1ELRA

Crystal structure of the tpr2a domain of hop in complex with the hsp90 peptide meevd
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
128
structure length
128
Chain Sequence
b'GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TPR2A-DOMAIN OF HOP
publication title Structure of TPR domain-peptide complexes: critical elements in the assembly of the Hsp70-Hsp90 multichaperone machine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 59
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2000-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1elrA00
3U4TA 4HORA 3UQ3A 4J8DA 3UPVA 4O6FA 3LKUA 1B89A 4GYOA 2WPVA 4WNGA 2KCKA 4I9EA 2OOEA 1PC2A 1A17A 3S7BA 1NZNA 2UY1A 2UY1B 2VGYA 3Q49B 4UQXA 5A6CA 4HOTA 3O48A 2Y4UA 2YQ8A 3CVNA 5KJLA 3ZGQA 3TG5A 4CGWA 3FFLA 1ZU2A 4J8EA 5BW8C 4HOSA 5G05C 4RG9A 1W3BA 4WNFA 3RJVA 3RIBA 2PL2A 3ZFWA 2I6HA 2XCCA 4RG6A 4GZ3A 4AM9A 3K9IA 3ZN3A 2BUGA 4G2VA 4XIFA 4G25A 5DIZA 5FZQA 1NA0A 2KC7A 2IF4A 2C0LA 5FT9A 4BTAA 4EQFA 4WNEA 3MV2B 3ASHA 5BNWA 4UI9J 3GYZA 4H7YA 3UUXA 3LY8A 2GW1A 2QFCA 1E96B 3AS8A 5FTPA 3CKCA 4U04A 2PQRA 3IEGA 3CVQA 4UI9K 3BEEA 2FEZA 3QWWA 4B94A 3ASGA 4XI9A 3E4BA 3LCAA 3ZPJA 4GZ6A 3OXFA 1QQEA 2VSYA 4I1AA 3CK8A 3KD7A 4F3VA 3RU0A 2E2EA 4J8FA 5CCMA 3MEKA 3VTXA 5C1DA 2UWJG 2L6JA 2Q7FA 4N3AA 5D0QD 2C0MA 4N5CA 2VSNA 4GA1A 4KXKB 4U0UA 3QDNA 1IHGA 3R9AB 1P5QA 1HZ4A 1OUVA 3EDTB 3ULQA 2XEVA 5KJNA 2LSUA 3QOUA 3QWPA 3OXGA 3S7JA 5ARGA 5CCLA 4CDRA 4GPKA 4JHRA 1ELWA 3MA5A 4GYWA 2FF4A 2V5FA 3FWVA 3AS4A 3URZA 2VYIA 5AYWD 4ABNA 4JL0A 2LNIA 4YVQC 5G04C 4U0ZA 3LY9A 2FO7A 3CVPA 3LPZA 3KS2A 4I2ZA 4GA0A 4H7XA 5JJTA 1ZBPA 4I17A 4KYOB 2HR2A 5EKQD 1HH8A 4GA2A 3NF1A 5G05J 4A1SA 3U3WA 4N2QA 3CVLA 2Y4TA 1YA0A 4JA9A 2J9QA 1Y8MA 3Q15A 3CK7A 4NRHB 3FP3A 2P58C 4I9CA 4WUYA 1HXIA 3HYMB 4N3BA 2KCLA 2KATA 5A7DB 4G26A 4KBQA 3PE4A 4ME2A 3ESKA 5HI7A 3Q5MA 5DBKA 4I2WA 2KCVA 3S7FA 3SZ7A 4BT9A 3GW4A 1KT1A 1IYGA 3RO2A 3CV0A 3RO3A 5ARFA 4BWRA 4HOUA 5HQ8A 3ASDA 3LYAA 2MHKA 3MV3B 4NQ0A 4IN3B 3TG4A 3N71A 4AY5A 2YHCA 1KLXA 2DBAA 2R5SA 2VQ2A 5BT1A 4GZ5A 5FZSA 4AY6A 4WNDA 3GZ2A 2FI7A 3JYSA 3S7DA 3CEQA 1WAO1 4G24A 4N39A 2LSVA 4UI9C 3ASFA 5EX0A 3SF4A 5FJYA 1NA3A 3VTYA 1WM5A 3MKRA 4GCNA 5M72A 4YNDA 5D0OD 5LCWC 2JLBA 2PQNA 2XCBA 4G1TA 2VGXA 4U0SA 2XGSA 4YVOA 2VGXB 2XGOA 4Y6WA 1ELRA 2AVPA 3PE3A 2HYZA 4U07A 4UQYA 3Q4AB 4Y6CA 4W9RA 3TAXA 3CK9A 5CHEE 3RKVA 3ZHEA 4XI0A 2IFUA 4BT8A 3ZHEB 3CKBA 1QZ2A 4CGVA 4AIFA 1FCHA 4BTBA 4UQZA 4HOQA 3AS5A 2XGMA 4JA7A 5JJ7A 4G23A 2PZIA 3QWVA 5KJKA 5G04J 4GYYA 3WXXA 3LY7A 5JJ6A 5LCWJ 2C2LA 5FZRA 4N2SA 2HO1A 3QKYA 2WQHA 2ONDA 2NC9A 3Q47B 5KJMA 1XNFA 4GCOA 4J0UA 3KAEA 4N3CA 4APOA 5EX3A 1TJCA 1KT0A 2XPIA 3OXLA 3TGOA 2FBNA 3PDNA 4LEUA 3GZ1A
chains in the Genus database with same CATH superfamily
4HORA 2IY0C 3UQ3A 4KT6B 3LKUA 2LXLA 2WVIA 3JUIA 4LNBA 3NBNB 3PUJA 3S7BA 1O1SA 4UQXA 4L9PA 2Y4UA 4URKA 1NL4A 1N9AA 3DSXA 3TG5A 2VGEA 2RG8A 5KNGA 3T9KA 4J8EA 3DXMG 4UWLA 4XEIG 4WNFA 3RJVA 3TL5A 2I6HA 3ML8A 2XCCA 4RG6A 3UM1A 4LG6A 2BUGA 4V3IA 4U8VD 4Q96A 5AQ7A 2EILE 3FTWA 3RRNB 4G25A 3CIAA 3UI2A 4IRUA 4KMOA 1HF8A 1Z3YA 3CVUA 1TNZA 4EQFA 4I6GA 4WNEA 2L9BA 4ACKA 3KSQA 3MKQB 3EU9A 3QARA 2HE0A 4MLPA 3CLJA 2Y69E 4JEUA 5H7PA 4HQDA 3DBSA 3PH0C 5FIOA 3HVEB 1JPLA 1TNYA 2PQRA 2EIKE 3BEEA 3HG0D 3ASGA 4XI9A 1OXJA 4K0RA 1A5EA 3E4BA 4FU3A 2MOWA 4JB8P 3OXFA 4WAFA 2P9IG 4A55A 3IHVA 4GTPA 5ENRD 3CK8A 3KD7A 3PNLB 2WM9A 3MEKA 1IQRA 3CHRA 4KZCA 4N3AA 3RRUA 2IOSA 2H6IA 3SGHA 2X6KA 4DX2A 3F6QA 2VTBA 3EIQC 4AVXA 3Q73A 1YMPA 1X81A 4A63B 3B7TA 5ENNA 2I1KA 1OCOE 2XENA 3TXNA 3EDTB 3D9OA 3NZSA 4F6RD 1K3ZD 1H6KA 3SFYA 4AV7A 1AP7A 4LNUD 1H6PA 5CCLA 5A23A 1V54E 4JHRA 3U64A 3FUDA 2V5FA 1E8WA 1N94A 3URZA 4AXHA 3B7BA 5G04C 5D2MC 1N0RA 4CDMA 4B89A 4C0EA 1LD7A 1N54A 5LX8A 5JJTA 3UM3A 4XKBA 5CRUA 1OWOA 4I17A 3EU5A 2CG2A 3ENEA 2ETCA 3ZYMA 3JCKC 5T4YA 2Y4TA 1YA0A 5EN5D 3JQ0A 3G2VA 3O4ZA 4JA9A 1OWMA 2HM8A 4JC8A 2XS1A 3C3QA 1H2UA 3FP3A 3VLFA 4U95D 4B8AA 4I9CA 4U8HA 5LP0A 1PAQA 4WUYA 4TXQA 2XEEA 3J5PA 3KEAA 2P2CP 2KCLA 2RKKA 3NOGD 5HI7A 4HFGA 3HXDA 1FT1A 2F37A 4I2WA 1E7VA 3TWSA 3CHMA 2CHWA 4DI4A 1KT1A 3TWRA 3C5RA 4BFRA 1O1TA 2QZAA 3B95A 2AJAA 4JEHA 4HOUA 2NXPA 4DI3A 5HQ8A 3ASDA 3Q7FA 5AARA 3TG4A 2IO2C 3E37A 5CERB 3ZXSA 2XRZA 3AAAC 4AY5A 3LDZA 2WMOA 3ISMC 2DBAA 3V31A 1X5BA 4YDYA 3I4GA 4AY6A 2WXOA 4WNDA 2B6CA 2IOLA 1LTXA 3CEQA 4G24A 4ILGA 4BETA 4UI9C 3T8KA 2JEKA 1BPOA 2XS8A 5EX0A 3QK0A 4DLOA 1D9SA 2V0PA 2OCCE 4BSXA 2ILRA 3Q75A 3PZDA 2LXMA 4HI9A 4K5AB 1KPSB 3FEYA 3JXJA 4TRQA 1HS6A 2JLBA 2YHEA 3V2XA 2OV8A 2CHZA 2WXQA 1Q2ZA 4C48B 5B3SE 3U9WA 1Y6IA 1ELRA 3CQGB 2AVPA 1WDYA 3PREA 2HYZA 5AQBA 3W9GA 4UQYA 1OCRE 3Q4AB 5CEDB 2WXMA 3D9JA 4QQIA 4UWGA 3R7QA 1JCSA 1BI7B 3AG4E 2JABA 2I1JA 3EHNA 1UN8A 1H2TC 1HG2A 2PZIA 3QWVA 3CVVA 4JXTA 4DPRA 2YNQA 2RFAA 4GYYA 3WXXA 3LY7A 5JJ6A 2HO1A 3QKYA 4NACA 2WQHA 3Q47B 1MJ0A 4N3CA 3AG1E 3ZNGA 1IXVA 5ENQD 4LEUA 4PS3A 2XZTG 1TN6A 4HXIA 3UPVA 2WXIA 4O6FA 3TWTA 1B89A 4GYOA 2WPVA 1UN9A 4WNGA 4I9EA 3UINC 1A17A 3V30A 1O1RA 4BX9A 2UY1B 2VGYA 3Q49B 5A6CA 4HOTA 2F8XK 3TWUA 3I4RB 4GAAA 1TEZA 3HXEA 3FY4A 4JPSA 2LUHA 3UT4A 3UKRG 5BW8C 3C98A 5G05C 4RG9A 4LRZA 5EIBE 4GTOA 4HRNA 2DZNA 4JHJA 3ZUVB 5FQ6A 1LD8A 1H6OA 4GPMA 2DYRE 4R7LA 4GZ3A 4NURA 3ZW3A 3APCA 4GZCA 4XIFA 5CEAA 1NA0A 4AP2A 2KC7A 3LJ3A 2IF4A 3DSUA 2WXLA 1FPPA 2C0LA 3FUNA 3D9LA 3FUHA 4ANUA 4Q69A 1QNFA 1E7UA 1VDYA 1XGWA 3GYZA 3RRMB 1U3DA 2EIME 3LY8A 5BPPA 1NP7A 5FQ7A 3PZ2A 5KCMA 4PS8A 1E96B 4OYSA 4U04A 4JHKA 3IEGA 3CVQA 1N4SA 4I1OB 4O60A 3QWWA 3SNXA 3LEWA 1D8DA 4JVSA 3SHFA 2ZISA 2BF0X 4GZ6A 4ANVA 3IHYA 4I1AA 1IKND 3G2UA 2WXKA 5BXOA 5JMND 4J8FA 3C3RA 1MX4A 3L9TA 4L1BA 4OAUC 3VTXA 3EHRA 3KSLA 3HDXA 5BV1A 1JUQA 5D0QD 2KZTB 1OY3D 1DC2A 2X38A 2CG3A 3D3MA 4PDXA 4GA1A 4KXKB 2R2LA 4BESA 4J8YA 1IHGA 2X6JA 2IU1A 1ZB1A 4HNAD 3DPDA 5LFAA 3QAQA 5KWDA 1P5QA 3ZVVA 3D9HA 2IQCA 3ULQA 2X6HA 2XEVA 3QOUA 3EHQA 3QWPA 3OXGA 3S7JA 2WXNA 1WG0A 1E8XA 2RD0A 4I6EA 1GW6A 1EF1C 2FF4A 4FULA 2EINE 1BLXB 4I43A 4FHKA 1UW4B 4ABNA 2ZGDA 1LF8A 3ABKE 3CVPA 3LS8A 5AIJA 1Z6TA 3NQPA 5CMYA 1ZBPA 3P2BA 2QYUA 4G11A 4ZFHA 3E33A 5EKQD 1HH8A 2YINA 5EDSA 3JXIA 4RSYA 2QC9A 2FO1E 3CHSA 4ILHB 2DIWA 2BKGA 3U3WA 3AU5A 4GTSA 4N2QA 1HU3A 3CVLA 3FUEA 3JUEA 1Y8MA 3SFXA 3ONLA 5KNHD 1N52A 2R03A 1S0PA 4TUMA 1HXIA 1MHQA 3QNKA 3EJNA 3Q9UC 3FU5A 2H6GA 5A7DB 2L6BA 4GMLA 2LO6A 5BUZA 4G8KA 4LSZE 5DBKA 4BT9A 3RO2A 3ZKJA 3RO3A 4GTVA 5CMWA 1RW2A 3LYAA 5JHAA 1SZ9A 2WB2A 2R05A 4IN3B 3C3OA 3UM2A 4U96D 4L2YA 2IONA 2YHCA 3AG2E 5G55A 1AWCB 2Y3AA 3L13A 3S7DA 4U63A 1WAO1 4N39A 3ZYLA 3AJIA 3QJZA 2X3MA 2XPYA 1WM5A 3ESLA 4BX8A 3UMVA 4YNDA 5LCWC 4OVVA 3BG0B 2RFMA 1KZOA 3BQOA 1HFAA 4YVOA 3D9IA 2VGXB 2XEHA 4HLEA 4XZ4A 2XGOA 4Y6WA 1MQSA 4K5CA 3MX3A 4OVUA 4OAVB 1OT8A 4CYMD 3ZXPA 2WXFA 3TAXA 4I1MA 3CK9A 2KBXA 1IQUA 1DNPA 4XI0A 2IFUA 1MX6A 4RQIA 3ZHEB 4B93B 3CKBA 3APDA 3GZSA 4CGVA 2R02A 3V2OA 5FWQA 4UQZA 4HOQA 3RSEG 1N95A 5EIDA 3T5XA 3FUMA 4DRXE 4Z68A 5JJ7A 5KJKA 1SW6A 4F1SA 1DVPA 3L54A 1H19A 3MYVA 5FZRA 4J6IA 4NIKA 3U66A 3PZ1A 2VSXE 4GCOA 3CVYA 4J0UA 3KAEA 5EX3A 1TJCA 2XPIA 4U7EB 3PDNA 5AN8A 1SA5A 4YDOA 1SVXA 3DSSA 4DUIA 3G2SA 5BV0A 1E8ZA 4HRMB 3HIZA 3U4TA 4ANXA 4J8DA 4O1PA 1PC2A 1NZNA 2WMNA 2A4ZA 4FP7A 4O1OA 3O48A 2YQ8A 2J4DA 3TWVA 5IY5E 5E75A 3PZ4A 2WXPA 5D66A 4CGWA 3FFLA 4QFVA 2P9KG 2GRLA 1N4PA 1W3BA 4E85A 3RIBA 3L08A 3ZFWA 3R9MA 3J5QB 2B0OE 2EQXA 3K9IA 3ZN3A 4G2VA 2J4BA 2OEVA 3PUKA 5JHBA 1KZPA 2MYOA 3UIPC 4FJYA 4J7WA 3DSVA 3BU8A 1K1BA 4FJZA 4FADA 3S2AA 1ELKA 3MKQA 4LNGA 5AAOA 3ASHA 5J90A 5AJLA 3ULYA 4H7YA 2V4HC 1N4QA 3PRZA 5EYPF 4A1GA 2QFCA 3MCXA 2L0TB 3HVEA 1DCQA 1SZAA 2Y0BG 4K5BA 3KEZA 3AS8A 5FTPA 3BUAA 5ANRA 2WXRA 4UI9K 2FEZA 3SY2A 2AXUA 5J08A 1DCEA 4RLYA 2X6FA 1QQEA 3DRAA 3T8MA 3Q9NC 3CGHA 2PM7A 4DX7D 3RU0A 3UX4A 5CCMA 2ZXWE 2ZU6B 3DEPA 3SI5A 3FH7A 3I3NA 1TJFA 4EPZA 5T8IA 3SO8A 2H6HA 2ETBA 4F7AA 4A3VA 2VSNA 4M3OA 1NI1A 2XRYA 4U0UA 4B0ZA 3QDNA 3PZ3A 4KVOA 3R9AB 3UT7A 4MKTA 1HZ4A 2WXGA 1OUVA 1MYOA 1OCCE 4DX5D 3FEXA 1YCSB 2F0YA 5CBNA 3SQVA 3OTNA 4JD2G 3R7RA 3MJWA 2I9CA 3E32A 5FINA 3MA5A 2MRIA 4GYWA 5ANLA 2CHXA 4AOFA 4UUCA 4EZLA 1V55E 2ZGGA 3AS4A 5AYWD 2WQ7A 3L82A 4JZYA 1OWPA 1PY1A 4YVQC 4B8CB 2IJGX 3Q78A 4U0ZA 4CT0A 3FULA 3LPZA 4AEZC 1O5MA 2VSOE 4Q94A 2ZIRA 4I2ZA 4GA0A 3FUKA 4KVMA 4KYOB 2HR2A 2V5QC 3PEVB 4GA2A 5AQ9A 3NF1A 4A1SA 5ENOD 4GTRA 4EBAG 4DLQA 2OEWA 5T3RA 2LAIA 4CRWA 3IKOB 3Q15A 3CK7A 1TR4A 3DXKG 4PS7A 3PVLA 3TWQA 4A3TA 3TWWA 3UXGA 3FUFA 1HE8A 2J09A 3DWLG 3HYMB 3IXEA 3ONKA 3FUJA 2DWZA 4GMRA 4KBQA 2H6FA 2QYJA 3LVRE 2KCVA 2XHEA 3S7FA 4DK5A 4HB5A 4F53A 3HXFA 1FVFA 3CV0A 3IV0A 5ARFA 1UJJA 3MV3B 1HX8A 4GTTA 1TN8A 1JCRA 2VQ2A 4AJWA 4APFA 3FH8A 3GZ2A 1OWNA 2FI7A 4YDWA 1EYHA 3HRAA 4GTMA 2LSVA 1INZA 3EIJA 4WWPA 2P9SG 3ASFA 1H2VC 3FH5A 4GZDA 4PUCA 5FJYA 3VTYA 3MGBA 3LVQE 1JCQA 3PS6A 4ANWA 5D0OD 3HXCA 4FC8A 2XQ0A 5FQ4A 4G1TA 2XCBA 5ITZF 3G2WA 5AJDA 1TNOA 3PE3A 3CVWA 3BG1B 4U07A 5EYLA 4Y6CA 3AU4A 4W9RA 2J08A 1TN7A 4C0MA 3ABLE 4BT8A 3VLEA 3NB2A 4GB9A 2AWIA 2V8SE 1FCHA 2PNNA 4HVBA 1K8KG 2XGMA 4G23A 3VLDA 5G04J 3NZUA 4WWNA 3UT8A 4TXRA 1G3NB 3PEUB 3SBSA 3APFA 3QC1A 5LCWJ 3ZU7B 4HI8A 2NC9A 5KJMA 1XNFA 5LOZA 4UWHA 3NOCD 4FHJA 4APOA 2R59A 1KT0A 3DSWA 3ML9A 3FTUA 3TGOA 4J8SA 1MX2A 4TXPA 4EZJA 2EIJE 4TUUA 3WG7E 3FTZA 5EILA 1S63A 1S64A 2KCKA 2OOEA 2UY1A 2NYJA 2NSZA 3RAUA 3D9KA 3D9PA 3DSTA 3CVNA 5KJLA 3ZGQA 3UIOC 4RVBA 1N11A 1H0AA 2WXJA 1ZU2A 5ENTD 5KBAA 1E8YA 3L17A 4LCTA 4DX6D 4HOSA 1WY6A 3B7UX 5JA4D 1EDUA 2OVBA 3TJPA 2PL2A 4GTQA 4ZHBA 3ZRHA 2V4LA 1QBQA 2E0IA 4G8LA 4AM9A 4U8YD 3E34A 3DPYA 2VJ8A 4N5QA 5DIZA 3MZLB 3G2TA 5FZQA 4CZ2D 2GRRB 2DZOA 2P9PG 3FU0A 5FT9A 4YDEA 4BTAA 3FU6A 4FLBA 1UG3A 4DX1A 3MV2B 5E76A 5BNWA 3FTYA 2GROB 4FA6A 2R17C 4UI9J 4HBDA 4ACLA 4M7CA 3UUXA 2GW1A 2QY7A 1SQMA 3L22A 1HO8A 3CKCA 3IBEA 4DJAA 4ATZD 2WQ6A 3HHMA 3AG3E 3QB2A 3CSTA 3E30A 4B94A 4CDNA 4P29A 3FTXA 3LCAA 5ENPD 3ZPJA 2VSYA 2DVWA 4CEMA 2CFUA 4F3VA 3B7RL 2A5EA 3RK6A 5HS0A 2E2EA 4XX5A 5C1DA 2UWJG 1QYMA 2P9LG 2L6JA 3LJNA 4EZKA 1MZCA 1UOHA 3CSFA 3ABME 2Q7FA 2KZTA 4IYPA 2C0MA 2I2OA 4N5CA 1FT2A 4HLLA 4I6JA 3Q79A 1YYHA 3V79K 3SFZA 3B13A 4EHMA 5CRVA 3LXUX 1BU9A 2ETAA 3FUIA 3FU3A 5KJNA 2LSUA 5BXUA 3SD5A 5ARGA 5CECB 4CDRA 4GPKA 1ELWA 4KZ0A 3ZYQA 2A5UA 3L16A 3FWVA 2VYIA 4ATGA 4JL0A 3OAWA 2LNIA 4BSZB 3I5PA 2OVFA 3LY9A 2FO7A 3KS2A 4FLHA 2J07A 5ENSD 2GRQB 4H7XA 3T5VA 3ZYKA 4LERA 3FHEA 3Q7AA 2FULA 3EHMA 2IO3C 4HS2A 5G05J 1FVHA 1NFIE 1TNUA 1N4RA 4BEPA 5HKPA 2P9UG 4BY6A 2J9QA 1JWFA 1EPUA 4NRHB 3UTMA 3W9FA 2BTDA 2P58C 3FTSA 2L0IA 3L6AA 1IHBA 3FTVA 4MS6A 4N3BA 3ULEG 2KATA 1HG5A 4G26A 3PE4A 4ME2A 3ESKA 1N0QA 3Q5MA 1U3CA 2WXHA 3SZ7A 3GW4A 1SA4A 4D10C 1IYGA 4L2LA 3C72A 4MBGA 1TNBA 1U2VG 4WWOA 4BWRA 4XE0A 3CHPA 3UKUG 2MHKA 4NQ0A 2VTBB 1BD8A 3N71A 3CQCB 3EUVA 2KM4A 2AW6A 3JQ1A 4E6HA 1KLXA 2R5SA 4XKCA 5BT1A 4GZ5A 2LAHA 5FZSA 4GMJA 3TWXA 3JYSA 2X6IA 4ILIA 5B1BE 5CBOA 3ASOE 1S70B 3CHOA 5B1AE 1OCZE 4L7TA 4TV3A 3SF4A 1NA3A 3X2QE 3MKRA 4GCNA 4EBAA 3P1UA 5AENA 1RZ4A 1OWLA 5M72A 2XPZA 4IULA 3SBTB 2AXVA 1Z5SC 2PQNA 2VGXA 4U0SA 4HRLA 2XGSA 2GGFA 1D8EA 2GRMA 5HRYA 4UWKA 4EECA 4JW1A 4L23A 2XZDG 1K1AA 1BI8B 2BKKB 2J49A 3ZEFA 5FQ8A 3ASNE 3ZIMA 1E90A 1JWGA 4F1PA 4UWFA 5CHEE 3RKVA 4CT4A 3D9NA 2KXPC 5AQAA 3ZHEA 3CVXA 2CFZA 1Z3XA 3PNTB 1QZ2A 3CR3A 4X8QA 4AIFA 3CHQA 4BTBA 2PM6A 3TXMA 2DCPA 3AS5A 2IEJA 3NAWA 2M63A 4PH4B 4JA7A 2BEDA 4K03A 3UM0A 5G2NA 1L5JA 3D9MA 4MRUA 4LUNU 2C2LA 2F8YA 3FDHA 4BERA 5C2YA 4N2SA 2ONDA 3B7SA 3DEOA 2GRPB 4CCAA 2J8SD 2DYSE 3OXLA 2Y1LE 4C9BB 2FBNA 2P9NG 2GRNB 4GU5A 3GZ1A 2AXZA 1TYQG 1UJKA 3HXBA
chains in the Genus database with same CATH topology
3U4TA 4ANXA 4HORA 4EZJA 4TUUA 4HXIA 3UQ3A 4J8DA 4KT6B 2WXIA 4O6FA 3UPVA 3LKUA 1B89A 2WVIA 2WPVA 1UN9A 3FTZA 3JUIA 4GYOA 4WNGA 2KCKA 3PUJA 2OOEA 1PC2A 4I9EA 1A17A 3S7BA 1NZNA 2WMNA 2UY1A 2A4ZA 4FP7A 4BX9A 2UY1B 2VGYA 3Q49B 4UQXA 5A6CA 4HOTA 3O48A 3I4RB 2NSZA 2Y4UA 4URKA 3D9KA 3D9PA 4GAAA 2YQ8A 2J4DA 1TEZA 3CVNA 5KJLA 3ZGQA 3FY4A 3TG5A 4JPSA 5E75A 2RG8A 2WXPA 4RVBA 3UT4A 1H0AA 2WXJA 3FFLA 1ZU2A 4QFVA 4CGWA 4J8EA 5BW8C 2GRLA 1E8YA 3L17A 4LCTA 4UWLA 3C98A 1WY6A 4HOSA 3B7UX 5G05C 4RG9A 1W3BA 4LRZA 4E85A 1EDUA 4JHJA 2OVBA 3TJPA 4WNFA 3RJVA 5FQ6A 3RIBA 2PL2A 3L08A 3TL5A 2I6HA 3ZFWA 3ZRHA 3ML8A 2V4LA 4R7LA 2XCCA 4RG6A 2E0IA 4GZ3A 2EQXA 4NURA 4AM9A 3K9IA 3ZN3A 3APCA 3ZW3A 2BUGA 4V3IA 4G2VA 4GZCA 2J4BA 4Q96A 2VJ8A 3FTWA 3RRNB 4XIFA 3PUKA 4G25A 5DIZA 3MZLB 5JHBA 3G2TA 3CIAA 5FZQA 1NA0A 4AP2A 2KC7A 3LJ3A 2IF4A 4IRUA 2WXLA 2C0LA 4FJYA 4KMOA 3FU0A 1HF8A 5FT9A 3FUNA 4BTAA 1Z3YA 3CVUA 3FU6A 4FLBA 1UG3A 3D9LA 4FJZA 3FUHA 4EQFA 4FADA 4I6GA 4WNEA 3S2AA 1ELKA 2L9BA 3MKQA 3MV2B 4ANUA 4ACKA 3ASHA 5E76A 3MKQB 4Q69A 5BNWA 1QNFA 5J90A 1E7UA 1VDYA 3FTYA 1XGWA 4FA6A 3QARA 2R17C 4UI9J 3GYZA 5AJLA 4ACLA 4MLPA 3CLJA 4H7YA 3RRMB 3UUXA 1U3DA 3LY8A 3PRZA 4A1GA 5BPPA 1NP7A 2GW1A 2QFCA 4JEUA 5FQ7A 3MCXA 3DBSA 5KCMA 2QY7A 4PS8A 2L0TB 1SQMA 3L22A 3PH0C 1E96B 3HVEA 1SZAA 1HO8A 3KEZA 3HVEB 3AS8A 5FTPA 3CKCA 1JPLA 4OYSA 4JHKA 4U04A 5ANRA 2PQRA 3IEGA 3IBEA 4DJAA 3CVQA 4I1OB 2WXRA 4UI9K 3BEEA 2WQ6A 3HHMA 2FEZA 3QB2A 3QWWA 3CSTA 3SNXA 4B94A 3ASGA 4XI9A 2AXUA 3LEWA 4K0RA 4JVSA 3SHFA 5J08A 3E4BA 4P29A 4FU3A 2MOWA 4CDNA 3FTXA 3LCAA 2X6FA 3ZPJA 2BF0X 4GZ6A 3OXFA 1QQEA 4WAFA 4ANVA 3IHYA 3T8MA 2VSYA 4A55A 4CEMA 3IHVA 4I1AA 3G2UA 2WXKA 2CFUA 3CK8A 3CGHA 2PM7A 3B7RL 3KD7A 3RK6A 4F3VA 3RU0A 2E2EA 3UX4A 4J8FA 5CCMA 4XX5A 3PNLB 4L1BA 2WM9A 3MEKA 3VTXA 5C1DA 2UWJG 2L6JA 2ZU6B 3HDXA 1IQRA 3SI5A 4EZKA 3FH7A 3I3NA 1TJFA 3CSFA 3CHRA 5BV1A 4KZCA 2Q7FA 4EPZA 4N3AA 1JUQA 2KZTA 5D0QD 3RRUA 4IYPA 2C0MA 5T8IA 2I2OA 2KZTB 4F7AA 2IOSA 4A3VA 4N5CA 2VSNA 2X38A 4I6JA 2CG3A 4M3OA 3D3MA 3SGHA 4PDXA 4GA1A 4KXKB 2XRYA 4U0UA 2X6KA 3SFZA 4B0ZA 3QDNA 3B13A 2VTBA 3EIQC 4AVXA 1IHGA 2X6JA 3LXUX 4KVOA 2IU1A 3R9AB 3FUIA 3B7TA 3DPDA 5LFAA 5ENNA 3UT7A 3QAQA 1P5QA 4MKTA 3ZVVA 1HZ4A 2WXGA 1OUVA 2I1KA 2IQCA 3TXNA 3FEXA 3EDTB 3D9OA 3ULQA 3FU3A 2X6HA 3OTNA 2XEVA 5KJNA 2LSUA 3QOUA 3NZSA 3QWPA 1H6KA 3OXGA 3R7RA 4AV7A 3MJWA 2WXNA 3S7JA 3SD5A 1E8XA 2RD0A 4I6EA 5ARGA 2I9CA 1GW6A 5CCLA 4CDRA 4GPKA 5A23A 4JHRA 1EF1C 1ELWA 3U64A 3MA5A 2MRIA 4GYWA 2FF4A 3FUDA 2V5FA 4FULA 4KZ0A 5ANLA 2CHXA 2A5UA 3ZYQA 4AOFA 3L16A 3FWVA 1E8WA 4I43A 4EZLA 4FHKA 1UW4B 3AS4A 3URZA 2VYIA 5AYWD 4ABNA 2WQ7A 4ATGA 4JL0A 3OAWA 2LNIA 4JZYA 4AXHA 1OWPA 1PY1A 4YVQC 4B8CB 5G04C 2IJGX 4U0ZA 3I5PA 4CT0A 1LF8A 2OVFA 3FULA 3LY9A 4CDMA 2FO7A 3CVPA 3LPZA 4AEZC 3KS2A 4FLHA 2VSOE 4B89A 4Q94A 2J07A 4C0EA 3LS8A 1N54A 4I2ZA 4GA0A 5LX8A 4H7XA 5JJTA 3FUKA 5AIJA 4KVMA 3ZYKA 3T5VA 1Z6TA 3NQPA 4LERA 4XKBA 1ZBPA 3P2BA 5CMYA 3FHEA 1OWOA 4I17A 4G11A 2FULA 2HR2A 3EHMA 4KYOB 3PEVB 5EKQD 2CG2A 1HH8A 4GA2A 2YINA 5EDSA 4HS2A 3NF1A 4RSYA 3ENEA 5G05J 1FVHA 3CHSA 4A1SA 3ZYMA 4ILHB 2DIWA 3U3WA 4EBAG 4DLQA 3JCKC 3AU5A 5T3RA 5T4YA 4N2QA 1HU3A 2LAIA 1YA0A 2Y4TA 3CVLA 3JQ0A 4CRWA 3G2VA 3O4ZA 3FUEA 4JA9A 4BY6A 2J9QA 1Y8MA 3IKOB 3Q15A 1OWMA 1JWFA 3CK7A 1EPUA 2HM8A 3ONLA 4JC8A 4NRHB 1N52A 4PS7A 3PVLA 1S0PA 1H2UA 3FP3A 3VLFA 2BTDA 2P58C 4A3TA 4B8AA 4I9CA 4U8HA 3FUFA 5LP0A 3FTSA 1HE8A 2J09A 1PAQA 2L0IA 4WUYA 3L6AA 1HXIA 3FTVA 3HYMB 1MHQA 3QNKA 4MS6A 3EJNA 4N3BA 3ONKA 3FU5A 2KCLA 2KATA 3FUJA 5A7DB 1HG5A 4G26A 4KBQA 3PE4A 4ME2A 3ESKA 4GMLA 2LO6A 4HFGA 5HI7A 5BUZA 3Q5MA 5DBKA 3LVRE 4I2WA 1U3CA 2KCVA 2XHEA 1E7VA 2WXHA 3CHMA 3S7FA 3SZ7A 2CHWA 3GW4A 4BT9A 4DI4A 4DK5A 1KT1A 4D10C 1IYGA 4BFRA 4L2LA 4F53A 3RO2A 1FVFA 3CV0A 3IV0A 4JEHA 3RO3A 4WWOA 5ARFA 4BWRA 4HOUA 4XE0A 2NXPA 5CMWA 4DI3A 5HQ8A 3CHPA 3ASDA 3LYAA 5JHAA 1UJJA 2MHKA 3MV3B 1SZ9A 4NQ0A 4IN3B 3TG4A 2WB2A 2VTBB 1HX8A 3N71A 3ZXSA 2XRZA 3CQCB 4AY5A 3LDZA 2KM4A 2AW6A 2WMOA 3JQ1A 4L2YA 2IONA 2YHCA 4E6HA 1KLXA 2DBAA 1X5BA 2R5SA 2VQ2A 4AJWA 4XKCA 5BT1A 4APFA 4GZ5A 5G55A 3I4GA 2LAHA 5FZSA 4GMJA 2WXOA 3FH8A 3GZ2A 4WNDA 4AY6A 1OWNA 2FI7A 2Y3AA 2IOLA 3JYSA 2X6IA 3L13A 3S7DA 4ILIA 4U63A 1EYHA 3CEQA 1WAO1 4G24A 4ILGA 4N39A 2LSVA 3CHOA 4UI9C 1INZA 3ZYLA 3EIJA 2JEKA 4WWPA 3ASFA 1BPOA 1H2VC 4L7TA 3FH5A 5EX0A 3QJZA 4GZDA 3QK0A 4TV3A 3SF4A 4DLOA 2V0PA 4PUCA 5FJYA 2X3MA 2XPYA 1NA3A 3VTYA 1WM5A 4BSXA 3MKRA 3MGBA 3LVQE 2ILRA 4GCNA 3ESLA 3PZDA 4BX8A 3UMVA 4EBAA 3P1UA 3PS6A 5AENA 1OWLA 4ANWA 5M72A 2XPZA 3FEYA 4TRQA 4YNDA 4IULA 1HS6A 5D0OD 5LCWC 4OVVA 3BG0B 3SBTB 2AXVA 2JLBA 2YHEA 4FC8A 2XQ0A 5FQ4A 2PQNA 2XCBA 4G1TA 2VGXA 4U0SA 2OV8A 1HFAA 2CHZA 2XGSA 3D9IA 2VGXB 4YVOA 2GGFA 2GRMA 4UWKA 2WXQA 4EECA 4HLEA 3G2WA 4JW1A 4L23A 4XZ4A 5AJDA 3U9WA 2XGOA 4Y6WA 1Y6IA 1MQSA 1ELRA 3MX3A 3CQGB 4OVUA 2AVPA 2J49A 3PE3A 3ZEFA 5FQ8A 3PREA 2HYZA 3CVWA 3ZIMA 3BG1B 4U07A 4UQYA 1E90A 3Q4AB 4Y6CA 3AU4A 4W9RA 1JWGA 2J08A 2WXFA 3TAXA 4I1MA 3CK9A 4UWFA 2WXMA 3D9JA 4C0MA 5CHEE 3RKVA 1IQUA 3D9NA 1DNPA 4CT4A 3ZHEA 4XI0A 2IFUA 4UWGA 4BT8A 3VLEA 3ZHEB 3CVXA 2CFZA 1Z3XA 3APDA 1QZ2A 3CR3A 3CKBA 3GZSA 3PNTB 3R7QA 4CGVA 4GB9A 2AWIA 2V8SE 4AIFA 1FCHA 3CHQA 5FWQA 4UQZA 4BTBA 4HOQA 2PM6A 3T5XA 3FUMA 3TXMA 2I1JA 3EHNA 2DCPA 3AS5A 4HVBA 1UN8A 2M63A 2XGMA 4PH4B 4JA7A 5JJ7A 1H2TC 1HG2A 4G23A 4K03A 3VLDA 2PZIA 3QWVA 5KJKA 4JXTA 5G04J 5G2NA 3CVVA 3NZUA 2YNQA 4WWNA 1L5JA 4GYYA 3UT8A 3WXXA 1DVPA 3D9MA 3PEUB 3L54A 3SBSA 4DPRA 4F1SA 1H19A 3LY7A 4MRUA 3APFA 3MYVA 3QC1A 5JJ6A 5LCWJ 4LUNU 2C2LA 3FDHA 5FZRA 5C2YA 4J6IA 4N2SA 2HO1A 3QKYA 4NACA 2WQHA 2ONDA 2NC9A 3B7SA 3Q47B 5KJMA 3U66A 1XNFA 2VSXE 4GCOA 5LOZA 4UWHA 4J0UA 3CVYA 3KAEA 4CCAA 4N3CA 4FHJA 4APOA 5EX3A 1TJCA 2R59A 1KT0A 3ML9A 2XPIA 3OXLA 3FTUA 4C9BB 3TGOA 2FBNA 3PDNA 4J8SA 4LEUA 4GU5A 3GZ1A 4PS3A 2AXZA 5BV0A 1UJKA 3G2SA 1E8ZA 3HIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U4T A;  4HOR A;  3UQ3 A;  4J8D A;  3UPV A;  4O6F A;  3LKU A;  1B89 A;  4GYO A;  2WPV A;  4WNG A;  2KCK A;  4I9E A;  2OOE A;  1PC2 A;  1A17 A;  3S7B A;  1NZN A;  2UY1 A;  2UY1 B;  2VGY A;  3Q49 B;  4UQX A;  5A6C A;  4HOT A;  3O48 A;  2Y4U A;  2YQ8 A;  3CVN A;  5KJL A;  3ZGQ A;  3TG5 A;  4CGW A;  3FFL A;  1ZU2 A;  4J8E A;  5BW8 C;  4HOS A;  5G05 C;  4RG9 A;  1W3B A;  4WNF A;  3RJV A;  3RIB A;  2PL2 A;  3ZFW A;  2I6H A;  2XCC A;  4RG6 A;  4GZ3 A;  4AM9 A;  3K9I A;  3ZN3 A;  2BUG A;  4G2V A;  4XIF A;  4G25 A;  5DIZ A;  5FZQ A;  1NA0 A;  2KC7 A;  2IF4 A;  2C0L A;  5FT9 A;  4BTA A;  4EQF A;  4WNE A;  3MV2 B;  3ASH A;  5BNW A;  4UI9 J;  3GYZ A;  4H7Y A;  3UUX A;  3LY8 A;  2GW1 A;  2QFC A;  1E96 B;  3AS8 A;  5FTP A;  3CKC A;  4U04 A;  2PQR A;  3IEG A;  3CVQ A;  4UI9 K;  3BEE A;  2FEZ A;  3QWW A;  4B94 A;  3ASG A;  4XI9 A;  3E4B A;  3LCA A;  3ZPJ A;  4GZ6 A;  3OXF A;  1QQE A;  2VSY A;  4I1A A;  3CK8 A;  3KD7 A;  4F3V A;  3RU0 A;  2E2E A;  4J8F A;  5CCM A;  3MEK A;  3VTX A;  5C1D A;  2UWJ G;  2L6J A;  2Q7F A;  4N3A A;  5D0Q D;  2C0M A;  4N5C A;  2VSN A;  4GA1 A;  4KXK B;  4U0U A;  3QDN A;  1IHG A;  3R9A B;  1P5Q A;  1HZ4 A;  1OUV A;  3EDT B;  3ULQ A;  2XEV A;  5KJN A;  2LSU A;  3QOU A;  3QWP A;  3OXG A;  3S7J A;  5ARG A;  5CCL A;  4CDR A;  4GPK A;  4JHR A;  1ELW A;  3MA5 A;  4GYW A;  2FF4 A;  2V5F A;  3FWV A;  3AS4 A;  3URZ A;  2VYI A;  5AYW D;  4ABN A;  4JL0 A;  2LNI A;  4YVQ C;  5G04 C;  4U0Z A;  3LY9 A;  2FO7 A;  3CVP A;  3LPZ A;  3KS2 A;  4I2Z A;  4GA0 A;  4H7X A;  5JJT A;  1ZBP A;  4I17 A;  4KYO B;  2HR2 A;  5EKQ D;  1HH8 A;  4GA2 A;  3NF1 A;  5G05 J;  4A1S A;  3U3W A;  4N2Q A;  3CVL A;  2Y4T A;  1YA0 A;  4JA9 A;  2J9Q A;  1Y8M A;  3Q15 A;  3CK7 A;  4NRH B;  3FP3 A;  2P58 C;  4I9C A;  4WUY A;  1HXI A;  3HYM B;  4N3B A;  2KCL A;  2KAT A;  5A7D B;  4G26 A;  4KBQ A;  3PE4 A;  4ME2 A;  3ESK A;  5HI7 A;  3Q5M A;  5DBK A;  4I2W A;  2KCV A;  3S7F A;  3SZ7 A;  4BT9 A;  3GW4 A;  1KT1 A;  1IYG A;  3RO2 A;  3CV0 A;  3RO3 A;  5ARF A;  4BWR A;  4HOU A;  5HQ8 A;  3ASD A;  3LYA A;  2MHK A;  3MV3 B;  4NQ0 A;  4IN3 B;  3TG4 A;  3N71 A;  4AY5 A;  2YHC A;  1KLX A;  2DBA A;  2R5S A;  2VQ2 A;  5BT1 A;  4GZ5 A;  5FZS A;  4AY6 A;  4WND A;  3GZ2 A;  2FI7 A;  3JYS A;  3S7D A;  3CEQ A;  1WAO 1;  4G24 A;  4N39 A;  2LSV A;  4UI9 C;  3ASF A;  5EX0 A;  3SF4 A;  5FJY A;  1NA3 A;  3VTY A;  1WM5 A;  3MKR A;  4GCN A;  5M72 A;  4YND A;  5D0O D;  5LCW C;  2JLB A;  2PQN A;  2XCB A;  4G1T A;  2VGX A;  4U0S A;  2XGS A;  4YVO A;  2VGX B;  2XGO A;  4Y6W A;  1ELR A;  2AVP A;  3PE3 A;  2HYZ A;  4U07 A;  4UQY A;  3Q4A B;  4Y6C A;  4W9R A;  3TAX A;  3CK9 A;  5CHE E;  3RKV A;  3ZHE A;  4XI0 A;  2IFU A;  4BT8 A;  3ZHE B;  3CKB A;  1QZ2 A;  4CGV A;  4AIF A;  1FCH A;  4BTB A;  4UQZ A;  4HOQ A;  3AS5 A;  2XGM A;  4JA7 A;  5JJ7 A;  4G23 A;  2PZI A;  3QWV A;  5KJK A;  5G04 J;  4GYY A;  3WXX A;  3LY7 A;  5JJ6 A;  5LCW J;  2C2L A;  5FZR A;  4N2S A;  2HO1 A;  3QKY A;  2WQH A;  2OND A;  2NC9 A;  3Q47 B;  5KJM A;  1XNF A;  4GCO A;  4J0U A;  3KAE A;  4N3C A;  4APO A;  5EX3 A;  1TJC A;  1KT0 A;  2XPI A;  3OXL A;  3TGO A;  2FBN A;  3PDN A;  4LEU A;  3GZ1 A; 
#chains in the Genus database with same CATH topology
 4HOR A;  2IY0 C;  3UQ3 A;  4KT6 B;  3LKU A;  2LXL A;  2WVI A;  3JUI A;  4LNB A;  3NBN B;  3PUJ A;  3S7B A;  1O1S A;  4UQX A;  4L9P A;  2Y4U A;  4URK A;  1NL4 A;  1N9A A;  3DSX A;  3TG5 A;  2VGE A;  2RG8 A;  5KNG A;  3T9K A;  4J8E A;  3DXM G;  4UWL A;  4XEI G;  4WNF A;  3RJV A;  3TL5 A;  2I6H A;  3ML8 A;  2XCC A;  4RG6 A;  3UM1 A;  4LG6 A;  2BUG A;  4V3I A;  4U8V D;  4Q96 A;  5AQ7 A;  2EIL E;  3FTW A;  3RRN B;  4G25 A;  3CIA A;  3UI2 A;  4IRU A;  4KMO A;  1HF8 A;  1Z3Y A;  3CVU A;  1TNZ A;  4EQF A;  4I6G A;  4WNE A;  2L9B A;  4ACK A;  3KSQ A;  3MKQ B;  3EU9 A;  3QAR A;  2HE0 A;  4MLP A;  3CLJ A;  2Y69 E;  4JEU A;  5H7P A;  4HQD A;  3DBS A;  3PH0 C;  5FIO A;  3HVE B;  1JPL A;  1TNY A;  2PQR A;  2EIK E;  3BEE A;  3HG0 D;  3ASG A;  4XI9 A;  1OXJ A;  4K0R A;  1A5E A;  3E4B A;  4FU3 A;  2MOW A;  4JB8 P;  3OXF A;  4WAF A;  2P9I G;  4A55 A;  3IHV A;  4GTP A;  5ENR D;  3CK8 A;  3KD7 A;  3PNL B;  2WM9 A;  3MEK A;  1IQR A;  3CHR A;  4KZC A;  4N3A A;  3RRU A;  2IOS A;  2H6I A;  3SGH A;  2X6K A;  4DX2 A;  3F6Q A;  2VTB A;  3EIQ C;  4AVX A;  3Q73 A;  1YMP A;  1X81 A;  4A63 B;  3B7T A;  5ENN A;  2I1K A;  1OCO E;  2XEN A;  3TXN A;  3EDT B;  3D9O A;  3NZS A;  4F6R D;  1K3Z D;  1H6K A;  3SFY A;  4AV7 A;  1AP7 A;  4LNU D;  1H6P A;  5CCL A;  5A23 A;  1V54 E;  4JHR A;  3U64 A;  3FUD A;  2V5F A;  1E8W A;  1N94 A;  3URZ A;  4AXH A;  3B7B A;  5G04 C;  5D2M C;  1N0R A;  4CDM A;  4B89 A;  4C0E A;  1LD7 A;  1N54 A;  5LX8 A;  5JJT A;  3UM3 A;  4XKB A;  5CRU A;  1OWO A;  4I17 A;  3EU5 A;  2CG2 A;  3ENE A;  2ETC A;  3ZYM A;  3JCK C;  5T4Y A;  2Y4T A;  1YA0 A;  5EN5 D;  3JQ0 A;  3G2V A;  3O4Z A;  4JA9 A;  1OWM A;  2HM8 A;  4JC8 A;  2XS1 A;  3C3Q A;  1H2U A;  3FP3 A;  3VLF A;  4U95 D;  4B8A A;  4I9C A;  4U8H A;  5LP0 A;  1PAQ A;  4WUY A;  4TXQ A;  2XEE A;  3J5P A;  3KEA A;  2P2C P;  2KCL A;  2RKK A;  3NOG D;  5HI7 A;  4HFG A;  3HXD A;  1FT1 A;  2F37 A;  4I2W A;  1E7V A;  3TWS A;  3CHM A;  2CHW A;  4DI4 A;  1KT1 A;  3TWR A;  3C5R A;  4BFR A;  1O1T A;  2QZA A;  3B95 A;  2AJA A;  4JEH A;  4HOU A;  2NXP A;  4DI3 A;  5HQ8 A;  3ASD A;  3Q7F A;  5AAR A;  3TG4 A;  2IO2 C;  3E37 A;  5CER B;  3ZXS A;  2XRZ A;  3AAA C;  4AY5 A;  3LDZ A;  2WMO A;  3ISM C;  2DBA A;  3V31 A;  1X5B A;  4YDY A;  3I4G A;  4AY6 A;  2WXO A;  4WND A;  2B6C A;  2IOL A;  1LTX A;  3CEQ A;  4G24 A;  4ILG A;  4BET A;  4UI9 C;  3T8K A;  2JEK A;  1BPO A;  2XS8 A;  5EX0 A;  3QK0 A;  4DLO A;  1D9S A;  2V0P A;  2OCC E;  4BSX A;  2ILR A;  3Q75 A;  3PZD A;  2LXM A;  4HI9 A;  4K5A B;  1KPS B;  3FEY A;  3JXJ A;  4TRQ A;  1HS6 A;  2JLB A;  2YHE A;  3V2X A;  2OV8 A;  2CHZ A;  2WXQ A;  1Q2Z A;  4C48 B;  5B3S E;  3U9W A;  1Y6I A;  1ELR A;  3CQG B;  2AVP A;  1WDY A;  3PRE A;  2HYZ A;  5AQB A;  3W9G A;  4UQY A;  1OCR E;  3Q4A B;  5CED B;  2WXM A;  3D9J A;  4QQI A;  4UWG A;  3R7Q A;  1JCS A;  1BI7 B;  3AG4 E;  2JAB A;  2I1J A;  3EHN A;  1UN8 A;  1H2T C;  1HG2 A;  2PZI A;  3QWV A;  3CVV A;  4JXT A;  4DPR A;  2YNQ A;  2RFA A;  4GYY A;  3WXX A;  3LY7 A;  5JJ6 A;  2HO1 A;  3QKY A;  4NAC A;  2WQH A;  3Q47 B;  1MJ0 A;  4N3C A;  3AG1 E;  3ZNG A;  1IXV A;  5ENQ D;  4LEU A;  4PS3 A;  2XZT G;  1TN6 A;  4HXI A;  3UPV A;  2WXI A;  4O6F A;  3TWT A;  1B89 A;  4GYO A;  2WPV A;  1UN9 A;  4WNG A;  4I9E A;  3UIN C;  1A17 A;  3V30 A;  1O1R A;  4BX9 A;  2UY1 B;  2VGY A;  3Q49 B;  5A6C A;  4HOT A;  2F8X K;  3TWU A;  3I4R B;  4GAA A;  1TEZ A;  3HXE A;  3FY4 A;  4JPS A;  2LUH A;  3UT4 A;  3UKR G;  5BW8 C;  3C98 A;  5G05 C;  4RG9 A;  4LRZ A;  5EIB E;  4GTO A;  4HRN A;  2DZN A;  4JHJ A;  3ZUV B;  5FQ6 A;  1LD8 A;  1H6O A;  4GPM A;  2DYR E;  4R7L A;  4GZ3 A;  4NUR A;  3ZW3 A;  3APC A;  4GZC A;  4XIF A;  5CEA A;  1NA0 A;  4AP2 A;  2KC7 A;  3LJ3 A;  2IF4 A;  3DSU A;  2WXL A;  1FPP A;  2C0L A;  3FUN A;  3D9L A;  3FUH A;  4ANU A;  4Q69 A;  1QNF A;  1E7U A;  1VDY A;  1XGW A;  3GYZ A;  3RRM B;  1U3D A;  2EIM E;  3LY8 A;  5BPP A;  1NP7 A;  5FQ7 A;  3PZ2 A;  5KCM A;  4PS8 A;  1E96 B;  4OYS A;  4U04 A;  4JHK A;  3IEG A;  3CVQ A;  1N4S A;  4I1O B;  4O60 A;  3QWW A;  3SNX A;  3LEW A;  1D8D A;  4JVS A;  3SHF A;  2ZIS A;  2BF0 X;  4GZ6 A;  4ANV A;  3IHY A;  4I1A A;  1IKN D;  3G2U A;  2WXK A;  5BXO A;  5JMN D;  4J8F A;  3C3R A;  1MX4 A;  3L9T A;  4L1B A;  4OAU C;  3VTX A;  3EHR A;  3KSL A;  3HDX A;  5BV1 A;  1JUQ A;  5D0Q D;  2KZT B;  1OY3 D;  1DC2 A;  2X38 A;  2CG3 A;  3D3M A;  4PDX A;  4GA1 A;  4KXK B;  2R2L A;  4BES A;  4J8Y A;  1IHG A;  2X6J A;  2IU1 A;  1ZB1 A;  4HNA D;  3DPD A;  5LFA A;  3QAQ A;  5KWD A;  1P5Q A;  3ZVV A;  3D9H A;  2IQC A;  3ULQ A;  2X6H A;  2XEV A;  3QOU A;  3EHQ A;  3QWP A;  3OXG A;  3S7J A;  2WXN A;  1WG0 A;  1E8X A;  2RD0 A;  4I6E A;  1GW6 A;  1EF1 C;  2FF4 A;  4FUL A;  2EIN E;  1BLX B;  4I43 A;  4FHK A;  1UW4 B;  4ABN A;  2ZGD A;  1LF8 A;  3ABK E;  3CVP A;  3LS8 A;  5AIJ A;  1Z6T A;  3NQP A;  5CMY A;  1ZBP A;  3P2B A;  2QYU A;  4G11 A;  4ZFH A;  3E33 A;  5EKQ D;  1HH8 A;  2YIN A;  5EDS A;  3JXI A;  4RSY A;  2QC9 A;  2FO1 E;  3CHS A;  4ILH B;  2DIW A;  2BKG A;  3U3W A;  3AU5 A;  4GTS A;  4N2Q A;  1HU3 A;  3CVL A;  3FUE A;  3JUE A;  1Y8M A;  3SFX A;  3ONL A;  5KNH D;  1N52 A;  2R03 A;  1S0P A;  4TUM A;  1HXI A;  1MHQ A;  3QNK A;  3EJN A;  3Q9U C;  3FU5 A;  2H6G A;  5A7D B;  2L6B A;  4GML A;  2LO6 A;  5BUZ A;  4G8K A;  4LSZ E;  5DBK A;  4BT9 A;  3RO2 A;  3ZKJ A;  3RO3 A;  4GTV A;  5CMW A;  1RW2 A;  3LYA A;  5JHA A;  1SZ9 A;  2WB2 A;  2R05 A;  4IN3 B;  3C3O A;  3UM2 A;  4U96 D;  4L2Y A;  2ION A;  2YHC A;  3AG2 E;  5G55 A;  1AWC B;  2Y3A A;  3L13 A;  3S7D A;  4U63 A;  1WAO 1;  4N39 A;  3ZYL A;  3AJI A;  3QJZ A;  2X3M A;  2XPY A;  1WM5 A;  3ESL A;  4BX8 A;  3UMV A;  4YND A;  5LCW C;  4OVV A;  3BG0 B;  2RFM A;  1KZO A;  3BQO A;  1HFA A;  4YVO A;  3D9I A;  2VGX B;  2XEH A;  4HLE A;  4XZ4 A;  2XGO A;  4Y6W A;  1MQS A;  4K5C A;  3MX3 A;  4OVU A;  4OAV B;  1OT8 A;  4CYM D;  3ZXP A;  2WXF A;  3TAX A;  4I1M A;  3CK9 A;  2KBX A;  1IQU A;  1DNP A;  4XI0 A;  2IFU A;  1MX6 A;  4RQI A;  3ZHE B;  4B93 B;  3CKB A;  3APD A;  3GZS A;  4CGV A;  2R02 A;  3V2O A;  5FWQ A;  4UQZ A;  4HOQ A;  3RSE G;  1N95 A;  5EID A;  3T5X A;  3FUM A;  4DRX E;  4Z68 A;  5JJ7 A;  5KJK A;  1SW6 A;  4F1S A;  1DVP A;  3L54 A;  1H19 A;  3MYV A;  5FZR A;  4J6I A;  4NIK A;  3U66 A;  3PZ1 A;  2VSX E;  4GCO A;  3CVY A;  4J0U A;  3KAE A;  5EX3 A;  1TJC A;  2XPI A;  4U7E B;  3PDN A;  5AN8 A;  1SA5 A;  4YDO A;  1SVX A;  3DSS A;  4DUI A;  3G2S A;  5BV0 A;  1E8Z A;  4HRM B;  3HIZ A;  3U4T A;  4ANX A;  4J8D A;  4O1P A;  1PC2 A;  1NZN A;  2WMN A;  2A4Z A;  4FP7 A;  4O1O A;  3O48 A;  2YQ8 A;  2J4D A;  3TWV A;  5IY5 E;  5E75 A;  3PZ4 A;  2WXP A;  5D66 A;  4CGW A;  3FFL A;  4QFV A;  2P9K G;  2GRL A;  1N4P A;  1W3B A;  4E85 A;  3RIB A;  3L08 A;  3ZFW A;  3R9M A;  3J5Q B;  2B0O E;  2EQX A;  3K9I A;  3ZN3 A;  4G2V A;  2J4B A;  2OEV A;  3PUK A;  5JHB A;  1KZP A;  2MYO A;  3UIP C;  4FJY A;  4J7W A;  3DSV A;  3BU8 A;  1K1B A;  4FJZ A;  4FAD A;  3S2A A;  1ELK A;  3MKQ A;  4LNG A;  5AAO A;  3ASH A;  5J90 A;  5AJL A;  3ULY A;  4H7Y A;  2V4H C;  1N4Q A;  3PRZ A;  5EYP F;  4A1G A;  2QFC A;  3MCX A;  2L0T B;  3HVE A;  1DCQ A;  1SZA A;  2Y0B G;  4K5B A;  3KEZ A;  3AS8 A;  5FTP A;  3BUA A;  5ANR A;  2WXR A;  4UI9 K;  2FEZ A;  3SY2 A;  2AXU A;  5J08 A;  1DCE A;  4RLY A;  2X6F A;  1QQE A;  3DRA A;  3T8M A;  3Q9N C;  3CGH A;  2PM7 A;  4DX7 D;  3RU0 A;  3UX4 A;  5CCM A;  2ZXW E;  2ZU6 B;  3DEP A;  3SI5 A;  3FH7 A;  3I3N A;  1TJF A;  4EPZ A;  5T8I A;  3SO8 A;  2H6H A;  2ETB A;  4F7A A;  4A3V A;  2VSN A;  4M3O A;  1NI1 A;  2XRY A;  4U0U A;  4B0Z A;  3QDN A;  3PZ3 A;  4KVO A;  3R9A B;  3UT7 A;  4MKT A;  1HZ4 A;  2WXG A;  1OUV A;  1MYO A;  1OCC E;  4DX5 D;  3FEX A;  1YCS B;  2F0Y A;  5CBN A;  3SQV A;  3OTN A;  4JD2 G;  3R7R A;  3MJW A;  2I9C A;  3E32 A;  5FIN A;  3MA5 A;  2MRI A;  4GYW A;  5ANL A;  2CHX A;  4AOF A;  4UUC A;  4EZL A;  1V55 E;  2ZGG A;  3AS4 A;  5AYW D;  2WQ7 A;  3L82 A;  4JZY A;  1OWP A;  1PY1 A;  4YVQ C;  4B8C B;  2IJG X;  3Q78 A;  4U0Z A;  4CT0 A;  3FUL A;  3LPZ A;  4AEZ C;  1O5M A;  2VSO E;  4Q94 A;  2ZIR A;  4I2Z A;  4GA0 A;  3FUK A;  4KVM A;  4KYO B;  2HR2 A;  2V5Q C;  3PEV B;  4GA2 A;  5AQ9 A;  3NF1 A;  4A1S A;  5ENO D;  4GTR A;  4EBA G;  4DLQ A;  2OEW A;  5T3R A;  2LAI A;  4CRW A;  3IKO B;  3Q15 A;  3CK7 A;  1TR4 A;  3DXK G;  4PS7 A;  3PVL A;  3TWQ A;  4A3T A;  3TWW A;  3UXG A;  3FUF A;  1HE8 A;  2J09 A;  3DWL G;  3HYM B;  3IXE A;  3ONK A;  3FUJ A;  2DWZ A;  4GMR A;  4KBQ A;  2H6F A;  2QYJ A;  3LVR E;  2KCV A;  2XHE A;  3S7F A;  4DK5 A;  4HB5 A;  4F53 A;  3HXF A;  1FVF A;  3CV0 A;  3IV0 A;  5ARF A;  1UJJ A;  3MV3 B;  1HX8 A;  4GTT A;  1TN8 A;  1JCR A;  2VQ2 A;  4AJW A;  4APF A;  3FH8 A;  3GZ2 A;  1OWN A;  2FI7 A;  4YDW A;  1EYH A;  3HRA A;  4GTM A;  2LSV A;  1INZ A;  3EIJ A;  4WWP A;  2P9S G;  3ASF A;  1H2V C;  3FH5 A;  4GZD A;  4PUC A;  5FJY A;  3VTY A;  3MGB A;  3LVQ E;  1JCQ A;  3PS6 A;  4ANW A;  5D0O D;  3HXC A;  4FC8 A;  2XQ0 A;  5FQ4 A;  4G1T A;  2XCB A;  5ITZ F;  3G2W A;  5AJD A;  1TNO A;  3PE3 A;  3CVW A;  3BG1 B;  4U07 A;  5EYL A;  4Y6C A;  3AU4 A;  4W9R A;  2J08 A;  1TN7 A;  4C0M A;  3ABL E;  4BT8 A;  3VLE A;  3NB2 A;  4GB9 A;  2AWI A;  2V8S E;  1FCH A;  2PNN A;  4HVB A;  1K8K G;  2XGM A;  4G23 A;  3VLD A;  5G04 J;  3NZU A;  4WWN A;  3UT8 A;  4TXR A;  1G3N B;  3PEU B;  3SBS A;  3APF A;  3QC1 A;  5LCW J;  3ZU7 B;  4HI8 A;  2NC9 A;  5KJM A;  1XNF A;  5LOZ A;  4UWH A;  3NOC D;  4FHJ A;  4APO A;  2R59 A;  1KT0 A;  3DSW A;  3ML9 A;  3FTU A;  3TGO A;  4J8S A;  1MX2 A;  4TXP A;  4EZJ A;  2EIJ E;  4TUU A;  3WG7 E;  3FTZ A;  5EIL A;  1S63 A;  1S64 A;  2KCK A;  2OOE A;  2UY1 A;  2NYJ A;  2NSZ A;  3RAU A;  3D9K A;  3D9P A;  3DST A;  3CVN A;  5KJL A;  3ZGQ A;  3UIO C;  4RVB A;  1N11 A;  1H0A A;  2WXJ A;  1ZU2 A;  5ENT D;  5KBA A;  1E8Y A;  3L17 A;  4LCT A;  4DX6 D;  4HOS A;  1WY6 A;  3B7U X;  5JA4 D;  1EDU A;  2OVB A;  3TJP A;  2PL2 A;  4GTQ A;  4ZHB A;  3ZRH A;  2V4L A;  1QBQ A;  2E0I A;  4G8L A;  4AM9 A;  4U8Y D;  3E34 A;  3DPY A;  2VJ8 A;  4N5Q A;  5DIZ A;  3MZL B;  3G2T A;  5FZQ A;  4CZ2 D;  2GRR B;  2DZO A;  2P9P G;  3FU0 A;  5FT9 A;  4YDE A;  4BTA A;  3FU6 A;  4FLB A;  1UG3 A;  4DX1 A;  3MV2 B;  5E76 A;  5BNW A;  3FTY A;  2GRO B;  4FA6 A;  2R17 C;  4UI9 J;  4HBD A;  4ACL A;  4M7C A;  3UUX A;  2GW1 A;  2QY7 A;  1SQM A;  3L22 A;  1HO8 A;  3CKC A;  3IBE A;  4DJA A;  4ATZ D;  2WQ6 A;  3HHM A;  3AG3 E;  3QB2 A;  3CST A;  3E30 A;  4B94 A;  4CDN A;  4P29 A;  3FTX A;  3LCA A;  5ENP D;  3ZPJ A;  2VSY A;  2DVW A;  4CEM A;  2CFU A;  4F3V A;  3B7R L;  2A5E A;  3RK6 A;  5HS0 A;  2E2E A;  4XX5 A;  5C1D A;  2UWJ G;  1QYM A;  2P9L G;  2L6J A;  3LJN A;  4EZK A;  1MZC A;  1UOH A;  3CSF A;  3ABM E;  2Q7F A;  2KZT A;  4IYP A;  2C0M A;  2I2O A;  4N5C A;  1FT2 A;  4HLL A;  4I6J A;  3Q79 A;  1YYH A;  3V79 K;  3SFZ A;  3B13 A;  4EHM A;  5CRV A;  3LXU X;  1BU9 A;  2ETA A;  3FUI A;  3FU3 A;  5KJN A;  2LSU A;  5BXU A;  3SD5 A;  5ARG A;  5CEC B;  4CDR A;  4GPK A;  1ELW A;  4KZ0 A;  3ZYQ A;  2A5U A;  3L16 A;  3FWV A;  2VYI A;  4ATG A;  4JL0 A;  3OAW A;  2LNI A;  4BSZ B;  3I5P A;  2OVF A;  3LY9 A;  2FO7 A;  3KS2 A;  4FLH A;  2J07 A;  5ENS D;  2GRQ B;  4H7X A;  3T5V A;  3ZYK A;  4LER A;  3FHE A;  3Q7A A;  2FUL A;  3EHM A;  2IO3 C;  4HS2 A;  5G05 J;  1FVH A;  1NFI E;  1TNU A;  1N4R A;  4BEP A;  5HKP A;  2P9U G;  4BY6 A;  2J9Q A;  1JWF A;  1EPU A;  4NRH B;  3UTM A;  3W9F A;  2BTD A;  2P58 C;  3FTS A;  2L0I A;  3L6A A;  1IHB A;  3FTV A;  4MS6 A;  4N3B A;  3ULE G;  2KAT A;  1HG5 A;  4G26 A;  3PE4 A;  4ME2 A;  3ESK A;  1N0Q A;  3Q5M A;  1U3C A;  2WXH A;  3SZ7 A;  3GW4 A;  1SA4 A;  4D10 C;  1IYG A;  4L2L A;  3C72 A;  4MBG A;  1TNB A;  1U2V G;  4WWO A;  4BWR A;  4XE0 A;  3CHP A;  3UKU G;  2MHK A;  4NQ0 A;  2VTB B;  1BD8 A;  3N71 A;  3CQC B;  3EUV A;  2KM4 A;  2AW6 A;  3JQ1 A;  4E6H A;  1KLX A;  2R5S A;  4XKC A;  5BT1 A;  4GZ5 A;  2LAH A;  5FZS A;  4GMJ A;  3TWX A;  3JYS A;  2X6I A;  4ILI A;  5B1B E;  5CBO A;  3ASO E;  1S70 B;  3CHO A;  5B1A E;  1OCZ E;  4L7T A;  4TV3 A;  3SF4 A;  1NA3 A;  3X2Q E;  3MKR A;  4GCN A;  4EBA A;  3P1U A;  5AEN A;  1RZ4 A;  1OWL A;  5M72 A;  2XPZ A;  4IUL A;  3SBT B;  2AXV A;  1Z5S C;  2PQN A;  2VGX A;  4U0S A;  4HRL A;  2XGS A;  2GGF A;  1D8E A;  2GRM A;  5HRY A;  4UWK A;  4EEC A;  4JW1 A;  4L23 A;  2XZD G;  1K1A A;  1BI8 B;  2BKK B;  2J49 A;  3ZEF A;  5FQ8 A;  3ASN E;  3ZIM A;  1E90 A;  1JWG A;  4F1P A;  4UWF A;  5CHE E;  3RKV A;  4CT4 A;  3D9N A;  2KXP C;  5AQA A;  3ZHE A;  3CVX A;  2CFZ A;  1Z3X A;  3PNT B;  1QZ2 A;  3CR3 A;  4X8Q A;  4AIF A;  3CHQ A;  4BTB A;  2PM6 A;  3TXM A;  2DCP A;  3AS5 A;  2IEJ A;  3NAW A;  2M63 A;  4PH4 B;  4JA7 A;  2BED A;  4K03 A;  3UM0 A;  5G2N A;  1L5J A;  3D9M A;  4MRU A;  4LUN U;  2C2L A;  2F8Y A;  3FDH A;  4BER A;  5C2Y A;  4N2S A;  2OND A;  3B7S A;  3DEO A;  2GRP B;  4CCA A;  2J8S D;  2DYS E;  3OXL A;  2Y1L E;  4C9B B;  2FBN A;  2P9N G;  2GRN B;  4GU5 A;  3GZ1 A;  2AXZ A;  1TYQ G;  1UJK A;  3HXB A; 
#chains in the Genus database with same CATH homology
 3U4T A;  4ANX A;  4HOR A;  4EZJ A;  4TUU A;  4HXI A;  3UQ3 A;  4J8D A;  4KT6 B;  2WXI A;  4O6F A;  3UPV A;  3LKU A;  1B89 A;  2WVI A;  2WPV A;  1UN9 A;  3FTZ A;  3JUI A;  4GYO A;  4WNG A;  2KCK A;  3PUJ A;  2OOE A;  1PC2 A;  4I9E A;  1A17 A;  3S7B A;  1NZN A;  2WMN A;  2UY1 A;  2A4Z A;  4FP7 A;  4BX9 A;  2UY1 B;  2VGY A;  3Q49 B;  4UQX A;  5A6C A;  4HOT A;  3O48 A;  3I4R B;  2NSZ A;  2Y4U A;  4URK A;  3D9K A;  3D9P A;  4GAA A;  2YQ8 A;  2J4D A;  1TEZ A;  3CVN A;  5KJL A;  3ZGQ A;  3FY4 A;  3TG5 A;  4JPS A;  5E75 A;  2RG8 A;  2WXP A;  4RVB A;  3UT4 A;  1H0A A;  2WXJ A;  3FFL A;  1ZU2 A;  4QFV A;  4CGW A;  4J8E A;  5BW8 C;  2GRL A;  1E8Y A;  3L17 A;  4LCT A;  4UWL A;  3C98 A;  1WY6 A;  4HOS A;  3B7U X;  5G05 C;  4RG9 A;  1W3B A;  4LRZ A;  4E85 A;  1EDU A;  4JHJ A;  2OVB A;  3TJP A;  4WNF A;  3RJV A;  5FQ6 A;  3RIB A;  2PL2 A;  3L08 A;  3TL5 A;  2I6H A;  3ZFW A;  3ZRH A;  3ML8 A;  2V4L A;  4R7L A;  2XCC A;  4RG6 A;  2E0I A;  4GZ3 A;  2EQX A;  4NUR A;  4AM9 A;  3K9I A;  3ZN3 A;  3APC A;  3ZW3 A;  2BUG A;  4V3I A;  4G2V A;  4GZC A;  2J4B A;  4Q96 A;  2VJ8 A;  3FTW A;  3RRN B;  4XIF A;  3PUK A;  4G25 A;  5DIZ A;  3MZL B;  5JHB A;  3G2T A;  3CIA A;  5FZQ A;  1NA0 A;  4AP2 A;  2KC7 A;  3LJ3 A;  2IF4 A;  4IRU A;  2WXL A;  2C0L A;  4FJY A;  4KMO A;  3FU0 A;  1HF8 A;  5FT9 A;  3FUN A;  4BTA A;  1Z3Y A;  3CVU A;  3FU6 A;  4FLB A;  1UG3 A;  3D9L A;  4FJZ A;  3FUH A;  4EQF A;  4FAD A;  4I6G A;  4WNE A;  3S2A A;  1ELK A;  2L9B A;  3MKQ A;  3MV2 B;  4ANU A;  4ACK A;  3ASH A;  5E76 A;  3MKQ B;  4Q69 A;  5BNW A;  1QNF A;  5J90 A;  1E7U A;  1VDY A;  3FTY A;  1XGW A;  4FA6 A;  3QAR A;  2R17 C;  4UI9 J;  3GYZ A;  5AJL A;  4ACL A;  4MLP A;  3CLJ A;  4H7Y A;  3RRM B;  3UUX A;  1U3D A;  3LY8 A;  3PRZ A;  4A1G A;  5BPP A;  1NP7 A;  2GW1 A;  2QFC A;  4JEU A;  5FQ7 A;  3MCX A;  3DBS A;  5KCM A;  2QY7 A;  4PS8 A;  2L0T B;  1SQM A;  3L22 A;  3PH0 C;  1E96 B;  3HVE A;  1SZA A;  1HO8 A;  3KEZ A;  3HVE B;  3AS8 A;  5FTP A;  3CKC A;  1JPL A;  4OYS A;  4JHK A;  4U04 A;  5ANR A;  2PQR A;  3IEG A;  3IBE A;  4DJA A;  3CVQ A;  4I1O B;  2WXR A;  4UI9 K;  3BEE A;  2WQ6 A;  3HHM A;  2FEZ A;  3QB2 A;  3QWW A;  3CST A;  3SNX A;  4B94 A;  3ASG A;  4XI9 A;  2AXU A;  3LEW A;  4K0R A;  4JVS A;  3SHF A;  5J08 A;  3E4B A;  4P29 A;  4FU3 A;  2MOW A;  4CDN A;  3FTX A;  3LCA A;  2X6F A;  3ZPJ A;  2BF0 X;  4GZ6 A;  3OXF A;  1QQE A;  4WAF A;  4ANV A;  3IHY A;  3T8M A;  2VSY A;  4A55 A;  4CEM A;  3IHV A;  4I1A A;  3G2U A;  2WXK A;  2CFU A;  3CK8 A;  3CGH A;  2PM7 A;  3B7R L;  3KD7 A;  3RK6 A;  4F3V A;  3RU0 A;  2E2E A;  3UX4 A;  4J8F A;  5CCM A;  4XX5 A;  3PNL B;  4L1B A;  2WM9 A;  3MEK A;  3VTX A;  5C1D A;  2UWJ G;  2L6J A;  2ZU6 B;  3HDX A;  1IQR A;  3SI5 A;  4EZK A;  3FH7 A;  3I3N A;  1TJF A;  3CSF A;  3CHR A;  5BV1 A;  4KZC A;  2Q7F A;  4EPZ A;  4N3A A;  1JUQ A;  2KZT A;  5D0Q D;  3RRU A;  4IYP A;  2C0M A;  5T8I A;  2I2O A;  2KZT B;  4F7A A;  2IOS A;  4A3V A;  4N5C A;  2VSN A;  2X38 A;  4I6J A;  2CG3 A;  4M3O A;  3D3M A;  3SGH A;  4PDX A;  4GA1 A;  4KXK B;  2XRY A;  4U0U A;  2X6K A;  3SFZ A;  4B0Z A;  3QDN A;  3B13 A;  2VTB A;  3EIQ C;  4AVX A;  1IHG A;  2X6J A;  3LXU X;  4KVO A;  2IU1 A;  3R9A B;  3FUI A;  3B7T A;  3DPD A;  5LFA A;  5ENN A;  3UT7 A;  3QAQ A;  1P5Q A;  4MKT A;  3ZVV A;  1HZ4 A;  2WXG A;  1OUV A;  2I1K A;  2IQC A;  3TXN A;  3FEX A;  3EDT B;  3D9O A;  3ULQ A;  3FU3 A;  2X6H A;  3OTN A;  2XEV A;  5KJN A;  2LSU A;  3QOU A;  3NZS A;  3QWP A;  1H6K A;  3OXG A;  3R7R A;  4AV7 A;  3MJW A;  2WXN A;  3S7J A;  3SD5 A;  1E8X A;  2RD0 A;  4I6E A;  5ARG A;  2I9C A;  1GW6 A;  5CCL A;  4CDR A;  4GPK A;  5A23 A;  4JHR A;  1EF1 C;  1ELW A;  3U64 A;  3MA5 A;  2MRI A;  4GYW A;  2FF4 A;  3FUD A;  2V5F A;  4FUL A;  4KZ0 A;  5ANL A;  2CHX A;  2A5U A;  3ZYQ A;  4AOF A;  3L16 A;  3FWV A;  1E8W A;  4I43 A;  4EZL A;  4FHK A;  1UW4 B;  3AS4 A;  3URZ A;  2VYI A;  5AYW D;  4ABN A;  2WQ7 A;  4ATG A;  4JL0 A;  3OAW A;  2LNI A;  4JZY A;  4AXH A;  1OWP A;  1PY1 A;  4YVQ C;  4B8C B;  5G04 C;  2IJG X;  4U0Z A;  3I5P A;  4CT0 A;  1LF8 A;  2OVF A;  3FUL A;  3LY9 A;  4CDM A;  2FO7 A;  3CVP A;  3LPZ A;  4AEZ C;  3KS2 A;  4FLH A;  2VSO E;  4B89 A;  4Q94 A;  2J07 A;  4C0E A;  3LS8 A;  1N54 A;  4I2Z A;  4GA0 A;  5LX8 A;  4H7X A;  5JJT A;  3FUK A;  5AIJ A;  4KVM A;  3ZYK A;  3T5V A;  1Z6T A;  3NQP A;  4LER A;  4XKB A;  1ZBP A;  3P2B A;  5CMY A;  3FHE A;  1OWO A;  4I17 A;  4G11 A;  2FUL A;  2HR2 A;  3EHM A;  4KYO B;  3PEV B;  5EKQ D;  2CG2 A;  1HH8 A;  4GA2 A;  2YIN A;  5EDS A;  4HS2 A;  3NF1 A;  4RSY A;  3ENE A;  5G05 J;  1FVH A;  3CHS A;  4A1S A;  3ZYM A;  4ILH B;  2DIW A;  3U3W A;  4EBA G;  4DLQ A;  3JCK C;  3AU5 A;  5T3R A;  5T4Y A;  4N2Q A;  1HU3 A;  2LAI A;  1YA0 A;  2Y4T A;  3CVL A;  3JQ0 A;  4CRW A;  3G2V A;  3O4Z A;  3FUE A;  4JA9 A;  4BY6 A;  2J9Q A;  1Y8M A;  3IKO B;  3Q15 A;  1OWM A;  1JWF A;  3CK7 A;  1EPU A;  2HM8 A;  3ONL A;  4JC8 A;  4NRH B;  1N52 A;  4PS7 A;  3PVL A;  1S0P A;  1H2U A;  3FP3 A;  3VLF A;  2BTD A;  2P58 C;  4A3T A;  4B8A A;  4I9C A;  4U8H A;  3FUF A;  5LP0 A;  3FTS A;  1HE8 A;  2J09 A;  1PAQ A;  2L0I A;  4WUY A;  3L6A A;  1HXI A;  3FTV A;  3HYM B;  1MHQ A;  3QNK A;  4MS6 A;  3EJN A;  4N3B A;  3ONK A;  3FU5 A;  2KCL A;  2KAT A;  3FUJ A;  5A7D B;  1HG5 A;  4G26 A;  4KBQ A;  3PE4 A;  4ME2 A;  3ESK A;  4GML A;  2LO6 A;  4HFG A;  5HI7 A;  5BUZ A;  3Q5M A;  5DBK A;  3LVR E;  4I2W A;  1U3C A;  2KCV A;  2XHE A;  1E7V A;  2WXH A;  3CHM A;  3S7F A;  3SZ7 A;  2CHW A;  3GW4 A;  4BT9 A;  4DI4 A;  4DK5 A;  1KT1 A;  4D10 C;  1IYG A;  4BFR A;  4L2L A;  4F53 A;  3RO2 A;  1FVF A;  3CV0 A;  3IV0 A;  4JEH A;  3RO3 A;  4WWO A;  5ARF A;  4BWR A;  4HOU A;  4XE0 A;  2NXP A;  5CMW A;  4DI3 A;  5HQ8 A;  3CHP A;  3ASD A;  3LYA A;  5JHA A;  1UJJ A;  2MHK A;  3MV3 B;  1SZ9 A;  4NQ0 A;  4IN3 B;  3TG4 A;  2WB2 A;  2VTB B;  1HX8 A;  3N71 A;  3ZXS A;  2XRZ A;  3CQC B;  4AY5 A;  3LDZ A;  2KM4 A;  2AW6 A;  2WMO A;  3JQ1 A;  4L2Y A;  2ION A;  2YHC A;  4E6H A;  1KLX A;  2DBA A;  1X5B A;  2R5S A;  2VQ2 A;  4AJW A;  4XKC A;  5BT1 A;  4APF A;  4GZ5 A;  5G55 A;  3I4G A;  2LAH A;  5FZS A;  4GMJ A;  2WXO A;  3FH8 A;  3GZ2 A;  4WND A;  4AY6 A;  1OWN A;  2FI7 A;  2Y3A A;  2IOL A;  3JYS A;  2X6I A;  3L13 A;  3S7D A;  4ILI A;  4U63 A;  1EYH A;  3CEQ A;  1WAO 1;  4G24 A;  4ILG A;  4N39 A;  2LSV A;  3CHO A;  4UI9 C;  1INZ A;  3ZYL A;  3EIJ A;  2JEK A;  4WWP A;  3ASF A;  1BPO A;  1H2V C;  4L7T A;  3FH5 A;  5EX0 A;  3QJZ A;  4GZD A;  3QK0 A;  4TV3 A;  3SF4 A;  4DLO A;  2V0P A;  4PUC A;  5FJY A;  2X3M A;  2XPY A;  1NA3 A;  3VTY A;  1WM5 A;  4BSX A;  3MKR A;  3MGB A;  3LVQ E;  2ILR A;  4GCN A;  3ESL A;  3PZD A;  4BX8 A;  3UMV A;  4EBA A;  3P1U A;  3PS6 A;  5AEN A;  1OWL A;  4ANW A;  5M72 A;  2XPZ A;  3FEY A;  4TRQ A;  4YND A;  4IUL A;  1HS6 A;  5D0O D;  5LCW C;  4OVV A;  3BG0 B;  3SBT B;  2AXV A;  2JLB A;  2YHE A;  4FC8 A;  2XQ0 A;  5FQ4 A;  2PQN A;  2XCB A;  4G1T A;  2VGX A;  4U0S A;  2OV8 A;  1HFA A;  2CHZ A;  2XGS A;  3D9I A;  2VGX B;  4YVO A;  2GGF A;  2GRM A;  4UWK A;  2WXQ A;  4EEC A;  4HLE A;  3G2W A;  4JW1 A;  4L23 A;  4XZ4 A;  5AJD A;  3U9W A;  2XGO A;  4Y6W A;  1Y6I A;  1MQS A;  1ELR A;  3MX3 A;  3CQG B;  4OVU A;  2AVP A;  2J49 A;  3PE3 A;  3ZEF A;  5FQ8 A;  3PRE A;  2HYZ A;  3CVW A;  3ZIM A;  3BG1 B;  4U07 A;  4UQY A;  1E90 A;  3Q4A B;  4Y6C A;  3AU4 A;  4W9R A;  1JWG A;  2J08 A;  2WXF A;  3TAX A;  4I1M A;  3CK9 A;  4UWF A;  2WXM A;  3D9J A;  4C0M A;  5CHE E;  3RKV A;  1IQU A;  3D9N A;  1DNP A;  4CT4 A;  3ZHE A;  4XI0 A;  2IFU A;  4UWG A;  4BT8 A;  3VLE A;  3ZHE B;  3CVX A;  2CFZ A;  1Z3X A;  3APD A;  1QZ2 A;  3CR3 A;  3CKB A;  3GZS A;  3PNT B;  3R7Q A;  4CGV A;  4GB9 A;  2AWI A;  2V8S E;  4AIF A;  1FCH A;  3CHQ A;  5FWQ A;  4UQZ A;  4BTB A;  4HOQ A;  2PM6 A;  3T5X A;  3FUM A;  3TXM A;  2I1J A;  3EHN A;  2DCP A;  3AS5 A;  4HVB A;  1UN8 A;  2M63 A;  2XGM A;  4PH4 B;  4JA7 A;  5JJ7 A;  1H2T C;  1HG2 A;  4G23 A;  4K03 A;  3VLD A;  2PZI A;  3QWV A;  5KJK A;  4JXT A;  5G04 J;  5G2N A;  3CVV A;  3NZU A;  2YNQ A;  4WWN A;  1L5J A;  4GYY A;  3UT8 A;  3WXX A;  1DVP A;  3D9M A;  3PEU B;  3L54 A;  3SBS A;  4DPR A;  4F1S A;  1H19 A;  3LY7 A;  4MRU A;  3APF A;  3MYV A;  3QC1 A;  5JJ6 A;  5LCW J;  4LUN U;  2C2L A;  3FDH A;  5FZR A;  5C2Y A;  4J6I A;  4N2S A;  2HO1 A;  3QKY A;  4NAC A;  2WQH A;  2OND A;  2NC9 A;  3B7S A;  3Q47 B;  5KJM A;  3U66 A;  1XNF A;  2VSX E;  4GCO A;  5LOZ A;  4UWH A;  4J0U A;  3CVY A;  3KAE A;  4CCA A;  4N3C A;  4FHJ A;  4APO A;  5EX3 A;  1TJC A;  2R59 A;  1KT0 A;  3ML9 A;  2XPI A;  3OXL A;  3FTU A;  4C9B B;  3TGO A;  2FBN A;  3PDN A;  4J8S A;  4LEU A;  4GU5 A;  3GZ1 A;  4PS3 A;  2AXZ A;  5BV0 A;  1UJK A;  3G2S A;  1E8Z A;  3HIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...