3TWTA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human mcl1 (chimeric peptide)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
156
structure length
156
Chain Sequence
NSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
molecule keywords Tankyrase-2
total genus 47
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twtA00
4U96D 4J8YA 5KNGA 5ENRD 1N0QA 3J5QB 4DX7D 5JA4D 3EHQA 5FIOA 2DWZA 2P2CP 2ZGGA 1BU9A 3DEPA 4BEPA 2JABA 4GPMA 5CERB 3EU9A 1G3NB 1UOHA 3JXJA 2KBXA 3JXIA 5EYPF 4O60A 2XZDG 2PNNA 1IKND 4RLYA 1SW6A 3V79K 4U8VD 3V2XA 5AAOA 5BXUA 2ZGDA 2Y0BG 1IHBA 5FINA 5EN5D 1MJ0A 3LJNA 2BKGA 3DEOA 3EHRA 3V30A 4HI9A 4CYMD 2F8YA 1BI7B 2MYOA 1OT8A 4U95D 2NYJA 3ZU7B 4CZ2D 2V5QC 3C5RA 1K1BA 2BKKB 2DZOA 1K1AA 5AN8A 4K5AB 1MX2A 4K5CA 4LG6A 4HB5A 3UI2A 5CEDB 5ITZF 1S70B 3J5PA 5ENPD 1TR4A 1YMPA 4HRNA 3NOGD 5D66A 1DCQA 4NIKA 4YDWA 5EYLA 5ENSD 1SVXA 1YCSB 2RFMA 4DUIA 2AJAA 3TWUA 3V31A 4LSZE 3AAAC 3F6QA 5AARA 3D9HA 3IXEA 5ENTD 5HS0A 4OAVB 4C48B 5BXOA 2XENA 2ETCA 3TWTA 4BESA 5AQAA 2Y1LE 3TWSA 1OY3D 3UXGA 2HE0A 1BI8B 1BD8A 4HNAD 4K5BA 5AQ7A 3SO8A 2A5EA 3W9GA 2KXPC 2RFAA 2QYJA 4B93B 4QFVA 1K3ZD 1BLXB 4ATZD 1N0RA 4A63B 5KWDA 3TWRA 2V4HC 2ETAA 3TWWA 2F8XK 4QQIA 3V2OA 4DX1A 4HI8A 4Z68A 3B7BA 5CECB 4ZHBA 4OAUC 4DX5D 4LNUD 5KBAA 4YDYA 5CBOA 3JUEA 4HQDA 3T8KA 1N11A 1A5EA 4DX2A 5KNHD 3B95A 3ZKJA 4F1PA 3HRAA 4G8KA 5AQ9A 3KEAA 2DVWA 1YYHA 2ETBA 4HRMB 4TUMA 5JMND 3TWQA 1DC2A 1IXVA 2F37A 5ENOD 3UTMA 3ZUVB 1AP7A 5EIBE 3AJIA 4UUCA 5AQBA 2J8SD 4N5QA 4O1OA 4O1PA 4ZFHA 1WG0A 4HRLA 3Q9NC 3W9FA 1MX6A 2FO1E 3TWXA 5HRYA 2DZNA 3NOCD 2QC9A 4DX6D 1D9SA 3ZNGA 2XEHA 4DRXE 4BERA 5CBNA 1QYMA 5ENQD 4F6RD 1AWCB 4GMRA 3HG0D 3TWVA 4BETA 5CEAA 4JB8P 4J7WA 2L6BA 5EIDA 4HLLA 4HBDA 2VGEA 5HKPA 3NBNB 4G8LA 1MYOA 2B0OE 2XEEA 2XZTG 4BSZB 5EILA 1WDYA 3Q9UC 4U8YD 3T9KA 1MX4A 1NFIE
chains in the Genus database with same CATH superfamily
1JUQA 4GCNA 1MZCA 3LDZA 4HOUA 3ZXPA 3C3QA 1H19A 3RO3A 5AYWD 2NSZA 4HS2A 1IQUA 3FTWA 2WMNA 4O60A 3UPVA 3SQVA 3E32A 3FU0A 4LUNU 3DPYA 2VGYA 4ANWA 3R9AB 3ASOE 5EX3A 2H6GA 5LOZA 1SQMA 2V5QC 4JC8A 2BKKB 5AN8A 4LG6A 3KS2A 3R7RA 4I9EA 4WNFA 4NIKA 3ZRHA 1N94A 4I2WA 4WWOA 4CRWA 5H7PA 1NP7A 3FTUA 1TNOA 3D9PA 3DSTA 5AQAA 2YNQA 1OY3D 1V55E 3PZ1A 2VGXB 3BEEA 3G2WA 1U2VG 3CVPA 1S63A 2GRPB 4TXQA 3CVXA 3UT8A 2PM7A 4DX5D 4UWHA 1E7VA 3LJ3A 1KZOA 4CT4A 4UI9J 2QYUA 4KVOA 4DLOA 3KEAA 1YYHA 2VTBB 1NA0A 3VLEA 5KJKA 2BEDA 3AJIA 2R03A 4Q96A 3FUFA 4O1PA 3ZW3A 3CHQA 4M3OA 3D9MA 3FFLA 3ZNGA 2HM8A 3WG7E 3MJWA 1NZNA 3B7UX 4HBDA 2B0OE 1LD8A 1EDUA 4U07A 5ENRD 4LERA 5HI7A 4L1BA 3DEPA 3OAWA 3SF4A 3JXJA 5FZRA 5BV1A 3MV2B 5EYPF 1E8ZA 5AAOA 3Q15A 3SGHA 3PS6A 2AVPA 4U95D 2IOSA 2XS8A 3C5RA 2J4BA 3HYMB 2ZU6B 4I6JA 4G2VA 3UT7A 1HFAA 3ABKE 3LY9A 4CT0A 1QNFA 5ENTD 4A3TA 2ETCA 4JA9A 5AQ7A 2CG2A 2RFAA 4KXKB 3TWRA 3UMVA 2CHWA 1N95A 1TNZA 3PE3A 5FJYA 3NF1A 3NB2A 3FUDA 1RW2A 3FTVA 5A6CA 2BUGA 2MOWA 4EHMA 4E6HA 4N3AA 4FP7A 3T5VA 3QWWA 2EIME 2L0TB 3FUIA 3ESKA 5AJDA 2DZNA 4LEUA 4NURA 1N4PA 4MS6A 3EJNA 2Y69E 1HF8A 4UWFA 3GZ1A 3FTXA 3CEQA 3KAEA 2QY7A 4GTPA 3DWLG 4HOQA 2XEEA 2Y4TA 1TNBA 1N54A 1TN6A 2WXOA 1N0QA 5FIOA 3RAUA 4PH4B 4F3VA 5LCWJ 3EU9A 3L9TA 5B1BE 3QC1A 3UM0A 3K9IA 3CK8A 3LVQE 2VGXA 3MA5A 1W3BA 2BKGA 3V30A 4GMLA 4GZDA 3CHRA 3FHEA 3UI2A 5CEDB 2V8SE 2ZISA 4K5CA 4ATGA 3P2BA 3FUJA 3NOGD 2OVFA 2J49A 3G2UA 3C98A 4C0MA 3CGHA 3CVQA 5T8IA 3UQ3A 2P58C 3RRNB 4ANUA 1N11A 5G04J 2L6JA 3ZKJA 3HRAA 4NACA 2DVWA 4HRMB 2OV8A 3UTMA 3EHNA 2LSUA 2KC7A 4N5QA 2WB2A 5FQ6A 4WNEA 4BERA 3TWVA 1ZB1A 3KSQA 3NBNB 1QZ2A 3DXMG 1DVPA 2XRZA 4U8YD 3DSUA 3ZYMA 2KCKA 3MZLB 4J8YA 5KNGA 3UM2A 3UX4A 3LY8A 4I6EA 3FUKA 2X6FA 2MHKA 3I3NA 4U0UA 3C72A 3UIPC 4LCTA 4DJAA 4ILHB 3S7BA 2IOLA 2Y0BG 3ABLE 2X38A 4Y6CA 5D0QD 2GRRB 5B3SE 3D9JA 2UWJG 4KZ0A 4XKBA 2I1JA 2PQRA 2WXPA 1E8XA 4JVSA 1HH8A 1YCSB 1PAQA 2FF4A 4BTBA 2XCBA 2XENA 1NL4A 3LEWA 2WXIA 3TGOA 2A5EA 4U04A 2QYJA 5KWDA 2IF4A 1Z3XA 2F8XK 1HS6A 5FTPA 4YDOA 3GZSA 4G1TA 4L2YA 1LF8A 5KNHD 2CHXA 4G8KA 1Y8MA 3PDNA 4XX5A 1S64A 3TWQA 2HO1A 2V5FA 1IXVA 3ENEA 3FWVA 3DRAA 5EIBE 4PS3A 4WUYA 2J8SD 3AS4A 4LNGA 3ZVVA 1TEZA 4A1SA 1FCHA 1YA0A 2AXZA 3EUVA 2QZAA 4DI4A 2HYZA 5J90A 3MKQA 4Q69A 3SFXA 5FQ4A 1DNPA 5EILA 4W9RA 5M72A 1MX4A 5KBAA 3PNLB 2LSVA 4FLHA 4ACLA 2V0PA 4FHJA 3FTSA 4DLQA 5JJ7A 4GU5A 2AXVA 2YHEA 5CERB 1KPSB 4EZKA 4GA0A 4GA2A 3V2XA 5AJLA 2EIKE 2C0MA 3I4GA 4H7YA 1EPUA 2PZIA 2DYSE 4Y6WA 3CLJA 2IY0C 3LYAA 3J5PA 3G2SA 1YMPA 2R2LA 1DCQA 4AOFA 5ENSD 2A5UA 3F6QA 3D9HA 3ZHEA 5HS0A 5BXOA 4TXRA 2PL2A 2I9CA 3ZFWA 4BT8A 2X6JA 1K3ZD 3EDTB 2V4HC 3FUNA 3UM1A 2WXRA 3FY4A 2X6HA 4U63A 3ASDA 2KCVA 1A5EA 2FEZA 1E96B 4N2QA 3PUJA 2XPIA 1NI1A 4GZCA 4UUCA 2PQNA 4OVVA 1XGWA 3IEGA 4O1OA 4HRLA 3Q9NC 3JCKC 2WQ7A 2P9PG 4I9CA 4J7WA 4ANXA 2J09A 4B8AA 4I1MA 3FU3A 2YQ8A 3EHQA 5ARGA 4J6IA 3Q75A 3ML9A 5J08A 3S7DA 3SI5A 4RLYA 2VSNA 3DXKG 2AXUA 1WM5A 3D9OA 2JLBA 5G55A 4CYMD 1H2TC 2NYJA 2WXMA 3Q7AA 2X3MA 3RO2A 3LS8A 2AJAA 4XEIG 3V31A 3AAAC 5AARA 3BQOA 3VLDA 3HVEB 2WMOA 1Q2ZA 4QFVA 2RG8A 3D9NA 4G23A 3V2OA 2J07A 4HI8A 3B7BA 5BT1A 5CECB 5ARFA 1KZPA 4R7LA 2GROB 1PC2A 2C2LA 2GRQB 5A7DB 3RJVA 2VYIA 3CKBA 2P9KG 5A23A 5ENOD 1HG2A 1DCEA 2R02A 2FBNA 3DSWA 3L08A 2X6IA 4WAFA 1AWCB 3DSVA 1UN8A 1HX8A 4CDMA 2VGEA 1MYOA 3T9KA 3PE4A 2DWZA 3IKOB 1UOHA 4AM9A 4FA6A 1SA5A 1E90A 1OUVA 2PNNA 1IKND 4U8VD 3SHFA 2IFUA 2VJ8A 1Y6IA 1V54E 3ASGA 1MJ0A 1MQSA 2AWIA 3ULYA 3VLFA 4KYOB 4J0UA 1K1BA 3SFZA 5CRVA 2OVBA 4YNDA 3CSFA 2Y3AA 4MRUA 3TWUA 2XS1A 5CRUA 3APDA 2XPZA 3CQCB 4ANVA 1WY6A 1HG5A 1PY1A 3BU8A 4N3CA 5CMWA 3UKUG 3ZIMA 3UIOC 2KXPC 2CHZA 3CK7A 4E85A 4DX1A 1JCSA 3R9MA 1FPPA 3HIZA 4XI9A 4P29A 3X2QE 4HQDA 3WXXA 5EX0A 1SA4A 2ZXWE 2ETBA 3LPZA 2H6IA 4AV7A 3MV3B 3EU5A 1H2VC 5G04C 3W9FA 4HLEA 1MX6A 1K8KG 3PH0C 3CVUA 3FUHA 4G25A 4GMRA 1ELRA 3DBSA 2EINE 4HLLA 2QFCA 5HKPA 3ULEG 4AIFA 4JA7A 5ENNA 3QARA 4BWRA 4AP2A 5EN5D 3E30A 3J5QB 3G2TA 5EKQD 4XZ4A 1IHGA 3I5PA 5E76A 2R05A 2KCLA 1FT1A 2H6HA 4N5CA 4GTVA 3U3WA 4LRZA 5T3RA 4RG6A 1BI7B 2I2OA 3JYSA 5D66A 4YDWA 1H6KA 4F1SA 4DUIA 2LXMA 5E75A 3FEYA 4F7AA 2XGMA 4GZ3A 4EQFA 2F0YA 3TWTA 3FTYA 1BPOA 3ASHA 1BI8B 2OEWA 3ZYKA 4ATZD 4AEZC 2DCPA 2GGFA 3L17A 4ME2A 5FWQA 1UG3A 4OAUC 3QNKA 4B0ZA 2LAHA 3UKRG 5AIJA 4GTOA 1HE8A 4GZ6A 2RD0A 4G24A 3KSLA 3CHOA 3PZDA 1JCRA 3RK6A 4DX6D 5BPPA 2DIWA 3IHVA 1ZU2A 5LX8A 1O5MA 4J8FA 4KBQA 3IBEA 1ELKA 1P5QA 3PREA 1G3NB 3TG4A 3N71A 1H2UA 3LCAA 2BTDA 3RRMB 5JHBA 3EHMA 4YDEA 2ZGDA 1TJFA 2LUHA 1KLXA 2GRMA 3QJZA 2MYOA 5KCMA 1HU3A 1MX2A 3B7RL 2L0IA 1S70B 2OEVA 4CCAA 2RFMA 4JHRA 1OWOA 1TN7A 2XGSA 4K0RA 4D10C 4PS7A 3HXEA 4OAVB 2CFZA 4GYYA 4BESA 2Y1LE 3W9GA 2E0IA 3FH8A 1UW4B 3CVNA 4FLBA 3U4TA 1N0RA 3HDXA 2WXKA 4YVQC 4HORA 2WXHA 2KATA 3FP3A 1IQRA 4X8QA 4FADA 5G05C 3ABME 3GZ2A 2B6CA 4TUMA 2P9SG 1X81A 4GTMA 5AQBA 4G11A 4EZJA 3ML8A 3LY7A 3APCA 4O6FA 1OCOE 2L6BA 1HZ4A 3PRZA 3G2VA 5HQ8A 5D0OD 4U0ZA 3OXGA 2ILRA 3SD5A 2NC9A 4UWLA 4FJYA 1UN9A 1LD7A 3L54A 3RRUA 1JWFA 3BUAA 3JUIA 3AU5A 3E4BA 3S7FA 3FDHA 3ZXSA 3PVLA 4CZ2D 2J9QA 1KT0A 4JEHA 1OWMA 1Z6TA 1WAO1 2XHEA 2UY1B 3ZGQA 5CCLA 2R5SA 1OWPA 4M7CA 3TWSA 5FT9A 2HE0A 4HNAD 4AVXA 4XI0A 4U8HA 3NZSA 4IYPA 3URZA 4N2SA 2WVIA 5JJTA 4NQ0A 4YDYA 1B89A 3OXLA 4KT6B 4HOSA 4HOTA 3FULA 3B7SA 5AQ9A 3S2AA 3Q78A 1GW6A 1DC2A 3CV0A 2X6KA 2LAIA 1UJJA 3BG0B 3AG2E 4EBAA 4TXPA 3D9KA 2R17C 3NQPA 5ENQD 2OCCE 1KT1A 2IJGX 3FUEA 3ISMC 4L9PA 2P9NG 1FVHA 4DX7D 2ZGGA 3QWPA 3NAWA 2IO2C 1OCZE 2FO7A 4UQXA 4JZYA 4ILGA 1SW6A 4YVOA 3MKRA 3SY2A 1H6PA 4EECA 2OOEA 4CGWA 2IU1A 4AXHA 1OT8A 4ACKA 5KJLA 2DZOA 1K1AA 5ITZF 1E8WA 3PZ3A 3T5XA 5ENPD 3ASFA 2CG3A 3Q79A 3AU4A 3C3RA 2XCCA 3C3OA 2AW6A 2KM4A 2MRIA 3FH5A 4GTTA 1OWNA 3QKYA 4KMOA 3SO8A 4ILIA 3D9IA 1XNFA 4XE0A 2IONA 3UM3A 4FJZA 3HVEA 1NA3A 3Q4AB 3L22A 4GTRA 2DBAA 5CCMA 4A1GA 4FULA 4B94A 3B95A 2I6HA 4F1PA 4DI3A 1E7UA 4MKTA 3CR3A 1N9AA 2F37A 4JHKA 3ZUVB 3EIQC 4U7EB 3O48A 3FU5A 4FC8A 5C1DA 3TAXA 3TWXA 3L82A 4C0EA 1D9SA 3D9LA 3RSEG 5AENA 2EQXA 1JWGA 1N52A 3SZ7A 3E34A 4GPKA 2HR2A 3UT4A 3TJPA 3PZ2A 1TNUA 2I1KA 2P2CP 1VDYA 3FTZA 2GRLA 2UY1A 2EILE 4TRQA 4IRUA 2E2EA 3HXFA 2IEJA 5C2YA 5BUZA 4RQIA 4BFRA 4AY5A 4K5AB 1QBQA 4HRNA 3PNTB 4LSZE 4GA1A 3HXBA 2VSXE 3UINC 3OTNA 2WXGA 2P9LG 2VSOE 3AG4E 3LKUA 4DPRA 1BD8A 3ONKA 4V3IA 4B93B 2YHCA 2P9IG 3U66A 3CVWA 4L2LA 2WQ6A 4PDXA 3ZEFA 4JL0A 3T8KA 4UI9K 5ANLA 3U9WA 1E8YA 4ABNA 4GAAA 3CHPA 4ZFHA 3L13A 3QB2A 3PUKA 2GW1A 3QWVA 3Q73A 3B13A 3CIAA 3Q49B 3ZYQA 4K03A 3QK0A 2XZTG 5BNWA 4GMJA 1EF1C 2L9BA 5JA4D 3CKCA 3DPDA 4MLPA 3L6AA 2P9UG 3BG1B 4UWKA 1OCCE 3GW4A 1TNYA 3CQGB 3RU0A 1OXJA 3U64A 5BXUA 4GTSA 5FINA 1D8DA 4JHJA 5FQ7A 1FVFA 3DEOA 4N39A 3ZU7B 3HXCA 3LVRE 4HB5A 1JPLA 3HXDA 5LP0A 3CK9A 1FT2A 3AS8A 1N4QA 5FZQA 3ZN3A 1X5BA 3FEXA 1Z5SC 2BF0X 4GYWA 4Q94A 2YINA 1Z3YA 2ONDA 4I6GA 4C48B 2WXNA 3IV0A 4WWNA 3UXGA 4N3BA 4UI9C 2ETAA 3TWWA 4QQIA 4BTAA 5BW8C 4UWGA 5CBOA 1LTXA 4DX2A 1HXIA 3E33A 5LFAA 3MX3A 3QOUA 3CSTA 4BT9A 4RG9A 4JW1A 4LNBA 4I1AA 4KVMA 3MGBA 1SZAA 1N4RA 2FO1E 2QC9A 4A3VA 3VTXA 1H6OA 4F6RD 4I2ZA 3DSSA 5EIDA 5CMYA 1O1RA 4JEUA 4BX9A 2FI7A 3Q9UC 3FUMA 5LCWC 4U96D 4NRHB 3PEUB 5ANRA 4CGVA 3OXFA 2ZIRA 4BEPA 4GYOA 4A55A 1EYHA 3JXIA 5FZSA 3V79K 4B89A 3CVLA 3SBSA 2VQ2A 4EZLA 3ONLA 1U3CA 3MKQB 4BSXA 4AJWA 4GB9A 4APFA 4PS8A 3UUXA 3ZPJA 2VSYA 1TR4A 2KZTB 1SVXA 4XIFA 2LNIA 2NXPA 1O1SA 1RZ4A 1TN8A 4PUCA 3SNXA 3TXMA 4URKA 3Q47B 1UJKA 4FHKA 4I43A 3T8MA 2KZTA 4U0SA 2V4LA 3I4RB 2WM9A 3KD7A 5KJNA 2Q7FA 2R59A 3MEKA 5FQ8A 4WNDA 3O4ZA 2CFUA 3VTYA 5EDSA 4OVUA 2J08A 4GTQA 2WXJA 2XRYA 1AP7A 2WQHA 4APOA 3RKVA 3ZHEB 3NOCD 3HHMA 2XEHA 1ZBPA 3HG0D 5CEAA 4JB8P 3APFA 1HO8A 4BSZB 1O1TA 1WDYA 4TV3A 3IXEA 4CDNA 2Y4UA 4H7XA 4L23A 3MYVA 4UQZA 1BU9A 4KZCA 3QAQA 3L16A 4J8DA 3KEZA 2XZDG 4DK5A 2FULA 2JEKA 1IHBA 1N4SA 4HFGA 1A17A 2GRNB 4L7TA 4HI9A 3ZYLA 4GZ5A 1INZA 3RIBA 4J8SA 5JJ6A 4IN3B 1IYGA 1TJCA 2XPYA 1ELWA 4RSYA 2PM6A 4J8EA 3P1UA 4RVBA 3FU6A 1BLXB 4A63B 3JQ1A 2XQ0A 5IY5E 4Z68A 3Q5MA 3Q7FA 3LXUX 5DBKA 3JUEA 3NZUA 4BY6A 3PZ4A 4F53A 2J4DA 2LXLA 4HVBA 3PEVB 5T4YA 3MCXA 5JMND 3SBTB 4JD2G 5BV0A 5B1AE 1WG0A 3ESLA 3ASNE 2IO3C 4CDRA 3CVVA 4DRXE 4OYSA 4BETA 4BX8A 1SZ9A 4G8LA 1JCQA 3TXNA 4WNGA 2EIJE 3CVYA 2VTBA 2WXQA 1NFIE 1D8EA 3AG3E 4CEMA 3GYZA 3TL5A 4XKCA 2H6FA 2JABA 4GPMA 2RKKA 1OWLA 4AY6A 4I1OB 3DSXA 2KBXA 2XEVA 3JQ0A 3IHYA 5CHEE 2XGOA 1L5JA 2C0LA 1TYQG 4I17A 3AS5A 3LJNA 3B7TA 1MHQA 3R7QA 3EHRA 3AG1E 2F8YA 1H0AA 2WPVA 4G26A 5DIZA 4WWPA 2IQCA 1S0PA 3ULQA 2A4ZA 2LO6A 5EYLA 3QDNA 4HXIA 3FH7A 5G2NA 3TG5A 5JHAA 3CHSA 4MBGA 4K5BA 3CHMA 4IULA 3S7JA 2M63A 4JXTA 5D2MC 3E37A 4JPSA 4ZHBA 2WXFA 5G05J 4LNUD 1QQEA 4B8CB 4UQYA 5KJMA 3SFYA 3D3MA 4GCOA 4FU3A 1U3DA 4C9BB 5HRYA 5CBNA 1QYMA 2WXLA 4TUUA 2DYRE 4EPZA 1OCRE 3EIJA 4EBAG
chains in the Genus database with same CATH topology
4U96D 4J8YA 5KNGA 5ENRD 1N0QA 3J5QB 4DX7D 5JA4D 3EHQA 5FIOA 2DWZA 2P2CP 2ZGGA 1BU9A 3DEPA 4BEPA 2JABA 4GPMA 5CERB 3EU9A 1G3NB 1UOHA 3JXJA 2KBXA 3JXIA 5EYPF 4O60A 2XZDG 2PNNA 1IKND 4RLYA 1SW6A 3V79K 4U8VD 3V2XA 5AAOA 5BXUA 2ZGDA 2Y0BG 1IHBA 5FINA 5EN5D 1MJ0A 3LJNA 2BKGA 3DEOA 3EHRA 3V30A 4HI9A 4CYMD 2F8YA 1BI7B 2MYOA 1OT8A 4U95D 2NYJA 3ZU7B 4CZ2D 2V5QC 3C5RA 1K1BA 2BKKB 2DZOA 1K1AA 5AN8A 4K5AB 1MX2A 4K5CA 4LG6A 4HB5A 3UI2A 5CEDB 5ITZF 1S70B 3J5PA 5ENPD 1TR4A 1YMPA 4HRNA 3NOGD 5D66A 1DCQA 4NIKA 4YDWA 5EYLA 5ENSD 1SVXA 1YCSB 2RFMA 4DUIA 2AJAA 3TWUA 3V31A 4LSZE 3AAAC 3F6QA 5AARA 3D9HA 3IXEA 5ENTD 5HS0A 4OAVB 4C48B 5BXOA 2XENA 2ETCA 3TWTA 4BESA 5AQAA 2Y1LE 3TWSA 1OY3D 3UXGA 2HE0A 1BI8B 1BD8A 4HNAD 4K5BA 5AQ7A 3SO8A 2A5EA 3W9GA 2KXPC 2RFAA 2QYJA 4B93B 4QFVA 1K3ZD 1BLXB 4ATZD 1N0RA 4A63B 5KWDA 3TWRA 2V4HC 2ETAA 3TWWA 2F8XK 4QQIA 3V2OA 4DX1A 4HI8A 4Z68A 3B7BA 5CECB 4ZHBA 4OAUC 4DX5D 4LNUD 5KBAA 4YDYA 5CBOA 3JUEA 4HQDA 3T8KA 1N11A 1A5EA 4DX2A 5KNHD 3B95A 3ZKJA 4F1PA 3HRAA 4G8KA 5AQ9A 3KEAA 2DVWA 1YYHA 2ETBA 4HRMB 4TUMA 5JMND 3TWQA 1DC2A 1IXVA 2F37A 5ENOD 3UTMA 3ZUVB 1AP7A 5EIBE 3AJIA 4UUCA 5AQBA 2J8SD 4N5QA 4O1OA 4O1PA 4ZFHA 1WG0A 4HRLA 3Q9NC 3W9FA 1MX6A 2FO1E 3TWXA 5HRYA 2DZNA 3NOCD 2QC9A 4DX6D 1D9SA 3ZNGA 2XEHA 4DRXE 4BERA 5CBNA 1QYMA 5ENQD 4F6RD 1AWCB 4GMRA 3HG0D 3TWVA 4BETA 5CEAA 4JB8P 4J7WA 2L6BA 5EIDA 4HLLA 4HBDA 2VGEA 5HKPA 3NBNB 4G8LA 1MYOA 2B0OE 2XEEA 2XZTG 4BSZB 5EILA 1WDYA 3Q9UC 4U8YD 3T9KA 1MX4A 1NFIE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U96 D;  4J8Y A;  5KNG A;  5ENR D;  1N0Q A;  3J5Q B;  4DX7 D;  5JA4 D;  3EHQ A;  5FIO A;  2DWZ A;  2P2C P;  2ZGG A;  1BU9 A;  3DEP A;  4BEP A;  2JAB A;  4GPM A;  5CER B;  3EU9 A;  1G3N B;  1UOH A;  3JXJ A;  2KBX A;  3JXI A;  5EYP F;  4O60 A;  2XZD G;  2PNN A;  1IKN D;  4RLY A;  1SW6 A;  3V79 K;  4U8V D;  3V2X A;  5AAO A;  5BXU A;  2ZGD A;  2Y0B G;  1IHB A;  5FIN A;  5EN5 D;  1MJ0 A;  3LJN A;  2BKG A;  3DEO A;  3EHR A;  3V30 A;  4HI9 A;  4CYM D;  2F8Y A;  1BI7 B;  2MYO A;  1OT8 A;  4U95 D;  2NYJ A;  3ZU7 B;  4CZ2 D;  2V5Q C;  3C5R A;  1K1B A;  2BKK B;  2DZO A;  1K1A A;  5AN8 A;  4K5A B;  1MX2 A;  4K5C A;  4LG6 A;  4HB5 A;  3UI2 A;  5CED B;  5ITZ F;  1S70 B;  3J5P A;  5ENP D;  1TR4 A;  1YMP A;  4HRN A;  3NOG D;  5D66 A;  1DCQ A;  4NIK A;  4YDW A;  5EYL A;  5ENS D;  1SVX A;  1YCS B;  2RFM A;  4DUI A;  2AJA A;  3TWU A;  3V31 A;  4LSZ E;  3AAA C;  3F6Q A;  5AAR A;  3D9H A;  3IXE A;  5ENT D;  5HS0 A;  4OAV B;  4C48 B;  5BXO A;  2XEN A;  2ETC A;  3TWT A;  4BES A;  5AQA A;  2Y1L E;  3TWS A;  1OY3 D;  3UXG A;  2HE0 A;  1BI8 B;  1BD8 A;  4HNA D;  4K5B A;  5AQ7 A;  3SO8 A;  2A5E A;  3W9G A;  2KXP C;  2RFA A;  2QYJ A;  4B93 B;  4QFV A;  1K3Z D;  1BLX B;  4ATZ D;  1N0R A;  4A63 B;  5KWD A;  3TWR A;  2V4H C;  2ETA A;  3TWW A;  2F8X K;  4QQI A;  3V2O A;  4DX1 A;  4HI8 A;  4Z68 A;  3B7B A;  5CEC B;  4ZHB A;  4OAU C;  4DX5 D;  4LNU D;  5KBA A;  4YDY A;  5CBO A;  3JUE A;  4HQD A;  3T8K A;  1N11 A;  1A5E A;  4DX2 A;  5KNH D;  3B95 A;  3ZKJ A;  4F1P A;  3HRA A;  4G8K A;  5AQ9 A;  3KEA A;  2DVW A;  1YYH A;  2ETB A;  4HRM B;  4TUM A;  5JMN D;  3TWQ A;  1DC2 A;  1IXV A;  2F37 A;  5ENO D;  3UTM A;  3ZUV B;  1AP7 A;  5EIB E;  3AJI A;  4UUC A;  5AQB A;  2J8S D;  4N5Q A;  4O1O A;  4O1P A;  4ZFH A;  1WG0 A;  4HRL A;  3Q9N C;  3W9F A;  1MX6 A;  2FO1 E;  3TWX A;  5HRY A;  2DZN A;  3NOC D;  2QC9 A;  4DX6 D;  1D9S A;  3ZNG A;  2XEH A;  4DRX E;  4BER A;  5CBN A;  1QYM A;  5ENQ D;  4F6R D;  1AWC B;  4GMR A;  3HG0 D;  3TWV A;  4BET A;  5CEA A;  4JB8 P;  4J7W A;  2L6B A;  5EID A;  4HLL A;  4HBD A;  2VGE A;  5HKP A;  3NBN B;  4G8L A;  1MYO A;  2B0O E;  2XEE A;  2XZT G;  4BSZ B;  5EIL A;  1WDY A;  3Q9U C;  4U8Y D;  3T9K A;  1MX4 A;  1NFI E; 
#chains in the Genus database with same CATH topology
 1JUQ A;  4GCN A;  1MZC A;  3LDZ A;  4HOU A;  3ZXP A;  3C3Q A;  1H19 A;  3RO3 A;  5AYW D;  2NSZ A;  4HS2 A;  1IQU A;  3FTW A;  2WMN A;  4O60 A;  3UPV A;  3SQV A;  3E32 A;  3FU0 A;  4LUN U;  3DPY A;  2VGY A;  4ANW A;  3R9A B;  3ASO E;  5EX3 A;  2H6G A;  5LOZ A;  1SQM A;  2V5Q C;  4JC8 A;  2BKK B;  5AN8 A;  4LG6 A;  3KS2 A;  3R7R A;  4I9E A;  4WNF A;  4NIK A;  3ZRH A;  1N94 A;  4I2W A;  4WWO A;  4CRW A;  5H7P A;  1NP7 A;  3FTU A;  1TNO A;  3D9P A;  3DST A;  5AQA A;  2YNQ A;  1OY3 D;  1V55 E;  3PZ1 A;  2VGX B;  3BEE A;  3G2W A;  1U2V G;  3CVP A;  1S63 A;  2GRP B;  4TXQ A;  3CVX A;  3UT8 A;  2PM7 A;  4DX5 D;  4UWH A;  1E7V A;  3LJ3 A;  1KZO A;  4CT4 A;  4UI9 J;  2QYU A;  4KVO A;  4DLO A;  3KEA A;  1YYH A;  2VTB B;  1NA0 A;  3VLE A;  5KJK A;  2BED A;  3AJI A;  2R03 A;  4Q96 A;  3FUF A;  4O1P A;  3ZW3 A;  3CHQ A;  4M3O A;  3D9M A;  3FFL A;  3ZNG A;  2HM8 A;  3WG7 E;  3MJW A;  1NZN A;  3B7U X;  4HBD A;  2B0O E;  1LD8 A;  1EDU A;  4U07 A;  5ENR D;  4LER A;  5HI7 A;  4L1B A;  3DEP A;  3OAW A;  3SF4 A;  3JXJ A;  5FZR A;  5BV1 A;  3MV2 B;  5EYP F;  1E8Z A;  5AAO A;  3Q15 A;  3SGH A;  3PS6 A;  2AVP A;  4U95 D;  2IOS A;  2XS8 A;  3C5R A;  2J4B A;  3HYM B;  2ZU6 B;  4I6J A;  4G2V A;  3UT7 A;  1HFA A;  3ABK E;  3LY9 A;  4CT0 A;  1QNF A;  5ENT D;  4A3T A;  2ETC A;  4JA9 A;  5AQ7 A;  2CG2 A;  2RFA A;  4KXK B;  3TWR A;  3UMV A;  2CHW A;  1N95 A;  1TNZ A;  3PE3 A;  5FJY A;  3NF1 A;  3NB2 A;  3FUD A;  1RW2 A;  3FTV A;  5A6C A;  2BUG A;  2MOW A;  4EHM A;  4E6H A;  4N3A A;  4FP7 A;  3T5V A;  3QWW A;  2EIM E;  2L0T B;  3FUI A;  3ESK A;  5AJD A;  2DZN A;  4LEU A;  4NUR A;  1N4P A;  4MS6 A;  3EJN A;  2Y69 E;  1HF8 A;  4UWF A;  3GZ1 A;  3FTX A;  3CEQ A;  3KAE A;  2QY7 A;  4GTP A;  3DWL G;  4HOQ A;  2XEE A;  2Y4T A;  1TNB A;  1N54 A;  1TN6 A;  2WXO A;  1N0Q A;  5FIO A;  3RAU A;  4PH4 B;  4F3V A;  5LCW J;  3EU9 A;  3L9T A;  5B1B E;  3QC1 A;  3UM0 A;  3K9I A;  3CK8 A;  3LVQ E;  2VGX A;  3MA5 A;  1W3B A;  2BKG A;  3V30 A;  4GML A;  4GZD A;  3CHR A;  3FHE A;  3UI2 A;  5CED B;  2V8S E;  2ZIS A;  4K5C A;  4ATG A;  3P2B A;  3FUJ A;  3NOG D;  2OVF A;  2J49 A;  3G2U A;  3C98 A;  4C0M A;  3CGH A;  3CVQ A;  5T8I A;  3UQ3 A;  2P58 C;  3RRN B;  4ANU A;  1N11 A;  5G04 J;  2L6J A;  3ZKJ A;  3HRA A;  4NAC A;  2DVW A;  4HRM B;  2OV8 A;  3UTM A;  3EHN A;  2LSU A;  2KC7 A;  4N5Q A;  2WB2 A;  5FQ6 A;  4WNE A;  4BER A;  3TWV A;  1ZB1 A;  3KSQ A;  3NBN B;  1QZ2 A;  3DXM G;  1DVP A;  2XRZ A;  4U8Y D;  3DSU A;  3ZYM A;  2KCK A;  3MZL B;  4J8Y A;  5KNG A;  3UM2 A;  3UX4 A;  3LY8 A;  4I6E A;  3FUK A;  2X6F A;  2MHK A;  3I3N A;  4U0U A;  3C72 A;  3UIP C;  4LCT A;  4DJA A;  4ILH B;  3S7B A;  2IOL A;  2Y0B G;  3ABL E;  2X38 A;  4Y6C A;  5D0Q D;  2GRR B;  5B3S E;  3D9J A;  2UWJ G;  4KZ0 A;  4XKB A;  2I1J A;  2PQR A;  2WXP A;  1E8X A;  4JVS A;  1HH8 A;  1YCS B;  1PAQ A;  2FF4 A;  4BTB A;  2XCB A;  2XEN A;  1NL4 A;  3LEW A;  2WXI A;  3TGO A;  2A5E A;  4U04 A;  2QYJ A;  5KWD A;  2IF4 A;  1Z3X A;  2F8X K;  1HS6 A;  5FTP A;  4YDO A;  3GZS A;  4G1T A;  4L2Y A;  1LF8 A;  5KNH D;  2CHX A;  4G8K A;  1Y8M A;  3PDN A;  4XX5 A;  1S64 A;  3TWQ A;  2HO1 A;  2V5F A;  1IXV A;  3ENE A;  3FWV A;  3DRA A;  5EIB E;  4PS3 A;  4WUY A;  2J8S D;  3AS4 A;  4LNG A;  3ZVV A;  1TEZ A;  4A1S A;  1FCH A;  1YA0 A;  2AXZ A;  3EUV A;  2QZA A;  4DI4 A;  2HYZ A;  5J90 A;  3MKQ A;  4Q69 A;  3SFX A;  5FQ4 A;  1DNP A;  5EIL A;  4W9R A;  5M72 A;  1MX4 A;  5KBA A;  3PNL B;  2LSV A;  4FLH A;  4ACL A;  2V0P A;  4FHJ A;  3FTS A;  4DLQ A;  5JJ7 A;  4GU5 A;  2AXV A;  2YHE A;  5CER B;  1KPS B;  4EZK A;  4GA0 A;  4GA2 A;  3V2X A;  5AJL A;  2EIK E;  2C0M A;  3I4G A;  4H7Y A;  1EPU A;  2PZI A;  2DYS E;  4Y6W A;  3CLJ A;  2IY0 C;  3LYA A;  3J5P A;  3G2S A;  1YMP A;  2R2L A;  1DCQ A;  4AOF A;  5ENS D;  2A5U A;  3F6Q A;  3D9H A;  3ZHE A;  5HS0 A;  5BXO A;  4TXR A;  2PL2 A;  2I9C A;  3ZFW A;  4BT8 A;  2X6J A;  1K3Z D;  3EDT B;  2V4H C;  3FUN A;  3UM1 A;  2WXR A;  3FY4 A;  2X6H A;  4U63 A;  3ASD A;  2KCV A;  1A5E A;  2FEZ A;  1E96 B;  4N2Q A;  3PUJ A;  2XPI A;  1NI1 A;  4GZC A;  4UUC A;  2PQN A;  4OVV A;  1XGW A;  3IEG A;  4O1O A;  4HRL A;  3Q9N C;  3JCK C;  2WQ7 A;  2P9P G;  4I9C A;  4J7W A;  4ANX A;  2J09 A;  4B8A A;  4I1M A;  3FU3 A;  2YQ8 A;  3EHQ A;  5ARG A;  4J6I A;  3Q75 A;  3ML9 A;  5J08 A;  3S7D A;  3SI5 A;  4RLY A;  2VSN A;  3DXK G;  2AXU A;  1WM5 A;  3D9O A;  2JLB A;  5G55 A;  4CYM D;  1H2T C;  2NYJ A;  2WXM A;  3Q7A A;  2X3M A;  3RO2 A;  3LS8 A;  2AJA A;  4XEI G;  3V31 A;  3AAA C;  5AAR A;  3BQO A;  3VLD A;  3HVE B;  2WMO A;  1Q2Z A;  4QFV A;  2RG8 A;  3D9N A;  4G23 A;  3V2O A;  2J07 A;  4HI8 A;  3B7B A;  5BT1 A;  5CEC B;  5ARF A;  1KZP A;  4R7L A;  2GRO B;  1PC2 A;  2C2L A;  2GRQ B;  5A7D B;  3RJV A;  2VYI A;  3CKB A;  2P9K G;  5A23 A;  5ENO D;  1HG2 A;  1DCE A;  2R02 A;  2FBN A;  3DSW A;  3L08 A;  2X6I A;  4WAF A;  1AWC B;  3DSV A;  1UN8 A;  1HX8 A;  4CDM A;  2VGE A;  1MYO A;  3T9K A;  3PE4 A;  2DWZ A;  3IKO B;  1UOH A;  4AM9 A;  4FA6 A;  1SA5 A;  1E90 A;  1OUV A;  2PNN A;  1IKN D;  4U8V D;  3SHF A;  2IFU A;  2VJ8 A;  1Y6I A;  1V54 E;  3ASG A;  1MJ0 A;  1MQS A;  2AWI A;  3ULY A;  3VLF A;  4KYO B;  4J0U A;  1K1B A;  3SFZ A;  5CRV A;  2OVB A;  4YND A;  3CSF A;  2Y3A A;  4MRU A;  3TWU A;  2XS1 A;  5CRU A;  3APD A;  2XPZ A;  3CQC B;  4ANV A;  1WY6 A;  1HG5 A;  1PY1 A;  3BU8 A;  4N3C A;  5CMW A;  3UKU G;  3ZIM A;  3UIO C;  2KXP C;  2CHZ A;  3CK7 A;  4E85 A;  4DX1 A;  1JCS A;  3R9M A;  1FPP A;  3HIZ A;  4XI9 A;  4P29 A;  3X2Q E;  4HQD A;  3WXX A;  5EX0 A;  1SA4 A;  2ZXW E;  2ETB A;  3LPZ A;  2H6I A;  4AV7 A;  3MV3 B;  3EU5 A;  1H2V C;  5G04 C;  3W9F A;  4HLE A;  1MX6 A;  1K8K G;  3PH0 C;  3CVU A;  3FUH A;  4G25 A;  4GMR A;  1ELR A;  3DBS A;  2EIN E;  4HLL A;  2QFC A;  5HKP A;  3ULE G;  4AIF A;  4JA7 A;  5ENN A;  3QAR A;  4BWR A;  4AP2 A;  5EN5 D;  3E30 A;  3J5Q B;  3G2T A;  5EKQ D;  4XZ4 A;  1IHG A;  3I5P A;  5E76 A;  2R05 A;  2KCL A;  1FT1 A;  2H6H A;  4N5C A;  4GTV A;  3U3W A;  4LRZ A;  5T3R A;  4RG6 A;  1BI7 B;  2I2O A;  3JYS A;  5D66 A;  4YDW A;  1H6K A;  4F1S A;  4DUI A;  2LXM A;  5E75 A;  3FEY A;  4F7A A;  2XGM A;  4GZ3 A;  4EQF A;  2F0Y A;  3TWT A;  3FTY A;  1BPO A;  3ASH A;  1BI8 B;  2OEW A;  3ZYK A;  4ATZ D;  4AEZ C;  2DCP A;  2GGF A;  3L17 A;  4ME2 A;  5FWQ A;  1UG3 A;  4OAU C;  3QNK A;  4B0Z A;  2LAH A;  3UKR G;  5AIJ A;  4GTO A;  1HE8 A;  4GZ6 A;  2RD0 A;  4G24 A;  3KSL A;  3CHO A;  3PZD A;  1JCR A;  3RK6 A;  4DX6 D;  5BPP A;  2DIW A;  3IHV A;  1ZU2 A;  5LX8 A;  1O5M A;  4J8F A;  4KBQ A;  3IBE A;  1ELK A;  1P5Q A;  3PRE A;  1G3N B;  3TG4 A;  3N71 A;  1H2U A;  3LCA A;  2BTD A;  3RRM B;  5JHB A;  3EHM A;  4YDE A;  2ZGD A;  1TJF A;  2LUH A;  1KLX A;  2GRM A;  3QJZ A;  2MYO A;  5KCM A;  1HU3 A;  1MX2 A;  3B7R L;  2L0I A;  1S70 B;  2OEV A;  4CCA A;  2RFM A;  4JHR A;  1OWO A;  1TN7 A;  2XGS A;  4K0R A;  4D10 C;  4PS7 A;  3HXE A;  4OAV B;  2CFZ A;  4GYY A;  4BES A;  2Y1L E;  3W9G A;  2E0I A;  3FH8 A;  1UW4 B;  3CVN A;  4FLB A;  3U4T A;  1N0R A;  3HDX A;  2WXK A;  4YVQ C;  4HOR A;  2WXH A;  2KAT A;  3FP3 A;  1IQR A;  4X8Q A;  4FAD A;  5G05 C;  3ABM E;  3GZ2 A;  2B6C A;  4TUM A;  2P9S G;  1X81 A;  4GTM A;  5AQB A;  4G11 A;  4EZJ A;  3ML8 A;  3LY7 A;  3APC A;  4O6F A;  1OCO E;  2L6B A;  1HZ4 A;  3PRZ A;  3G2V A;  5HQ8 A;  5D0O D;  4U0Z A;  3OXG A;  2ILR A;  3SD5 A;  2NC9 A;  4UWL A;  4FJY A;  1UN9 A;  1LD7 A;  3L54 A;  3RRU A;  1JWF A;  3BUA A;  3JUI A;  3AU5 A;  3E4B A;  3S7F A;  3FDH A;  3ZXS A;  3PVL A;  4CZ2 D;  2J9Q A;  1KT0 A;  4JEH A;  1OWM A;  1Z6T A;  1WAO 1;  2XHE A;  2UY1 B;  3ZGQ A;  5CCL A;  2R5S A;  1OWP A;  4M7C A;  3TWS A;  5FT9 A;  2HE0 A;  4HNA D;  4AVX A;  4XI0 A;  4U8H A;  3NZS A;  4IYP A;  3URZ A;  4N2S A;  2WVI A;  5JJT A;  4NQ0 A;  4YDY A;  1B89 A;  3OXL A;  4KT6 B;  4HOS A;  4HOT A;  3FUL A;  3B7S A;  5AQ9 A;  3S2A A;  3Q78 A;  1GW6 A;  1DC2 A;  3CV0 A;  2X6K A;  2LAI A;  1UJJ A;  3BG0 B;  3AG2 E;  4EBA A;  4TXP A;  3D9K A;  2R17 C;  3NQP A;  5ENQ D;  2OCC E;  1KT1 A;  2IJG X;  3FUE A;  3ISM C;  4L9P A;  2P9N G;  1FVH A;  4DX7 D;  2ZGG A;  3QWP A;  3NAW A;  2IO2 C;  1OCZ E;  2FO7 A;  4UQX A;  4JZY A;  4ILG A;  1SW6 A;  4YVO A;  3MKR A;  3SY2 A;  1H6P A;  4EEC A;  2OOE A;  4CGW A;  2IU1 A;  4AXH A;  1OT8 A;  4ACK A;  5KJL A;  2DZO A;  1K1A A;  5ITZ F;  1E8W A;  3PZ3 A;  3T5X A;  5ENP D;  3ASF A;  2CG3 A;  3Q79 A;  3AU4 A;  3C3R A;  2XCC A;  3C3O A;  2AW6 A;  2KM4 A;  2MRI A;  3FH5 A;  4GTT A;  1OWN A;  3QKY A;  4KMO A;  3SO8 A;  4ILI A;  3D9I A;  1XNF A;  4XE0 A;  2ION A;  3UM3 A;  4FJZ A;  3HVE A;  1NA3 A;  3Q4A B;  3L22 A;  4GTR A;  2DBA A;  5CCM A;  4A1G A;  4FUL A;  4B94 A;  3B95 A;  2I6H A;  4F1P A;  4DI3 A;  1E7U A;  4MKT A;  3CR3 A;  1N9A A;  2F37 A;  4JHK A;  3ZUV B;  3EIQ C;  4U7E B;  3O48 A;  3FU5 A;  4FC8 A;  5C1D A;  3TAX A;  3TWX A;  3L82 A;  4C0E A;  1D9S A;  3D9L A;  3RSE G;  5AEN A;  2EQX A;  1JWG A;  1N52 A;  3SZ7 A;  3E34 A;  4GPK A;  2HR2 A;  3UT4 A;  3TJP A;  3PZ2 A;  1TNU A;  2I1K A;  2P2C P;  1VDY A;  3FTZ A;  2GRL A;  2UY1 A;  2EIL E;  4TRQ A;  4IRU A;  2E2E A;  3HXF A;  2IEJ A;  5C2Y A;  5BUZ A;  4RQI A;  4BFR A;  4AY5 A;  4K5A B;  1QBQ A;  4HRN A;  3PNT B;  4LSZ E;  4GA1 A;  3HXB A;  2VSX E;  3UIN C;  3OTN A;  2WXG A;  2P9L G;  2VSO E;  3AG4 E;  3LKU A;  4DPR A;  1BD8 A;  3ONK A;  4V3I A;  4B93 B;  2YHC A;  2P9I G;  3U66 A;  3CVW A;  4L2L A;  2WQ6 A;  4PDX A;  3ZEF A;  4JL0 A;  3T8K A;  4UI9 K;  5ANL A;  3U9W A;  1E8Y A;  4ABN A;  4GAA A;  3CHP A;  4ZFH A;  3L13 A;  3QB2 A;  3PUK A;  2GW1 A;  3QWV A;  3Q73 A;  3B13 A;  3CIA A;  3Q49 B;  3ZYQ A;  4K03 A;  3QK0 A;  2XZT G;  5BNW A;  4GMJ A;  1EF1 C;  2L9B A;  5JA4 D;  3CKC A;  3DPD A;  4MLP A;  3L6A A;  2P9U G;  3BG1 B;  4UWK A;  1OCC E;  3GW4 A;  1TNY A;  3CQG B;  3RU0 A;  1OXJ A;  3U64 A;  5BXU A;  4GTS A;  5FIN A;  1D8D A;  4JHJ A;  5FQ7 A;  1FVF A;  3DEO A;  4N39 A;  3ZU7 B;  3HXC A;  3LVR E;  4HB5 A;  1JPL A;  3HXD A;  5LP0 A;  3CK9 A;  1FT2 A;  3AS8 A;  1N4Q A;  5FZQ A;  3ZN3 A;  1X5B A;  3FEX A;  1Z5S C;  2BF0 X;  4GYW A;  4Q94 A;  2YIN A;  1Z3Y A;  2OND A;  4I6G A;  4C48 B;  2WXN A;  3IV0 A;  4WWN A;  3UXG A;  4N3B A;  4UI9 C;  2ETA A;  3TWW A;  4QQI A;  4BTA A;  5BW8 C;  4UWG A;  5CBO A;  1LTX A;  4DX2 A;  1HXI A;  3E33 A;  5LFA A;  3MX3 A;  3QOU A;  3CST A;  4BT9 A;  4RG9 A;  4JW1 A;  4LNB A;  4I1A A;  4KVM A;  3MGB A;  1SZA A;  1N4R A;  2FO1 E;  2QC9 A;  4A3V A;  3VTX A;  1H6O A;  4F6R D;  4I2Z A;  3DSS A;  5EID A;  5CMY A;  1O1R A;  4JEU A;  4BX9 A;  2FI7 A;  3Q9U C;  3FUM A;  5LCW C;  4U96 D;  4NRH B;  3PEU B;  5ANR A;  4CGV A;  3OXF A;  2ZIR A;  4BEP A;  4GYO A;  4A55 A;  1EYH A;  3JXI A;  5FZS A;  3V79 K;  4B89 A;  3CVL A;  3SBS A;  2VQ2 A;  4EZL A;  3ONL A;  1U3C A;  3MKQ B;  4BSX A;  4AJW A;  4GB9 A;  4APF A;  4PS8 A;  3UUX A;  3ZPJ A;  2VSY A;  1TR4 A;  2KZT B;  1SVX A;  4XIF A;  2LNI A;  2NXP A;  1O1S A;  1RZ4 A;  1TN8 A;  4PUC A;  3SNX A;  3TXM A;  4URK A;  3Q47 B;  1UJK A;  4FHK A;  4I43 A;  3T8M A;  2KZT A;  4U0S A;  2V4L A;  3I4R B;  2WM9 A;  3KD7 A;  5KJN A;  2Q7F A;  2R59 A;  3MEK A;  5FQ8 A;  4WND A;  3O4Z A;  2CFU A;  3VTY A;  5EDS A;  4OVU A;  2J08 A;  4GTQ A;  2WXJ A;  2XRY A;  1AP7 A;  2WQH A;  4APO A;  3RKV A;  3ZHE B;  3NOC D;  3HHM A;  2XEH A;  1ZBP A;  3HG0 D;  5CEA A;  4JB8 P;  3APF A;  1HO8 A;  4BSZ B;  1O1T A;  1WDY A;  4TV3 A;  3IXE A;  4CDN A;  2Y4U A;  4H7X A;  4L23 A;  3MYV A;  4UQZ A;  1BU9 A;  4KZC A;  3QAQ A;  3L16 A;  4J8D A;  3KEZ A;  2XZD G;  4DK5 A;  2FUL A;  2JEK A;  1IHB A;  1N4S A;  4HFG A;  1A17 A;  2GRN B;  4L7T A;  4HI9 A;  3ZYL A;  4GZ5 A;  1INZ A;  3RIB A;  4J8S A;  5JJ6 A;  4IN3 B;  1IYG A;  1TJC A;  2XPY A;  1ELW A;  4RSY A;  2PM6 A;  4J8E A;  3P1U A;  4RVB A;  3FU6 A;  1BLX B;  4A63 B;  3JQ1 A;  2XQ0 A;  5IY5 E;  4Z68 A;  3Q5M A;  3Q7F A;  3LXU X;  5DBK A;  3JUE A;  3NZU A;  4BY6 A;  3PZ4 A;  4F53 A;  2J4D A;  2LXL A;  4HVB A;  3PEV B;  5T4Y A;  3MCX A;  5JMN D;  3SBT B;  4JD2 G;  5BV0 A;  5B1A E;  1WG0 A;  3ESL A;  3ASN E;  2IO3 C;  4CDR A;  3CVV A;  4DRX E;  4OYS A;  4BET A;  4BX8 A;  1SZ9 A;  4G8L A;  1JCQ A;  3TXN A;  4WNG A;  2EIJ E;  3CVY A;  2VTB A;  2WXQ A;  1NFI E;  1D8E A;  3AG3 E;  4CEM A;  3GYZ A;  3TL5 A;  4XKC A;  2H6F A;  2JAB A;  4GPM A;  2RKK A;  1OWL A;  4AY6 A;  4I1O B;  3DSX A;  2KBX A;  2XEV A;  3JQ0 A;  3IHY A;  5CHE E;  2XGO A;  1L5J A;  2C0L A;  1TYQ G;  4I17 A;  3AS5 A;  3LJN A;  3B7T A;  1MHQ A;  3R7Q A;  3EHR A;  3AG1 E;  2F8Y A;  1H0A A;  2WPV A;  4G26 A;  5DIZ A;  4WWP A;  2IQC A;  1S0P A;  3ULQ A;  2A4Z A;  2LO6 A;  5EYL A;  3QDN A;  4HXI A;  3FH7 A;  5G2N A;  3TG5 A;  5JHA A;  3CHS A;  4MBG A;  4K5B A;  3CHM A;  4IUL A;  3S7J A;  2M63 A;  4JXT A;  5D2M C;  3E37 A;  4JPS A;  4ZHB A;  2WXF A;  5G05 J;  4LNU D;  1QQE A;  4B8C B;  4UQY A;  5KJM A;  3SFY A;  3D3M A;  4GCO A;  4FU3 A;  1U3D A;  4C9B B;  5HRY A;  5CBN A;  1QYM A;  2WXL A;  4TUU A;  2DYR E;  4EPZ A;  1OCR E;  3EIJ A;  4EBA G; 
#chains in the Genus database with same CATH homology
 4U96 D;  4J8Y A;  5KNG A;  5ENR D;  1N0Q A;  3J5Q B;  4DX7 D;  5JA4 D;  3EHQ A;  5FIO A;  2DWZ A;  2P2C P;  2ZGG A;  1BU9 A;  3DEP A;  4BEP A;  2JAB A;  4GPM A;  5CER B;  3EU9 A;  1G3N B;  1UOH A;  3JXJ A;  2KBX A;  3JXI A;  5EYP F;  4O60 A;  2XZD G;  2PNN A;  1IKN D;  4RLY A;  1SW6 A;  3V79 K;  4U8V D;  3V2X A;  5AAO A;  5BXU A;  2ZGD A;  2Y0B G;  1IHB A;  5FIN A;  5EN5 D;  1MJ0 A;  3LJN A;  2BKG A;  3DEO A;  3EHR A;  3V30 A;  4HI9 A;  4CYM D;  2F8Y A;  1BI7 B;  2MYO A;  1OT8 A;  4U95 D;  2NYJ A;  3ZU7 B;  4CZ2 D;  2V5Q C;  3C5R A;  1K1B A;  2BKK B;  2DZO A;  1K1A A;  5AN8 A;  4K5A B;  1MX2 A;  4K5C A;  4LG6 A;  4HB5 A;  3UI2 A;  5CED B;  5ITZ F;  1S70 B;  3J5P A;  5ENP D;  1TR4 A;  1YMP A;  4HRN A;  3NOG D;  5D66 A;  1DCQ A;  4NIK A;  4YDW A;  5EYL A;  5ENS D;  1SVX A;  1YCS B;  2RFM A;  4DUI A;  2AJA A;  3TWU A;  3V31 A;  4LSZ E;  3AAA C;  3F6Q A;  5AAR A;  3D9H A;  3IXE A;  5ENT D;  5HS0 A;  4OAV B;  4C48 B;  5BXO A;  2XEN A;  2ETC A;  3TWT A;  4BES A;  5AQA A;  2Y1L E;  3TWS A;  1OY3 D;  3UXG A;  2HE0 A;  1BI8 B;  1BD8 A;  4HNA D;  4K5B A;  5AQ7 A;  3SO8 A;  2A5E A;  3W9G A;  2KXP C;  2RFA A;  2QYJ A;  4B93 B;  4QFV A;  1K3Z D;  1BLX B;  4ATZ D;  1N0R A;  4A63 B;  5KWD A;  3TWR A;  2V4H C;  2ETA A;  3TWW A;  2F8X K;  4QQI A;  3V2O A;  4DX1 A;  4HI8 A;  4Z68 A;  3B7B A;  5CEC B;  4ZHB A;  4OAU C;  4DX5 D;  4LNU D;  5KBA A;  4YDY A;  5CBO A;  3JUE A;  4HQD A;  3T8K A;  1N11 A;  1A5E A;  4DX2 A;  5KNH D;  3B95 A;  3ZKJ A;  4F1P A;  3HRA A;  4G8K A;  5AQ9 A;  3KEA A;  2DVW A;  1YYH A;  2ETB A;  4HRM B;  4TUM A;  5JMN D;  3TWQ A;  1DC2 A;  1IXV A;  2F37 A;  5ENO D;  3UTM A;  3ZUV B;  1AP7 A;  5EIB E;  3AJI A;  4UUC A;  5AQB A;  2J8S D;  4N5Q A;  4O1O A;  4O1P A;  4ZFH A;  1WG0 A;  4HRL A;  3Q9N C;  3W9F A;  1MX6 A;  2FO1 E;  3TWX A;  5HRY A;  2DZN A;  3NOC D;  2QC9 A;  4DX6 D;  1D9S A;  3ZNG A;  2XEH A;  4DRX E;  4BER A;  5CBN A;  1QYM A;  5ENQ D;  4F6R D;  1AWC B;  4GMR A;  3HG0 D;  3TWV A;  4BET A;  5CEA A;  4JB8 P;  4J7W A;  2L6B A;  5EID A;  4HLL A;  4HBD A;  2VGE A;  5HKP A;  3NBN B;  4G8L A;  1MYO A;  2B0O E;  2XEE A;  2XZT G;  4BSZ B;  5EIL A;  1WDY A;  3Q9U C;  4U8Y D;  3T9K A;  1MX4 A;  1NFI E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...