3Q79A

Cryptococcus neoformans protein farnesyltransferase in complex with farnesyl-ddptasacniq product
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
330
structure length
314
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase
molecule keywords Farnesyltransferase alpha subunit
total genus 122
structure length 314
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q79A00
3E33A 3HXDA 1N4RA 1S64A 1QBQA 2H6IA 3DSWA 1O5MA 1N9AA 2H6HA 1TNZA 2H6GA 3KSQA 1TNOA 3KSLA 1JCRA 3HXCA 1TNYA 4MBGA 1JCSA 1N95A 4EHMA 1NI1A 3EUVA 3E34A 3Q73A 3DSUA 3DPYA 4GTPA 3EU5A 3DSXA 4GTVA 1TN7A 4GTTA 1S63A 1NL4A 3DSVA 1TN8A 3Q7AA 3C72A 3Q78A 1D8EA 3Q79A 1LTXA 3DRAA 4L9PA 4YDEA 1N4QA 3E30A 1N4SA 1KZPA 2BEDA 1O1RA 3SFYA 1LD8A 3E32A 3HXBA 1SA5A 3Q75A 1MZCA 1DCEA 1TNUA 4GTRA 1D8DA 3DSSA 3PZ3A 1N4PA 3DSTA 1O1SA 3E37A 1O1TA 1JCQA 3PZ4A 3PZ2A 3Q7FA 4GTSA 2F0YA 1KZOA 1LD7A 2ZIRA 1X81A 4LNBA 4GTQA 3PZ1A 2IEJA 3HXEA 4YDOA 4LNGA 1FT1A 4GTMA 3SFXA 2R2LA 4GTOA 2H6FA 1SA4A 1FT2A 3HXFA 1TN6A 1TNBA 1FPPA 2ZISA 1N94A
chains in the Genus database with same CATH superfamily
2FF4A 3TL5A 4YNDA 3MKQB 1EDUA 3FDHA 1QQEA 1IXVA 3ASNE 3SNXA 3ZIMA 3DSUA 1NP7A 4I9CA 4KVOA 4BT9A 4GTVA 4GTTA 1N52A 3DSVA 3Q7AA 4X8QA 1S70B 5G2NA 2HE0A 3UMVA 1BI7B 4N5QA 4J7WA 5FZQA 1ELWA 3NB2A 2EILE 4E85A 1OWPA 4NIKA 1O1RA 1UOHA 1YMPA 3OXGA 4DX1A 2WXNA 3G2UA 1H2UA 2WXQA 1HZ4A 5EIBE 5HKPA 4I1OB 3UIPC 3C3RA 5JJTA 2GROB 5C2YA 1NZNA 3DPDA 3D9NA 4ACKA 2R59A 4AP2A 2XZTG 4YDOA 3UM2A 4TUMA 3MJWA 2AVPA 3NZUA 4TXRA 4U8YD 4JEHA 2MRIA 1SQMA 3EIJA 1UG3A 3KAEA 2IFUA 3UX4A 2IOSA 4U7EB 2X6HA 4PS8A 1N94A 3E33A 4J6IA 3PNLB 4BERA 1O5MA 4MKTA 4PH4B 3PE4A 3OTNA 3QDNA 4HB5A 1TNYA 3JXJA 3U64A 3T9KA 1FVFA 2HR2A 3T5XA 1WY6A 1EYHA 2E0IA 3APDA 3PNTB 1IQRA 2KCVA 3VLDA 2WXGA 3SBSA 2RD0A 4UUCA 2Y0BG 3UINC 3LY9A 4ANXA 3CVPA 4UWFA 2DYSE 1MYOA 3PEUB 4GCNA 2LO6A 3CVUA 1QYMA 3E4BA 4QFVA 4JW1A 5B1BE 3CHMA 4GZDA 1KLXA 3TWRA 4XKBA 5EYLA 3RRMB 1D8DA 4TV3A 2PQNA 2WXFA 1JUQA 3Q7FA 5KJNA 4HRLA 5BV0A 2MOWA 4GMRA 5FT9A 3D3MA 4LG6A 1Z3YA 3B95A 3UM0A 2V4HC 2AXVA 2ETCA 4B89A 4B93B 1GW6A 2F37A 4C48B 3EHQA 1QBQA 2QC9A 5AENA 2H6HA 2XEHA 2GW1A 1V54E 3L22A 3I4GA 3D9JA 5C1DA 3T8MA 4HOSA 4RLYA 3R7QA 3UI2A 3DPYA 4LUNU 2IY0C 2WXKA 4LEUA 3CHRA 3PH0C 1NL4A 1OXJA 5FQ7A 4G11A 3G2VA 2GRRB 5DBKA 3P2BA 1E8YA 1Z5SC 3DBSA 3L82A 4GZ6A 2DWZA 2WXOA 2FULA 3PEVB 3QARA 2RFMA 3L17A 4NURA 3WG7E 2P9KG 1UN9A 3ONLA 3W9GA 3RK6A 1TNUA 3HYMB 3I4RB 3D9HA 4EZKA 4LRZA 2J08A 3VLEA 4G25A 2I6HA 3N71A 1HE8A 3CHQA 3JCKC 4L7TA 3QWPA 2X6KA 4JA9A 3HXEA 3MKQA 2XHEA 3CHOA 5BV1A 2VGYA 1YCSB 4GA1A 3EU9A 2WB2A 4GTMA 3IHYA 1ELRA 3GW4A 1FVHA 2J9QA 3FU5A 1H6KA 4HORA 4AV7A 4HXIA 5D0QD 3U3WA 3FTSA 2PQRA 3FUFA 4W9RA 3NOCD 3BG0B 2KCKA 3NOGD 5AQBA 2PZIA 3ULEG 4ILHB 4FA6A 2XS1A 3EHRA 3R9AB 4MS6A 4CT0A 4A3VA 4EZLA 3CVWA 3AG3E 5CHEE 1E7VA 3EIQC 3LJNA 4UI9C 2IU1A 3BUAA 2V5QC 1TYQG 1X5BA 3R7RA 1OCCE 2GGFA 2LXLA 4J0UA 3E30A 5T8IA 4FLBA 3DWLG 1KZPA 1JWGA 3E32A 4WWNA 2R02A 4IULA 4U04A 2LNIA 3L16A 4A3TA 3ZU7B 4HRNA 4ANUA 2XGOA 3D9MA 2P9IG 3F6QA 2XPYA 3MZLB 4J8SA 3BU8A 5FIOA 2WVIA 4DX6D 3TWXA 2IEJA 2L0TB 4DX2A 4RG9A 4CDNA 3OAWA 4UI9J 4XE0A 3G2SA 2P9UG 1NA3A 4RQIA 4GYWA 4F3VA 4BX8A 2HYZA 3PDNA 2C2LA 3CKCA 4AVXA 2PM7A 5BXUA 5ANLA 3HRAA 1BLXB 4NRHB 4TUUA 4BTAA 4FADA 4RVBA 1OWOA 3UKRG 5HS0A 1H6OA 5G05C 2IQCA 3TXMA 1PAQA 3FUJA 3B7TA 4FULA 5ARGA 3VTYA 2GRNB 3RAUA 1U3DA 4JEUA 5ENRD 1FCHA 3B7RL 3UIOC 4K0RA 2LAHA 3V31A 3MKRA 1K8KG 2M63A 4HI9A 4LNUD 3ASFA 1E96B 4APFA 4UWHA 3CK7A 4DI4A 3EHNA 3SFYA 5FZRA 4CT4A 2J09A 4GTRA 3U4TA 3L13A 3ASGA 3PZ3A 1N4PA 1U3CA 3FWVA 4ABNA 2CFUA 2OEVA 1ZU2A 4U8VD 1ELKA 4IN3B 4GTQA 2WXPA 4G2VA 4QQIA 3MV3B 4G1TA 2Y3AA 1TJCA 4WNFA 4YDYA 3CQGB 3AG1E 5JHBA 3SFXA 5J90A 4JXTA 3C3OA 3CR3A 4BESA 3ENEA 1IKND 3LJ3A 3CEQA 1FT2A 3PRZA 3FUHA 2CG2A 3D9IA 4GZ3A 3FTWA 3HXDA 3L9TA 4HBDA 3IV0A 2R03A 2QYJA 4L1BA 3ZFWA 3KSQA 2X6IA 3CVLA 5EIDA 2MHKA 3AU5A 2OCCE 3RIBA 3NF1A 3LVQE 4B8AA 2R17C 1OWNA 3QB2A 2X3MA 2ZXWE 1YA0A 5KJMA 4HQDA 2NYJA 4GTPA 4PUCA 3DEOA 4GU5A 4J8EA 1L5JA 1DNPA 2ETAA 3TG4A 1TN8A 1H19A 3C72A 4OVVA 3NAWA 1LTXA 3ZPJA 3CHSA 5KJLA 3CGHA 5JHAA 4XI0A 4TXQA 2BEDA 4GPKA 2DZNA 4JPSA 2J4DA 1PC2A 5AN8A 3ZVVA 4GZ5A 2X6JA 1KZOA 4DPRA 3ONKA 2C0MA 4I2WA 3LKUA 3URZA 1HU3A 4RSYA 3FUKA 2WXJA 3AS8A 4KXKB 2P9SG 4NQ0A 2ZU6B 4Y6WA 1INZA 2H6FA 5AQ9A 3P1UA 1QNFA 4HOUA 2BUGA 3HXFA 3HVEB 1D9SA 3Q4AB 4O60A 4KYOB 4LERA 2I1JA 2H6IA 4GPMA 3EHMA 2XQ0A 1BU9A 3ASDA 3FULA 3L54A 4N3CA 4I6EA 2DCPA 3ESLA 4BY6A 5FWQA 4EQFA 5AARA 3CVQA 2JABA 1OUVA 1K1AA 1HS6A 3LPZA 3LYAA 4JL0A 1S63A 2KZTB 4MLPA 2IF4A 2ZGDA 5EDSA 2JEKA 3HIZA 4CRWA 3CK9A 2VTBA 3UT8A 4GYOA 4ANVA 3ASOE 2EINE 4EECA 2ETBA 3VTXA 4UQZA 2OVBA 3E37A 3Q9UC 2FO7A 5BT1A 2IOLA 1E8ZA 2UY1A 5T4YA 3C5RA 4JC8A 3ABKE 2PNNA 4KVMA 2WQ7A 2GRPB 3GYZA 3FUNA 4CGWA 4G8KA 3FTZA 1WAO1 5D2MC 1HH8A 2R2LA 4MRUA 5FJYA 3ASHA 3PUJA 1MX2A 4GYYA 4JVSA 5D0OD 3HVEA 4U0SA 4JHRA 2L6JA 5EN5D 5FTPA 4GMLA 3FTVA 3KD7A 1UJJA 3JQ0A 1BD8A 3CIAA 4DUIA 3TWWA 5ARFA 3TGOA 5CERB 2H6GA 4Q69A 5CECB 5EILA 3W9FA 5G05J 1H0AA 2AJAA 3QKYA 5HI7A 1OCOE 4HVBA 4JA7A 3LCAA 2ZGGA 4JB8P 1TR4A 4CCAA 3FEYA 4BETA 2VGXA 1NFIE 1MJ0A 5CBNA 3V79K 5A7DB 1H2TC 5G04J 5B1AE 2XPZA 5D66A 2RKKA 3RJVA 1Y8MA 3ABLE 3UXGA 4EZJA 5JMND 4G23A 4ACLA 1NA0A 4WUYA 3S7DA 3DSTA 4FJYA 2XPIA 2DZOA 2A4ZA 2I1KA 4DJAA 2ZIRA 4BSXA 4LNBA 1ZB1A 1N11A 2J49A 2Y4UA 4LNGA 4K03A 2WPVA 3U9WA 1FT1A 2KCLA 5IY5E 1Q2ZA 2XZDG 5KNHD 4ANWA 5BXOA 3ZXSA 3CVVA 2CHXA 2KXPC 2WXIA 4J8FA 4WAFA 2EIKE 2BKGA 4BSZB 3U66A 4ZFHA 5LCWC 3KEZA 3B7UX 1N9AA 2J4BA 2IO2C 3G2WA 2UWJG 5CMWA 4EBAG 4R7LA 4TRQA 4MBGA 2WQHA 3I3NA 3ZGQA 2YNQA 3V2XA 3FTUA 1EPUA 4M3OA 3EJNA 3Q73A 4APOA 5ENTD 2Q7FA 3AS5A 4N3AA 4AIFA 3D9LA 3Q78A 1DCQA 1OWMA 1N0QA 4XI9A 2X38A 5LP0A 1DC2A 5H7PA 5LOZA 2V5FA 4D10C 1EF1C 2AXUA 4A1SA 3S7BA 4WNEA 4DK5A 3HHMA 3LDZA 3V30A 3JUEA 3AS4A 5LCWJ 3TWVA 1SVXA 4GTSA 5B3SE 5A6CA 1RW2A 4N2QA 1X81A 1HXIA 3SZ7A 3ISMC 5EKQD 2PM6A 3KEAA 3LXUX 4DLQA 4DI3A 4Z68A 3UM3A 2Y1LE 3GZ2A 4CEMA 4OYSA 3RRNB 4I6GA 2ZISA 5KJKA 3IBEA 4J8YA 4GCOA 3MX3A 2VGXB 1AP7A 2J07A 2AWIA 4BFRA 3ZW3A 1JCRA 5CBOA 3TWSA 1XGWA 2OVFA 3SF4A 4LCTA 4XZ4A 3KS2A 4F7AA 4J8DA 3FUIA 3Q49B 3TG5A 3ZYMA 4DX5D 4OVUA 4YDWA 4WNDA 2KATA 1OY3D 5AJLA 1WG0A 3GZSA 1HO8A 2L9BA 5T3RA 1MQSA 1IQUA 1PY1A 4HOTA 3MEKA 3HG0D 2V8SE 2I9CA 1JCQA 1A17A 4RG6A 4HI8A 2LAIA 1LD7A 4G24A 4JHJA 1G3NB 2BTDA 2WXMA 1H6PA 2NSZA 4U95D 5LX8A 3Q47B 3D9OA 2BKKB 1OCRE 5CMYA 4BT8A 3Q9NC 4AJWA 3QK0A 1VDYA 5JJ6A 3AU4A 4JHKA 3ZUVB 4BX9A 2VGEA 1SZAA 2I2OA 2YINA 3B13A 3DSWA 4H7XA 4ATGA 5AAOA 1IYGA 3KSLA 3ZHEB 3ESKA 4E6HA 3ZYKA 1NI1A 3ULQA 3EUVA 3AJIA 3B7BA 4CDMA 1HX8A 5E76A 4N39A 1TJFA 5CCMA 1IHGA 3BG1B 1K3ZD 4YVOA 2HM8A 1KT1A 1E90A 2IO3C 3LY8A 3OXFA 4WNGA 5BNWA 1N4SA 1MX6A 3LS8A 5G04C 5AJDA 2EIME 2P9NG 4U63A 1WDYA 3CHPA 3Q5MA 5ANRA 4DX7D 1A5EA 3PUKA 3I5PA 3CVNA 2WXLA 5ENQD 2LUHA 3PZ2A 5KWDA 2Y4TA 4GMJA 2L0IA 1W3BA 4O1OA 2MYOA 2WMNA 3D9KA 3CK8A 1E7UA 3LY7A 4HLLA 3TAXA 2VQ2A 3IEGA 3ZRHA 3DXMG 3C98A 4DLOA 2X6FA 4OAVB 3X2QE 2PL2A 1TN6A 2GRQB 4O1PA 4HLEA 1FPPA 5JA4D 4EPZA 3ZYLA 2ONDA 4ME2A 4FHKA 4GB9A 5FQ4A 2XCCA 5BPPA 3ZYQA 2LSUA 4FP7A 4I2ZA 1YYHA 3HXCA 4UWLA 3SI5A 2KBXA 3RO2A 4I43A 3EDTB 2Y69E 4A55A 3SGHA 2FO1E 3LVRE 1UW4B 2KM4A 5AQAA 2VSXE 4FLHA 2AW6A 3PE3A 1TEZA 2VJ8A 4YDEA 1HG2A 4HOQA 5ENOD 5ITZF 3RRUA 3ZKJA 5HRYA 1S0PA 2LSVA 4C0EA 4F6RD 4G26A 2DBAA 3DSSA 4CZ2D 3LEWA 3UM1A 3C3QA 1O1SA 2YHCA 3PZ4A 4NACA 1E8WA 3UKUG 3FU6A 2F0YA 3QWWA 3ZN3A 5BUZA 5EX3A 4C0MA 4AOFA 1BI8B 5AYWD 1OWLA 1E8XA 4GTOA 4KT6B 5AIJA 4V3IA 1SA4A 3GZ1A 3ZXPA 3QWVA 4M7CA 1TNBA 5ENPD 1JPLA 3J5QB 4U07A 2QY7A 3JYSA 4BEPA 1N54A 2IONA 3DEPA 3IXEA 4AY6A 1TNOA 2VSOE 3FH5A 3FU3A 1N95A 5CEAA 2OOEA 1XNFA 2F8XK 3S7FA 4L23A 4I17A 3SQVA 1MHQA 3BEEA 4XKCA 2GRLA 2XGMA 1JWFA 4C9BB 3MGBA 1K1BA 4EBAA 4Q96A 3DRAA 3ZHEA 2F8YA 4BTBA 2VSYA 5BW8C 2AXZA 2VYIA 3IHVA 1DVPA 2V0PA 3Q75A 2A5EA 4BWRA 4A1GA 2NC9A 3VLFA 3FHEA 3UUXA 4ILGA 3UPVA 4B8CB 1O1TA 3CQCB 3HDXA 1KPSB 3FU0A 2JLBA 3ZEFA 3O4ZA 2FBNA 4I6JA 2B6CA 4K5CA 3FEXA 4U0UA 5HQ8A 4KZCA 4F1SA 3PVLA 5ENNA 2GRMA 4HRMB 4F1PA 2XENA 2QYUA 3G2TA 4A63B 3PZDA 3CSFA 1HFAA 3TWUA 1TNZA 2OEWA 3ML8A 2R5SA 2XGSA 2CG3A 3UT4A 3MCXA 1HG5A 2ILRA 1UN8A 3RKVA 4GA2A 1Z3XA 4AY5A 1BPOA 4N5CA 2DVWA 3V2OA 3E34A 3L6AA 2WMOA 3ULYA 2BF0X 4U0ZA 4F53A 2KZTA 1TN7A 4UQYA 4B0ZA 1B89A 4ATZD 5KBAA 1V55E 1ZBPA 4HFGA 1Y6IA 5LFAA 3FP3A 2C0LA 5KCMA 3UQ3A 4PS7A 3TXNA 5KNGA 4B94A 2J8SD 5G55A 4HNAD 3AG4E 1KT0A 1RZ4A 3QOUA 2P9PG 3QJZA 4H7YA 3PS6A 4FHJA 3RU0A 5J08A 3CSTA 3MYVA 3QAQA 4ZHBA 1U2VG 4KBQA 3K9IA 2XEEA 5FINA 4CGVA 3PREA 3CVYA 4XEIG 3FTXA 2YHEA 4XIFA 5JJ7A 3DXKG 2E2EA 3SO8A 3FY4A 3TJPA 4AM9A 2XRYA 5M72A 1HF8A 2XRZA 1OCZE 3L08A 4WWOA 2B0OE 2A5UA 2FI7A 4GA0A 5CEDB 1SZ9A 2UY1B 2CHZA 1N4RA 4FU3A 2HO1A 4Y6CA 5A23A 2WXHA 3BQOA 3JUIA 2QFCA 3S2AA 1H2VC 1UJKA 5CCLA 3ZNGA 3OXLA 1JCSA 2VTBB 2CHWA 4U8HA 5ENSD 4JZYA 4TXPA 3DSXA 4DRXE 4L2LA 1MX4A 5AQ7A 1Z6TA 3AG2E 3Q79A 4IRUA 3FH8A 4L9PA 3APCA 1N4QA 4HS2A 4GZCA 3RO3A 3JQ1A 3SBTB 1QZ2A 1LD8A 4AXHA 1SA5A 3D9PA 5E75A 1MZCA 3UT7A 3T5VA 4UWGA 3MA5A 3NBNB 4AEZC 3NZSA 2R05A 3CV0A 4U96D 4ILIA 4I1AA 2DIWA 4Q94A 3WXXA 2XCBA 4KZ0A 3FUMA 4WWPA 4GAAA 4K5BA 4UQXA 4G8LA 4PS3A 3O48A 3CVXA 4LSZE 2V4LA 2XEVA 4UWKA 1SW6A 4L2YA 2YQ8A 3IKOB 2QZAA 5CRUA 5FZSA 5DIZA 3RSEG 4PDXA 2P9LG 2WXRA 2RG8A 4CDRA 4K5AB 3CKBA 5EYPF 1S64A 2P58C 3FUDA 5FQ8A 3CLJA 2KC7A 3NQPA 1AWCB 4YVQC 2OV8A 3SFZA 5FQ6A 2RFAA 2WQ6A 4EHMA 3AAAC 2XS8A 3B7SA 2P2CP 3MV2B 2VSNA 3EU5A 3TWQA 3SHFA 4IYPA 4URKA 3SD5A 3FUEA 1P5QA 4XX5A 1D8EA 5EX0A 2EIJE 4KMOA 1N0RA 3ML9A 3R9MA 3T8KA 2EQXA 3APFA 3QNKA 3J5PA 3FH7A 3HXBA 3QC1A 1OT8A 1DCEA 4OAUC 4JD2G 2FEZA 2IJGX 2L6BA 2WM9A 4CYMD 4N2SA 4P29A 4FJZA 3PZ1A 4O6FA 1WM5A 4FC8A 3FTYA 4N3BA 2LXMA 4UI9K 2CFZA 1LF8A 4I9EA 5CRVA 1IHBA 4I1MA 3ABME 3UTMA 2NXPA 3JXIA 3SY2A 3S7JA 2DYRE 3FFLA 3Q15A 3TWTA
chains in the Genus database with same CATH topology
3E33A 3HXDA 1N4RA 1S64A 1QBQA 2H6IA 3DSWA 1O5MA 1N9AA 2H6HA 1TNZA 2H6GA 3KSQA 1TNOA 3KSLA 1JCRA 3HXCA 1TNYA 4MBGA 1JCSA 1N95A 4EHMA 1NI1A 3EUVA 3E34A 3Q73A 3DSUA 3DPYA 4GTPA 3EU5A 3DSXA 4GTVA 1TN7A 4GTTA 1S63A 1NL4A 3DSVA 1TN8A 3Q7AA 3C72A 3Q78A 1D8EA 3Q79A 1LTXA 3DRAA 4L9PA 4YDEA 1N4QA 3E30A 1N4SA 1KZPA 2BEDA 1O1RA 3SFYA 1LD8A 3E32A 3HXBA 1SA5A 3Q75A 1MZCA 1DCEA 1TNUA 4GTRA 1D8DA 3DSSA 3PZ3A 1N4PA 3DSTA 1O1SA 3E37A 1O1TA 1JCQA 3PZ4A 3PZ2A 3Q7FA 4GTSA 2F0YA 1KZOA 1LD7A 2ZIRA 1X81A 4LNBA 4GTQA 3PZ1A 2IEJA 3HXEA 4YDOA 4LNGA 1FT1A 4GTMA 3SFXA 2R2LA 4GTOA 2H6FA 1SA4A 1FT2A 3HXFA 1TN6A 1TNBA 1FPPA 2ZISA 1N94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E33 A;  3HXD A;  1N4R A;  1S64 A;  1QBQ A;  2H6I A;  3DSW A;  1O5M A;  1N9A A;  2H6H A;  1TNZ A;  2H6G A;  3KSQ A;  1TNO A;  3KSL A;  1JCR A;  3HXC A;  1TNY A;  4MBG A;  1JCS A;  1N95 A;  4EHM A;  1NI1 A;  3EUV A;  3E34 A;  3Q73 A;  3DSU A;  3DPY A;  4GTP A;  3EU5 A;  3DSX A;  4GTV A;  1TN7 A;  4GTT A;  1S63 A;  1NL4 A;  3DSV A;  1TN8 A;  3Q7A A;  3C72 A;  3Q78 A;  1D8E A;  3Q79 A;  1LTX A;  3DRA A;  4L9P A;  4YDE A;  1N4Q A;  3E30 A;  1N4S A;  1KZP A;  2BED A;  1O1R A;  3SFY A;  1LD8 A;  3E32 A;  3HXB A;  1SA5 A;  3Q75 A;  1MZC A;  1DCE A;  1TNU A;  4GTR A;  1D8D A;  3DSS A;  3PZ3 A;  1N4P A;  3DST A;  1O1S A;  3E37 A;  1O1T A;  1JCQ A;  3PZ4 A;  3PZ2 A;  3Q7F A;  4GTS A;  2F0Y A;  1KZO A;  1LD7 A;  2ZIR A;  1X81 A;  4LNB A;  4GTQ A;  3PZ1 A;  2IEJ A;  3HXE A;  4YDO A;  4LNG A;  1FT1 A;  4GTM A;  3SFX A;  2R2L A;  4GTO A;  2H6F A;  1SA4 A;  1FT2 A;  3HXF A;  1TN6 A;  1TNB A;  1FPP A;  2ZIS A;  1N94 A; 
#chains in the Genus database with same CATH topology
 2FF4 A;  3TL5 A;  4YND A;  3MKQ B;  1EDU A;  3FDH A;  1QQE A;  1IXV A;  3ASN E;  3SNX A;  3ZIM A;  3DSU A;  1NP7 A;  4I9C A;  4KVO A;  4BT9 A;  4GTV A;  4GTT A;  1N52 A;  3DSV A;  3Q7A A;  4X8Q A;  1S70 B;  5G2N A;  2HE0 A;  3UMV A;  1BI7 B;  4N5Q A;  4J7W A;  5FZQ A;  1ELW A;  3NB2 A;  2EIL E;  4E85 A;  1OWP A;  4NIK A;  1O1R A;  1UOH A;  1YMP A;  3OXG A;  4DX1 A;  2WXN A;  3G2U A;  1H2U A;  2WXQ A;  1HZ4 A;  5EIB E;  5HKP A;  4I1O B;  3UIP C;  3C3R A;  5JJT A;  2GRO B;  5C2Y A;  1NZN A;  3DPD A;  3D9N A;  4ACK A;  2R59 A;  4AP2 A;  2XZT G;  4YDO A;  3UM2 A;  4TUM A;  3MJW A;  2AVP A;  3NZU A;  4TXR A;  4U8Y D;  4JEH A;  2MRI A;  1SQM A;  3EIJ A;  1UG3 A;  3KAE A;  2IFU A;  3UX4 A;  2IOS A;  4U7E B;  2X6H A;  4PS8 A;  1N94 A;  3E33 A;  4J6I A;  3PNL B;  4BER A;  1O5M A;  4MKT A;  4PH4 B;  3PE4 A;  3OTN A;  3QDN A;  4HB5 A;  1TNY A;  3JXJ A;  3U64 A;  3T9K A;  1FVF A;  2HR2 A;  3T5X A;  1WY6 A;  1EYH A;  2E0I A;  3APD A;  3PNT B;  1IQR A;  2KCV A;  3VLD A;  2WXG A;  3SBS A;  2RD0 A;  4UUC A;  2Y0B G;  3UIN C;  3LY9 A;  4ANX A;  3CVP A;  4UWF A;  2DYS E;  1MYO A;  3PEU B;  4GCN A;  2LO6 A;  3CVU A;  1QYM A;  3E4B A;  4QFV A;  4JW1 A;  5B1B E;  3CHM A;  4GZD A;  1KLX A;  3TWR A;  4XKB A;  5EYL A;  3RRM B;  1D8D A;  4TV3 A;  2PQN A;  2WXF A;  1JUQ A;  3Q7F A;  5KJN A;  4HRL A;  5BV0 A;  2MOW A;  4GMR A;  5FT9 A;  3D3M A;  4LG6 A;  1Z3Y A;  3B95 A;  3UM0 A;  2V4H C;  2AXV A;  2ETC A;  4B89 A;  4B93 B;  1GW6 A;  2F37 A;  4C48 B;  3EHQ A;  1QBQ A;  2QC9 A;  5AEN A;  2H6H A;  2XEH A;  2GW1 A;  1V54 E;  3L22 A;  3I4G A;  3D9J A;  5C1D A;  3T8M A;  4HOS A;  4RLY A;  3R7Q A;  3UI2 A;  3DPY A;  4LUN U;  2IY0 C;  2WXK A;  4LEU A;  3CHR A;  3PH0 C;  1NL4 A;  1OXJ A;  5FQ7 A;  4G11 A;  3G2V A;  2GRR B;  5DBK A;  3P2B A;  1E8Y A;  1Z5S C;  3DBS A;  3L82 A;  4GZ6 A;  2DWZ A;  2WXO A;  2FUL A;  3PEV B;  3QAR A;  2RFM A;  3L17 A;  4NUR A;  3WG7 E;  2P9K G;  1UN9 A;  3ONL A;  3W9G A;  3RK6 A;  1TNU A;  3HYM B;  3I4R B;  3D9H A;  4EZK A;  4LRZ A;  2J08 A;  3VLE A;  4G25 A;  2I6H A;  3N71 A;  1HE8 A;  3CHQ A;  3JCK C;  4L7T A;  3QWP A;  2X6K A;  4JA9 A;  3HXE A;  3MKQ A;  2XHE A;  3CHO A;  5BV1 A;  2VGY A;  1YCS B;  4GA1 A;  3EU9 A;  2WB2 A;  4GTM A;  3IHY A;  1ELR A;  3GW4 A;  1FVH A;  2J9Q A;  3FU5 A;  1H6K A;  4HOR A;  4AV7 A;  4HXI A;  5D0Q D;  3U3W A;  3FTS A;  2PQR A;  3FUF A;  4W9R A;  3NOC D;  3BG0 B;  2KCK A;  3NOG D;  5AQB A;  2PZI A;  3ULE G;  4ILH B;  4FA6 A;  2XS1 A;  3EHR A;  3R9A B;  4MS6 A;  4CT0 A;  4A3V A;  4EZL A;  3CVW A;  3AG3 E;  5CHE E;  1E7V A;  3EIQ C;  3LJN A;  4UI9 C;  2IU1 A;  3BUA A;  2V5Q C;  1TYQ G;  1X5B A;  3R7R A;  1OCC E;  2GGF A;  2LXL A;  4J0U A;  3E30 A;  5T8I A;  4FLB A;  3DWL G;  1KZP A;  1JWG A;  3E32 A;  4WWN A;  2R02 A;  4IUL A;  4U04 A;  2LNI A;  3L16 A;  4A3T A;  3ZU7 B;  4HRN A;  4ANU A;  2XGO A;  3D9M A;  2P9I G;  3F6Q A;  2XPY A;  3MZL B;  4J8S A;  3BU8 A;  5FIO A;  2WVI A;  4DX6 D;  3TWX A;  2IEJ A;  2L0T B;  4DX2 A;  4RG9 A;  4CDN A;  3OAW A;  4UI9 J;  4XE0 A;  3G2S A;  2P9U G;  1NA3 A;  4RQI A;  4GYW A;  4F3V A;  4BX8 A;  2HYZ A;  3PDN A;  2C2L A;  3CKC A;  4AVX A;  2PM7 A;  5BXU A;  5ANL A;  3HRA A;  1BLX B;  4NRH B;  4TUU A;  4BTA A;  4FAD A;  4RVB A;  1OWO A;  3UKR G;  5HS0 A;  1H6O A;  5G05 C;  2IQC A;  3TXM A;  1PAQ A;  3FUJ A;  3B7T A;  4FUL A;  5ARG A;  3VTY A;  2GRN B;  3RAU A;  1U3D A;  4JEU A;  5ENR D;  1FCH A;  3B7R L;  3UIO C;  4K0R A;  2LAH A;  3V31 A;  3MKR A;  1K8K G;  2M63 A;  4HI9 A;  4LNU D;  3ASF A;  1E96 B;  4APF A;  4UWH A;  3CK7 A;  4DI4 A;  3EHN A;  3SFY A;  5FZR A;  4CT4 A;  2J09 A;  4GTR A;  3U4T A;  3L13 A;  3ASG A;  3PZ3 A;  1N4P A;  1U3C A;  3FWV A;  4ABN A;  2CFU A;  2OEV A;  1ZU2 A;  4U8V D;  1ELK A;  4IN3 B;  4GTQ A;  2WXP A;  4G2V A;  4QQI A;  3MV3 B;  4G1T A;  2Y3A A;  1TJC A;  4WNF A;  4YDY A;  3CQG B;  3AG1 E;  5JHB A;  3SFX A;  5J90 A;  4JXT A;  3C3O A;  3CR3 A;  4BES A;  3ENE A;  1IKN D;  3LJ3 A;  3CEQ A;  1FT2 A;  3PRZ A;  3FUH A;  2CG2 A;  3D9I A;  4GZ3 A;  3FTW A;  3HXD A;  3L9T A;  4HBD A;  3IV0 A;  2R03 A;  2QYJ A;  4L1B A;  3ZFW A;  3KSQ A;  2X6I A;  3CVL A;  5EID A;  2MHK A;  3AU5 A;  2OCC E;  3RIB A;  3NF1 A;  3LVQ E;  4B8A A;  2R17 C;  1OWN A;  3QB2 A;  2X3M A;  2ZXW E;  1YA0 A;  5KJM A;  4HQD A;  2NYJ A;  4GTP A;  4PUC A;  3DEO A;  4GU5 A;  4J8E A;  1L5J A;  1DNP A;  2ETA A;  3TG4 A;  1TN8 A;  1H19 A;  3C72 A;  4OVV A;  3NAW A;  1LTX A;  3ZPJ A;  3CHS A;  5KJL A;  3CGH A;  5JHA A;  4XI0 A;  4TXQ A;  2BED A;  4GPK A;  2DZN A;  4JPS A;  2J4D A;  1PC2 A;  5AN8 A;  3ZVV A;  4GZ5 A;  2X6J A;  1KZO A;  4DPR A;  3ONK A;  2C0M A;  4I2W A;  3LKU A;  3URZ A;  1HU3 A;  4RSY A;  3FUK A;  2WXJ A;  3AS8 A;  4KXK B;  2P9S G;  4NQ0 A;  2ZU6 B;  4Y6W A;  1INZ A;  2H6F A;  5AQ9 A;  3P1U A;  1QNF A;  4HOU A;  2BUG A;  3HXF A;  3HVE B;  1D9S A;  3Q4A B;  4O60 A;  4KYO B;  4LER A;  2I1J A;  2H6I A;  4GPM A;  3EHM A;  2XQ0 A;  1BU9 A;  3ASD A;  3FUL A;  3L54 A;  4N3C A;  4I6E A;  2DCP A;  3ESL A;  4BY6 A;  5FWQ A;  4EQF A;  5AAR A;  3CVQ A;  2JAB A;  1OUV A;  1K1A A;  1HS6 A;  3LPZ A;  3LYA A;  4JL0 A;  1S63 A;  2KZT B;  4MLP A;  2IF4 A;  2ZGD A;  5EDS A;  2JEK A;  3HIZ A;  4CRW A;  3CK9 A;  2VTB A;  3UT8 A;  4GYO A;  4ANV A;  3ASO E;  2EIN E;  4EEC A;  2ETB A;  3VTX A;  4UQZ A;  2OVB A;  3E37 A;  3Q9U C;  2FO7 A;  5BT1 A;  2IOL A;  1E8Z A;  2UY1 A;  5T4Y A;  3C5R A;  4JC8 A;  3ABK E;  2PNN A;  4KVM A;  2WQ7 A;  2GRP B;  3GYZ A;  3FUN A;  4CGW A;  4G8K A;  3FTZ A;  1WAO 1;  5D2M C;  1HH8 A;  2R2L A;  4MRU A;  5FJY A;  3ASH A;  3PUJ A;  1MX2 A;  4GYY A;  4JVS A;  5D0O D;  3HVE A;  4U0S A;  4JHR A;  2L6J A;  5EN5 D;  5FTP A;  4GML A;  3FTV A;  3KD7 A;  1UJJ A;  3JQ0 A;  1BD8 A;  3CIA A;  4DUI A;  3TWW A;  5ARF A;  3TGO A;  5CER B;  2H6G A;  4Q69 A;  5CEC B;  5EIL A;  3W9F A;  5G05 J;  1H0A A;  2AJA A;  3QKY A;  5HI7 A;  1OCO E;  4HVB A;  4JA7 A;  3LCA A;  2ZGG A;  4JB8 P;  1TR4 A;  4CCA A;  3FEY A;  4BET A;  2VGX A;  1NFI E;  1MJ0 A;  5CBN A;  3V79 K;  5A7D B;  1H2T C;  5G04 J;  5B1A E;  2XPZ A;  5D66 A;  2RKK A;  3RJV A;  1Y8M A;  3ABL E;  3UXG A;  4EZJ A;  5JMN D;  4G23 A;  4ACL A;  1NA0 A;  4WUY A;  3S7D A;  3DST A;  4FJY A;  2XPI A;  2DZO A;  2A4Z A;  2I1K A;  4DJA A;  2ZIR A;  4BSX A;  4LNB A;  1ZB1 A;  1N11 A;  2J49 A;  2Y4U A;  4LNG A;  4K03 A;  2WPV A;  3U9W A;  1FT1 A;  2KCL A;  5IY5 E;  1Q2Z A;  2XZD G;  5KNH D;  4ANW A;  5BXO A;  3ZXS A;  3CVV A;  2CHX A;  2KXP C;  2WXI A;  4J8F A;  4WAF A;  2EIK E;  2BKG A;  4BSZ B;  3U66 A;  4ZFH A;  5LCW C;  3KEZ A;  3B7U X;  1N9A A;  2J4B A;  2IO2 C;  3G2W A;  2UWJ G;  5CMW A;  4EBA G;  4R7L A;  4TRQ A;  4MBG A;  2WQH A;  3I3N A;  3ZGQ A;  2YNQ A;  3V2X A;  3FTU A;  1EPU A;  4M3O A;  3EJN A;  3Q73 A;  4APO A;  5ENT D;  2Q7F A;  3AS5 A;  4N3A A;  4AIF A;  3D9L A;  3Q78 A;  1DCQ A;  1OWM A;  1N0Q A;  4XI9 A;  2X38 A;  5LP0 A;  1DC2 A;  5H7P A;  5LOZ A;  2V5F A;  4D10 C;  1EF1 C;  2AXU A;  4A1S A;  3S7B A;  4WNE A;  4DK5 A;  3HHM A;  3LDZ A;  3V30 A;  3JUE A;  3AS4 A;  5LCW J;  3TWV A;  1SVX A;  4GTS A;  5B3S E;  5A6C A;  1RW2 A;  4N2Q A;  1X81 A;  1HXI A;  3SZ7 A;  3ISM C;  5EKQ D;  2PM6 A;  3KEA A;  3LXU X;  4DLQ A;  4DI3 A;  4Z68 A;  3UM3 A;  2Y1L E;  3GZ2 A;  4CEM A;  4OYS A;  3RRN B;  4I6G A;  2ZIS A;  5KJK A;  3IBE A;  4J8Y A;  4GCO A;  3MX3 A;  2VGX B;  1AP7 A;  2J07 A;  2AWI A;  4BFR A;  3ZW3 A;  1JCR A;  5CBO A;  3TWS A;  1XGW A;  2OVF A;  3SF4 A;  4LCT A;  4XZ4 A;  3KS2 A;  4F7A A;  4J8D A;  3FUI A;  3Q49 B;  3TG5 A;  3ZYM A;  4DX5 D;  4OVU A;  4YDW A;  4WND A;  2KAT A;  1OY3 D;  5AJL A;  1WG0 A;  3GZS A;  1HO8 A;  2L9B A;  5T3R A;  1MQS A;  1IQU A;  1PY1 A;  4HOT A;  3MEK A;  3HG0 D;  2V8S E;  2I9C A;  1JCQ A;  1A17 A;  4RG6 A;  4HI8 A;  2LAI A;  1LD7 A;  4G24 A;  4JHJ A;  1G3N B;  2BTD A;  2WXM A;  1H6P A;  2NSZ A;  4U95 D;  5LX8 A;  3Q47 B;  3D9O A;  2BKK B;  1OCR E;  5CMY A;  4BT8 A;  3Q9N C;  4AJW A;  3QK0 A;  1VDY A;  5JJ6 A;  3AU4 A;  4JHK A;  3ZUV B;  4BX9 A;  2VGE A;  1SZA A;  2I2O A;  2YIN A;  3B13 A;  3DSW A;  4H7X A;  4ATG A;  5AAO A;  1IYG A;  3KSL A;  3ZHE B;  3ESK A;  4E6H A;  3ZYK A;  1NI1 A;  3ULQ A;  3EUV A;  3AJI A;  3B7B A;  4CDM A;  1HX8 A;  5E76 A;  4N39 A;  1TJF A;  5CCM A;  1IHG A;  3BG1 B;  1K3Z D;  4YVO A;  2HM8 A;  1KT1 A;  1E90 A;  2IO3 C;  3LY8 A;  3OXF A;  4WNG A;  5BNW A;  1N4S A;  1MX6 A;  3LS8 A;  5G04 C;  5AJD A;  2EIM E;  2P9N G;  4U63 A;  1WDY A;  3CHP A;  3Q5M A;  5ANR A;  4DX7 D;  1A5E A;  3PUK A;  3I5P A;  3CVN A;  2WXL A;  5ENQ D;  2LUH A;  3PZ2 A;  5KWD A;  2Y4T A;  4GMJ A;  2L0I A;  1W3B A;  4O1O A;  2MYO A;  2WMN A;  3D9K A;  3CK8 A;  1E7U A;  3LY7 A;  4HLL A;  3TAX A;  2VQ2 A;  3IEG A;  3ZRH A;  3DXM G;  3C98 A;  4DLO A;  2X6F A;  4OAV B;  3X2Q E;  2PL2 A;  1TN6 A;  2GRQ B;  4O1P A;  4HLE A;  1FPP A;  5JA4 D;  4EPZ A;  3ZYL A;  2OND A;  4ME2 A;  4FHK A;  4GB9 A;  5FQ4 A;  2XCC A;  5BPP A;  3ZYQ A;  2LSU A;  4FP7 A;  4I2Z A;  1YYH A;  3HXC A;  4UWL A;  3SI5 A;  2KBX A;  3RO2 A;  4I43 A;  3EDT B;  2Y69 E;  4A55 A;  3SGH A;  2FO1 E;  3LVR E;  1UW4 B;  2KM4 A;  5AQA A;  2VSX E;  4FLH A;  2AW6 A;  3PE3 A;  1TEZ A;  2VJ8 A;  4YDE A;  1HG2 A;  4HOQ A;  5ENO D;  5ITZ F;  3RRU A;  3ZKJ A;  5HRY A;  1S0P A;  2LSV A;  4C0E A;  4F6R D;  4G26 A;  2DBA A;  3DSS A;  4CZ2 D;  3LEW A;  3UM1 A;  3C3Q A;  1O1S A;  2YHC A;  3PZ4 A;  4NAC A;  1E8W A;  3UKU G;  3FU6 A;  2F0Y A;  3QWW A;  3ZN3 A;  5BUZ A;  5EX3 A;  4C0M A;  4AOF A;  1BI8 B;  5AYW D;  1OWL A;  1E8X A;  4GTO A;  4KT6 B;  5AIJ A;  4V3I A;  1SA4 A;  3GZ1 A;  3ZXP A;  3QWV A;  4M7C A;  1TNB A;  5ENP D;  1JPL A;  3J5Q B;  4U07 A;  2QY7 A;  3JYS A;  4BEP A;  1N54 A;  2ION A;  3DEP A;  3IXE A;  4AY6 A;  1TNO A;  2VSO E;  3FH5 A;  3FU3 A;  1N95 A;  5CEA A;  2OOE A;  1XNF A;  2F8X K;  3S7F A;  4L23 A;  4I17 A;  3SQV A;  1MHQ A;  3BEE A;  4XKC A;  2GRL A;  2XGM A;  1JWF A;  4C9B B;  3MGB A;  1K1B A;  4EBA A;  4Q96 A;  3DRA A;  3ZHE A;  2F8Y A;  4BTB A;  2VSY A;  5BW8 C;  2AXZ A;  2VYI A;  3IHV A;  1DVP A;  2V0P A;  3Q75 A;  2A5E A;  4BWR A;  4A1G A;  2NC9 A;  3VLF A;  3FHE A;  3UUX A;  4ILG A;  3UPV A;  4B8C B;  1O1T A;  3CQC B;  3HDX A;  1KPS B;  3FU0 A;  2JLB A;  3ZEF A;  3O4Z A;  2FBN A;  4I6J A;  2B6C A;  4K5C A;  3FEX A;  4U0U A;  5HQ8 A;  4KZC A;  4F1S A;  3PVL A;  5ENN A;  2GRM A;  4HRM B;  4F1P A;  2XEN A;  2QYU A;  3G2T A;  4A63 B;  3PZD A;  3CSF A;  1HFA A;  3TWU A;  1TNZ A;  2OEW A;  3ML8 A;  2R5S A;  2XGS A;  2CG3 A;  3UT4 A;  3MCX A;  1HG5 A;  2ILR A;  1UN8 A;  3RKV A;  4GA2 A;  1Z3X A;  4AY5 A;  1BPO A;  4N5C A;  2DVW A;  3V2O A;  3E34 A;  3L6A A;  2WMO A;  3ULY A;  2BF0 X;  4U0Z A;  4F53 A;  2KZT A;  1TN7 A;  4UQY A;  4B0Z A;  1B89 A;  4ATZ D;  5KBA A;  1V55 E;  1ZBP A;  4HFG A;  1Y6I A;  5LFA A;  3FP3 A;  2C0L A;  5KCM A;  3UQ3 A;  4PS7 A;  3TXN A;  5KNG A;  4B94 A;  2J8S D;  5G55 A;  4HNA D;  3AG4 E;  1KT0 A;  1RZ4 A;  3QOU A;  2P9P G;  3QJZ A;  4H7Y A;  3PS6 A;  4FHJ A;  3RU0 A;  5J08 A;  3CST A;  3MYV A;  3QAQ A;  4ZHB A;  1U2V G;  4KBQ A;  3K9I A;  2XEE A;  5FIN A;  4CGV A;  3PRE A;  3CVY A;  4XEI G;  3FTX A;  2YHE A;  4XIF A;  5JJ7 A;  3DXK G;  2E2E A;  3SO8 A;  3FY4 A;  3TJP A;  4AM9 A;  2XRY A;  5M72 A;  1HF8 A;  2XRZ A;  1OCZ E;  3L08 A;  4WWO A;  2B0O E;  2A5U A;  2FI7 A;  4GA0 A;  5CED B;  1SZ9 A;  2UY1 B;  2CHZ A;  1N4R A;  4FU3 A;  2HO1 A;  4Y6C A;  5A23 A;  2WXH A;  3BQO A;  3JUI A;  2QFC A;  3S2A A;  1H2V C;  1UJK A;  5CCL A;  3ZNG A;  3OXL A;  1JCS A;  2VTB B;  2CHW A;  4U8H A;  5ENS D;  4JZY A;  4TXP A;  3DSX A;  4DRX E;  4L2L A;  1MX4 A;  5AQ7 A;  1Z6T A;  3AG2 E;  3Q79 A;  4IRU A;  3FH8 A;  4L9P A;  3APC A;  1N4Q A;  4HS2 A;  4GZC A;  3RO3 A;  3JQ1 A;  3SBT B;  1QZ2 A;  1LD8 A;  4AXH A;  1SA5 A;  3D9P A;  5E75 A;  1MZC A;  3UT7 A;  3T5V A;  4UWG A;  3MA5 A;  3NBN B;  4AEZ C;  3NZS A;  2R05 A;  3CV0 A;  4U96 D;  4ILI A;  4I1A A;  2DIW A;  4Q94 A;  3WXX A;  2XCB A;  4KZ0 A;  3FUM A;  4WWP A;  4GAA A;  4K5B A;  4UQX A;  4G8L A;  4PS3 A;  3O48 A;  3CVX A;  4LSZ E;  2V4L A;  2XEV A;  4UWK A;  1SW6 A;  4L2Y A;  2YQ8 A;  3IKO B;  2QZA A;  5CRU A;  5FZS A;  5DIZ A;  3RSE G;  4PDX A;  2P9L G;  2WXR A;  2RG8 A;  4CDR A;  4K5A B;  3CKB A;  5EYP F;  1S64 A;  2P58 C;  3FUD A;  5FQ8 A;  3CLJ A;  2KC7 A;  3NQP A;  1AWC B;  4YVQ C;  2OV8 A;  3SFZ A;  5FQ6 A;  2RFA A;  2WQ6 A;  4EHM A;  3AAA C;  2XS8 A;  3B7S A;  2P2C P;  3MV2 B;  2VSN A;  3EU5 A;  3TWQ A;  3SHF A;  4IYP A;  4URK A;  3SD5 A;  3FUE A;  1P5Q A;  4XX5 A;  1D8E A;  5EX0 A;  2EIJ E;  4KMO A;  1N0R A;  3ML9 A;  3R9M A;  3T8K A;  2EQX A;  3APF A;  3QNK A;  3J5P A;  3FH7 A;  3HXB A;  3QC1 A;  1OT8 A;  1DCE A;  4OAU C;  4JD2 G;  2FEZ A;  2IJG X;  2L6B A;  2WM9 A;  4CYM D;  4N2S A;  4P29 A;  4FJZ A;  3PZ1 A;  4O6F A;  1WM5 A;  4FC8 A;  3FTY A;  4N3B A;  2LXM A;  4UI9 K;  2CFZ A;  1LF8 A;  4I9E A;  5CRV A;  1IHB A;  4I1M A;  3ABM E;  3UTM A;  2NXP A;  3JXI A;  3SY2 A;  3S7J A;  2DYR E;  3FFL A;  3Q15 A;  3TWT A; 
#chains in the Genus database with same CATH homology
 3E33 A;  3HXD A;  1N4R A;  1S64 A;  1QBQ A;  2H6I A;  3DSW A;  1O5M A;  1N9A A;  2H6H A;  1TNZ A;  2H6G A;  3KSQ A;  1TNO A;  3KSL A;  1JCR A;  3HXC A;  1TNY A;  4MBG A;  1JCS A;  1N95 A;  4EHM A;  1NI1 A;  3EUV A;  3E34 A;  3Q73 A;  3DSU A;  3DPY A;  4GTP A;  3EU5 A;  3DSX A;  4GTV A;  1TN7 A;  4GTT A;  1S63 A;  1NL4 A;  3DSV A;  1TN8 A;  3Q7A A;  3C72 A;  3Q78 A;  1D8E A;  3Q79 A;  1LTX A;  3DRA A;  4L9P A;  4YDE A;  1N4Q A;  3E30 A;  1N4S A;  1KZP A;  2BED A;  1O1R A;  3SFY A;  1LD8 A;  3E32 A;  3HXB A;  1SA5 A;  3Q75 A;  1MZC A;  1DCE A;  1TNU A;  4GTR A;  1D8D A;  3DSS A;  3PZ3 A;  1N4P A;  3DST A;  1O1S A;  3E37 A;  1O1T A;  1JCQ A;  3PZ4 A;  3PZ2 A;  3Q7F A;  4GTS A;  2F0Y A;  1KZO A;  1LD7 A;  2ZIR A;  1X81 A;  4LNB A;  4GTQ A;  3PZ1 A;  2IEJ A;  3HXE A;  4YDO A;  4LNG A;  1FT1 A;  4GTM A;  3SFX A;  2R2L A;  4GTO A;  2H6F A;  1SA4 A;  1FT2 A;  3HXF A;  1TN6 A;  1TNB A;  1FPP A;  2ZIS A;  1N94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...