1ELRA

Crystal structure of the tpr2a domain of hop in complex with the hsp90 peptide meevd
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
128
structure length
128
Chain Sequence
GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of TPR domain-peptide complexes: critical elements in the assembly of the Hsp70-Hsp90 multichaperone machine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords TPR2A-DOMAIN OF HOP
total genus 59
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2000-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1elrA00
2VYIA 2FF4A 4RG6A 2I6HA 4U0SA 1ZBPA 3FFLA 1NA3A 3CV0A 4J8DA 5BW8C 1HXIA 1W3BA 3QKYA 3AS8A 3ZPJA 2C0MA 4N3BA 1WAO1 3QWWA 4GA1A 5ARFA 3FWVA 4RG9A 2KCLA 1E96B 3O48A 1QZ2A 2FI7A 4IN3B 2VSYA 3RKVA 2XPIA 3ULQA 4GYOA 3RU0A 4I1AA 4G25A 3OXGA 1KT1A 4U07A 4I9CA 2XGMA 3JYSA 4J8FA 5HI7A 3CK9A 3NF1A 4HOSA 3LPZA 5BT1A 1WM5A 3TG5A 5KJMA 4HOQA 3URZA 2UWJG 5LCWJ 5BNWA 3ASGA 4UI9J 1ELRA 2NC9A 3HYMB 2R5SA 1IYGA 4HOTA 3LY8A 3CVNA 4UI9K 3AS5A 2E2EA 4NQ0A 3SF4A 4N2SA 3S7DA 4I17A 3E4BA 2XEVA 4EQFA 1ZU2A 2LNIA 4J0UA 4J8EA 2KATA 5D0QD 2WPVA 3K9IA 2UY1B 2C0LA 4I9EA 4UQXA 2PZIA 4WNEA 3CVPA 4CDRA 5C1DA 3CVLA 4N5CA 3CEQA 2HYZA 3R9AB 4BT8A 5FZQA 3FP3A 3Q49B 4G1TA 1NA0A 2IFUA 2UY1A 3ASFA 3ASHA 4H7XA 1FCHA 2QFCA 5FT9A 5HQ8A 5KJNA 4GZ3A 4GA0A 4AY6A 4ABNA 2XCCA 3GZ2A 3GYZA 3QOUA 3QWVA 4GZ6A 2L6JA 4GYWA 5FZRA 3S7JA 3RJVA 4G26A 4U0UA 1OUVA 4BT9A 5G04J 4YVOA 3RO3A 5G05J 3OXLA 5JJTA 3OXFA 3TG4A 4KBQA 3KS2A 5A7DB 5D0OD 4HORA 4Y6WA 3QWPA 4G24A 4UI9C 2FBNA 2XGOA 3UPVA 3PE4A 4JA9A 1ELWA 2BUGA 4UQZA 3MA5A 3S7FA 3WXXA 3ZFWA 4U04A 3EDTB 3ZHEB 5EX0A 5G05C 2XCBA 3Q15A 4APOA 3LY7A 2C2LA 2KC7A 2MHKA 2PQNA 2VQ2A 3AS4A 4CGWA 5ARGA 5CCMA 4YNDA 4ME2A 3LCAA 3N71A 4HOUA 4GZ5A 5JJ6A 4N3AA 1A17A 2Y4UA 3U3WA 2VGYA 2LSVA 3IEGA 4WNFA 4AY5A 4BTAA 4BTBA 5A6CA 4WNDA 3RIBA 1Y8MA 3ZGQA 4U0ZA 1IHGA 2VSNA 3VTYA 3TAXA 4W9RA 2HR2A 1NZNA 4BWRA 2PL2A 3Q5MA 4GYYA 2V5FA 3SZ7A 3TGOA 4JHRA 5LCWC 2AVPA 2DBAA 3PE3A 4AM9A 5M72A 4N2QA 2YHCA 4GA2A 2Y4TA 4WNGA 4LEUA 3QDNA 5FTPA 2WQHA 3MKRA 5DIZA 3LKUA 3ZHEA 4F3VA 2VGXA 3LYAA 4NRHB 4UQYA 3U4TA 3ASDA 2LSUA 3VTXA 5G04C 5FJYA 4JL0A 3UUXA 3ZN3A 4GPKA 4G23A 4G2VA 3MV2B 3S7BA 5CHEE 1QQEA 4CGVA 3CK7A 5EKQD 5CCLA 1HZ4A 3RO2A 4A1SA 4B94A 3KAEA 5KJLA 3MEKA 3PDNA 3CKBA 3MV3B 3ESKA 4JA7A 5FZSA 2ONDA 3BEEA 4KXKB 1PC2A 4I2ZA 5DBKA 2FO7A 1B89A 1XNFA 2IF4A 2HO1A 2KCKA 4GCNA 4XI0A 4H7YA 4YVQC 1YA0A 2P58C 3CK8A 3CVQA 2FEZA 2GW1A 4N39A 4GCOA 4I2WA 4KYOB 4XIFA 4XI9A 5EX3A 5AYWD 2Q7FA 1TJCA 3Q47B 3Q4AB 2J9QA 4AIFA 4N3CA 2OOEA 4WUYA 2JLBA 3KD7A 2KCVA 4Y6CA 3UQ3A 5JJ7A 1HH8A 1P5QA 3GZ1A 3LY9A 5KJKA 1KLXA 2XGSA 3CKCA 2PQRA 1KT0A 3GW4A 2VGXB 4O6FA 2YQ8A
chains in the Genus database with same CATH superfamily
4TUUA 1H6OA 4DX5D 2X3MA 3FWVA 4F6RD 5D2MC 2A5EA 3CR3A 5B1AE 1JUQA 5ENNA 2WXQA 4G25A 4RQIA 3NB2A 1JPLA 2BKKB 3S7DA 3QNKA 2L9BA 4EPZA 3SNXA 2WPVA 2WVIA 2FO1E 1H6PA 2VTBB 5LP0A 3Q49B 4NURA 4JB8P 3NOGD 2V5QC 2WMNA 3GZ2A 3PNLB 3I4RB 4ANVA 4L23A 5D0OD 3FTUA 2XGOA 4Q69A 3WXXA 5JHBA 2B0OE 3EHMA 2VQ2A 3FTSA 1V54E 4BESA 3DXKG 2VJ8A 4C0EA 1DC2A 3L22A 1SVXA 4IRUA 2AVPA 4N2QA 5M72A 2J09A 4GA2A 3APCA 2R2LA 2HE0A 3QDNA 1WY6A 3B7RL 3UT4A 4GPKA 3ZU7B 5HS0A 3HRAA 1KPSB 5CEAA 2ZXWE 1LF8A 3X2QE 1OWLA 4Y6CA 1TNBA 4Z68A 2V4LA 1HFAA 3O4ZA 3FTYA 2VYIA 3LXUX 4RG6A 4J8DA 1TN7A 1K1AA 3PUJA 2XPIA 4CDMA 4DJAA 4O1PA 4CT0A 2XRYA 2ZGDA 2UWJG 3DPDA 2MOWA 3CLJA 5BNWA 2YHEA 2GRPB 5CBNA 1BI7B 3LY8A 5FQ6A 4E6HA 1MX2A 5T8IA 2PZIA 3D9OA 2AXUA 3C3RA 4GZ3A 3WG7E 4B89A 5FZRA 4GYWA 4G26A 4JW1A 5G04J 3J5QB 3AG4E 4P29A 4MLPA 2QY7A 1ELKA 3AU4A 4B8CB 2P9IG 3IKOB 2P9NG 2IOLA 3KEAA 1TNUA 4EHMA 2KXPC 1Y8MA 5FINA 3UKUG 2LXMA 2IEJA 3PE3A 3R7QA 1HU3A 2P2CP 4DK5A 4F3VA 5KCMA 4XE0A 5CHEE 2OEVA 5AQBA 4JA7A 4KMOA 3BEEA 1HO8A 4BT9A 2FO7A 2IONA 1HG5A 3U3WA 4KYOB 4AIFA 4WUYA 1P5QA 1OCOE 2AW6A 5BV0A 1W3BA 5CBOA 3CSTA 2F8YA 3PVLA 2QC9A 4J8SA 2J8SD 4RVBA 2WQ7A 4A3TA 4TXQA 3LJNA 4HOQA 2DYSE 4UI9J 3HYMB 3UINC 3CHSA 4EBAG 4CDRA 4CGWA 4LNBA 5CECB 3SFYA 4LEUA 1UN8A 2XRZA 2IFUA 4H7XA 3G2SA 4AEZC 3GYZA 4GZ6A 1AWCB 2CHZA 1QNFA 4U8VD 3L13A 4C0MA 3DSWA 5CMYA 3Q15A 3Q7FA 1Z3XA 2C2LA 4AOFA 3SGHA 1N0RA 4PS7A 2R05A 4ACKA 2HR2A 5AQ7A 3TWSA 1EYHA 3SQVA 2YHCA 5FTPA 1HX8A 2X6KA 3E33A 5B3SE 3RO2A 5KJLA 3E37A 4LSZE 2XEEA 2KCKA 2LUHA 3NQPA 5AJLA 5CCLA 2I9CA 3Q78A 3C72A 4UWHA 1N52A 3UQ3A 3HXEA 3D9KA 2XGSA 4WAFA 1MZCA 3GW4A 5G2NA 3PEVB 3V2OA 4XKCA 1E96B 2P9PG 4GTPA 3ULQA 4UUCA 1OWNA 4U7EB 3V2XA 4MRUA 4HB5A 3URZA 3ASGA 3C98A 3R7RA 1BPOA 2XEVA 1O1SA 1ZU2A 2X6HA 1N4SA 3D9LA 5FZQA 4G1TA 5FT9A 3DPYA 3S7JA 2OCCE 1OUVA 2ZU6B 4HORA 3QWPA 1NI1A 2FBNA 3RRNB 1ELWA 3DWLG 2DZNA 5EX0A 1N0QA 3FTVA 4GTMA 4WNDA 1N4PA 2RFAA 3ZGQA 3VTYA 2WXPA 5CERB 3TGOA 4MKTA 4OAVB 3D9IA 3MKRA 4G2VA 3ZKJA 1QQEA 3PRZA 2GRNB 4EZKA 3HG0D 2CHXA 4H7YA 3CK8A 4KZ0A 3CVVA 3Q47B 2WXKA 1FVFA 5KJKA 4C48B 1KT0A 2X6JA 4U0SA 4HRMB 2IO2C 2EIJE 3QWWA 2VGEA 4ZFHA 3RKVA 3FH7A 1Y6IA 4WWNA 3G2WA 3PZ1A 5HI7A 3FUMA 2X6IA 2QZAA 2NC9A 4HRNA 2IJGX 1K3ZD 3AS5A 3RK6A 2RFMA 3K9IA 2UY1B 2BTDA 3ASNE 3CEQA 3ASHA 5HQ8A 4HFGA 3C5RA 4OVVA 1Z6TA 4J6IA 5T4YA 3AU5A 5H7PA 3V31A 2WXIA 4TXRA 2A5UA 5B1BE 4GTQA 4AXHA 2PQNA 1ZB1A 3IEGA 3MKQB 4CZ2D 4F7AA 4ILHB 4GPMA 1PAQA 4XZ4A 4FADA 1AP7A 2IQCA 5IY5E 3MKQA 1N54A 3HXBA 2OV8A 4BSZB 3CK7A 1HZ4A 3CVWA 2ETBA 4B93B 2WXOA 1PC2A 4GCNA 2WMOA 2WXMA 5CRVA 1KLXA 4G8LA 2PQRA 3FDHA 2FF4A 3PUKA 1NA3A 3QB2A 2LO6A 3EHNA 5AQAA 3ZYMA 2VTBA 4QFVA 1O5MA 3ZYKA 1NL4A 5AARA 1KT1A 3DSSA 3FEYA 4HNAD 4IYPA 3E4BA 1D8EA 3ZNGA 1E8XA 4HRLA 2WXGA 3SFXA 1EPUA 3BG0B 4HS2A 2XZDG 1FT2A 1KZOA 1E7UA 1U3DA 1INZA 4FJYA 5G05J 2RG8A 2J4BA 3DSUA 2H6FA 3PE4A 2CHWA 3DSVA 1DCQA 5EN5D 3FTWA 3LCAA 1A17A 2VGYA 2WXNA 4L2YA 3RIBA 4U0ZA 2VSNA 3QC1A 5AENA 4K5AB 1BLXB 1Q2ZA 3MGBA 1Z3YA 3TXNA 5DIZA 3PZ3A 4A3VA 4X8QA 4CEMA 2V8SE 3C3OA 1EF1C 5FZSA 2DZOA 1N94A 2J4DA 5EILA 1XNFA 3JUIA 2AJAA 1QBQA 3LVQE 5JJ7A 1IQRA 1LTXA 1TNZA 4UWLA 4N5QA 5BW8C 4WWPA 2VSYA 4I6EA 1H19A 5D66A 3LJ3A 1TNOA 4U07A 2IY0C 3JYSA 3CK9A 4DX6D 1SZ9A 4FP7A 1YYHA 3CHQA 3EHQA 4GTVA 1HS6A 3T5XA 4I17A 3CSFA 4J8EA 1MX6A 3T9KA 5KWDA 3B95A 3DSTA 3ASFA 3HXFA 4LERA 4DLOA 3ZXPA 4JVSA 4K5CA 4YVOA 2L0IA 3OXLA 5ENQD 2ILRA 4UQZA 5T3RA 4AY5A 4DX7D 1IHGA 4BWRA 1NP7A 4JZYA 5LCWC 2H6IA 3NAWA 4AM9A 4L7TA 3G2TA 2WXFA 3LKUA 3LYAA 3UIOC 2GROB 1N11A 4CGVA 4TUMA 5HRYA 1WG0A 4FHJA 4ILGA 4MS6A 1QYMA 2I1KA 1HH8A 4LUNU 3Q7AA 1UOHA 5ENOD 3FH8A 4EZJA 3PNTB 4GMRA 1HXIA 3AS8A 1WAO1 3UM1A 3NZSA 4GYOA 3TXMA 1UN9A 4HI8A 2KZTB 4L9PA 4L2LA 3SI5A 4JD2G 4UWKA 5BT1A 1WM5A 3TG5A 3I4GA 4UI9K 2A4ZA 2KZTA 4PUCA 1N95A 5FQ8A 5EDSA 1UG3A 3G2UA 1S64A 2QYJA 3SBSA 3PZ2A 3QWVA 3MZLB 3FUJA 3W9FA 4KVOA 3C3QA 4O60A 4CRWA 1OT8A 2XEHA 4UI9C 3LDZA 3ZIMA 3TWTA 4GTOA 2KC7A 1OY3D 4FJZA 3HDXA 4FC8A 4V3IA 3PS6A 4XEIG 5AAOA 3L6AA 4ATGA 3SZ7A 2Y4TA 3VLEA 1TNYA 2Y1LE 3CIAA 4LNGA 3UPVA 4AVXA 1E90A 2WM9A 3RAUA 2VSOE 3D9HA 1KZPA 2X6FA 3MV3B 1EDUA 3FUHA 4A1GA 3KSLA 1YA0A 2FEZA 3HXCA 2ZGGA 3E30A 3VLFA 4K0RA 3TL5A 3CKCA 1OXJA 4O6FA 4XKBA 4PDXA 5HKPA 1DVPA 3L08A 5ITZF 3ZUVB 1BD8A 3FU6A 4L1BA 1JWGA 4J8FA 2ETAA 2OVFA 1Z5SC 2BF0X 4HQDA 2R5SA 3P2BA 4GMLA 5BXUA 3PZDA 4J0UA 4UQXA 4HOTA 3B7BA 3CVUA 3FTZA 2LAIA 1N4RA 3R9AB 4BT8A 3IBEA 1NA0A 3EIQC 2V0PA 2XCCA 4JHJA 4K03A 1FT1A 1HE8A 3RJVA 4AP2A 5E75A 3RO3A 3EHRA 2RD0A 5A7DB 2DYRE 2R59A 3T8KA 2EQXA 4G24A 3S7FA 4ANUA 3FU5A 3UM0A 3AS4A 2FULA 2HM8A 5ARGA 3AG1E 3MCXA 3OAWA 3P1UA 4I6GA 2DBAA 4HXIA 1H2TC 3CVXA 3NZUA 4U96D 3TWWA 3CHRA 3ASDA 2CG3A 2ZIRA 4JL0A 5FWQA 4A63B 3GZSA 3Q73A 3FULA 4B94A 3BQOA 4NIKA 2EILE 3JXIA 3QAQA 2HO1A 1E8YA 3U4TA 4XI9A 2F0YA 5EX3A 4FLHA 2P9KG 5EYPF 1HG2A 2VGXB 3FY4A 3B7SA 2I6HA 3UT8A 4BEPA 2F8XK 5ARFA 2KCLA 3UT7A 4KZCA 2R03A 1H2VC 5LX8A 3B7UX 1MJ0A 2MYOA 4BX9A 1IYGA 4GTTA 4ANWA 3ESLA 2M63A 1OCRE 2KATA 4UWFA 4I9EA 4PS8A 1X81A 2HYZA 4FU3A 3FEXA 4DI4A 1IHBA 4ABNA 1OWPA 3I3NA 4DUIA 2H6GA 4JPSA 2I1JA 3Q9UC 3ZEFA 3APFA 5AN8A 3KS2A 1N4QA 5JHAA 3UM3A 3ZHEB 3DSXA 1TEZA 4G11A 2R17C 4ME2A 5JJ6A 4B0ZA 3D9JA 5C2YA 4EBAA 3ML9A 4FLBA 3PH0C 1NZNA 4ZHBA 4JHRA 3L82A 1D8DA 4K5BA 4BX8A 1SZAA 2QYUA 2ONDA 2XS1A 5DBKA 3ZYLA 3L54A 4N39A 2P58C 2NYJA 4JC8A 1UW4B 4LNUD 1TJCA 3ZVVA 2YNQA 3ML8A 3NOCD 3HVEB 2E0IA 4UWGA 3ABKE 2JABA 3W9GA 2C0MA 4GAAA 4I6JA 1QZ2A 3CQCB 4F53A 4I1AA 4JEUA 3L9TA 5AIJA 3UXGA 3MX3A 4U8YD 1JCQA 2PM6A 5BPPA 1V55E 5KJMA 2NXPA 5KBAA 4GMJA 1YMPA 2C0LA 4EZLA 4BETA 4AJWA 3FP3A 2UY1A 4Q94A 4GA0A 2GRRB 5E76A 1H6KA 5ENTD 1BU9A 2IO3C 5LFAA 1E8WA 3FUKA 5JJTA 3HXDA 4GTSA 3MJWA 1U3CA 2XPYA 4JA9A 2IU1A 2BUGA 3ZFWA 3EDTB 5G05C 2XCBA 2XENA 5A23A 1DNPA 4APFA 1OCZE 4BTAA 1PY1A 3ONKA 4OVUA 2PL2A 3L17A 2Y3AA 4CT4A 2DVWA 3D9MA 4PH4B 3ZHEA 4NRHB 5G04C 4KT6B 3F6QA 4A1SA 3KAEA 1H2UA 3UTMA 3AAAC 3PDNA 3ESKA 5JA4D 2CG2A 2ZISA 4G8KA 2RKKA 2GW1A 4XIFA 3JQ1A 3PZ4A 3ZW3A 3LY9A 3IV0A 3CHPA 4ACLA 3QJZA 1SA5A 1GW6A 3B13A 2GRMA 3O48A 2FI7A 2OVBA 3FUNA 1OCCE 3ISMC 3HIZA 2Y69E 5BXOA 3NF1A 4URKA 1H0AA 3TWRA 4N2SA 2LNIA 3ABLE 5D0QD 4DPRA 1MYOA 3UIPC 5AJDA 4LG6A 3T8MA 3CVLA 4JXTA 4C9BB 3RRMB 2QFCA 3LVRE 5CMWA 3JCKC 3LEWA 2DWZA 2YINA 4YDYA 4IULA 2P9SG 1N9AA 3TG4A 3FHEA 1SW6A 3HHMA 4B8AA 2BEDA 4U04A 3FUEA 1RW2A 4M3OA 5CEDB 4HOUA 2KBXA 2LXLA 3B7TA 4FHKA 2P9UG 3G2VA 4JHKA 3FU3A 4WNGA 1E7VA 3HVEA 2H6HA 2VGXA 4UQYA 1UJJA 2LSUA 4OYSA 3UUXA 5BV1A 4TRQA 1IKND 1UJKA 4R7LA 4WWOA 4GZCA 1B89A 3R9MA 3S7BA 2XZTG 3IHVA 3J5PA 3D9PA 1ZBPA 2PNNA 3Q75A 2EIKE 1OWOA 4RG9A 4DLQA 4IN3B 2X38A 5EIDA 3OXGA 4M7CA 1S63A 4HOSA 2AWIA 3LPZA 4XX5A 1ELRA 3D9NA 3RSEG 1S70B 3CVNA 2WXLA 2WXHA 4BSXA 3T5VA 4DX1A 4J8YA 2V4HC 5CCMA 2XHEA 1K8KG 3SO8A 2I2OA 1LD7A 3E34A 3FUIA 1OWMA 3SBTB 4KBQA 4Q96A 4HLLA 4GZDA 2EINE 3CVYA 3LY7A 4I43A 4YNDA 3I5PA 4GU5A 4N3AA 2IOSA 4W9RA 4NACA 3BU8A 3Q5MA 4GYYA 3TWQA 5LOZA 4ILIA 3E32A 5JMND 3ULYA 2XQ0A 4LRZA 2WQHA 3S2AA 2AXVA 4G23A 4EECA 1E8ZA 5EKQD 1WDYA 1JCRA 3JXJA 4HI9A 4U8HA 2XPZA 4I2ZA 4XI0A 5AYWD 4ANXA 2Q7FA 1SA4A 4GTRA 5KNHD 3KD7A 2F37A 4KVMA 2VSXE 2YQ8A 4DI3A 2Y0BG 1IXVA 5FQ7A 3QKYA 1S0PA 3UX4A 3ENEA 4EQFA 5ANRA 1DCEA 3BUAA 1HF8A 2AXZA 3ULEG 3FUDA 1TJFA 3MYVA 1TR4A 1RZ4A 4MBGA 2E2EA 4RLYA 5EIBE 3ABME 4BERA 2LAHA 3DBSA 2J49A 2CFUA 3LS8A 4PS3A 3KEZA 1VDYA 4AY6A 2WXRA 2WXJA 5AQ9A 3SY2A 3OXFA 5G55A 4DRXE 3IXEA 5KNGA 1YCSB 3Q79A 3Q9NC 1TYQG 4GZ5A 2Y4UA 2LSVA 4BTBA 2WB2A 4CDNA 3OTNA 3TAXA 5ANLA 3TWUA 1JCSA 4CCAA 3ZXSA 3U64A 4O1OA 3ONLA 2GRQB 2NSZA 4HVBA 3ZN3A 3EJNA 4JEHA 2L0TB 2DIWA 3MEKA 3CKBA 4KXKB 1U2VG 4YVQC 2IF4A 4GCOA 3APDA 4I2WA 2JLBA 2KCVA 3VLDA 1K1BA 4E85A 3CHOA 3AG2E 4FULA 3EU5A 3ZPJA 4N3BA 3PREA 4GA1A 4QQIA 4FA6A 3SFZA 1JWFA 4BY6A 2DCPA 3TWVA 1IQUA 5ENSD 5EYLA 3V30A 1TN8A 1MX4A 4TV3A 4A55A 4YDEA 4HLEA 3ASOE 2BKGA 3DRAA 3SF4A 3QK0A 1FPPA 4WNEA 3CVPA 2GRLA 3UI2A 2JEKA 4F1PA 4TXPA 5CRUA 3DEPA 2L6JA 2J07A 3TJPA 3U66A 1O1TA 3MA5A 3V79K 1NFIE 2WQ6A 4APOA 3UMVA 2MHKA 2OEWA 5ENPD 3SHFA 3CQGB 4HBDA 3AG3E 2V5FA 2GGFA 3SD5A 2P9LG 3D3MA 2XS8A 3IHYA 4J7WA 4AV7A 3FTXA 4YDOA 3MV2B 4GB9A 2ETCA 1O1RA 3DXMG 4D10C 3U9WA 5FIOA 1MQSA 3RRUA 3CVQA 4F1SA 3Q4AB 2J9QA 1A5EA 4I1MA 2J08A 3GZ1A 3JQ0A 4LCTA 3FFLA 3CV0A 3EIJA 3KSQA 1BI8B 1TN6A 2MRIA 3FH5A 4U63A 2CFZA 3RU0A 3UM2A 4I9CA 2XGMA 1D9SA 1LD8A 1X5BA 4I1OB 3QARA 3NBNB 5ENRD 4NQ0A 1MHQA 1L5JA 5C1DA 3FU0A 4N5CA 4BFRA 5KJNA 1FCHA 4U95D 3JUEA 1FVHA 1SQMA 2EIME 3QOUA 4U0UA 4OAUC 3DEOA 3PEUB 4DX2A 4Y6WA 5FQ4A 5J08A 1XGWA 2PM7A 2B6CA 4YDWA 2R02A 2KM4A 3N71A 5A6CA 4WNFA 4CYMD 5BUZA 4RSYA 3UKRG 3BG1B 3AJIA 3L16A 3EU9A 3ZYQA 3TWXA 3VTXA 4ATZD 5FJYA 3ZRHA 5J90A 2L6BA 3CHMA 3CGHA 3FUFA 5LCWJ 4N3CA 2OOEA 1G3NB 3EUVA
chains in the Genus database with same CATH topology
4TUUA 4PDXA 4XKBA 2X6JA 4U0SA 1ZBPA 1DVPA 3L08A 3QWWA 2X3MA 1OWOA 3FWVA 4RG9A 4DLQA 4IN3B 2X38A 3FH7A 3RKVA 1Y6IA 3CR3A 1JUQA 3FU6A 5ENNA 4L1BA 2WXQA 4WWNA 3G2WA 4G25A 3OXGA 1JWGA 4J8FA 5HI7A 4HOSA 2AWIA 3LPZA 2OVFA 4XX5A 2BF0X 3FUMA 2X6IA 1ELRA 2NC9A 2R5SA 3D9NA 2IJGX 3CVNA 3P2BA 1JPLA 2WXLA 2WXHA 3AS5A 4GMLA 3RK6A 3S7DA 3PZDA 3QNKA 2L9BA 4BSXA 3T5VA 4J0UA 4EPZA 3SNXA 2WPVA 2WVIA 3K9IA 2UY1B 4UQXA 4HOTA 3CVUA 2BTDA 3FTZA 3CEQA 2LAIA 3R9AB 2VTBB 4BT8A 3IBEA 5LP0A 3Q49B 5CCMA 1NA0A 3ASHA 2XHEA 4NURA 4HFGA 3EIQC 5HQ8A 2V0PA 2XCCA 4OVVA 2I2OA 4JHJA 4K03A 1Z6TA 2WMNA 3GZ2A 1HE8A 3PNLB 3RJVA 4AP2A 3FUIA 4J6IA 5E75A 3I4RB 1OWMA 3AU5A 5T4YA 3RO3A 3SBTB 2RD0A 4ANVA 2WXIA 4KBQA 4Q96A 4L23A 5D0OD 5A7DB 2R59A 3FTUA 2EQXA 4G24A 2XGOA 2A5UA 4Q69A 3WXXA 3S7FA 5JHBA 4GZDA 4ANUA 3FU5A 3EHMA 3CVYA 3LY7A 3AS4A 2FULA 2PQNA 4AXHA 2HM8A 2VQ2A 3FTSA 5ARGA 4I43A 4YNDA 3I5PA 4GU5A 4N3AA 3IEGA 3MKQB 2VJ8A 4C0EA 2IOSA 3MCXA 4W9RA 3L22A 3OAWA 4NACA 3Q5MA 4F7AA 4GYYA 4ILHB 1PAQA 4IRUA 2AVPA 3P1UA 4I6GA 2DBAA 4ILIA 5LOZA 5M72A 4N2QA 2J09A 4XZ4A 4GA2A 4HXIA 2XQ0A 1H2TC 4FADA 3APCA 4LRZA 3CVXA 3NZUA 2IQCA 3QDNA 2WQHA 3MKQA 3CHRA 1WY6A 3ASDA 1N54A 3B7RL 2CG3A 2OV8A 4JL0A 2AXVA 5FWQA 3GZSA 4G23A 3S2AA 3UT4A 3FULA 4EECA 4GPKA 1E8ZA 3CK7A 5EKQD 1HZ4A 4B94A 4U8HA 3CVWA 2XPZA 2WXOA 1PC2A 4I2ZA 3QAQA 4XI0A 2HO1A 1E8YA 4GCNA 3U4TA 2WMOA 4XI9A 5AYWD 5EX3A 4ANXA 2Q7FA 1LF8A 2WXMA 1OWLA 4Y6CA 3KD7A 4FLHA 2V4LA 4KVMA 1HFAA 1KLXA 2VSXE 2PQRA 3O4ZA 2VGXB 1HG2A 3FY4A 3FTYA 2YQ8A 3FDHA 2VYIA 3LXUX 4DI3A 3B7SA 2FF4A 3PUKA 2I6HA 4RG6A 3UT8A 1NA3A 3QB2A 4J8DA 2LO6A 3EHNA 5FQ7A 3QKYA 1S0PA 3UX4A 3ENEA 5ARFA 3ZYMA 4EQFA 2KCLA 2VTBA 3PUJA 2XPIA 4QFVA 4CDMA 3ZYKA 5ANRA 3UT7A 4DJAA 1HF8A 2AXZA 1KT1A 4KZCA 3FEYA 1H2VC 3FUDA 1TJFA 5LX8A 4CT0A 2XRYA 3B7UX 4IYPA 3DPDA 2UWJG 3MYVA 2MOWA 3CLJA 5BNWA 2YHEA 4BX9A 1IYGA 3LY8A 4ANWA 2E2EA 5FQ6A 4E6HA 3E4BA 3ESLA 5T8IA 2M63A 2KATA 1E8XA 4UWFA 4I9EA 2LAHA 3DBSA 4PS8A 2J49A 2CFUA 2PZIA 3LS8A 4PS3A 2HYZA 2WXGA 3KEZA 3D9OA 1VDYA 4FU3A 3FEXA 1EPUA 2AXUA 3BG0B 4DI4A 4HS2A 4GZ3A 4AY6A 2WXRA 4ABNA 1OWPA 2WXJA 4B89A 1E7UA 5FZRA 1U3DA 4GYWA 3I3NA 4G26A 4JW1A 4JPSA 2I1JA 1INZA 4FJYA 5G04J 3ZEFA 3APFA 4P29A 5G05J 2RG8A 3OXFA 2J4BA 4MLPA 3KS2A 5G55A 5JHAA 2QY7A 3PE4A 1ELKA 2CHWA 3AU4A 3ZHEB 4B8CB 1TEZA 3IKOB 4G11A 2R17C 2IOLA 3FTWA 4ME2A 3LCAA 4GZ5A 5JJ6A 1A17A 2Y4UA 2VGYA 4B0ZA 2LSVA 4BTBA 2WXNA 2WB2A 4CDNA 3D9JA 4L2YA 5C2YA 4EBAA 3RIBA 1Y8MA 3ML9A 2VSNA 3OTNA 3QC1A 4FLBA 4U0ZA 3PH0C 1NZNA 5ANLA 3TAXA 5AENA 4JHRA 3PE3A 3R7QA 4CCAA 3ZXSA 3MGBA 3U64A 1Z3YA 1HU3A 3ONLA 3TXNA 4DK5A 5DIZA 2NSZA 4A3VA 4F3VA 5KCMA 4XE0A 4HVBA 3ZN3A 4CEMA 2V8SE 3EJNA 5CHEE 4BX8A 1SZAA 4JEHA 2L0TB 2DIWA 3MEKA 1EF1C 3CKBA 4JA7A 4KMOA 5FZSA 2ONDA 3BEEA 2J4DA 4KXKB 1HO8A 4BT9A 5DBKA 2FO7A 1XNFA 4YVQC 2IF4A 3JUIA 3ZYLA 2IONA 3L54A 1HG5A 4N39A 2P58C 3U3WA 4JC8A 4GCOA 1UW4B 3APDA 4I2WA 4KYOB 4AIFA 3LVQE 1TJCA 3ZVVA 2YNQA 4WUYA 2JLBA 2KCVA 3VLDA 3ML8A 1IQRA 5JJ7A 1P5QA 3HVEB 4E85A 3CHOA 2E0IA 4UWGA 4UWLA 4FULA 2AW6A 5BV0A 5BW8C 1W3BA 3ZPJA 2C0MA 4GAAA 4I6JA 4N3BA 3PREA 4GA1A 4WWPA 3CSTA 3PVLA 4FA6A 1QZ2A 2VSYA 3CQCB 4I6EA 1H19A 4F53A 3SFZA 1JWFA 4I1AA 4JEUA 3LJ3A 5AIJA 4U07A 3MX3A 4J8SA 3JYSA 4BY6A 4RVBA 2DCPA 4A3TA 2WQ7A 3CK9A 2PM6A 5BPPA 1IQUA 1SZ9A 5KJMA 4HOQA 4UI9J 4FP7A 2NXPA 3HYMB 4TV3A 4A55A 3CHQA 4HLEA 1HS6A 3SF4A 3T5XA 3CHSA 4I17A 3CSFA 4EBAG 4GMJA 3QK0A 4J8EA 4CDRA 2C0LA 4CGWA 4WNEA 3CVPA 4EZLA 2GRLA 3FP3A 1UN8A 2UY1A 2IFUA 3ASFA 4LEUA 4H7XA 4AJWA 2JEKA 4Q94A 2XRZA 4LERA 3G2SA 4GA0A 4DLOA 5E76A 4AEZC 1H6KA 3GYZA 4GZ6A 4JVSA 2L6JA 2CHZA 1QNFA 5LFAA 1E8WA 3FUKA 2J07A 4YVOA 3TJPA 3L13A 2L0IA 3OXLA 5JJTA 2ILRA 3U66A 3MJWA 4C0MA 1U3CA 2XPYA 4JA9A 2IU1A 2BUGA 4UQZA 3MA5A 5CMYA 3ZFWA 3EDTB 2WQ6A 5G05C 2XCBA 3Q15A 3UMVA 4APOA 5T3RA 1Z3XA 2C2LA 2MHKA 4AOFA 3SGHA 3SHFA 5A23A 3CQGB 1DNPA 4AY5A 4APFA 4BTAA 4PS7A 1PY1A 3ONKA 1IHGA 4ACKA 4BWRA 2HR2A 4OVUA 2PL2A 1NP7A 3L17A 4JZYA 1EYHA 2V5FA 2GGFA 5LCWC 2Y3AA 4AM9A 4CT4A 3SD5A 2YHCA 3G2TA 2WXFA 4L7TA 3D3MA 3D9MA 4PH4B 5FTPA 3LKUA 1HX8A 3ZHEA 3LYAA 4NRHB 3IHYA 5G04C 4AV7A 3FTXA 4KT6B 2X6KA 3MV2B 4GB9A 4CGVA 3RO2A 4A1SA 3KAEA 1H2UA 4D10C 5KJLA 3U9WA 3PDNA 3ESKA 2CG2A 4FHJA 4ILGA 2KCKA 3NQPA 1MQSA 4MS6A 5AJLA 2I9CA 3RRUA 3CVQA 5CCLA 2GW1A 4F1SA 4XIFA 3JQ1A 3Q4AB 2J9QA 2I1KA 1N52A 4UWHA 3UQ3A 3ZW3A 1HH8A 4LUNU 3D9KA 3LY9A 2XGSA 4WAFA 3GW4A 5G2NA 3IV0A 4I1MA 3CHPA 2J08A 3GZ1A 3JQ0A 3PEVB 4LCTA 4ACLA 3QJZA 3FFLA 3CV0A 3FH8A 3PNTB 4EZJA 1HXIA 3EIJA 3AS8A 1GW6A 1WAO1 2MRIA 3B13A 2GRMA 4XKCA 3FH5A 1E96B 3O48A 2FI7A 4U63A 2OVBA 3FUNA 3NZSA 1OWNA 2CFZA 4GYOA 3RU0A 3TXMA 3ULQA 1UN9A 3HIZA 4I9CA 2XGMA 2KZTB 4L2LA 3SI5A 3NF1A 4UWKA 4MRUA 5BT1A 1WM5A 4URKA 3TG5A 3URZA 1X5BA 4I1OB 3ASGA 3I4GA 3C98A 3QARA 3R7RA 1H0AA 1BPOA 4UI9K 4NQ0A 2A4ZA 4N2SA 2XEVA 1MHQA 1L5JA 1ZU2A 2LNIA 2X6HA 5D0QD 4DPRA 5AJDA 3T8MA 2KZTA 5C1DA 3CVLA 3FU0A 4N5CA 4JXTA 4C9BB 4PUCA 3D9LA 5FQ8A 5FZQA 3RRMB 4G1TA 5FT9A 4BFRA 1FCHA 1UG3A 2QFCA 3G2UA 3LVRE 5EDSA 5KJNA 1FVHA 3SBSA 5CMWA 3JCKC 3LEWA 1SQMA 3QOUA 3QWVA 3MZLB 3S7JA 2YINA 3FUJA 4U0UA 4KVOA 1OUVA 3PEUB 4IULA 4CRWA 3TG4A 2ZU6B 3FHEA 4HORA 4Y6WA 3QWPA 4UI9C 2FBNA 5FQ4A 3HHMA 5J08A 3RRNB 3LDZA 1ELWA 4B8AA 1XGWA 4U04A 3ZIMA 5EX0A 3FUEA 2PM7A 2KC7A 4M3OA 2KM4A 3N71A 4HOUA 3FTVA 5A6CA 4FJZA 3HDXA 4FC8A 4V3IA 4WNFA 4WNDA 3ZGQA 3B7TA 3VTYA 3PS6A 4FHKA 2WXPA 3L6AA 4ATGA 5BUZA 4RSYA 3G2VA 3SZ7A 4MKTA 3TGOA 4JHKA 3BG1B 3D9IA 2Y4TA 3VLEA 3FU3A 4WNGA 1E7VA 3HVEA 3L16A 3ZYQA 3CIAA 3MKRA 3UPVA 4AVXA 2VGXA 4UQYA 1UJJA 3VTXA 1E90A 2LSUA 2WM9A 4OYSA 5FJYA 3UUXA 4G2VA 5BV1A 4TRQA 1QQEA 2VSOE 3ZRHA 5J90A 1UJKA 3PRZA 4R7LA 2X6FA 3MV3B 1EDUA 4EZKA 3FUHA 4WWOA 4A1GA 4GZCA 1B89A 3S7BA 3CHMA 2CHXA 3CGHA 3CK8A 1YA0A 3FUFA 4H7YA 2FEZA 5LCWJ 3VLFA 4KZ0A 3CVVA 3Q47B 2WXKA 3IHVA 1FVFA 4K0RA 4N3CA 2OOEA 3TL5A 5KJKA 3CKCA 1KT0A 3D9PA 4O6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VYI A;  2FF4 A;  4RG6 A;  2I6H A;  4U0S A;  1ZBP A;  3FFL A;  1NA3 A;  3CV0 A;  4J8D A;  5BW8 C;  1HXI A;  1W3B A;  3QKY A;  3AS8 A;  3ZPJ A;  2C0M A;  4N3B A;  1WAO 1;  3QWW A;  4GA1 A;  5ARF A;  3FWV A;  4RG9 A;  2KCL A;  1E96 B;  3O48 A;  1QZ2 A;  2FI7 A;  4IN3 B;  2VSY A;  3RKV A;  2XPI A;  3ULQ A;  4GYO A;  3RU0 A;  4I1A A;  4G25 A;  3OXG A;  1KT1 A;  4U07 A;  4I9C A;  2XGM A;  3JYS A;  4J8F A;  5HI7 A;  3CK9 A;  3NF1 A;  4HOS A;  3LPZ A;  5BT1 A;  1WM5 A;  3TG5 A;  5KJM A;  4HOQ A;  3URZ A;  2UWJ G;  5LCW J;  5BNW A;  3ASG A;  4UI9 J;  1ELR A;  2NC9 A;  3HYM B;  2R5S A;  1IYG A;  4HOT A;  3LY8 A;  3CVN A;  4UI9 K;  3AS5 A;  2E2E A;  4NQ0 A;  3SF4 A;  4N2S A;  3S7D A;  4I17 A;  3E4B A;  2XEV A;  4EQF A;  1ZU2 A;  2LNI A;  4J0U A;  4J8E A;  2KAT A;  5D0Q D;  2WPV A;  3K9I A;  2UY1 B;  2C0L A;  4I9E A;  4UQX A;  2PZI A;  4WNE A;  3CVP A;  4CDR A;  5C1D A;  3CVL A;  4N5C A;  3CEQ A;  2HYZ A;  3R9A B;  4BT8 A;  5FZQ A;  3FP3 A;  3Q49 B;  4G1T A;  1NA0 A;  2IFU A;  2UY1 A;  3ASF A;  3ASH A;  4H7X A;  1FCH A;  2QFC A;  5FT9 A;  5HQ8 A;  5KJN A;  4GZ3 A;  4GA0 A;  4AY6 A;  4ABN A;  2XCC A;  3GZ2 A;  3GYZ A;  3QOU A;  3QWV A;  4GZ6 A;  2L6J A;  4GYW A;  5FZR A;  3S7J A;  3RJV A;  4G26 A;  4U0U A;  1OUV A;  4BT9 A;  5G04 J;  4YVO A;  3RO3 A;  5G05 J;  3OXL A;  5JJT A;  3OXF A;  3TG4 A;  4KBQ A;  3KS2 A;  5A7D B;  5D0O D;  4HOR A;  4Y6W A;  3QWP A;  4G24 A;  4UI9 C;  2FBN A;  2XGO A;  3UPV A;  3PE4 A;  4JA9 A;  1ELW A;  2BUG A;  4UQZ A;  3MA5 A;  3S7F A;  3WXX A;  3ZFW A;  4U04 A;  3EDT B;  3ZHE B;  5EX0 A;  5G05 C;  2XCB A;  3Q15 A;  4APO A;  3LY7 A;  2C2L A;  2KC7 A;  2MHK A;  2PQN A;  2VQ2 A;  3AS4 A;  4CGW A;  5ARG A;  5CCM A;  4YND A;  4ME2 A;  3LCA A;  3N71 A;  4HOU A;  4GZ5 A;  5JJ6 A;  4N3A A;  1A17 A;  2Y4U A;  3U3W A;  2VGY A;  2LSV A;  3IEG A;  4WNF A;  4AY5 A;  4BTA A;  4BTB A;  5A6C A;  4WND A;  3RIB A;  1Y8M A;  3ZGQ A;  4U0Z A;  1IHG A;  2VSN A;  3VTY A;  3TAX A;  4W9R A;  2HR2 A;  1NZN A;  4BWR A;  2PL2 A;  3Q5M A;  4GYY A;  2V5F A;  3SZ7 A;  3TGO A;  4JHR A;  5LCW C;  2AVP A;  2DBA A;  3PE3 A;  4AM9 A;  5M72 A;  4N2Q A;  2YHC A;  4GA2 A;  2Y4T A;  4WNG A;  4LEU A;  3QDN A;  5FTP A;  2WQH A;  3MKR A;  5DIZ A;  3LKU A;  3ZHE A;  4F3V A;  2VGX A;  3LYA A;  4NRH B;  4UQY A;  3U4T A;  3ASD A;  2LSU A;  3VTX A;  5G04 C;  5FJY A;  4JL0 A;  3UUX A;  3ZN3 A;  4GPK A;  4G23 A;  4G2V A;  3MV2 B;  3S7B A;  5CHE E;  1QQE A;  4CGV A;  3CK7 A;  5EKQ D;  5CCL A;  1HZ4 A;  3RO2 A;  4A1S A;  4B94 A;  3KAE A;  5KJL A;  3MEK A;  3PDN A;  3CKB A;  3MV3 B;  3ESK A;  4JA7 A;  5FZS A;  2OND A;  3BEE A;  4KXK B;  1PC2 A;  4I2Z A;  5DBK A;  2FO7 A;  1B89 A;  1XNF A;  2IF4 A;  2HO1 A;  2KCK A;  4GCN A;  4XI0 A;  4H7Y A;  4YVQ C;  1YA0 A;  2P58 C;  3CK8 A;  3CVQ A;  2FEZ A;  2GW1 A;  4N39 A;  4GCO A;  4I2W A;  4KYO B;  4XIF A;  4XI9 A;  5EX3 A;  5AYW D;  2Q7F A;  1TJC A;  3Q47 B;  3Q4A B;  2J9Q A;  4AIF A;  4N3C A;  2OOE A;  4WUY A;  2JLB A;  3KD7 A;  2KCV A;  4Y6C A;  3UQ3 A;  5JJ7 A;  1HH8 A;  1P5Q A;  3GZ1 A;  3LY9 A;  5KJK A;  1KLX A;  2XGS A;  3CKC A;  2PQR A;  1KT0 A;  3GW4 A;  2VGX B;  4O6F A;  2YQ8 A; 
#chains in the Genus database with same CATH topology
 4TUU A;  1H6O A;  4DX5 D;  2X3M A;  3FWV A;  4F6R D;  5D2M C;  2A5E A;  3CR3 A;  5B1A E;  1JUQ A;  5ENN A;  2WXQ A;  4G25 A;  4RQI A;  3NB2 A;  1JPL A;  2BKK B;  3S7D A;  3QNK A;  2L9B A;  4EPZ A;  3SNX A;  2WPV A;  2WVI A;  2FO1 E;  1H6P A;  2VTB B;  5LP0 A;  3Q49 B;  4NUR A;  4JB8 P;  3NOG D;  2V5Q C;  2WMN A;  3GZ2 A;  3PNL B;  3I4R B;  4ANV A;  4L23 A;  5D0O D;  3FTU A;  2XGO A;  4Q69 A;  3WXX A;  5JHB A;  2B0O E;  3EHM A;  2VQ2 A;  3FTS A;  1V54 E;  4BES A;  3DXK G;  2VJ8 A;  4C0E A;  1DC2 A;  3L22 A;  1SVX A;  4IRU A;  2AVP A;  4N2Q A;  5M72 A;  2J09 A;  4GA2 A;  3APC A;  2R2L A;  2HE0 A;  3QDN A;  1WY6 A;  3B7R L;  3UT4 A;  4GPK A;  3ZU7 B;  5HS0 A;  3HRA A;  1KPS B;  5CEA A;  2ZXW E;  1LF8 A;  3X2Q E;  1OWL A;  4Y6C A;  1TNB A;  4Z68 A;  2V4L A;  1HFA A;  3O4Z A;  3FTY A;  2VYI A;  3LXU X;  4RG6 A;  4J8D A;  1TN7 A;  1K1A A;  3PUJ A;  2XPI A;  4CDM A;  4DJA A;  4O1P A;  4CT0 A;  2XRY A;  2ZGD A;  2UWJ G;  3DPD A;  2MOW A;  3CLJ A;  5BNW A;  2YHE A;  2GRP B;  5CBN A;  1BI7 B;  3LY8 A;  5FQ6 A;  4E6H A;  1MX2 A;  5T8I A;  2PZI A;  3D9O A;  2AXU A;  3C3R A;  4GZ3 A;  3WG7 E;  4B89 A;  5FZR A;  4GYW A;  4G26 A;  4JW1 A;  5G04 J;  3J5Q B;  3AG4 E;  4P29 A;  4MLP A;  2QY7 A;  1ELK A;  3AU4 A;  4B8C B;  2P9I G;  3IKO B;  2P9N G;  2IOL A;  3KEA A;  1TNU A;  4EHM A;  2KXP C;  1Y8M A;  5FIN A;  3UKU G;  2LXM A;  2IEJ A;  3PE3 A;  3R7Q A;  1HU3 A;  2P2C P;  4DK5 A;  4F3V A;  5KCM A;  4XE0 A;  5CHE E;  2OEV A;  5AQB A;  4JA7 A;  4KMO A;  3BEE A;  1HO8 A;  4BT9 A;  2FO7 A;  2ION A;  1HG5 A;  3U3W A;  4KYO B;  4AIF A;  4WUY A;  1P5Q A;  1OCO E;  2AW6 A;  5BV0 A;  1W3B A;  5CBO A;  3CST A;  2F8Y A;  3PVL A;  2QC9 A;  4J8S A;  2J8S D;  4RVB A;  2WQ7 A;  4A3T A;  4TXQ A;  3LJN A;  4HOQ A;  2DYS E;  4UI9 J;  3HYM B;  3UIN C;  3CHS A;  4EBA G;  4CDR A;  4CGW A;  4LNB A;  5CEC B;  3SFY A;  4LEU A;  1UN8 A;  2XRZ A;  2IFU A;  4H7X A;  3G2S A;  4AEZ C;  3GYZ A;  4GZ6 A;  1AWC B;  2CHZ A;  1QNF A;  4U8V D;  3L13 A;  4C0M A;  3DSW A;  5CMY A;  3Q15 A;  3Q7F A;  1Z3X A;  2C2L A;  4AOF A;  3SGH A;  1N0R A;  4PS7 A;  2R05 A;  4ACK A;  2HR2 A;  5AQ7 A;  3TWS A;  1EYH A;  3SQV A;  2YHC A;  5FTP A;  1HX8 A;  2X6K A;  3E33 A;  5B3S E;  3RO2 A;  5KJL A;  3E37 A;  4LSZ E;  2XEE A;  2KCK A;  2LUH A;  3NQP A;  5AJL A;  5CCL A;  2I9C A;  3Q78 A;  3C72 A;  4UWH A;  1N52 A;  3UQ3 A;  3HXE A;  3D9K A;  2XGS A;  4WAF A;  1MZC A;  3GW4 A;  5G2N A;  3PEV B;  3V2O A;  4XKC A;  1E96 B;  2P9P G;  4GTP A;  3ULQ A;  4UUC A;  1OWN A;  4U7E B;  3V2X A;  4MRU A;  4HB5 A;  3URZ A;  3ASG A;  3C98 A;  3R7R A;  1BPO A;  2XEV A;  1O1S A;  1ZU2 A;  2X6H A;  1N4S A;  3D9L A;  5FZQ A;  4G1T A;  5FT9 A;  3DPY A;  3S7J A;  2OCC E;  1OUV A;  2ZU6 B;  4HOR A;  3QWP A;  1NI1 A;  2FBN A;  3RRN B;  1ELW A;  3DWL G;  2DZN A;  5EX0 A;  1N0Q A;  3FTV A;  4GTM A;  4WND A;  1N4P A;  2RFA A;  3ZGQ A;  3VTY A;  2WXP A;  5CER B;  3TGO A;  4MKT A;  4OAV B;  3D9I A;  3MKR A;  4G2V A;  3ZKJ A;  1QQE A;  3PRZ A;  2GRN B;  4EZK A;  3HG0 D;  2CHX A;  4H7Y A;  3CK8 A;  4KZ0 A;  3CVV A;  3Q47 B;  2WXK A;  1FVF A;  5KJK A;  4C48 B;  1KT0 A;  2X6J A;  4U0S A;  4HRM B;  2IO2 C;  2EIJ E;  3QWW A;  2VGE A;  4ZFH A;  3RKV A;  3FH7 A;  1Y6I A;  4WWN A;  3G2W A;  3PZ1 A;  5HI7 A;  3FUM A;  2X6I A;  2QZA A;  2NC9 A;  4HRN A;  2IJG X;  1K3Z D;  3AS5 A;  3RK6 A;  2RFM A;  3K9I A;  2UY1 B;  2BTD A;  3ASN E;  3CEQ A;  3ASH A;  5HQ8 A;  4HFG A;  3C5R A;  4OVV A;  1Z6T A;  4J6I A;  5T4Y A;  3AU5 A;  5H7P A;  3V31 A;  2WXI A;  4TXR A;  2A5U A;  5B1B E;  4GTQ A;  4AXH A;  2PQN A;  1ZB1 A;  3IEG A;  3MKQ B;  4CZ2 D;  4F7A A;  4ILH B;  4GPM A;  1PAQ A;  4XZ4 A;  4FAD A;  1AP7 A;  2IQC A;  5IY5 E;  3MKQ A;  1N54 A;  3HXB A;  2OV8 A;  4BSZ B;  3CK7 A;  1HZ4 A;  3CVW A;  2ETB A;  4B93 B;  2WXO A;  1PC2 A;  4GCN A;  2WMO A;  2WXM A;  5CRV A;  1KLX A;  4G8L A;  2PQR A;  3FDH A;  2FF4 A;  3PUK A;  1NA3 A;  3QB2 A;  2LO6 A;  3EHN A;  5AQA A;  3ZYM A;  2VTB A;  4QFV A;  1O5M A;  3ZYK A;  1NL4 A;  5AAR A;  1KT1 A;  3DSS A;  3FEY A;  4HNA D;  4IYP A;  3E4B A;  1D8E A;  3ZNG A;  1E8X A;  4HRL A;  2WXG A;  3SFX A;  1EPU A;  3BG0 B;  4HS2 A;  2XZD G;  1FT2 A;  1KZO A;  1E7U A;  1U3D A;  1INZ A;  4FJY A;  5G05 J;  2RG8 A;  2J4B A;  3DSU A;  2H6F A;  3PE4 A;  2CHW A;  3DSV A;  1DCQ A;  5EN5 D;  3FTW A;  3LCA A;  1A17 A;  2VGY A;  2WXN A;  4L2Y A;  3RIB A;  4U0Z A;  2VSN A;  3QC1 A;  5AEN A;  4K5A B;  1BLX B;  1Q2Z A;  3MGB A;  1Z3Y A;  3TXN A;  5DIZ A;  3PZ3 A;  4A3V A;  4X8Q A;  4CEM A;  2V8S E;  3C3O A;  1EF1 C;  5FZS A;  2DZO A;  1N94 A;  2J4D A;  5EIL A;  1XNF A;  3JUI A;  2AJA A;  1QBQ A;  3LVQ E;  5JJ7 A;  1IQR A;  1LTX A;  1TNZ A;  4UWL A;  4N5Q A;  5BW8 C;  4WWP A;  2VSY A;  4I6E A;  1H19 A;  5D66 A;  3LJ3 A;  1TNO A;  4U07 A;  2IY0 C;  3JYS A;  3CK9 A;  4DX6 D;  1SZ9 A;  4FP7 A;  1YYH A;  3CHQ A;  3EHQ A;  4GTV A;  1HS6 A;  3T5X A;  4I17 A;  3CSF A;  4J8E A;  1MX6 A;  3T9K A;  5KWD A;  3B95 A;  3DST A;  3ASF A;  3HXF A;  4LER A;  4DLO A;  3ZXP A;  4JVS A;  4K5C A;  4YVO A;  2L0I A;  3OXL A;  5ENQ D;  2ILR A;  4UQZ A;  5T3R A;  4AY5 A;  4DX7 D;  1IHG A;  4BWR A;  1NP7 A;  4JZY A;  5LCW C;  2H6I A;  3NAW A;  4AM9 A;  4L7T A;  3G2T A;  2WXF A;  3LKU A;  3LYA A;  3UIO C;  2GRO B;  1N11 A;  4CGV A;  4TUM A;  5HRY A;  1WG0 A;  4FHJ A;  4ILG A;  4MS6 A;  1QYM A;  2I1K A;  1HH8 A;  4LUN U;  3Q7A A;  1UOH A;  5ENO D;  3FH8 A;  4EZJ A;  3PNT B;  4GMR A;  1HXI A;  3AS8 A;  1WAO 1;  3UM1 A;  3NZS A;  4GYO A;  3TXM A;  1UN9 A;  4HI8 A;  2KZT B;  4L9P A;  4L2L A;  3SI5 A;  4JD2 G;  4UWK A;  5BT1 A;  1WM5 A;  3TG5 A;  3I4G A;  4UI9 K;  2A4Z A;  2KZT A;  4PUC A;  1N95 A;  5FQ8 A;  5EDS A;  1UG3 A;  3G2U A;  1S64 A;  2QYJ A;  3SBS A;  3PZ2 A;  3QWV A;  3MZL B;  3FUJ A;  3W9F A;  4KVO A;  3C3Q A;  4O60 A;  4CRW A;  1OT8 A;  2XEH A;  4UI9 C;  3LDZ A;  3ZIM A;  3TWT A;  4GTO A;  2KC7 A;  1OY3 D;  4FJZ A;  3HDX A;  4FC8 A;  4V3I A;  3PS6 A;  4XEI G;  5AAO A;  3L6A A;  4ATG A;  3SZ7 A;  2Y4T A;  3VLE A;  1TNY A;  2Y1L E;  3CIA A;  4LNG A;  3UPV A;  4AVX A;  1E90 A;  2WM9 A;  3RAU A;  2VSO E;  3D9H A;  1KZP A;  2X6F A;  3MV3 B;  1EDU A;  3FUH A;  4A1G A;  3KSL A;  1YA0 A;  2FEZ A;  3HXC A;  2ZGG A;  3E30 A;  3VLF A;  4K0R A;  3TL5 A;  3CKC A;  1OXJ A;  4O6F A;  4XKB A;  4PDX A;  5HKP A;  1DVP A;  3L08 A;  5ITZ F;  3ZUV B;  1BD8 A;  3FU6 A;  4L1B A;  1JWG A;  4J8F A;  2ETA A;  2OVF A;  1Z5S C;  2BF0 X;  4HQD A;  2R5S A;  3P2B A;  4GML A;  5BXU A;  3PZD A;  4J0U A;  4UQX A;  4HOT A;  3B7B A;  3CVU A;  3FTZ A;  2LAI A;  1N4R A;  3R9A B;  4BT8 A;  3IBE A;  1NA0 A;  3EIQ C;  2V0P A;  2XCC A;  4JHJ A;  4K03 A;  1FT1 A;  1HE8 A;  3RJV A;  4AP2 A;  5E75 A;  3RO3 A;  3EHR A;  2RD0 A;  5A7D B;  2DYR E;  2R59 A;  3T8K A;  2EQX A;  4G24 A;  3S7F A;  4ANU A;  3FU5 A;  3UM0 A;  3AS4 A;  2FUL A;  2HM8 A;  5ARG A;  3AG1 E;  3MCX A;  3OAW A;  3P1U A;  4I6G A;  2DBA A;  4HXI A;  1H2T C;  3CVX A;  3NZU A;  4U96 D;  3TWW A;  3CHR A;  3ASD A;  2CG3 A;  2ZIR A;  4JL0 A;  5FWQ A;  4A63 B;  3GZS A;  3Q73 A;  3FUL A;  4B94 A;  3BQO A;  4NIK A;  2EIL E;  3JXI A;  3QAQ A;  2HO1 A;  1E8Y A;  3U4T A;  4XI9 A;  2F0Y A;  5EX3 A;  4FLH A;  2P9K G;  5EYP F;  1HG2 A;  2VGX B;  3FY4 A;  3B7S A;  2I6H A;  3UT8 A;  4BEP A;  2F8X K;  5ARF A;  2KCL A;  3UT7 A;  4KZC A;  2R03 A;  1H2V C;  5LX8 A;  3B7U X;  1MJ0 A;  2MYO A;  4BX9 A;  1IYG A;  4GTT A;  4ANW A;  3ESL A;  2M63 A;  1OCR E;  2KAT A;  4UWF A;  4I9E A;  4PS8 A;  1X81 A;  2HYZ A;  4FU3 A;  3FEX A;  4DI4 A;  1IHB A;  4ABN A;  1OWP A;  3I3N A;  4DUI A;  2H6G A;  4JPS A;  2I1J A;  3Q9U C;  3ZEF A;  3APF A;  5AN8 A;  3KS2 A;  1N4Q A;  5JHA A;  3UM3 A;  3ZHE B;  3DSX A;  1TEZ A;  4G11 A;  2R17 C;  4ME2 A;  5JJ6 A;  4B0Z A;  3D9J A;  5C2Y A;  4EBA A;  3ML9 A;  4FLB A;  3PH0 C;  1NZN A;  4ZHB A;  4JHR A;  3L82 A;  1D8D A;  4K5B A;  4BX8 A;  1SZA A;  2QYU A;  2OND A;  2XS1 A;  5DBK A;  3ZYL A;  3L54 A;  4N39 A;  2P58 C;  2NYJ A;  4JC8 A;  1UW4 B;  4LNU D;  1TJC A;  3ZVV A;  2YNQ A;  3ML8 A;  3NOC D;  3HVE B;  2E0I A;  4UWG A;  3ABK E;  2JAB A;  3W9G A;  2C0M A;  4GAA A;  4I6J A;  1QZ2 A;  3CQC B;  4F53 A;  4I1A A;  4JEU A;  3L9T A;  5AIJ A;  3UXG A;  3MX3 A;  4U8Y D;  1JCQ A;  2PM6 A;  5BPP A;  1V55 E;  5KJM A;  2NXP A;  5KBA A;  4GMJ A;  1YMP A;  2C0L A;  4EZL A;  4BET A;  4AJW A;  3FP3 A;  2UY1 A;  4Q94 A;  4GA0 A;  2GRR B;  5E76 A;  1H6K A;  5ENT D;  1BU9 A;  2IO3 C;  5LFA A;  1E8W A;  3FUK A;  5JJT A;  3HXD A;  4GTS A;  3MJW A;  1U3C A;  2XPY A;  4JA9 A;  2IU1 A;  2BUG A;  3ZFW A;  3EDT B;  5G05 C;  2XCB A;  2XEN A;  5A23 A;  1DNP A;  4APF A;  1OCZ E;  4BTA A;  1PY1 A;  3ONK A;  4OVU A;  2PL2 A;  3L17 A;  2Y3A A;  4CT4 A;  2DVW A;  3D9M A;  4PH4 B;  3ZHE A;  4NRH B;  5G04 C;  4KT6 B;  3F6Q A;  4A1S A;  3KAE A;  1H2U A;  3UTM A;  3AAA C;  3PDN A;  3ESK A;  5JA4 D;  2CG2 A;  2ZIS A;  4G8K A;  2RKK A;  2GW1 A;  4XIF A;  3JQ1 A;  3PZ4 A;  3ZW3 A;  3LY9 A;  3IV0 A;  3CHP A;  4ACL A;  3QJZ A;  1SA5 A;  1GW6 A;  3B13 A;  2GRM A;  3O48 A;  2FI7 A;  2OVB A;  3FUN A;  1OCC E;  3ISM C;  3HIZ A;  2Y69 E;  5BXO A;  3NF1 A;  4URK A;  1H0A A;  3TWR A;  4N2S A;  2LNI A;  3ABL E;  5D0Q D;  4DPR A;  1MYO A;  3UIP C;  5AJD A;  4LG6 A;  3T8M A;  3CVL A;  4JXT A;  4C9B B;  3RRM B;  2QFC A;  3LVR E;  5CMW A;  3JCK C;  3LEW A;  2DWZ A;  2YIN A;  4YDY A;  4IUL A;  2P9S G;  1N9A A;  3TG4 A;  3FHE A;  1SW6 A;  3HHM A;  4B8A A;  2BED A;  4U04 A;  3FUE A;  1RW2 A;  4M3O A;  5CED B;  4HOU A;  2KBX A;  2LXL A;  3B7T A;  4FHK A;  2P9U G;  3G2V A;  4JHK A;  3FU3 A;  4WNG A;  1E7V A;  3HVE A;  2H6H A;  2VGX A;  4UQY A;  1UJJ A;  2LSU A;  4OYS A;  3UUX A;  5BV1 A;  4TRQ A;  1IKN D;  1UJK A;  4R7L A;  4WWO A;  4GZC A;  1B89 A;  3R9M A;  3S7B A;  2XZT G;  3IHV A;  3J5P A;  3D9P A;  1ZBP A;  2PNN A;  3Q75 A;  2EIK E;  1OWO A;  4RG9 A;  4DLQ A;  4IN3 B;  2X38 A;  5EID A;  3OXG A;  4M7C A;  1S63 A;  4HOS A;  2AWI A;  3LPZ A;  4XX5 A;  1ELR A;  3D9N A;  3RSE G;  1S70 B;  3CVN A;  2WXL A;  2WXH A;  4BSX A;  3T5V A;  4DX1 A;  4J8Y A;  2V4H C;  5CCM A;  2XHE A;  1K8K G;  3SO8 A;  2I2O A;  1LD7 A;  3E34 A;  3FUI A;  1OWM A;  3SBT B;  4KBQ A;  4Q96 A;  4HLL A;  4GZD A;  2EIN E;  3CVY A;  3LY7 A;  4I43 A;  4YND A;  3I5P A;  4GU5 A;  4N3A A;  2IOS A;  4W9R A;  4NAC A;  3BU8 A;  3Q5M A;  4GYY A;  3TWQ A;  5LOZ A;  4ILI A;  3E32 A;  5JMN D;  3ULY A;  2XQ0 A;  4LRZ A;  2WQH A;  3S2A A;  2AXV A;  4G23 A;  4EEC A;  1E8Z A;  5EKQ D;  1WDY A;  1JCR A;  3JXJ A;  4HI9 A;  4U8H A;  2XPZ A;  4I2Z A;  4XI0 A;  5AYW D;  4ANX A;  2Q7F A;  1SA4 A;  4GTR A;  5KNH D;  3KD7 A;  2F37 A;  4KVM A;  2VSX E;  2YQ8 A;  4DI3 A;  2Y0B G;  1IXV A;  5FQ7 A;  3QKY A;  1S0P A;  3UX4 A;  3ENE A;  4EQF A;  5ANR A;  1DCE A;  3BUA A;  1HF8 A;  2AXZ A;  3ULE G;  3FUD A;  1TJF A;  3MYV A;  1TR4 A;  1RZ4 A;  4MBG A;  2E2E A;  4RLY A;  5EIB E;  3ABM E;  4BER A;  2LAH A;  3DBS A;  2J49 A;  2CFU A;  3LS8 A;  4PS3 A;  3KEZ A;  1VDY A;  4AY6 A;  2WXR A;  2WXJ A;  5AQ9 A;  3SY2 A;  3OXF A;  5G55 A;  4DRX E;  3IXE A;  5KNG A;  1YCS B;  3Q79 A;  3Q9N C;  1TYQ G;  4GZ5 A;  2Y4U A;  2LSV A;  4BTB A;  2WB2 A;  4CDN A;  3OTN A;  3TAX A;  5ANL A;  3TWU A;  1JCS A;  4CCA A;  3ZXS A;  3U64 A;  4O1O A;  3ONL A;  2GRQ B;  2NSZ A;  4HVB A;  3ZN3 A;  3EJN A;  4JEH A;  2L0T B;  2DIW A;  3MEK A;  3CKB A;  4KXK B;  1U2V G;  4YVQ C;  2IF4 A;  4GCO A;  3APD A;  4I2W A;  2JLB A;  2KCV A;  3VLD A;  1K1B A;  4E85 A;  3CHO A;  3AG2 E;  4FUL A;  3EU5 A;  3ZPJ A;  4N3B A;  3PRE A;  4GA1 A;  4QQI A;  4FA6 A;  3SFZ A;  1JWF A;  4BY6 A;  2DCP A;  3TWV A;  1IQU A;  5ENS D;  5EYL A;  3V30 A;  1TN8 A;  1MX4 A;  4TV3 A;  4A55 A;  4YDE A;  4HLE A;  3ASO E;  2BKG A;  3DRA A;  3SF4 A;  3QK0 A;  1FPP A;  4WNE A;  3CVP A;  2GRL A;  3UI2 A;  2JEK A;  4F1P A;  4TXP A;  5CRU A;  3DEP A;  2L6J A;  2J07 A;  3TJP A;  3U66 A;  1O1T A;  3MA5 A;  3V79 K;  1NFI E;  2WQ6 A;  4APO A;  3UMV A;  2MHK A;  2OEW A;  5ENP D;  3SHF A;  3CQG B;  4HBD A;  3AG3 E;  2V5F A;  2GGF A;  3SD5 A;  2P9L G;  3D3M A;  2XS8 A;  3IHY A;  4J7W A;  4AV7 A;  3FTX A;  4YDO A;  3MV2 B;  4GB9 A;  2ETC A;  1O1R A;  3DXM G;  4D10 C;  3U9W A;  5FIO A;  1MQS A;  3RRU A;  3CVQ A;  4F1S A;  3Q4A B;  2J9Q A;  1A5E A;  4I1M A;  2J08 A;  3GZ1 A;  3JQ0 A;  4LCT A;  3FFL A;  3CV0 A;  3EIJ A;  3KSQ A;  1BI8 B;  1TN6 A;  2MRI A;  3FH5 A;  4U63 A;  2CFZ A;  3RU0 A;  3UM2 A;  4I9C A;  2XGM A;  1D9S A;  1LD8 A;  1X5B A;  4I1O B;  3QAR A;  3NBN B;  5ENR D;  4NQ0 A;  1MHQ A;  1L5J A;  5C1D A;  3FU0 A;  4N5C A;  4BFR A;  5KJN A;  1FCH A;  4U95 D;  3JUE A;  1FVH A;  1SQM A;  2EIM E;  3QOU A;  4U0U A;  4OAU C;  3DEO A;  3PEU B;  4DX2 A;  4Y6W A;  5FQ4 A;  5J08 A;  1XGW A;  2PM7 A;  2B6C A;  4YDW A;  2R02 A;  2KM4 A;  3N71 A;  5A6C A;  4WNF A;  4CYM D;  5BUZ A;  4RSY A;  3UKR G;  3BG1 B;  3AJI A;  3L16 A;  3EU9 A;  3ZYQ A;  3TWX A;  3VTX A;  4ATZ D;  5FJY A;  3ZRH A;  5J90 A;  2L6B A;  3CHM A;  3CGH A;  3FUF A;  5LCW J;  4N3C A;  2OOE A;  1G3N B;  3EUV A; 
#chains in the Genus database with same CATH homology
 4TUU A;  4PDX A;  4XKB A;  2X6J A;  4U0S A;  1ZBP A;  1DVP A;  3L08 A;  3QWW A;  2X3M A;  1OWO A;  3FWV A;  4RG9 A;  4DLQ A;  4IN3 B;  2X38 A;  3FH7 A;  3RKV A;  1Y6I A;  3CR3 A;  1JUQ A;  3FU6 A;  5ENN A;  4L1B A;  2WXQ A;  4WWN A;  3G2W A;  4G25 A;  3OXG A;  1JWG A;  4J8F A;  5HI7 A;  4HOS A;  2AWI A;  3LPZ A;  2OVF A;  4XX5 A;  2BF0 X;  3FUM A;  2X6I A;  1ELR A;  2NC9 A;  2R5S A;  3D9N A;  2IJG X;  3CVN A;  3P2B A;  1JPL A;  2WXL A;  2WXH A;  3AS5 A;  4GML A;  3RK6 A;  3S7D A;  3PZD A;  3QNK A;  2L9B A;  4BSX A;  3T5V A;  4J0U A;  4EPZ A;  3SNX A;  2WPV A;  2WVI A;  3K9I A;  2UY1 B;  4UQX A;  4HOT A;  3CVU A;  2BTD A;  3FTZ A;  3CEQ A;  2LAI A;  3R9A B;  2VTB B;  4BT8 A;  3IBE A;  5LP0 A;  3Q49 B;  5CCM A;  1NA0 A;  3ASH A;  2XHE A;  4NUR A;  4HFG A;  3EIQ C;  5HQ8 A;  2V0P A;  2XCC A;  4OVV A;  2I2O A;  4JHJ A;  4K03 A;  1Z6T A;  2WMN A;  3GZ2 A;  1HE8 A;  3PNL B;  3RJV A;  4AP2 A;  3FUI A;  4J6I A;  5E75 A;  3I4R B;  1OWM A;  3AU5 A;  5T4Y A;  3RO3 A;  3SBT B;  2RD0 A;  4ANV A;  2WXI A;  4KBQ A;  4Q96 A;  4L23 A;  5D0O D;  5A7D B;  2R59 A;  3FTU A;  2EQX A;  4G24 A;  2XGO A;  2A5U A;  4Q69 A;  3WXX A;  3S7F A;  5JHB A;  4GZD A;  4ANU A;  3FU5 A;  3EHM A;  3CVY A;  3LY7 A;  3AS4 A;  2FUL A;  2PQN A;  4AXH A;  2HM8 A;  2VQ2 A;  3FTS A;  5ARG A;  4I43 A;  4YND A;  3I5P A;  4GU5 A;  4N3A A;  3IEG A;  3MKQ B;  2VJ8 A;  4C0E A;  2IOS A;  3MCX A;  4W9R A;  3L22 A;  3OAW A;  4NAC A;  3Q5M A;  4F7A A;  4GYY A;  4ILH B;  1PAQ A;  4IRU A;  2AVP A;  3P1U A;  4I6G A;  2DBA A;  4ILI A;  5LOZ A;  5M72 A;  4N2Q A;  2J09 A;  4XZ4 A;  4GA2 A;  4HXI A;  2XQ0 A;  1H2T C;  4FAD A;  3APC A;  4LRZ A;  3CVX A;  3NZU A;  2IQC A;  3QDN A;  2WQH A;  3MKQ A;  3CHR A;  1WY6 A;  3ASD A;  1N54 A;  3B7R L;  2CG3 A;  2OV8 A;  4JL0 A;  2AXV A;  5FWQ A;  3GZS A;  4G23 A;  3S2A A;  3UT4 A;  3FUL A;  4EEC A;  4GPK A;  1E8Z A;  3CK7 A;  5EKQ D;  1HZ4 A;  4B94 A;  4U8H A;  3CVW A;  2XPZ A;  2WXO A;  1PC2 A;  4I2Z A;  3QAQ A;  4XI0 A;  2HO1 A;  1E8Y A;  4GCN A;  3U4T A;  2WMO A;  4XI9 A;  5AYW D;  5EX3 A;  4ANX A;  2Q7F A;  1LF8 A;  2WXM A;  1OWL A;  4Y6C A;  3KD7 A;  4FLH A;  2V4L A;  4KVM A;  1HFA A;  1KLX A;  2VSX E;  2PQR A;  3O4Z A;  2VGX B;  1HG2 A;  3FY4 A;  3FTY A;  2YQ8 A;  3FDH A;  2VYI A;  3LXU X;  4DI3 A;  3B7S A;  2FF4 A;  3PUK A;  2I6H A;  4RG6 A;  3UT8 A;  1NA3 A;  3QB2 A;  4J8D A;  2LO6 A;  3EHN A;  5FQ7 A;  3QKY A;  1S0P A;  3UX4 A;  3ENE A;  5ARF A;  3ZYM A;  4EQF A;  2KCL A;  2VTB A;  3PUJ A;  2XPI A;  4QFV A;  4CDM A;  3ZYK A;  5ANR A;  3UT7 A;  4DJA A;  1HF8 A;  2AXZ A;  1KT1 A;  4KZC A;  3FEY A;  1H2V C;  3FUD A;  1TJF A;  5LX8 A;  4CT0 A;  2XRY A;  3B7U X;  4IYP A;  3DPD A;  2UWJ G;  3MYV A;  2MOW A;  3CLJ A;  5BNW A;  2YHE A;  4BX9 A;  1IYG A;  3LY8 A;  4ANW A;  2E2E A;  5FQ6 A;  4E6H A;  3E4B A;  3ESL A;  5T8I A;  2M63 A;  2KAT A;  1E8X A;  4UWF A;  4I9E A;  2LAH A;  3DBS A;  4PS8 A;  2J49 A;  2CFU A;  2PZI A;  3LS8 A;  4PS3 A;  2HYZ A;  2WXG A;  3KEZ A;  3D9O A;  1VDY A;  4FU3 A;  3FEX A;  1EPU A;  2AXU A;  3BG0 B;  4DI4 A;  4HS2 A;  4GZ3 A;  4AY6 A;  2WXR A;  4ABN A;  1OWP A;  2WXJ A;  4B89 A;  1E7U A;  5FZR A;  1U3D A;  4GYW A;  3I3N A;  4G26 A;  4JW1 A;  4JPS A;  2I1J A;  1INZ A;  4FJY A;  5G04 J;  3ZEF A;  3APF A;  4P29 A;  5G05 J;  2RG8 A;  3OXF A;  2J4B A;  4MLP A;  3KS2 A;  5G55 A;  5JHA A;  2QY7 A;  3PE4 A;  1ELK A;  2CHW A;  3AU4 A;  3ZHE B;  4B8C B;  1TEZ A;  3IKO B;  4G11 A;  2R17 C;  2IOL A;  3FTW A;  4ME2 A;  3LCA A;  4GZ5 A;  5JJ6 A;  1A17 A;  2Y4U A;  2VGY A;  4B0Z A;  2LSV A;  4BTB A;  2WXN A;  2WB2 A;  4CDN A;  3D9J A;  4L2Y A;  5C2Y A;  4EBA A;  3RIB A;  1Y8M A;  3ML9 A;  2VSN A;  3OTN A;  3QC1 A;  4FLB A;  4U0Z A;  3PH0 C;  1NZN A;  5ANL A;  3TAX A;  5AEN A;  4JHR A;  3PE3 A;  3R7Q A;  4CCA A;  3ZXS A;  3MGB A;  3U64 A;  1Z3Y A;  1HU3 A;  3ONL A;  3TXN A;  4DK5 A;  5DIZ A;  2NSZ A;  4A3V A;  4F3V A;  5KCM A;  4XE0 A;  4HVB A;  3ZN3 A;  4CEM A;  2V8S E;  3EJN A;  5CHE E;  4BX8 A;  1SZA A;  4JEH A;  2L0T B;  2DIW A;  3MEK A;  1EF1 C;  3CKB A;  4JA7 A;  4KMO A;  5FZS A;  2OND A;  3BEE A;  2J4D A;  4KXK B;  1HO8 A;  4BT9 A;  5DBK A;  2FO7 A;  1XNF A;  4YVQ C;  2IF4 A;  3JUI A;  3ZYL A;  2ION A;  3L54 A;  1HG5 A;  4N39 A;  2P58 C;  3U3W A;  4JC8 A;  4GCO A;  1UW4 B;  3APD A;  4I2W A;  4KYO B;  4AIF A;  3LVQ E;  1TJC A;  3ZVV A;  2YNQ A;  4WUY A;  2JLB A;  2KCV A;  3VLD A;  3ML8 A;  1IQR A;  5JJ7 A;  1P5Q A;  3HVE B;  4E85 A;  3CHO A;  2E0I A;  4UWG A;  4UWL A;  4FUL A;  2AW6 A;  5BV0 A;  5BW8 C;  1W3B A;  3ZPJ A;  2C0M A;  4GAA A;  4I6J A;  4N3B A;  3PRE A;  4GA1 A;  4WWP A;  3CST A;  3PVL A;  4FA6 A;  1QZ2 A;  2VSY A;  3CQC B;  4I6E A;  1H19 A;  4F53 A;  3SFZ A;  1JWF A;  4I1A A;  4JEU A;  3LJ3 A;  5AIJ A;  4U07 A;  3MX3 A;  4J8S A;  3JYS A;  4BY6 A;  4RVB A;  2DCP A;  4A3T A;  2WQ7 A;  3CK9 A;  2PM6 A;  5BPP A;  1IQU A;  1SZ9 A;  5KJM A;  4HOQ A;  4UI9 J;  4FP7 A;  2NXP A;  3HYM B;  4TV3 A;  4A55 A;  3CHQ A;  4HLE A;  1HS6 A;  3SF4 A;  3T5X A;  3CHS A;  4I17 A;  3CSF A;  4EBA G;  4GMJ A;  3QK0 A;  4J8E A;  4CDR A;  2C0L A;  4CGW A;  4WNE A;  3CVP A;  4EZL A;  2GRL A;  3FP3 A;  1UN8 A;  2UY1 A;  2IFU A;  3ASF A;  4LEU A;  4H7X A;  4AJW A;  2JEK A;  4Q94 A;  2XRZ A;  4LER A;  3G2S A;  4GA0 A;  4DLO A;  5E76 A;  4AEZ C;  1H6K A;  3GYZ A;  4GZ6 A;  4JVS A;  2L6J A;  2CHZ A;  1QNF A;  5LFA A;  1E8W A;  3FUK A;  2J07 A;  4YVO A;  3TJP A;  3L13 A;  2L0I A;  3OXL A;  5JJT A;  2ILR A;  3U66 A;  3MJW A;  4C0M A;  1U3C A;  2XPY A;  4JA9 A;  2IU1 A;  2BUG A;  4UQZ A;  3MA5 A;  5CMY A;  3ZFW A;  3EDT B;  2WQ6 A;  5G05 C;  2XCB A;  3Q15 A;  3UMV A;  4APO A;  5T3R A;  1Z3X A;  2C2L A;  2MHK A;  4AOF A;  3SGH A;  3SHF A;  5A23 A;  3CQG B;  1DNP A;  4AY5 A;  4APF A;  4BTA A;  4PS7 A;  1PY1 A;  3ONK A;  1IHG A;  4ACK A;  4BWR A;  2HR2 A;  4OVU A;  2PL2 A;  1NP7 A;  3L17 A;  4JZY A;  1EYH A;  2V5F A;  2GGF A;  5LCW C;  2Y3A A;  4AM9 A;  4CT4 A;  3SD5 A;  2YHC A;  3G2T A;  2WXF A;  4L7T A;  3D3M A;  3D9M A;  4PH4 B;  5FTP A;  3LKU A;  1HX8 A;  3ZHE A;  3LYA A;  4NRH B;  3IHY A;  5G04 C;  4AV7 A;  3FTX A;  4KT6 B;  2X6K A;  3MV2 B;  4GB9 A;  4CGV A;  3RO2 A;  4A1S A;  3KAE A;  1H2U A;  4D10 C;  5KJL A;  3U9W A;  3PDN A;  3ESK A;  2CG2 A;  4FHJ A;  4ILG A;  2KCK A;  3NQP A;  1MQS A;  4MS6 A;  5AJL A;  2I9C A;  3RRU A;  3CVQ A;  5CCL A;  2GW1 A;  4F1S A;  4XIF A;  3JQ1 A;  3Q4A B;  2J9Q A;  2I1K A;  1N52 A;  4UWH A;  3UQ3 A;  3ZW3 A;  1HH8 A;  4LUN U;  3D9K A;  3LY9 A;  2XGS A;  4WAF A;  3GW4 A;  5G2N A;  3IV0 A;  4I1M A;  3CHP A;  2J08 A;  3GZ1 A;  3JQ0 A;  3PEV B;  4LCT A;  4ACL A;  3QJZ A;  3FFL A;  3CV0 A;  3FH8 A;  3PNT B;  4EZJ A;  1HXI A;  3EIJ A;  3AS8 A;  1GW6 A;  1WAO 1;  2MRI A;  3B13 A;  2GRM A;  4XKC A;  3FH5 A;  1E96 B;  3O48 A;  2FI7 A;  4U63 A;  2OVB A;  3FUN A;  3NZS A;  1OWN A;  2CFZ A;  4GYO A;  3RU0 A;  3TXM A;  3ULQ A;  1UN9 A;  3HIZ A;  4I9C A;  2XGM A;  2KZT B;  4L2L A;  3SI5 A;  3NF1 A;  4UWK A;  4MRU A;  5BT1 A;  1WM5 A;  4URK A;  3TG5 A;  3URZ A;  1X5B A;  4I1O B;  3ASG A;  3I4G A;  3C98 A;  3QAR A;  3R7R A;  1H0A A;  1BPO A;  4UI9 K;  4NQ0 A;  2A4Z A;  4N2S A;  2XEV A;  1MHQ A;  1L5J A;  1ZU2 A;  2LNI A;  2X6H A;  5D0Q D;  4DPR A;  5AJD A;  3T8M A;  2KZT A;  5C1D A;  3CVL A;  3FU0 A;  4N5C A;  4JXT A;  4C9B B;  4PUC A;  3D9L A;  5FQ8 A;  5FZQ A;  3RRM B;  4G1T A;  5FT9 A;  4BFR A;  1FCH A;  1UG3 A;  2QFC A;  3G2U A;  3LVR E;  5EDS A;  5KJN A;  1FVH A;  3SBS A;  5CMW A;  3JCK C;  3LEW A;  1SQM A;  3QOU A;  3QWV A;  3MZL B;  3S7J A;  2YIN A;  3FUJ A;  4U0U A;  4KVO A;  1OUV A;  3PEU B;  4IUL A;  4CRW A;  3TG4 A;  2ZU6 B;  3FHE A;  4HOR A;  4Y6W A;  3QWP A;  4UI9 C;  2FBN A;  5FQ4 A;  3HHM A;  5J08 A;  3RRN B;  3LDZ A;  1ELW A;  4B8A A;  1XGW A;  4U04 A;  3ZIM A;  5EX0 A;  3FUE A;  2PM7 A;  2KC7 A;  4M3O A;  2KM4 A;  3N71 A;  4HOU A;  3FTV A;  5A6C A;  4FJZ A;  3HDX A;  4FC8 A;  4V3I A;  4WNF A;  4WND A;  3ZGQ A;  3B7T A;  3VTY A;  3PS6 A;  4FHK A;  2WXP A;  3L6A A;  4ATG A;  5BUZ A;  4RSY A;  3G2V A;  3SZ7 A;  4MKT A;  3TGO A;  4JHK A;  3BG1 B;  3D9I A;  2Y4T A;  3VLE A;  3FU3 A;  4WNG A;  1E7V A;  3HVE A;  3L16 A;  3ZYQ A;  3CIA A;  3MKR A;  3UPV A;  4AVX A;  2VGX A;  4UQY A;  1UJJ A;  3VTX A;  1E90 A;  2LSU A;  2WM9 A;  4OYS A;  5FJY A;  3UUX A;  4G2V A;  5BV1 A;  4TRQ A;  1QQE A;  2VSO E;  3ZRH A;  5J90 A;  1UJK A;  3PRZ A;  4R7L A;  2X6F A;  3MV3 B;  1EDU A;  4EZK A;  3FUH A;  4WWO A;  4A1G A;  4GZC A;  1B89 A;  3S7B A;  3CHM A;  2CHX A;  3CGH A;  3CK8 A;  1YA0 A;  3FUF A;  4H7Y A;  2FEZ A;  5LCW J;  3VLF A;  4KZ0 A;  3CVV A;  3Q47 B;  2WXK A;  3IHV A;  1FVF A;  4K0R A;  4N3C A;  2OOE A;  3TL5 A;  5KJK A;  3CKC A;  1KT0 A;  3D9P A;  4O6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...