3TWTA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human mcl1 (chimeric peptide)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
156
structure length
156
Chain Sequence
NSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 47
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twtA00
1BLXB 4HI8A 3J5QB 4O1PA 3B7BA 4BESA 4DUIA 2V5QC 5HS0A 1N0RA 1AP7A 2RFMA 3V79K 1SW6A 4DX2A 3C5RA 1N0QA 5ENQD 3V30A 2ETCA 5EN5D 5KNHD 3T8KA 4HRMB 4U8VD 1IKND 2ETBA 1MYOA 4RLYA 5BXOA 3V31A 3EHRA 4HRNA 4DX1A 3JUEA 4HB5A 5KBAA 5KNGA 1OT8A 2BKGA 4HQDA 4HNAD 5ENRD 1NFIE 1BI8B 2KBXA 2L6BA 4CZ2D 2ZGDA 1A5EA 1BI7B 1WDYA 5AARA 3UTMA 1IHBA 2MYOA 2VGEA 3Q9UC 3UI2A 2J8SD 1YYHA 3NOCD 4LNUD 4O60A 4UUCA 3W9GA 5HKPA 4DRXE 3JXJA 1MX2A 4BETA 1SVXA 4C48B 3TWVA 2DVWA 4DX5D 5EIDA 1K1BA 1MX6A 2AJAA 2XEEA 5BXUA 4NIKA 1S70B 2PNNA 4YDYA 4K5BA 3V2XA 3NOGD 4O1OA 4U96D 5HRYA 5FINA 3TWUA 4A63B 4N5QA 4HI9A 2XZDG 3DEPA 2F8YA 4DX7D 4F1PA 4GPMA 3KEAA 4HRLA 5CBOA 2DWZA 4ATZD 5AQBA 5ITZF 4Z68A 3SO8A 5AQAA 4F6RD 5CERB 2JABA 4ZFHA 2BKKB 5JMND 5CEDB 5ENPD 3LJNA 1AWCB 1TR4A 2F37A 5AAOA 1DC2A 5EYLA 2ZGGA 4U8YD 2FO1E 2KXPC 1BU9A 4BSZB 1BD8A 4GMRA 2F8XK 3B95A 4OAUC 1QYMA 2XEHA 1DCQA 2Y0BG 3EU9A 2DZOA 4HLLA 1N11A 3IXEA 5ENSD 1YCSB 5CEAA 2DZNA 1D9SA 1YMPA 3TWWA 5AQ7A 5KWDA 4B93B 2B0OE 5AN8A 3F6QA 5FIOA 2RFAA 4TUMA 1IXVA 5EYPF 1MX4A 2QC9A 3JXIA 2QYJA 1MJ0A 3TWXA 3UXGA 3TWRA 4BEPA 5ENTD 5EIBE 3HG0D 3HRAA 5JA4D 4HBDA 3T9KA 2HE0A 3AJIA 4G8KA 4BERA 2A5EA 5D66A 2P2CP 4QQIA 2NYJA 3NBNB 2V4HC 4YDWA 3TWSA 3ZKJA 5AQ9A 3J5PA 3W9FA 4LG6A 3EHQA 3TWQA 4K5AB 3DEOA 4OAVB 1UOHA 3TWTA 4ZHBA 4K5CA 1G3NB 4J7WA 4QFVA 2Y1LE 4J8YA 4G8LA 3V2OA 3D9HA 5EILA 3AAAC 1K1AA 1K3ZD 1OY3D 1WG0A 5CBNA 4LSZE 4CYMD 3Q9NC 3ZU7B 3ZNGA 5ENOD 5CECB 4U95D 4JB8P 2XENA 2XZTG 2ETAA 3ZUVB 4DX6D
chains in the Genus database with same CATH superfamily
4F1SA 2EINE 5D2MC 3IKOB 4XI9A 1B89A 3FTYA 1N4RA 3PZ1A 3HVEA 4U04A 2NXPA 2R05A 5T4YA 3FTXA 1JCQA 4BTBA 3EIQC 4GTQA 1YA0A 2OEVA 4JPSA 4JEHA 5FT9A 3WXXA 3DWLG 4B8CB 3HXFA 1XNFA 1SVXA 1TNBA 3B13A 5AYWD 3RJVA 2V4LA 4RQIA 1UW4B 1PC2A 4EZLA 2PNNA 4ACLA 2XRYA 4R7LA 3TWUA 4J8FA 4DX7D 3FU6A 3FHEA 4ILGA 3FUDA 3UT7A 5C1DA 3SO8A 5FJYA 3B7TA 4U7EB 3RK6A 3SFXA 4NACA 3SFZA 1ELWA 4UWGA 1BD8A 3B95A 4ANWA 1QYMA 2Y0BG 3EU9A 3ZFWA 5AQ7A 1TNOA 4B93B 2WXHA 3CVLA 3PRZA 5AJLA 3LY9A 3VLFA 1OWLA 3D9JA 3E37A 3QWWA 2EIKE 3CIAA 3T9KA 2H6GA 3CK9A 1S64A 2AWIA 3QK0A 2WQ7A 2I9CA 4GTSA 3SHFA 5LCWC 2R59A 1UOHA 2LO6A 4ILIA 1NI1A 1LTXA 3V2OA 1K3ZD 5G05J 3SD5A 1ZBPA 3CHRA 2HYZA 3EIJA 2B6CA 3HXBA 2ZU6B 3T5XA 2KM4A 4ABNA 3SZ7A 4UI9K 4F3VA 4HRMB 4U8VD 4L9PA 4B8AA 3PE4A 4GAAA 1KLXA 4FULA 4HB5A 3UPVA 3Q78A 4FHJA 4HQDA 3CV0A 4M3OA 3MGBA 4U8HA 1BI7B 2VGEA 3Q9UC 5FZRA 1Z3YA 4XIFA 3W9GA 1DVPA 3OTNA 4HVBA 3ABLE 2X6HA 2Q7FA 3KSLA 3SF4A 4B0ZA 4UWFA 4L23A 4GTPA 4K5BA 3NOGD 5FTPA 2XZDG 2F8YA 1U2VG 2JLBA 4Z68A 5ENPD 5AAOA 1DC2A 2J08A 3Q75A 3GZSA 3D9KA 4GA2A 3PNLB 5KJKA 1BPOA 4EPZA 2IY0C 3DSXA 3PDNA 5JJ7A 3AU5A 4BT8A 1HG5A 3RAUA 2YNQA 2VSYA 3T5VA 3ZEFA 5CCLA 5BV1A 5CRVA 3PE3A 2XEVA 3ZKJA 4LG6A 3EHQA 1LF8A 3IV0A 2FO7A 4ZHBA 5D0OD 1H6OA 3AAAC 4LUNU 1JWFA 4JA9A 5G04J 4I1AA 3FUMA 1V55E 3GYZA 2ETAA 3FUKA 3BG1B 5ANRA 3CQCB 4HI8A 4MRUA 2ZISA 3B7BA 2XS8A 3CVQA 1OUVA 1N0RA 3ULYA 2J4BA 3VTXA 3V30A 2AXZA 4LERA 1DCEA 3ZYQA 5KBAA 1HS6A 2EIJE 1H2UA 4I6EA 3R7RA 4ACKA 3LKUA 2VGXA 3UIPC 3CHSA 4UWHA 1NA0A 1UG3A 2KCLA 3MA5A 3OXFA 3HVEB 3FEYA 3RRNB 3QNKA 4I2ZA 1FPPA 5HRYA 4HI9A 3IHVA 1KT1A 1LD7A 1TNUA 4F6RD 3R9MA 4I1OB 5EYLA 5B1BE 1HO8A 4N3BA 2FI7A 3BUAA 2WQ6A 4GZCA 1KZOA 4N3CA 2X6FA 4J8EA 4CDMA 4GZ3A 2BEDA 4BTAA 4BERA 3FUIA 4G8KA 1OWPA 3LPZA 4JW1A 2C0LA 3MCXA 5A6CA 4FJYA 1JCSA 3D9IA 3O4ZA 4LEUA 4GA1A 3U66A 4Q96A 4V3IA 4A1GA 1WG0A 4KZCA 3QDNA 3CQGB 3LXUX 4EZJA 5BW8C 3CR3A 3ZVVA 1FCHA 3VLEA 3D9NA 3PUKA 4JXTA 3ZN3A 1NZNA 2GRQB 1H19A 4FADA 3PEUB 4B94A 5H7PA 4LCTA 4L1BA 4H7XA 5HKPA 1MX2A 3EJNA 1K1BA 4NIKA 4GMLA 2V5FA 2F0YA 2MHKA 1WY6A 1N94A 2KCVA 4U63A 2GRNB 4CDRA 2ZIRA 3RIBA 4HLEA 3U4TA 3UM1A 2QYUA 2MRIA 3C3RA 2KXPC 4ILHB 4IULA 3TWWA 5LCWJ 5FIOA 2KCKA 3KS2A 3SQVA 2QYJA 3SFYA 5CCMA 3Q47B 1N54A 4M7CA 3B7RL 1OXJA 4OAVB 1S63A 3PUJA 4K5CA 1HE8A 4J7WA 4OVUA 4G8LA 5EILA 4AY6A 3CGHA 4N5CA 3LS8A 4GTOA 4U95D 5LFAA 4UQXA 1SA4A 2XENA 3S7BA 2YHEA 1QZ2A 4XKBA 4BESA 2OVFA 2V5QC 2KZTB 1AP7A 3PS6A 3C5RA 3CHMA 3RKVA 2VSNA 3LJ3A 2NSZA 5JHBA 1IYGA 2KATA 4CZ2D 1BI8B 2OEWA 2CG2A 3BQOA 2X38A 1IHBA 1UN8A 4IYPA 4JL0A 1O1RA 2Y69E 1D8DA 4HOTA 4BETA 3NF1A 3G2UA 3KAEA 4WNEA 3CK7A 4FC8A 4C9BB 5EDSA 2R03A 1FT1A 4J6IA 4F1PA 3Q7FA 3TL5A 1Q2ZA 5HI7A 4A3VA 1JCRA 4BSXA 4U0ZA 1TN6A 4I9CA 4N3AA 2XRZA 2VGXB 3DSUA 2DZOA 4I6JA 5ENSD 2WXRA 4NURA 2XQ0A 4APOA 3G2TA 4XZ4A 3DXMG 4C0MA 3KEZA 3APCA 4YVQC 2WMNA 4AY5A 3LY7A 3HRAA 5T3RA 4DK5A 1X5BA 3QARA 3ASOE 5FZQA 4TRQA 3E4BA 3L82A 3ZU7B 1EDUA 4EBAA 3RRUA 1EPUA 4JB8P 5FQ6A 4JD2G 3ISMC 4ANXA 1WM5A 3R9AB 2RFMA 3RO2A 4W9RA 3QC1A 3ASGA 2A4ZA 3PEVB 1U3CA 2AXVA 3JUEA 1H0AA 2H6IA 1NFIE 2L6BA 3ZYMA 1RZ4A 2PZIA 3L6AA 3BEEA 3EU5A 4A63B 4U96D 1IQUA 4N39A 2GRLA 3GZ1A 4P29A 5EX3A 5CEDB 1L5JA 2MOWA 2CHWA 2UY1A 1WAO1 3I5PA 3UKUG 3L08A 2X6KA 2RG8A 3SBTB 4AM9A 2PL2A 3NQPA 3EHNA 3MX3A 1MZCA 3E33A 4TUUA 3JQ1A 3AJIA 2V8SE 4QQIA 4XE0A 1E7UA 2P9PG 3LYAA 4ANVA 3J5PA 4I1MA 1TYQG 3TWQA 4AVXA 1QQEA 3UX4A 4L7TA 2QZAA 1OWMA 3FU3A 3DBSA 1OY3D 1DNPA 3R7QA 5FQ7A 5LOZA 4PS3A 4DX6D 4ME2A 2PM7A 1A17A 1SW6A 4KMOA 2X6IA 4RLYA 4YDEA 2AXUA 4DX1A 4I2WA 5ENNA 3FUEA 2VTBB 2KBXA 3MJWA 2AW6A 1ZB1A 2DBAA 3LDZA 4RG9A 3TWVA 2GROB 2WXFA 5BXUA 5JHAA 5B3SE 3E32A 3IHYA 4KT6B 2LAHA 5FINA 4HS2A 4GCOA 3DEPA 3B7UX 3CK8A 2RD0A 1OWOA 3Q15A 3FH8A 2FO1E 1BU9A 3FU0A 3D9MA 2XPYA 2OOEA 2DZNA 1D9SA 3DPYA 1HU3A 1IXVA 5M72A 5EKQD 2QC9A 3UXGA 3QAQA 5JA4D 1H6KA 3ZGQA 2NYJA 4DI3A 2V4HC 1FVHA 3HDXA 2IONA 1EYHA 3PZ2A 3FY4A 4WWOA 5AJDA 4TXQA 3SBSA 1O1SA 4F53A 3NZUA 4KYOB 2QFCA 3ULQA 1E8YA 2WMOA 3ZUVB 3PH0C 1Z5SC 2KZTA 3J5QB 3ENEA 3L13A 2H6HA 2BUGA 2FULA 2L0IA 4GMJA 5BPPA 3P2BA 2YQ8A 3NZSA 2VSXE 4HRNA 2IOLA 3C72A 1ELKA 3DXKG 2EQXA 2ZGDA 4CCAA 3CHPA 3ZHEA 3UKRG 3NOCD 2IEJA 5FZSA 3WG7E 4O60A 4Q94A 4JA7A 5KJMA 2CHXA 2HO1A 3Q4AB 3UM0A 2VJ8A 3D9PA 4K03A 4YDYA 1U3DA 4EZKA 4O1OA 4AJWA 2HM8A 1HFAA 2DWZA 4ATZD 3JQ0A 4ZFHA 1AWCB 5AIJA 4WWPA 1V54E 3FUJA 3FTVA 4DLOA 4OAUC 4A1SA 2P9UG 1IHGA 2LAIA 2WXKA 4L2YA 2RFAA 4GA0A 3APDA 3PNTB 4DPRA 1EF1C 4HOSA 3HIZA 4U0UA 2OVBA 1TNZA 4NQ0A 3FUFA 2HE0A 2P2CP 3CLJA 2XGMA 2UY1B 4YDWA 3TWSA 2IF4A 1SA5A 3CVNA 4K5AB 4ATGA 4WNGA 3RSEG 3UIOC 2J49A 3S7JA 1X81A 4BX8A 3ZPJA 4LRZA 4GYWA 2XS1A 5HS0A 1HX8A 2XPZA 3ONKA 5FQ4A 3ONLA 4URKA 3ZW3A 2Y3AA 2BKGA 3LVRE 2MYOA 4J0UA 1JPLA 2R2LA 1QBQA 4DRXE 3EHMA 3HXDA 2XGOA 4LNGA 3FULA 2LXLA 4MS6A 3RO3A 3ESLA 1S70B 2R17C 3AS4A 3KD7A 3K9IA 4UI9C 1TR4A 2CFUA 2ZGGA 2BTDA 5J90A 4BFRA 4GMRA 3PREA 2L0TB 5G2NA 5AN8A 2IU1A 4GTVA 2FBNA 3UQ3A 4G25A 5C2YA 4F7AA 3FTUA 3UM3A 2DCPA 3FEXA 4XEIG 1MQSA 4I9EA 2JEKA 4N2SA 4E6HA 3FFLA 3HHMA 2OCCE 3CSTA 3OXLA 2VQ2A 1D8EA 4CRWA 2PQRA 4HOUA 5D0QD 1FVFA 4DX2A 3T8KA 4J8DA 3ABKE 1IKND 1MYOA 4G1TA 3VTYA 1N95A 1SZ9A 2VTBA 3U9WA 2DYRE 2Y4UA 4G2VA 3GZ2A 3AS5A 4GZDA 1Y6IA 2J8SD 3Q7AA 4RVBA 1RW2A 4BY6A 3ZYKA 1TEZA 4C48B 2M63A 1OCRE 2I2OA 2LSUA 4GTTA 3X2QE 4H7YA 3FUHA 4GB9A 3S2AA 1QNFA 5AQAA 5A23A 3U3WA 4KVMA 4U8YD 3ZHEB 2GRMA 4HLLA 1N9AA 3CHOA 2IJGX 3I4RB 4FA6A 4CT4A 2C0MA 2B0OE 2WPVA 3EUVA 1TNYA 5JJ6A 3EDTB 2XCCA 3LEWA 3E30A 3JYSA 4GCNA 5ARFA 5CMYA 3ZNGA 3FH5A 2CHZA 2J9QA 2WVIA 3CSFA 3GW4A 5EIBE 5BT1A 3URZA 4BX9A 2ETBA 4I6GA 1TN7A 4YDOA 3C3QA 2ONDA 2WB2A 4HOQA 3C98A 2Y4TA 4DJAA 1Z6TA 2P9SG 1UJKA 2IOSA 3OXGA 3QOUA 1WDYA 1H6PA 3FH7A 4K0RA 3ZXPA 2P9KG 1OCZE 1MX6A 4WNFA 2WXPA 4I43A 4TV3A 5ANLA 1KPSB 5E75A 4WWNA 1UN9A 3TG5A 3UT8A 3IBEA 2XPIA 5G55A 4AIFA 4A55A 4UQYA 3ZXSA 2JABA 3LJNA 3FP3A 5BUZA 3DSVA 1IQRA 3ZRHA 4FU3A 3OAWA 4OVVA 1DCQA 2WXMA 3CEQA 3QB2A 1HZ4A 3L17A 2KC7A 1HF8A 2X6JA 3PZ4A 4BT9A 3DSWA 2A5EA 3D9LA 5AQ9A 3UUXA 3G2SA 4GYOA 5J08A 3FWVA 5BV0A 3UMVA 1G3NB 4RSYA 1OWNA 2WXIA 4IN3B 4A3TA 3TJPA 5T8IA 3SGHA 4DI4A 2CFZA 2WXOA 5ARGA 4Q69A 2EIME 3Q9NC 5CECB 4RG6A 4E85A 1SQMA 1N4PA 4GYYA 1E96B 5LP0A 2R02A 3CVWA 2LXMA 3DSTA 5LX8A 5BXOA 4B89A 3S7DA 1OT8A 2XGSA 3ASNE 4HNAD 3FTSA 4O6FA 3CKCA 3QJZA 3T8MA 4KBQA 2X3MA 3JXJA 4UI9J 3L9TA 3AG4E 4DX5D 4XKCA 5EIDA 1HH8A 2DIWA 1W3BA 3TXMA 2L9BA 5CBOA 3ASHA 5ITZF 1SZAA 2XCBA 3L54A 1OCOE 1N4SA 5IY5E 2IO2C 2XEHA 1TJCA 3TGOA 1NL4A 2VSOE 5CRUA 1GW6A 2J09A 1MJ0A 5EX0A 5HQ8A 4FLBA 4GPKA 3D9OA 2ZXWE 4TXRA 5FWQA 2BF0X 4NRHB 3AG2E 2WXGA 4JC8A 3AG1E 3JUIA 3TWTA 2Y1LE 4G26A 4LSZE 2R5SA 4APFA 4BWRA 4KVOA 3MV3B 5AENA 3KSQA 3L22A 3UM2A 2P9IG 4JEUA 4AXHA 3MKQB 5EN5D 2J07A 2P9LG 1E8ZA 3EHRA 2WXJA 3QKYA 3CKBA 5KJNA 1H2TC 4HXIA 1E8WA 2DYSE 3UI2A 4EBAG 4GZ6A 3ASDA 5JJTA 3AU4A 2WQHA 3S7FA 4N5QA 3MV2B 3CVVA 4GTRA 1NA3A 2CG3A 4FHKA 2GW1A 4D10C 3E34A 5KCMA 2BKKB 5CMWA 3HXEA 2OV8A 3HYMB 3Q5MA 4WAFA 1N11A 4PS7A 2QY7A 2RKKA 4HFGA 3F6QA 4U0SA 1MX4A 3AG3E 3JXIA 2XHEA 5ENTD 2P9NG 5E76A 1Z3XA 4HBDA 3JCKC 1KZPA 3Q73A 3DSSA 3ULEG 3Q49B 3TAXA 2I1KA 3DEOA 4QFVA 1K1AA 3LY8A 1NP7A 4DUIA 1OCCE 3CVUA 2ETCA 5KNHD 2LNIA 4U07A 2ILRA 3FDHA 3G2VA 3ML8A 3CHQA 4UWKA 1JUQA 3UTMA 3O48A 4X8QA 2PQNA 1FT2A 3AS8A 3U64A 4CGWA 2DVWA 3FU5A 4FP7A 1K8KG 3MEKA 3TG4A 3V2XA 3ABME 4EHMA 1E7VA 4PH4B 4HRLA 3KEAA 4L2LA 3C3OA 5JMND 4AP2A 4AV7A 4AOFA 4I17A 3FTZA 5CEAA 4EECA 1YMPA 2E0IA 3BU8A 4UQZA 4TUMA 1TJFA 2P58C 2LSVA 3Q79A 3CVPA 4FJZA 5FQ8A 2VGYA 3ASFA 4HORA 1XGWA 2YHCA 3D9HA 4CEMA 4CYMD 3UINC 1INZA 5A7DB 2FF4A 3IEGA 1PAQA 2H6FA 3LCAA 3DPDA 1P5QA 1BLXB 3NAWA 4O1PA 2AVPA 3SY2A 4MBGA 3BG0B 3V79K 1H2VC 4KZ0A 1N0QA 4Y6WA 1O5MA 3NB2A 1MHQA 1JWGA 5G05C 3V31A 2VYIA 4G23A 2C2LA 4EQFA 5ENRD 1A5EA 5AARA 1YYHA 1S0PA 4MLPA 4OYSA 4C0EA 3ZYLA 3D3MA 2AJAA 2XEEA 4XX5A 1TN8A 4YNDA 4GPMA 2V0PA 3QWVA 3ZIMA 1Y8MA 2F37A 2IFUA 3RU0A 1E90A 4LNBA 4BSZB 4CT0A 2GGFA 4N2QA 3PZDA 1YCSB 3TXNA 2HR2A 2FEZA 4WUYA 4TXPA 1O1TA 3TWXA 3TWRA 5BNWA 3FUNA 3HG0D 1E8XA 3G2WA 3VLDA 5D66A 3NBNB 2A5UA 3ML9A 4GTMA 1N52A 4J8YA 3CVXA 1N4QA 2IO3C 4PDXA 5CHEE 4YVOA 1PY1A 2XZTG 4DLQA 3RRMB 2GRRB 4PUCA 3CVYA 1HXIA 2WXLA 3MKQA 5ENQD 4JVSA 5KJLA 2J4DA 4GU5A 1ELRA 3PZ3A 1KT0A 2E2EA 5G04C 5KNGA 2GRPB 2WM9A 5B1AE 4IRUA 2PM6A 3SNXA 2LUHA 4LNUD 4UUCA 2EILE 1UJJA 2UWJG 3I3NA 3QWPA 3SI5A 3PVLA 4UWLA 3LVQE 4XI0A 3MYVA 4JHRA 3UT4A 4G11A 4MKTA 4GZ5A 4AEZC 2L6JA 5DIZA 2I1JA 3MKRA 2YINA 4ANUA 3ESKA 5AQBA 3MZLB 5CERB 3APFA 4CGVA 2F8XK 4J8SA 4JZYA 3IXEA 4CDNA 3FTWA 5KWDA 3L16A 2WXQA 3P1UA 5EYPF 4BEPA 4KXKB 4JHKA 1ZU2A 3I4GA 1VDYA 2I6HA 4PS8A 5DBKA 3HXCA 3W9FA 3DRAA 3B7SA 2NC9A 2WXNA 4WNDA 5CBNA 5ENOD 4G24A 2IQCA 3N71A 4FLHA 1HG2A 4JHJA 4Y6CA 1LD8A
chains in the Genus database with same CATH topology
1BLXB 4HI8A 3J5QB 4O1PA 3B7BA 4BESA 4DUIA 2V5QC 5HS0A 1N0RA 1AP7A 2RFMA 3V79K 1SW6A 4DX2A 3C5RA 1N0QA 5ENQD 3V30A 2ETCA 5EN5D 5KNHD 3T8KA 4HRMB 4U8VD 1IKND 2ETBA 1MYOA 4RLYA 5BXOA 3V31A 3EHRA 4HRNA 4DX1A 3JUEA 4HB5A 5KBAA 5KNGA 1OT8A 2BKGA 4HQDA 4HNAD 5ENRD 1NFIE 1BI8B 2KBXA 2L6BA 4CZ2D 2ZGDA 1A5EA 1BI7B 1WDYA 5AARA 3UTMA 1IHBA 2MYOA 2VGEA 3Q9UC 3UI2A 2J8SD 1YYHA 3NOCD 4LNUD 4O60A 4UUCA 3W9GA 5HKPA 4DRXE 3JXJA 1MX2A 4BETA 1SVXA 4C48B 3TWVA 2DVWA 4DX5D 5EIDA 1K1BA 1MX6A 2AJAA 2XEEA 5BXUA 4NIKA 1S70B 2PNNA 4YDYA 4K5BA 3V2XA 3NOGD 4O1OA 4U96D 5HRYA 5FINA 3TWUA 4A63B 4N5QA 4HI9A 2XZDG 3DEPA 2F8YA 4DX7D 4F1PA 4GPMA 3KEAA 4HRLA 5CBOA 2DWZA 4ATZD 5AQBA 5ITZF 4Z68A 3SO8A 5AQAA 4F6RD 5CERB 2JABA 4ZFHA 2BKKB 5JMND 5CEDB 5ENPD 3LJNA 1AWCB 1TR4A 2F37A 5AAOA 1DC2A 5EYLA 2ZGGA 4U8YD 2FO1E 2KXPC 1BU9A 4BSZB 1BD8A 4GMRA 2F8XK 3B95A 4OAUC 1QYMA 2XEHA 1DCQA 2Y0BG 3EU9A 2DZOA 4HLLA 1N11A 3IXEA 5ENSD 1YCSB 5CEAA 2DZNA 1D9SA 1YMPA 3TWWA 5AQ7A 5KWDA 4B93B 2B0OE 5AN8A 3F6QA 5FIOA 2RFAA 4TUMA 1IXVA 5EYPF 1MX4A 2QC9A 3JXIA 2QYJA 1MJ0A 3TWXA 3UXGA 3TWRA 4BEPA 5ENTD 5EIBE 3HG0D 3HRAA 5JA4D 4HBDA 3T9KA 2HE0A 3AJIA 4G8KA 4BERA 2A5EA 5D66A 2P2CP 4QQIA 2NYJA 3NBNB 2V4HC 4YDWA 3TWSA 3ZKJA 5AQ9A 3J5PA 3W9FA 4LG6A 3EHQA 3TWQA 4K5AB 3DEOA 4OAVB 1UOHA 3TWTA 4ZHBA 4K5CA 1G3NB 4J7WA 4QFVA 2Y1LE 4J8YA 4G8LA 3V2OA 3D9HA 5EILA 3AAAC 1K1AA 1K3ZD 1OY3D 1WG0A 5CBNA 4LSZE 4CYMD 3Q9NC 3ZU7B 3ZNGA 5ENOD 5CECB 4U95D 4JB8P 2XENA 2XZTG 2ETAA 3ZUVB 4DX6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLX B;  4HI8 A;  3J5Q B;  4O1P A;  3B7B A;  4BES A;  4DUI A;  2V5Q C;  5HS0 A;  1N0R A;  1AP7 A;  2RFM A;  3V79 K;  1SW6 A;  4DX2 A;  3C5R A;  1N0Q A;  5ENQ D;  3V30 A;  2ETC A;  5EN5 D;  5KNH D;  3T8K A;  4HRM B;  4U8V D;  1IKN D;  2ETB A;  1MYO A;  4RLY A;  5BXO A;  3V31 A;  3EHR A;  4HRN A;  4DX1 A;  3JUE A;  4HB5 A;  5KBA A;  5KNG A;  1OT8 A;  2BKG A;  4HQD A;  4HNA D;  5ENR D;  1NFI E;  1BI8 B;  2KBX A;  2L6B A;  4CZ2 D;  2ZGD A;  1A5E A;  1BI7 B;  1WDY A;  5AAR A;  3UTM A;  1IHB A;  2MYO A;  2VGE A;  3Q9U C;  3UI2 A;  2J8S D;  1YYH A;  3NOC D;  4LNU D;  4O60 A;  4UUC A;  3W9G A;  5HKP A;  4DRX E;  3JXJ A;  1MX2 A;  4BET A;  1SVX A;  4C48 B;  3TWV A;  2DVW A;  4DX5 D;  5EID A;  1K1B A;  1MX6 A;  2AJA A;  2XEE A;  5BXU A;  4NIK A;  1S70 B;  2PNN A;  4YDY A;  4K5B A;  3V2X A;  3NOG D;  4O1O A;  4U96 D;  5HRY A;  5FIN A;  3TWU A;  4A63 B;  4N5Q A;  4HI9 A;  2XZD G;  3DEP A;  2F8Y A;  4DX7 D;  4F1P A;  4GPM A;  3KEA A;  4HRL A;  5CBO A;  2DWZ A;  4ATZ D;  5AQB A;  5ITZ F;  4Z68 A;  3SO8 A;  5AQA A;  4F6R D;  5CER B;  2JAB A;  4ZFH A;  2BKK B;  5JMN D;  5CED B;  5ENP D;  3LJN A;  1AWC B;  1TR4 A;  2F37 A;  5AAO A;  1DC2 A;  5EYL A;  2ZGG A;  4U8Y D;  2FO1 E;  2KXP C;  1BU9 A;  4BSZ B;  1BD8 A;  4GMR A;  2F8X K;  3B95 A;  4OAU C;  1QYM A;  2XEH A;  1DCQ A;  2Y0B G;  3EU9 A;  2DZO A;  4HLL A;  1N11 A;  3IXE A;  5ENS D;  1YCS B;  5CEA A;  2DZN A;  1D9S A;  1YMP A;  3TWW A;  5AQ7 A;  5KWD A;  4B93 B;  2B0O E;  5AN8 A;  3F6Q A;  5FIO A;  2RFA A;  4TUM A;  1IXV A;  5EYP F;  1MX4 A;  2QC9 A;  3JXI A;  2QYJ A;  1MJ0 A;  3TWX A;  3UXG A;  3TWR A;  4BEP A;  5ENT D;  5EIB E;  3HG0 D;  3HRA A;  5JA4 D;  4HBD A;  3T9K A;  2HE0 A;  3AJI A;  4G8K A;  4BER A;  2A5E A;  5D66 A;  2P2C P;  4QQI A;  2NYJ A;  3NBN B;  2V4H C;  4YDW A;  3TWS A;  3ZKJ A;  5AQ9 A;  3J5P A;  3W9F A;  4LG6 A;  3EHQ A;  3TWQ A;  4K5A B;  3DEO A;  4OAV B;  1UOH A;  3TWT A;  4ZHB A;  4K5C A;  1G3N B;  4J7W A;  4QFV A;  2Y1L E;  4J8Y A;  4G8L A;  3V2O A;  3D9H A;  5EIL A;  3AAA C;  1K1A A;  1K3Z D;  1OY3 D;  1WG0 A;  5CBN A;  4LSZ E;  4CYM D;  3Q9N C;  3ZU7 B;  3ZNG A;  5ENO D;  5CEC B;  4U95 D;  4JB8 P;  2XEN A;  2XZT G;  2ETA A;  3ZUV B;  4DX6 D; 
#chains in the Genus database with same CATH topology
 4F1S A;  2EIN E;  5D2M C;  3IKO B;  4XI9 A;  1B89 A;  3FTY A;  1N4R A;  3PZ1 A;  3HVE A;  4U04 A;  2NXP A;  2R05 A;  5T4Y A;  3FTX A;  1JCQ A;  4BTB A;  3EIQ C;  4GTQ A;  1YA0 A;  2OEV A;  4JPS A;  4JEH A;  5FT9 A;  3WXX A;  3DWL G;  4B8C B;  3HXF A;  1XNF A;  1SVX A;  1TNB A;  3B13 A;  5AYW D;  3RJV A;  2V4L A;  4RQI A;  1UW4 B;  1PC2 A;  4EZL A;  2PNN A;  4ACL A;  2XRY A;  4R7L A;  3TWU A;  4J8F A;  4DX7 D;  3FU6 A;  3FHE A;  4ILG A;  3FUD A;  3UT7 A;  5C1D A;  3SO8 A;  5FJY A;  3B7T A;  4U7E B;  3RK6 A;  3SFX A;  4NAC A;  3SFZ A;  1ELW A;  4UWG A;  1BD8 A;  3B95 A;  4ANW A;  1QYM A;  2Y0B G;  3EU9 A;  3ZFW A;  5AQ7 A;  1TNO A;  4B93 B;  2WXH A;  3CVL A;  3PRZ A;  5AJL A;  3LY9 A;  3VLF A;  1OWL A;  3D9J A;  3E37 A;  3QWW A;  2EIK E;  3CIA A;  3T9K A;  2H6G A;  3CK9 A;  1S64 A;  2AWI A;  3QK0 A;  2WQ7 A;  2I9C A;  4GTS A;  3SHF A;  5LCW C;  2R59 A;  1UOH A;  2LO6 A;  4ILI A;  1NI1 A;  1LTX A;  3V2O A;  1K3Z D;  5G05 J;  3SD5 A;  1ZBP A;  3CHR A;  2HYZ A;  3EIJ A;  2B6C A;  3HXB A;  2ZU6 B;  3T5X A;  2KM4 A;  4ABN A;  3SZ7 A;  4UI9 K;  4F3V A;  4HRM B;  4U8V D;  4L9P A;  4B8A A;  3PE4 A;  4GAA A;  1KLX A;  4FUL A;  4HB5 A;  3UPV A;  3Q78 A;  4FHJ A;  4HQD A;  3CV0 A;  4M3O A;  3MGB A;  4U8H A;  1BI7 B;  2VGE A;  3Q9U C;  5FZR A;  1Z3Y A;  4XIF A;  3W9G A;  1DVP A;  3OTN A;  4HVB A;  3ABL E;  2X6H A;  2Q7F A;  3KSL A;  3SF4 A;  4B0Z A;  4UWF A;  4L23 A;  4GTP A;  4K5B A;  3NOG D;  5FTP A;  2XZD G;  2F8Y A;  1U2V G;  2JLB A;  4Z68 A;  5ENP D;  5AAO A;  1DC2 A;  2J08 A;  3Q75 A;  3GZS A;  3D9K A;  4GA2 A;  3PNL B;  5KJK A;  1BPO A;  4EPZ A;  2IY0 C;  3DSX A;  3PDN A;  5JJ7 A;  3AU5 A;  4BT8 A;  1HG5 A;  3RAU A;  2YNQ A;  2VSY A;  3T5V A;  3ZEF A;  5CCL A;  5BV1 A;  5CRV A;  3PE3 A;  2XEV A;  3ZKJ A;  4LG6 A;  3EHQ A;  1LF8 A;  3IV0 A;  2FO7 A;  4ZHB A;  5D0O D;  1H6O A;  3AAA C;  4LUN U;  1JWF A;  4JA9 A;  5G04 J;  4I1A A;  3FUM A;  1V55 E;  3GYZ A;  2ETA A;  3FUK A;  3BG1 B;  5ANR A;  3CQC B;  4HI8 A;  4MRU A;  2ZIS A;  3B7B A;  2XS8 A;  3CVQ A;  1OUV A;  1N0R A;  3ULY A;  2J4B A;  3VTX A;  3V30 A;  2AXZ A;  4LER A;  1DCE A;  3ZYQ A;  5KBA A;  1HS6 A;  2EIJ E;  1H2U A;  4I6E A;  3R7R A;  4ACK A;  3LKU A;  2VGX A;  3UIP C;  3CHS A;  4UWH A;  1NA0 A;  1UG3 A;  2KCL A;  3MA5 A;  3OXF A;  3HVE B;  3FEY A;  3RRN B;  3QNK A;  4I2Z A;  1FPP A;  5HRY A;  4HI9 A;  3IHV A;  1KT1 A;  1LD7 A;  1TNU A;  4F6R D;  3R9M A;  4I1O B;  5EYL A;  5B1B E;  1HO8 A;  4N3B A;  2FI7 A;  3BUA A;  2WQ6 A;  4GZC A;  1KZO A;  4N3C A;  2X6F A;  4J8E A;  4CDM A;  4GZ3 A;  2BED A;  4BTA A;  4BER A;  3FUI A;  4G8K A;  1OWP A;  3LPZ A;  4JW1 A;  2C0L A;  3MCX A;  5A6C A;  4FJY A;  1JCS A;  3D9I A;  3O4Z A;  4LEU A;  4GA1 A;  3U66 A;  4Q96 A;  4V3I A;  4A1G A;  1WG0 A;  4KZC A;  3QDN A;  3CQG B;  3LXU X;  4EZJ A;  5BW8 C;  3CR3 A;  3ZVV A;  1FCH A;  3VLE A;  3D9N A;  3PUK A;  4JXT A;  3ZN3 A;  1NZN A;  2GRQ B;  1H19 A;  4FAD A;  3PEU B;  4B94 A;  5H7P A;  4LCT A;  4L1B A;  4H7X A;  5HKP A;  1MX2 A;  3EJN A;  1K1B A;  4NIK A;  4GML A;  2V5F A;  2F0Y A;  2MHK A;  1WY6 A;  1N94 A;  2KCV A;  4U63 A;  2GRN B;  4CDR A;  2ZIR A;  3RIB A;  4HLE A;  3U4T A;  3UM1 A;  2QYU A;  2MRI A;  3C3R A;  2KXP C;  4ILH B;  4IUL A;  3TWW A;  5LCW J;  5FIO A;  2KCK A;  3KS2 A;  3SQV A;  2QYJ A;  3SFY A;  5CCM A;  3Q47 B;  1N54 A;  4M7C A;  3B7R L;  1OXJ A;  4OAV B;  1S63 A;  3PUJ A;  4K5C A;  1HE8 A;  4J7W A;  4OVU A;  4G8L A;  5EIL A;  4AY6 A;  3CGH A;  4N5C A;  3LS8 A;  4GTO A;  4U95 D;  5LFA A;  4UQX A;  1SA4 A;  2XEN A;  3S7B A;  2YHE A;  1QZ2 A;  4XKB A;  4BES A;  2OVF A;  2V5Q C;  2KZT B;  1AP7 A;  3PS6 A;  3C5R A;  3CHM A;  3RKV A;  2VSN A;  3LJ3 A;  2NSZ A;  5JHB A;  1IYG A;  2KAT A;  4CZ2 D;  1BI8 B;  2OEW A;  2CG2 A;  3BQO A;  2X38 A;  1IHB A;  1UN8 A;  4IYP A;  4JL0 A;  1O1R A;  2Y69 E;  1D8D A;  4HOT A;  4BET A;  3NF1 A;  3G2U A;  3KAE A;  4WNE A;  3CK7 A;  4FC8 A;  4C9B B;  5EDS A;  2R03 A;  1FT1 A;  4J6I A;  4F1P A;  3Q7F A;  3TL5 A;  1Q2Z A;  5HI7 A;  4A3V A;  1JCR A;  4BSX A;  4U0Z A;  1TN6 A;  4I9C A;  4N3A A;  2XRZ A;  2VGX B;  3DSU A;  2DZO A;  4I6J A;  5ENS D;  2WXR A;  4NUR A;  2XQ0 A;  4APO A;  3G2T A;  4XZ4 A;  3DXM G;  4C0M A;  3KEZ A;  3APC A;  4YVQ C;  2WMN A;  4AY5 A;  3LY7 A;  3HRA A;  5T3R A;  4DK5 A;  1X5B A;  3QAR A;  3ASO E;  5FZQ A;  4TRQ A;  3E4B A;  3L82 A;  3ZU7 B;  1EDU A;  4EBA A;  3RRU A;  1EPU A;  4JB8 P;  5FQ6 A;  4JD2 G;  3ISM C;  4ANX A;  1WM5 A;  3R9A B;  2RFM A;  3RO2 A;  4W9R A;  3QC1 A;  3ASG A;  2A4Z A;  3PEV B;  1U3C A;  2AXV A;  3JUE A;  1H0A A;  2H6I A;  1NFI E;  2L6B A;  3ZYM A;  1RZ4 A;  2PZI A;  3L6A A;  3BEE A;  3EU5 A;  4A63 B;  4U96 D;  1IQU A;  4N39 A;  2GRL A;  3GZ1 A;  4P29 A;  5EX3 A;  5CED B;  1L5J A;  2MOW A;  2CHW A;  2UY1 A;  1WAO 1;  3I5P A;  3UKU G;  3L08 A;  2X6K A;  2RG8 A;  3SBT B;  4AM9 A;  2PL2 A;  3NQP A;  3EHN A;  3MX3 A;  1MZC A;  3E33 A;  4TUU A;  3JQ1 A;  3AJI A;  2V8S E;  4QQI A;  4XE0 A;  1E7U A;  2P9P G;  3LYA A;  4ANV A;  3J5P A;  4I1M A;  1TYQ G;  3TWQ A;  4AVX A;  1QQE A;  3UX4 A;  4L7T A;  2QZA A;  1OWM A;  3FU3 A;  3DBS A;  1OY3 D;  1DNP A;  3R7Q A;  5FQ7 A;  5LOZ A;  4PS3 A;  4DX6 D;  4ME2 A;  2PM7 A;  1A17 A;  1SW6 A;  4KMO A;  2X6I A;  4RLY A;  4YDE A;  2AXU A;  4DX1 A;  4I2W A;  5ENN A;  3FUE A;  2VTB B;  2KBX A;  3MJW A;  2AW6 A;  1ZB1 A;  2DBA A;  3LDZ A;  4RG9 A;  3TWV A;  2GRO B;  2WXF A;  5BXU A;  5JHA A;  5B3S E;  3E32 A;  3IHY A;  4KT6 B;  2LAH A;  5FIN A;  4HS2 A;  4GCO A;  3DEP A;  3B7U X;  3CK8 A;  2RD0 A;  1OWO A;  3Q15 A;  3FH8 A;  2FO1 E;  1BU9 A;  3FU0 A;  3D9M A;  2XPY A;  2OOE A;  2DZN A;  1D9S A;  3DPY A;  1HU3 A;  1IXV A;  5M72 A;  5EKQ D;  2QC9 A;  3UXG A;  3QAQ A;  5JA4 D;  1H6K A;  3ZGQ A;  2NYJ A;  4DI3 A;  2V4H C;  1FVH A;  3HDX A;  2ION A;  1EYH A;  3PZ2 A;  3FY4 A;  4WWO A;  5AJD A;  4TXQ A;  3SBS A;  1O1S A;  4F53 A;  3NZU A;  4KYO B;  2QFC A;  3ULQ A;  1E8Y A;  2WMO A;  3ZUV B;  3PH0 C;  1Z5S C;  2KZT A;  3J5Q B;  3ENE A;  3L13 A;  2H6H A;  2BUG A;  2FUL A;  2L0I A;  4GMJ A;  5BPP A;  3P2B A;  2YQ8 A;  3NZS A;  2VSX E;  4HRN A;  2IOL A;  3C72 A;  1ELK A;  3DXK G;  2EQX A;  2ZGD A;  4CCA A;  3CHP A;  3ZHE A;  3UKR G;  3NOC D;  2IEJ A;  5FZS A;  3WG7 E;  4O60 A;  4Q94 A;  4JA7 A;  5KJM A;  2CHX A;  2HO1 A;  3Q4A B;  3UM0 A;  2VJ8 A;  3D9P A;  4K03 A;  4YDY A;  1U3D A;  4EZK A;  4O1O A;  4AJW A;  2HM8 A;  1HFA A;  2DWZ A;  4ATZ D;  3JQ0 A;  4ZFH A;  1AWC B;  5AIJ A;  4WWP A;  1V54 E;  3FUJ A;  3FTV A;  4DLO A;  4OAU C;  4A1S A;  2P9U G;  1IHG A;  2LAI A;  2WXK A;  4L2Y A;  2RFA A;  4GA0 A;  3APD A;  3PNT B;  4DPR A;  1EF1 C;  4HOS A;  3HIZ A;  4U0U A;  2OVB A;  1TNZ A;  4NQ0 A;  3FUF A;  2HE0 A;  2P2C P;  3CLJ A;  2XGM A;  2UY1 B;  4YDW A;  3TWS A;  2IF4 A;  1SA5 A;  3CVN A;  4K5A B;  4ATG A;  4WNG A;  3RSE G;  3UIO C;  2J49 A;  3S7J A;  1X81 A;  4BX8 A;  3ZPJ A;  4LRZ A;  4GYW A;  2XS1 A;  5HS0 A;  1HX8 A;  2XPZ A;  3ONK A;  5FQ4 A;  3ONL A;  4URK A;  3ZW3 A;  2Y3A A;  2BKG A;  3LVR E;  2MYO A;  4J0U A;  1JPL A;  2R2L A;  1QBQ A;  4DRX E;  3EHM A;  3HXD A;  2XGO A;  4LNG A;  3FUL A;  2LXL A;  4MS6 A;  3RO3 A;  3ESL A;  1S70 B;  2R17 C;  3AS4 A;  3KD7 A;  3K9I A;  4UI9 C;  1TR4 A;  2CFU A;  2ZGG A;  2BTD A;  5J90 A;  4BFR A;  4GMR A;  3PRE A;  2L0T B;  5G2N A;  5AN8 A;  2IU1 A;  4GTV A;  2FBN A;  3UQ3 A;  4G25 A;  5C2Y A;  4F7A A;  3FTU A;  3UM3 A;  2DCP A;  3FEX A;  4XEI G;  1MQS A;  4I9E A;  2JEK A;  4N2S A;  4E6H A;  3FFL A;  3HHM A;  2OCC E;  3CST A;  3OXL A;  2VQ2 A;  1D8E A;  4CRW A;  2PQR A;  4HOU A;  5D0Q D;  1FVF A;  4DX2 A;  3T8K A;  4J8D A;  3ABK E;  1IKN D;  1MYO A;  4G1T A;  3VTY A;  1N95 A;  1SZ9 A;  2VTB A;  3U9W A;  2DYR E;  2Y4U A;  4G2V A;  3GZ2 A;  3AS5 A;  4GZD A;  1Y6I A;  2J8S D;  3Q7A A;  4RVB A;  1RW2 A;  4BY6 A;  3ZYK A;  1TEZ A;  4C48 B;  2M63 A;  1OCR E;  2I2O A;  2LSU A;  4GTT A;  3X2Q E;  4H7Y A;  3FUH A;  4GB9 A;  3S2A A;  1QNF A;  5AQA A;  5A23 A;  3U3W A;  4KVM A;  4U8Y D;  3ZHE B;  2GRM A;  4HLL A;  1N9A A;  3CHO A;  2IJG X;  3I4R B;  4FA6 A;  4CT4 A;  2C0M A;  2B0O E;  2WPV A;  3EUV A;  1TNY A;  5JJ6 A;  3EDT B;  2XCC A;  3LEW A;  3E30 A;  3JYS A;  4GCN A;  5ARF A;  5CMY A;  3ZNG A;  3FH5 A;  2CHZ A;  2J9Q A;  2WVI A;  3CSF A;  3GW4 A;  5EIB E;  5BT1 A;  3URZ A;  4BX9 A;  2ETB A;  4I6G A;  1TN7 A;  4YDO A;  3C3Q A;  2OND A;  2WB2 A;  4HOQ A;  3C98 A;  2Y4T A;  4DJA A;  1Z6T A;  2P9S G;  1UJK A;  2IOS A;  3OXG A;  3QOU A;  1WDY A;  1H6P A;  3FH7 A;  4K0R A;  3ZXP A;  2P9K G;  1OCZ E;  1MX6 A;  4WNF A;  2WXP A;  4I43 A;  4TV3 A;  5ANL A;  1KPS B;  5E75 A;  4WWN A;  1UN9 A;  3TG5 A;  3UT8 A;  3IBE A;  2XPI A;  5G55 A;  4AIF A;  4A55 A;  4UQY A;  3ZXS A;  2JAB A;  3LJN A;  3FP3 A;  5BUZ A;  3DSV A;  1IQR A;  3ZRH A;  4FU3 A;  3OAW A;  4OVV A;  1DCQ A;  2WXM A;  3CEQ A;  3QB2 A;  1HZ4 A;  3L17 A;  2KC7 A;  1HF8 A;  2X6J A;  3PZ4 A;  4BT9 A;  3DSW A;  2A5E A;  3D9L A;  5AQ9 A;  3UUX A;  3G2S A;  4GYO A;  5J08 A;  3FWV A;  5BV0 A;  3UMV A;  1G3N B;  4RSY A;  1OWN A;  2WXI A;  4IN3 B;  4A3T A;  3TJP A;  5T8I A;  3SGH A;  4DI4 A;  2CFZ A;  2WXO A;  5ARG A;  4Q69 A;  2EIM E;  3Q9N C;  5CEC B;  4RG6 A;  4E85 A;  1SQM A;  1N4P A;  4GYY A;  1E96 B;  5LP0 A;  2R02 A;  3CVW A;  2LXM A;  3DST A;  5LX8 A;  5BXO A;  4B89 A;  3S7D A;  1OT8 A;  2XGS A;  3ASN E;  4HNA D;  3FTS A;  4O6F A;  3CKC A;  3QJZ A;  3T8M A;  4KBQ A;  2X3M A;  3JXJ A;  4UI9 J;  3L9T A;  3AG4 E;  4DX5 D;  4XKC A;  5EID A;  1HH8 A;  2DIW A;  1W3B A;  3TXM A;  2L9B A;  5CBO A;  3ASH A;  5ITZ F;  1SZA A;  2XCB A;  3L54 A;  1OCO E;  1N4S A;  5IY5 E;  2IO2 C;  2XEH A;  1TJC A;  3TGO A;  1NL4 A;  2VSO E;  5CRU A;  1GW6 A;  2J09 A;  1MJ0 A;  5EX0 A;  5HQ8 A;  4FLB A;  4GPK A;  3D9O A;  2ZXW E;  4TXR A;  5FWQ A;  2BF0 X;  4NRH B;  3AG2 E;  2WXG A;  4JC8 A;  3AG1 E;  3JUI A;  3TWT A;  2Y1L E;  4G26 A;  4LSZ E;  2R5S A;  4APF A;  4BWR A;  4KVO A;  3MV3 B;  5AEN A;  3KSQ A;  3L22 A;  3UM2 A;  2P9I G;  4JEU A;  4AXH A;  3MKQ B;  5EN5 D;  2J07 A;  2P9L G;  1E8Z A;  3EHR A;  2WXJ A;  3QKY A;  3CKB A;  5KJN A;  1H2T C;  4HXI A;  1E8W A;  2DYS E;  3UI2 A;  4EBA G;  4GZ6 A;  3ASD A;  5JJT A;  3AU4 A;  2WQH A;  3S7F A;  4N5Q A;  3MV2 B;  3CVV A;  4GTR A;  1NA3 A;  2CG3 A;  4FHK A;  2GW1 A;  4D10 C;  3E34 A;  5KCM A;  2BKK B;  5CMW A;  3HXE A;  2OV8 A;  3HYM B;  3Q5M A;  4WAF A;  1N11 A;  4PS7 A;  2QY7 A;  2RKK A;  4HFG A;  3F6Q A;  4U0S A;  1MX4 A;  3AG3 E;  3JXI A;  2XHE A;  5ENT D;  2P9N G;  5E76 A;  1Z3X A;  4HBD A;  3JCK C;  1KZP A;  3Q73 A;  3DSS A;  3ULE G;  3Q49 B;  3TAX A;  2I1K A;  3DEO A;  4QFV A;  1K1A A;  3LY8 A;  1NP7 A;  4DUI A;  1OCC E;  3CVU A;  2ETC A;  5KNH D;  2LNI A;  4U07 A;  2ILR A;  3FDH A;  3G2V A;  3ML8 A;  3CHQ A;  4UWK A;  1JUQ A;  3UTM A;  3O48 A;  4X8Q A;  2PQN A;  1FT2 A;  3AS8 A;  3U64 A;  4CGW A;  2DVW A;  3FU5 A;  4FP7 A;  1K8K G;  3MEK A;  3TG4 A;  3V2X A;  3ABM E;  4EHM A;  1E7V A;  4PH4 B;  4HRL A;  3KEA A;  4L2L A;  3C3O A;  5JMN D;  4AP2 A;  4AV7 A;  4AOF A;  4I17 A;  3FTZ A;  5CEA A;  4EEC A;  1YMP A;  2E0I A;  3BU8 A;  4UQZ A;  4TUM A;  1TJF A;  2P58 C;  2LSV A;  3Q79 A;  3CVP A;  4FJZ A;  5FQ8 A;  2VGY A;  3ASF A;  4HOR A;  1XGW A;  2YHC A;  3D9H A;  4CEM A;  4CYM D;  3UIN C;  1INZ A;  5A7D B;  2FF4 A;  3IEG A;  1PAQ A;  2H6F A;  3LCA A;  3DPD A;  1P5Q A;  1BLX B;  3NAW A;  4O1P A;  2AVP A;  3SY2 A;  4MBG A;  3BG0 B;  3V79 K;  1H2V C;  4KZ0 A;  1N0Q A;  4Y6W A;  1O5M A;  3NB2 A;  1MHQ A;  1JWG A;  5G05 C;  3V31 A;  2VYI A;  4G23 A;  2C2L A;  4EQF A;  5ENR D;  1A5E A;  5AAR A;  1YYH A;  1S0P A;  4MLP A;  4OYS A;  4C0E A;  3ZYL A;  3D3M A;  2AJA A;  2XEE A;  4XX5 A;  1TN8 A;  4YND A;  4GPM A;  2V0P A;  3QWV A;  3ZIM A;  1Y8M A;  2F37 A;  2IFU A;  3RU0 A;  1E90 A;  4LNB A;  4BSZ B;  4CT0 A;  2GGF A;  4N2Q A;  3PZD A;  1YCS B;  3TXN A;  2HR2 A;  2FEZ A;  4WUY A;  4TXP A;  1O1T A;  3TWX A;  3TWR A;  5BNW A;  3FUN A;  3HG0 D;  1E8X A;  3G2W A;  3VLD A;  5D66 A;  3NBN B;  2A5U A;  3ML9 A;  4GTM A;  1N52 A;  4J8Y A;  3CVX A;  1N4Q A;  2IO3 C;  4PDX A;  5CHE E;  4YVO A;  1PY1 A;  2XZT G;  4DLQ A;  3RRM B;  2GRR B;  4PUC A;  3CVY A;  1HXI A;  2WXL A;  3MKQ A;  5ENQ D;  4JVS A;  5KJL A;  2J4D A;  4GU5 A;  1ELR A;  3PZ3 A;  1KT0 A;  2E2E A;  5G04 C;  5KNG A;  2GRP B;  2WM9 A;  5B1A E;  4IRU A;  2PM6 A;  3SNX A;  2LUH A;  4LNU D;  4UUC A;  2EIL E;  1UJJ A;  2UWJ G;  3I3N A;  3QWP A;  3SI5 A;  3PVL A;  4UWL A;  3LVQ E;  4XI0 A;  3MYV A;  4JHR A;  3UT4 A;  4G11 A;  4MKT A;  4GZ5 A;  4AEZ C;  2L6J A;  5DIZ A;  2I1J A;  3MKR A;  2YIN A;  4ANU A;  3ESK A;  5AQB A;  3MZL B;  5CER B;  3APF A;  4CGV A;  2F8X K;  4J8S A;  4JZY A;  3IXE A;  4CDN A;  3FTW A;  5KWD A;  3L16 A;  2WXQ A;  3P1U A;  5EYP F;  4BEP A;  4KXK B;  4JHK A;  1ZU2 A;  3I4G A;  1VDY A;  2I6H A;  4PS8 A;  5DBK A;  3HXC A;  3W9F A;  3DRA A;  3B7S A;  2NC9 A;  2WXN A;  4WND A;  5CBN A;  5ENO D;  4G24 A;  2IQC A;  3N71 A;  4FLH A;  1HG2 A;  4JHJ A;  4Y6C A;  1LD8 A; 
#chains in the Genus database with same CATH homology
 1BLX B;  4HI8 A;  3J5Q B;  4O1P A;  3B7B A;  4BES A;  4DUI A;  2V5Q C;  5HS0 A;  1N0R A;  1AP7 A;  2RFM A;  3V79 K;  1SW6 A;  4DX2 A;  3C5R A;  1N0Q A;  5ENQ D;  3V30 A;  2ETC A;  5EN5 D;  5KNH D;  3T8K A;  4HRM B;  4U8V D;  1IKN D;  2ETB A;  1MYO A;  4RLY A;  5BXO A;  3V31 A;  3EHR A;  4HRN A;  4DX1 A;  3JUE A;  4HB5 A;  5KBA A;  5KNG A;  1OT8 A;  2BKG A;  4HQD A;  4HNA D;  5ENR D;  1NFI E;  1BI8 B;  2KBX A;  2L6B A;  4CZ2 D;  2ZGD A;  1A5E A;  1BI7 B;  1WDY A;  5AAR A;  3UTM A;  1IHB A;  2MYO A;  2VGE A;  3Q9U C;  3UI2 A;  2J8S D;  1YYH A;  3NOC D;  4LNU D;  4O60 A;  4UUC A;  3W9G A;  5HKP A;  4DRX E;  3JXJ A;  1MX2 A;  4BET A;  1SVX A;  4C48 B;  3TWV A;  2DVW A;  4DX5 D;  5EID A;  1K1B A;  1MX6 A;  2AJA A;  2XEE A;  5BXU A;  4NIK A;  1S70 B;  2PNN A;  4YDY A;  4K5B A;  3V2X A;  3NOG D;  4O1O A;  4U96 D;  5HRY A;  5FIN A;  3TWU A;  4A63 B;  4N5Q A;  4HI9 A;  2XZD G;  3DEP A;  2F8Y A;  4DX7 D;  4F1P A;  4GPM A;  3KEA A;  4HRL A;  5CBO A;  2DWZ A;  4ATZ D;  5AQB A;  5ITZ F;  4Z68 A;  3SO8 A;  5AQA A;  4F6R D;  5CER B;  2JAB A;  4ZFH A;  2BKK B;  5JMN D;  5CED B;  5ENP D;  3LJN A;  1AWC B;  1TR4 A;  2F37 A;  5AAO A;  1DC2 A;  5EYL A;  2ZGG A;  4U8Y D;  2FO1 E;  2KXP C;  1BU9 A;  4BSZ B;  1BD8 A;  4GMR A;  2F8X K;  3B95 A;  4OAU C;  1QYM A;  2XEH A;  1DCQ A;  2Y0B G;  3EU9 A;  2DZO A;  4HLL A;  1N11 A;  3IXE A;  5ENS D;  1YCS B;  5CEA A;  2DZN A;  1D9S A;  1YMP A;  3TWW A;  5AQ7 A;  5KWD A;  4B93 B;  2B0O E;  5AN8 A;  3F6Q A;  5FIO A;  2RFA A;  4TUM A;  1IXV A;  5EYP F;  1MX4 A;  2QC9 A;  3JXI A;  2QYJ A;  1MJ0 A;  3TWX A;  3UXG A;  3TWR A;  4BEP A;  5ENT D;  5EIB E;  3HG0 D;  3HRA A;  5JA4 D;  4HBD A;  3T9K A;  2HE0 A;  3AJI A;  4G8K A;  4BER A;  2A5E A;  5D66 A;  2P2C P;  4QQI A;  2NYJ A;  3NBN B;  2V4H C;  4YDW A;  3TWS A;  3ZKJ A;  5AQ9 A;  3J5P A;  3W9F A;  4LG6 A;  3EHQ A;  3TWQ A;  4K5A B;  3DEO A;  4OAV B;  1UOH A;  3TWT A;  4ZHB A;  4K5C A;  1G3N B;  4J7W A;  4QFV A;  2Y1L E;  4J8Y A;  4G8L A;  3V2O A;  3D9H A;  5EIL A;  3AAA C;  1K1A A;  1K3Z D;  1OY3 D;  1WG0 A;  5CBN A;  4LSZ E;  4CYM D;  3Q9N C;  3ZU7 B;  3ZNG A;  5ENO D;  5CEC B;  4U95 D;  4JB8 P;  2XEN A;  2XZT G;  2ETA A;  3ZUV B;  4DX6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...