3Q79A

Cryptococcus neoformans protein farnesyltransferase in complex with farnesyl-ddptasacniq product
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
330
structure length
314
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Farnesyltransferase alpha subunit
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
total genus 122
structure length 314
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q79A00
2H6HA 4GTQA 1X81A 3DSXA 4EHMA 4LNGA 1LD8A 3HXCA 1S63A 3KSLA 1D8EA 3Q75A 3KSQA 4GTSA 3SFXA 3DPYA 1NI1A 4GTMA 1JCSA 1O1SA 3PZ1A 3DSSA 1MZCA 4GTRA 4MBGA 3PZ3A 3Q78A 3E37A 3Q7FA 2F0YA 3PZ4A 1TN8A 1DCEA 3SFYA 4YDOA 1QBQA 2H6IA 2IEJA 1N4SA 3Q7AA 1SA4A 4LNBA 2BEDA 2R2LA 1KZPA 1KZOA 3DRAA 1JCRA 2H6GA 1D8DA 1N4QA 3HXBA 1TNUA 4GTTA 1O1RA 4GTVA 1O5MA 4GTPA 3DSTA 3EUVA 1TNOA 1JCQA 1FT2A 3E32A 1N95A 1TNBA 3E33A 2ZISA 3DSVA 4GTOA 1SA5A 1LTXA 3HXEA 1O1TA 1N4RA 4L9PA 1FPPA 3DSUA 1NL4A 3C72A 1LD7A 3HXDA 3PZ2A 1S64A 3Q79A 1TN7A 1N94A 3E30A 2ZIRA 1N4PA 1FT1A 1TNZA 3DSWA 3HXFA 1N9AA 3E34A 1TN6A 2H6FA 3Q73A 3EU5A 4YDEA 1TNYA
chains in the Genus database with same CATH superfamily
5A6CA 3ZU7B 2BTDA 3R7RA 2DYRE 3B95A 2XRZA 4FC8A 2R17C 3L08A 2X6JA 4XI9A 4EZLA 1EYHA 2Y4UA 1PY1A 3ONLA 3DWLG 3ZPJA 3JUIA 4GTRA 4N39A 4GMLA 3QDNA 3FTUA 3ISMC 1MX4A 4PS8A 3QNKA 4B93B 1DCEA 3SFYA 3UM0A 3ULQA 2ETCA 3ZYMA 1UJJA 1IQRA 4BESA 3MCXA 4B89A 2NYJA 3CVNA 3QWVA 3CHSA 4FLBA 3BG0B 5ARGA 5M72A 3NQPA 3CHPA 4LG6A 4MS6A 4U63A 5AYWD 3RU0A 2QC9A 4FLHA 2AXZA 2KZTB 4QQIA 4FHKA 3S7DA 4HRMB 2IF4A 4D10C 1ZB1A 1HFAA 1IYGA 3PUJA 3K9IA 1Y6IA 4RG9A 4PS7A 3R7QA 3FU0A 3FTZA 4BERA 3TWVA 4O60A 3D9OA 3UM1A 3FUKA 3MYVA 4XX5A 2XCBA 4TXPA 3T9KA 2L0TB 4YDWA 4JZYA 2XQ0A 3S2AA 5LCWC 4HI9A 4JXTA 3UUXA 5LOZA 2FEZA 3FEXA 4L2LA 4G25A 3N71A 4F6RD 4FA6A 1BI8B 4UQXA 1MJ0A 2P9NG 2NSZA 3I5PA 2R02A 3WG7E 2XPIA 2F8XK 3RRNB 2WXMA 1N4SA 3FHEA 1SA4A 5G2NA 4DX7D 4BTBA 4BTAA 1NA0A 3EHMA 4HI8A 5EX0A 1KT1A 3AU4A 4AIFA 1N0RA 1FT2A 4HFGA 3O48A 1N95A 4AJWA 4I1MA 4U8VD 5B1AE 3Q5MA 3O4ZA 2E2EA 5FIOA 4O6FA 2J07A 4J0UA 4E6HA 3NF1A 4JA7A 3ONKA 2F8YA 4GZ5A 1E8YA 5B1BE 4HOUA 2R05A 2IOSA 1FT1A 4EBAG 5CBOA 3DSWA 4DX2A 2WXQA 4JD2G 4G26A 2ETAA 1TN6A 4TRQA 4APOA 4F53A 1X81A 4EQFA 2IONA 2LXMA 3I3NA 1D8EA 3SY2A 4GTSA 3ZXSA 3FP3A 1U3CA 4J8EA 1A5EA 4I43A 4DLOA 4KMOA 4G23A 3OXFA 5HI7A 4BFRA 3UI2A 4UWHA 4I6JA 4LERA 2KZTA 2YHEA 4ACLA 2CFUA 3Q9UC 4GZ6A 2DIWA 5G04J 2VSYA 3ZHEB 2E0IA 4ILIA 3DRAA 2HM8A 1JUQA 3ZKJA 3RKVA 1N4QA 3SF4A 4A1SA 4OVUA 3SBTB 3UIPC 5KBAA 4JHKA 5ITZF 3OAWA 4HS2A 4A3VA 4GPKA 1ELWA 4P29A 2MOWA 3DSVA 2WMNA 1O1TA 4IN3B 3PDNA 4KT6B 2NC9A 1FVFA 3MV2B 3Q79A 2I2OA 4B94A 5EILA 4O1OA 5ENSD 3HXFA 4WWPA 5IY5E 2XEHA 5AQBA 2H6FA 3EHQA 3EU5A 3BUAA 4ANXA 4MLPA 2X6IA 2IOLA 4XE0A 3LY7A 3SFZA 3AJIA 3OTNA 1LD8A 3ULEG 3TG5A 4JC8A 3LPZA 2CG2A 3FU3A 3JQ1A 3DPYA 3JYSA 3SD5A 3QOUA 3FDHA 5CEAA 3UKRG 3CR3A 3CVLA 5LFAA 3B7RL 3ZIMA 4GCOA 1MYOA 4OYSA 5BNWA 3PREA 3QJZA 3W9FA 1IHBA 2YNQA 3FUNA 4GAAA 1AP7A 3NZSA 2BKKB 3QWWA 4RG6A 2AW6A 4YVOA 2AWIA 3S7BA 1TJCA 3UINC 1E7VA 4GTPA 1TYQG 1JCQA 4XIFA 1U2VG 4TV3A 5EDSA 4BEPA 3PRZA 1RZ4A 2VJ8A 1H19A 4M7CA 4L7TA 1SA5A 4GYWA 3V79K 3B7TA 3ZNGA 4J6IA 5KJMA 5EYLA 3TWUA 4GZ3A 4FADA 3GZ1A 1BU9A 3MKQB 3U3WA 3TJPA 2Y4TA 3ZYLA 4M3OA 3FUDA 4URKA 3FU6A 4C0EA 3JCKC 3ZHEA 4HLEA 4XI0A 3DSXA 5BV1A 3R9MA 3I4GA 3UM3A 1OWLA 1G3NB 4X8QA 2QYJA 1KT0A 3L13A 4IYPA 5E76A 4KXKB 3D9KA 4GYYA 2PM7A 2CHZA 2J08A 3ZVVA 1MZCA 2LO6A 2GRRB 3EHRA 4GMRA 4MRUA 2J8SD 5G55A 2OOEA 2XENA 2CFZA 3Q4AB 1SZAA 2DWZA 3SQVA 4C0MA 2GRMA 2HO1A 1H6KA 1Y8MA 4XZ4A 3Q7AA 3LVRE 5G04C 1B89A 2P9LG 4NURA 4A63B 3ZYKA 5FT9A 3APCA 4L23A 1K8KG 1H2TC 1VDYA 1ZBPA 3ABKE 2J09A 4AY5A 5D0OD 3NOCD 4F7AA 1S0PA 4HORA 1V54E 3UT4A 4CT4A 3E33A 3CVWA 4CDNA 5CBNA 3WXXA 3AS8A 3ML9A 1JWGA 4CDRA 4CRWA 2XS1A 3QB2A 1K3ZD 3FU5A 3C72A 3MX3A 4BSZB 5EX3A 1D9SA 4DPRA 3Q73A 4YDEA 1TNYA 4V3IA 1S70B 4FJZA 3TG4A 5FQ6A 2RD0A 2WXGA 4F1PA 5KNHD 1SZ9A 1YYHA 2XZTG 4TUUA 3CQGB 3ENEA 4GA0A 2C0LA 5ENNA 2KATA 3S7FA 2PM6A 5LX8A 4FU3A 1JCSA 3C98A 2V4HC 3FH7A 2X6KA 1TEZA 3CSFA 2OVBA 3TWQA 2ZGGA 3E37A 1PC2A 4HRLA 4K5AB 3IV0A 5HQ8A 3CVQA 1TN8A 3HG0D 4B8AA 1IQUA 3BU8A 5AJDA 1BPOA 5A23A 4HOTA 3QKYA 3FUEA 2R2LA 5CEDB 1KZOA 3MKQA 1JCRA 4AOFA 1N54A 1DVPA 2A5EA 5BV0A 4E85A 2P9IG 4FJYA 3AS5A 4J8SA 4GMJA 4XKCA 4CDMA 3CHRA 3U66A 3UMVA 4AP2A 3E32A 5A7DB 5AQAA 4CEMA 2XPYA 3KEAA 4WNDA 4QFVA 4A55A 3FY4A 3Q47B 5ENTD 5CCMA 3MZLB 4GB9A 3FUIA 4HBDA 3SO8A 1Z3XA 1N94A 5CRVA 1HG5A 4U7EB 5ENOD 1TNZA 1Z3YA 2WXJA 3ABME 3CVXA 2VTBB 2RKKA 4JW1A 2KM4A 3TWWA 4F3VA 3CGHA 4FP7A 3TWRA 1YA0A 2PQNA 3AS4A 5H7PA 2HYZA 4JB8P 2ILRA 4PS3A 4U07A 4A1GA 2WXIA 5BXUA 4KZCA 1O1SA 4OVVA 4TUMA 1E7UA 1KPSB 3V2XA 3Q78A 1H0AA 3CVYA 3EU9A 3PE4A 4U96D 4YNDA 4Y6WA 5ENPD 2C0MA 1BI7B 3J5QB 2DYSE 5AAOA 2A4ZA 3B7SA 3FUMA 3UIOC 4HOQA 2VGEA 4FHJA 3PUKA 3CVPA 4LRZA 4C9BB 1E90A 1N52A 1QQEA 4RQIA 3APFA 1TNUA 4GTTA 4UWGA 3HVEB 2IO2C 4YVQC 3FTYA 5FZQA 5JJ6A 3LYAA 2XCCA 3RRUA 3SGHA 4K5CA 4I2WA 1HU3A 5BPPA 3HDXA 2BUGA 5ARFA 2VSXE 3FTXA 1K1AA 3CHMA 2X6FA 2KCLA 4UQYA 5FINA 4JEHA 4JPSA 3KEZA 4UI9K 3PS6A 1FVHA 3LY9A 3GYZA 2OV8A 5D0QD 4BT9A 2YHCA 1OWNA 3RIBA 3CK9A 5KNGA 3E34A 2KCVA 2J9QA 3RRMB 5AN8A 3APDA 4LNGA 1MHQA 3CV0A 4GU5A 2DCPA 4DUIA 2VYIA 5EIBE 2Q7FA 5C2YA 4ZHBA 4W9RA 2Y1LE 3PZ3A 2EQXA 4ATZD 1NA3A 3Q7FA 4UWFA 2IY0C 3RO3A 3TWSA 3ZRHA 4ANVA 2WQ6A 3ZXPA 3PZ4A 3IBEA 3VTXA 4U0ZA 2KC7A 4G2VA 4BT8A 2BEDA 2LNIA 1WAO1 4U95D 5JJ7A 3B7BA 2VTBA 4RLYA 5JHBA 3RJVA 4EZJA 2I1JA 5AIJA 3EUVA 1HO8A 3ZYQA 2ZISA 3ZN3A 3IHYA 2PNNA 1EDUA 3T8KA 1INZA 3T5XA 4WNEA 3DSUA 4H7XA 1NL4A 3S7JA 2YINA 2KBXA 4LEUA 2P58C 1OCCE 3L9TA 4Q96A 2WXHA 5KCMA 3PEUB 4GZDA 4L1BA 5CMYA 5T4YA 3U4TA 3GZSA 1QYMA 2GRLA 3D9HA 3CHOA 3KAEA 3ESLA 4EHMA 5LP0A 4WWNA 3UTMA 2XRYA 5D66A 2X38A 2XZDG 3HVEA 4CGVA 1DCQA 3FH5A 4RSYA 2AXVA 3OXGA 1OCRE 5JHAA 3LXUX 1X5BA 3FH8A 2V5FA 4GA2A 4CYMD 5CCLA 1NZNA 3CSTA 3L17A 4JHJA 3EHNA 2KXPC 4JA9A 3NBNB 3FTSA 2IJGX 4B8CB 2IFUA 3I4RB 2Y69E 4HLLA 4F1SA 1IXVA 2WXLA 4I2ZA 5ANLA 4GTVA 5EKQD 3CK7A 1WDYA 2L6JA 1TNOA 2PL2A 3LJ3A 4UUCA 2MYOA 1TNBA 1OWOA 3LY8A 4U04A 4HRNA 1K1BA 4ANWA 2DZNA 3HXDA 4PUCA 3T5VA 5AJLA 2AXUA 2MHKA 1UN8A 4ABNA 1MQSA 3ASNE 4LSZE 2GGFA 1OXJA 1N9AA 3ULYA 4N5QA 4G11A 3LDZA 4BWRA 4UQZA 1S63A 3NZUA 4HB5A 4EECA 3ML8A 4L2YA 1SVXA 1E8XA 4HVBA 2VGXA 4DX5D 4Q94A 3C3RA 1GW6A 3DBSA 3G2SA 3G2WA 1EF1C 3CIAA 2EINE 1SW6A 1HH8A 3VLFA 1QBQA 2RFMA 4U8YD 2LUHA 3PE3A 5BXOA 4OAVB 3B13A 3L82A 3TXNA 1SQMA 3LJNA 3T8MA 2IO3C 1YMPA 1O1RA 1BD8A 2OEWA 2OCCE 3LKUA 4JHRA 3AU5A 3C3OA 3CVUA 2B6CA 4TXRA 1ELRA 1BLXB 1LD7A 4BSXA 3MEKA 3L54A 1H2UA 3NAWA 2ZIRA 3DPDA 4IULA 3MJWA 2IQCA 3IKOB 4GCNA 2UY1B 3CHQA 4GTQA 4BX9A 3D9NA 5HKPA 1P5QA 3ASGA 5FZSA 3QARA 4DI3A 3Q75A 4G1TA 4K03A 3QC1A 3DSSA 2LSUA 3AG3E 2FI7A 2XPZA 4J8DA 5EIDA 5G05J 3AAAC 3MKRA 5CERB 4N3AA 4FULA 4GZCA 3LEWA 2H6IA 3HHMA 4GYOA 3QAQA 3EIJA 4GPMA 1ZU2A 1AWCB 2GRPB 2ZGDA 3W9GA 4LCTA 4Z68A 1NFIE 1O5MA 4MKTA 3UM2A 5AARA 3KD7A 2DZOA 5FWQA 3B7UX 5KJKA 4PH4B 2WVIA 3HXEA 4I6GA 4R7LA 2V5QC 3DEOA 1FPPA 3DXMG 2FO1E 4I6EA 2JLBA 3ZFWA 4DI4A 3AG1E 2I9CA 4I9CA 4N2SA 3G2UA 4ATGA 1EPUA 4NRHB 4J8FA 3TGOA 1UW4B 3UT7A 1UJKA 2WXRA 2X3MA 1WY6A 4WAFA 2WXPA 2H6HA 4PDXA 3LS8A 4AEZC 3TL5A 3JQ0A 3TWXA 3SNXA 1UN9A 3ASFA 3D9MA 4JVSA 2DBAA 5AQ9A 2WPVA 4GTMA 4EPZA 3SHFA 3L16A 3RSEG 3ZGQA 5FQ4A 3FUJA 1E8ZA 4UWKA 3BEEA 1OWMA 4DK5A 4NQ0A 3UQ3A 3U64A 5ENRD 2VQ2A 3G2VA 3VLEA 3PEVB 4YDOA 2XS8A 2IU1A 4Q69A 1HS6A 2EIKE 4K5BA 3URZA 3DXKG 2HR2A 2VSOE 3RK6A 3TAXA 2WQ7A 1UG3A 4AM9A 2UY1A 4G8KA 4JEUA 4NACA 5HRYA 4Y6CA 1H6OA 1Z5SC 1OWPA 4CCAA 3FUHA 5FZRA 3FTVA 4GTOA 3GW4A 1N4RA 2UWJG 2QYUA 3L22A 3CKCA 4WUYA 3EJNA 3AG2E 4BY6A 3D9LA 1N11A 2LXLA 3BQOA 1RW2A 4UWLA 2AJAA 3HRAA 4LNUD 1PAQA 3ABLE 3PNLB 5C1DA 3NOGD 2XHEA 5FJYA 4DX1A 5FQ7A 5D2MC 3UKUG 4U8HA 5AENA 3KSQA 2L0IA 3E4BA 3SFXA 2FO7A 2I1KA 1NI1A 1W3BA 1HF8A 2F37A 4CGWA 2XGOA 2GROB 5G05C 2MRIA 2VGYA 5ANRA 2QFCA 2F0YA 2XEEA 2P9SG 2P9UG 3KS2A 4H7YA 3DEPA 4DLQA 2I6HA 2IEJA 4GA1A 3FEYA 3ESKA 4A3TA 2GRNB 1HG2A 1KZPA 4BX8A 1NP7A 3J5PA 2R03A 3P1UA 3V31A 1D8DA 1JPLA 2CHWA 1MX2A 1WM5A 3VTYA 3DSTA 1HZ4A 2P2CP 3SZ7A 2NXPA 1H2VC 1TR4A 3CKBA 2R59A 5JMND 4JL0A 3ZW3A 3FTWA 1HX8A 2FF4A 3PH0C 3ZEFA 3ZUVB 3TWTA 1Q2ZA 5J08A 3SI5A 1S64A 3E30A 4CT0A 4AV7A 2A5UA 2AVPA 2J4BA 4UI9J 1H6PA 2VGXB 1A17A 2OEVA 3D3MA 2CHXA 2RG8A 4TXQA 1TJFA 5FTPA 1QNFA 4HXIA 1MX6A 5KWDA 2J4DA 2WXOA 5J90A 5T8IA 5JA4D 4DRXE 2ZU6B 1HXIA 4ACKA 3UXGA 4KVOA 2RFAA 2Y0BG 4MBGA 2PQRA 3JUEA 2ONDA 3D9JA 1XGWA 4C48B 3FUFA 5JJTA 3SBSA 5BUZA 3CQCB 4IRUA 1LF8A 2QZAA 5EYPF 3ASDA 4LNBA 4I1OB 2JEKA 2EIME 4J8YA 4N2QA 3HXBA 5KJLA 3PZDA 4N5CA 1OT8A 1IHGA 4XEIG 2C2LA 3G2TA 2EIJE 3P2BA 4KZ0A 2EILE 3C5RA 4KVMA 3PNTB 2BF0X 3IHVA 2WMOA 1OCOE 3IXEA 4ANUA 1FCHA 1N0QA 4N3BA 3HYMB 3AG4E 1V55E 4B0ZA 5BW8C 5DIZA 3NB2A 2XEVA 2VSNA 2ETBA 4G8LA 3MV3B 3FFLA 4O1PA 2X6HA 2P9PG 4YDYA 3KSLA 4I17A 4NIKA 2WM9A 4XKBA 1IKND 2GRQB 4WNFA 3PZ1A 5T3RA 2HE0A 2LAHA 5CMWA 3C3QA 3QK0A 3ASOE 4J7WA 3R9AB 4LUNU 3ASHA 4RVBA 2KCKA 3EDTB 5CECB 2B0OE 2Y3AA 3MGBA 3LCAA 3CK8A 1OY3D 4AY6A 3GZ2A 3OXLA 5ENQD 2WXNA 4KYOB 3QWPA 3D9IA 4AXHA 2WQHA 1E8WA 2V0PA 4L9PA 3Q49B 2CG3A 3HIZA 5E75A 4G24A 3IEGA 5CHEE 1TN7A 3V30A 1WG0A 4WWOA 1YCSB 2LSVA 2FULA 3RAUA 3JXJA 4ZFHA 3D9PA 1HE8A 3L6AA 4DX6D 4UI9C 3UT8A 4EBAA 4HOSA 2OVFA 5CRUA 4DJAA 4ILGA 2R5SA 4ILHB 4BETA 4KBQA 5B3SE 4WNGA 3U9WA 3HXCA 2GW1A 2WXFA 3CVVA 4I1AA 5LCWJ 2XGMA 5EN5D 5AQ7A 2QY7A 1OUVA 2M63A 5HS0A 1Z6TA 1DNPA 3Q15A 3JXIA 1QZ2A 2ZXWE 4HNAD 5KJNA 3RO2A 4K0RA 1DC2A 5DBKA 1JWFA 4OAUC 2J49A 2YQ8A 3FULA 4U0UA 3VLDA 4EZKA 4U0SA 3Q9NC 2P9KG 1XNFA 5FQ8A 2L6BA 2V4LA 2H6GA 4APFA 3V2OA 2PZIA 4N3CA 2LAIA 2XGSA 1L5JA 3CLJA 4CZ2D 1OCZE 2L9BA 3LVQE 2JABA 3EIQC 4ME2A 1LTXA 4I9EA 3BG1B 4HQDA 2V8SE 1U3DA 3UPVA 1ELKA 4AVXA 3F6QA 1E96B 3PVLA 3CEQA 3PZ2A 2BKGA 5BT1A 1N4PA 3TXMA 2FBNA 2WXKA 1UOHA 1KLXA 3MA5A 3X2QE 2DVWA 3UX4A 2WB2A 3FWVA
chains in the Genus database with same CATH topology
2H6HA 4GTQA 1X81A 3DSXA 4EHMA 4LNGA 1LD8A 3HXCA 1S63A 3KSLA 1D8EA 3Q75A 3KSQA 4GTSA 3SFXA 3DPYA 1NI1A 4GTMA 1JCSA 1O1SA 3PZ1A 3DSSA 1MZCA 4GTRA 4MBGA 3PZ3A 3Q78A 3E37A 3Q7FA 2F0YA 3PZ4A 1TN8A 1DCEA 3SFYA 4YDOA 1QBQA 2H6IA 2IEJA 1N4SA 3Q7AA 1SA4A 4LNBA 2BEDA 2R2LA 1KZPA 1KZOA 3DRAA 1JCRA 2H6GA 1D8DA 1N4QA 3HXBA 1TNUA 4GTTA 1O1RA 4GTVA 1O5MA 4GTPA 3DSTA 3EUVA 1TNOA 1JCQA 1FT2A 3E32A 1N95A 1TNBA 3E33A 2ZISA 3DSVA 4GTOA 1SA5A 1LTXA 3HXEA 1O1TA 1N4RA 4L9PA 1FPPA 3DSUA 1NL4A 3C72A 1LD7A 3HXDA 3PZ2A 1S64A 3Q79A 1TN7A 1N94A 3E30A 2ZIRA 1N4PA 1FT1A 1TNZA 3DSWA 3HXFA 1N9AA 3E34A 1TN6A 2H6FA 3Q73A 3EU5A 4YDEA 1TNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6H A;  4GTQ A;  1X81 A;  3DSX A;  4EHM A;  4LNG A;  1LD8 A;  3HXC A;  1S63 A;  3KSL A;  1D8E A;  3Q75 A;  3KSQ A;  4GTS A;  3SFX A;  3DPY A;  1NI1 A;  4GTM A;  1JCS A;  1O1S A;  3PZ1 A;  3DSS A;  1MZC A;  4GTR A;  4MBG A;  3PZ3 A;  3Q78 A;  3E37 A;  3Q7F A;  2F0Y A;  3PZ4 A;  1TN8 A;  1DCE A;  3SFY A;  4YDO A;  1QBQ A;  2H6I A;  2IEJ A;  1N4S A;  3Q7A A;  1SA4 A;  4LNB A;  2BED A;  2R2L A;  1KZP A;  1KZO A;  3DRA A;  1JCR A;  2H6G A;  1D8D A;  1N4Q A;  3HXB A;  1TNU A;  4GTT A;  1O1R A;  4GTV A;  1O5M A;  4GTP A;  3DST A;  3EUV A;  1TNO A;  1JCQ A;  1FT2 A;  3E32 A;  1N95 A;  1TNB A;  3E33 A;  2ZIS A;  3DSV A;  4GTO A;  1SA5 A;  1LTX A;  3HXE A;  1O1T A;  1N4R A;  4L9P A;  1FPP A;  3DSU A;  1NL4 A;  3C72 A;  1LD7 A;  3HXD A;  3PZ2 A;  1S64 A;  3Q79 A;  1TN7 A;  1N94 A;  3E30 A;  2ZIR A;  1N4P A;  1FT1 A;  1TNZ A;  3DSW A;  3HXF A;  1N9A A;  3E34 A;  1TN6 A;  2H6F A;  3Q73 A;  3EU5 A;  4YDE A;  1TNY A; 
#chains in the Genus database with same CATH topology
 5A6C A;  3ZU7 B;  2BTD A;  3R7R A;  2DYR E;  3B95 A;  2XRZ A;  4FC8 A;  2R17 C;  3L08 A;  2X6J A;  4XI9 A;  4EZL A;  1EYH A;  2Y4U A;  1PY1 A;  3ONL A;  3DWL G;  3ZPJ A;  3JUI A;  4GTR A;  4N39 A;  4GML A;  3QDN A;  3FTU A;  3ISM C;  1MX4 A;  4PS8 A;  3QNK A;  4B93 B;  1DCE A;  3SFY A;  3UM0 A;  3ULQ A;  2ETC A;  3ZYM A;  1UJJ A;  1IQR A;  4BES A;  3MCX A;  4B89 A;  2NYJ A;  3CVN A;  3QWV A;  3CHS A;  4FLB A;  3BG0 B;  5ARG A;  5M72 A;  3NQP A;  3CHP A;  4LG6 A;  4MS6 A;  4U63 A;  5AYW D;  3RU0 A;  2QC9 A;  4FLH A;  2AXZ A;  2KZT B;  4QQI A;  4FHK A;  3S7D A;  4HRM B;  2IF4 A;  4D10 C;  1ZB1 A;  1HFA A;  1IYG A;  3PUJ A;  3K9I A;  1Y6I A;  4RG9 A;  4PS7 A;  3R7Q A;  3FU0 A;  3FTZ A;  4BER A;  3TWV A;  4O60 A;  3D9O A;  3UM1 A;  3FUK A;  3MYV A;  4XX5 A;  2XCB A;  4TXP A;  3T9K A;  2L0T B;  4YDW A;  4JZY A;  2XQ0 A;  3S2A A;  5LCW C;  4HI9 A;  4JXT A;  3UUX A;  5LOZ A;  2FEZ A;  3FEX A;  4L2L A;  4G25 A;  3N71 A;  4F6R D;  4FA6 A;  1BI8 B;  4UQX A;  1MJ0 A;  2P9N G;  2NSZ A;  3I5P A;  2R02 A;  3WG7 E;  2XPI A;  2F8X K;  3RRN B;  2WXM A;  1N4S A;  3FHE A;  1SA4 A;  5G2N A;  4DX7 D;  4BTB A;  4BTA A;  1NA0 A;  3EHM A;  4HI8 A;  5EX0 A;  1KT1 A;  3AU4 A;  4AIF A;  1N0R A;  1FT2 A;  4HFG A;  3O48 A;  1N95 A;  4AJW A;  4I1M A;  4U8V D;  5B1A E;  3Q5M A;  3O4Z A;  2E2E A;  5FIO A;  4O6F A;  2J07 A;  4J0U A;  4E6H A;  3NF1 A;  4JA7 A;  3ONK A;  2F8Y A;  4GZ5 A;  1E8Y A;  5B1B E;  4HOU A;  2R05 A;  2IOS A;  1FT1 A;  4EBA G;  5CBO A;  3DSW A;  4DX2 A;  2WXQ A;  4JD2 G;  4G26 A;  2ETA A;  1TN6 A;  4TRQ A;  4APO A;  4F53 A;  1X81 A;  4EQF A;  2ION A;  2LXM A;  3I3N A;  1D8E A;  3SY2 A;  4GTS A;  3ZXS A;  3FP3 A;  1U3C A;  4J8E A;  1A5E A;  4I43 A;  4DLO A;  4KMO A;  4G23 A;  3OXF A;  5HI7 A;  4BFR A;  3UI2 A;  4UWH A;  4I6J A;  4LER A;  2KZT A;  2YHE A;  4ACL A;  2CFU A;  3Q9U C;  4GZ6 A;  2DIW A;  5G04 J;  2VSY A;  3ZHE B;  2E0I A;  4ILI A;  3DRA A;  2HM8 A;  1JUQ A;  3ZKJ A;  3RKV A;  1N4Q A;  3SF4 A;  4A1S A;  4OVU A;  3SBT B;  3UIP C;  5KBA A;  4JHK A;  5ITZ F;  3OAW A;  4HS2 A;  4A3V A;  4GPK A;  1ELW A;  4P29 A;  2MOW A;  3DSV A;  2WMN A;  1O1T A;  4IN3 B;  3PDN A;  4KT6 B;  2NC9 A;  1FVF A;  3MV2 B;  3Q79 A;  2I2O A;  4B94 A;  5EIL A;  4O1O A;  5ENS D;  3HXF A;  4WWP A;  5IY5 E;  2XEH A;  5AQB A;  2H6F A;  3EHQ A;  3EU5 A;  3BUA A;  4ANX A;  4MLP A;  2X6I A;  2IOL A;  4XE0 A;  3LY7 A;  3SFZ A;  3AJI A;  3OTN A;  1LD8 A;  3ULE G;  3TG5 A;  4JC8 A;  3LPZ A;  2CG2 A;  3FU3 A;  3JQ1 A;  3DPY A;  3JYS A;  3SD5 A;  3QOU A;  3FDH A;  5CEA A;  3UKR G;  3CR3 A;  3CVL A;  5LFA A;  3B7R L;  3ZIM A;  4GCO A;  1MYO A;  4OYS A;  5BNW A;  3PRE A;  3QJZ A;  3W9F A;  1IHB A;  2YNQ A;  3FUN A;  4GAA A;  1AP7 A;  3NZS A;  2BKK B;  3QWW A;  4RG6 A;  2AW6 A;  4YVO A;  2AWI A;  3S7B A;  1TJC A;  3UIN C;  1E7V A;  4GTP A;  1TYQ G;  1JCQ A;  4XIF A;  1U2V G;  4TV3 A;  5EDS A;  4BEP A;  3PRZ A;  1RZ4 A;  2VJ8 A;  1H19 A;  4M7C A;  4L7T A;  1SA5 A;  4GYW A;  3V79 K;  3B7T A;  3ZNG A;  4J6I A;  5KJM A;  5EYL A;  3TWU A;  4GZ3 A;  4FAD A;  3GZ1 A;  1BU9 A;  3MKQ B;  3U3W A;  3TJP A;  2Y4T A;  3ZYL A;  4M3O A;  3FUD A;  4URK A;  3FU6 A;  4C0E A;  3JCK C;  3ZHE A;  4HLE A;  4XI0 A;  3DSX A;  5BV1 A;  3R9M A;  3I4G A;  3UM3 A;  1OWL A;  1G3N B;  4X8Q A;  2QYJ A;  1KT0 A;  3L13 A;  4IYP A;  5E76 A;  4KXK B;  3D9K A;  4GYY A;  2PM7 A;  2CHZ A;  2J08 A;  3ZVV A;  1MZC A;  2LO6 A;  2GRR B;  3EHR A;  4GMR A;  4MRU A;  2J8S D;  5G55 A;  2OOE A;  2XEN A;  2CFZ A;  3Q4A B;  1SZA A;  2DWZ A;  3SQV A;  4C0M A;  2GRM A;  2HO1 A;  1H6K A;  1Y8M A;  4XZ4 A;  3Q7A A;  3LVR E;  5G04 C;  1B89 A;  2P9L G;  4NUR A;  4A63 B;  3ZYK A;  5FT9 A;  3APC A;  4L23 A;  1K8K G;  1H2T C;  1VDY A;  1ZBP A;  3ABK E;  2J09 A;  4AY5 A;  5D0O D;  3NOC D;  4F7A A;  1S0P A;  4HOR A;  1V54 E;  3UT4 A;  4CT4 A;  3E33 A;  3CVW A;  4CDN A;  5CBN A;  3WXX A;  3AS8 A;  3ML9 A;  1JWG A;  4CDR A;  4CRW A;  2XS1 A;  3QB2 A;  1K3Z D;  3FU5 A;  3C72 A;  3MX3 A;  4BSZ B;  5EX3 A;  1D9S A;  4DPR A;  3Q73 A;  4YDE A;  1TNY A;  4V3I A;  1S70 B;  4FJZ A;  3TG4 A;  5FQ6 A;  2RD0 A;  2WXG A;  4F1P A;  5KNH D;  1SZ9 A;  1YYH A;  2XZT G;  4TUU A;  3CQG B;  3ENE A;  4GA0 A;  2C0L A;  5ENN A;  2KAT A;  3S7F A;  2PM6 A;  5LX8 A;  4FU3 A;  1JCS A;  3C98 A;  2V4H C;  3FH7 A;  2X6K A;  1TEZ A;  3CSF A;  2OVB A;  3TWQ A;  2ZGG A;  3E37 A;  1PC2 A;  4HRL A;  4K5A B;  3IV0 A;  5HQ8 A;  3CVQ A;  1TN8 A;  3HG0 D;  4B8A A;  1IQU A;  3BU8 A;  5AJD A;  1BPO A;  5A23 A;  4HOT A;  3QKY A;  3FUE A;  2R2L A;  5CED B;  1KZO A;  3MKQ A;  1JCR A;  4AOF A;  1N54 A;  1DVP A;  2A5E A;  5BV0 A;  4E85 A;  2P9I G;  4FJY A;  3AS5 A;  4J8S A;  4GMJ A;  4XKC A;  4CDM A;  3CHR A;  3U66 A;  3UMV A;  4AP2 A;  3E32 A;  5A7D B;  5AQA A;  4CEM A;  2XPY A;  3KEA A;  4WND A;  4QFV A;  4A55 A;  3FY4 A;  3Q47 B;  5ENT D;  5CCM A;  3MZL B;  4GB9 A;  3FUI A;  4HBD A;  3SO8 A;  1Z3X A;  1N94 A;  5CRV A;  1HG5 A;  4U7E B;  5ENO D;  1TNZ A;  1Z3Y A;  2WXJ A;  3ABM E;  3CVX A;  2VTB B;  2RKK A;  4JW1 A;  2KM4 A;  3TWW A;  4F3V A;  3CGH A;  4FP7 A;  3TWR A;  1YA0 A;  2PQN A;  3AS4 A;  5H7P A;  2HYZ A;  4JB8 P;  2ILR A;  4PS3 A;  4U07 A;  4A1G A;  2WXI A;  5BXU A;  4KZC A;  1O1S A;  4OVV A;  4TUM A;  1E7U A;  1KPS B;  3V2X A;  3Q78 A;  1H0A A;  3CVY A;  3EU9 A;  3PE4 A;  4U96 D;  4YND A;  4Y6W A;  5ENP D;  2C0M A;  1BI7 B;  3J5Q B;  2DYS E;  5AAO A;  2A4Z A;  3B7S A;  3FUM A;  3UIO C;  4HOQ A;  2VGE A;  4FHJ A;  3PUK A;  3CVP A;  4LRZ A;  4C9B B;  1E90 A;  1N52 A;  1QQE A;  4RQI A;  3APF A;  1TNU A;  4GTT A;  4UWG A;  3HVE B;  2IO2 C;  4YVQ C;  3FTY A;  5FZQ A;  5JJ6 A;  3LYA A;  2XCC A;  3RRU A;  3SGH A;  4K5C A;  4I2W A;  1HU3 A;  5BPP A;  3HDX A;  2BUG A;  5ARF A;  2VSX E;  3FTX A;  1K1A A;  3CHM A;  2X6F A;  2KCL A;  4UQY A;  5FIN A;  4JEH A;  4JPS A;  3KEZ A;  4UI9 K;  3PS6 A;  1FVH A;  3LY9 A;  3GYZ A;  2OV8 A;  5D0Q D;  4BT9 A;  2YHC A;  1OWN A;  3RIB A;  3CK9 A;  5KNG A;  3E34 A;  2KCV A;  2J9Q A;  3RRM B;  5AN8 A;  3APD A;  4LNG A;  1MHQ A;  3CV0 A;  4GU5 A;  2DCP A;  4DUI A;  2VYI A;  5EIB E;  2Q7F A;  5C2Y A;  4ZHB A;  4W9R A;  2Y1L E;  3PZ3 A;  2EQX A;  4ATZ D;  1NA3 A;  3Q7F A;  4UWF A;  2IY0 C;  3RO3 A;  3TWS A;  3ZRH A;  4ANV A;  2WQ6 A;  3ZXP A;  3PZ4 A;  3IBE A;  3VTX A;  4U0Z A;  2KC7 A;  4G2V A;  4BT8 A;  2BED A;  2LNI A;  1WAO 1;  4U95 D;  5JJ7 A;  3B7B A;  2VTB A;  4RLY A;  5JHB A;  3RJV A;  4EZJ A;  2I1J A;  5AIJ A;  3EUV A;  1HO8 A;  3ZYQ A;  2ZIS A;  3ZN3 A;  3IHY A;  2PNN A;  1EDU A;  3T8K A;  1INZ A;  3T5X A;  4WNE A;  3DSU A;  4H7X A;  1NL4 A;  3S7J A;  2YIN A;  2KBX A;  4LEU A;  2P58 C;  1OCC E;  3L9T A;  4Q96 A;  2WXH A;  5KCM A;  3PEU B;  4GZD A;  4L1B A;  5CMY A;  5T4Y A;  3U4T A;  3GZS A;  1QYM A;  2GRL A;  3D9H A;  3CHO A;  3KAE A;  3ESL A;  4EHM A;  5LP0 A;  4WWN A;  3UTM A;  2XRY A;  5D66 A;  2X38 A;  2XZD G;  3HVE A;  4CGV A;  1DCQ A;  3FH5 A;  4RSY A;  2AXV A;  3OXG A;  1OCR E;  5JHA A;  3LXU X;  1X5B A;  3FH8 A;  2V5F A;  4GA2 A;  4CYM D;  5CCL A;  1NZN A;  3CST A;  3L17 A;  4JHJ A;  3EHN A;  2KXP C;  4JA9 A;  3NBN B;  3FTS A;  2IJG X;  4B8C B;  2IFU A;  3I4R B;  2Y69 E;  4HLL A;  4F1S A;  1IXV A;  2WXL A;  4I2Z A;  5ANL A;  4GTV A;  5EKQ D;  3CK7 A;  1WDY A;  2L6J A;  1TNO A;  2PL2 A;  3LJ3 A;  4UUC A;  2MYO A;  1TNB A;  1OWO A;  3LY8 A;  4U04 A;  4HRN A;  1K1B A;  4ANW A;  2DZN A;  3HXD A;  4PUC A;  3T5V A;  5AJL A;  2AXU A;  2MHK A;  1UN8 A;  4ABN A;  1MQS A;  3ASN E;  4LSZ E;  2GGF A;  1OXJ A;  1N9A A;  3ULY A;  4N5Q A;  4G11 A;  3LDZ A;  4BWR A;  4UQZ A;  1S63 A;  3NZU A;  4HB5 A;  4EEC A;  3ML8 A;  4L2Y A;  1SVX A;  1E8X A;  4HVB A;  2VGX A;  4DX5 D;  4Q94 A;  3C3R A;  1GW6 A;  3DBS A;  3G2S A;  3G2W A;  1EF1 C;  3CIA A;  2EIN E;  1SW6 A;  1HH8 A;  3VLF A;  1QBQ A;  2RFM A;  4U8Y D;  2LUH A;  3PE3 A;  5BXO A;  4OAV B;  3B13 A;  3L82 A;  3TXN A;  1SQM A;  3LJN A;  3T8M A;  2IO3 C;  1YMP A;  1O1R A;  1BD8 A;  2OEW A;  2OCC E;  3LKU A;  4JHR A;  3AU5 A;  3C3O A;  3CVU A;  2B6C A;  4TXR A;  1ELR A;  1BLX B;  1LD7 A;  4BSX A;  3MEK A;  3L54 A;  1H2U A;  3NAW A;  2ZIR A;  3DPD A;  4IUL A;  3MJW A;  2IQC A;  3IKO B;  4GCN A;  2UY1 B;  3CHQ A;  4GTQ A;  4BX9 A;  3D9N A;  5HKP A;  1P5Q A;  3ASG A;  5FZS A;  3QAR A;  4DI3 A;  3Q75 A;  4G1T A;  4K03 A;  3QC1 A;  3DSS A;  2LSU A;  3AG3 E;  2FI7 A;  2XPZ A;  4J8D A;  5EID A;  5G05 J;  3AAA C;  3MKR A;  5CER B;  4N3A A;  4FUL A;  4GZC A;  3LEW A;  2H6I A;  3HHM A;  4GYO A;  3QAQ A;  3EIJ A;  4GPM A;  1ZU2 A;  1AWC B;  2GRP B;  2ZGD A;  3W9G A;  4LCT A;  4Z68 A;  1NFI E;  1O5M A;  4MKT A;  3UM2 A;  5AAR A;  3KD7 A;  2DZO A;  5FWQ A;  3B7U X;  5KJK A;  4PH4 B;  2WVI A;  3HXE A;  4I6G A;  4R7L A;  2V5Q C;  3DEO A;  1FPP A;  3DXM G;  2FO1 E;  4I6E A;  2JLB A;  3ZFW A;  4DI4 A;  3AG1 E;  2I9C A;  4I9C A;  4N2S A;  3G2U A;  4ATG A;  1EPU A;  4NRH B;  4J8F A;  3TGO A;  1UW4 B;  3UT7 A;  1UJK A;  2WXR A;  2X3M A;  1WY6 A;  4WAF A;  2WXP A;  2H6H A;  4PDX A;  3LS8 A;  4AEZ C;  3TL5 A;  3JQ0 A;  3TWX A;  3SNX A;  1UN9 A;  3ASF A;  3D9M A;  4JVS A;  2DBA A;  5AQ9 A;  2WPV A;  4GTM A;  4EPZ A;  3SHF A;  3L16 A;  3RSE G;  3ZGQ A;  5FQ4 A;  3FUJ A;  1E8Z A;  4UWK A;  3BEE A;  1OWM A;  4DK5 A;  4NQ0 A;  3UQ3 A;  3U64 A;  5ENR D;  2VQ2 A;  3G2V A;  3VLE A;  3PEV B;  4YDO A;  2XS8 A;  2IU1 A;  4Q69 A;  1HS6 A;  2EIK E;  4K5B A;  3URZ A;  3DXK G;  2HR2 A;  2VSO E;  3RK6 A;  3TAX A;  2WQ7 A;  1UG3 A;  4AM9 A;  2UY1 A;  4G8K A;  4JEU A;  4NAC A;  5HRY A;  4Y6C A;  1H6O A;  1Z5S C;  1OWP A;  4CCA A;  3FUH A;  5FZR A;  3FTV A;  4GTO A;  3GW4 A;  1N4R A;  2UWJ G;  2QYU A;  3L22 A;  3CKC A;  4WUY A;  3EJN A;  3AG2 E;  4BY6 A;  3D9L A;  1N11 A;  2LXL A;  3BQO A;  1RW2 A;  4UWL A;  2AJA A;  3HRA A;  4LNU D;  1PAQ A;  3ABL E;  3PNL B;  5C1D A;  3NOG D;  2XHE A;  5FJY A;  4DX1 A;  5FQ7 A;  5D2M C;  3UKU G;  4U8H A;  5AEN A;  3KSQ A;  2L0I A;  3E4B A;  3SFX A;  2FO7 A;  2I1K A;  1NI1 A;  1W3B A;  1HF8 A;  2F37 A;  4CGW A;  2XGO A;  2GRO B;  5G05 C;  2MRI A;  2VGY A;  5ANR A;  2QFC A;  2F0Y A;  2XEE A;  2P9S G;  2P9U G;  3KS2 A;  4H7Y A;  3DEP A;  4DLQ A;  2I6H A;  2IEJ A;  4GA1 A;  3FEY A;  3ESK A;  4A3T A;  2GRN B;  1HG2 A;  1KZP A;  4BX8 A;  1NP7 A;  3J5P A;  2R03 A;  3P1U A;  3V31 A;  1D8D A;  1JPL A;  2CHW A;  1MX2 A;  1WM5 A;  3VTY A;  3DST A;  1HZ4 A;  2P2C P;  3SZ7 A;  2NXP A;  1H2V C;  1TR4 A;  3CKB A;  2R59 A;  5JMN D;  4JL0 A;  3ZW3 A;  3FTW A;  1HX8 A;  2FF4 A;  3PH0 C;  3ZEF A;  3ZUV B;  3TWT A;  1Q2Z A;  5J08 A;  3SI5 A;  1S64 A;  3E30 A;  4CT0 A;  4AV7 A;  2A5U A;  2AVP A;  2J4B A;  4UI9 J;  1H6P A;  2VGX B;  1A17 A;  2OEV A;  3D3M A;  2CHX A;  2RG8 A;  4TXQ A;  1TJF A;  5FTP A;  1QNF A;  4HXI A;  1MX6 A;  5KWD A;  2J4D A;  2WXO A;  5J90 A;  5T8I A;  5JA4 D;  4DRX E;  2ZU6 B;  1HXI A;  4ACK A;  3UXG A;  4KVO A;  2RFA A;  2Y0B G;  4MBG A;  2PQR A;  3JUE A;  2OND A;  3D9J A;  1XGW A;  4C48 B;  3FUF A;  5JJT A;  3SBS A;  5BUZ A;  3CQC B;  4IRU A;  1LF8 A;  2QZA A;  5EYP F;  3ASD A;  4LNB A;  4I1O B;  2JEK A;  2EIM E;  4J8Y A;  4N2Q A;  3HXB A;  5KJL A;  3PZD A;  4N5C A;  1OT8 A;  1IHG A;  4XEI G;  2C2L A;  3G2T A;  2EIJ E;  3P2B A;  4KZ0 A;  2EIL E;  3C5R A;  4KVM A;  3PNT B;  2BF0 X;  3IHV A;  2WMO A;  1OCO E;  3IXE A;  4ANU A;  1FCH A;  1N0Q A;  4N3B A;  3HYM B;  3AG4 E;  1V55 E;  4B0Z A;  5BW8 C;  5DIZ A;  3NB2 A;  2XEV A;  2VSN A;  2ETB A;  4G8L A;  3MV3 B;  3FFL A;  4O1P A;  2X6H A;  2P9P G;  4YDY A;  3KSL A;  4I17 A;  4NIK A;  2WM9 A;  4XKB A;  1IKN D;  2GRQ B;  4WNF A;  3PZ1 A;  5T3R A;  2HE0 A;  2LAH A;  5CMW A;  3C3Q A;  3QK0 A;  3ASO E;  4J7W A;  3R9A B;  4LUN U;  3ASH A;  4RVB A;  2KCK A;  3EDT B;  5CEC B;  2B0O E;  2Y3A A;  3MGB A;  3LCA A;  3CK8 A;  1OY3 D;  4AY6 A;  3GZ2 A;  3OXL A;  5ENQ D;  2WXN A;  4KYO B;  3QWP A;  3D9I A;  4AXH A;  2WQH A;  1E8W A;  2V0P A;  4L9P A;  3Q49 B;  2CG3 A;  3HIZ A;  5E75 A;  4G24 A;  3IEG A;  5CHE E;  1TN7 A;  3V30 A;  1WG0 A;  4WWO A;  1YCS B;  2LSV A;  2FUL A;  3RAU A;  3JXJ A;  4ZFH A;  3D9P A;  1HE8 A;  3L6A A;  4DX6 D;  4UI9 C;  3UT8 A;  4EBA A;  4HOS A;  2OVF A;  5CRU A;  4DJA A;  4ILG A;  2R5S A;  4ILH B;  4BET A;  4KBQ A;  5B3S E;  4WNG A;  3U9W A;  3HXC A;  2GW1 A;  2WXF A;  3CVV A;  4I1A A;  5LCW J;  2XGM A;  5EN5 D;  5AQ7 A;  2QY7 A;  1OUV A;  2M63 A;  5HS0 A;  1Z6T A;  1DNP A;  3Q15 A;  3JXI A;  1QZ2 A;  2ZXW E;  4HNA D;  5KJN A;  3RO2 A;  4K0R A;  1DC2 A;  5DBK A;  1JWF A;  4OAU C;  2J49 A;  2YQ8 A;  3FUL A;  4U0U A;  3VLD A;  4EZK A;  4U0S A;  3Q9N C;  2P9K G;  1XNF A;  5FQ8 A;  2L6B A;  2V4L A;  2H6G A;  4APF A;  3V2O A;  2PZI A;  4N3C A;  2LAI A;  2XGS A;  1L5J A;  3CLJ A;  4CZ2 D;  1OCZ E;  2L9B A;  3LVQ E;  2JAB A;  3EIQ C;  4ME2 A;  1LTX A;  4I9E A;  3BG1 B;  4HQD A;  2V8S E;  1U3D A;  3UPV A;  1ELK A;  4AVX A;  3F6Q A;  1E96 B;  3PVL A;  3CEQ A;  3PZ2 A;  2BKG A;  5BT1 A;  1N4P A;  3TXM A;  2FBN A;  2WXK A;  1UOH A;  1KLX A;  3MA5 A;  3X2Q E;  2DVW A;  3UX4 A;  2WB2 A;  3FWV A; 
#chains in the Genus database with same CATH homology
 2H6H A;  4GTQ A;  1X81 A;  3DSX A;  4EHM A;  4LNG A;  1LD8 A;  3HXC A;  1S63 A;  3KSL A;  1D8E A;  3Q75 A;  3KSQ A;  4GTS A;  3SFX A;  3DPY A;  1NI1 A;  4GTM A;  1JCS A;  1O1S A;  3PZ1 A;  3DSS A;  1MZC A;  4GTR A;  4MBG A;  3PZ3 A;  3Q78 A;  3E37 A;  3Q7F A;  2F0Y A;  3PZ4 A;  1TN8 A;  1DCE A;  3SFY A;  4YDO A;  1QBQ A;  2H6I A;  2IEJ A;  1N4S A;  3Q7A A;  1SA4 A;  4LNB A;  2BED A;  2R2L A;  1KZP A;  1KZO A;  3DRA A;  1JCR A;  2H6G A;  1D8D A;  1N4Q A;  3HXB A;  1TNU A;  4GTT A;  1O1R A;  4GTV A;  1O5M A;  4GTP A;  3DST A;  3EUV A;  1TNO A;  1JCQ A;  1FT2 A;  3E32 A;  1N95 A;  1TNB A;  3E33 A;  2ZIS A;  3DSV A;  4GTO A;  1SA5 A;  1LTX A;  3HXE A;  1O1T A;  1N4R A;  4L9P A;  1FPP A;  3DSU A;  1NL4 A;  3C72 A;  1LD7 A;  3HXD A;  3PZ2 A;  1S64 A;  3Q79 A;  1TN7 A;  1N94 A;  3E30 A;  2ZIR A;  1N4P A;  1FT1 A;  1TNZ A;  3DSW A;  3HXF A;  1N9A A;  3E34 A;  1TN6 A;  2H6F A;  3Q73 A;  3EU5 A;  4YDE A;  1TNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...