3Q79A

Cryptococcus neoformans protein farnesyltransferase in complex with farnesyl-ddptasacniq product
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
330
structure length
314
Chain Sequence
b'TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase alpha subunit
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase
total genus 122
structure length 314
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q79A00
1TN8A 1D8DA 1QBQA 2H6FA 2R2LA 3PZ1A 3Q78A 1FT1A 1SA4A 3Q75A 3PZ3A 1TNYA 4GTVA 1S64A 2H6IA 1N4SA 3KSQA 1S63A 1TN6A 4GTPA 1MZCA 1SA5A 4EHMA 3PZ2A 3SFXA 1TNBA 1N94A 1JCRA 3DSTA 3E37A 3HXDA 1O1SA 3DSUA 3Q73A 3Q79A 4YDEA 3Q7AA 1TN7A 2ZIRA 3E30A 3HXCA 1N9AA 1O1RA 4GTRA 3DPYA 4L9PA 4GTTA 1LTXA 1TNOA 3E34A 1FPPA 3PZ4A 4GTQA 1NI1A 1NL4A 3HXEA 1TNUA 1D8EA 3SFYA 1KZOA 3EUVA 1TNZA 1O5MA 2F0YA 1JCSA 3DSXA 4MBGA 1JCQA 3KSLA 1N95A 1LD8A 3Q7FA 2BEDA 3HXBA 3C72A 1N4QA 3DSVA 3E32A 3E33A 3EU5A 2ZISA 4GTOA 3DSWA 4LNBA 1DCEA 4GTSA 1X81A 3HXFA 1LD7A 1O1TA 4LNGA 4YDOA 1FT2A 1N4RA 2IEJA 1N4PA 3DSSA 2H6GA 3DRAA 1KZPA 2H6HA 4GTMA
chains in the Genus database with same CATH superfamily
4KZ0A 2NC9A 4G8LA 4AXHA 2FI7A 4CCAA 4XEIG 1Z5SC 1HH8A 1TN6A 4FHJA 5FTPA 4DUIA 3AG4E 3N71A 1EDUA 4APFA 2VYIA 1UW4B 2OOEA 1ZB1A 5AYWD 1P5QA 4TUUA 4CGWA 4GZDA 4I9EA 2WVIA 2BF0X 2BKKB 5BNWA 1DVPA 5BXOA 3HYMB 3RRUA 3MJWA 5CBOA 4GU5A 4AM9A 2OCCE 3DSXA 3QC1A 1WDYA 4KBQA 1IQUA 1ZU2A 3ZKJA 4J0UA 3QNKA 2LXMA 5CCLA 3OAWA 2YHEA 2R02A 3E32A 3E33A 4C0EA 4A63B 3HXFA 3MGBA 4F3VA 3R7QA 4R7LA 4WNFA 1IQRA 4B94A 3RAUA 2IEJA 1QNFA 5ENTD 1MX6A 3JYSA 2I1KA 2P9UG 2F8XK 3RO2A 2C0LA 3D9MA 1OWLA 2IY0C 4HRNA 3TL5A 4GA2A 4Y6WA 2XEVA 3Q78A 4CDRA 4WWNA 3Q4AB 5CERB 2XCCA 4U95D 2AXZA 1IXVA 5JJ6A 3AU5A 3ABKE 4CEMA 3PZ2A 1TNBA 2KC7A 5EKQD 3ZFWA 4UWLA 5KNGA 1H2VC 3UTMA 3QKYA 2X6IA 3EIJA 1U2VG 3FUJA 4M7CA 3CK8A 5AARA 4GA0A 4MRUA 3FDHA 3IV0A 5FIOA 1NI1A 5BV0A 4UWFA 4N3BA 4JW1A 2KBXA 4K5CA 1HF8A 3PUJA 5FT9A 4L1BA 4XI0A 4BSZB 1NP7A 2QFCA 3Q7FA 4U8VD 3IBEA 1U3CA 4Z68A 3T5VA 1OCRE 4DX1A 4WWOA 2KCLA 3DSWA 3P1UA 5EN5D 5G04J 4DPRA 3DEPA 3ULYA 4AOFA 4GCNA 3QJZA 4OVVA 3QB2A 3FUIA 5ENRD 3QK0A 5BPPA 5FQ4A 3G2WA 4B0ZA 1PY1A 3LDZA 4J7WA 1HS6A 1OWOA 4G25A 4X8QA 3B13A 4EHMA 3SFXA 4Q96A 5G2NA 2EIJE 2GGFA 2LUHA 4F7AA 1E7VA 1OUVA 3P2BA 2RG8A 3CVYA 5ENQD 3ULEG 2P9SG 3DEOA 4UI9C 2M63A 3ZYMA 3JXIA 1TNUA 2L0IA 5ENSD 4FP7A 2OV8A 3WXXA 1TR4A 2F0YA 1JCSA 2LAHA 1H2TC 3UKRG 4L23A 3HXBA 5JHBA 3PDNA 3L82A 4KZCA 2J49A 1Y8MA 4AIFA 4CT4A 1V54E 3ZUVB 2MRIA 5HQ8A 1RZ4A 2WXGA 1DCEA 4UWHA 4LEUA 3ONKA 3CHOA 1FT2A 2Y3AA 2GROB 3ISMC 4WNDA 2YQ8A 5B1BE 3DSSA 3IEGA 2L6BA 1IKND 3FU6A 4GZ3A 4AV7A 2WXLA 5ARFA 4BX9A 2UWJG 3CKBA 3DWLG 3VLFA 3FH5A 3OXFA 3S7DA 2CHWA 4UQYA 5AENA 4TV3A 4I6EA 1SVXA 3KSQA 1DC2A 3S2AA 4Y6CA 1Q2ZA 3UM3A 4ZHBA 2DYSE 3MEKA 3U66A 3CHRA 4E6HA 3Q7AA 1O1RA 2CFUA 1TEZA 4CZ2D 3TWQA 3UM0A 1LTXA 1H6OA 2DZOA 3CGHA 5FZQA 4J8FA 3TWUA 1ELWA 2RKKA 4N3CA 3JUEA 4FLHA 2WMNA 1KZOA 2QYJA 3EUVA 3FP3A 3B7UX 4LERA 1TNZA 1O5MA 4UQXA 2WQ7A 1OWNA 3SFZA 4KVOA 2AVPA 2KATA 2HO1A 2IQCA 3TXMA 3UI2A 3CVLA 2DVWA 3CHQA 2NXPA 4HI9A 3ASDA 1HFAA 3S7BA 4PS7A 3MCXA 5EX3A 4LUNU 5JMND 3QOUA 3CHSA 4GPKA 3TG5A 2Y4UA 1GW6A 3G2SA 1KZPA 4JA7A 4F1PA 4RQIA 3T9KA 5FZRA 4HB5A 4O1PA 2PL2A 4BT8A 4JHJA 5EYLA 5EIDA 3SY2A 1N4SA 5KNHD 1MX4A 2R5SA 4BTAA 3FTYA 3BG1B 4K03A 5ENOD 4K5BA 1E7UA 3DSTA 5FJYA 2DIWA 3CQGB 4HS2A 3ZNGA 5LCWJ 2XRZA 4ZFHA 5KBAA 1QZ2A 4HVBA 3E30A 3AS5A 2ZGGA 3W9FA 1N9AA 4B8CB 3PEVB 1ELKA 3L17A 5D66A 3LCAA 2RFMA 4XI9A 3UT8A 2X6JA 1MYOA 4JZYA 4I6GA 2LSUA 1NL4A 2CG3A 4WUYA 4J8YA 2BKGA 2J08A 1W3BA 1FVFA 3U64A 2XZTG 3EHQA 3FUEA 3BUAA 4EECA 4GAAA 4WNGA 3PS6A 3LKUA 4UWKA 4JVSA 5EIBE 2X6KA 4LNBA 4GTSA 4A1SA 3CK9A 1K3ZD 1N52A 3UUXA 3C98A 3BU8A 3ZXSA 4HORA 2GRQB 1OCCE 3FTWA 2P2CP 4Q69A 4U8HA 5FQ8A 1QBQA 4CT0A 3RO3A 4H7YA 3Q49B 1S64A 4GTPA 1MZCA 2X6FA 3KEZA 4YVOA 1HE8A 3PREA 2XGSA 3SBSA 4XE0A 4YDEA 2B0OE 4JL0A 1IHBA 4HXIA 2CG2A 3SD5A 4GYYA 3JUIA 4FJZA 4TUMA 1UN8A 2XQ0A 1FPPA 5EDSA 4DI4A 5A7DB 4HNAD 2CHZA 3G2TA 5C1DA 4JPSA 1AP7A 4UWGA 2Y1LE 4C9BB 4V3IA 4BETA 3OXLA 5B1AE 1N95A 5DIZA 2PM7A 3NAWA 4HOQA 2OEWA 4XIFA 3RJVA 3ZYLA 3EHRA 1YYHA 2X38A 4AY5A 2I6HA 4WWPA 3U4TA 3L54A 4ATZD 4PUCA 3ASHA 4LG6A 3FU5A 3LEWA 4DX2A 2J07A 2B6CA 5CHEE 5DBKA 5JJTA 3MYVA 4BFRA 4DX6D 3LPZA 2OEVA 5EX0A 4EBAA 3CIAA 3ASGA 2H6FA 4TRQA 3UMVA 2VSYA 4U63A 3W9GA 2QC9A 2H6IA 5ENPD 1E90A 5AIJA 4BY6A 4YVQC 3APFA 3ZXPA 3S7FA 5AQAA 1MJ0A 4U07A 4BTBA 5FQ7A 3HG0D 3L08A 2VSXE 1TYQG 2WXKA 4U96D 4GTRA 3VTXA 4AVXA 2P58C 3FEXA 4K5AB 1X5BA 5FQ6A 1XNFA 2XENA 4C48B 3V2OA 4NQ0A 4BEPA 4U8YD 3LXUX 3JQ1A 5HI7A 3ZRHA 1K1AA 3IXEA 5CEAA 1HG2A 1LD8A 4I2WA 4A3TA 3FFLA 4HFGA 2FO1E 3FTXA 5AN8A 4MS6A 2Y0BG 2HE0A 4G8KA 3D9HA 1YCSB 3DSVA 3CHPA 3CVUA 3RIBA 4CYMD 2XGMA 3ESLA 3ML9A 3PH0C 2A4ZA 3J5QB 3IHYA 5CCMA 4I1AA 4B8AA 2L9BA 4J8DA 4U0SA 1H19A 5CECB 2JLBA 3JXJA 3FTVA 5A23A 3ZGQA 3Q15A 2KXPC 4AJWA 4HQDA 3RRNB 5ITZF 5EILA 3I3NA 4I43A 4YNDA 2Y4TA 5ANRA 2IOLA 4N39A 5BT1A 2ZIRA 2LXLA 3QAQA 4OVUA 3SF4A 2WXNA 4GTQA 2ILRA 3X2QE 1UOHA 3S7JA 1UJKA 4JD2G 2GRPB 1OT8A 3J5PA 1Y6IA 3Q47B 3MZLB 5HS0A 5LOZA 3D9OA 3R7RA 5FINA 2BEDA 4UI9J 5AQ7A 3UX4A 1N54A 4HOUA 3MV3B 1IYGA 5EYPF 3CVNA 1MQSA 1V55E 3FTZA 3TWTA 3TWXA 2WQ6A 4I1MA 5CRUA 3EDTB 5HKPA 4DX7D 2MYOA 2BTDA 3FUMA 5G05C 1X81A 4AEZC 4YDOA 4ILGA 2VTBA 1N4RA 3CLJA 3AS8A 2IJGX 3DRAA 4EBAG 3FHEA 2XPYA 2IONA 2WXJA 2KCVA 3CSFA 1ELRA 2R2LA 3UIPC 1G3NB 5IY5E 1TNYA 3I4RB 4GZCA 4GTVA 3UIOC 4QQIA 5G55A 4A1GA 4EZKA 2C2LA 3O48A 2ZGDA 4WAFA 3GYZA 3SI5A 4RSYA 3OTNA 3CVXA 3DXKG 4UI9K 4IYPA 1B89A 4GZ6A 3VLEA 2XGOA 3NOCD 1XGWA 4DLOA 3AG2E 5H7PA 3ZEFA 1Z3YA 4BESA 1EF1C 3KEAA 4F53A 1AWCB 3I5PA 1WY6A 3DPDA 4N5CA 3MA5A 5AAOA 3ENEA 3C3RA 3NQPA 3L13A 4XX5A 4B93B 2AJAA 4DX5D 2WXQA 3C3QA 1KT1A 5D2MC 3ZYQA 5KJLA 3B95A 3F6QA 2I9CA 4FADA 4BERA 3Q5MA 4GA1A 4FJYA 1UJJA 3CKCA 3CVVA 2LSVA 3ZU7B 4TXRA 2PNNA 4MLPA 3FUHA 4GTOA 5LFAA 4J8EA 4EZLA 2ONDA 2WXRA 4PH4B 4L2YA 1E8YA 4HLLA 1SW6A 4M3OA 2DCPA 3PRZA 1JPLA 2JABA 2XEEA 4APOA 2OVFA 1BPOA 3D9PA 2R17C 3KD7A 1NZNA 2HYZA 4NURA 2YHCA 3G2VA 4N2QA 4IRUA 5E75A 4ATGA 3HRAA 1OXJA 2NSZA 1KLXA 4O60A 1HO8A 4MKTA 3HIZA 4PS3A 4G23A 4G26A 3HXCA 4TXPA 3TWVA 3HVEA 1VDYA 4GTTA 4NACA 2AWIA 3V79K 1OY3D 1TNOA 4DRXE 3E34A 4FHKA 3UT7A 2XS8A 3I4GA 4DI3A 4FLBA 1D8EA 2EILE 3B7RL 3T8KA 4HBDA 4GMLA 2Q7FA 2J4BA 2LNIA 1JCQA 4BWRA 5CMWA 4LRZA 3FULA 3UM2A 3FTSA 2C0MA 1JWGA 4BT9A 1N4QA 5AJLA 4DLQA 3ASFA 3CR3A 3UM1A 2FF4A 3MX3A 1KPSB 4FU3A 5CEDB 2V5QC 3L16A 3NBNB 4Q94A 1LF8A 3MKRA 3AAAC 4HOTA 1N11A 3ASNE 2L0TB 3PZ1A 1TJFA 3KAEA 3R9AB 3T8MA 2HM8A 3NZUA 3LY7A 3ABLE 2DYRE 5BUZA 1JCRA 1U3DA 3E4BA 3L6AA 1N0RA 4DK5A 5A6CA 2IFUA 4XKCA 2DWZA 5D0QD 4JHRA 3DPYA 3FUFA 4RLYA 4L2LA 3FY4A 5ARGA 1WG0A 4GYOA 4F1SA 2WXFA 4PS8A 5J08A 4XZ4A 2FBNA 2RFAA 4O1OA 5KJNA 1Z6TA 3SFYA 1E8WA 2UY1B 5C2YA 4OAUC 5T4YA 4B89A 4DJAA 2R59A 3HHMA 3PNTB 3APDA 3QARA 4KMOA 2GRRB 3NF1A 2ETBA 3R9MA 2UY1A 1PAQA 4I17A 1EYHA 4I6JA 3JCKC 3OXGA 2J4DA 2XCBA 3T5XA 5CRVA 5KWDA 4O6FA 1LD7A 4HRLA 2L6JA 4BSXA 1O1TA 4G24A 1L5JA 3SGHA 4J6IA 1N4PA 1SQMA 1E96B 1S70B 2DBAA 1NA3A 3TWWA 3NZSA 4ACLA 5FWQA 1YA0A 4QFVA 3D3MA 1SA4A 2VSOE 2EIME 3CQCB 4TXQA 1DCQA 4YDWA 2XS1A 4GB9A 1E8ZA 3LS8A 2DZNA 2EIKE 3E37A 3NB2A 4C0MA 3PE3A 3QWVA 2IO3C 1ZBPA 2EQXA 1JUQA 3GZ1A 2WM9A 4UUCA 2P9NG 3D9IA 3EHNA 2AXUA 4L7TA 3GZSA 5E76A 3VTYA 4CDMA 2GRLA 2P9PG 2XPZA 4ACKA 2YNQA 2IO2C 3ONLA 2VGEA 2E2EA 3RU0A 2GRNB 3RK6A 3IHVA 3KS2A 1H6PA 1HX8A 1N0QA 4OYSA 2P9IG 3ESKA 5BXUA 1QQEA 3SHFA 2ZXWE 4LNGA 3LY8A 3RKVA 1HZ4A 4GZ5A 3ABME 4UQZA 3PEUB 2VSNA 2X6HA 2H6GA 1UN9A 4ANXA 3SQVA 3UT4A 5B3SE 5M72A 5AQ9A 3Q9NC 3CK7A 2ETCA 2RD0A 4EZJA 1H6KA 3LJNA 3PZ3A 1H0AA 2XRYA 3UINC 3U3WA 3TJPA 2HR2A 4AP2A 3EU9A 2GRMA 1S63A 5LP0A 1SA5A 3GZ2A 5J90A 3ML8A 3G2UA 3FWVA 5T8IA 4AY6A 1OCOE 3DSUA 4IULA 4J8SA 3Q79A 1SZ9A 3URZA 3AG3E 3FH8A 5ANLA 4I2ZA 2BUGA 1HXIA 3AS4A 5AQBA 4RG9A 2LAIA 4ILHB 1FCHA 2QY7A 1HG5A 4ANUA 4LSZE 3HXEA 3LJ3A 3RSEG 4RVBA 3ZIMA 2CHXA 5BV1A 2WXHA 2V0PA 2WXMA 1WM5A 4U04A 3KSLA 3PNLB 3FEYA 2A5EA 2WPVA 1SZAA 5G04C 4JB8P 4U0UA 3D9NA 5FZSA 5ENNA 1K1BA 3C72A 2I1JA 2V4LA 2VQ2A 1PC2A 2XEHA 2YINA 3EU5A 4N3AA 2ZISA 4U0ZA 4D10C 3B7BA 4ABNA 2WB2A 3DBSA 4A3VA 2KCKA 1WAO1 3TWSA 5JJ7A 2GW1A 2NYJA 3O4ZA 2WQHA 2VTBB 2KZTB 1TN8A 2WMOA 3CSTA 1D8DA 5KCMA 5G05J 3EHMA 1KT0A 1OWMA 2J09A 2XHEA 3D9JA 5T3RA 2KZTA 2R05A 3FTUA 4HRMB 3QDNA 3UQ3A 4A55A 4W9RA 4HOSA 5CMYA 1UG3A 3HXDA 2QZAA 4ANWA 2F8YA 3CEQA 2VGYA 3BQOA 3FH7A 3ULQA 3APCA 3PUKA 2ETAA 1Z3XA 2PM6A 4KXKB 2CFZA 3SZ7A 3LVQE 2P9LG 1BU9A 3FUNA 2E0IA 4G2VA 2XZDG 3CVQA 3NOGD 3V30A 2PZIA 4NRHB 3ZPJA 5BW8C 3CHMA 4RG6A 4KVMA 2LO6A 3UPVA 2ZU6B 3D9LA 3WG7E 2A5UA 2Y69E 3FUDA 3AU4A 1E8XA 2EINE 3IKOB 3AJIA 3MKQB 2WXIA 3EJNA 1S0PA 3SNXA 3ZYKA 3MV2B 1QYMA 2J8SD 2FEZA 4CGVA 3MKQA 4K0RA 4E85A 1O1SA 4FULA 2VJ8A 3Q73A 3ZHEB 2FULA 4WNEA 3JQ0A 2AW6A 1IHGA 1BI7B 1H2UA 3VLDA 4F6RD 4FA6A 1MX2A 3ZHEA 2WXOA 2V8SE 3CVPA 1D9SA 4GCOA 5KJKA 3ZN3A 3HVEB 1A17A 3TAXA 2JEKA 4HI8A 4FC8A 2AXVA 5HRYA 4MBGA 4EPZA 3HDXA 3Q9UC 1BLXB 5LX8A 4IN3B 5KJMA 4JHKA 4JC8A 3QWWA 3BEEA 3LY9A 4JA9A 3FUKA 3V2XA 4GYWA 3FU3A 4XKBA 4ILIA 4N2SA 3QWPA 1K8KG 2IF4A 3FU0A 3RRMB 4URKA 1NFIE 3ZW3A 3LYAA 4ME2A 3UXGA 3PZDA 5JA4D 5AJDA 2H6HA 4GTMA 2J9QA 3B7SA 3B7TA 4KT6B 5LCWC 3LVRE 3SBTB 4GMRA 3SO8A 3ZVVA 3CVWA 3V31A 1FT1A 4JEHA 3Q75A 4G1TA 2PQNA 3ASOE 1DNPA 2I2OA 4U7EB 3AG1E 3UKUG 1OCZE 4EQFA 4YDYA 1N94A 3C3OA 2MOWA 1RW2A 3L9TA 3DXMG 2MHKA 1HU3A 3D9KA 4NIKA 1TJCA 2IU1A 2FO7A 3PE4A 2V5FA 3L22A 4BX8A 4HLEA 3TWRA 1TN7A 2V4HC 4ANVA 3BG0B 4N5QA 4KYOB 2KM4A 1OWPA 4L9PA 1EPUA 3CV0A 3TG4A 3PZ4A 1NA0A 4LNUD 4CDNA 2P9KG 3C5RA 1BI8B 2IOSA 4I1OB 4JEUA 3U9WA 2QYUA 2VGXB 2XPIA 1JWFA 5D0OD 4CRWA 4I9CA 2F37A 3TXNA 3GW4A 4OAVB 5JHAA 2PQRA 3TGOA 2VGXA 2X3MA 2OVBA 4H7XA 1BD8A 4JXTA 4GPMA 5CBNA 4GMJA 3PVLA 1FVHA 1INZA 4PDXA 2WXPA 1YMPA 1MHQA 4G11A 3K9IA 4LCTA 2R03A 1A5EA 4P29A 3EIQC
chains in the Genus database with same CATH topology
1TN8A 1D8DA 1QBQA 2H6FA 2R2LA 3PZ1A 3Q78A 1FT1A 1SA4A 3Q75A 3PZ3A 1TNYA 4GTVA 1S64A 2H6IA 1N4SA 3KSQA 1S63A 1TN6A 4GTPA 1MZCA 1SA5A 4EHMA 3PZ2A 3SFXA 1TNBA 1N94A 1JCRA 3DSTA 3E37A 3HXDA 1O1SA 3DSUA 3Q73A 3Q79A 4YDEA 3Q7AA 1TN7A 2ZIRA 3E30A 3HXCA 1N9AA 1O1RA 4GTRA 3DPYA 4L9PA 4GTTA 1LTXA 1TNOA 3E34A 1FPPA 3PZ4A 4GTQA 1NI1A 1NL4A 3HXEA 1TNUA 1D8EA 3SFYA 1KZOA 3EUVA 1TNZA 1O5MA 2F0YA 1JCSA 3DSXA 4MBGA 1JCQA 3KSLA 1N95A 1LD8A 3Q7FA 2BEDA 3HXBA 3C72A 1N4QA 3DSVA 3E32A 3E33A 3EU5A 2ZISA 4GTOA 3DSWA 4LNBA 1DCEA 4GTSA 1X81A 3HXFA 1LD7A 1O1TA 4LNGA 4YDOA 1FT2A 1N4RA 2IEJA 1N4PA 3DSSA 2H6GA 3DRAA 1KZPA 2H6HA 4GTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN8 A;  1D8D A;  1QBQ A;  2H6F A;  2R2L A;  3PZ1 A;  3Q78 A;  1FT1 A;  1SA4 A;  3Q75 A;  3PZ3 A;  1TNY A;  4GTV A;  1S64 A;  2H6I A;  1N4S A;  3KSQ A;  1S63 A;  1TN6 A;  4GTP A;  1MZC A;  1SA5 A;  4EHM A;  3PZ2 A;  3SFX A;  1TNB A;  1N94 A;  1JCR A;  3DST A;  3E37 A;  3HXD A;  1O1S A;  3DSU A;  3Q73 A;  3Q79 A;  4YDE A;  3Q7A A;  1TN7 A;  2ZIR A;  3E30 A;  3HXC A;  1N9A A;  1O1R A;  4GTR A;  3DPY A;  4L9P A;  4GTT A;  1LTX A;  1TNO A;  3E34 A;  1FPP A;  3PZ4 A;  4GTQ A;  1NI1 A;  1NL4 A;  3HXE A;  1TNU A;  1D8E A;  3SFY A;  1KZO A;  3EUV A;  1TNZ A;  1O5M A;  2F0Y A;  1JCS A;  3DSX A;  4MBG A;  1JCQ A;  3KSL A;  1N95 A;  1LD8 A;  3Q7F A;  2BED A;  3HXB A;  3C72 A;  1N4Q A;  3DSV A;  3E32 A;  3E33 A;  3EU5 A;  2ZIS A;  4GTO A;  3DSW A;  4LNB A;  1DCE A;  4GTS A;  1X81 A;  3HXF A;  1LD7 A;  1O1T A;  4LNG A;  4YDO A;  1FT2 A;  1N4R A;  2IEJ A;  1N4P A;  3DSS A;  2H6G A;  3DRA A;  1KZP A;  2H6H A;  4GTM A; 
#chains in the Genus database with same CATH topology
 4KZ0 A;  2NC9 A;  4G8L A;  4AXH A;  2FI7 A;  4CCA A;  4XEI G;  1Z5S C;  1HH8 A;  1TN6 A;  4FHJ A;  5FTP A;  4DUI A;  3AG4 E;  3N71 A;  1EDU A;  4APF A;  2VYI A;  1UW4 B;  2OOE A;  1ZB1 A;  5AYW D;  1P5Q A;  4TUU A;  4CGW A;  4GZD A;  4I9E A;  2WVI A;  2BF0 X;  2BKK B;  5BNW A;  1DVP A;  5BXO A;  3HYM B;  3RRU A;  3MJW A;  5CBO A;  4GU5 A;  4AM9 A;  2OCC E;  3DSX A;  3QC1 A;  1WDY A;  4KBQ A;  1IQU A;  1ZU2 A;  3ZKJ A;  4J0U A;  3QNK A;  2LXM A;  5CCL A;  3OAW A;  2YHE A;  2R02 A;  3E32 A;  3E33 A;  4C0E A;  4A63 B;  3HXF A;  3MGB A;  4F3V A;  3R7Q A;  4R7L A;  4WNF A;  1IQR A;  4B94 A;  3RAU A;  2IEJ A;  1QNF A;  5ENT D;  1MX6 A;  3JYS A;  2I1K A;  2P9U G;  2F8X K;  3RO2 A;  2C0L A;  3D9M A;  1OWL A;  2IY0 C;  4HRN A;  3TL5 A;  4GA2 A;  4Y6W A;  2XEV A;  3Q78 A;  4CDR A;  4WWN A;  3Q4A B;  5CER B;  2XCC A;  4U95 D;  2AXZ A;  1IXV A;  5JJ6 A;  3AU5 A;  3ABK E;  4CEM A;  3PZ2 A;  1TNB A;  2KC7 A;  5EKQ D;  3ZFW A;  4UWL A;  5KNG A;  1H2V C;  3UTM A;  3QKY A;  2X6I A;  3EIJ A;  1U2V G;  3FUJ A;  4M7C A;  3CK8 A;  5AAR A;  4GA0 A;  4MRU A;  3FDH A;  3IV0 A;  5FIO A;  1NI1 A;  5BV0 A;  4UWF A;  4N3B A;  4JW1 A;  2KBX A;  4K5C A;  1HF8 A;  3PUJ A;  5FT9 A;  4L1B A;  4XI0 A;  4BSZ B;  1NP7 A;  2QFC A;  3Q7F A;  4U8V D;  3IBE A;  1U3C A;  4Z68 A;  3T5V A;  1OCR E;  4DX1 A;  4WWO A;  2KCL A;  3DSW A;  3P1U A;  5EN5 D;  5G04 J;  4DPR A;  3DEP A;  3ULY A;  4AOF A;  4GCN A;  3QJZ A;  4OVV A;  3QB2 A;  3FUI A;  5ENR D;  3QK0 A;  5BPP A;  5FQ4 A;  3G2W A;  4B0Z A;  1PY1 A;  3LDZ A;  4J7W A;  1HS6 A;  1OWO A;  4G25 A;  4X8Q A;  3B13 A;  4EHM A;  3SFX A;  4Q96 A;  5G2N A;  2EIJ E;  2GGF A;  2LUH A;  4F7A A;  1E7V A;  1OUV A;  3P2B A;  2RG8 A;  3CVY A;  5ENQ D;  3ULE G;  2P9S G;  3DEO A;  4UI9 C;  2M63 A;  3ZYM A;  3JXI A;  1TNU A;  2L0I A;  5ENS D;  4FP7 A;  2OV8 A;  3WXX A;  1TR4 A;  2F0Y A;  1JCS A;  2LAH A;  1H2T C;  3UKR G;  4L23 A;  3HXB A;  5JHB A;  3PDN A;  3L82 A;  4KZC A;  2J49 A;  1Y8M A;  4AIF A;  4CT4 A;  1V54 E;  3ZUV B;  2MRI A;  5HQ8 A;  1RZ4 A;  2WXG A;  1DCE A;  4UWH A;  4LEU A;  3ONK A;  3CHO A;  1FT2 A;  2Y3A A;  2GRO B;  3ISM C;  4WND A;  2YQ8 A;  5B1B E;  3DSS A;  3IEG A;  2L6B A;  1IKN D;  3FU6 A;  4GZ3 A;  4AV7 A;  2WXL A;  5ARF A;  4BX9 A;  2UWJ G;  3CKB A;  3DWL G;  3VLF A;  3FH5 A;  3OXF A;  3S7D A;  2CHW A;  4UQY A;  5AEN A;  4TV3 A;  4I6E A;  1SVX A;  3KSQ A;  1DC2 A;  3S2A A;  4Y6C A;  1Q2Z A;  3UM3 A;  4ZHB A;  2DYS E;  3MEK A;  3U66 A;  3CHR A;  4E6H A;  3Q7A A;  1O1R A;  2CFU A;  1TEZ A;  4CZ2 D;  3TWQ A;  3UM0 A;  1LTX A;  1H6O A;  2DZO A;  3CGH A;  5FZQ A;  4J8F A;  3TWU A;  1ELW A;  2RKK A;  4N3C A;  3JUE A;  4FLH A;  2WMN A;  1KZO A;  2QYJ A;  3EUV A;  3FP3 A;  3B7U X;  4LER A;  1TNZ A;  1O5M A;  4UQX A;  2WQ7 A;  1OWN A;  3SFZ A;  4KVO A;  2AVP A;  2KAT A;  2HO1 A;  2IQC A;  3TXM A;  3UI2 A;  3CVL A;  2DVW A;  3CHQ A;  2NXP A;  4HI9 A;  3ASD A;  1HFA A;  3S7B A;  4PS7 A;  3MCX A;  5EX3 A;  4LUN U;  5JMN D;  3QOU A;  3CHS A;  4GPK A;  3TG5 A;  2Y4U A;  1GW6 A;  3G2S A;  1KZP A;  4JA7 A;  4F1P A;  4RQI A;  3T9K A;  5FZR A;  4HB5 A;  4O1P A;  2PL2 A;  4BT8 A;  4JHJ A;  5EYL A;  5EID A;  3SY2 A;  1N4S A;  5KNH D;  1MX4 A;  2R5S A;  4BTA A;  3FTY A;  3BG1 B;  4K03 A;  5ENO D;  4K5B A;  1E7U A;  3DST A;  5FJY A;  2DIW A;  3CQG B;  4HS2 A;  3ZNG A;  5LCW J;  2XRZ A;  4ZFH A;  5KBA A;  1QZ2 A;  4HVB A;  3E30 A;  3AS5 A;  2ZGG A;  3W9F A;  1N9A A;  4B8C B;  3PEV B;  1ELK A;  3L17 A;  5D66 A;  3LCA A;  2RFM A;  4XI9 A;  3UT8 A;  2X6J A;  1MYO A;  4JZY A;  4I6G A;  2LSU A;  1NL4 A;  2CG3 A;  4WUY A;  4J8Y A;  2BKG A;  2J08 A;  1W3B A;  1FVF A;  3U64 A;  2XZT G;  3EHQ A;  3FUE A;  3BUA A;  4EEC A;  4GAA A;  4WNG A;  3PS6 A;  3LKU A;  4UWK A;  4JVS A;  5EIB E;  2X6K A;  4LNB A;  4GTS A;  4A1S A;  3CK9 A;  1K3Z D;  1N52 A;  3UUX A;  3C98 A;  3BU8 A;  3ZXS A;  4HOR A;  2GRQ B;  1OCC E;  3FTW A;  2P2C P;  4Q69 A;  4U8H A;  5FQ8 A;  1QBQ A;  4CT0 A;  3RO3 A;  4H7Y A;  3Q49 B;  1S64 A;  4GTP A;  1MZC A;  2X6F A;  3KEZ A;  4YVO A;  1HE8 A;  3PRE A;  2XGS A;  3SBS A;  4XE0 A;  4YDE A;  2B0O E;  4JL0 A;  1IHB A;  4HXI A;  2CG2 A;  3SD5 A;  4GYY A;  3JUI A;  4FJZ A;  4TUM A;  1UN8 A;  2XQ0 A;  1FPP A;  5EDS A;  4DI4 A;  5A7D B;  4HNA D;  2CHZ A;  3G2T A;  5C1D A;  4JPS A;  1AP7 A;  4UWG A;  2Y1L E;  4C9B B;  4V3I A;  4BET A;  3OXL A;  5B1A E;  1N95 A;  5DIZ A;  2PM7 A;  3NAW A;  4HOQ A;  2OEW A;  4XIF A;  3RJV A;  3ZYL A;  3EHR A;  1YYH A;  2X38 A;  4AY5 A;  2I6H A;  4WWP A;  3U4T A;  3L54 A;  4ATZ D;  4PUC A;  3ASH A;  4LG6 A;  3FU5 A;  3LEW A;  4DX2 A;  2J07 A;  2B6C A;  5CHE E;  5DBK A;  5JJT A;  3MYV A;  4BFR A;  4DX6 D;  3LPZ A;  2OEV A;  5EX0 A;  4EBA A;  3CIA A;  3ASG A;  2H6F A;  4TRQ A;  3UMV A;  2VSY A;  4U63 A;  3W9G A;  2QC9 A;  2H6I A;  5ENP D;  1E90 A;  5AIJ A;  4BY6 A;  4YVQ C;  3APF A;  3ZXP A;  3S7F A;  5AQA A;  1MJ0 A;  4U07 A;  4BTB A;  5FQ7 A;  3HG0 D;  3L08 A;  2VSX E;  1TYQ G;  2WXK A;  4U96 D;  4GTR A;  3VTX A;  4AVX A;  2P58 C;  3FEX A;  4K5A B;  1X5B A;  5FQ6 A;  1XNF A;  2XEN A;  4C48 B;  3V2O A;  4NQ0 A;  4BEP A;  4U8Y D;  3LXU X;  3JQ1 A;  5HI7 A;  3ZRH A;  1K1A A;  3IXE A;  5CEA A;  1HG2 A;  1LD8 A;  4I2W A;  4A3T A;  3FFL A;  4HFG A;  2FO1 E;  3FTX A;  5AN8 A;  4MS6 A;  2Y0B G;  2HE0 A;  4G8K A;  3D9H A;  1YCS B;  3DSV A;  3CHP A;  3CVU A;  3RIB A;  4CYM D;  2XGM A;  3ESL A;  3ML9 A;  3PH0 C;  2A4Z A;  3J5Q B;  3IHY A;  5CCM A;  4I1A A;  4B8A A;  2L9B A;  4J8D A;  4U0S A;  1H19 A;  5CEC B;  2JLB A;  3JXJ A;  3FTV A;  5A23 A;  3ZGQ A;  3Q15 A;  2KXP C;  4AJW A;  4HQD A;  3RRN B;  5ITZ F;  5EIL A;  3I3N A;  4I43 A;  4YND A;  2Y4T A;  5ANR A;  2IOL A;  4N39 A;  5BT1 A;  2ZIR A;  2LXL A;  3QAQ A;  4OVU A;  3SF4 A;  2WXN A;  4GTQ A;  2ILR A;  3X2Q E;  1UOH A;  3S7J A;  1UJK A;  4JD2 G;  2GRP B;  1OT8 A;  3J5P A;  1Y6I A;  3Q47 B;  3MZL B;  5HS0 A;  5LOZ A;  3D9O A;  3R7R A;  5FIN A;  2BED A;  4UI9 J;  5AQ7 A;  3UX4 A;  1N54 A;  4HOU A;  3MV3 B;  1IYG A;  5EYP F;  3CVN A;  1MQS A;  1V55 E;  3FTZ A;  3TWT A;  3TWX A;  2WQ6 A;  4I1M A;  5CRU A;  3EDT B;  5HKP A;  4DX7 D;  2MYO A;  2BTD A;  3FUM A;  5G05 C;  1X81 A;  4AEZ C;  4YDO A;  4ILG A;  2VTB A;  1N4R A;  3CLJ A;  3AS8 A;  2IJG X;  3DRA A;  4EBA G;  3FHE A;  2XPY A;  2ION A;  2WXJ A;  2KCV A;  3CSF A;  1ELR A;  2R2L A;  3UIP C;  1G3N B;  5IY5 E;  1TNY A;  3I4R B;  4GZC A;  4GTV A;  3UIO C;  4QQI A;  5G55 A;  4A1G A;  4EZK A;  2C2L A;  3O48 A;  2ZGD A;  4WAF A;  3GYZ A;  3SI5 A;  4RSY A;  3OTN A;  3CVX A;  3DXK G;  4UI9 K;  4IYP A;  1B89 A;  4GZ6 A;  3VLE A;  2XGO A;  3NOC D;  1XGW A;  4DLO A;  3AG2 E;  5H7P A;  3ZEF A;  1Z3Y A;  4BES A;  1EF1 C;  3KEA A;  4F53 A;  1AWC B;  3I5P A;  1WY6 A;  3DPD A;  4N5C A;  3MA5 A;  5AAO A;  3ENE A;  3C3R A;  3NQP A;  3L13 A;  4XX5 A;  4B93 B;  2AJA A;  4DX5 D;  2WXQ A;  3C3Q A;  1KT1 A;  5D2M C;  3ZYQ A;  5KJL A;  3B95 A;  3F6Q A;  2I9C A;  4FAD A;  4BER A;  3Q5M A;  4GA1 A;  4FJY A;  1UJJ A;  3CKC A;  3CVV A;  2LSV A;  3ZU7 B;  4TXR A;  2PNN A;  4MLP A;  3FUH A;  4GTO A;  5LFA A;  4J8E A;  4EZL A;  2OND A;  2WXR A;  4PH4 B;  4L2Y A;  1E8Y A;  4HLL A;  1SW6 A;  4M3O A;  2DCP A;  3PRZ A;  1JPL A;  2JAB A;  2XEE A;  4APO A;  2OVF A;  1BPO A;  3D9P A;  2R17 C;  3KD7 A;  1NZN A;  2HYZ A;  4NUR A;  2YHC A;  3G2V A;  4N2Q A;  4IRU A;  5E75 A;  4ATG A;  3HRA A;  1OXJ A;  2NSZ A;  1KLX A;  4O60 A;  1HO8 A;  4MKT A;  3HIZ A;  4PS3 A;  4G23 A;  4G26 A;  3HXC A;  4TXP A;  3TWV A;  3HVE A;  1VDY A;  4GTT A;  4NAC A;  2AWI A;  3V79 K;  1OY3 D;  1TNO A;  4DRX E;  3E34 A;  4FHK A;  3UT7 A;  2XS8 A;  3I4G A;  4DI3 A;  4FLB A;  1D8E A;  2EIL E;  3B7R L;  3T8K A;  4HBD A;  4GML A;  2Q7F A;  2J4B A;  2LNI A;  1JCQ A;  4BWR A;  5CMW A;  4LRZ A;  3FUL A;  3UM2 A;  3FTS A;  2C0M A;  1JWG A;  4BT9 A;  1N4Q A;  5AJL A;  4DLQ A;  3ASF A;  3CR3 A;  3UM1 A;  2FF4 A;  3MX3 A;  1KPS B;  4FU3 A;  5CED B;  2V5Q C;  3L16 A;  3NBN B;  4Q94 A;  1LF8 A;  3MKR A;  3AAA C;  4HOT A;  1N11 A;  3ASN E;  2L0T B;  3PZ1 A;  1TJF A;  3KAE A;  3R9A B;  3T8M A;  2HM8 A;  3NZU A;  3LY7 A;  3ABL E;  2DYR E;  5BUZ A;  1JCR A;  1U3D A;  3E4B A;  3L6A A;  1N0R A;  4DK5 A;  5A6C A;  2IFU A;  4XKC A;  2DWZ A;  5D0Q D;  4JHR A;  3DPY A;  3FUF A;  4RLY A;  4L2L A;  3FY4 A;  5ARG A;  1WG0 A;  4GYO A;  4F1S A;  2WXF A;  4PS8 A;  5J08 A;  4XZ4 A;  2FBN A;  2RFA A;  4O1O A;  5KJN A;  1Z6T A;  3SFY A;  1E8W A;  2UY1 B;  5C2Y A;  4OAU C;  5T4Y A;  4B89 A;  4DJA A;  2R59 A;  3HHM A;  3PNT B;  3APD A;  3QAR A;  4KMO A;  2GRR B;  3NF1 A;  2ETB A;  3R9M A;  2UY1 A;  1PAQ A;  4I17 A;  1EYH A;  4I6J A;  3JCK C;  3OXG A;  2J4D A;  2XCB A;  3T5X A;  5CRV A;  5KWD A;  4O6F A;  1LD7 A;  4HRL A;  2L6J A;  4BSX A;  1O1T A;  4G24 A;  1L5J A;  3SGH A;  4J6I A;  1N4P A;  1SQM A;  1E96 B;  1S70 B;  2DBA A;  1NA3 A;  3TWW A;  3NZS A;  4ACL A;  5FWQ A;  1YA0 A;  4QFV A;  3D3M A;  1SA4 A;  2VSO E;  2EIM E;  3CQC B;  4TXQ A;  1DCQ A;  4YDW A;  2XS1 A;  4GB9 A;  1E8Z A;  3LS8 A;  2DZN A;  2EIK E;  3E37 A;  3NB2 A;  4C0M A;  3PE3 A;  3QWV A;  2IO3 C;  1ZBP A;  2EQX A;  1JUQ A;  3GZ1 A;  2WM9 A;  4UUC A;  2P9N G;  3D9I A;  3EHN A;  2AXU A;  4L7T A;  3GZS A;  5E76 A;  3VTY A;  4CDM A;  2GRL A;  2P9P G;  2XPZ A;  4ACK A;  2YNQ A;  2IO2 C;  3ONL A;  2VGE A;  2E2E A;  3RU0 A;  2GRN B;  3RK6 A;  3IHV A;  3KS2 A;  1H6P A;  1HX8 A;  1N0Q A;  4OYS A;  2P9I G;  3ESK A;  5BXU A;  1QQE A;  3SHF A;  2ZXW E;  4LNG A;  3LY8 A;  3RKV A;  1HZ4 A;  4GZ5 A;  3ABM E;  4UQZ A;  3PEU B;  2VSN A;  2X6H A;  2H6G A;  1UN9 A;  4ANX A;  3SQV A;  3UT4 A;  5B3S E;  5M72 A;  5AQ9 A;  3Q9N C;  3CK7 A;  2ETC A;  2RD0 A;  4EZJ A;  1H6K A;  3LJN A;  3PZ3 A;  1H0A A;  2XRY A;  3UIN C;  3U3W A;  3TJP A;  2HR2 A;  4AP2 A;  3EU9 A;  2GRM A;  1S63 A;  5LP0 A;  1SA5 A;  3GZ2 A;  5J90 A;  3ML8 A;  3G2U A;  3FWV A;  5T8I A;  4AY6 A;  1OCO E;  3DSU A;  4IUL A;  4J8S A;  3Q79 A;  1SZ9 A;  3URZ A;  3AG3 E;  3FH8 A;  5ANL A;  4I2Z A;  2BUG A;  1HXI A;  3AS4 A;  5AQB A;  4RG9 A;  2LAI A;  4ILH B;  1FCH A;  2QY7 A;  1HG5 A;  4ANU A;  4LSZ E;  3HXE A;  3LJ3 A;  3RSE G;  4RVB A;  3ZIM A;  2CHX A;  5BV1 A;  2WXH A;  2V0P A;  2WXM A;  1WM5 A;  4U04 A;  3KSL A;  3PNL B;  3FEY A;  2A5E A;  2WPV A;  1SZA A;  5G04 C;  4JB8 P;  4U0U A;  3D9N A;  5FZS A;  5ENN A;  1K1B A;  3C72 A;  2I1J A;  2V4L A;  2VQ2 A;  1PC2 A;  2XEH A;  2YIN A;  3EU5 A;  4N3A A;  2ZIS A;  4U0Z A;  4D10 C;  3B7B A;  4ABN A;  2WB2 A;  3DBS A;  4A3V A;  2KCK A;  1WAO 1;  3TWS A;  5JJ7 A;  2GW1 A;  2NYJ A;  3O4Z A;  2WQH A;  2VTB B;  2KZT B;  1TN8 A;  2WMO A;  3CST A;  1D8D A;  5KCM A;  5G05 J;  3EHM A;  1KT0 A;  1OWM A;  2J09 A;  2XHE A;  3D9J A;  5T3R A;  2KZT A;  2R05 A;  3FTU A;  4HRM B;  3QDN A;  3UQ3 A;  4A55 A;  4W9R A;  4HOS A;  5CMY A;  1UG3 A;  3HXD A;  2QZA A;  4ANW A;  2F8Y A;  3CEQ A;  2VGY A;  3BQO A;  3FH7 A;  3ULQ A;  3APC A;  3PUK A;  2ETA A;  1Z3X A;  2PM6 A;  4KXK B;  2CFZ A;  3SZ7 A;  3LVQ E;  2P9L G;  1BU9 A;  3FUN A;  2E0I A;  4G2V A;  2XZD G;  3CVQ A;  3NOG D;  3V30 A;  2PZI A;  4NRH B;  3ZPJ A;  5BW8 C;  3CHM A;  4RG6 A;  4KVM A;  2LO6 A;  3UPV A;  2ZU6 B;  3D9L A;  3WG7 E;  2A5U A;  2Y69 E;  3FUD A;  3AU4 A;  1E8X A;  2EIN E;  3IKO B;  3AJI A;  3MKQ B;  2WXI A;  3EJN A;  1S0P A;  3SNX A;  3ZYK A;  3MV2 B;  1QYM A;  2J8S D;  2FEZ A;  4CGV A;  3MKQ A;  4K0R A;  4E85 A;  1O1S A;  4FUL A;  2VJ8 A;  3Q73 A;  3ZHE B;  2FUL A;  4WNE A;  3JQ0 A;  2AW6 A;  1IHG A;  1BI7 B;  1H2U A;  3VLD A;  4F6R D;  4FA6 A;  1MX2 A;  3ZHE A;  2WXO A;  2V8S E;  3CVP A;  1D9S A;  4GCO A;  5KJK A;  3ZN3 A;  3HVE B;  1A17 A;  3TAX A;  2JEK A;  4HI8 A;  4FC8 A;  2AXV A;  5HRY A;  4MBG A;  4EPZ A;  3HDX A;  3Q9U C;  1BLX B;  5LX8 A;  4IN3 B;  5KJM A;  4JHK A;  4JC8 A;  3QWW A;  3BEE A;  3LY9 A;  4JA9 A;  3FUK A;  3V2X A;  4GYW A;  3FU3 A;  4XKB A;  4ILI A;  4N2S A;  3QWP A;  1K8K G;  2IF4 A;  3FU0 A;  3RRM B;  4URK A;  1NFI E;  3ZW3 A;  3LYA A;  4ME2 A;  3UXG A;  3PZD A;  5JA4 D;  5AJD A;  2H6H A;  4GTM A;  2J9Q A;  3B7S A;  3B7T A;  4KT6 B;  5LCW C;  3LVR E;  3SBT B;  4GMR A;  3SO8 A;  3ZVV A;  3CVW A;  3V31 A;  1FT1 A;  4JEH A;  3Q75 A;  4G1T A;  2PQN A;  3ASO E;  1DNP A;  2I2O A;  4U7E B;  3AG1 E;  3UKU G;  1OCZ E;  4EQF A;  4YDY A;  1N94 A;  3C3O A;  2MOW A;  1RW2 A;  3L9T A;  3DXM G;  2MHK A;  1HU3 A;  3D9K A;  4NIK A;  1TJC A;  2IU1 A;  2FO7 A;  3PE4 A;  2V5F A;  3L22 A;  4BX8 A;  4HLE A;  3TWR A;  1TN7 A;  2V4H C;  4ANV A;  3BG0 B;  4N5Q A;  4KYO B;  2KM4 A;  1OWP A;  4L9P A;  1EPU A;  3CV0 A;  3TG4 A;  3PZ4 A;  1NA0 A;  4LNU D;  4CDN A;  2P9K G;  3C5R A;  1BI8 B;  2IOS A;  4I1O B;  4JEU A;  3U9W A;  2QYU A;  2VGX B;  2XPI A;  1JWF A;  5D0O D;  4CRW A;  4I9C A;  2F37 A;  3TXN A;  3GW4 A;  4OAV B;  5JHA A;  2PQR A;  3TGO A;  2VGX A;  2X3M A;  2OVB A;  4H7X A;  1BD8 A;  4JXT A;  4GPM A;  5CBN A;  4GMJ A;  3PVL A;  1FVH A;  1INZ A;  4PDX A;  2WXP A;  1YMP A;  1MHQ A;  4G11 A;  3K9I A;  4LCT A;  2R03 A;  1A5E A;  4P29 A;  3EIQ C; 
#chains in the Genus database with same CATH homology
 1TN8 A;  1D8D A;  1QBQ A;  2H6F A;  2R2L A;  3PZ1 A;  3Q78 A;  1FT1 A;  1SA4 A;  3Q75 A;  3PZ3 A;  1TNY A;  4GTV A;  1S64 A;  2H6I A;  1N4S A;  3KSQ A;  1S63 A;  1TN6 A;  4GTP A;  1MZC A;  1SA5 A;  4EHM A;  3PZ2 A;  3SFX A;  1TNB A;  1N94 A;  1JCR A;  3DST A;  3E37 A;  3HXD A;  1O1S A;  3DSU A;  3Q73 A;  3Q79 A;  4YDE A;  3Q7A A;  1TN7 A;  2ZIR A;  3E30 A;  3HXC A;  1N9A A;  1O1R A;  4GTR A;  3DPY A;  4L9P A;  4GTT A;  1LTX A;  1TNO A;  3E34 A;  1FPP A;  3PZ4 A;  4GTQ A;  1NI1 A;  1NL4 A;  3HXE A;  1TNU A;  1D8E A;  3SFY A;  1KZO A;  3EUV A;  1TNZ A;  1O5M A;  2F0Y A;  1JCS A;  3DSX A;  4MBG A;  1JCQ A;  3KSL A;  1N95 A;  1LD8 A;  3Q7F A;  2BED A;  3HXB A;  3C72 A;  1N4Q A;  3DSV A;  3E32 A;  3E33 A;  3EU5 A;  2ZIS A;  4GTO A;  3DSW A;  4LNB A;  1DCE A;  4GTS A;  1X81 A;  3HXF A;  1LD7 A;  1O1T A;  4LNG A;  4YDO A;  1FT2 A;  1N4R A;  2IEJ A;  1N4P A;  3DSS A;  2H6G A;  3DRA A;  1KZP A;  2H6H A;  4GTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...