  3EHQ A;  3Q73 A;  2Q7F A;  4IUL A;  1S64 A;  3QJZ A;  2X6J A;  2EIK E;  4YDO A;  2ZGD A;  3DSW A;  1PAQ A;  1YA0 A;  3IV0 A;  1TNU A;  2CHW A;  2AXU A;  5G04 J;  3PE4 A;  5IY5 E;  2LAI A;  4ATZ D;  1YMP A;  4EBA G;  5CEA A;  2C0L A;  4GA1 A;  2B0O E;  1OUV A;  2E2E A;  1N4R A;  3MGB A;  4CEM A;  3T5V A;  1QBQ A;  2XZD G;  2C2L A;  4UWG A;  4YND A;  2KZT A;  1TR4 A;  2ZU6 B;  4EZJ A;  5JHA A;  2LAH A;  3EHR A;  2YQ8 A;  4HNA D;  5ENQ D;  3ZIM A;  2WMN A;  4U04 A;  2J8S D;  3SFY A;  2MYO A;  4GYY A;  3WG7 E;  2V4H C;  2KXP C;  1H2V C;  4BER A;  4UQX A;  4U8Y D;  2WXJ A;  3PZ2 A;  2CG3 A;  3CST A;  4G11 A;  4K5A B;  1BD8 A;  3EUV A;  5M72 A;  1MX4 A;  3V2O A;  2VQ2 A;  1FCH A;  3C3R A;  3CVV A;  2WQH A;  4N3B A;  3T9K A;  1Q2Z A;  4APF A;  1TN7 A;  1U3C A;  1MYO A;  5FIO A;  4FJY A;  3CHR A;  3VLE A;  4BT8 A;  4LCT A;  3JXJ A;  3UKR G;  2LXL A;  3ZPJ A;  3CVU A;  3D3M A;  4U0U A;  1PC2 A;  2L6J A;  4UI9 J;  4CDM A;  2DYS E;  2WXQ A;  5JJ7 A;  4G8K A;  5LOZ A;  3KEZ A;  2FEZ A;  4GTV A;  3NAW A;  1H6K A;  2AJA A;  1E8W A;  4QQI A;  1N11 A;  4UWF A;  1E8Z A;  3OXF A;  3B7U X;  2PM6 A;  3UQ3 A;  2ILR A;  4HRN A;  1HU3 A;  3R7Q A;  3NZU A;  5AYW D;  3PUJ A;  4FAD A;  1UN9 A;  3AS5 A;  3V2X A;  3UIN C;  4JA9 A;  3MJW A;  1N94 A;  3QK0 A;  5ITZ F;  4GYO A;  5BUZ A;  4D10 C;  4AY5 A;  4DJA A;  4I9E A;  3G2S A;  2WXH A;  2XRZ A;  4K0R A;  4HRL A;  1H2U A;  2CHZ A;  4GTT A;  4U8V D;  2BF0 X;  4J6I A;  3D9P A;  5BXO A;  3BEE A;  5FWQ A;  2V4L A;  3AS4 A;  5FTP A;  5LX8 A;  1G3N B;  1RZ4 A;  3FU6 A;  4I17 A;  4HQD A;  3HXF A;  1UJK A;  2BED A;  1TNY A;  4L2Y A;  4GA2 A;  4EBA A;  2MHK A;  1HZ4 A;  4UWK A;  3SHF A;  4F3V A;  2XEV A;  3CVQ A;  3DWL G;  3G2V A;  1OCC E;  3ZW3 A;  4ANV A;  4BSX A;  3TGO A;  2VGE A;  1SVX A;  2AXZ A;  4OAU C;  1NP7 A;  3Q78 A;  4I1O B;  4HFG A;  1TJF A;  2RD0 A;  5B3S E;  4DI4 A;  3B7B A;  4WND A;  2CHX A;  3KD7 A;  4GYW A;  4KT6 B;  4H7Y A;  5EKQ D;  4NQ0 A;  3APF A;  3FU3 A;  4PUC A;  2XEE A;  4TXP A;  2R17 C;  4BWR A;  1Z3X A;  3CR3 A;  4GZC A;  3FTX A;  4CRW A;  4KBQ A;  4Q96 A;  5B1B E;  1IQR A;  1IXV A;  2RFA A;  5EDS A;  2ETC A;  2LSU A;  1YCS B;  3KSL A;  1WAO 1;  4J8D A;  3SI5 A;  2GRQ B;  3EDT B;  3E33 A;  1AWC B;  4I1A A;  3SFX A;  4LRZ A;  2FO7 A;  2GW1 A;  5ARG A;  5EX3 A;  2MOW A;  3ASH A;  2FUL A;  2RFM A;  4WNG A;  3S2A A;  1GW6 A;  3SY2 A;  3IKO B;  4CGW A;  3CIA A;  3Q79 A;  5FQ8 A;  3R9A B;  1UW4 B;  4XKB A;  2UY1 A;  4PS8 A;  1JCQ A;  3FY4 A;  4XIF A;  1ELR A;  3IHV A;  1JPL A;  2EIL E;  2RG8 A;  4RQI A;  2JAB A;  4Z68 A;  2EIM E;  4L23 A;  1O1T A;  2XEN A;  3I5P A;  2L6B A;  1H0A A;  4O6F A;  4AJW A;  3FUN A;  2OOE A;  2P9P G;  1DVP A;  1WY6 A;  2XCC A;  4NUR A;  3UI2 A;  5BPP A;  5CMW A;  1TN6 A;  1UOH A;  3BU8 A;  3GYZ A;  2ETB A;  4Q94 A;  1TNZ A;  4OVV A;  4UQZ A;  1D9S A;  2PNN A;  3CVX A;  2QY7 A;  3CK9 A;  4JVS A;  3DEO A;  3D9L A;  5AJL A;  5EID A;  4OAV B;  3BQO A;  4WWP A;  4U95 D;  3F6Q A;  5ANL A;  4HRM B;  4RVB A;  3ONK A;  2Y0B G;  1P5Q A;  4I1M A;  5ENN A;  2XRY A;  5D2M C;  4O1P A;  3EIJ A;  3ASD A;  3ZYQ A;  5FT9 A;  1BI7 B;  1E7V A;  2L0T B;  2IF4 A;  4DX2 A;  3PEU B;  3JQ1 A;  2EQX A;  5CED B;  4O1O A;  5ENS D;  2ION A;  3LXU X;  2XZT G;  4AOF A;  3MV2 B;  1SZ9 A;  4TUM A;  1QZ2 A;  3PZ1 A;  2VSN A;  3L82 A;  4ILH B;  4XZ4 A;  4FU3 A;  5A7D B;  2BKG A;  1KT1 A;  3DST A;  3ZUV B;  3SBS A;  2DWZ A;  2KC7 A;  4HLE A;  1H19 A;  5AN8 A;  2HE0 A; 
#chains in the Genus database with same CATH homology
 2XEN A;  5CEC B;  1MX6 A;  4NIK A;  4DUI A;  3B95 A;  2L6B A;  3B7B A;  4K5B A;  5EYL A;  4HB5 A;  4ATZ D;  2ETA A;  4UUC A;  4C48 B;  2DZO A;  1YMP A;  3TWS A;  3J5P A;  3AJI A;  5CEA A;  1IHB A;  5ENT D;  2V5Q C;  5HS0 A;  4DX7 D;  2B0O E;  1MJ0 A;  2XEE A;  3NOC D;  3UI2 A;  3UXG A;  4N5Q A;  4A63 B;  2FO1 E;  4HI9 A;  1N0R A;  4HRN A;  5ENR D;  5EN5 D;  3ZKJ A;  2DVW A;  1QYM A;  3UTM A;  2XZD G;  4K5C A;  1UOH A;  2QC9 A;  4LSZ E;  3NBN B;  1A5E A;  1NFI E;  2ETB A;  1TR4 A;  3C5R A;  1IXV A;  3V2X A;  2RFA A;  5KBA A;  3EHR A;  2ETC A;  1BLX B;  3Q9U C;  4HNA D;  4DX1 A;  5KNH D;  1D9S A;  1YCS B;  5JMN D;  1DC2 A;  2PNN A;  5ENQ D;  4YDW A;  2NYJ A;  5CBO A;  5ITZ F;  3JXI A;  2Y1L E;  5EYP F;  3DEO A;  2J8S D;  3TWR A;  4ZHB A;  4O60 A;  5CER B;  4U96 D;  3SO8 A;  2MYO A;  2V4H C;  5EID A;  2KXP C;  5ENO D;  3TWX A;  3V30 A;  2P2C P;  4OAV B;  1IKN D;  5FIN A;  4U95 D;  5BXU A;  1K1B A;  4BER A;  3F6Q A;  1AWC B;  1N0Q A;  4HRM B;  5EIB E;  3ZU7 B;  4U8Y D;  5D66 A;  2A5E A;  4LG6 A;  4GMR A;  5AQB A;  2Y0B G;  4HRL A;  4HLL A;  4K5A B;  1BD8 A;  4HBD A;  1SW6 A;  2BKK B;  4JB8 P;  4LNU D;  3D9H A;  1S70 B;  3HRA A;  3TWT A;  4DX5 D;  4O1P A;  1MX4 A;  3V2O A;  4U8V D;  4HI8 A;  3DEP A;  4G8L A;  4CYM D;  5BXO A;  1BI8 B;  5AAR A;  3TWU A;  5AAO A;  1K3Z D;  2F8X K;  2DZN A;  2XEH A;  1BI7 B;  5JA4 D;  3KEA A;  1YYH A;  3T9K A;  2KBX A;  4DX6 D;  2RFM A;  3AAA C;  4J7W A;  4BES A;  3ZNG A;  3IXE A;  4BSZ B;  4DX2 A;  1MYO A;  5FIO A;  5AQ7 A;  1OY3 D;  5CED B;  4O1O A;  3TWV A;  1G3N B;  5ENS D;  5AQ9 A;  2XZT G;  1MX2 A;  3JXJ A;  3V79 K;  4GPM A;  1K1A A;  4HQD A;  3JUE A;  5KWD A;  5CBN A;  3EU9 A;  4TUM A;  4F1P A;  4RLY A;  1OT8 A;  4B93 B;  1WDY A;  1WG0 A;  4BEP A;  2QYJ A;  3HG0 D;  3EHQ A;  2F37 A;  3T8K A;  1DCQ A;  3J5Q B;  5HKP A;  3LJN A;  4J8Y A;  1BU9 A;  2BKG A;  5ENP D;  3W9F A;  4DRX E;  2F8Y A;  3ZUV B;  4G8K A;  3TWQ A;  3NOG D;  2DWZ A;  5EIL A;  2VGE A;  2ZGD A;  4BET A;  1SVX A;  3Q9N C;  4OAU C;  2AJA A;  5HRY A;  4YDY A;  4QFV A;  4QQI A;  3TWW A;  2JAB A;  1AP7 A;  3V31 A;  2ZGG A;  5AN8 A;  4Z68 A;  4ZFH A;  5AQA A;  2HE0 A;  4CZ2 D;  3W9G A;  4F6R D;  1N11 A;  5KNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...