1ELRA

Crystal structure of the tpr2a domain of hop in complex with the hsp90 peptide meevd
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
128
structure length
128
Chain Sequence
GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords TPR2A-DOMAIN OF HOP
publication title Structure of TPR domain-peptide complexes: critical elements in the assembly of the Hsp70-Hsp90 multichaperone machine.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2000-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1elrA00
1NA0A 2AVPA 4XI9A 1NA3A 5JJTA 3TG5A 4CDRA 2Y4TA 3MV3B 4JL0A 4APOA 4J0UA 5C1DA 3ZHEA 5D0QD 4G2VA 3ZGQA 4W9RA 2XPIA 3ASFA 3U4TA 4I2ZA 4Y6CA 3GW4A 3SF4A 3Q15A 3ESKA 4UQXA 3CK8A 5HQ8A 3QWWA 3GZ2A 1YA0A 4GZ6A 1ZBPA 4UI9K 3Q49B 3CVPA 5FZQA 3MA5A 4N3CA 5G05J 2C0MA 1ZU2A 3OXFA 4I1AA 4BWRA 1KT0A 3Q5MA 3VTXA 1IYGA 3LY8A 2Y4UA 3LY9A 3K9IA 4Y6WA 3LYAA 3CKBA 2IFUA 5HI7A 3BEEA 2Q7FA 3AS4A 3KAEA 4ME2A 2DBAA 3LPZA 2J9QA 3MKRA 3HYMB 4KYOB 4J8EA 2UWJG 5FZSA 1HH8A 3KD7A 3VTYA 4AY5A 3ASHA 2VGYA 2LSUA 3RKVA 1A17A 2UY1A 5DBKA 4GYWA 2KCKA 3AS8A 4N39A 4O6FA 5G05C 4N3AA 2VSYA 1TJCA 5KJKA 4UI9J 2WPVA 4U07A 4U0UA 3TGOA 1B89A 2XEVA 1E96B 3ASDA 5CHEE 4G23A 4EQFA 2IF4A 5KJMA 3PE4A 1OUVA 4G26A 4BT8A 3CEQA 4RG9A 3ZHEB 3Q4AB 5JJ7A 2XGMA 3PE3A 4GA0A 4A1SA 4N2QA 5BW8C 5KJNA 1PC2A 5FT9A 3CV0A 4GYYA 2FEZA 4HORA 4IN3B 4GZ3A 1ELRA 3QKYA 3QDNA 3S7DA 3UPVA 4H7YA 3TG4A 4H7XA 4UI9C 3E4BA 3UUXA 4YVOA 2HR2A 1KT1A 2HYZA 2C2LA 2PZIA 3RO3A 3CVQA 3ZFWA 4N5CA 4U04A 3MV2B 3IEGA 3Q47B 1IHGA 2PL2A 2FF4A 2GW1A 3O48A 3GYZA 3ULQA 4WNGA 2WQHA 4RG6A 5AYWD 2PQNA 3GZ1A 3LY7A 2KC7A 2P58C 5G04J 4JA7A 4HOUA 3WXXA 4BTAA 2UY1B 5ARFA 2FI7A 4GCOA 4AIFA 2QFCA 4XI0A 4GCNA 2XGOA 1HXIA 4G1TA 4N3BA 4YVQC 1XNFA 2VGXA 3N71A 1FCHA 3LKUA 4YNDA 5DIZA 2VYIA 4GA2A 4F3VA 5A6CA 4UQYA 5EX3A 2XGSA 4U0SA 4GA1A 3SZ7A 4CGWA 3KS2A 4LEUA 2KCLA 4BTBA 5CCLA 4UQZA 3QWVA 2V5FA 5BT1A 3CKCA 4GZ5A 4AY6A 5D0OD 4HOQA 5G04C 4XIFA 2FBNA 1QQEA 2KATA 2MHKA 3RIBA 3URZA 4I17A 3FWVA 4WUYA 4J8DA 4WNEA 3RJVA 1NZNA 2LNIA 5BNWA 2JLBA 2HO1A 1P5QA 4WNDA 2L6JA 4JHRA 4NRHB 3S7JA 3NF1A 4N2SA 2ONDA 3FFLA 4U0ZA 3TAXA 2I6HA 3EDTB 2PQRA 3CK7A 3QOUA 3CVNA 1W3BA 5M72A 4G24A 3OXLA 4WNFA 4B94A 5LCWC 2XCBA 5ARGA 4AM9A 5A7DB 5FTPA 5JJ6A 4J8FA 1QZ2A 1ELWA 2FO7A 4I2WA 5EX0A 2XCCA 4KBQA 2NC9A 3AS5A 3S7BA 2VQ2A 2VSNA 3S7FA 3R9AB 3JYSA 4I9CA 2YHCA 3PDNA 3U3WA 2YQ8A 3MEKA 5CCMA 1HZ4A 4ABNA 5KJLA 4KXKB 5EKQD 4HOSA 3LCAA 3CK9A 1WAO1 1WM5A 3OXGA 2VGXB 3QWPA 3ZPJA 3FP3A 4GPKA 1Y8MA 4CGVA 4G25A 4BT9A 4HOTA 2R5SA 4GYOA 3RU0A 3ZN3A 4I9EA 4NQ0A 4JA9A 2BUGA 2OOEA 5FZRA 2C0LA 3UQ3A 5LCWJ 3RO2A 3CVLA 3ASGA 1KLXA 2KCVA 5FJYA 2E2EA 2LSVA
chains in the Genus database with same CATH superfamily
1AP7A 2AVPA 3Q75A 3FH7A 4KVOA 3ISMC 4HLEA 3TG5A 1UN8A 1QBQA 3APDA 4J0UA 2J07A 2LXLA 2LUHA 4W9RA 3ASFA 4CT0A 3U4TA 4I2ZA 3UT7A 4X8QA 5KNHD 3CK8A 5HQ8A 3TWTA 1YA0A 4GZ6A 1D8DA 4TUMA 4N3CA 2I9CA 4FADA 3PUJA 3TWWA 4GTQA 1ZU2A 1TR4A 2AJAA 3OXFA 1INZA 3EU5A 1N4PA 3P1UA 5FQ6A 3T8KA 3P2BA 4L2LA 3FDHA 3VLEA 5AQ9A 2CHZA 3BEEA 1RW2A 4ATGA 5BUZA 4Q96A 3NBNB 2AW6A 4RVBA 2NSZA 4ME2A 1EPUA 4IRUA 3VLFA 3UIOC 2B0OE 3MKRA 5LX8A 1LD8A 3CHRA 3FTXA 4J8EA 2WXIA 2XHEA 4ZHBA 3TWVA 4K5CA 2EQXA 3ASHA 2VGYA 2LSUA 1HF8A 3DWLG 3I4GA 4DX6D 2KM4A 3L22A 4BSZB 5B3SE 4GYWA 4HI9A 4O6FA 1FPPA 2ETBA 5KCMA 3NAWA 3PVLA 4MRUA 2WPVA 3EJNA 1SQMA 3FUHA 3FUNA 2XEVA 3BU8A 3EHMA 2LAIA 3SBSA 5KJMA 4JHKA 1D9SA 4G26A 4HRMB 2WXGA 3E33A 1OY3D 3U66A 3RK6A 5HRYA 4RG9A 4OAVB 3Q4AB 2RFMA 4FA6A 3I4RB 3G2WA 4GA0A 2IO2C 1ELKA 1E8ZA 2WXKA 3AJIA 2KZTA 3TWUA 2NXPA 2X6FA 1N95A 3CV0A 1NP7A 5EN5D 1IQRA 4HB5A 3TWRA 2GRMA 4LERA 3UPVA 3JUEA 4J8SA 3TG4A 4UI9C 3U64A 4YVOA 1RZ4A 4EHMA 2F8XK 2P2CP 4EBAA 4O1OA 3CVQA 4U04A 3AG1E 3NZUA 4Q69A 3ZW3A 2ZU6B 4PS7A 2FF4A 2GW1A 4WAFA 1YMPA 3B13A 2WQHA 3UXGA 3SNXA 4ILHB 2PQNA 3FU5A 5G04J 2WXMA 2AWIA 2XS8A 3HDXA 4JA7A 3E30A 4U7EB 3DBSA 4BTAA 2UY1B 1HG2A 2EINE 4AIFA 4N5QA 3LXUX 2QFCA 4GCNA 3DPYA 2XGOA 3R7QA 2IONA 3Q7AA 3DSSA 4JC8A 4ACKA 3LKUA 4YNDA 5E75A 5FQ8A 4DX7D 1DNPA 1O1TA 2V4LA 3PUKA 5EX3A 2XGSA 3S2AA 4GA1A 2CFZA 5CBNA 1MJ0A 3FUEA 5BV1A 4V3IA 2KCLA 3VLDA 4O60A 2EILE 2E0IA 3EIQC 2WXQA 3CKCA 4GZ5A 3ZXSA 2WXPA 4JW1A 4FC8A 1MX2A 4XIFA 5C2YA 3RIBA 2VGEA 4EECA 4K5AB 4I17A 3FEYA 3FWVA 4J8DA 4WNEA 3RJVA 4FJYA 3Q79A 4ANXA 3EHNA 3C5RA 4DI4A 2L9BA 4BESA 3CR3A 4WWOA 2GRLA 2JLBA 4AXHA 4WNDA 5HS0A 4CDNA 2IJGX 4P29A 3NF1A 3G2VA 4GTMA 4U0ZA 5ENPD 3CVXA 4BSXA 3CK7A 3HVEA 3QOUA 1W3BA 3R7RA 4G24A 1FVFA 4F53A 4WNFA 4TXPA 2X6JA 1JPLA 4AM9A 4YDOA 2XENA 3BQOA 3CQGB 4WWNA 1QZ2A 4MS6A 1KPSB 3UT4A 2V8SE 4U8VD 3UM3A 1N11A 4KBQA 2WQ7A 3D9NA 4J8YA 1H19A 3R9AB 2A5UA 3JYSA 2YHCA 2WM9A 4FHJA 3D9IA 3MYVA 3U3WA 2FO1E 2F0YA 1E7VA 5CCMA 3RRNB 4FHKA 2Y69E 4UWFA 5T3RA 1WM5A 3OXGA 2A5EA 3EUVA 5BPPA 4GAAA 1HE8A 3ZPJA 1Y8MA 3J5QB 4BT9A 2R5SA 3Q9NC 3ESLA 1BI7B 1IKND 3L16A 1X5BA 4AV7A 1OWMA 4WWPA 3UQ3A 1XGWA 5LCWJ 3CVLA 4CYMD 3ASGA 1KLXA 2IY0C 3OAWA 3DEOA 1NA0A 4HRLA 5IY5E 3SGHA 2IQCA 3QC1A 4CDMA 2WXFA 4JL0A 4U63A 4APOA 3L54A 4GMLA 1X81A 4LUNU 3ZHEA 2OEVA 3D9JA 4LNGA 2XPIA 3ASNE 2Y0BG 3Q73A 1HFAA 1Q2ZA 4NIKA 3ABKE 1N4RA 1TNUA 2YNQA 2GRPB 2I1KA 1SW6A 3IBEA 4UI9K 3CVPA 3RSEG 4U8YD 2P9IG 2WVIA 1N9AA 2C0MA 5B1AE 2OCCE 3FUDA 3B7SA 3VTXA 1IYGA 5KWDA 3LY8A 1TNZA 2Y4UA 3APCA 3CKBA 2IFUA 2L0TB 2Y1LE 5HI7A 1A5EA 3FUMA 3L82A 2DZOA 2R05A 3QAQA 3TWSA 2DBAA 3G2UA 3PZDA 3FUJA 3V2OA 3J5PA 4JVSA 1HH8A 4NACA 3G2SA 4A3TA 3X2QE 1E7UA 4APFA 4JPSA 3Q7FA 3UM2A 3MGBA 1A17A 5DBKA 3E37A 1S64A 2KCKA 5G05C 3IKOB 4YDEA 3FUIA 3QNKA 1D8EA 4TXRA 5KJKA 4UI9J 2R03A 2MYOA 3HG0D 2P9LG 1Z3XA 5CHEE 2DWZA 4G23A 5G2NA 1OUVA 3W9GA 3T8MA 4DUIA 3PZ2A 3PS6A 4I6JA 4OVUA 3L17A 3CEQA 2DIWA 4HFGA 4HI8A 1UN9A 1SA5A 2OEWA 4EZLA 2LAHA 1JWFA 2J08A 2XGMA 5CMYA 3HXEA 2R2LA 3PZ4A 4LG6A 1DCEA 2VSXE 3D9MA 4BERA 5ENSD 3PH0C 5BXUA 3HXBA 3ZNGA 2IOLA 3QKYA 2M63A 4H7YA 4MLPA 1QYMA 4A3VA 4F1SA 5ANRA 3D3MA 3UUXA 3DRAA 3UINC 2HR2A 3B7RL 5BXOA 2C2LA 3SFYA 3CQCB 1LF8A 3GZSA 3TJPA 3ZFWA 4N5CA 1HS6A 4DX2A 3Q47B 4BETA 4JXTA 1OCOE 1IQUA 1E8WA 4B89A 4CT4A 3GYZA 4U95D 5CMWA 5LOZA 3APFA 1UJJA 2WXLA 5AYWD 5AQBA 4HXIA 2CHWA 4HBDA 2WB2A 3GZ1A 2IU1A 2WQ6A 2KC7A 2GRNB 5AENA 4ANVA 4HOUA 3WXXA 3MKQB 4B93B 2V4HC 2MRIA 4GCOA 2WXHA 4C0MA 3BG0B 3FY4A 3CHPA 4PH4B 5JHBA 4GU5A 3UI2A 2J09A 1V54E 4YVQC 4GZDA 1XNFA 4J6IA 2VGXA 1FCHA 4URKA 5AJDA 3EU9A 2RFAA 3L9TA 5DIZA 4F3VA 1TEZA 3UTMA 1JCSA 3DSUA 1MX6A 4B0ZA 2DVWA 3SZ7A 5LP0A 3C72A 4ANUA 3FH8A 2V5FA 1EYHA 3HXCA 5BT1A 3TXNA 2CFUA 4AY6A 4ZFHA 2HE0A 1O1SA 3URZA 2X6IA 3BG1B 2BKGA 3FULA 1NZNA 3ZIMA 5BNWA 4DX5D 4XKCA 1FVHA 3KEAA 3FTZA 4NRHB 4OAUC 3S7JA 3LDZA 2ONDA 2I6HA 4GMJA 4GTVA 2GROB 1OWOA 2GRRB 4UWHA 1N54A 5CRUA 5ARGA 5EILA 5JJ6A 2WMOA 4XX5A 4J8FA 1H6PA 1ELWA 2FO7A 4ILGA 2V0PA 3QK0A 4PS8A 4KZ0A 4HNAD 4HLLA 1SVXA 2XQ0A 3FUKA 4C0EA 1N0RA 4PS3A 1MYOA 2NC9A 2X6HA 1UG3A 2VQ2A 1U2VG 1SA4A 3ULEG 2I2OA 2WXJA 2YQ8A 5KJLA 4KZCA 1O5MA 5EKQD 4RQIA 3SQVA 5H7PA 1E90A 1GW6A 3CHSA 4CEMA 2V5QC 5ENQD 3KSLA 4KMOA 1BD8A 5ENTD 4F1PA 1OWLA 2ZXWE 2XPYA 4G25A 1Y6IA 3RU0A 3ZVVA 1PAQA 4LCTA 4BFRA 4NQ0A 2AXZA 3ZYLA 1VDYA 3B7UX 2C0LA 1TNOA 4DLOA 3TWQA 3FU6A 1EDUA 2KCVA 2E2EA 4JD2G 3JCKC 2LSVA 3NOGD 4XI9A 3ZU7B 5JJTA 2F8YA 4ATZD 4CDRA 3ZEFA 4CRWA 4IYPA 1H6KA 3SHFA 5KBAA 4G2VA 4LSZE 3LS8A 4LNBA 4Z68A 4Q94A 2QYUA 3SD5A 3SF4A 4YDWA 1NL4A 3Q15A 1KZPA 4BY6A 3DSXA 5JMND 1JWGA 4JZYA 3LVQE 3UMVA 3DXMG 3C3OA 3MA5A 1L5JA 3UM0A 5G05J 4I1AA 4BWRA 1KT0A 2A4ZA 1YYHA 4JEUA 4L1BA 3LY9A 4Y6WA 2DYSE 1S0PA 5FQ7A 3F6QA 2Q7FA 3CHOA 5FIOA 3AS4A 3JXJA 2P9SG 3KAEA 4UWKA 5ENRD 3ZXPA 3LPZA 1WG0A 2RG8A 4G11A 2UWJG 3CGHA 2QC9A 5FZSA 3UT8A 5FINA 3KD7A 3JUIA 3FTUA 2VTBB 3UX4A 3VTYA 1S70B 3FTSA 4LRZA 2ZIRA 2P9UG 4UWGA 3RKVA 2UY1A 3LEWA 4U96D 4L7TA 2YHEA 4N39A 5ENOD 3OTNA 2VSYA 5ITZF 1TJCA 1LTXA 3AG3E 4GTPA 2ETCA 4KVMA 3FH5A 4U0UA 3ZYKA 1B89A 1OCRE 1E96B 3ASDA 3FTYA 3FUFA 4EQFA 2BTDA 2IF4A 4GTSA 4FULA 3ZYMA 3CVWA 1BLXB 4G8LA 4GZCA 3QJZA 5JJ7A 3HRAA 2J49A 1HU3A 3T9KA 1BPOA 1QNFA 1PC2A 2FEZA 4GZ3A 1FT2A 4XEIG 2CHXA 4AP2A 3QDNA 3S7DA 3B7BA 3UKRG 1H0AA 2XEHA 5ANLA 3E4BA 1KT1A 1TJFA 4UWLA 2OVFA 3E32A 4E6HA 2P9NG 3MV2B 1K3ZD 2X38A 1IHGA 3ONKA 2RKKA 4L9PA 2PL2A 3AU4A 2B6CA 2DCPA 3NB2A 3QARA 3E34A 3DEPA 2VSOE 3PNTB 3FTWA 3ULQA 2IEJA 1TNBA 2P9KG 3FHEA 4RG6A 2P58C 3CVUA 1H6OA 4B8CB 2WMNA 4OVVA 4G8KA 2FI7A 3R9MA 1IXVA 4XI0A 1N4SA 3KEZA 1HXIA 4G1TA 3FTVA 1JUQA 4A63B 5T4YA 1U3CA 3N71A 2YINA 2DZNA 4I1OB 1OCZE 1OCCE 2VJ8A 3CSFA 3O4ZA 1TN7A 5A6CA 4U0SA 4BX8A 2BF0X 3JXIA 3SO8A 1MQSA 1H2TC 1WDYA 1DVPA 2ZGGA 1Z3YA 3CHMA 1V55E 4EZKA 2QYJA 3Q9UC 3T5VA 2J4BA 2MOWA 4EPZA 4B8AA 2FBNA 4TXQA 1QQEA 2KATA 4FLHA 2KZTB 2QZAA 4DLQA 3SFXA 3DPDA 1UW4B 2ZISA 3L08A 3Q78A 2AXVA 4HRNA 3CVYA 5JA4D 2HO1A 1TN6A 3UIPC 1K8KG 3PREA 4JHRA 2BKKB 2WXRA 4AEZC 1JCRA 5CERB 3ZYQA 3ONLA 3FFLA 3TAXA 5EYLA 3EDTB 3CVNA 1IHBA 5M72A 4GMRA 5T8IA 5LCWC 3AAAC 2PNNA 2J4DA 5G55A 5EDSA 2QY7A 4DJAA 5EX0A 3JQ0A 2WXOA 3FU0A 2XCCA 3IHVA 1FT1A 4FJZA 1H2UA 4MKTA 4MBGA 5AJLA 4GTTA 3UM1A 2VSNA 3D9KA 4R7LA 4I9CA 3PRZA 3L13A 2PM7A 1KZOA 3HHMA 1HZ4A 4ABNA 4KXKB 4HOSA 4AVXA 4LNUD 4XE0A 4L23A 4HQDA 2ETAA 3QWPA 2OV8A 4RLYA 3FP3A 5A23A 2I1JA 5AARA 4CGVA 1MX4A 4C9BB 3CLJA 4HOTA 1Z6TA 3V31A 4I9EA 3FU3A 2BUGA 2OOEA 3D9LA 3KSQA 2RD0A 3RO2A 3D9OA 1NI1A 5E76A 4K03A 4F6RD 4A55A 1OXJA 2Y3AA 2JEKA 5CEAA 2P9PG 3AG2E 4JHJA 1NA3A 3ABLE 5JHAA 3RRUA 3I5PA 2Y4TA 3MV3B 5C1DA 5D0QD 3ZGQA 3EIJA 1OWPA 4AOFA 4Y6CA 4DPRA 3GW4A 4CCAA 4HVBA 3ESKA 4UQXA 2L0IA 3IHYA 2F37A 3AG4E 1PY1A 1BU9A 2H6FA 3GZ2A 3QWWA 1ZBPA 3Q49B 5FZQA 3NQPA 1E8XA 3PZ1A 3HVEB 3CIAA 4ACLA 4M3OA 4FP7A 4GTOA 3SY2A 3Q5MA 1DC2A 3PNLB 5LFAA 1Z5SC 4I6EA 2H6IA 3JQ1A 4I1MA 3K9IA 5AIJA 3LYAA 2KBXA 4GPMA 3ZUVB 4TUUA 2LXMA 4L2YA 2AXUA 1MHQA 2J9QA 1HX8A 3IV0A 3HYMB 3ENEA 5CRVA 4KYOB 2OVBA 2CG2A 3NZSA 4AY5A 1YCSB 3MKQA 2XRZA 3ZKJA 1AWCB 3AS8A 4DI3A 4GB9A 4JB8P 4N3AA 2IO3C 3V2XA 5J90A 3ULYA 2ZGDA 4U07A 1OWNA 3TGOA 1EF1C 4ILIA 5FQ4A 5J08A 3UKUG 5BV0A 1S63A 4OYSA 1N0QA 4FLBA 4YDYA 2XPZA 4U8HA 5EYPF 3PE4A 3V30A 4C48B 4D10C 3RRMB 3WG7E 4KT6B 2JABA 1TN8A 3ASOE 4BT8A 1SZ9A 1HG5A 3ML8A 3CVVA 4IULA 4F7AA 3ZHEB 3W9FA 3CHQA 4TRQA 3NOCD 3PE3A 4A1SA 5D2MC 2J8SD 4N2QA 2R59A 5BW8C 5KJNA 3PEVB 5FT9A 4GYYA 4HORA 4IN3B 2EIME 3EHQA 3LVRE 4XZ4A 1ELRA 3HXFA 3PZ3A 4H7XA 2CG3A 3ABME 1G3NB 1TNYA 3LJNA 3QB2A 3TWXA 2HYZA 2PM6A 4ANWA 4JEHA 2PZIA 3I3NA 5B1BE 3RO3A 3B7TA 3C98A 3IEGA 4BEPA 1HO8A 1BI8B 3DSVA 3TL5A 1N52A 1UJKA 3O48A 2R17C 4WNGA 4GTRA 4RSYA 3RAUA 2H6GA 2LO6A 3LY7A 4E85A 2BEDA 3C3RA 3MZLB 3G2TA 2X6KA 2XS1A 5D66A 2R02A 5ARFA 3C3QA 3HXDA 2XEEA 4I43A 2DYRE 4TV3A 4N3BA 1MZCA 1O1RA 3ML9A 4DK5A 3BUAA 1DCQA 4BX9A 1SZAA 2XZDG 4QFVA 1UOHA 2VYIA 4GA2A 2IOSA 4UQYA 3ZRHA 4PUCA 2EIJE 3MJWA 2XRYA 3TXMA 4CGWA 3SBTB 3KS2A 4LEUA 5CECB 4BTBA 5CCLA 4UQZA 3QWVA 2FULA 3IXEA 4NURA 4O1PA 4FU3A 5D0OD 2KXPC 4HOQA 5G04C 5EIDA 2MHKA 3DXKG 3U9WA 1N94A 3AU5A 4CZ2D 3MCXA 2X3MA 3DSWA 2HM8A 4WUYA 1JCQA 2LNIA 3FEXA 1P5QA 2XZTG 2GRQB 2L6JA 3L6AA 3T5XA 2NYJA 5EIBE 4QQIA 5HKPA 4M7CA 4N2SA 4HS2A 3D9PA 2PQRA 1ZB1A 1WY6A 3D9HA 1U3DA 1LD7A 2GGFA 5AN8A 5AQAA 5AAOA 3MX3A 3OXLA 4B94A 2H6HA 4EZJA 5CBOA 4DRXE 2XCBA 4AJWA 1OT8A 5A7DB 4K0RA 4J7WA 5FTPA 5AQ7A 4XKBA 3HIZA 4I2WA 3DSTA 3AS5A 3S7BA 3SFZA 5CEDB 1K1BA 5FWQA 3S7FA 3PDNA 3B95A 3MEKA 3SI5A 3LCAA 2VTBA 4A1GA 3CK9A 4UUCA 4DX1A 1WAO1 3EHRA 4I6GA 2VGXB 3LJ3A 4GPKA 2EIKE 3CSTA 3V79K 2ILRA 4GYOA 3ZN3A 5ENNA 5KNGA 1K1AA 4EBAG 1TYQG 4JA9A 1N4QA 3PEUB 5FZRA 4K5BA 1E8YA 1H2VC 4PDXA 5FJYA 2L6BA 1NFIE 2WXNA
chains in the Genus database with same CATH topology
1NA0A 4JHJA 2AVPA 4XI9A 1NA3A 3FH7A 4KVOA 3SGHA 2IQCA 4HLEA 5JJTA 5JHAA 3QC1A 3TG5A 4CDRA 3RRUA 3ZEFA 3I5PA 1UN8A 2Y4TA 3MV3B 4CRWA 5CCMA 4CDMA 2WXFA 4JL0A 4IYPA 1H6KA 3SHFA 4U63A 3APDA 3L54A 4J0UA 4APOA 2J07A 4GMLA 5C1DA 4LUNU 3ZHEA 5D0QD 4G2VA 3ZGQA 4W9RA 3D9JA 3EIJA 3LS8A 2XPIA 1OWPA 3ASFA 4CT0A 3U4TA 4AOFA 4I2ZA 5KJLA 4Y6CA 4Q94A 3UT7A 3SD5A 4DPRA 1HFAA 3GW4A 3SF4A 4CCAA 4HVBA 3Q15A 3ESKA 4UQXA 2L0IA 3CK8A 4BY6A 3IHYA 5HQ8A 1JWGA 4JZYA 3LVQE 1PY1A 3QWWA 3GZ2A 1YA0A 2YNQA 4GZ6A 3UMVA 1ZBPA 2I1KA 3IBEA 3Q49B 3CVPA 4UI9K 5FZQA 3MA5A 1L5JA 3NQPA 4N3CA 1E8XA 2I9CA 3HVEB 2WVIA 3CIAA 4FADA 3PUJA 5G05J 4ACLA 2C0MA 4M3OA 4FP7A 1ZU2A 3OXFA 4I1AA 4BWRA 1KT0A 3Q5MA 2A4ZA 3FUDA 3B7SA 1INZA 3PNLB 5LFAA 3VTXA 1IYGA 3P1UA 5FQ6A 3LY8A 4JEUA 3P2BA 4I6EA 4L2LA 4L1BA 2Y4UA 3APCA 3FDHA 3JQ1A 4I1MA 3VLEA 3LY9A 3K9IA 5AIJA 4Y6WA 3LYAA 3CKBA 1S0PA 2IFUA 2L0TB 5FQ7A 2CHZA 5HI7A 3BEEA 2Q7FA 3FUMA 4ATGA 3CHOA 5BUZA 4Q96A 2AW6A 4TUUA 3AS4A 4RVBA 3KAEA 2NSZA 3QAQA 4L2YA 4ME2A 4UWKA 1EPUA 4IRUA 3VLFA 2DBAA 2AXUA 3G2UA 3LPZA 1MHQA 3PZDA 2J9QA 1HX8A 3MKRA 5LX8A 3CHRA 3FUJA 3IV0A 3FTXA 3HYMB 3ENEA 2RG8A 4G11A 4KYOB 4J8EA 2OVBA 2UWJG 3CGHA 2WXIA 4JVSA 2CG2A 2XHEA 1HH8A 3KD7A 3JUIA 4NACA 5FZSA 3G2SA 3UT8A 3FTUA 2VTBB 4A3TA 3NZSA 3UX4A 1E7UA 2EQXA 3VTYA 3FTSA 4APFA 4AY5A 3ASHA 4LRZA 4JPSA 2VGYA 2LSUA 1HF8A 3I4GA 3MGBA 3MKQA 1A17A 2KM4A 2UY1A 4UWGA 3LEWA 5DBKA 3L22A 3RKVA 2XRZA 4GYWA 4L7TA 2KCKA 3AS8A 2YHEA 4DI3A 4N39A 4O6FA 5G05C 4GB9A 3OTNA 4N3AA 5J90A 2VSYA 1TJCA 3IKOB 5KCMA 3FUIA 3PVLA 3QNKA 5KJKA 4MRUA 4UI9J 2WPVA 4U07A 4KVMA 3FH5A 1OWNA 4U0UA 3TGOA 1EF1C 1SQMA 3EJNA 3FUHA 3FUNA 4ILIA 5FQ4A 5J08A 3ZYKA 1B89A 2XEVA 5BV0A 1E96B 3ASDA 1Z3XA 4OYSA 3FTYA 5CHEE 4FLBA 3EHMA 2XPZA 4G23A 2LAIA 4U8HA 3FUFA 3SBSA 4EQFA 2BTDA 2IF4A 5KJMA 3PE4A 4JHKA 5G2NA 1OUVA 4FULA 3T8MA 4D10C 3RRMB 4G26A 3PS6A 2WXGA 4KT6B 4I6JA 4OVUA 4BT8A 3L17A 1SZ9A 3CEQA 2DIWA 1HG5A 3ML8A 4HFGA 3CVVA 3ZYMA 1UN9A 3U66A 4IULA 3RK6A 4F7AA 4RG9A 3ZHEB 3Q4AB 3CVWA 3CHQA 4EZLA 2LAHA 1JWFA 5JJ7A 4GZCA 3QJZA 2J08A 2XGMA 4TRQA 4FA6A 5CMYA 3PE3A 3I4RB 3G2WA 4GA0A 4A1SA 1ELKA 1E8ZA 2J49A 2WXKA 2KZTA 1HU3A 4N2QA 1BPOA 2NXPA 1QNFA 2R59A 5BW8C 2X6FA 5KJNA 1PC2A 3PEVB 5FT9A 3CV0A 2VSXE 3D9MA 4GYYA 1NP7A 2FEZA 4HORA 4IN3B 4GZ3A 1IQRA 3PH0C 2GRMA 3LVRE 4XZ4A 4LERA 1ELRA 2IOLA 2CHXA 3QKYA 4AP2A 3QDNA 3S7DA 2M63A 3UPVA 4H7YA 4MLPA 4J8SA 3TG4A 4A3VA 4F1SA 4H7XA 5ANRA 3JCKC 1H0AA 2CG3A 3D3MA 4UI9C 5ANLA 3U64A 3E4BA 3UUXA 4YVOA 2HR2A 3QB2A 1KT1A 2HYZA 3B7RL 2PM6A 4ANWA 2C2LA 4EBAA 1TJFA 3CQCB 4JEHA 4UWLA 1LF8A 2PZIA 2OVFA 3I3NA 3CVQA 3GZSA 3RO3A 3TJPA 3ZFWA 4N5CA 4U04A 4E6HA 3B7TA 3NZUA 3MV2B 1HS6A 4Q69A 2X38A 3C98A 3IEGA 3Q47B 3ZW3A 1IHGA 3ONKA 1HO8A 2PL2A 2ZU6B 4PS7A 3TL5A 3AU4A 4JXTA 1IQUA 2DCPA 1E8WA 2FF4A 1N52A 1UJKA 3QARA 2GW1A 4B89A 3O48A 4WAFA 2VSOE 3PNTB 4CT4A 3GYZA 3FTWA 3ULQA 5CMWA 2R17C 4WNGA 5LOZA 3APFA 3B13A 1UJJA 4RSYA 2WQHA 2WXLA 3FHEA 2LO6A 4RG6A 5AYWD 4HXIA 2CHWA 3SNXA 2WB2A 4ILHB 2PQNA 3GZ1A 2IU1A 3LY7A 2WQ6A 2KC7A 2P58C 3FU5A 4E85A 3CVUA 5G04J 2WXMA 5AENA 2AWIA 3MZLB 3G2TA 4ANVA 2X6KA 3HDXA 4JA7A 4HOUA 3WXXA 3MKQB 3DBSA 4B8CB 2WMNA 4OVVA 4BTAA 2UY1B 5ARFA 2FI7A 2MRIA 1HG2A 4GCOA 4AIFA 2WXHA 4C0MA 3LXUX 2QFCA 4XI0A 4GCNA 3BG0B 3FY4A 2XGOA 3CHPA 4I43A 3KEZA 3R7QA 2IONA 1HXIA 4PH4B 4TV3A 4G1TA 3FTVA 4N3BA 4GU5A 5JHBA 1JUQA 2J09A 4YVQC 3ML9A 5T4YA 4GZDA 1U3CA 1XNFA 4J6IA 2VGXA 3N71A 1FCHA 4DK5A 4URKA 5AJDA 4BX9A 2YINA 4I1OB 4JC8A 1SZAA 4ACKA 3LKUA 4YNDA 2VJ8A 5E75A 5DIZA 5FQ8A 4QFVA 3CSFA 1DNPA 3O4ZA 2VYIA 4GA2A 4F3VA 1TEZA 2V4LA 2IOSA 3PUKA 4UQYA 2XGSA 5EX3A 5A6CA 4U0SA 4BX8A 3ZRHA 4B0ZA 2BF0X 4PUCA 4GA1A 3S2AA 2CFZA 1MQSA 1H2TC 3MJWA 1DVPA 2XRYA 3FUEA 3TXMA 3SZ7A 5BV1A 4CGWA 3SBTB 5LP0A 4V3IA 1Z3YA 3KS2A 4LEUA 2KCLA 3CHMA 4ANUA 3VLDA 4EZKA 4BTBA 5CCLA 4UQZA 3FH8A 2V5FA 1EYHA 3QWVA 2FULA 5BT1A 4NURA 3TXNA 3T5VA 2J4BA 2CFUA 2MOWA 2E0IA 3EIQC 2WXQA 3CKCA 4EPZA 4FU3A 4GZ5A 5D0OD 4AY6A 4HOQA 4B8AA 3ZXSA 2WXPA 4JW1A 2FBNA 4FC8A 4XIFA 5G04C 5C2YA 1QQEA 2KATA 2MHKA 4FLHA 3RIBA 2KZTB 3U9WA 4DLQA 2JEKA 4EECA 3URZA 4I17A 2X6IA 3AU5A 3DPDA 3FEYA 1UW4B 3MCXA 2X3MA 3FWVA 2HM8A 4WUYA 4J8DA 4WNEA 3RJVA 3BG1B 4FJYA 3L08A 3FULA 1NZNA 4ANXA 3EHNA 2AXVA 2LNIA 4DI4A 2L9BA 3ZIMA 3CR3A 3CVYA 4WWOA 2GRLA 5BNWA 2JLBA 1FVHA 2HO1A 4XKCA 3FEXA 1P5QA 4AXHA 4WNDA 3PREA 2L6JA 3L6AA 4JHRA 3T5XA 3FTZA 4NRHB 4CDNA 2WXRA 3S7JA 4AEZC 2IJGX 4P29A 3NF1A 3LDZA 3ZYQA 4N2SA 3ONLA 2ONDA 3FFLA 3G2VA 4HS2A 4U0ZA 3TAXA 2I6HA 3CVXA 3EDTB 3D9PA 4GMJA 2PQRA 4BSXA 1WY6A 3CK7A 3HVEA 3QOUA 1U3DA 3CVNA 1W3BA 3R7RA 5M72A 4G24A 1FVFA 4F53A 2GGFA 5T8IA 1OWOA 3MX3A 3OXLA 4WNFA 4UWHA 1N54A 4B94A 4EZJA 5LCWC 2X6JA 2XCBA 4AJWA 1JPLA 5ARGA 4AM9A 2J4DA 5A7DB 4K0RA 5FTPA 5G55A 3CQGB 5JJ6A 5EDSA 2WMOA 4XX5A 4J8FA 4XKBA 4WWNA 1QZ2A 1ELWA 2QY7A 4MS6A 4DJAA 2FO7A 3HIZA 4ILGA 2V0PA 3QK0A 3UT4A 4I2WA 5EX0A 3JQ0A 2V8SE 4PS8A 4KZ0A 2WXOA 3FU0A 2XCCA 2XQ0A 3IHVA 3FUKA 4C0EA 4KBQA 4PS3A 4FJZA 1H2UA 2NC9A 4MKTA 2X6HA 3AS5A 3S7BA 3SFZA 2WQ7A 5AJLA 1UG3A 3D9NA 5FWQA 2VQ2A 2VSNA 1H19A 3D9KA 4R7LA 3R9AB 2A5UA 3S7FA 3JYSA 4I9CA 2YHCA 3PRZA 2WM9A 4FHJA 3D9IA 3L13A 3MYVA 2I2OA 2PM7A 3PDNA 3U3WA 3HHMA 2WXJA 2YQ8A 1E7VA 3MEKA 1HZ4A 3RRNB 4ABNA 4FHKA 4KXKB 4KZCA 5EKQD 3SI5A 3LCAA 4AVXA 2VTBA 4HOSA 4A1GA 3CK9A 4UWFA 1E90A 1WAO1 5T3RA 1WM5A 1GW6A 4XE0A 3CHSA 4CEMA 3OXGA 4I6GA 4KMOA 4L23A 5BPPA 2VGXB 3QWPA 4GAAA 2OV8A 1HE8A 1OWLA 3ZPJA 3FP3A 5A23A 2I1JA 3LJ3A 4GPKA 1Y8MA 3CSTA 4CGVA 2XPYA 4G25A 4C9BB 4BT9A 3CLJA 1Y6IA 4HOTA 1Z6TA 2ILRA 2R5SA 4GYOA 5ENNA 3RU0A 3ZN3A 4I9EA 3ZVVA 1PAQA 4LCTA 3FU3A 3ESLA 4BFRA 4NQ0A 4EBAG 4JA9A 2AXZA 3L16A 2BUGA 2OOEA 1VDYA 3PEUB 5FZRA 3ZYLA 3B7UX 2C0LA 3D9LA 4DLOA 1X5BA 3FU6A 1OWMA 4AV7A 4WWPA 3UQ3A 1XGWA 1EDUA 1E8YA 1H2VC 2RD0A 3RO2A 3CVLA 3D9OA 5LCWJ 3ASGA 4PDXA 1KLXA 5E76A 2KCVA 5FJYA 4K03A 3OAWA 4A55A 2E2EA 2Y3AA 2LSVA 2WXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NA0 A;  2AVP A;  4XI9 A;  1NA3 A;  5JJT A;  3TG5 A;  4CDR A;  2Y4T A;  3MV3 B;  4JL0 A;  4APO A;  4J0U A;  5C1D A;  3ZHE A;  5D0Q D;  4G2V A;  3ZGQ A;  4W9R A;  2XPI A;  3ASF A;  3U4T A;  4I2Z A;  4Y6C A;  3GW4 A;  3SF4 A;  3Q15 A;  3ESK A;  4UQX A;  3CK8 A;  5HQ8 A;  3QWW A;  3GZ2 A;  1YA0 A;  4GZ6 A;  1ZBP A;  4UI9 K;  3Q49 B;  3CVP A;  5FZQ A;  3MA5 A;  4N3C A;  5G05 J;  2C0M A;  1ZU2 A;  3OXF A;  4I1A A;  4BWR A;  1KT0 A;  3Q5M A;  3VTX A;  1IYG A;  3LY8 A;  2Y4U A;  3LY9 A;  3K9I A;  4Y6W A;  3LYA A;  3CKB A;  2IFU A;  5HI7 A;  3BEE A;  2Q7F A;  3AS4 A;  3KAE A;  4ME2 A;  2DBA A;  3LPZ A;  2J9Q A;  3MKR A;  3HYM B;  4KYO B;  4J8E A;  2UWJ G;  5FZS A;  1HH8 A;  3KD7 A;  3VTY A;  4AY5 A;  3ASH A;  2VGY A;  2LSU A;  3RKV A;  1A17 A;  2UY1 A;  5DBK A;  4GYW A;  2KCK A;  3AS8 A;  4N39 A;  4O6F A;  5G05 C;  4N3A A;  2VSY A;  1TJC A;  5KJK A;  4UI9 J;  2WPV A;  4U07 A;  4U0U A;  3TGO A;  1B89 A;  2XEV A;  1E96 B;  3ASD A;  5CHE E;  4G23 A;  4EQF A;  2IF4 A;  5KJM A;  3PE4 A;  1OUV A;  4G26 A;  4BT8 A;  3CEQ A;  4RG9 A;  3ZHE B;  3Q4A B;  5JJ7 A;  2XGM A;  3PE3 A;  4GA0 A;  4A1S A;  4N2Q A;  5BW8 C;  5KJN A;  1PC2 A;  5FT9 A;  3CV0 A;  4GYY A;  2FEZ A;  4HOR A;  4IN3 B;  4GZ3 A;  1ELR A;  3QKY A;  3QDN A;  3S7D A;  3UPV A;  4H7Y A;  3TG4 A;  4H7X A;  4UI9 C;  3E4B A;  3UUX A;  4YVO A;  2HR2 A;  1KT1 A;  2HYZ A;  2C2L A;  2PZI A;  3RO3 A;  3CVQ A;  3ZFW A;  4N5C A;  4U04 A;  3MV2 B;  3IEG A;  3Q47 B;  1IHG A;  2PL2 A;  2FF4 A;  2GW1 A;  3O48 A;  3GYZ A;  3ULQ A;  4WNG A;  2WQH A;  4RG6 A;  5AYW D;  2PQN A;  3GZ1 A;  3LY7 A;  2KC7 A;  2P58 C;  5G04 J;  4JA7 A;  4HOU A;  3WXX A;  4BTA A;  2UY1 B;  5ARF A;  2FI7 A;  4GCO A;  4AIF A;  2QFC A;  4XI0 A;  4GCN A;  2XGO A;  1HXI A;  4G1T A;  4N3B A;  4YVQ C;  1XNF A;  2VGX A;  3N71 A;  1FCH A;  3LKU A;  4YND A;  5DIZ A;  2VYI A;  4GA2 A;  4F3V A;  5A6C A;  4UQY A;  5EX3 A;  2XGS A;  4U0S A;  4GA1 A;  3SZ7 A;  4CGW A;  3KS2 A;  4LEU A;  2KCL A;  4BTB A;  5CCL A;  4UQZ A;  3QWV A;  2V5F A;  5BT1 A;  3CKC A;  4GZ5 A;  4AY6 A;  5D0O D;  4HOQ A;  5G04 C;  4XIF A;  2FBN A;  1QQE A;  2KAT A;  2MHK A;  3RIB A;  3URZ A;  4I17 A;  3FWV A;  4WUY A;  4J8D A;  4WNE A;  3RJV A;  1NZN A;  2LNI A;  5BNW A;  2JLB A;  2HO1 A;  1P5Q A;  4WND A;  2L6J A;  4JHR A;  4NRH B;  3S7J A;  3NF1 A;  4N2S A;  2OND A;  3FFL A;  4U0Z A;  3TAX A;  2I6H A;  3EDT B;  2PQR A;  3CK7 A;  3QOU A;  3CVN A;  1W3B A;  5M72 A;  4G24 A;  3OXL A;  4WNF A;  4B94 A;  5LCW C;  2XCB A;  5ARG A;  4AM9 A;  5A7D B;  5FTP A;  5JJ6 A;  4J8F A;  1QZ2 A;  1ELW A;  2FO7 A;  4I2W A;  5EX0 A;  2XCC A;  4KBQ A;  2NC9 A;  3AS5 A;  3S7B A;  2VQ2 A;  2VSN A;  3S7F A;  3R9A B;  3JYS A;  4I9C A;  2YHC A;  3PDN A;  3U3W A;  2YQ8 A;  3MEK A;  5CCM A;  1HZ4 A;  4ABN A;  5KJL A;  4KXK B;  5EKQ D;  4HOS A;  3LCA A;  3CK9 A;  1WAO 1;  1WM5 A;  3OXG A;  2VGX B;  3QWP A;  3ZPJ A;  3FP3 A;  4GPK A;  1Y8M A;  4CGV A;  4G25 A;  4BT9 A;  4HOT A;  2R5S A;  4GYO A;  3RU0 A;  3ZN3 A;  4I9E A;  4NQ0 A;  4JA9 A;  2BUG A;  2OOE A;  5FZR A;  2C0L A;  3UQ3 A;  5LCW J;  3RO2 A;  3CVL A;  3ASG A;  1KLX A;  2KCV A;  5FJY A;  2E2E A;  2LSV A; 
#chains in the Genus database with same CATH topology
 1AP7 A;  2AVP A;  3Q75 A;  3FH7 A;  4KVO A;  3ISM C;  4HLE A;  3TG5 A;  1UN8 A;  1QBQ A;  3APD A;  4J0U A;  2J07 A;  2LXL A;  2LUH A;  4W9R A;  3ASF A;  4CT0 A;  3U4T A;  4I2Z A;  3UT7 A;  4X8Q A;  5KNH D;  3CK8 A;  5HQ8 A;  3TWT A;  1YA0 A;  4GZ6 A;  1D8D A;  4TUM A;  4N3C A;  2I9C A;  4FAD A;  3PUJ A;  3TWW A;  4GTQ A;  1ZU2 A;  1TR4 A;  2AJA A;  3OXF A;  1INZ A;  3EU5 A;  1N4P A;  3P1U A;  5FQ6 A;  3T8K A;  3P2B A;  4L2L A;  3FDH A;  3VLE A;  5AQ9 A;  2CHZ A;  3BEE A;  1RW2 A;  4ATG A;  5BUZ A;  4Q96 A;  3NBN B;  2AW6 A;  4RVB A;  2NSZ A;  4ME2 A;  1EPU A;  4IRU A;  3VLF A;  3UIO C;  2B0O E;  3MKR A;  5LX8 A;  1LD8 A;  3CHR A;  3FTX A;  4J8E A;  2WXI A;  2XHE A;  4ZHB A;  3TWV A;  4K5C A;  2EQX A;  3ASH A;  2VGY A;  2LSU A;  1HF8 A;  3DWL G;  3I4G A;  4DX6 D;  2KM4 A;  3L22 A;  4BSZ B;  5B3S E;  4GYW A;  4HI9 A;  4O6F A;  1FPP A;  2ETB A;  5KCM A;  3NAW A;  3PVL A;  4MRU A;  2WPV A;  3EJN A;  1SQM A;  3FUH A;  3FUN A;  2XEV A;  3BU8 A;  3EHM A;  2LAI A;  3SBS A;  5KJM A;  4JHK A;  1D9S A;  4G26 A;  4HRM B;  2WXG A;  3E33 A;  1OY3 D;  3U66 A;  3RK6 A;  5HRY A;  4RG9 A;  4OAV B;  3Q4A B;  2RFM A;  4FA6 A;  3I4R B;  3G2W A;  4GA0 A;  2IO2 C;  1ELK A;  1E8Z A;  2WXK A;  3AJI A;  2KZT A;  3TWU A;  2NXP A;  2X6F A;  1N95 A;  3CV0 A;  1NP7 A;  5EN5 D;  1IQR A;  4HB5 A;  3TWR A;  2GRM A;  4LER A;  3UPV A;  3JUE A;  4J8S A;  3TG4 A;  4UI9 C;  3U64 A;  4YVO A;  1RZ4 A;  4EHM A;  2F8X K;  2P2C P;  4EBA A;  4O1O A;  3CVQ A;  4U04 A;  3AG1 E;  3NZU A;  4Q69 A;  3ZW3 A;  2ZU6 B;  4PS7 A;  2FF4 A;  2GW1 A;  4WAF A;  1YMP A;  3B13 A;  2WQH A;  3UXG A;  3SNX A;  4ILH B;  2PQN A;  3FU5 A;  5G04 J;  2WXM A;  2AWI A;  2XS8 A;  3HDX A;  4JA7 A;  3E30 A;  4U7E B;  3DBS A;  4BTA A;  2UY1 B;  1HG2 A;  2EIN E;  4AIF A;  4N5Q A;  3LXU X;  2QFC A;  4GCN A;  3DPY A;  2XGO A;  3R7Q A;  2ION A;  3Q7A A;  3DSS A;  4JC8 A;  4ACK A;  3LKU A;  4YND A;  5E75 A;  5FQ8 A;  4DX7 D;  1DNP A;  1O1T A;  2V4L A;  3PUK A;  5EX3 A;  2XGS A;  3S2A A;  4GA1 A;  2CFZ A;  5CBN A;  1MJ0 A;  3FUE A;  5BV1 A;  4V3I A;  2KCL A;  3VLD A;  4O60 A;  2EIL E;  2E0I A;  3EIQ C;  2WXQ A;  3CKC A;  4GZ5 A;  3ZXS A;  2WXP A;  4JW1 A;  4FC8 A;  1MX2 A;  4XIF A;  5C2Y A;  3RIB A;  2VGE A;  4EEC A;  4K5A B;  4I17 A;  3FEY A;  3FWV A;  4J8D A;  4WNE A;  3RJV A;  4FJY A;  3Q79 A;  4ANX A;  3EHN A;  3C5R A;  4DI4 A;  2L9B A;  4BES A;  3CR3 A;  4WWO A;  2GRL A;  2JLB A;  4AXH A;  4WND A;  5HS0 A;  4CDN A;  2IJG X;  4P29 A;  3NF1 A;  3G2V A;  4GTM A;  4U0Z A;  5ENP D;  3CVX A;  4BSX A;  3CK7 A;  3HVE A;  3QOU A;  1W3B A;  3R7R A;  4G24 A;  1FVF A;  4F53 A;  4WNF A;  4TXP A;  2X6J A;  1JPL A;  4AM9 A;  4YDO A;  2XEN A;  3BQO A;  3CQG B;  4WWN A;  1QZ2 A;  4MS6 A;  1KPS B;  3UT4 A;  2V8S E;  4U8V D;  3UM3 A;  1N11 A;  4KBQ A;  2WQ7 A;  3D9N A;  4J8Y A;  1H19 A;  3R9A B;  2A5U A;  3JYS A;  2YHC A;  2WM9 A;  4FHJ A;  3D9I A;  3MYV A;  3U3W A;  2FO1 E;  2F0Y A;  1E7V A;  5CCM A;  3RRN B;  4FHK A;  2Y69 E;  4UWF A;  5T3R A;  1WM5 A;  3OXG A;  2A5E A;  3EUV A;  5BPP A;  4GAA A;  1HE8 A;  3ZPJ A;  1Y8M A;  3J5Q B;  4BT9 A;  2R5S A;  3Q9N C;  3ESL A;  1BI7 B;  1IKN D;  3L16 A;  1X5B A;  4AV7 A;  1OWM A;  4WWP A;  3UQ3 A;  1XGW A;  5LCW J;  3CVL A;  4CYM D;  3ASG A;  1KLX A;  2IY0 C;  3OAW A;  3DEO A;  1NA0 A;  4HRL A;  5IY5 E;  3SGH A;  2IQC A;  3QC1 A;  4CDM A;  2WXF A;  4JL0 A;  4U63 A;  4APO A;  3L54 A;  4GML A;  1X81 A;  4LUN U;  3ZHE A;  2OEV A;  3D9J A;  4LNG A;  2XPI A;  3ASN E;  2Y0B G;  3Q73 A;  1HFA A;  1Q2Z A;  4NIK A;  3ABK E;  1N4R A;  1TNU A;  2YNQ A;  2GRP B;  2I1K A;  1SW6 A;  3IBE A;  4UI9 K;  3CVP A;  3RSE G;  4U8Y D;  2P9I G;  2WVI A;  1N9A A;  2C0M A;  5B1A E;  2OCC E;  3FUD A;  3B7S A;  3VTX A;  1IYG A;  5KWD A;  3LY8 A;  1TNZ A;  2Y4U A;  3APC A;  3CKB A;  2IFU A;  2L0T B;  2Y1L E;  5HI7 A;  1A5E A;  3FUM A;  3L82 A;  2DZO A;  2R05 A;  3QAQ A;  3TWS A;  2DBA A;  3G2U A;  3PZD A;  3FUJ A;  3V2O A;  3J5P A;  4JVS A;  1HH8 A;  4NAC A;  3G2S A;  4A3T A;  3X2Q E;  1E7U A;  4APF A;  4JPS A;  3Q7F A;  3UM2 A;  3MGB A;  1A17 A;  5DBK A;  3E37 A;  1S64 A;  2KCK A;  5G05 C;  3IKO B;  4YDE A;  3FUI A;  3QNK A;  1D8E A;  4TXR A;  5KJK A;  4UI9 J;  2R03 A;  2MYO A;  3HG0 D;  2P9L G;  1Z3X A;  5CHE E;  2DWZ A;  4G23 A;  5G2N A;  1OUV A;  3W9G A;  3T8M A;  4DUI A;  3PZ2 A;  3PS6 A;  4I6J A;  4OVU A;  3L17 A;  3CEQ A;  2DIW A;  4HFG A;  4HI8 A;  1UN9 A;  1SA5 A;  2OEW A;  4EZL A;  2LAH A;  1JWF A;  2J08 A;  2XGM A;  5CMY A;  3HXE A;  2R2L A;  3PZ4 A;  4LG6 A;  1DCE A;  2VSX E;  3D9M A;  4BER A;  5ENS D;  3PH0 C;  5BXU A;  3HXB A;  3ZNG A;  2IOL A;  3QKY A;  2M63 A;  4H7Y A;  4MLP A;  1QYM A;  4A3V A;  4F1S A;  5ANR A;  3D3M A;  3UUX A;  3DRA A;  3UIN C;  2HR2 A;  3B7R L;  5BXO A;  2C2L A;  3SFY A;  3CQC B;  1LF8 A;  3GZS A;  3TJP A;  3ZFW A;  4N5C A;  1HS6 A;  4DX2 A;  3Q47 B;  4BET A;  4JXT A;  1OCO E;  1IQU A;  1E8W A;  4B89 A;  4CT4 A;  3GYZ A;  4U95 D;  5CMW A;  5LOZ A;  3APF A;  1UJJ A;  2WXL A;  5AYW D;  5AQB A;  4HXI A;  2CHW A;  4HBD A;  2WB2 A;  3GZ1 A;  2IU1 A;  2WQ6 A;  2KC7 A;  2GRN B;  5AEN A;  4ANV A;  4HOU A;  3WXX A;  3MKQ B;  4B93 B;  2V4H C;  2MRI A;  4GCO A;  2WXH A;  4C0M A;  3BG0 B;  3FY4 A;  3CHP A;  4PH4 B;  5JHB A;  4GU5 A;  3UI2 A;  2J09 A;  1V54 E;  4YVQ C;  4GZD A;  1XNF A;  4J6I A;  2VGX A;  1FCH A;  4URK A;  5AJD A;  3EU9 A;  2RFA A;  3L9T A;  5DIZ A;  4F3V A;  1TEZ A;  3UTM A;  1JCS A;  3DSU A;  1MX6 A;  4B0Z A;  2DVW A;  3SZ7 A;  5LP0 A;  3C72 A;  4ANU A;  3FH8 A;  2V5F A;  1EYH A;  3HXC A;  5BT1 A;  3TXN A;  2CFU A;  4AY6 A;  4ZFH A;  2HE0 A;  1O1S A;  3URZ A;  2X6I A;  3BG1 B;  2BKG A;  3FUL A;  1NZN A;  3ZIM A;  5BNW A;  4DX5 D;  4XKC A;  1FVH A;  3KEA A;  3FTZ A;  4NRH B;  4OAU C;  3S7J A;  3LDZ A;  2OND A;  2I6H A;  4GMJ A;  4GTV A;  2GRO B;  1OWO A;  2GRR B;  4UWH A;  1N54 A;  5CRU A;  5ARG A;  5EIL A;  5JJ6 A;  2WMO A;  4XX5 A;  4J8F A;  1H6P A;  1ELW A;  2FO7 A;  4ILG A;  2V0P A;  3QK0 A;  4PS8 A;  4KZ0 A;  4HNA D;  4HLL A;  1SVX A;  2XQ0 A;  3FUK A;  4C0E A;  1N0R A;  4PS3 A;  1MYO A;  2NC9 A;  2X6H A;  1UG3 A;  2VQ2 A;  1U2V G;  1SA4 A;  3ULE G;  2I2O A;  2WXJ A;  2YQ8 A;  5KJL A;  4KZC A;  1O5M A;  5EKQ D;  4RQI A;  3SQV A;  5H7P A;  1E90 A;  1GW6 A;  3CHS A;  4CEM A;  2V5Q C;  5ENQ D;  3KSL A;  4KMO A;  1BD8 A;  5ENT D;  4F1P A;  1OWL A;  2ZXW E;  2XPY A;  4G25 A;  1Y6I A;  3RU0 A;  3ZVV A;  1PAQ A;  4LCT A;  4BFR A;  4NQ0 A;  2AXZ A;  3ZYL A;  1VDY A;  3B7U X;  2C0L A;  1TNO A;  4DLO A;  3TWQ A;  3FU6 A;  1EDU A;  2KCV A;  2E2E A;  4JD2 G;  3JCK C;  2LSV A;  3NOG D;  4XI9 A;  3ZU7 B;  5JJT A;  2F8Y A;  4ATZ D;  4CDR A;  3ZEF A;  4CRW A;  4IYP A;  1H6K A;  3SHF A;  5KBA A;  4G2V A;  4LSZ E;  3LS8 A;  4LNB A;  4Z68 A;  4Q94 A;  2QYU A;  3SD5 A;  3SF4 A;  4YDW A;  1NL4 A;  3Q15 A;  1KZP A;  4BY6 A;  3DSX A;  5JMN D;  1JWG A;  4JZY A;  3LVQ E;  3UMV A;  3DXM G;  3C3O A;  3MA5 A;  1L5J A;  3UM0 A;  5G05 J;  4I1A A;  4BWR A;  1KT0 A;  2A4Z A;  1YYH A;  4JEU A;  4L1B A;  3LY9 A;  4Y6W A;  2DYS E;  1S0P A;  5FQ7 A;  3F6Q A;  2Q7F A;  3CHO A;  5FIO A;  3AS4 A;  3JXJ A;  2P9S G;  3KAE A;  4UWK A;  5ENR D;  3ZXP A;  3LPZ A;  1WG0 A;  2RG8 A;  4G11 A;  2UWJ G;  3CGH A;  2QC9 A;  5FZS A;  3UT8 A;  5FIN A;  3KD7 A;  3JUI A;  3FTU A;  2VTB B;  3UX4 A;  3VTY A;  1S70 B;  3FTS A;  4LRZ A;  2ZIR A;  2P9U G;  4UWG A;  3RKV A;  2UY1 A;  3LEW A;  4U96 D;  4L7T A;  2YHE A;  4N39 A;  5ENO D;  3OTN A;  2VSY A;  5ITZ F;  1TJC A;  1LTX A;  3AG3 E;  4GTP A;  2ETC A;  4KVM A;  3FH5 A;  4U0U A;  3ZYK A;  1B89 A;  1OCR E;  1E96 B;  3ASD A;  3FTY A;  3FUF A;  4EQF A;  2BTD A;  2IF4 A;  4GTS A;  4FUL A;  3ZYM A;  3CVW A;  1BLX B;  4G8L A;  4GZC A;  3QJZ A;  5JJ7 A;  3HRA A;  2J49 A;  1HU3 A;  3T9K A;  1BPO A;  1QNF A;  1PC2 A;  2FEZ A;  4GZ3 A;  1FT2 A;  4XEI G;  2CHX A;  4AP2 A;  3QDN A;  3S7D A;  3B7B A;  3UKR G;  1H0A A;  2XEH A;  5ANL A;  3E4B A;  1KT1 A;  1TJF A;  4UWL A;  2OVF A;  3E32 A;  4E6H A;  2P9N G;  3MV2 B;  1K3Z D;  2X38 A;  1IHG A;  3ONK A;  2RKK A;  4L9P A;  2PL2 A;  3AU4 A;  2B6C A;  2DCP A;  3NB2 A;  3QAR A;  3E34 A;  3DEP A;  2VSO E;  3PNT B;  3FTW A;  3ULQ A;  2IEJ A;  1TNB A;  2P9K G;  3FHE A;  4RG6 A;  2P58 C;  3CVU A;  1H6O A;  4B8C B;  2WMN A;  4OVV A;  4G8K A;  2FI7 A;  3R9M A;  1IXV A;  4XI0 A;  1N4S A;  3KEZ A;  1HXI A;  4G1T A;  3FTV A;  1JUQ A;  4A63 B;  5T4Y A;  1U3C A;  3N71 A;  2YIN A;  2DZN A;  4I1O B;  1OCZ E;  1OCC E;  2VJ8 A;  3CSF A;  3O4Z A;  1TN7 A;  5A6C A;  4U0S A;  4BX8 A;  2BF0 X;  3JXI A;  3SO8 A;  1MQS A;  1H2T C;  1WDY A;  1DVP A;  2ZGG A;  1Z3Y A;  3CHM A;  1V55 E;  4EZK A;  2QYJ A;  3Q9U C;  3T5V A;  2J4B A;  2MOW A;  4EPZ A;  4B8A A;  2FBN A;  4TXQ A;  1QQE A;  2KAT A;  4FLH A;  2KZT B;  2QZA A;  4DLQ A;  3SFX A;  3DPD A;  1UW4 B;  2ZIS A;  3L08 A;  3Q78 A;  2AXV A;  4HRN A;  3CVY A;  5JA4 D;  2HO1 A;  1TN6 A;  3UIP C;  1K8K G;  3PRE A;  4JHR A;  2BKK B;  2WXR A;  4AEZ C;  1JCR A;  5CER B;  3ZYQ A;  3ONL A;  3FFL A;  3TAX A;  5EYL A;  3EDT B;  3CVN A;  1IHB A;  5M72 A;  4GMR A;  5T8I A;  5LCW C;  3AAA C;  2PNN A;  2J4D A;  5G55 A;  5EDS A;  2QY7 A;  4DJA A;  5EX0 A;  3JQ0 A;  2WXO A;  3FU0 A;  2XCC A;  3IHV A;  1FT1 A;  4FJZ A;  1H2U A;  4MKT A;  4MBG A;  5AJL A;  4GTT A;  3UM1 A;  2VSN A;  3D9K A;  4R7L A;  4I9C A;  3PRZ A;  3L13 A;  2PM7 A;  1KZO A;  3HHM A;  1HZ4 A;  4ABN A;  4KXK B;  4HOS A;  4AVX A;  4LNU D;  4XE0 A;  4L23 A;  4HQD A;  2ETA A;  3QWP A;  2OV8 A;  4RLY A;  3FP3 A;  5A23 A;  2I1J A;  5AAR A;  4CGV A;  1MX4 A;  4C9B B;  3CLJ A;  4HOT A;  1Z6T A;  3V31 A;  4I9E A;  3FU3 A;  2BUG A;  2OOE A;  3D9L A;  3KSQ A;  2RD0 A;  3RO2 A;  3D9O A;  1NI1 A;  5E76 A;  4K03 A;  4F6R D;  4A55 A;  1OXJ A;  2Y3A A;  2JEK A;  5CEA A;  2P9P G;  3AG2 E;  4JHJ A;  1NA3 A;  3ABL E;  5JHA A;  3RRU A;  3I5P A;  2Y4T A;  3MV3 B;  5C1D A;  5D0Q D;  3ZGQ A;  3EIJ A;  1OWP A;  4AOF A;  4Y6C A;  4DPR A;  3GW4 A;  4CCA A;  4HVB A;  3ESK A;  4UQX A;  2L0I A;  3IHY A;  2F37 A;  3AG4 E;  1PY1 A;  1BU9 A;  2H6F A;  3GZ2 A;  3QWW A;  1ZBP A;  3Q49 B;  5FZQ A;  3NQP A;  1E8X A;  3PZ1 A;  3HVE B;  3CIA A;  4ACL A;  4M3O A;  4FP7 A;  4GTO A;  3SY2 A;  3Q5M A;  1DC2 A;  3PNL B;  5LFA A;  1Z5S C;  4I6E A;  2H6I A;  3JQ1 A;  4I1M A;  3K9I A;  5AIJ A;  3LYA A;  2KBX A;  4GPM A;  3ZUV B;  4TUU A;  2LXM A;  4L2Y A;  2AXU A;  1MHQ A;  2J9Q A;  1HX8 A;  3IV0 A;  3HYM B;  3ENE A;  5CRV A;  4KYO B;  2OVB A;  2CG2 A;  3NZS A;  4AY5 A;  1YCS B;  3MKQ A;  2XRZ A;  3ZKJ A;  1AWC B;  3AS8 A;  4DI3 A;  4GB9 A;  4JB8 P;  4N3A A;  2IO3 C;  3V2X A;  5J90 A;  3ULY A;  2ZGD A;  4U07 A;  1OWN A;  3TGO A;  1EF1 C;  4ILI A;  5FQ4 A;  5J08 A;  3UKU G;  5BV0 A;  1S63 A;  4OYS A;  1N0Q A;  4FLB A;  4YDY A;  2XPZ A;  4U8H A;  5EYP F;  3PE4 A;  3V30 A;  4C48 B;  4D10 C;  3RRM B;  3WG7 E;  4KT6 B;  2JAB A;  1TN8 A;  3ASO E;  4BT8 A;  1SZ9 A;  1HG5 A;  3ML8 A;  3CVV A;  4IUL A;  4F7A A;  3ZHE B;  3W9F A;  3CHQ A;  4TRQ A;  3NOC D;  3PE3 A;  4A1S A;  5D2M C;  2J8S D;  4N2Q A;  2R59 A;  5BW8 C;  5KJN A;  3PEV B;  5FT9 A;  4GYY A;  4HOR A;  4IN3 B;  2EIM E;  3EHQ A;  3LVR E;  4XZ4 A;  1ELR A;  3HXF A;  3PZ3 A;  4H7X A;  2CG3 A;  3ABM E;  1G3N B;  1TNY A;  3LJN A;  3QB2 A;  3TWX A;  2HYZ A;  2PM6 A;  4ANW A;  4JEH A;  2PZI A;  3I3N A;  5B1B E;  3RO3 A;  3B7T A;  3C98 A;  3IEG A;  4BEP A;  1HO8 A;  1BI8 B;  3DSV A;  3TL5 A;  1N52 A;  1UJK A;  3O48 A;  2R17 C;  4WNG A;  4GTR A;  4RSY A;  3RAU A;  2H6G A;  2LO6 A;  3LY7 A;  4E85 A;  2BED A;  3C3R A;  3MZL B;  3G2T A;  2X6K A;  2XS1 A;  5D66 A;  2R02 A;  5ARF A;  3C3Q A;  3HXD A;  2XEE A;  4I43 A;  2DYR E;  4TV3 A;  4N3B A;  1MZC A;  1O1R A;  3ML9 A;  4DK5 A;  3BUA A;  1DCQ A;  4BX9 A;  1SZA A;  2XZD G;  4QFV A;  1UOH A;  2VYI A;  4GA2 A;  2IOS A;  4UQY A;  3ZRH A;  4PUC A;  2EIJ E;  3MJW A;  2XRY A;  3TXM A;  4CGW A;  3SBT B;  3KS2 A;  4LEU A;  5CEC B;  4BTB A;  5CCL A;  4UQZ A;  3QWV A;  2FUL A;  3IXE A;  4NUR A;  4O1P A;  4FU3 A;  5D0O D;  2KXP C;  4HOQ A;  5G04 C;  5EID A;  2MHK A;  3DXK G;  3U9W A;  1N94 A;  3AU5 A;  4CZ2 D;  3MCX A;  2X3M A;  3DSW A;  2HM8 A;  4WUY A;  1JCQ A;  2LNI A;  3FEX A;  1P5Q A;  2XZT G;  2GRQ B;  2L6J A;  3L6A A;  3T5X A;  2NYJ A;  5EIB E;  4QQI A;  5HKP A;  4M7C A;  4N2S A;  4HS2 A;  3D9P A;  2PQR A;  1ZB1 A;  1WY6 A;  3D9H A;  1U3D A;  1LD7 A;  2GGF A;  5AN8 A;  5AQA A;  5AAO A;  3MX3 A;  3OXL A;  4B94 A;  2H6H A;  4EZJ A;  5CBO A;  4DRX E;  2XCB A;  4AJW A;  1OT8 A;  5A7D B;  4K0R A;  4J7W A;  5FTP A;  5AQ7 A;  4XKB A;  3HIZ A;  4I2W A;  3DST A;  3AS5 A;  3S7B A;  3SFZ A;  5CED B;  1K1B A;  5FWQ A;  3S7F A;  3PDN A;  3B95 A;  3MEK A;  3SI5 A;  3LCA A;  2VTB A;  4A1G A;  3CK9 A;  4UUC A;  4DX1 A;  1WAO 1;  3EHR A;  4I6G A;  2VGX B;  3LJ3 A;  4GPK A;  2EIK E;  3CST A;  3V79 K;  2ILR A;  4GYO A;  3ZN3 A;  5ENN A;  5KNG A;  1K1A A;  4EBA G;  1TYQ G;  4JA9 A;  1N4Q A;  3PEU B;  5FZR A;  4K5B A;  1E8Y A;  1H2V C;  4PDX A;  5FJY A;  2L6B A;  1NFI E;  2WXN A; 
#chains in the Genus database with same CATH homology
 1NA0 A;  4JHJ A;  2AVP A;  4XI9 A;  1NA3 A;  3FH7 A;  4KVO A;  3SGH A;  2IQC A;  4HLE A;  5JJT A;  5JHA A;  3QC1 A;  3TG5 A;  4CDR A;  3RRU A;  3ZEF A;  3I5P A;  1UN8 A;  2Y4T A;  3MV3 B;  4CRW A;  5CCM A;  4CDM A;  2WXF A;  4JL0 A;  4IYP A;  1H6K A;  3SHF A;  4U63 A;  3APD A;  3L54 A;  4J0U A;  4APO A;  2J07 A;  4GML A;  5C1D A;  4LUN U;  3ZHE A;  5D0Q D;  4G2V A;  3ZGQ A;  4W9R A;  3D9J A;  3EIJ A;  3LS8 A;  2XPI A;  1OWP A;  3ASF A;  4CT0 A;  3U4T A;  4AOF A;  4I2Z A;  5KJL A;  4Y6C A;  4Q94 A;  3UT7 A;  3SD5 A;  4DPR A;  1HFA A;  3GW4 A;  3SF4 A;  4CCA A;  4HVB A;  3Q15 A;  3ESK A;  4UQX A;  2L0I A;  3CK8 A;  4BY6 A;  3IHY A;  5HQ8 A;  1JWG A;  4JZY A;  3LVQ E;  1PY1 A;  3QWW A;  3GZ2 A;  1YA0 A;  2YNQ A;  4GZ6 A;  3UMV A;  1ZBP A;  2I1K A;  3IBE A;  3Q49 B;  3CVP A;  4UI9 K;  5FZQ A;  3MA5 A;  1L5J A;  3NQP A;  4N3C A;  1E8X A;  2I9C A;  3HVE B;  2WVI A;  3CIA A;  4FAD A;  3PUJ A;  5G05 J;  4ACL A;  2C0M A;  4M3O A;  4FP7 A;  1ZU2 A;  3OXF A;  4I1A A;  4BWR A;  1KT0 A;  3Q5M A;  2A4Z A;  3FUD A;  3B7S A;  1INZ A;  3PNL B;  5LFA A;  3VTX A;  1IYG A;  3P1U A;  5FQ6 A;  3LY8 A;  4JEU A;  3P2B A;  4I6E A;  4L2L A;  4L1B A;  2Y4U A;  3APC A;  3FDH A;  3JQ1 A;  4I1M A;  3VLE A;  3LY9 A;  3K9I A;  5AIJ A;  4Y6W A;  3LYA A;  3CKB A;  1S0P A;  2IFU A;  2L0T B;  5FQ7 A;  2CHZ A;  5HI7 A;  3BEE A;  2Q7F A;  3FUM A;  4ATG A;  3CHO A;  5BUZ A;  4Q96 A;  2AW6 A;  4TUU A;  3AS4 A;  4RVB A;  3KAE A;  2NSZ A;  3QAQ A;  4L2Y A;  4ME2 A;  4UWK A;  1EPU A;  4IRU A;  3VLF A;  2DBA A;  2AXU A;  3G2U A;  3LPZ A;  1MHQ A;  3PZD A;  2J9Q A;  1HX8 A;  3MKR A;  5LX8 A;  3CHR A;  3FUJ A;  3IV0 A;  3FTX A;  3HYM B;  3ENE A;  2RG8 A;  4G11 A;  4KYO B;  4J8E A;  2OVB A;  2UWJ G;  3CGH A;  2WXI A;  4JVS A;  2CG2 A;  2XHE A;  1HH8 A;  3KD7 A;  3JUI A;  4NAC A;  5FZS A;  3G2S A;  3UT8 A;  3FTU A;  2VTB B;  4A3T A;  3NZS A;  3UX4 A;  1E7U A;  2EQX A;  3VTY A;  3FTS A;  4APF A;  4AY5 A;  3ASH A;  4LRZ A;  4JPS A;  2VGY A;  2LSU A;  1HF8 A;  3I4G A;  3MGB A;  3MKQ A;  1A17 A;  2KM4 A;  2UY1 A;  4UWG A;  3LEW A;  5DBK A;  3L22 A;  3RKV A;  2XRZ A;  4GYW A;  4L7T A;  2KCK A;  3AS8 A;  2YHE A;  4DI3 A;  4N39 A;  4O6F A;  5G05 C;  4GB9 A;  3OTN A;  4N3A A;  5J90 A;  2VSY A;  1TJC A;  3IKO B;  5KCM A;  3FUI A;  3PVL A;  3QNK A;  5KJK A;  4MRU A;  4UI9 J;  2WPV A;  4U07 A;  4KVM A;  3FH5 A;  1OWN A;  4U0U A;  3TGO A;  1EF1 C;  1SQM A;  3EJN A;  3FUH A;  3FUN A;  4ILI A;  5FQ4 A;  5J08 A;  3ZYK A;  1B89 A;  2XEV A;  5BV0 A;  1E96 B;  3ASD A;  1Z3X A;  4OYS A;  3FTY A;  5CHE E;  4FLB A;  3EHM A;  2XPZ A;  4G23 A;  2LAI A;  4U8H A;  3FUF A;  3SBS A;  4EQF A;  2BTD A;  2IF4 A;  5KJM A;  3PE4 A;  4JHK A;  5G2N A;  1OUV A;  4FUL A;  3T8M A;  4D10 C;  3RRM B;  4G26 A;  3PS6 A;  2WXG A;  4KT6 B;  4I6J A;  4OVU A;  4BT8 A;  3L17 A;  1SZ9 A;  3CEQ A;  2DIW A;  1HG5 A;  3ML8 A;  4HFG A;  3CVV A;  3ZYM A;  1UN9 A;  3U66 A;  4IUL A;  3RK6 A;  4F7A A;  4RG9 A;  3ZHE B;  3Q4A B;  3CVW A;  3CHQ A;  4EZL A;  2LAH A;  1JWF A;  5JJ7 A;  4GZC A;  3QJZ A;  2J08 A;  2XGM A;  4TRQ A;  4FA6 A;  5CMY A;  3PE3 A;  3I4R B;  3G2W A;  4GA0 A;  4A1S A;  1ELK A;  1E8Z A;  2J49 A;  2WXK A;  2KZT A;  1HU3 A;  4N2Q A;  1BPO A;  2NXP A;  1QNF A;  2R59 A;  5BW8 C;  2X6F A;  5KJN A;  1PC2 A;  3PEV B;  5FT9 A;  3CV0 A;  2VSX E;  3D9M A;  4GYY A;  1NP7 A;  2FEZ A;  4HOR A;  4IN3 B;  4GZ3 A;  1IQR A;  3PH0 C;  2GRM A;  3LVR E;  4XZ4 A;  4LER A;  1ELR A;  2IOL A;  2CHX A;  3QKY A;  4AP2 A;  3QDN A;  3S7D A;  2M63 A;  3UPV A;  4H7Y A;  4MLP A;  4J8S A;  3TG4 A;  4A3V A;  4F1S A;  4H7X A;  5ANR A;  3JCK C;  1H0A A;  2CG3 A;  3D3M A;  4UI9 C;  5ANL A;  3U64 A;  3E4B A;  3UUX A;  4YVO A;  2HR2 A;  3QB2 A;  1KT1 A;  2HYZ A;  3B7R L;  2PM6 A;  4ANW A;  2C2L A;  4EBA A;  1TJF A;  3CQC B;  4JEH A;  4UWL A;  1LF8 A;  2PZI A;  2OVF A;  3I3N A;  3CVQ A;  3GZS A;  3RO3 A;  3TJP A;  3ZFW A;  4N5C A;  4U04 A;  4E6H A;  3B7T A;  3NZU A;  3MV2 B;  1HS6 A;  4Q69 A;  2X38 A;  3C98 A;  3IEG A;  3Q47 B;  3ZW3 A;  1IHG A;  3ONK A;  1HO8 A;  2PL2 A;  2ZU6 B;  4PS7 A;  3TL5 A;  3AU4 A;  4JXT A;  1IQU A;  2DCP A;  1E8W A;  2FF4 A;  1N52 A;  1UJK A;  3QAR A;  2GW1 A;  4B89 A;  3O48 A;  4WAF A;  2VSO E;  3PNT B;  4CT4 A;  3GYZ A;  3FTW A;  3ULQ A;  5CMW A;  2R17 C;  4WNG A;  5LOZ A;  3APF A;  3B13 A;  1UJJ A;  4RSY A;  2WQH A;  2WXL A;  3FHE A;  2LO6 A;  4RG6 A;  5AYW D;  4HXI A;  2CHW A;  3SNX A;  2WB2 A;  4ILH B;  2PQN A;  3GZ1 A;  2IU1 A;  3LY7 A;  2WQ6 A;  2KC7 A;  2P58 C;  3FU5 A;  4E85 A;  3CVU A;  5G04 J;  2WXM A;  5AEN A;  2AWI A;  3MZL B;  3G2T A;  4ANV A;  2X6K A;  3HDX A;  4JA7 A;  4HOU A;  3WXX A;  3MKQ B;  3DBS A;  4B8C B;  2WMN A;  4OVV A;  4BTA A;  2UY1 B;  5ARF A;  2FI7 A;  2MRI A;  1HG2 A;  4GCO A;  4AIF A;  2WXH A;  4C0M A;  3LXU X;  2QFC A;  4XI0 A;  4GCN A;  3BG0 B;  3FY4 A;  2XGO A;  3CHP A;  4I43 A;  3KEZ A;  3R7Q A;  2ION A;  1HXI A;  4PH4 B;  4TV3 A;  4G1T A;  3FTV A;  4N3B A;  4GU5 A;  5JHB A;  1JUQ A;  2J09 A;  4YVQ C;  3ML9 A;  5T4Y A;  4GZD A;  1U3C A;  1XNF A;  4J6I A;  2VGX A;  3N71 A;  1FCH A;  4DK5 A;  4URK A;  5AJD A;  4BX9 A;  2YIN A;  4I1O B;  4JC8 A;  1SZA A;  4ACK A;  3LKU A;  4YND A;  2VJ8 A;  5E75 A;  5DIZ A;  5FQ8 A;  4QFV A;  3CSF A;  1DNP A;  3O4Z A;  2VYI A;  4GA2 A;  4F3V A;  1TEZ A;  2V4L A;  2IOS A;  3PUK A;  4UQY A;  2XGS A;  5EX3 A;  5A6C A;  4U0S A;  4BX8 A;  3ZRH A;  4B0Z A;  2BF0 X;  4PUC A;  4GA1 A;  3S2A A;  2CFZ A;  1MQS A;  1H2T C;  3MJW A;  1DVP A;  2XRY A;  3FUE A;  3TXM A;  3SZ7 A;  5BV1 A;  4CGW A;  3SBT B;  5LP0 A;  4V3I A;  1Z3Y A;  3KS2 A;  4LEU A;  2KCL A;  3CHM A;  4ANU A;  3VLD A;  4EZK A;  4BTB A;  5CCL A;  4UQZ A;  3FH8 A;  2V5F A;  1EYH A;  3QWV A;  2FUL A;  5BT1 A;  4NUR A;  3TXN A;  3T5V A;  2J4B A;  2CFU A;  2MOW A;  2E0I A;  3EIQ C;  2WXQ A;  3CKC A;  4EPZ A;  4FU3 A;  4GZ5 A;  5D0O D;  4AY6 A;  4HOQ A;  4B8A A;  3ZXS A;  2WXP A;  4JW1 A;  2FBN A;  4FC8 A;  4XIF A;  5G04 C;  5C2Y A;  1QQE A;  2KAT A;  2MHK A;  4FLH A;  3RIB A;  2KZT B;  3U9W A;  4DLQ A;  2JEK A;  4EEC A;  3URZ A;  4I17 A;  2X6I A;  3AU5 A;  3DPD A;  3FEY A;  1UW4 B;  3MCX A;  2X3M A;  3FWV A;  2HM8 A;  4WUY A;  4J8D A;  4WNE A;  3RJV A;  3BG1 B;  4FJY A;  3L08 A;  3FUL A;  1NZN A;  4ANX A;  3EHN A;  2AXV A;  2LNI A;  4DI4 A;  2L9B A;  3ZIM A;  3CR3 A;  3CVY A;  4WWO A;  2GRL A;  5BNW A;  2JLB A;  1FVH A;  2HO1 A;  4XKC A;  3FEX A;  1P5Q A;  4AXH A;  4WND A;  3PRE A;  2L6J A;  3L6A A;  4JHR A;  3T5X A;  3FTZ A;  4NRH B;  4CDN A;  2WXR A;  3S7J A;  4AEZ C;  2IJG X;  4P29 A;  3NF1 A;  3LDZ A;  3ZYQ A;  4N2S A;  3ONL A;  2OND A;  3FFL A;  3G2V A;  4HS2 A;  4U0Z A;  3TAX A;  2I6H A;  3CVX A;  3EDT B;  3D9P A;  4GMJ A;  2PQR A;  4BSX A;  1WY6 A;  3CK7 A;  3HVE A;  3QOU A;  1U3D A;  3CVN A;  1W3B A;  3R7R A;  5M72 A;  4G24 A;  1FVF A;  4F53 A;  2GGF A;  5T8I A;  1OWO A;  3MX3 A;  3OXL A;  4WNF A;  4UWH A;  1N54 A;  4B94 A;  4EZJ A;  5LCW C;  2X6J A;  2XCB A;  4AJW A;  1JPL A;  5ARG A;  4AM9 A;  2J4D A;  5A7D B;  4K0R A;  5FTP A;  5G55 A;  3CQG B;  5JJ6 A;  5EDS A;  2WMO A;  4XX5 A;  4J8F A;  4XKB A;  4WWN A;  1QZ2 A;  1ELW A;  2QY7 A;  4MS6 A;  4DJA A;  2FO7 A;  3HIZ A;  4ILG A;  2V0P A;  3QK0 A;  3UT4 A;  4I2W A;  5EX0 A;  3JQ0 A;  2V8S E;  4PS8 A;  4KZ0 A;  2WXO A;  3FU0 A;  2XCC A;  2XQ0 A;  3IHV A;  3FUK A;  4C0E A;  4KBQ A;  4PS3 A;  4FJZ A;  1H2U A;  2NC9 A;  4MKT A;  2X6H A;  3AS5 A;  3S7B A;  3SFZ A;  2WQ7 A;  5AJL A;  1UG3 A;  3D9N A;  5FWQ A;  2VQ2 A;  2VSN A;  1H19 A;  3D9K A;  4R7L A;  3R9A B;  2A5U A;  3S7F A;  3JYS A;  4I9C A;  2YHC A;  3PRZ A;  2WM9 A;  4FHJ A;  3D9I A;  3L13 A;  3MYV A;  2I2O A;  2PM7 A;  3PDN A;  3U3W A;  3HHM A;  2WXJ A;  2YQ8 A;  1E7V A;  3MEK A;  1HZ4 A;  3RRN B;  4ABN A;  4FHK A;  4KXK B;  4KZC A;  5EKQ D;  3SI5 A;  3LCA A;  4AVX A;  2VTB A;  4HOS A;  4A1G A;  3CK9 A;  4UWF A;  1E90 A;  1WAO 1;  5T3R A;  1WM5 A;  1GW6 A;  4XE0 A;  3CHS A;  4CEM A;  3OXG A;  4I6G A;  4KMO A;  4L23 A;  5BPP A;  2VGX B;  3QWP A;  4GAA A;  2OV8 A;  1HE8 A;  1OWL A;  3ZPJ A;  3FP3 A;  5A23 A;  2I1J A;  3LJ3 A;  4GPK A;  1Y8M A;  3CST A;  4CGV A;  2XPY A;  4G25 A;  4C9B B;  4BT9 A;  3CLJ A;  1Y6I A;  4HOT A;  1Z6T A;  2ILR A;  2R5S A;  4GYO A;  5ENN A;  3RU0 A;  3ZN3 A;  4I9E A;  3ZVV A;  1PAQ A;  4LCT A;  3FU3 A;  3ESL A;  4BFR A;  4NQ0 A;  4EBA G;  4JA9 A;  2AXZ A;  3L16 A;  2BUG A;  2OOE A;  1VDY A;  3PEU B;  5FZR A;  3ZYL A;  3B7U X;  2C0L A;  3D9L A;  4DLO A;  1X5B A;  3FU6 A;  1OWM A;  4AV7 A;  4WWP A;  3UQ3 A;  1XGW A;  1EDU A;  1E8Y A;  1H2V C;  2RD0 A;  3RO2 A;  3CVL A;  3D9O A;  5LCW J;  3ASG A;  4PDX A;  1KLX A;  5E76 A;  2KCV A;  5FJY A;  4K03 A;  3OAW A;  4A55 A;  2E2E A;  2Y3A A;  2LSV A;  2WXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...