3TWTA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human mcl1 (chimeric peptide)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
156
structure length
156
Chain Sequence
NSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
molecule keywords Tankyrase-2
total genus 47
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twtA00
1BI7B 4LG6A 3B95A 5KNHD 1K1AA 1N11A 1IKND 1OY3D 3Q9UC 3V31A 5ENQD 5KBAA 4U8YD 1MX4A 3TWQA 1AWCB 5HRYA 3W9FA 2XZTG 4YDYA 4O1OA 1AP7A 4UUCA 2MYOA 4ZHBA 4F6RD 3JXIA 2J8SD 5HKPA 3TWTA 3NOCD 5AQBA 2L6BA 1WDYA 4DX1A 2AJAA 4QQIA 1MX2A 3TWSA 3ZUVB 4U8VD 3UXGA 4Z68A 5ENSD 4ZFHA 4LNUD 5ENOD 4DX2A 4U96D 3TWUA 3V30A 2KBXA 3ZU7B 1K3ZD 1SW6A 5EIDA 1MJ0A 5AQAA 2P2CP 5ITZF 4O1PA 3NBNB 5AQ7A 4HRMB 4TUMA 5AQ9A 2QC9A 3V2XA 1K1BA 1QYMA 3EHRA 5EYPF 4YDWA 3Q9NC 3DEPA 3C5RA 2ZGDA 5AARA 1IXVA 2DZOA 4HI9A 5EN5D 1BI8B 5HS0A 4OAVB 4F1PA 5AAOA 1DC2A 2DWZA 1BU9A 2F8XK 5FIOA 4HBDA 2F8YA 4HLLA 1TR4A 5D66A 2XEEA 3DEOA 5EYLA 5CECB 2A5EA 5FINA 4B93B 1N0QA 3B7BA 4G8KA 2XENA 4U95D 3TWWA 4BSZB 2V4HC 1N0RA 2B0OE 4HRNA 4CZ2D 1UOHA 4HB5A 4A63B 4OAUC 4DX5D 5BXOA 3T9KA 1S70B 2QYJA 5JMND 2ETAA 4K5AB 4DX6D 4JB8P 1MYOA 3EU9A 4GPMA 3AJIA 4LSZE 2ZGGA 1BLXB 3D9HA 3J5QB 3J5PA 4DUIA 3ZNGA 2Y0BG 2F37A 2JABA 3JXJA 1G3NB 5KNGA 2RFAA 2HE0A 1BD8A 5CEDB 5CEAA 4O60A 3HG0D 3NOGD 3V2OA 5CBOA 3TWXA 4HQDA 1MX6A 3KEAA 4BERA 3EHQA 2XEHA 3SO8A 1DCQA 4DRXE 5EIBE 5JA4D 3W9GA 2DVWA 4HI8A 3JUEA 5ENPD 2FO1E 4N5QA 3TWRA 2BKKB 5CERB 1IHBA 5EILA 4HNAD 3IXEA 2VGEA 2RFMA 4QFVA 1WG0A 1YYHA 2DZNA 5AN8A 4ATZD 5KWDA 4HRLA 4K5BA 1D9SA 2V5QC 3TWVA 4BETA 4BESA 3UTMA 2PNNA 2BKGA 3T8KA 3UI2A 1SVXA 4CYMD 5ENTD 1NFIE 4NIKA 3ZKJA 5CBNA 4RLYA 4C48B 3V79K 2ETBA 3F6QA 2XZDG 3HRAA 2NYJA 4J8YA 5BXUA 2ETCA 4G8LA 1A5EA 4GMRA 2Y1LE 2KXPC 4J7WA 4BEPA 3LJNA 5ENRD 4DX7D 1YCSB 3AAAC 4K5CA 1YMPA 1OT8A
chains in the Genus database with same CATH superfamily
1BI7B 1OY3D 2X3MA 2OV8A 4LCTA 3PEUB 3ONLA 4RG6A 2MYOA 3T5VA 2VSXE 1WM5A 1JWGA 5AQBA 4L7TA 4CRWA 1JCRA 3PUJA 3CHRA 5ENSD 3SFZA 4U0UA 1LTXA 2IO2C 5EYPF 1KT1A 2I1KA 2XGMA 3UINC 4HBDA 1K8KG 4UWLA 3O48A 2WXIA 3ESKA 3FTZA 4G8KA 2V4HC 1HZ4A 4FP7A 1N4SA 1S70B 1D8DA 2ETAA 4CEMA 1EYHA 3E34A 4FADA 3SFXA 4EBAG 2AXZA 5CEAA 4U04A 4N3CA 2XPIA 3ABME 5FZQA 2R5SA 2KM4A 2XEHA 1P5QA 4HVBA 1XNFA 5ENPD 4KT6B 2KCKA 2VGEA 2AW6A 3FULA 4JL0A 3RIBA 3ZKJA 3LYAA 4GYWA 3UQ3A 1N9AA 5IY5E 1N54A 4FJZA 1Z6TA 2LXLA 4DX7D 3NB2A 1YCSB 3AAAC 5KJKA 4LG6A 3AG1E 2B6CA 4CCAA 3D9KA 3HXEA 4H7XA 3UX4A 3DSTA 5KBAA 2AVPA 4AIFA 3FU6A 2VJ8A 3Q75A 2R05A 4GYYA 3B7TA 2V5FA 4G24A 4IN3B 2MOWA 4B8CB 3ESLA 3L16A 3FUKA 3LY8A 3ULEG 4GU5A 3FDHA 4DI3A 3CQCB 3RJVA 4LNGA 2ZU6B 3WG7E 4XI9A 5LOZA 3MV3B 2WQ6A 2IONA 2BF0X 1N0QA 1IQRA 4U95D 3AU5A 4GZDA 4JA7A 5D0QD 4CDRA 4A63B 4GTQA 2Y4UA 3L9TA 4HOUA 4MBGA 1TN6A 2Y0BG 2GRQB 1G3NB 5KNGA 1E96B 2IY0C 2VSOE 3Q15A 4DRXE 4GYOA 4HI8A 4MKTA 3TXNA 5FWQA 3Q49B 3HYMB 4L1BA 5CMYA 3UTMA 5BV1A 4BTBA 4FC8A 1NP7A 2Y1LE 3MZLB 2VTBA 1HFAA 1NZNA 4HS2A 3L08A 3RO3A 5AIJA 3V31A 2NXPA 2C0LA 4L9PA 3FU3A 2XZTG 2GW1A 1OCCE 2ZISA 4YDOA 4XI0A 4M7CA 2XHEA 3CHQA 5J08A 2WMNA 4ATGA 1JCSA 2M63A 3QJZA 1OUVA 4JHRA 2WXJA 1VDYA 4O1PA 5AQ9A 2ZIRA 2LUHA 1QYMA 5FQ7A 4RSYA 2EILE 3ASOE 4UI9K 2QFCA 2UWJG 4WNDA 1Y6IA 3FUHA 5B1BE 4HB5A 5H7PA 4GPKA 3TAXA 5BXOA 3L13A 2OOEA 4APOA 2H6GA 2QZAA 1O1TA 4PS3A 3JYSA 3TXMA 2AWIA 4OVVA 3DWLG 3AU4A 1E7UA 3HIZA 4HORA 1Y8MA 2L0IA 3SF4A 5CERB 4ABNA 3RRNB 4UI9C 3PDNA 3P2BA 1NFIE 1Z5SC 3PRZA 2ETBA 4WNFA 3JCKC 3QB2A 2V8SE 4NQ0A 2ETCA 1EF1C 4FULA 4J8DA 3E33A 3JQ0A 3LPZA 2HM8A 4HOSA 5G04C 3X2QE 1AP7A 4GTOA 4DJAA 3ZYQA 2AJAA 4JW1A 4GB9A 4N3AA 5JJTA 4Z68A 3PE3A 2RD0A 1SW6A 5EIDA 3ASHA 4HRMB 4FJYA 4AEZC 2WB2A 4G1TA 3EU5A 3RAUA 2F8YA 2CHWA 2J4DA 5CECB 3MKQA 2L9BA 2DBAA 1SZ9A 2QYJA 4LEUA 3FTVA 3I4RB 3FH7A 3FUEA 2XRZA 1KLXA 4HOTA 2YNQA 3ZYKA 1ZB1A 4DK5A 2UY1A 4BY6A 4GTPA 4AOFA 1DCQA 4BWRA 4AM9A 3ZHEB 3FWVA 4BETA 2GRRB 4Q96A 2CFZA 5ENTD 4GA1A 5FTPA 4U7EB 3HVEA 3V79K 2XGSA 2PM7A 2LXMA 3RRUA 1IYGA 1TJCA 3Q4AB 3IEGA 4MS6A 4JXTA 3TWQA 4E85A 3PNTB 4O1OA 2X6KA 4ZHBA 3TGOA 3MV2B 1TNBA 3HXDA 2EIME 4AVXA 3FTXA 2KZTB 2WXOA 3D9JA 3NZUA 3ZGQA 4AP2A 5AJLA 3CR3A 3R9AB 1MHQA 3DSSA 3BG1B 5CCMA 3MX3A 1HG5A 3OAWA 4I2WA 3RO2A 4AJWA 3CVXA 2EIKE 3NAWA 3Q79A 1FT1A 3ZFWA 5AJDA 3CHSA 4HRNA 1UJKA 1QNFA 4DLOA 3S7FA 3MA5A 3AJIA 2EQXA 3J5PA 1V54E 3GYZA 3TG5A 2UY1B 1BD8A 4I17A 4J8EA 3QKYA 1L5JA 2WXFA 4ACKA 1UW4B 1HU3A 4GZ6A 2VGXA 3U4TA 4MRUA 5JHAA 2Y69E 5D0OD 4HNAD 1UN8A 2VGYA 3DBSA 3EHMA 4GAAA 1OCRE 3I4GA 3ML8A 3SFYA 5A23A 2OEWA 1PY1A 3C3RA 2WQHA 4GTTA 3Q47B 2BEDA 4G8LA 5BW8C 3CKCA 4A1SA 5LFAA 3Q5MA 1K1AA 1AWCB 3DRAA 3W9FA 3R9MA 3DXMG 3NOCD 3U9WA 5FT9A 5FJYA 2OEVA 1O5MA 1E7VA 5CHEE 4EBAA 1WAO1 3QC1A 3S7DA 4HLEA 4UWGA 3V2XA 5FQ6A 2CG2A 3EHRA 3BQOA 4YVOA 3ZXPA 2J4BA 3ASFA 3CGHA 3N71A 1IQUA 4W9RA 3C5RA 4GZ3A 4BX9A 4EZJA 5D66A 4A55A 2XEEA 5KJNA 3VLEA 3TWWA 3IHVA 2WXPA 2JEKA 4CZ2D 3CHMA 3UM3A 4OAUC 4XEIG 3EIQC 4O6FA 3QK0A 3LVQE 4KZ0A 1OWOA 4UWHA 4GTRA 5ANLA 2OVFA 1QQEA 4B94A 1KZOA 2HO1A 2IFUA 1OWPA 3OXLA 3DPDA 4MLPA 3AS5A 1IHGA 2P58C 4B0ZA 2DZNA 3ZVVA 2R17C 4DI4A 3L6AA 4I43A 3CVUA 3LKUA 3Q7FA 1SZAA 2IQCA 1PC2A 2FEZA 4J8YA 2VTBB 3RSEG 1EPUA 4UQYA 3BU8A 1FT2A 1OT8A 2L6JA 3CVPA 1E8YA 4JHJA 5BT1A 3DPYA 4XX5A 5HRYA 4YDYA 5HKPA 4AY6A 4A3TA 1WDYA 1Z3YA 4U8VD 4GMLA 1NI1A 2WXKA 2YHCA 4RG9A 2LSUA 2P9PG 4JA9A 4G25A 4J0UA 2VQ2A 2QC9A 3EDTB 3KEZA 3OXFA 4PS7A 2DZOA 4F1PA 3HXFA 3GZ1A 1Z3XA 4B8AA 1TJFA 3BG0B 2A5EA 4B93B 3UPVA 1H19A 2VSNA 2P9LG 5EX3A 3ASDA 2HYZA 3PH0C 2WXQA 4ME2A 4XE0A 2JLBA 3PE4A 3MEKA 1TNOA 2ZGGA 3D9HA 3URZA 4ANXA 3FH8A 3VLFA 5FZSA 2HE0A 2A4ZA 3NOGD 1SQMA 4ANVA 4BERA 5DIZA 4K03A 2J09A 3TWRA 2BTDA 5EILA 4ILHB 4QFVA 4ATZD 2VGXB 3E4BA 3QAQA 4HRLA 4K5BA 3CVWA 4L23A 2V5QC 5CRVA 3ULQA 3CIAA 3RU0A 1OCOE 2BKGA 3UT8A 3EIJA 2R59A 3PZDA 4JD2G 1H6KA 3OXGA 3CVVA 5FZRA 1OWMA 4CT0A 4V3IA 3ZYLA 1LF8A 3TWXA 3C3QA 3E30A 3PZ4A 3G2WA 3IV0A 2MRIA 4D10C 3CHPA 4LUNU 2CHZA 3S2AA 2J8SD 1MX2A 3B7UX 3CV0A 3FEXA 2WXGA 1OXJA 3ZU7B 4WWPA 1TEZA 4EQFA 4XKBA 3AG2E 2E2EA 4AV7A 5C2YA 1OCZE 3QARA 1JCQA 2YINA 4YDWA 1H6PA 1HO8A 3O4ZA 2ZGDA 3APFA 5AARA 2I1JA 3SGHA 5ENNA 2F8XK 1LD8A 4HLLA 3DEOA 3MKQB 4WWOA 4KBQA 4HFGA 3QWVA 3S7BA 4U8HA 4AY5A 1OWNA 1N4QA 3LVRE 3J5QB 2Y3AA 4DUIA 5A6CA 2WXRA 3G2TA 1YA0A 1Q2ZA 5HQ8A 3SO8A 3GZ2A 3FUMA 2WXLA 1YYHA 3SNXA 2P9SG 4GA2A 3LJ3A 5G55A 2CHXA 2H6HA 1H2TC 3G2VA 3Q7AA 2X6IA 2QY7A 2IEJA 3PZ3A 5EIBE 4GZCA 3B95A 5JJ7A 3Q9UC 2DYSE 1MX4A 4WNEA 4FHJA 3RRMB 4CGWA 2L0TB 4LERA 1ELWA 4G11A 1S64A 3U64A 3ZYMA 3UIPC 3PREA 1QBQA 2KCVA 1HF8A 4IYPA 4CDMA 3CVLA 1K1BA 3FUJA 3ZN3A 4JZYA 4HI9A 1KPSB 4U63A 1HE8A 3SBTB 2EINE 3FUFA 4I1AA 3JUIA 1N0RA 4GTVA 2IOLA 3D9IA 4FA6A 3FTWA 4I1MA 3B13A 4GPMA 4TV3A 1BLXB 3ISMC 2LO6A 4N5CA 5BV0A 2J9QA 5CEDB 4RVBA 3FTSA 4Y6CA 5C1DA 1QZ2A 1N94A 1KT0A 3W9GA 5T4YA 1HX8A 4U0SA 4TUUA 2XQ0A 1GW6A 2IO3C 2XCBA 3KSQA 1RW2A 4RLYA 3PZ2A 2J07A 3VLDA 2LSVA 5AENA 2FI7A 1N11A 4R7LA 3UT4A 4U8YD 4NURA 4N2SA 5LX8A 3K9IA 2XCCA 4NRHB 2V4LA 2X6JA 1H0AA 1INZA 3D3MA 1ELRA 1K3ZD 2IOSA 2P9KG 2P2CP 4UQZA 5AQ7A 2P9IG 4KZCA 4I9CA 2I9CA 3MJWA 2GRMA 2R2LA 3Q9NC 5M72A 1X81A 4YNDA 2XPZA 3Q78A 3CK9A 4GMJA 5HS0A 4ANUA 4ILGA 3KAEA 2A5UA 5KCMA 3C3OA 4TRQA 2PM6A 5B3SE 2LNIA 3UIOC 2YHEA 1ELKA 3PS6A 2OCCE 2HR2A 4I9EA 3D9OA 3RK6A 2F37A 5KJLA 3LCAA 5T3RA 3BUAA 4EECA 1U3CA 3HXBA 4NACA 3E32A 4APFA 4BX8A 4HQDA 1MX6A 2ZXWE 3UUXA 4U07A 1NA3A 4I6JA 4RQIA 1HXIA 2FO1E 3UM2A 2BKKB 5CCLA 3LY9A 4Q69A 3T8MA 4TXRA 4A3VA 5G04J 2ILRA 3QOUA 2FULA 5B1AE 3EUVA 2I6HA 3LDZA 2KXPC 3PUKA 5KWDA 3KS2A 5KNHD 3ZXSA 5FQ4A 4UQXA 3IHYA 1UG3A 4TXPA 2GRNB 3ONKA 4YDEA 3TWTA 5CMWA 4DX1A 2VYIA 5E75A 3ZW3A 3G2SA 3JQ1A 3MKRA 5ENOD 4DX2A 2J08A 2J49A 1WY6A 3AS4A 3FTYA 3FHEA 3FEYA 2GGFA 3D9LA 2WVIA 3DSUA 4JC8A 2WXHA 1BI8B 5EDSA 1BU9A 5E76A 3I5PA 3B7BA 2XENA 4BSZB 4KXKB 3AS8A 3NZSA 3FUDA 1E8ZA 2Q7FA 2FBNA 3FU5A 4JPSA 3TG4A 4P29A 4LSZE 3HXCA 2JABA 3CEQA 2NC9A 4L2YA 5EKQD 1O1RA 3QWWA 4N39A 4KMOA 3KEAA 4BT9A 5JA4D 2FO7A 3ZHEA 2IJGX 2BUGA 2RFMA 1WG0A 1EDUA 3ABKE 2PQRA 4PS8A 3UI2A 5AYWD 3FY4A 2XS1A 3CVYA 2NYJA 3APCA 4LRZA 3MYVA 2C2LA 3SQVA 3HDXA 3WXXA 1D8EA 4XZ4A 1U2VG 4BFRA 4C9BB 4CGVA 4F6RD 3QDNA 4UI9J 3ZUVB 3CQGB 2KZTA 4GCOA 3L22A 2X6FA 3L54A 4C0EA 1N95A 1UN9A 5LCWJ 1IXVA 5EN5D 2IU1A 4JHKA 3R7QA 5BPPA 5EYLA 4U0ZA 4XIFA 1UOHA 4DX5D 2Y4TA 4AXHA 2H6IA 3EU9A 3SHFA 2YQ8A 3JXJA 3FFLA 4PUCA 4GCNA 3ZIMA 2AXUA 4IRUA 4OVUA 4F7AA 1XGWA 3SD5A 1E90A 2OVBA 1N4RA 1S63A 1NL4A 1A17A 4BESA 3T8KA 4OYSA 4XKCA 4CYMD 5CBNA 2AXVA 3QWPA 2F0YA 1DNPA 2KCLA 4GMRA 4BEPA 3ULYA 1FPPA 2H6FA 4UUCA 4QQIA 3CK8A 3FP3A 2XRYA 2VSYA 3UXGA 4ZFHA 2XEVA 2XS8A 2WPVA 4JEHA 5LP0A 2R02A 3NBNB 4EZKA 4CDNA 3D9MA 2DYRE 3AG3E 3UT7A 1DC2A 5AAOA 4PH4B 5FIOA 2GRLA 5KJMA 5FINA 2RKKA 3CVQA 3B7RL 5CRUA 1E8WA 4GA0A 4I6GA 5EX0A 3LS8A 5JMND 4K5AB 1JWFA 4DX6D 1MYOA 1PAQA 4FU3A 1B89A 2CG3A 3MGBA 4H7YA 3UKRG 3SY2A 3L17A 2RG8A 3KSLA 3IBEA 4N2QA 3L82A 3TL5A 4F3VA 1O1SA 3CSFA 4N5QA 4I6EA 3S7JA 3DSXA 3DXKG 4ANWA 1RZ4A 4Y6WA 4UWKA 3ABLE 3D9NA 2I2OA 2E0IA 2XZDG 5ENRD 2PQNA 4K5CA 1S0PA 3UM0A 3SZ7A 1V55E 4G26A 5G05J 5ENQD 2KATA 2GRPB 3ASGA 4TXQA 2WMOA 4ILIA 4EPZA 4DPRA 2CFUA 2V0PA 4C0MA 4F1SA 3Q73A 5DBKA 2WM9A 3CHOA 1JPLA 5ITZF 1TNUA 2EIJE 3SBSA 2R03A 3B7SA 3DEPA 3G2UA 1TNYA 2GROB 2DWZA 1W3BA 3ASNE 4URKA 1H2UA 5D2MC 3VTXA 3CVNA 1FVHA 2IF4A 4N3BA 1LD7A 3CLJA 4JB8P 3T5XA 1FVFA 2LAIA 4I1OB 3CKBA 3FUIA 4BTAA 5G05C 1HG2A 3CSTA 1UJJA 3FU0A 2P9NG 3TJPA 2PZIA 1DCEA 3FTUA 5A7DB 1JUQA 2KC7A 4FHKA 3CK7A 1IHBA 3IXEA 4K0RA 1SA4A 5AN8A 2LAHA 3TWVA 2PNNA 4J8FA 3VTYA 1DVPA 1N52A 2X38A 3F6QA 3HRAA 5JHBA 1A5EA 4J7WA 1U3DA 4CT4A 1YMPA 3U66A 3UM1A 5ARFA 1IKND 4G2VA 5ARGA 3LY7A 4KVOA 2X6HA 5BUZA 2C0MA 4KYOB 4M3OA 1H2VC 3U3WA 3FUNA 2NSZA 4WUYA 3APDA 4B89A 3LEWA 1HH8A 4A1GA 2KBXA 3QNKA 3I3NA 1MZCA 4TUMA 4JEUA 5J90A 3ML9A 1TYQG 4OAVB 1TR4A 3EJNA 4E6HA 2XGOA 1TNZA 1ZU2A 5FQ8A 3KD7A 3MCXA 3T9KA 3ZPJA 1TN8A 4BSXA 2RFAA 3PNLB 3NQPA 4GTMA 1TN7A 5T8IA 3UKUG 5CBOA 4IULA 4X8QA 4FLBA 3EHQA 3E37A 4EZLA 3BEEA 4KVMA 3GZSA 4J8SA 2XPYA 2WXMA 3PZ1A 3OTNA 4NIKA 3DSVA 4L2LA 4G23A 4WWNA 2P9UG 2MHKA 5BXUA 1OWLA 5HI7A 4GTSA 4HOQA 3C72A 4HXIA 1KZPA 3GW4A 1MQSA 3JXIA 3P1UA 3ZEFA 2L6BA 3D9PA 3TWSA 1N4PA 3PEVB 4WAFA 4LNUD 4BT8A 4U96D 3TWUA 1ZBPA 1HS6A 4FLHA 4Q94A 3V30A 1MJ0A 5AQAA 4YVQC 4F53A 4WNGA 4UWFA 3UMVA 2PL2A 1X5BA 3FH5A 4GZ5A 5LCWC 4J6IA 5ANRA 1H6OA 4DLQA 3R7RA 3ENEA 2ONDA 2B0OE 2DCPA 5JJ6A 2WXNA 3LXUX 1NA0A 5BNWA 2QYUA 4JVSA 3PVLA 3ZNGA 3SI5A 4ACLA 1FCHA 2WQ7A 4O60A 3NF1A 3HG0D 3V2OA 5G2NA 3IKOB 3C98A 3EHNA 3ZRHA 2FF4A 2DVWA 3JUEA 4I2ZA 1E8XA 4PDXA 1D9SA 4LNBA 1BPOA 1SVXA 4EHMA 4C48B 3HHMA 2DIWA 3HVEB 3AG4E 3RKVA 3DSWA 3LJNA 1SA5A
chains in the Genus database with same CATH topology
1BI7B 4LG6A 3B95A 5KNHD 1K1AA 1N11A 1IKND 1OY3D 3Q9UC 3V31A 5ENQD 5KBAA 4U8YD 1MX4A 3TWQA 1AWCB 5HRYA 3W9FA 2XZTG 4YDYA 4O1OA 1AP7A 4UUCA 2MYOA 4ZHBA 4F6RD 3JXIA 2J8SD 5HKPA 3TWTA 3NOCD 5AQBA 2L6BA 1WDYA 4DX1A 2AJAA 4QQIA 1MX2A 3TWSA 3ZUVB 4U8VD 3UXGA 4Z68A 5ENSD 4ZFHA 4LNUD 5ENOD 4DX2A 4U96D 3TWUA 3V30A 2KBXA 3ZU7B 1K3ZD 1SW6A 5EIDA 1MJ0A 5AQAA 2P2CP 5ITZF 4O1PA 3NBNB 5AQ7A 4HRMB 4TUMA 5AQ9A 2QC9A 3V2XA 1K1BA 1QYMA 3EHRA 5EYPF 4YDWA 3Q9NC 3DEPA 3C5RA 2ZGDA 5AARA 1IXVA 2DZOA 4HI9A 5EN5D 1BI8B 5HS0A 4OAVB 4F1PA 5AAOA 1DC2A 2DWZA 1BU9A 2F8XK 5FIOA 4HBDA 2F8YA 4HLLA 1TR4A 5D66A 2XEEA 3DEOA 5EYLA 5CECB 2A5EA 5FINA 4B93B 1N0QA 3B7BA 4G8KA 2XENA 4U95D 3TWWA 4BSZB 2V4HC 1N0RA 2B0OE 4HRNA 4CZ2D 1UOHA 4HB5A 4A63B 4OAUC 4DX5D 5BXOA 3T9KA 1S70B 2QYJA 5JMND 2ETAA 4K5AB 4DX6D 4JB8P 1MYOA 3EU9A 4GPMA 3AJIA 4LSZE 2ZGGA 1BLXB 3D9HA 3J5QB 3J5PA 4DUIA 3ZNGA 2Y0BG 2F37A 2JABA 3JXJA 1G3NB 5KNGA 2RFAA 2HE0A 1BD8A 5CEDB 5CEAA 4O60A 3HG0D 3NOGD 3V2OA 5CBOA 3TWXA 4HQDA 1MX6A 3KEAA 4BERA 3EHQA 2XEHA 3SO8A 1DCQA 4DRXE 5EIBE 5JA4D 3W9GA 2DVWA 4HI8A 3JUEA 5ENPD 2FO1E 4N5QA 3TWRA 2BKKB 5CERB 1IHBA 5EILA 4HNAD 3IXEA 2VGEA 2RFMA 4QFVA 1WG0A 1YYHA 2DZNA 5AN8A 4ATZD 5KWDA 4HRLA 4K5BA 1D9SA 2V5QC 3TWVA 4BETA 4BESA 3UTMA 2PNNA 2BKGA 3T8KA 3UI2A 1SVXA 4CYMD 5ENTD 1NFIE 4NIKA 3ZKJA 5CBNA 4RLYA 4C48B 3V79K 2ETBA 3F6QA 2XZDG 3HRAA 2NYJA 4J8YA 5BXUA 2ETCA 4G8LA 1A5EA 4GMRA 2Y1LE 2KXPC 4J7WA 4BEPA 3LJNA 5ENRD 4DX7D 1YCSB 3AAAC 4K5CA 1YMPA 1OT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI7 B;  4LG6 A;  3B95 A;  5KNH D;  1K1A A;  1N11 A;  1IKN D;  1OY3 D;  3Q9U C;  3V31 A;  5ENQ D;  5KBA A;  4U8Y D;  1MX4 A;  3TWQ A;  1AWC B;  5HRY A;  3W9F A;  2XZT G;  4YDY A;  4O1O A;  1AP7 A;  4UUC A;  2MYO A;  4ZHB A;  4F6R D;  3JXI A;  2J8S D;  5HKP A;  3TWT A;  3NOC D;  5AQB A;  2L6B A;  1WDY A;  4DX1 A;  2AJA A;  4QQI A;  1MX2 A;  3TWS A;  3ZUV B;  4U8V D;  3UXG A;  4Z68 A;  5ENS D;  4ZFH A;  4LNU D;  5ENO D;  4DX2 A;  4U96 D;  3TWU A;  3V30 A;  2KBX A;  3ZU7 B;  1K3Z D;  1SW6 A;  5EID A;  1MJ0 A;  5AQA A;  2P2C P;  5ITZ F;  4O1P A;  3NBN B;  5AQ7 A;  4HRM B;  4TUM A;  5AQ9 A;  2QC9 A;  3V2X A;  1K1B A;  1QYM A;  3EHR A;  5EYP F;  4YDW A;  3Q9N C;  3DEP A;  3C5R A;  2ZGD A;  5AAR A;  1IXV A;  2DZO A;  4HI9 A;  5EN5 D;  1BI8 B;  5HS0 A;  4OAV B;  4F1P A;  5AAO A;  1DC2 A;  2DWZ A;  1BU9 A;  2F8X K;  5FIO A;  4HBD A;  2F8Y A;  4HLL A;  1TR4 A;  5D66 A;  2XEE A;  3DEO A;  5EYL A;  5CEC B;  2A5E A;  5FIN A;  4B93 B;  1N0Q A;  3B7B A;  4G8K A;  2XEN A;  4U95 D;  3TWW A;  4BSZ B;  2V4H C;  1N0R A;  2B0O E;  4HRN A;  4CZ2 D;  1UOH A;  4HB5 A;  4A63 B;  4OAU C;  4DX5 D;  5BXO A;  3T9K A;  1S70 B;  2QYJ A;  5JMN D;  2ETA A;  4K5A B;  4DX6 D;  4JB8 P;  1MYO A;  3EU9 A;  4GPM A;  3AJI A;  4LSZ E;  2ZGG A;  1BLX B;  3D9H A;  3J5Q B;  3J5P A;  4DUI A;  3ZNG A;  2Y0B G;  2F37 A;  2JAB A;  3JXJ A;  1G3N B;  5KNG A;  2RFA A;  2HE0 A;  1BD8 A;  5CED B;  5CEA A;  4O60 A;  3HG0 D;  3NOG D;  3V2O A;  5CBO A;  3TWX A;  4HQD A;  1MX6 A;  3KEA A;  4BER A;  3EHQ A;  2XEH A;  3SO8 A;  1DCQ A;  4DRX E;  5EIB E;  5JA4 D;  3W9G A;  2DVW A;  4HI8 A;  3JUE A;  5ENP D;  2FO1 E;  4N5Q A;  3TWR A;  2BKK B;  5CER B;  1IHB A;  5EIL A;  4HNA D;  3IXE A;  2VGE A;  2RFM A;  4QFV A;  1WG0 A;  1YYH A;  2DZN A;  5AN8 A;  4ATZ D;  5KWD A;  4HRL A;  4K5B A;  1D9S A;  2V5Q C;  3TWV A;  4BET A;  4BES A;  3UTM A;  2PNN A;  2BKG A;  3T8K A;  3UI2 A;  1SVX A;  4CYM D;  5ENT D;  1NFI E;  4NIK A;  3ZKJ A;  5CBN A;  4RLY A;  4C48 B;  3V79 K;  2ETB A;  3F6Q A;  2XZD G;  3HRA A;  2NYJ A;  4J8Y A;  5BXU A;  2ETC A;  4G8L A;  1A5E A;  4GMR A;  2Y1L E;  2KXP C;  4J7W A;  4BEP A;  3LJN A;  5ENR D;  4DX7 D;  1YCS B;  3AAA C;  4K5C A;  1YMP A;  1OT8 A; 
#chains in the Genus database with same CATH topology
 1BI7 B;  1OY3 D;  2X3M A;  2OV8 A;  4LCT A;  3PEU B;  3ONL A;  4RG6 A;  2MYO A;  3T5V A;  2VSX E;  1WM5 A;  1JWG A;  5AQB A;  4L7T A;  4CRW A;  1JCR A;  3PUJ A;  3CHR A;  5ENS D;  3SFZ A;  4U0U A;  1LTX A;  2IO2 C;  5EYP F;  1KT1 A;  2I1K A;  2XGM A;  3UIN C;  4HBD A;  1K8K G;  4UWL A;  3O48 A;  2WXI A;  3ESK A;  3FTZ A;  4G8K A;  2V4H C;  1HZ4 A;  4FP7 A;  1N4S A;  1S70 B;  1D8D A;  2ETA A;  4CEM A;  1EYH A;  3E34 A;  4FAD A;  3SFX A;  4EBA G;  2AXZ A;  5CEA A;  4U04 A;  4N3C A;  2XPI A;  3ABM E;  5FZQ A;  2R5S A;  2KM4 A;  2XEH A;  1P5Q A;  4HVB A;  1XNF A;  5ENP D;  4KT6 B;  2KCK A;  2VGE A;  2AW6 A;  3FUL A;  4JL0 A;  3RIB A;  3ZKJ A;  3LYA A;  4GYW A;  3UQ3 A;  1N9A A;  5IY5 E;  1N54 A;  4FJZ A;  1Z6T A;  2LXL A;  4DX7 D;  3NB2 A;  1YCS B;  3AAA C;  5KJK A;  4LG6 A;  3AG1 E;  2B6C A;  4CCA A;  3D9K A;  3HXE A;  4H7X A;  3UX4 A;  3DST A;  5KBA A;  2AVP A;  4AIF A;  3FU6 A;  2VJ8 A;  3Q75 A;  2R05 A;  4GYY A;  3B7T A;  2V5F A;  4G24 A;  4IN3 B;  2MOW A;  4B8C B;  3ESL A;  3L16 A;  3FUK A;  3LY8 A;  3ULE G;  4GU5 A;  3FDH A;  4DI3 A;  3CQC B;  3RJV A;  4LNG A;  2ZU6 B;  3WG7 E;  4XI9 A;  5LOZ A;  3MV3 B;  2WQ6 A;  2ION A;  2BF0 X;  1N0Q A;  1IQR A;  4U95 D;  3AU5 A;  4GZD A;  4JA7 A;  5D0Q D;  4CDR A;  4A63 B;  4GTQ A;  2Y4U A;  3L9T A;  4HOU A;  4MBG A;  1TN6 A;  2Y0B G;  2GRQ B;  1G3N B;  5KNG A;  1E96 B;  2IY0 C;  2VSO E;  3Q15 A;  4DRX E;  4GYO A;  4HI8 A;  4MKT A;  3TXN A;  5FWQ A;  3Q49 B;  3HYM B;  4L1B A;  5CMY A;  3UTM A;  5BV1 A;  4BTB A;  4FC8 A;  1NP7 A;  2Y1L E;  3MZL B;  2VTB A;  1HFA A;  1NZN A;  4HS2 A;  3L08 A;  3RO3 A;  5AIJ A;  3V31 A;  2NXP A;  2C0L A;  4L9P A;  3FU3 A;  2XZT G;  2GW1 A;  1OCC E;  2ZIS A;  4YDO A;  4XI0 A;  4M7C A;  2XHE A;  3CHQ A;  5J08 A;  2WMN A;  4ATG A;  1JCS A;  2M63 A;  3QJZ A;  1OUV A;  4JHR A;  2WXJ A;  1VDY A;  4O1P A;  5AQ9 A;  2ZIR A;  2LUH A;  1QYM A;  5FQ7 A;  4RSY A;  2EIL E;  3ASO E;  4UI9 K;  2QFC A;  2UWJ G;  4WND A;  1Y6I A;  3FUH A;  5B1B E;  4HB5 A;  5H7P A;  4GPK A;  3TAX A;  5BXO A;  3L13 A;  2OOE A;  4APO A;  2H6G A;  2QZA A;  1O1T A;  4PS3 A;  3JYS A;  3TXM A;  2AWI A;  4OVV A;  3DWL G;  3AU4 A;  1E7U A;  3HIZ A;  4HOR A;  1Y8M A;  2L0I A;  3SF4 A;  5CER B;  4ABN A;  3RRN B;  4UI9 C;  3PDN A;  3P2B A;  1NFI E;  1Z5S C;  3PRZ A;  2ETB A;  4WNF A;  3JCK C;  3QB2 A;  2V8S E;  4NQ0 A;  2ETC A;  1EF1 C;  4FUL A;  4J8D A;  3E33 A;  3JQ0 A;  3LPZ A;  2HM8 A;  4HOS A;  5G04 C;  3X2Q E;  1AP7 A;  4GTO A;  4DJA A;  3ZYQ A;  2AJA A;  4JW1 A;  4GB9 A;  4N3A A;  5JJT A;  4Z68 A;  3PE3 A;  2RD0 A;  1SW6 A;  5EID A;  3ASH A;  4HRM B;  4FJY A;  4AEZ C;  2WB2 A;  4G1T A;  3EU5 A;  3RAU A;  2F8Y A;  2CHW A;  2J4D A;  5CEC B;  3MKQ A;  2L9B A;  2DBA A;  1SZ9 A;  2QYJ A;  4LEU A;  3FTV A;  3I4R B;  3FH7 A;  3FUE A;  2XRZ A;  1KLX A;  4HOT A;  2YNQ A;  3ZYK A;  1ZB1 A;  4DK5 A;  2UY1 A;  4BY6 A;  4GTP A;  4AOF A;  1DCQ A;  4BWR A;  4AM9 A;  3ZHE B;  3FWV A;  4BET A;  2GRR B;  4Q96 A;  2CFZ A;  5ENT D;  4GA1 A;  5FTP A;  4U7E B;  3HVE A;  3V79 K;  2XGS A;  2PM7 A;  2LXM A;  3RRU A;  1IYG A;  1TJC A;  3Q4A B;  3IEG A;  4MS6 A;  4JXT A;  3TWQ A;  4E85 A;  3PNT B;  4O1O A;  2X6K A;  4ZHB A;  3TGO A;  3MV2 B;  1TNB A;  3HXD A;  2EIM E;  4AVX A;  3FTX A;  2KZT B;  2WXO A;  3D9J A;  3NZU A;  3ZGQ A;  4AP2 A;  5AJL A;  3CR3 A;  3R9A B;  1MHQ A;  3DSS A;  3BG1 B;  5CCM A;  3MX3 A;  1HG5 A;  3OAW A;  4I2W A;  3RO2 A;  4AJW A;  3CVX A;  2EIK E;  3NAW A;  3Q79 A;  1FT1 A;  3ZFW A;  5AJD A;  3CHS A;  4HRN A;  1UJK A;  1QNF A;  4DLO A;  3S7F A;  3MA5 A;  3AJI A;  2EQX A;  3J5P A;  1V54 E;  3GYZ A;  3TG5 A;  2UY1 B;  1BD8 A;  4I17 A;  4J8E A;  3QKY A;  1L5J A;  2WXF A;  4ACK A;  1UW4 B;  1HU3 A;  4GZ6 A;  2VGX A;  3U4T A;  4MRU A;  5JHA A;  2Y69 E;  5D0O D;  4HNA D;  1UN8 A;  2VGY A;  3DBS A;  3EHM A;  4GAA A;  1OCR E;  3I4G A;  3ML8 A;  3SFY A;  5A23 A;  2OEW A;  1PY1 A;  3C3R A;  2WQH A;  4GTT A;  3Q47 B;  2BED A;  4G8L A;  5BW8 C;  3CKC A;  4A1S A;  5LFA A;  3Q5M A;  1K1A A;  1AWC B;  3DRA A;  3W9F A;  3R9M A;  3DXM G;  3NOC D;  3U9W A;  5FT9 A;  5FJY A;  2OEV A;  1O5M A;  1E7V A;  5CHE E;  4EBA A;  1WAO 1;  3QC1 A;  3S7D A;  4HLE A;  4UWG A;  3V2X A;  5FQ6 A;  2CG2 A;  3EHR A;  3BQO A;  4YVO A;  3ZXP A;  2J4B A;  3ASF A;  3CGH A;  3N71 A;  1IQU A;  4W9R A;  3C5R A;  4GZ3 A;  4BX9 A;  4EZJ A;  5D66 A;  4A55 A;  2XEE A;  5KJN A;  3VLE A;  3TWW A;  3IHV A;  2WXP A;  2JEK A;  4CZ2 D;  3CHM A;  3UM3 A;  4OAU C;  4XEI G;  3EIQ C;  4O6F A;  3QK0 A;  3LVQ E;  4KZ0 A;  1OWO A;  4UWH A;  4GTR A;  5ANL A;  2OVF A;  1QQE A;  4B94 A;  1KZO A;  2HO1 A;  2IFU A;  1OWP A;  3OXL A;  3DPD A;  4MLP A;  3AS5 A;  1IHG A;  2P58 C;  4B0Z A;  2DZN A;  3ZVV A;  2R17 C;  4DI4 A;  3L6A A;  4I43 A;  3CVU A;  3LKU A;  3Q7F A;  1SZA A;  2IQC A;  1PC2 A;  2FEZ A;  4J8Y A;  2VTB B;  3RSE G;  1EPU A;  4UQY A;  3BU8 A;  1FT2 A;  1OT8 A;  2L6J A;  3CVP A;  1E8Y A;  4JHJ A;  5BT1 A;  3DPY A;  4XX5 A;  5HRY A;  4YDY A;  5HKP A;  4AY6 A;  4A3T A;  1WDY A;  1Z3Y A;  4U8V D;  4GML A;  1NI1 A;  2WXK A;  2YHC A;  4RG9 A;  2LSU A;  2P9P G;  4JA9 A;  4G25 A;  4J0U A;  2VQ2 A;  2QC9 A;  3EDT B;  3KEZ A;  3OXF A;  4PS7 A;  2DZO A;  4F1P A;  3HXF A;  3GZ1 A;  1Z3X A;  4B8A A;  1TJF A;  3BG0 B;  2A5E A;  4B93 B;  3UPV A;  1H19 A;  2VSN A;  2P9L G;  5EX3 A;  3ASD A;  2HYZ A;  3PH0 C;  2WXQ A;  4ME2 A;  4XE0 A;  2JLB A;  3PE4 A;  3MEK A;  1TNO A;  2ZGG A;  3D9H A;  3URZ A;  4ANX A;  3FH8 A;  3VLF A;  5FZS A;  2HE0 A;  2A4Z A;  3NOG D;  1SQM A;  4ANV A;  4BER A;  5DIZ A;  4K03 A;  2J09 A;  3TWR A;  2BTD A;  5EIL A;  4ILH B;  4QFV A;  4ATZ D;  2VGX B;  3E4B A;  3QAQ A;  4HRL A;  4K5B A;  3CVW A;  4L23 A;  2V5Q C;  5CRV A;  3ULQ A;  3CIA A;  3RU0 A;  1OCO E;  2BKG A;  3UT8 A;  3EIJ A;  2R59 A;  3PZD A;  4JD2 G;  1H6K A;  3OXG A;  3CVV A;  5FZR A;  1OWM A;  4CT0 A;  4V3I A;  3ZYL A;  1LF8 A;  3TWX A;  3C3Q A;  3E30 A;  3PZ4 A;  3G2W A;  3IV0 A;  2MRI A;  4D10 C;  3CHP A;  4LUN U;  2CHZ A;  3S2A A;  2J8S D;  1MX2 A;  3B7U X;  3CV0 A;  3FEX A;  2WXG A;  1OXJ A;  3ZU7 B;  4WWP A;  1TEZ A;  4EQF A;  4XKB A;  3AG2 E;  2E2E A;  4AV7 A;  5C2Y A;  1OCZ E;  3QAR A;  1JCQ A;  2YIN A;  4YDW A;  1H6P A;  1HO8 A;  3O4Z A;  2ZGD A;  3APF A;  5AAR A;  2I1J A;  3SGH A;  5ENN A;  2F8X K;  1LD8 A;  4HLL A;  3DEO A;  3MKQ B;  4WWO A;  4KBQ A;  4HFG A;  3QWV A;  3S7B A;  4U8H A;  4AY5 A;  1OWN A;  1N4Q A;  3LVR E;  3J5Q B;  2Y3A A;  4DUI A;  5A6C A;  2WXR A;  3G2T A;  1YA0 A;  1Q2Z A;  5HQ8 A;  3SO8 A;  3GZ2 A;  3FUM A;  2WXL A;  1YYH A;  3SNX A;  2P9S G;  4GA2 A;  3LJ3 A;  5G55 A;  2CHX A;  2H6H A;  1H2T C;  3G2V A;  3Q7A A;  2X6I A;  2QY7 A;  2IEJ A;  3PZ3 A;  5EIB E;  4GZC A;  3B95 A;  5JJ7 A;  3Q9U C;  2DYS E;  1MX4 A;  4WNE A;  4FHJ A;  3RRM B;  4CGW A;  2L0T B;  4LER A;  1ELW A;  4G11 A;  1S64 A;  3U64 A;  3ZYM A;  3UIP C;  3PRE A;  1QBQ A;  2KCV A;  1HF8 A;  4IYP A;  4CDM A;  3CVL A;  1K1B A;  3FUJ A;  3ZN3 A;  4JZY A;  4HI9 A;  1KPS B;  4U63 A;  1HE8 A;  3SBT B;  2EIN E;  3FUF A;  4I1A A;  3JUI A;  1N0R A;  4GTV A;  2IOL A;  3D9I A;  4FA6 A;  3FTW A;  4I1M A;  3B13 A;  4GPM A;  4TV3 A;  1BLX B;  3ISM C;  2LO6 A;  4N5C A;  5BV0 A;  2J9Q A;  5CED B;  4RVB A;  3FTS A;  4Y6C A;  5C1D A;  1QZ2 A;  1N94 A;  1KT0 A;  3W9G A;  5T4Y A;  1HX8 A;  4U0S A;  4TUU A;  2XQ0 A;  1GW6 A;  2IO3 C;  2XCB A;  3KSQ A;  1RW2 A;  4RLY A;  3PZ2 A;  2J07 A;  3VLD A;  2LSV A;  5AEN A;  2FI7 A;  1N11 A;  4R7L A;  3UT4 A;  4U8Y D;  4NUR A;  4N2S A;  5LX8 A;  3K9I A;  2XCC A;  4NRH B;  2V4L A;  2X6J A;  1H0A A;  1INZ A;  3D3M A;  1ELR A;  1K3Z D;  2IOS A;  2P9K G;  2P2C P;  4UQZ A;  5AQ7 A;  2P9I G;  4KZC A;  4I9C A;  2I9C A;  3MJW A;  2GRM A;  2R2L A;  3Q9N C;  5M72 A;  1X81 A;  4YND A;  2XPZ A;  3Q78 A;  3CK9 A;  4GMJ A;  5HS0 A;  4ANU A;  4ILG A;  3KAE A;  2A5U A;  5KCM A;  3C3O A;  4TRQ A;  2PM6 A;  5B3S E;  2LNI A;  3UIO C;  2YHE A;  1ELK A;  3PS6 A;  2OCC E;  2HR2 A;  4I9E A;  3D9O A;  3RK6 A;  2F37 A;  5KJL A;  3LCA A;  5T3R A;  3BUA A;  4EEC A;  1U3C A;  3HXB A;  4NAC A;  3E32 A;  4APF A;  4BX8 A;  4HQD A;  1MX6 A;  2ZXW E;  3UUX A;  4U07 A;  1NA3 A;  4I6J A;  4RQI A;  1HXI A;  2FO1 E;  3UM2 A;  2BKK B;  5CCL A;  3LY9 A;  4Q69 A;  3T8M A;  4TXR A;  4A3V A;  5G04 J;  2ILR A;  3QOU A;  2FUL A;  5B1A E;  3EUV A;  2I6H A;  3LDZ A;  2KXP C;  3PUK A;  5KWD A;  3KS2 A;  5KNH D;  3ZXS A;  5FQ4 A;  4UQX A;  3IHY A;  1UG3 A;  4TXP A;  2GRN B;  3ONK A;  4YDE A;  3TWT A;  5CMW A;  4DX1 A;  2VYI A;  5E75 A;  3ZW3 A;  3G2S A;  3JQ1 A;  3MKR A;  5ENO D;  4DX2 A;  2J08 A;  2J49 A;  1WY6 A;  3AS4 A;  3FTY A;  3FHE A;  3FEY A;  2GGF A;  3D9L A;  2WVI A;  3DSU A;  4JC8 A;  2WXH A;  1BI8 B;  5EDS A;  1BU9 A;  5E76 A;  3I5P A;  3B7B A;  2XEN A;  4BSZ B;  4KXK B;  3AS8 A;  3NZS A;  3FUD A;  1E8Z A;  2Q7F A;  2FBN A;  3FU5 A;  4JPS A;  3TG4 A;  4P29 A;  4LSZ E;  3HXC A;  2JAB A;  3CEQ A;  2NC9 A;  4L2Y A;  5EKQ D;  1O1R A;  3QWW A;  4N39 A;  4KMO A;  3KEA A;  4BT9 A;  5JA4 D;  2FO7 A;  3ZHE A;  2IJG X;  2BUG A;  2RFM A;  1WG0 A;  1EDU A;  3ABK E;  2PQR A;  4PS8 A;  3UI2 A;  5AYW D;  3FY4 A;  2XS1 A;  3CVY A;  2NYJ A;  3APC A;  4LRZ A;  3MYV A;  2C2L A;  3SQV A;  3HDX A;  3WXX A;  1D8E A;  4XZ4 A;  1U2V G;  4BFR A;  4C9B B;  4CGV A;  4F6R D;  3QDN A;  4UI9 J;  3ZUV B;  3CQG B;  2KZT A;  4GCO A;  3L22 A;  2X6F A;  3L54 A;  4C0E A;  1N95 A;  1UN9 A;  5LCW J;  1IXV A;  5EN5 D;  2IU1 A;  4JHK A;  3R7Q A;  5BPP A;  5EYL A;  4U0Z A;  4XIF A;  1UOH A;  4DX5 D;  2Y4T A;  4AXH A;  2H6I A;  3EU9 A;  3SHF A;  2YQ8 A;  3JXJ A;  3FFL A;  4PUC A;  4GCN A;  3ZIM A;  2AXU A;  4IRU A;  4OVU A;  4F7A A;  1XGW A;  3SD5 A;  1E90 A;  2OVB A;  1N4R A;  1S63 A;  1NL4 A;  1A17 A;  4BES A;  3T8K A;  4OYS A;  4XKC A;  4CYM D;  5CBN A;  2AXV A;  3QWP A;  2F0Y A;  1DNP A;  2KCL A;  4GMR A;  4BEP A;  3ULY A;  1FPP A;  2H6F A;  4UUC A;  4QQI A;  3CK8 A;  3FP3 A;  2XRY A;  2VSY A;  3UXG A;  4ZFH A;  2XEV A;  2XS8 A;  2WPV A;  4JEH A;  5LP0 A;  2R02 A;  3NBN B;  4EZK A;  4CDN A;  3D9M A;  2DYR E;  3AG3 E;  3UT7 A;  1DC2 A;  5AAO A;  4PH4 B;  5FIO A;  2GRL A;  5KJM A;  5FIN A;  2RKK A;  3CVQ A;  3B7R L;  5CRU A;  1E8W A;  4GA0 A;  4I6G A;  5EX0 A;  3LS8 A;  5JMN D;  4K5A B;  1JWF A;  4DX6 D;  1MYO A;  1PAQ A;  4FU3 A;  1B89 A;  2CG3 A;  3MGB A;  4H7Y A;  3UKR G;  3SY2 A;  3L17 A;  2RG8 A;  3KSL A;  3IBE A;  4N2Q A;  3L82 A;  3TL5 A;  4F3V A;  1O1S A;  3CSF A;  4N5Q A;  4I6E A;  3S7J A;  3DSX A;  3DXK G;  4ANW A;  1RZ4 A;  4Y6W A;  4UWK A;  3ABL E;  3D9N A;  2I2O A;  2E0I A;  2XZD G;  5ENR D;  2PQN A;  4K5C A;  1S0P A;  3UM0 A;  3SZ7 A;  1V55 E;  4G26 A;  5G05 J;  5ENQ D;  2KAT A;  2GRP B;  3ASG A;  4TXQ A;  2WMO A;  4ILI A;  4EPZ A;  4DPR A;  2CFU A;  2V0P A;  4C0M A;  4F1S A;  3Q73 A;  5DBK A;  2WM9 A;  3CHO A;  1JPL A;  5ITZ F;  1TNU A;  2EIJ E;  3SBS A;  2R03 A;  3B7S A;  3DEP A;  3G2U A;  1TNY A;  2GRO B;  2DWZ A;  1W3B A;  3ASN E;  4URK A;  1H2U A;  5D2M C;  3VTX A;  3CVN A;  1FVH A;  2IF4 A;  4N3B A;  1LD7 A;  3CLJ A;  4JB8 P;  3T5X A;  1FVF A;  2LAI A;  4I1O B;  3CKB A;  3FUI A;  4BTA A;  5G05 C;  1HG2 A;  3CST A;  1UJJ A;  3FU0 A;  2P9N G;  3TJP A;  2PZI A;  1DCE A;  3FTU A;  5A7D B;  1JUQ A;  2KC7 A;  4FHK A;  3CK7 A;  1IHB A;  3IXE A;  4K0R A;  1SA4 A;  5AN8 A;  2LAH A;  3TWV A;  2PNN A;  4J8F A;  3VTY A;  1DVP A;  1N52 A;  2X38 A;  3F6Q A;  3HRA A;  5JHB A;  1A5E A;  4J7W A;  1U3D A;  4CT4 A;  1YMP A;  3U66 A;  3UM1 A;  5ARF A;  1IKN D;  4G2V A;  5ARG A;  3LY7 A;  4KVO A;  2X6H A;  5BUZ A;  2C0M A;  4KYO B;  4M3O A;  1H2V C;  3U3W A;  3FUN A;  2NSZ A;  4WUY A;  3APD A;  4B89 A;  3LEW A;  1HH8 A;  4A1G A;  2KBX A;  3QNK A;  3I3N A;  1MZC A;  4TUM A;  4JEU A;  5J90 A;  3ML9 A;  1TYQ G;  4OAV B;  1TR4 A;  3EJN A;  4E6H A;  2XGO A;  1TNZ A;  1ZU2 A;  5FQ8 A;  3KD7 A;  3MCX A;  3T9K A;  3ZPJ A;  1TN8 A;  4BSX A;  2RFA A;  3PNL B;  3NQP A;  4GTM A;  1TN7 A;  5T8I A;  3UKU G;  5CBO A;  4IUL A;  4X8Q A;  4FLB A;  3EHQ A;  3E37 A;  4EZL A;  3BEE A;  4KVM A;  3GZS A;  4J8S A;  2XPY A;  2WXM A;  3PZ1 A;  3OTN A;  4NIK A;  3DSV A;  4L2L A;  4G23 A;  4WWN A;  2P9U G;  2MHK A;  5BXU A;  1OWL A;  5HI7 A;  4GTS A;  4HOQ A;  3C72 A;  4HXI A;  1KZP A;  3GW4 A;  1MQS A;  3JXI A;  3P1U A;  3ZEF A;  2L6B A;  3D9P A;  3TWS A;  1N4P A;  3PEV B;  4WAF A;  4LNU D;  4BT8 A;  4U96 D;  3TWU A;  1ZBP A;  1HS6 A;  4FLH A;  4Q94 A;  3V30 A;  1MJ0 A;  5AQA A;  4YVQ C;  4F53 A;  4WNG A;  4UWF A;  3UMV A;  2PL2 A;  1X5B A;  3FH5 A;  4GZ5 A;  5LCW C;  4J6I A;  5ANR A;  1H6O A;  4DLQ A;  3R7R A;  3ENE A;  2OND A;  2B0O E;  2DCP A;  5JJ6 A;  2WXN A;  3LXU X;  1NA0 A;  5BNW A;  2QYU A;  4JVS A;  3PVL A;  3ZNG A;  3SI5 A;  4ACL A;  1FCH A;  2WQ7 A;  4O60 A;  3NF1 A;  3HG0 D;  3V2O A;  5G2N A;  3IKO B;  3C98 A;  3EHN A;  3ZRH A;  2FF4 A;  2DVW A;  3JUE A;  4I2Z A;  1E8X A;  4PDX A;  1D9S A;  4LNB A;  1BPO A;  1SVX A;  4EHM A;  4C48 B;  3HHM A;  2DIW A;  3HVE B;  3AG4 E;  3RKV A;  3DSW A;  3LJN A;  1SA5 A; 
#chains in the Genus database with same CATH homology
 1BI7 B;  4LG6 A;  3B95 A;  5KNH D;  1K1A A;  1N11 A;  1IKN D;  1OY3 D;  3Q9U C;  3V31 A;  5ENQ D;  5KBA A;  4U8Y D;  1MX4 A;  3TWQ A;  1AWC B;  5HRY A;  3W9F A;  2XZT G;  4YDY A;  4O1O A;  1AP7 A;  4UUC A;  2MYO A;  4ZHB A;  4F6R D;  3JXI A;  2J8S D;  5HKP A;  3TWT A;  3NOC D;  5AQB A;  2L6B A;  1WDY A;  4DX1 A;  2AJA A;  4QQI A;  1MX2 A;  3TWS A;  3ZUV B;  4U8V D;  3UXG A;  4Z68 A;  5ENS D;  4ZFH A;  4LNU D;  5ENO D;  4DX2 A;  4U96 D;  3TWU A;  3V30 A;  2KBX A;  3ZU7 B;  1K3Z D;  1SW6 A;  5EID A;  1MJ0 A;  5AQA A;  2P2C P;  5ITZ F;  4O1P A;  3NBN B;  5AQ7 A;  4HRM B;  4TUM A;  5AQ9 A;  2QC9 A;  3V2X A;  1K1B A;  1QYM A;  3EHR A;  5EYP F;  4YDW A;  3Q9N C;  3DEP A;  3C5R A;  2ZGD A;  5AAR A;  1IXV A;  2DZO A;  4HI9 A;  5EN5 D;  1BI8 B;  5HS0 A;  4OAV B;  4F1P A;  5AAO A;  1DC2 A;  2DWZ A;  1BU9 A;  2F8X K;  5FIO A;  4HBD A;  2F8Y A;  4HLL A;  1TR4 A;  5D66 A;  2XEE A;  3DEO A;  5EYL A;  5CEC B;  2A5E A;  5FIN A;  4B93 B;  1N0Q A;  3B7B A;  4G8K A;  2XEN A;  4U95 D;  3TWW A;  4BSZ B;  2V4H C;  1N0R A;  2B0O E;  4HRN A;  4CZ2 D;  1UOH A;  4HB5 A;  4A63 B;  4OAU C;  4DX5 D;  5BXO A;  3T9K A;  1S70 B;  2QYJ A;  5JMN D;  2ETA A;  4K5A B;  4DX6 D;  4JB8 P;  1MYO A;  3EU9 A;  4GPM A;  3AJI A;  4LSZ E;  2ZGG A;  1BLX B;  3D9H A;  3J5Q B;  3J5P A;  4DUI A;  3ZNG A;  2Y0B G;  2F37 A;  2JAB A;  3JXJ A;  1G3N B;  5KNG A;  2RFA A;  2HE0 A;  1BD8 A;  5CED B;  5CEA A;  4O60 A;  3HG0 D;  3NOG D;  3V2O A;  5CBO A;  3TWX A;  4HQD A;  1MX6 A;  3KEA A;  4BER A;  3EHQ A;  2XEH A;  3SO8 A;  1DCQ A;  4DRX E;  5EIB E;  5JA4 D;  3W9G A;  2DVW A;  4HI8 A;  3JUE A;  5ENP D;  2FO1 E;  4N5Q A;  3TWR A;  2BKK B;  5CER B;  1IHB A;  5EIL A;  4HNA D;  3IXE A;  2VGE A;  2RFM A;  4QFV A;  1WG0 A;  1YYH A;  2DZN A;  5AN8 A;  4ATZ D;  5KWD A;  4HRL A;  4K5B A;  1D9S A;  2V5Q C;  3TWV A;  4BET A;  4BES A;  3UTM A;  2PNN A;  2BKG A;  3T8K A;  3UI2 A;  1SVX A;  4CYM D;  5ENT D;  1NFI E;  4NIK A;  3ZKJ A;  5CBN A;  4RLY A;  4C48 B;  3V79 K;  2ETB A;  3F6Q A;  2XZD G;  3HRA A;  2NYJ A;  4J8Y A;  5BXU A;  2ETC A;  4G8L A;  1A5E A;  4GMR A;  2Y1L E;  2KXP C;  4J7W A;  4BEP A;  3LJN A;  5ENR D;  4DX7 D;  1YCS B;  3AAA C;  4K5C A;  1YMP A;  1OT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...