3TWTA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human mcl1 (chimeric peptide)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
156
structure length
156
Chain Sequence
NSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/peptide
molecule keywords Tankyrase-2
publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twtA00
3T9KA 4ZHBA 2ETCA 3HG0D 2V5QC 4O1OA 4F6RD 4JB8P 3Q9UC 1YYHA 2XZTG 2DZNA 2V4HC 1DCQA 1OY3D 5EYLA 3DEPA 1SW6A 2F8YA 1N0QA 4HI8A 4ZFHA 4GPMA 3V30A 5FIOA 2DWZA 4DRXE 5JA4D 3LJNA 5AN8A 4O60A 3B7BA 4DX5D 1BI7B 1K1AA 4K5CA 3F6QA 4NIKA 3NBNB 5HKPA 4BERA 4O1PA 3TWTA 5HRYA 1BLXB 2ZGDA 2F8XK 4TUMA 3TWXA 2HE0A 3TWQA 3UTMA 5D66A 5CECB 2AJAA 4B93B 1IKND 3UXGA 3Q9NC 1WDYA 5FINA 2KXPC 5ENRD 1D9SA 4G8KA 3D9HA 4U8YD 4HRLA 5EIDA 4BESA 5CERB 5EN5D 5ITZF 2PNNA 3EU9A 4OAVB 3W9FA 5EYPF 1MX4A 2XENA 4ATZD 3AAAC 3KEAA 4OAUC 4Z68A 3HRAA 1AP7A 4J8YA 1BU9A 4A63B 4HQDA 5ENQD 4U95D 5ENSD 5KNGA 4QQIA 4HI9A 3ZU7B 4F1PA 4GMRA 5AQ7A 5AQAA 3TWRA 5ENPD 3C5RA 1K1BA 2QYJA 4DX2A 4DX6D 5BXUA 1NFIE 1BD8A 2Y1LE 4YDYA 1DC2A 2XEEA 2B0OE 2Y0BG 4HRNA 4N5QA 1K3ZD 4HB5A 4UUCA 4HNAD 1SVXA 3JXJA 4C48B 4HRMB 5AARA 4YDWA 1YCSB 2RFMA 4CYMD 3J5QB 1A5EA 3AJIA 3V79K 1MJ0A 3EHQA 3EHRA 4LSZE 3TWVA 3ZNGA 1AWCB 2DVWA 1YMPA 2NYJA 2BKKB 5AQBA 3T8KA 1MX6A 2P2CP 1G3NB 4BETA 4DX7D 1WG0A 1BI8B 3JUEA 1S70B 4RLYA 5AQ9A 5JMND 3J5PA 4DX1A 1QYMA 5CEAA 4LNUD 4HBDA 2KBXA 4U96D 1N0RA 4K5AB 3SO8A 5CBOA 1IHBA 2J8SD 4K5BA 5CEDB 2ETAA 2RFAA 3NOGD 4QFVA 3W9GA 4BEPA 4CZ2D 2XEHA 5ENTD 2BKGA 2XZDG 4J7WA 3UI2A 3ZUVB 5KNHD 5KBAA 5CBNA 4HLLA 1TR4A 4LG6A 1N11A 1MYOA 2DZOA 3V31A 4BSZB 3DEOA 3V2XA 5HS0A 1UOHA 4DUIA 5KWDA 2ZGGA 3JXIA 5BXOA 2MYOA 3TWWA 3V2OA 1IXVA 4G8LA 2ETBA 3B95A 2VGEA 1OT8A 2A5EA 5EIBE 2FO1E 3TWUA 5ENOD 2JABA 3ZKJA 3IXEA 5AAOA 2QC9A 4U8VD 5EILA 3TWSA 2L6BA 2F37A 3NOCD 1MX2A
chains in the Genus database with same CATH superfamily
3FUJA 3O48A 3NF1A 5B3SE 1OY3D 3QWVA 5EYLA 4HI8A 3RO2A 5G04J 2IONA 3ML9A 3IBEA 3FU5A 3ZFWA 3ZIMA 3CKBA 5D66A 3UINC 1FVHA 2P9LG 4RSYA 2V4LA 2R03A 4Y6WA 4G23A 3FU3A 5EIDA 3UQ3A 3VTXA 5EN5D 3UM2A 5EYPF 2ONDA 2XPZA 4GB9A 4QQIA 1ELWA 1UN9A 4EBAG 3U9WA 5BXUA 4MLPA 2Y1LE 2B0OE 3SD5A 4HS2A 2LO6A 3PZDA 4DI4A 4GMJA 4FC8A 2HYZA 3FTWA 2KCKA 2NYJA 2BKKB 5AQBA 4ME2A 3S2AA 3JUEA 4UI9K 3ASNE 1SA4A 2ETAA 3G2VA 3R7QA 4HVBA 1SZ9A 1OWMA 4OVUA 3UIPC 3CSTA 2FI7A 4G8LA 5LX8A 3B95A 3DSUA 1E90A 1TN8A 2JABA 4J8FA 3NQPA 1OCCE 5AAOA 1FT1A 5CRVA 4I6GA 2L6BA 1HG2A 4EHMA 5LCWJ 4O1OA 4F6RD 5CCMA 4NRHB 4DLOA 4GYYA 1DCQA 4YNDA 3RRMB 4AVXA 1VDYA 2WXRA 2PQRA 3BUAA 2AXUA 2V0PA 3EUVA 3I3NA 4EZKA 3JQ1A 3EJNA 1V54E 4TUMA 5LCWC 2NC9A 4F3VA 5T8IA 1N52A 2M63A 3UUXA 3UT7A 4ILHB 4KVMA 2Q7FA 3HHMA 5ARFA 4AM9A 2VSYA 1HO8A 1BPOA 4WWOA 1WAO1 2VGYA 4UQYA 2XPYA 5D2MC 2IQCA 4WAFA 3TXMA 3FTSA 3KS2A 2VYIA 4CT0A 1MJ0A 2I6HA 2P2CP 4JXTA 4JEUA 2XHEA 5EX0A 4IRUA 4PS7A 2WXHA 3QB2A 3FUEA 4L2LA 5AYWD 2LXMA 3SNXA 4GTQA 3N71A 3U4TA 4HORA 3Q4AB 2EINE 3V31A 3E33A 4X8QA 2ZGGA 3DXMG 2VSNA 3C3QA 2DBAA 2A5EA 1X81A 3PH0C 5HQ8A 2P9SG 5EKQD 3FUFA 5ENOD 4KZCA 4F53A 4U8VD 4FP7A 4U0ZA 2RKKA 3HG0D 2PL2A 3SGHA 4N2QA 3HIZA 2BF0X 3UKRG 2VGXA 2X3MA 3DWLG 3HYMB 3QDNA 3OTNA 3C3OA 5G05J 3TWQA 3L13A 3UTMA 2C2LA 3MZLB 3UXGA 2KC7A 3LEWA 3FTVA 4BX9A 3PNLB 5HI7A 5CCLA 4WNFA 3K9IA 4IN3B 5JJTA 4U95D 3LY7A 5G05C 2YHEA 2V8SE 2QYJA 2AVPA 5FJYA 4HRMB 3SZ7A 5BUZA 2P9KG 3V79K 4ACKA 2ZXWE 1JCRA 3HXCA 3B7TA 1YMPA 4YVOA 4JD2G 4RLYA 3ISMC 3CLJA 4L7TA 1H0AA 4N3AA 1TNZA 1MQSA 3LYAA 5CBNA 2R05A 1IQUA 2WMNA 5KCMA 5LFAA 3FTXA 2RD0A 2DYSE 1O1RA 4U7EB 3FUNA 3SFZA 4KMOA 3ESKA 1JWFA 3QOUA 4I9EA 5DIZA 2Y4TA 1S64A 4GCOA 2R59A 3CVLA 2CFUA 5IY5E 1QNFA 4A3TA 2DYRE 5J90A 3CIAA 3NZUA 2E2EA 4NIKA 3NBNB 3UKUG 4FADA 3X2QE 1XNFA 2OOEA 4B0ZA 3IKOB 3CEQA 3ASDA 4WUYA 2LUHA 1HU3A 3DSXA 4NQ0A 4U8YD 2OEWA 4XI0A 4I6EA 4ATZD 4Z68A 4J8YA 5KJLA 4HQDA 5ENQD 2FEZA 3ZU7B 4YVQC 3C3RA 4TXRA 4DX6D 4GZ3A 1BD8A 4FULA 3UM1A 2Y0BG 4GTVA 1SVXA 2P9UG 3PDNA 3MEKA 1IYGA 4CYMD 2LXLA 3CVUA 1OWLA 2XGOA 3AG3E 4GTTA 1QYMA 1EYHA 1N0RA 5E76A 3RSEG 2WXLA 1H19A 3PS6A 2GW1A 3SBSA 4TXPA 3UI2A 2FO7A 4AIFA 4N5CA 2XS8A 3MV3B 2VJ8A 3U3WA 1IXVA 2XCBA 3ZHEB 4DPRA 3T8MA 3HVEB 3Q73A 4GMLA 5A7DB 1FT2A 4E6HA 4J6IA 3TWSA 1U2VG 4L2YA 3BG0B 2CG2A 4F1SA 2LAHA 1YYHA 4GYOA 3FUMA 3CGHA 4I1MA 5BPPA 4ILGA 4UWLA 4GTRA 3S7BA 3PUKA 2J9QA 1W3BA 4M3OA 4YDEA 4EQFA 3KSQA 3JUIA 1N4SA 4LNGA 3FEYA 4PUCA 2CFZA 3ASOE 2GRPB 3P1UA 4I2WA 3FDHA 4UWGA 5LOZA 3TXNA 5KNGA 1U3DA 4JA7A 5FZRA 3ASGA 2OCCE 4J8EA 4WNDA 3DBSA 1K1BA 2L0IA 3IEGA 2XQ0A 3BQOA 2NXPA 4HNAD 2RFMA 2WXPA 4AV7A 2J4DA 4FLBA 1YA0A 3E30A 4BETA 3Q78A 1WM5A 3CHRA 4ANWA 2F0YA 3ZRHA 2BEDA 3DSTA 5CBOA 3CHOA 3QK0A 2WQ7A 3CV0A 3U66A 3D9JA 5C1DA 3D9KA 1OCOE 3Q79A 3NB2A 3ML8A 2F37A 3NOCD 1JPLA 4A1SA 3Q9UC 2XZTG 1TJCA 2DZNA 3QJZA 4G25A 4GPMA 3V30A 3DXKG 3ZEFA 3ZGQA 3LPZA 5G55A 4DX5D 1K1AA 3FH5A 3CHQA 3RAUA 4O1PA 3MGBA 1BLXB 3DSVA 2X6JA 3AG1E 4LERA 1WDYA 2KXPC 2R17C 2IJGX 3FUHA 2X6HA 4JHKA 1O5MA 1H2UA 1H6KA 2CG3A 4F1PA 5ANRA 1QZ2A 3AU4A 3L82A 3C5RA 4HFGA 3G2SA 5G2NA 4HOTA 1DCEA 3HDXA 2WPVA 4GZDA 3RKVA 4JZYA 1TNUA 2DVWA 3LS8A 1G3NB 3AS4A 3EHNA 5G04C 1EDUA 1S70B 2WQHA 3S7FA 4CDNA 4BWRA 4K03A 1Z3XA 4MS6A 2KBXA 3PVLA 3FH8A 3W9GA 1TNYA 3PE4A 4AY6A 4J7WA 1FVFA 1O1SA 4GA2A 3R9AB 4AP2A 2AXVA 4KBQA 2FBNA 3UMVA 2VGEA 3ULEG 5BNWA 1ZB1A 1KT1A 2C0MA 5CHEE 3LKUA 2VTBA 1E8WA 4ILIA 3DEPA 4H7XA 4A55A 3ZN3A 1TN6A 3B7BA 1HX8A 4TUUA 4GYWA 1HFAA 2EIKE 2ZGDA 3AS8A 5D0OD 4GZ6A 3MKQB 1Z5SC 3CKCA 2NSZA 5ENRD 1KLXA 3HXBA 1ELKA 3ZYKA 4BESA 2WMOA 4C9BB 5KJKA 4A63B 5J08A 3OXGA 5FQ7A 4BT9A 1NFIE 3PZ3A 2BUGA 3TG5A 4L1BA 3E4BA 1FCHA 4UQZA 3Q75A 3FULA 5JMND 3WXXA 4GTMA 1IHBA 3BEEA 3MV2B 1TEZA 2QYUA 3LXUX 5HS0A 4MBGA 4ACLA 1TN7A 1HS6A 3CK9A 1N54A 4AY5A 4IULA 3ZKJA 3QARA 3PUJA 3TAXA 2QC9A 3CQCB 2OV8A 3DRAA 5JJ6A 2WXKA 1GW6A 1OXJA 1MHQA 1XGWA 2HM8A 2CHWA 2LAIA 2MHKA 3SY2A 3QWPA 4HOUA 3RRUA 5FIOA 3AG2E 3QAQA 3CSFA 2Y4UA 3FUIA 5HRYA 2VTBB 3TWXA 3ZW3A 1U3CA 3IHVA 2WB2A 3B13A 4YDOA 1INZA 1N9AA 1KZOA 3Q7AA 4CGWA 3KSLA 1ZBPA 3HRAA 4XZ4A 4LRZA 5ENSD 3R7RA 1D8EA 3PREA 4ATGA 2KZTB 4FHKA 4RQIA 1O1TA 2VQ2A 3ZPJA 4DJAA 4GA1A 2XEEA 3CHPA 3CHMA 2AWIA 2Y69E 1K3ZD 4WNGA 1S63A 5AARA 1A5EA 4FJYA 1SQMA 4I43A 1AWCB 4FJZA 3FTZA 1E8YA 3CK7A 4V3IA 3I4RB 1HF8A 3D9LA 2EIME 2I1KA 4CT4A 3T5XA 2GRMA 3TGOA 2IFUA 2GRQB 4EZJA 4DUIA 3SI5A 1QQEA 2YNQA 4LEUA 3R9MA 3FTYA 2VSOE 2EQXA 2XS1A 1LD8A 3ZHEA 4OVVA 2E0IA 3HVEA 2YINA 1UW4B 1PY1A 3L9TA 2JEKA 4URKA 4JC8A 2F8YA 2WXOA 2AXZA 4GAAA 3VLEA 3U64A 1BI7B 3B7SA 2DIWA 4LUNU 2L0TB 3SF4A 2J08A 4B8AA 5BT1A 2F8XK 2ZISA 4NACA 4WWNA 3Q9NC 3FY4A 4XIFA 1H6PA 2XRYA 4GZ5A 2KCLA 4RVBA 3ZYQA 2JLBA 1HZ4A 1KZPA 5AQ7A 4U0SA 2DCPA 3FP3A 3FEXA 3GZSA 3RO3A 4N5QA 4CRWA 2PQNA 2OVFA 3TG4A 4XKCA 3ZNGA 4UI9J 1MX6A 4WWPA 1JCSA 3ZXPA 3PEUB 4B8CB 3RRNB 3ASFA 2EILE 3FU0A 5ANLA 1EF1C 4LNBA 1E96B 1JCQA 4AJWA 2DZOA 2C0LA 3V2XA 4UI9C 5BXOA 2MYOA 3TWWA 1HXIA 5B1BE 1S0PA 2J09A 3CVWA 5EX3A 4GTSA 4XKBA 5C2YA 1A17A 4DK5A 1H2TC 2LSVA 1MX2A 4CDMA 4JB8P 4EBAA 3ONKA 3ENEA 1QBQA 4BTBA 2V4HC 2UY1B 3CR3A 1IHGA 5T4YA 4JA9A 3S7DA 3VLFA 5HKPA 4ANVA 3TWTA 2X6KA 1TYQG 4LCTA 4B93B 3HXFA 1OWPA 5FQ8A 4G24A 3HXDA 3G2WA 2XGMA 4WNEA 2XENA 3KEAA 3UM0A 4OAUC 3UPVA 3NAWA 1BU9A 3I5PA 4UWFA 1ELRA 4EECA 1Z3YA 3C72A 3EIQC 4UUCA 4I1AA 4XE0A 5FQ6A 3JXJA 2WXIA 3UT8A 3KEZA 2P9NG 4U04A 3RJVA 5AQ9A 3ASHA 1UJKA 5CEAA 4CGVA 2J07A 3SO8A 4G1TA 3PE3A 4BEPA 3NOGD 4L9PA 5KWDA 4JEHA 5B1AE 5KJMA 1IQRA 5FTPA 3Q15A 4JL0A 5EIBE 1TNBA 3IXEA 3ZYMA 1X5BA 3FUKA 3T9KA 5BW8C 2L6JA 2X6FA 3FFLA 3WG7E 3QNKA 2B6CA 5JHBA 2R2LA 4I17A 5JA4D 3QKYA 3ZYLA 2GROB 4CDRA 3SFXA 3TL5A 4UWHA 5CECB 1IKND 4EPZA 5AENA 3D9IA 4P29A 3MKQA 4TXQA 4AEZC 2YQ8A 1LF8A 5CERB 2Y3AA 3AAAC 2GRRB 1OWOA 2HO1A 5AJLA 3RK6A 3RIBA 4DX2A 4HB5A 4YDWA 2X38A 2H6HA 4E85A 4GZCA 1WG0A 1BI8B 2WQ6A 3PZ4A 4B89A 3E34A 2OVBA 4TV3A 4B94A 4K5BA 3G2TA 2BKGA 1NP7A 5KBAA 3CVPA 4LG6A 4XI9A 2V5FA 3JXIA 5BV1A 3V2OA 3G2UA 2WXMA 4JHJA 5JHAA 3T5VA 2H6FA 3PZ1A 4ZHBA 4KZ0A 2ILRA 4RG6A 5FT9A 3AU5A 3VTYA 3PEVB 4ABNA 3AG4E 1V55E 2WXFA 3L16A 3LJNA 3APFA 3BG1B 1E7UA 3ONLA 4HLEA 4H7YA 1HE8A 2AJAA 4APOA 1ZU2A 3D3MA 4HOQA 4G8KA 4JPSA 5D0QD 3EU9A 1MX4A 4G26A 4G11A 2GRLA 4AXHA 2KZTA 3UIOC 2HR2A 3NZSA 2CHXA 1YCSB 3APDA 4JVSA 1NI1A 3LY9A 2FF4A 4CCAA 4N3CA 4BY6A 4N39A 4R7LA 1Q2ZA 4W9RA 5FZQA 4LNUD 1TJFA 1OUVA 2J8SD 2RFAA 4KXKB 3LVRE 4CZ2D 1UJJA 1LTXA 2IY0C 4I6JA 4L23A 4BSXA 1NA0A 1E8XA 4I1OB 1TNOA 4HOSA 4HXIA 5ARGA 3CVVA 3TWUA 3ESLA 2P9PG 3MYVA 2ETCA 4UQXA 4GCNA 2V5QC 4MRUA 5CRUA 1SW6A 3BU8A 4PS8A 5DBKA 2XCCA 1N4QA 1N94A 5AN8A 2KATA 3F6QA 3FU6A 4BERA 3L22A 2HE0A 2EIJE 3MX3A 2QY7A 5FINA 4TRQA 2LNIA 1JUQA 2I1JA 3SHFA 4OAVB 2X6IA 2J49A 3TJPA 1AP7A 3ULYA 5LP0A 4AOFA 3CHSA 4JHRA 1JWGA 4EZLA 3VLDA 1UG3A 5CMWA 4I2ZA 1SZAA 3RU0A 5FZSA 2MOWA 4Y6CA 2RG8A 1OWNA 2XGSA 1NA3A 3L54A 2UWJG 4D10C 3UX4A 2IU1A 3EIJA 4GTOA 4DX7D 4JW1A 3HXEA 2QZAA 3J5PA 4DX1A 4U96D 4GA0A 4GU5A 2XEVA 3EU5A 4BX8A 4XEIG 1MYOA 1UOHA 3L08A 1K8KG 2ETBA 3AS5A 2WXNA 2P58C 1B89A 2KCVA 4J0UA 4FLHA 3O4ZA 3ABME 3W9FA 3FTUA 3L17A 3PRZA 4FA6A 3LDZA 1H6OA 2IOSA 3JQ0A 3APCA 3JYSA 4ZFHA 3QC1A 4U63A 2IF4A 1KT0A 4DRXE 3CVXA 2UY1A 2ZU6B 3CVQA 1Y6IA 2A5UA 4K5CA 4DLQA 1DNPA 4XX5A 4IYPA 4GPKA 3MJWA 2PNNA 3CVYA 4J8DA 4Q69A 3EHMA 4APFA 4NURA 3TWRA 2I9CA 2P9IG 2J4BA 1MZCA 1PAQA 4N3BA 5KJNA 3J5QB 3AJIA 4UWKA 3GZ2A 3IHYA 3EHRA 4LSZE 4PS3A 1PC2A 3T8KA 4MKTA 2GRNB 3D9PA 2ZIRA 4U0UA 4CEMA 2XPIA 4QFVA 3DPYA 3DPDA 1N4RA 2PM6A 5JJ7A 1HG5A 3FHEA 3FWVA 5FWQA 3MKRA 2R02A 3CQGB 3QWWA 1OCZE 3ABLE 3SQVA 5H7PA 4Q94A 4BFRA 2A4ZA 2IO2C 2WXQA 1Y8MA 5M72A 4KYOB 3URZA 3UM3A 3SBTB 4C0MA 2VGXB 2PM7A 1N0QA 3I4GA 2OEVA 1DVPA 2H6IA 4O60A 2XRZA 3B7UX 4U8HA 4A3VA 2WVIA 4KT6B 1FPPA 3MCXA 3Q5MA 3D9MA 5A23A 3D9HA 4PDXA 4F7AA 3LCAA 1UN8A 1D8DA 4HI9A 3LY8A 4J8SA 4GTPA 1Z6TA 4OYSA 5AQAA 5ENPD 4YDYA 2LSUA 1DC2A 2WXGA 1RW2A 3DSSA 3GW4A 4C48B 1EPUA 5FQ4A 4M7CA 3MA5A 4KVOA 3TWVA 3PZ2A 1OCRE 3CVNA 3EDTB 1KPSB 5AIJA 2CHZA 3Q7FA 1N4PA 4HBDA 3ZXSA 4N2SA 1N95A 5CEDB 3P2BA 2H6GA 5KNHD 1TR4A 3L6AA 3SFYA 5CMYA 3Q49B 3CK8A 1NZNA 3ULQA 1NL4A 2R5SA 4K0RA 2I2OA 2L9BA 2FO1E 3FH7A 5EDSA 1P5QA 3KAEA 3JCKC 4DI3A 1RZ4A 2IO3C 4I9CA 2WM9A 3GYZA 3Q47B 1L5JA 4BT8A 3OXFA 2DWZA 4O6FA 4FHJA 3FUDA 3E37A 4U07A 5ENNA 5T3RA 2FULA 4PH4B 5A6CA 4Q96A 2WXJA 3KD7A 5AJDA 1D9SA 4HRLA 2BTDA 2IEJA 5ITZF 3ZVVA 4ANXA 2MRIA 4GMRA 2YHCA 2IOLA 3B7RL 1H2VC 4FU3A 4HRNA 4C0EA 3LJ3A 3OXLA 2KM4A 3EHQA 2QFCA 3OAWA 1HH8A 1LD7A 4G2VA 2PZIA 2VSXE 3D9OA 3UT4A 3IV0A 3GZ1A 3D9NA 4K5AB 3ABKE 3LVQE 2XEHA 5ENTD 2XZDG 1E7VA 3ZUVB 3E32A 3PNTB 4HLLA 1N11A 5BV0A 4BSZB 1WY6A 2GGFA 3DEOA 3DSWA 3S7JA 1SA5A 4ANUA 1OT8A 4A1GA 3C98A 4BTAA 5E75A 4RG9A 2AW6A 5EILA 1E8ZA
chains in the Genus database with same CATH topology
3T9KA 4ZHBA 2ETCA 3HG0D 2V5QC 4O1OA 4F6RD 4JB8P 3Q9UC 1YYHA 2XZTG 2DZNA 2V4HC 1DCQA 1OY3D 5EYLA 3DEPA 1SW6A 2F8YA 1N0QA 4HI8A 4ZFHA 4GPMA 3V30A 5FIOA 2DWZA 4DRXE 5JA4D 3LJNA 5AN8A 4O60A 3B7BA 4DX5D 1BI7B 1K1AA 4K5CA 3F6QA 4NIKA 3NBNB 5HKPA 4BERA 4O1PA 3TWTA 5HRYA 1BLXB 2ZGDA 2F8XK 4TUMA 3TWXA 2HE0A 3TWQA 3UTMA 5D66A 5CECB 2AJAA 4B93B 1IKND 3UXGA 3Q9NC 1WDYA 5FINA 2KXPC 5ENRD 1D9SA 4G8KA 3D9HA 4U8YD 4HRLA 5EIDA 4BESA 5CERB 5EN5D 5ITZF 2PNNA 3EU9A 4OAVB 3W9FA 5EYPF 1MX4A 2XENA 4ATZD 3AAAC 3KEAA 4OAUC 4Z68A 3HRAA 1AP7A 4J8YA 1BU9A 4A63B 4HQDA 5ENQD 4U95D 5ENSD 5KNGA 4QQIA 4HI9A 3ZU7B 4F1PA 4GMRA 5AQ7A 5AQAA 3TWRA 5ENPD 3C5RA 1K1BA 2QYJA 4DX2A 4DX6D 5BXUA 1NFIE 1BD8A 2Y1LE 4YDYA 1DC2A 2XEEA 2B0OE 2Y0BG 4HRNA 4N5QA 1K3ZD 4HB5A 4UUCA 4HNAD 1SVXA 3JXJA 4C48B 4HRMB 5AARA 4YDWA 1YCSB 2RFMA 4CYMD 3J5QB 1A5EA 3AJIA 3V79K 1MJ0A 3EHQA 3EHRA 4LSZE 3TWVA 3ZNGA 1AWCB 2DVWA 1YMPA 2NYJA 2BKKB 5AQBA 3T8KA 1MX6A 2P2CP 1G3NB 4BETA 4DX7D 1WG0A 1BI8B 3JUEA 1S70B 4RLYA 5AQ9A 5JMND 3J5PA 4DX1A 1QYMA 5CEAA 4LNUD 4HBDA 2KBXA 4U96D 1N0RA 4K5AB 3SO8A 5CBOA 1IHBA 2J8SD 4K5BA 5CEDB 2ETAA 2RFAA 3NOGD 4QFVA 3W9GA 4BEPA 4CZ2D 2XEHA 5ENTD 2BKGA 2XZDG 4J7WA 3UI2A 3ZUVB 5KNHD 5KBAA 5CBNA 4HLLA 1TR4A 4LG6A 1N11A 1MYOA 2DZOA 3V31A 4BSZB 3DEOA 3V2XA 5HS0A 1UOHA 4DUIA 5KWDA 2ZGGA 3JXIA 5BXOA 2MYOA 3TWWA 3V2OA 1IXVA 4G8LA 2ETBA 3B95A 2VGEA 1OT8A 2A5EA 5EIBE 2FO1E 3TWUA 5ENOD 2JABA 3ZKJA 3IXEA 5AAOA 2QC9A 4U8VD 5EILA 3TWSA 2L6BA 2F37A 3NOCD 1MX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9K A;  4ZHB A;  2ETC A;  3HG0 D;  2V5Q C;  4O1O A;  4F6R D;  4JB8 P;  3Q9U C;  1YYH A;  2XZT G;  2DZN A;  2V4H C;  1DCQ A;  1OY3 D;  5EYL A;  3DEP A;  1SW6 A;  2F8Y A;  1N0Q A;  4HI8 A;  4ZFH A;  4GPM A;  3V30 A;  5FIO A;  2DWZ A;  4DRX E;  5JA4 D;  3LJN A;  5AN8 A;  4O60 A;  3B7B A;  4DX5 D;  1BI7 B;  1K1A A;  4K5C A;  3F6Q A;  4NIK A;  3NBN B;  5HKP A;  4BER A;  4O1P A;  3TWT A;  5HRY A;  1BLX B;  2ZGD A;  2F8X K;  4TUM A;  3TWX A;  2HE0 A;  3TWQ A;  3UTM A;  5D66 A;  5CEC B;  2AJA A;  4B93 B;  1IKN D;  3UXG A;  3Q9N C;  1WDY A;  5FIN A;  2KXP C;  5ENR D;  1D9S A;  4G8K A;  3D9H A;  4U8Y D;  4HRL A;  5EID A;  4BES A;  5CER B;  5EN5 D;  5ITZ F;  2PNN A;  3EU9 A;  4OAV B;  3W9F A;  5EYP F;  1MX4 A;  2XEN A;  4ATZ D;  3AAA C;  3KEA A;  4OAU C;  4Z68 A;  3HRA A;  1AP7 A;  4J8Y A;  1BU9 A;  4A63 B;  4HQD A;  5ENQ D;  4U95 D;  5ENS D;  5KNG A;  4QQI A;  4HI9 A;  3ZU7 B;  4F1P A;  4GMR A;  5AQ7 A;  5AQA A;  3TWR A;  5ENP D;  3C5R A;  1K1B A;  2QYJ A;  4DX2 A;  4DX6 D;  5BXU A;  1NFI E;  1BD8 A;  2Y1L E;  4YDY A;  1DC2 A;  2XEE A;  2B0O E;  2Y0B G;  4HRN A;  4N5Q A;  1K3Z D;  4HB5 A;  4UUC A;  4HNA D;  1SVX A;  3JXJ A;  4C48 B;  4HRM B;  5AAR A;  4YDW A;  1YCS B;  2RFM A;  4CYM D;  3J5Q B;  1A5E A;  3AJI A;  3V79 K;  1MJ0 A;  3EHQ A;  3EHR A;  4LSZ E;  3TWV A;  3ZNG A;  1AWC B;  2DVW A;  1YMP A;  2NYJ A;  2BKK B;  5AQB A;  3T8K A;  1MX6 A;  2P2C P;  1G3N B;  4BET A;  4DX7 D;  1WG0 A;  1BI8 B;  3JUE A;  1S70 B;  4RLY A;  5AQ9 A;  5JMN D;  3J5P A;  4DX1 A;  1QYM A;  5CEA A;  4LNU D;  4HBD A;  2KBX A;  4U96 D;  1N0R A;  4K5A B;  3SO8 A;  5CBO A;  1IHB A;  2J8S D;  4K5B A;  5CED B;  2ETA A;  2RFA A;  3NOG D;  4QFV A;  3W9G A;  4BEP A;  4CZ2 D;  2XEH A;  5ENT D;  2BKG A;  2XZD G;  4J7W A;  3UI2 A;  3ZUV B;  5KNH D;  5KBA A;  5CBN A;  4HLL A;  1TR4 A;  4LG6 A;  1N11 A;  1MYO A;  2DZO A;  3V31 A;  4BSZ B;  3DEO A;  3V2X A;  5HS0 A;  1UOH A;  4DUI A;  5KWD A;  2ZGG A;  3JXI A;  5BXO A;  2MYO A;  3TWW A;  3V2O A;  1IXV A;  4G8L A;  2ETB A;  3B95 A;  2VGE A;  1OT8 A;  2A5E A;  5EIB E;  2FO1 E;  3TWU A;  5ENO D;  2JAB A;  3ZKJ A;  3IXE A;  5AAO A;  2QC9 A;  4U8V D;  5EIL A;  3TWS A;  2L6B A;  2F37 A;  3NOC D;  1MX2 A; 
#chains in the Genus database with same CATH topology
 3FUJ A;  3O48 A;  3NF1 A;  5B3S E;  1OY3 D;  3QWV A;  5EYL A;  4HI8 A;  3RO2 A;  5G04 J;  2ION A;  3ML9 A;  3IBE A;  3FU5 A;  3ZFW A;  3ZIM A;  3CKB A;  5D66 A;  3UIN C;  1FVH A;  2P9L G;  4RSY A;  2V4L A;  2R03 A;  4Y6W A;  4G23 A;  3FU3 A;  5EID A;  3UQ3 A;  3VTX A;  5EN5 D;  3UM2 A;  5EYP F;  2OND A;  2XPZ A;  4GB9 A;  4QQI A;  1ELW A;  1UN9 A;  4EBA G;  3U9W A;  5BXU A;  4MLP A;  2Y1L E;  2B0O E;  3SD5 A;  4HS2 A;  2LO6 A;  3PZD A;  4DI4 A;  4GMJ A;  4FC8 A;  2HYZ A;  3FTW A;  2KCK A;  2NYJ A;  2BKK B;  5AQB A;  4ME2 A;  3S2A A;  3JUE A;  4UI9 K;  3ASN E;  1SA4 A;  2ETA A;  3G2V A;  3R7Q A;  4HVB A;  1SZ9 A;  1OWM A;  4OVU A;  3UIP C;  3CST A;  2FI7 A;  4G8L A;  5LX8 A;  3B95 A;  3DSU A;  1E90 A;  1TN8 A;  2JAB A;  4J8F A;  3NQP A;  1OCC E;  5AAO A;  1FT1 A;  5CRV A;  4I6G A;  2L6B A;  1HG2 A;  4EHM A;  5LCW J;  4O1O A;  4F6R D;  5CCM A;  4NRH B;  4DLO A;  4GYY A;  1DCQ A;  4YND A;  3RRM B;  4AVX A;  1VDY A;  2WXR A;  2PQR A;  3BUA A;  2AXU A;  2V0P A;  3EUV A;  3I3N A;  4EZK A;  3JQ1 A;  3EJN A;  1V54 E;  4TUM A;  5LCW C;  2NC9 A;  4F3V A;  5T8I A;  1N52 A;  2M63 A;  3UUX A;  3UT7 A;  4ILH B;  4KVM A;  2Q7F A;  3HHM A;  5ARF A;  4AM9 A;  2VSY A;  1HO8 A;  1BPO A;  4WWO A;  1WAO 1;  2VGY A;  4UQY A;  2XPY A;  5D2M C;  2IQC A;  4WAF A;  3TXM A;  3FTS A;  3KS2 A;  2VYI A;  4CT0 A;  1MJ0 A;  2I6H A;  2P2C P;  4JXT A;  4JEU A;  2XHE A;  5EX0 A;  4IRU A;  4PS7 A;  2WXH A;  3QB2 A;  3FUE A;  4L2L A;  5AYW D;  2LXM A;  3SNX A;  4GTQ A;  3N71 A;  3U4T A;  4HOR A;  3Q4A B;  2EIN E;  3V31 A;  3E33 A;  4X8Q A;  2ZGG A;  3DXM G;  2VSN A;  3C3Q A;  2DBA A;  2A5E A;  1X81 A;  3PH0 C;  5HQ8 A;  2P9S G;  5EKQ D;  3FUF A;  5ENO D;  4KZC A;  4F53 A;  4U8V D;  4FP7 A;  4U0Z A;  2RKK A;  3HG0 D;  2PL2 A;  3SGH A;  4N2Q A;  3HIZ A;  2BF0 X;  3UKR G;  2VGX A;  2X3M A;  3DWL G;  3HYM B;  3QDN A;  3OTN A;  3C3O A;  5G05 J;  3TWQ A;  3L13 A;  3UTM A;  2C2L A;  3MZL B;  3UXG A;  2KC7 A;  3LEW A;  3FTV A;  4BX9 A;  3PNL B;  5HI7 A;  5CCL A;  4WNF A;  3K9I A;  4IN3 B;  5JJT A;  4U95 D;  3LY7 A;  5G05 C;  2YHE A;  2V8S E;  2QYJ A;  2AVP A;  5FJY A;  4HRM B;  3SZ7 A;  5BUZ A;  2P9K G;  3V79 K;  4ACK A;  2ZXW E;  1JCR A;  3HXC A;  3B7T A;  1YMP A;  4YVO A;  4JD2 G;  4RLY A;  3ISM C;  3CLJ A;  4L7T A;  1H0A A;  4N3A A;  1TNZ A;  1MQS A;  3LYA A;  5CBN A;  2R05 A;  1IQU A;  2WMN A;  5KCM A;  5LFA A;  3FTX A;  2RD0 A;  2DYS E;  1O1R A;  4U7E B;  3FUN A;  3SFZ A;  4KMO A;  3ESK A;  1JWF A;  3QOU A;  4I9E A;  5DIZ A;  2Y4T A;  1S64 A;  4GCO A;  2R59 A;  3CVL A;  2CFU A;  5IY5 E;  1QNF A;  4A3T A;  2DYR E;  5J90 A;  3CIA A;  3NZU A;  2E2E A;  4NIK A;  3NBN B;  3UKU G;  4FAD A;  3X2Q E;  1XNF A;  2OOE A;  4B0Z A;  3IKO B;  3CEQ A;  3ASD A;  4WUY A;  2LUH A;  1HU3 A;  3DSX A;  4NQ0 A;  4U8Y D;  2OEW A;  4XI0 A;  4I6E A;  4ATZ D;  4Z68 A;  4J8Y A;  5KJL A;  4HQD A;  5ENQ D;  2FEZ A;  3ZU7 B;  4YVQ C;  3C3R A;  4TXR A;  4DX6 D;  4GZ3 A;  1BD8 A;  4FUL A;  3UM1 A;  2Y0B G;  4GTV A;  1SVX A;  2P9U G;  3PDN A;  3MEK A;  1IYG A;  4CYM D;  2LXL A;  3CVU A;  1OWL A;  2XGO A;  3AG3 E;  4GTT A;  1QYM A;  1EYH A;  1N0R A;  5E76 A;  3RSE G;  2WXL A;  1H19 A;  3PS6 A;  2GW1 A;  3SBS A;  4TXP A;  3UI2 A;  2FO7 A;  4AIF A;  4N5C A;  2XS8 A;  3MV3 B;  2VJ8 A;  3U3W A;  1IXV A;  2XCB A;  3ZHE B;  4DPR A;  3T8M A;  3HVE B;  3Q73 A;  4GML A;  5A7D B;  1FT2 A;  4E6H A;  4J6I A;  3TWS A;  1U2V G;  4L2Y A;  3BG0 B;  2CG2 A;  4F1S A;  2LAH A;  1YYH A;  4GYO A;  3FUM A;  3CGH A;  4I1M A;  5BPP A;  4ILG A;  4UWL A;  4GTR A;  3S7B A;  3PUK A;  2J9Q A;  1W3B A;  4M3O A;  4YDE A;  4EQF A;  3KSQ A;  3JUI A;  1N4S A;  4LNG A;  3FEY A;  4PUC A;  2CFZ A;  3ASO E;  2GRP B;  3P1U A;  4I2W A;  3FDH A;  4UWG A;  5LOZ A;  3TXN A;  5KNG A;  1U3D A;  4JA7 A;  5FZR A;  3ASG A;  2OCC E;  4J8E A;  4WND A;  3DBS A;  1K1B A;  2L0I A;  3IEG A;  2XQ0 A;  3BQO A;  2NXP A;  4HNA D;  2RFM A;  2WXP A;  4AV7 A;  2J4D A;  4FLB A;  1YA0 A;  3E30 A;  4BET A;  3Q78 A;  1WM5 A;  3CHR A;  4ANW A;  2F0Y A;  3ZRH A;  2BED A;  3DST A;  5CBO A;  3CHO A;  3QK0 A;  2WQ7 A;  3CV0 A;  3U66 A;  3D9J A;  5C1D A;  3D9K A;  1OCO E;  3Q79 A;  3NB2 A;  3ML8 A;  2F37 A;  3NOC D;  1JPL A;  4A1S A;  3Q9U C;  2XZT G;  1TJC A;  2DZN A;  3QJZ A;  4G25 A;  4GPM A;  3V30 A;  3DXK G;  3ZEF A;  3ZGQ A;  3LPZ A;  5G55 A;  4DX5 D;  1K1A A;  3FH5 A;  3CHQ A;  3RAU A;  4O1P A;  3MGB A;  1BLX B;  3DSV A;  2X6J A;  3AG1 E;  4LER A;  1WDY A;  2KXP C;  2R17 C;  2IJG X;  3FUH A;  2X6H A;  4JHK A;  1O5M A;  1H2U A;  1H6K A;  2CG3 A;  4F1P A;  5ANR A;  1QZ2 A;  3AU4 A;  3L82 A;  3C5R A;  4HFG A;  3G2S A;  5G2N A;  4HOT A;  1DCE A;  3HDX A;  2WPV A;  4GZD A;  3RKV A;  4JZY A;  1TNU A;  2DVW A;  3LS8 A;  1G3N B;  3AS4 A;  3EHN A;  5G04 C;  1EDU A;  1S70 B;  2WQH A;  3S7F A;  4CDN A;  4BWR A;  4K03 A;  1Z3X A;  4MS6 A;  2KBX A;  3PVL A;  3FH8 A;  3W9G A;  1TNY A;  3PE4 A;  4AY6 A;  4J7W A;  1FVF A;  1O1S A;  4GA2 A;  3R9A B;  4AP2 A;  2AXV A;  4KBQ A;  2FBN A;  3UMV A;  2VGE A;  3ULE G;  5BNW A;  1ZB1 A;  1KT1 A;  2C0M A;  5CHE E;  3LKU A;  2VTB A;  1E8W A;  4ILI A;  3DEP A;  4H7X A;  4A55 A;  3ZN3 A;  1TN6 A;  3B7B A;  1HX8 A;  4TUU A;  4GYW A;  1HFA A;  2EIK E;  2ZGD A;  3AS8 A;  5D0O D;  4GZ6 A;  3MKQ B;  1Z5S C;  3CKC A;  2NSZ A;  5ENR D;  1KLX A;  3HXB A;  1ELK A;  3ZYK A;  4BES A;  2WMO A;  4C9B B;  5KJK A;  4A63 B;  5J08 A;  3OXG A;  5FQ7 A;  4BT9 A;  1NFI E;  3PZ3 A;  2BUG A;  3TG5 A;  4L1B A;  3E4B A;  1FCH A;  4UQZ A;  3Q75 A;  3FUL A;  5JMN D;  3WXX A;  4GTM A;  1IHB A;  3BEE A;  3MV2 B;  1TEZ A;  2QYU A;  3LXU X;  5HS0 A;  4MBG A;  4ACL A;  1TN7 A;  1HS6 A;  3CK9 A;  1N54 A;  4AY5 A;  4IUL A;  3ZKJ A;  3QAR A;  3PUJ A;  3TAX A;  2QC9 A;  3CQC B;  2OV8 A;  3DRA A;  5JJ6 A;  2WXK A;  1GW6 A;  1OXJ A;  1MHQ A;  1XGW A;  2HM8 A;  2CHW A;  2LAI A;  2MHK A;  3SY2 A;  3QWP A;  4HOU A;  3RRU A;  5FIO A;  3AG2 E;  3QAQ A;  3CSF A;  2Y4U A;  3FUI A;  5HRY A;  2VTB B;  3TWX A;  3ZW3 A;  1U3C A;  3IHV A;  2WB2 A;  3B13 A;  4YDO A;  1INZ A;  1N9A A;  1KZO A;  3Q7A A;  4CGW A;  3KSL A;  1ZBP A;  3HRA A;  4XZ4 A;  4LRZ A;  5ENS D;  3R7R A;  1D8E A;  3PRE A;  4ATG A;  2KZT B;  4FHK A;  4RQI A;  1O1T A;  2VQ2 A;  3ZPJ A;  4DJA A;  4GA1 A;  2XEE A;  3CHP A;  3CHM A;  2AWI A;  2Y69 E;  1K3Z D;  4WNG A;  1S63 A;  5AAR A;  1A5E A;  4FJY A;  1SQM A;  4I43 A;  1AWC B;  4FJZ A;  3FTZ A;  1E8Y A;  3CK7 A;  4V3I A;  3I4R B;  1HF8 A;  3D9L A;  2EIM E;  2I1K A;  4CT4 A;  3T5X A;  2GRM A;  3TGO A;  2IFU A;  2GRQ B;  4EZJ A;  4DUI A;  3SI5 A;  1QQE A;  2YNQ A;  4LEU A;  3R9M A;  3FTY A;  2VSO E;  2EQX A;  2XS1 A;  1LD8 A;  3ZHE A;  4OVV A;  2E0I A;  3HVE A;  2YIN A;  1UW4 B;  1PY1 A;  3L9T A;  2JEK A;  4URK A;  4JC8 A;  2F8Y A;  2WXO A;  2AXZ A;  4GAA A;  3VLE A;  3U64 A;  1BI7 B;  3B7S A;  2DIW A;  4LUN U;  2L0T B;  3SF4 A;  2J08 A;  4B8A A;  5BT1 A;  2F8X K;  2ZIS A;  4NAC A;  4WWN A;  3Q9N C;  3FY4 A;  4XIF A;  1H6P A;  2XRY A;  4GZ5 A;  2KCL A;  4RVB A;  3ZYQ A;  2JLB A;  1HZ4 A;  1KZP A;  5AQ7 A;  4U0S A;  2DCP A;  3FP3 A;  3FEX A;  3GZS A;  3RO3 A;  4N5Q A;  4CRW A;  2PQN A;  2OVF A;  3TG4 A;  4XKC A;  3ZNG A;  4UI9 J;  1MX6 A;  4WWP A;  1JCS A;  3ZXP A;  3PEU B;  4B8C B;  3RRN B;  3ASF A;  2EIL E;  3FU0 A;  5ANL A;  1EF1 C;  4LNB A;  1E96 B;  1JCQ A;  4AJW A;  2DZO A;  2C0L A;  3V2X A;  4UI9 C;  5BXO A;  2MYO A;  3TWW A;  1HXI A;  5B1B E;  1S0P A;  2J09 A;  3CVW A;  5EX3 A;  4GTS A;  4XKB A;  5C2Y A;  1A17 A;  4DK5 A;  1H2T C;  2LSV A;  1MX2 A;  4CDM A;  4JB8 P;  4EBA A;  3ONK A;  3ENE A;  1QBQ A;  4BTB A;  2V4H C;  2UY1 B;  3CR3 A;  1IHG A;  5T4Y A;  4JA9 A;  3S7D A;  3VLF A;  5HKP A;  4ANV A;  3TWT A;  2X6K A;  1TYQ G;  4LCT A;  4B93 B;  3HXF A;  1OWP A;  5FQ8 A;  4G24 A;  3HXD A;  3G2W A;  2XGM A;  4WNE A;  2XEN A;  3KEA A;  3UM0 A;  4OAU C;  3UPV A;  3NAW A;  1BU9 A;  3I5P A;  4UWF A;  1ELR A;  4EEC A;  1Z3Y A;  3C72 A;  3EIQ C;  4UUC A;  4I1A A;  4XE0 A;  5FQ6 A;  3JXJ A;  2WXI A;  3UT8 A;  3KEZ A;  2P9N G;  4U04 A;  3RJV A;  5AQ9 A;  3ASH A;  1UJK A;  5CEA A;  4CGV A;  2J07 A;  3SO8 A;  4G1T A;  3PE3 A;  4BEP A;  3NOG D;  4L9P A;  5KWD A;  4JEH A;  5B1A E;  5KJM A;  1IQR A;  5FTP A;  3Q15 A;  4JL0 A;  5EIB E;  1TNB A;  3IXE A;  3ZYM A;  1X5B A;  3FUK A;  3T9K A;  5BW8 C;  2L6J A;  2X6F A;  3FFL A;  3WG7 E;  3QNK A;  2B6C A;  5JHB A;  2R2L A;  4I17 A;  5JA4 D;  3QKY A;  3ZYL A;  2GRO B;  4CDR A;  3SFX A;  3TL5 A;  4UWH A;  5CEC B;  1IKN D;  4EPZ A;  5AEN A;  3D9I A;  4P29 A;  3MKQ A;  4TXQ A;  4AEZ C;  2YQ8 A;  1LF8 A;  5CER B;  2Y3A A;  3AAA C;  2GRR B;  1OWO A;  2HO1 A;  5AJL A;  3RK6 A;  3RIB A;  4DX2 A;  4HB5 A;  4YDW A;  2X38 A;  2H6H A;  4E85 A;  4GZC A;  1WG0 A;  1BI8 B;  2WQ6 A;  3PZ4 A;  4B89 A;  3E34 A;  2OVB A;  4TV3 A;  4B94 A;  4K5B A;  3G2T A;  2BKG A;  1NP7 A;  5KBA A;  3CVP A;  4LG6 A;  4XI9 A;  2V5F A;  3JXI A;  5BV1 A;  3V2O A;  3G2U A;  2WXM A;  4JHJ A;  5JHA A;  3T5V A;  2H6F A;  3PZ1 A;  4ZHB A;  4KZ0 A;  2ILR A;  4RG6 A;  5FT9 A;  3AU5 A;  3VTY A;  3PEV B;  4ABN A;  3AG4 E;  1V55 E;  2WXF A;  3L16 A;  3LJN A;  3APF A;  3BG1 B;  1E7U A;  3ONL A;  4HLE A;  4H7Y A;  1HE8 A;  2AJA A;  4APO A;  1ZU2 A;  3D3M A;  4HOQ A;  4G8K A;  4JPS A;  5D0Q D;  3EU9 A;  1MX4 A;  4G26 A;  4G11 A;  2GRL A;  4AXH A;  2KZT A;  3UIO C;  2HR2 A;  3NZS A;  2CHX A;  1YCS B;  3APD A;  4JVS A;  1NI1 A;  3LY9 A;  2FF4 A;  4CCA A;  4N3C A;  4BY6 A;  4N39 A;  4R7L A;  1Q2Z A;  4W9R A;  5FZQ A;  4LNU D;  1TJF A;  1OUV A;  2J8S D;  2RFA A;  4KXK B;  3LVR E;  4CZ2 D;  1UJJ A;  1LTX A;  2IY0 C;  4I6J A;  4L23 A;  4BSX A;  1NA0 A;  1E8X A;  4I1O B;  1TNO A;  4HOS A;  4HXI A;  5ARG A;  3CVV A;  3TWU A;  3ESL A;  2P9P G;  3MYV A;  2ETC A;  4UQX A;  4GCN A;  2V5Q C;  4MRU A;  5CRU A;  1SW6 A;  3BU8 A;  4PS8 A;  5DBK A;  2XCC A;  1N4Q A;  1N94 A;  5AN8 A;  2KAT A;  3F6Q A;  3FU6 A;  4BER A;  3L22 A;  2HE0 A;  2EIJ E;  3MX3 A;  2QY7 A;  5FIN A;  4TRQ A;  2LNI A;  1JUQ A;  2I1J A;  3SHF A;  4OAV B;  2X6I A;  2J49 A;  3TJP A;  1AP7 A;  3ULY A;  5LP0 A;  4AOF A;  3CHS A;  4JHR A;  1JWG A;  4EZL A;  3VLD A;  1UG3 A;  5CMW A;  4I2Z A;  1SZA A;  3RU0 A;  5FZS A;  2MOW A;  4Y6C A;  2RG8 A;  1OWN A;  2XGS A;  1NA3 A;  3L54 A;  2UWJ G;  4D10 C;  3UX4 A;  2IU1 A;  3EIJ A;  4GTO A;  4DX7 D;  4JW1 A;  3HXE A;  2QZA A;  3J5P A;  4DX1 A;  4U96 D;  4GA0 A;  4GU5 A;  2XEV A;  3EU5 A;  4BX8 A;  4XEI G;  1MYO A;  1UOH A;  3L08 A;  1K8K G;  2ETB A;  3AS5 A;  2WXN A;  2P58 C;  1B89 A;  2KCV A;  4J0U A;  4FLH A;  3O4Z A;  3ABM E;  3W9F A;  3FTU A;  3L17 A;  3PRZ A;  4FA6 A;  3LDZ A;  1H6O A;  2IOS A;  3JQ0 A;  3APC A;  3JYS A;  4ZFH A;  3QC1 A;  4U63 A;  2IF4 A;  1KT0 A;  4DRX E;  3CVX A;  2UY1 A;  2ZU6 B;  3CVQ A;  1Y6I A;  2A5U A;  4K5C A;  4DLQ A;  1DNP A;  4XX5 A;  4IYP A;  4GPK A;  3MJW A;  2PNN A;  3CVY A;  4J8D A;  4Q69 A;  3EHM A;  4APF A;  4NUR A;  3TWR A;  2I9C A;  2P9I G;  2J4B A;  1MZC A;  1PAQ A;  4N3B A;  5KJN A;  3J5Q B;  3AJI A;  4UWK A;  3GZ2 A;  3IHY A;  3EHR A;  4LSZ E;  4PS3 A;  1PC2 A;  3T8K A;  4MKT A;  2GRN B;  3D9P A;  2ZIR A;  4U0U A;  4CEM A;  2XPI A;  4QFV A;  3DPY A;  3DPD A;  1N4R A;  2PM6 A;  5JJ7 A;  1HG5 A;  3FHE A;  3FWV A;  5FWQ A;  3MKR A;  2R02 A;  3CQG B;  3QWW A;  1OCZ E;  3ABL E;  3SQV A;  5H7P A;  4Q94 A;  4BFR A;  2A4Z A;  2IO2 C;  2WXQ A;  1Y8M A;  5M72 A;  4KYO B;  3URZ A;  3UM3 A;  3SBT B;  4C0M A;  2VGX B;  2PM7 A;  1N0Q A;  3I4G A;  2OEV A;  1DVP A;  2H6I A;  4O60 A;  2XRZ A;  3B7U X;  4U8H A;  4A3V A;  2WVI A;  4KT6 B;  1FPP A;  3MCX A;  3Q5M A;  3D9M A;  5A23 A;  3D9H A;  4PDX A;  4F7A A;  3LCA A;  1UN8 A;  1D8D A;  4HI9 A;  3LY8 A;  4J8S A;  4GTP A;  1Z6T A;  4OYS A;  5AQA A;  5ENP D;  4YDY A;  2LSU A;  1DC2 A;  2WXG A;  1RW2 A;  3DSS A;  3GW4 A;  4C48 B;  1EPU A;  5FQ4 A;  4M7C A;  3MA5 A;  4KVO A;  3TWV A;  3PZ2 A;  1OCR E;  3CVN A;  3EDT B;  1KPS B;  5AIJ A;  2CHZ A;  3Q7F A;  1N4P A;  4HBD A;  3ZXS A;  4N2S A;  1N95 A;  5CED B;  3P2B A;  2H6G A;  5KNH D;  1TR4 A;  3L6A A;  3SFY A;  5CMY A;  3Q49 B;  3CK8 A;  1NZN A;  3ULQ A;  1NL4 A;  2R5S A;  4K0R A;  2I2O A;  2L9B A;  2FO1 E;  3FH7 A;  5EDS A;  1P5Q A;  3KAE A;  3JCK C;  4DI3 A;  1RZ4 A;  2IO3 C;  4I9C A;  2WM9 A;  3GYZ A;  3Q47 B;  1L5J A;  4BT8 A;  3OXF A;  2DWZ A;  4O6F A;  4FHJ A;  3FUD A;  3E37 A;  4U07 A;  5ENN A;  5T3R A;  2FUL A;  4PH4 B;  5A6C A;  4Q96 A;  2WXJ A;  3KD7 A;  5AJD A;  1D9S A;  4HRL A;  2BTD A;  2IEJ A;  5ITZ F;  3ZVV A;  4ANX A;  2MRI A;  4GMR A;  2YHC A;  2IOL A;  3B7R L;  1H2V C;  4FU3 A;  4HRN A;  4C0E A;  3LJ3 A;  3OXL A;  2KM4 A;  3EHQ A;  2QFC A;  3OAW A;  1HH8 A;  1LD7 A;  4G2V A;  2PZI A;  2VSX E;  3D9O A;  3UT4 A;  3IV0 A;  3GZ1 A;  3D9N A;  4K5A B;  3ABK E;  3LVQ E;  2XEH A;  5ENT D;  2XZD G;  1E7V A;  3ZUV B;  3E32 A;  3PNT B;  4HLL A;  1N11 A;  5BV0 A;  4BSZ B;  1WY6 A;  2GGF A;  3DEO A;  3DSW A;  3S7J A;  1SA5 A;  4ANU A;  1OT8 A;  4A1G A;  3C98 A;  4BTA A;  5E75 A;  4RG9 A;  2AW6 A;  5EIL A;  1E8Z A; 
#chains in the Genus database with same CATH homology
 3T9K A;  4ZHB A;  2ETC A;  3HG0 D;  2V5Q C;  4O1O A;  4F6R D;  4JB8 P;  3Q9U C;  1YYH A;  2XZT G;  2DZN A;  2V4H C;  1DCQ A;  1OY3 D;  5EYL A;  3DEP A;  1SW6 A;  2F8Y A;  1N0Q A;  4HI8 A;  4ZFH A;  4GPM A;  3V30 A;  5FIO A;  2DWZ A;  4DRX E;  5JA4 D;  3LJN A;  5AN8 A;  4O60 A;  3B7B A;  4DX5 D;  1BI7 B;  1K1A A;  4K5C A;  3F6Q A;  4NIK A;  3NBN B;  5HKP A;  4BER A;  4O1P A;  3TWT A;  5HRY A;  1BLX B;  2ZGD A;  2F8X K;  4TUM A;  3TWX A;  2HE0 A;  3TWQ A;  3UTM A;  5D66 A;  5CEC B;  2AJA A;  4B93 B;  1IKN D;  3UXG A;  3Q9N C;  1WDY A;  5FIN A;  2KXP C;  5ENR D;  1D9S A;  4G8K A;  3D9H A;  4U8Y D;  4HRL A;  5EID A;  4BES A;  5CER B;  5EN5 D;  5ITZ F;  2PNN A;  3EU9 A;  4OAV B;  3W9F A;  5EYP F;  1MX4 A;  2XEN A;  4ATZ D;  3AAA C;  3KEA A;  4OAU C;  4Z68 A;  3HRA A;  1AP7 A;  4J8Y A;  1BU9 A;  4A63 B;  4HQD A;  5ENQ D;  4U95 D;  5ENS D;  5KNG A;  4QQI A;  4HI9 A;  3ZU7 B;  4F1P A;  4GMR A;  5AQ7 A;  5AQA A;  3TWR A;  5ENP D;  3C5R A;  1K1B A;  2QYJ A;  4DX2 A;  4DX6 D;  5BXU A;  1NFI E;  1BD8 A;  2Y1L E;  4YDY A;  1DC2 A;  2XEE A;  2B0O E;  2Y0B G;  4HRN A;  4N5Q A;  1K3Z D;  4HB5 A;  4UUC A;  4HNA D;  1SVX A;  3JXJ A;  4C48 B;  4HRM B;  5AAR A;  4YDW A;  1YCS B;  2RFM A;  4CYM D;  3J5Q B;  1A5E A;  3AJI A;  3V79 K;  1MJ0 A;  3EHQ A;  3EHR A;  4LSZ E;  3TWV A;  3ZNG A;  1AWC B;  2DVW A;  1YMP A;  2NYJ A;  2BKK B;  5AQB A;  3T8K A;  1MX6 A;  2P2C P;  1G3N B;  4BET A;  4DX7 D;  1WG0 A;  1BI8 B;  3JUE A;  1S70 B;  4RLY A;  5AQ9 A;  5JMN D;  3J5P A;  4DX1 A;  1QYM A;  5CEA A;  4LNU D;  4HBD A;  2KBX A;  4U96 D;  1N0R A;  4K5A B;  3SO8 A;  5CBO A;  1IHB A;  2J8S D;  4K5B A;  5CED B;  2ETA A;  2RFA A;  3NOG D;  4QFV A;  3W9G A;  4BEP A;  4CZ2 D;  2XEH A;  5ENT D;  2BKG A;  2XZD G;  4J7W A;  3UI2 A;  3ZUV B;  5KNH D;  5KBA A;  5CBN A;  4HLL A;  1TR4 A;  4LG6 A;  1N11 A;  1MYO A;  2DZO A;  3V31 A;  4BSZ B;  3DEO A;  3V2X A;  5HS0 A;  1UOH A;  4DUI A;  5KWD A;  2ZGG A;  3JXI A;  5BXO A;  2MYO A;  3TWW A;  3V2O A;  1IXV A;  4G8L A;  2ETB A;  3B95 A;  2VGE A;  1OT8 A;  2A5E A;  5EIB E;  2FO1 E;  3TWU A;  5ENO D;  2JAB A;  3ZKJ A;  3IXE A;  5AAO A;  2QC9 A;  4U8V D;  5EIL A;  3TWS A;  2L6B A;  2F37 A;  3NOC D;  1MX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...