3Q79A

Cryptococcus neoformans protein farnesyltransferase in complex with farnesyl-ddptasacniq product
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
330
structure length
314
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase alpha subunit
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase
total genus 122
structure length 314
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q79A00
1TN6A 4GTMA 2H6FA 1NI1A 1TNUA 3Q7AA 1QBQA 1TNYA 3E37A 1N95A 1NL4A 2H6IA 2R2LA 4GTQA 3PZ3A 1O1TA 1N9AA 1KZPA 4LNBA 3KSLA 4GTSA 1N4PA 4EHMA 3EUVA 1SA5A 1D8DA 3DRAA 3DSTA 1JCQA 3KSQA 4GTTA 2ZIRA 3E30A 3DSUA 1N4RA 3DSSA 3Q7FA 1N4SA 1DCEA 1LD7A 1TNOA 1O1SA 1FT2A 1LTXA 3EU5A 1TN7A 1N4QA 4GTVA 4GTRA 1FPPA 1SA4A 1KZOA 2F0YA 3E33A 2IEJA 2BEDA 3E32A 1TN8A 3HXFA 3DSVA 4YDOA 1O1RA 3HXBA 1MZCA 4YDEA 1S63A 3SFYA 3DPYA 3DSWA 3HXDA 3E34A 3C72A 1FT1A 3Q73A 1JCSA 1JCRA 1LD8A 1N94A 4L9PA 1D8EA 2H6HA 2H6GA 3Q75A 3HXCA 3HXEA 3PZ4A 1S64A 4LNGA 4GTPA 1TNZA 2ZISA 1O5MA 1X81A 4GTOA 3Q78A 3SFXA 3Q79A 3PZ1A 1TNBA 4MBGA 3PZ2A 3DSXA
chains in the Genus database with same CATH superfamily
1E8YA 4A63B 1WAO1 4O6FA 5KBAA 2LXMA 3CVNA 3SO8A 3R9MA 3ZPJA 4GCOA 1ELRA 2GROB 4Y6CA 4CT4A 1H2VC 4WWNA 1XGWA 4OYSA 2XEHA 2PNNA 4L23A 2WVIA 2J4DA 2A5UA 3ZVVA 1KPSB 3C98A 5EILA 3FTZA 2F8YA 4GCNA 2JLBA 2IONA 3LY9A 3E4BA 4E85A 3GZ1A 2I1JA 4HBDA 3APDA 2EILE 4ANWA 1SZAA 4BEPA 1TN8A 3AS5A 2WXNA 3DSVA 3CVLA 3UINC 3ZYQA 3P1UA 2Y1LE 4JPSA 3L82A 4L1BA 4HXIA 3T5XA 4LEUA 3VLEA 3FDHA 3B7TA 3KEZA 1HZ4A 3DXKG 2X6FA 1QYMA 4H7YA 4BETA 3FU3A 2WMOA 1LD8A 3RKVA 3FUEA 3X2QE 1MQSA 4DI3A 4TUUA 5BV0A 3QARA 3CVWA 5AAOA 3BU8A 3EU9A 3DSXA 3B7SA 3SZ7A 3J5QB 3CVUA 3QOUA 5FIOA 5JJTA 2CFUA 2JEKA 3GW4A 1A17A 2OCCE 1OCZE 2ZGGA 5ARGA 3QK0A 4Q96A 2MHKA 1ZU2A 4LNUD 4FHJA 2NXPA 1N54A 5HS0A 3EUVA 4U07A 4AV7A 1YCSB 3L17A 3PE4A 3DSTA 2ZU6B 2R02A 3KD7A 1EPUA 2MRIA 2LNIA 1FVHA 4O1OA 2DIWA 4GB9A 2C2LA 3EU5A 4HNAD 3GZSA 3TWQA 2OV8A 4HS2A 2HM8A 3MV3B 3PREA 4HI8A 3FTUA 4XZ4A 3MGBA 4HVBA 3CVQA 2IJGX 4PDXA 3IV0A 2P9NG 1Z6TA 3CHRA 1E90A 4JB8P 2Y4TA 3UT4A 3SD5A 5AYWD 4PS8A 2XCCA 1TEZA 4UWGA 3OXFA 2V5FA 5BV1A 3UQ3A 3HXCA 3ULYA 3FUFA 4M3OA 3D3MA 3SFXA 1X5BA 4F1SA 2OEVA 5AQ7A 3PDNA 2AXUA 2HR2A 2QYUA 2XPIA 3CLJA 3ZUVB 2H6FA 3BG1B 2QC9A 2IO2C 4I1OB 4F3VA 3ZYKA 4CCAA 4EZKA 3I3NA 3TG5A 2XGSA 4JZYA 3R9AB 3UIOC 4LSZE 1A5EA 3KS2A 4F1PA 4AM9A 4EHMA 4B89A 4DX1A 3ONLA 1BI7B 2ZIRA 3IBEA 3QWVA 1BLXB 4RG6A 2PQRA 1VDYA 2RD0A 1DCEA 1TNOA 2P9UG 2VTBB 4IYPA 3AS8A 3JXJA 3PRZA 3QKYA 4ZHBA 3PNTB 4TXPA 3FU0A 2AXVA 3LVRE 2QZAA 3CHQA 3CGHA 4BT8A 1ELKA 3UMVA 4E6HA 3LY8A 3MCXA 2F37A 1UJKA 2WB2A 3CQCB 3L6AA 3DEOA 1HFAA 3CK8A 1D8EA 3OTNA 3NAWA 3D9LA 2XPYA 4CDRA 4ILHB 3NOCD 3WXXA 1SQMA 4U0ZA 3UIPC 4BTBA 3PZ1A 1H19A 4KT6B 5HRYA 3HVEB 4AY6A 4CDNA 4IN3B 2P9LG 3V79K 4NIKA 5ANRA 4MLPA 2R2LA 4I2WA 1HX8A 1FVFA 3B13A 4Q94A 3BG0B 3S2AA 4K5CA 2YHCA 1MX2A 4APOA 3U3WA 3TWRA 1G3NB 3UKRG 1PAQA 1NA3A 3ONKA 3DXMG 3GYZA 3UT8A 4HQDA 4AP2A 1LD7A 5BNWA 2XHEA 3ZHEA 2A5EA 4OAUC 2V8SE 3B7RL 3G2TA 2XGOA 3GZ2A 3AG2E 3N71A 3TG4A 4ACKA 3D9JA 5LP0A 1O1RA 1RZ4A 4A55A 3U64A 5B1BE 4FU3A 4XE0A 2EIKE 3Q73A 3KEAA 4JVSA 1SW6A 2H6HA 3S7DA 2H6GA 1H2TC 3IHYA 1EDUA 3U4TA 5G04J 2LXLA 4UWKA 4Z68A 4B94A 3G2UA 3CHMA 3ZRHA 2ONDA 1MHQA 2DYSE 2IOLA 4DX5D 4IULA 3FUIA 1N0RA 4KVMA 4KVOA 4LCTA 1ZB1A 3PZ3A 4JA9A 4JHRA 4HRMB 1KZPA 2NSZA 3WG7E 4DX6D 1KT1A 4F7AA 3CR3A 2IQCA 2DCPA 4W9RA 2YINA 3B7BA 3DSSA 3ISMC 3HHMA 2WXKA 3TJPA 2LSVA 1OWOA 1GW6A 4U63A 4FULA 4GTVA 1MX6A 4ILGA 1ELWA 3IHVA 4AY5A 3UPVA 5LFAA 3QWWA 4C0MA 3PE3A 2MOWA 1TJCA 1MZCA 3FTXA 5FT9A 1JUQA 5A6CA 4FA6A 1TJFA 3CSTA 4L9PA 3AU4A 3DWLG 4U95D 2IOSA 2J9QA 4CZ2D 4GU5A 4F53A 2GRMA 2NC9A 2FF4A 4O60A 2VQ2A 2WXLA 4ATZD 1K3ZD 2QYJA 2EQXA 1U3CA 3Q79A 4GMRA 2XCBA 3PS6A 3HVEA 1B89A 3LS8A 3LKUA 3V30A 5KJKA 2WXHA 4HRLA 3QB2A 4XIFA 4GTQA 3MX3A 5KJMA 1N9AA 3D9NA 1V55E 3CV0A 5BXUA 4U04A 1K1AA 2L0IA 4DRXE 4GZ5A 1Z3XA 2OEWA 4WAFA 1XNFA 1D8DA 3DSUA 4KBQA 1N4SA 3ZKJA 4AJWA 4MRUA 3SI5A 3CKBA 3RRNB 5KNHD 4N2SA 1D9SA 3V31A 2IU1A 5ENNA 3ZNGA 3QJZA 2B6CA 3SGHA 4PS3A 3RSEG 3UM3A 2F0YA 2I2OA 4J8FA 3FH5A 3CVYA 1S63A 2DVWA 5DBKA 2R03A 1RW2A 4JD2G 3IKOB 2CG3A 3C72A 1DC2A 3D9IA 3ESLA 3V2XA 3RRMB 5JHBA 3JUIA 5D66A 2YQ8A 2R5SA 3OXLA 4UQZA 4JL0A 1P5QA 5FTPA 1O5MA 4AXHA 3QWPA 4HOTA 1Z3YA 2CHXA 3ABLE 4CT0A 2XENA 2EIME 3FULA 1DCQA 4LERA 2FO1E 3G2WA 4K5AB 3Q4AB 3ZXSA 4TV3A 3MA5A 2X6HA 3ZN3A 4GA0A 4JHKA 1HU3A 4EECA 3ASGA 3RRUA 1L5JA 4C0EA 2FBNA 4GTTA 3JQ0A 5T3RA 2IY0C 4RLYA 4GYOA 3FUDA 1SVXA 3C5RA 3ZXPA 3RJVA 4JC8A 5CHEE 4PH4B 4B0ZA 2C0MA 4CDMA 5C2YA 4C9BB 2VSYA 4I43A 4J8DA 4ACLA 3UXGA 1E7UA 4N3AA 3ZW3A 3ESKA 2CG2A 2MYOA 3DSWA 3ZHEB 2OOEA 3FUHA 4JA7A 1K1BA 2DYRE 3R7QA 5BPPA 3BUAA 3PEVB 5G04C 3EJNA 4NQ0A 3ML8A 5D0QD 4GTOA 2ZGDA 3JQ1A 1E7VA 5CMWA 3CSFA 2YHEA 2VGYA 4YDYA 5AENA 2X6KA 4EQFA 2GRLA 2CHWA 2KC7A 1TN6A 1Q2ZA 5AIJA 1NI1A 1QNFA 4OVVA 5B1AE 4N2QA 2H6IA 5CCMA 3FFLA 3FEXA 2XEVA 3TXMA 1OWNA 4DPRA 2GW1A 4L2LA 5FQ6A 1UW4B 2FI7A 1N4PA 1PC2A 4I2ZA 2B0OE 2DZOA 3DBSA 5JHAA 3KSQA 5ANLA 3LY7A 4AIFA 4I9EA 3ZYMA 4DLOA 3SF4A 3UM0A 3T9KA 3MJWA 5FQ4A 3ZFWA 3JXIA 1E8ZA 4J0UA 4U0SA 3HYMB 3RU0A 3TWUA 1HG5A 1PY1A 4NRHB 1OXJA 2FO7A 3HXBA 3HG0D 3B95A 4AOFA 4J8YA 4JEHA 3ZGQA 4GAAA 4DI4A 1FT1A 4U8YD 1WDYA 3I5PA 1JCRA 1N94A 3PUKA 1BD8A 1IQUA 2WXQA 2BKKB 3PVLA 2J4BA 4FLBA 2LAIA 5CBOA 1H6KA 2XS1A 3LEWA 3HXEA 1S64A 3FUKA 1X81A 3EIQC 5BW8C 4ANVA 4N39A 5E75A 3FY4A 3PZ2A 3MKRA 4U8VD 5E76A 1TNUA 1W3BA 5G05J 3E37A 2I6HA 1JWGA 3FWVA 4CRWA 2NYJA 1DNPA 1WM5A 2WXJA 4XI9A 1WG0A 2RG8A 4FLHA 2DWZA 2WMNA 4GTSA 2BUGA 3PUJA 2KZTA 5AQ9A 4BY6A 2HE0A 4NURA 5LOZA 3E30A 1BI8B 1HH8A 4I17A 2AWIA 3Q7FA 2UWJG 5J90A 2YNQA 3JUEA 3UX4A 4XX5A 3CEQA 1IKND 3AU5A 2R59A 5KJNA 1ZBPA 2J09A 5ITZF 5JJ7A 4YNDA 4OVUA 4FHKA 3O4ZA 4BX9A 3TWWA 3OXGA 4KZCA 4XEIG 1UJJA 4YDOA 3L9TA 3TWTA 4F6RD 5CBNA 2PZIA 1FCHA 3E34A 2XS8A 3AJIA 3LJNA 4LUNU 2WXRA 4G24A 5KJLA 2PM7A 4HORA 2Y4UA 3UT7A 4B8CB 3ASDA 2QY7A 5FWQA 4XKCA 4ANXA 3FUJA 1TR4A 3CHPA 2I1KA 2VJ8A 1DVPA 3FTWA 4UWFA 4I6EA 4Y6WA 3ASFA 4FJYA 2Q7FA 5FQ7A 3BEEA 4HRNA 5BT1A 5M72A 3TWVA 4GTMA 3FTSA 2RFMA 2XZDG 1UN8A 4BX8A 1QBQA 3ABME 2V0PA 1E96B 2DBAA 4C48B 5AARA 4M7CA 4J6IA 3NBNB 3C3QA 2ZXWE 4PUCA 4GA1A 4N5QA 2DZNA 3ULQA 2IF4A 5CEDB 1OCCE 2VSXE 1SA5A 1N4RA 4DJAA 4DX2A 5LCWJ 1UOHA 3T8KA 2GRNB 3FU6A 1N4QA 3LXUX 1UG3A 2E0IA 3EHMA 5EX3A 3PNLB 2BEDA 5EN5D 4HOSA 3AG1E 4KMOA 1UN9A 4BERA 2KXPC 2P9KG 2XQ0A 4ME2A 3NZSA 2CFZA 4X8QA 4D10C 4TUMA 3D9HA 3Q75A 1H6OA 5ARFA 3DPDA 1AWCB 3PZ4A 3QC1A 2IO3C 4Q69A 1LF8A 3UM1A 4CEMA 2BTDA 5LX8A 3S7JA 4G26A 2WXIA 2ETBA 4QFVA 1TYQG 3AG3E 3UI2A 4K5BA 2AW6A 5DIZA 1NP7A 1EF1C 1OCOE 5B3SE 4A1SA 3FHEA 3NZUA 3CQGB 3VLDA 1OWPA 1OCRE 5AQAA 1O1TA 2XPZA 2WQHA 3D9OA 2FEZA 3URZA 4GPKA 3DEPA 3D9PA 3EHNA 2WPVA 4UI9J 4WNEA 2IFUA 3UKUG 4JW1A 2PL2A 5T4YA 3JYSA 2GRQB 5HQ8A 4GZCA 4KZ0A 2Y69E 4MKTA 4I1AA 3AS4A 1O1SA 3ULEG 2QFCA 2L6BA 4FC8A 4V3IA 3SBSA 4FADA 2BF0X 1SA4A 4GMJA 4A3TA 4GYWA 1BPOA 3CIAA 3HXFA 4LRZA 4EPZA 1HE8A 4U8HA 1NFIE 1S70B 1MX4A 2EIJE 2XZTG 2ETCA 2XGMA 1INZA 2HO1A 4UI9K 3Q47B 1Y8MA 5FZRA 3QNKA 3SNXA 2GGFA 3S7FA 5D0OD 3FH7A 2V5QC 2Y0BG 4U7EB 5ENRD 4DUIA 5JMND 3UTMA 2V4LA 4DK5A 2CHZA 2L0TB 5G05C 3MKQA 1WY6A 3CVVA 3CHOA 3L54A 3Q7AA 1N95A 4UWLA 5D2MC 5ENQD 3ENEA 1EYHA 4JXTA 1QZ2A 3SQVA 3TXNA 4GPMA 3KSLA 2J8SD 3EHRA 4K0RA 3VTXA 2I9CA 4WWOA 3P2BA 1HG2A 1HS6A 2KCKA 3EHQA 1JPLA 4HLLA 1OWLA 1HO8A 3APFA 1FT2A 3I4GA 3FUMA 1LTXA 3LYAA 5H7PA 2LUHA 3G2VA 4JEUA 4N5CA 2KZTB 2WXOA 2F8XK 2J08A 3C3OA 4J8EA 1NZNA 1IHGA 3DPYA 2VYIA 4ILIA 2VGXB 3HXDA 4XI0A 4P29A 2J07A 3LDZA 2L9BA 1QQEA 4I6JA 5G2NA 1N0QA 2XRYA 3PZDA 3RK6A 3T8MA 5FQ8A 5CRVA 3O48A 3QAQA 3MV2B 3PEUB 1MJ0A 5CMYA 5FINA 2XRZA 2LAHA 4HB5A 3R7RA 2KBXA 3CHSA 4EZJA 2OVFA 4LNGA 2ZISA 2UY1A 1OY3D 3I4RB 3L22A 3AAAC 5AJLA 4J8SA 3W9FA 4WNDA 3Q15A 4B93B 4BSXA 3NB2A 5ENTD 2WM9A 4MS6A 3AG4E 4YVQC 3B7UX 5AN8A 4GYYA 3FTVA 3IXEA 2L6JA 2ILRA 1IXVA 3L13A 3ML9A 1H6PA 4WNGA 3G2SA 2WXGA 3D9MA 3FP3A 4GMLA 5FZQA 2OVBA 3ABKE 4WNFA 3TGOA 2VGEA 2GRPB 2P9PG 4GA2A 2Y3AA 5LCWC 3LVQE 4G8LA 2X3MA 1U2VG 3F6QA 2V4HC 3S7BA 2R05A 3NQPA 4R7LA 3V2OA 1TN7A 1IHBA 4EZLA 2VSNA 4TRQA 3SY2A 5CERB 4FP7A 4UQYA 3ZYLA 1NA0A 3SFYA 5KWDA 4UUCA 2ETAA 4N3CA 2PQNA 3TWSA 4AEZC 4AVXA 1JWFA 3ZEFA 4BESA 4CYMD 2X6JA 1KT0A 3J5PA 2R17C 4GTPA 4UQXA 3VTYA 5ENSD 3FUNA 5KCMA 1IQRA 1HXIA 5JA4D 5EYLA 3KAEA 3CK7A 3NOGD 4ABNA 2AVPA 3U9WA 1TNYA 3LPZA 3LCAA 1AP7A 4JHJA 3TL5A 4U96D 5CECB 4HFGA 2X38A 4UI9C 4WUYA 4HLEA 4BTAA 4DLQA 4YVOA 4I6GA 2XEEA 5BUZA 4G8KA 4HI9A 4I1MA 1E8WA 4NACA 5EX0A 5EKQD 5KNGA 1Y6IA 3MYVA 1K8KG 4J7WA 4CGVA 2P9IG 1Z5SC 4UWHA 1S0PA 2IEJA 1SZ9A 5A23A 3TAXA 3ASNE 4ATGA 3PH0C 2PM6A 3BQOA 3HIZA 2VGXA 4URKA 3L08A 2AJAA 3NF1A 5ENOD 1U3DA 3W9GA 5CEAA 3SHFA 3QDNA 1OUVA 1V54E 5FZSA 5HI7A 3SFZA 3RO2A 2P2CP 1E8XA 2C0LA 4KYOB 5EIDA 4RQIA 5EIBE 1TNBA 4MBGA 4EBAG 4BWRA 4RVBA 3ZU7B 3U66A 1YA0A 5ENPD 3RIBA 1OWMA 3FH8A 2E2EA 5T8IA 4G1TA 4HOQA 4G23A 3JCKC 4TXRA 3EDTB 2WQ6A 4B8AA 1YYHA 4APFA 3UUXA 2P58C 4LNBA 3Q49B 3L16A 5HKPA 1N11A 3MKQB 3UM2A 3ASHA 1H2UA 4TXQA 4G11A 2LO6A 1BU9A 3FU5A 3IEGA 4H7XA 4PS7A 4G2VA 4DX7D 4L7TA 3FEYA 4ANUA 4FJZA 2KCVA 2JABA 2P9SG 4GTRA 1FPPA 3APCA 4L2YA 1HF8A 2LSUA 3T5VA 2HYZA 2RFAA 2M63A 4YDEA 5BXOA 4KXKB 3CVXA 4EBAA 1MYOA 3VLFA 4LG6A 1IYGA 5EDSA 4GZ6A 2FULA 5EYPF 4CGWA 1TNZA 3SBTB 3Q78A 4OAVB 2AXZA 3MZLB 2GRRB 3RAUA 5AQBA 1N52A 4QQIA 4U0UA 2WQ7A 3MEKA 1NL4A 4O1PA 1H0AA 5IY5E 2VTBA 2UY1B 5JJ6A 3CK9A 3CKCA 4K03A 2KCLA 4RSYA 1YMPA 4RG9A 2EINE 3OAWA 3DRAA 3ZIMA 1JCQA 3HDXA 4G25A 4GZDA 5C1DA 4BSZB 1KLXA 4A1GA 5CCLA 3C3RA 2BKGA 4GZ3A 2VSOE 2KATA 4XKBA 3D9KA 3HRAA 3RO3A 1KZOA 2WXMA 5FJYA 3E33A 2J49A 3CVPA 3E32A 2A4ZA 4IRUA 4N3BA 2WXPA 5G55A 4HOUA 4YDWA 5CRUA 4BFRA 2WXFA 1OT8A 1JCSA 4A3VA 4WWPA 3FTYA 5A7DB 3LJ3A 3TWXA 5J08A 4I9CA 3K9IA 3ASOE 3Q9UC 2KM4A 5AJDA 2RKKA 2X6IA 4ZFHA 4BT9A 3Q9NC 3Q5MA 3EIJA
chains in the Genus database with same CATH topology
1TN6A 4GTMA 2H6FA 1NI1A 1TNUA 3Q7AA 1QBQA 1TNYA 3E37A 1N95A 1NL4A 2H6IA 2R2LA 4GTQA 3PZ3A 1O1TA 1N9AA 1KZPA 4LNBA 3KSLA 4GTSA 1N4PA 4EHMA 3EUVA 1SA5A 1D8DA 3DRAA 3DSTA 1JCQA 3KSQA 4GTTA 2ZIRA 3E30A 3DSUA 1N4RA 3DSSA 3Q7FA 1N4SA 1DCEA 1LD7A 1TNOA 1O1SA 1FT2A 1LTXA 3EU5A 1TN7A 1N4QA 4GTVA 4GTRA 1FPPA 1SA4A 1KZOA 2F0YA 3E33A 2IEJA 2BEDA 3E32A 1TN8A 3HXFA 3DSVA 4YDOA 1O1RA 3HXBA 1MZCA 4YDEA 1S63A 3SFYA 3DPYA 3DSWA 3HXDA 3E34A 3C72A 1FT1A 3Q73A 1JCSA 1JCRA 1LD8A 1N94A 4L9PA 1D8EA 2H6HA 2H6GA 3Q75A 3HXCA 3HXEA 3PZ4A 1S64A 4LNGA 4GTPA 1TNZA 2ZISA 1O5MA 1X81A 4GTOA 3Q78A 3SFXA 3Q79A 3PZ1A 1TNBA 4MBGA 3PZ2A 3DSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN6 A;  4GTM A;  2H6F A;  1NI1 A;  1TNU A;  3Q7A A;  1QBQ A;  1TNY A;  3E37 A;  1N95 A;  1NL4 A;  2H6I A;  2R2L A;  4GTQ A;  3PZ3 A;  1O1T A;  1N9A A;  1KZP A;  4LNB A;  3KSL A;  4GTS A;  1N4P A;  4EHM A;  3EUV A;  1SA5 A;  1D8D A;  3DRA A;  3DST A;  1JCQ A;  3KSQ A;  4GTT A;  2ZIR A;  3E30 A;  3DSU A;  1N4R A;  3DSS A;  3Q7F A;  1N4S A;  1DCE A;  1LD7 A;  1TNO A;  1O1S A;  1FT2 A;  1LTX A;  3EU5 A;  1TN7 A;  1N4Q A;  4GTV A;  4GTR A;  1FPP A;  1SA4 A;  1KZO A;  2F0Y A;  3E33 A;  2IEJ A;  2BED A;  3E32 A;  1TN8 A;  3HXF A;  3DSV A;  4YDO A;  1O1R A;  3HXB A;  1MZC A;  4YDE A;  1S63 A;  3SFY A;  3DPY A;  3DSW A;  3HXD A;  3E34 A;  3C72 A;  1FT1 A;  3Q73 A;  1JCS A;  1JCR A;  1LD8 A;  1N94 A;  4L9P A;  1D8E A;  2H6H A;  2H6G A;  3Q75 A;  3HXC A;  3HXE A;  3PZ4 A;  1S64 A;  4LNG A;  4GTP A;  1TNZ A;  2ZIS A;  1O5M A;  1X81 A;  4GTO A;  3Q78 A;  3SFX A;  3Q79 A;  3PZ1 A;  1TNB A;  4MBG A;  3PZ2 A;  3DSX A; 
#chains in the Genus database with same CATH topology
 1E8Y A;  4A63 B;  1WAO 1;  4O6F A;  5KBA A;  2LXM A;  3CVN A;  3SO8 A;  3R9M A;  3ZPJ A;  4GCO A;  1ELR A;  2GRO B;  4Y6C A;  4CT4 A;  1H2V C;  4WWN A;  1XGW A;  4OYS A;  2XEH A;  2PNN A;  4L23 A;  2WVI A;  2J4D A;  2A5U A;  3ZVV A;  1KPS B;  3C98 A;  5EIL A;  3FTZ A;  2F8Y A;  4GCN A;  2JLB A;  2ION A;  3LY9 A;  3E4B A;  4E85 A;  3GZ1 A;  2I1J A;  4HBD A;  3APD A;  2EIL E;  4ANW A;  1SZA A;  4BEP A;  1TN8 A;  3AS5 A;  2WXN A;  3DSV A;  3CVL A;  3UIN C;  3ZYQ A;  3P1U A;  2Y1L E;  4JPS A;  3L82 A;  4L1B A;  4HXI A;  3T5X A;  4LEU A;  3VLE A;  3FDH A;  3B7T A;  3KEZ A;  1HZ4 A;  3DXK G;  2X6F A;  1QYM A;  4H7Y A;  4BET A;  3FU3 A;  2WMO A;  1LD8 A;  3RKV A;  3FUE A;  3X2Q E;  1MQS A;  4DI3 A;  4TUU A;  5BV0 A;  3QAR A;  3CVW A;  5AAO A;  3BU8 A;  3EU9 A;  3DSX A;  3B7S A;  3SZ7 A;  3J5Q B;  3CVU A;  3QOU A;  5FIO A;  5JJT A;  2CFU A;  2JEK A;  3GW4 A;  1A17 A;  2OCC E;  1OCZ E;  2ZGG A;  5ARG A;  3QK0 A;  4Q96 A;  2MHK A;  1ZU2 A;  4LNU D;  4FHJ A;  2NXP A;  1N54 A;  5HS0 A;  3EUV A;  4U07 A;  4AV7 A;  1YCS B;  3L17 A;  3PE4 A;  3DST A;  2ZU6 B;  2R02 A;  3KD7 A;  1EPU A;  2MRI A;  2LNI A;  1FVH A;  4O1O A;  2DIW A;  4GB9 A;  2C2L A;  3EU5 A;  4HNA D;  3GZS A;  3TWQ A;  2OV8 A;  4HS2 A;  2HM8 A;  3MV3 B;  3PRE A;  4HI8 A;  3FTU A;  4XZ4 A;  3MGB A;  4HVB A;  3CVQ A;  2IJG X;  4PDX A;  3IV0 A;  2P9N G;  1Z6T A;  3CHR A;  1E90 A;  4JB8 P;  2Y4T A;  3UT4 A;  3SD5 A;  5AYW D;  4PS8 A;  2XCC A;  1TEZ A;  4UWG A;  3OXF A;  2V5F A;  5BV1 A;  3UQ3 A;  3HXC A;  3ULY A;  3FUF A;  4M3O A;  3D3M A;  3SFX A;  1X5B A;  4F1S A;  2OEV A;  5AQ7 A;  3PDN A;  2AXU A;  2HR2 A;  2QYU A;  2XPI A;  3CLJ A;  3ZUV B;  2H6F A;  3BG1 B;  2QC9 A;  2IO2 C;  4I1O B;  4F3V A;  3ZYK A;  4CCA A;  4EZK A;  3I3N A;  3TG5 A;  2XGS A;  4JZY A;  3R9A B;  3UIO C;  4LSZ E;  1A5E A;  3KS2 A;  4F1P A;  4AM9 A;  4EHM A;  4B89 A;  4DX1 A;  3ONL A;  1BI7 B;  2ZIR A;  3IBE A;  3QWV A;  1BLX B;  4RG6 A;  2PQR A;  1VDY A;  2RD0 A;  1DCE A;  1TNO A;  2P9U G;  2VTB B;  4IYP A;  3AS8 A;  3JXJ A;  3PRZ A;  3QKY A;  4ZHB A;  3PNT B;  4TXP A;  3FU0 A;  2AXV A;  3LVR E;  2QZA A;  3CHQ A;  3CGH A;  4BT8 A;  1ELK A;  3UMV A;  4E6H A;  3LY8 A;  3MCX A;  2F37 A;  1UJK A;  2WB2 A;  3CQC B;  3L6A A;  3DEO A;  1HFA A;  3CK8 A;  1D8E A;  3OTN A;  3NAW A;  3D9L A;  2XPY A;  4CDR A;  4ILH B;  3NOC D;  3WXX A;  1SQM A;  4U0Z A;  3UIP C;  4BTB A;  3PZ1 A;  1H19 A;  4KT6 B;  5HRY A;  3HVE B;  4AY6 A;  4CDN A;  4IN3 B;  2P9L G;  3V79 K;  4NIK A;  5ANR A;  4MLP A;  2R2L A;  4I2W A;  1HX8 A;  1FVF A;  3B13 A;  4Q94 A;  3BG0 B;  3S2A A;  4K5C A;  2YHC A;  1MX2 A;  4APO A;  3U3W A;  3TWR A;  1G3N B;  3UKR G;  1PAQ A;  1NA3 A;  3ONK A;  3DXM G;  3GYZ A;  3UT8 A;  4HQD A;  4AP2 A;  1LD7 A;  5BNW A;  2XHE A;  3ZHE A;  2A5E A;  4OAU C;  2V8S E;  3B7R L;  3G2T A;  2XGO A;  3GZ2 A;  3AG2 E;  3N71 A;  3TG4 A;  4ACK A;  3D9J A;  5LP0 A;  1O1R A;  1RZ4 A;  4A55 A;  3U64 A;  5B1B E;  4FU3 A;  4XE0 A;  2EIK E;  3Q73 A;  3KEA A;  4JVS A;  1SW6 A;  2H6H A;  3S7D A;  2H6G A;  1H2T C;  3IHY A;  1EDU A;  3U4T A;  5G04 J;  2LXL A;  4UWK A;  4Z68 A;  4B94 A;  3G2U A;  3CHM A;  3ZRH A;  2OND A;  1MHQ A;  2DYS E;  2IOL A;  4DX5 D;  4IUL A;  3FUI A;  1N0R A;  4KVM A;  4KVO A;  4LCT A;  1ZB1 A;  3PZ3 A;  4JA9 A;  4JHR A;  4HRM B;  1KZP A;  2NSZ A;  3WG7 E;  4DX6 D;  1KT1 A;  4F7A A;  3CR3 A;  2IQC A;  2DCP A;  4W9R A;  2YIN A;  3B7B A;  3DSS A;  3ISM C;  3HHM A;  2WXK A;  3TJP A;  2LSV A;  1OWO A;  1GW6 A;  4U63 A;  4FUL A;  4GTV A;  1MX6 A;  4ILG A;  1ELW A;  3IHV A;  4AY5 A;  3UPV A;  5LFA A;  3QWW A;  4C0M A;  3PE3 A;  2MOW A;  1TJC A;  1MZC A;  3FTX A;  5FT9 A;  1JUQ A;  5A6C A;  4FA6 A;  1TJF A;  3CST A;  4L9P A;  3AU4 A;  3DWL G;  4U95 D;  2IOS A;  2J9Q A;  4CZ2 D;  4GU5 A;  4F53 A;  2GRM A;  2NC9 A;  2FF4 A;  4O60 A;  2VQ2 A;  2WXL A;  4ATZ D;  1K3Z D;  2QYJ A;  2EQX A;  1U3C A;  3Q79 A;  4GMR A;  2XCB A;  3PS6 A;  3HVE A;  1B89 A;  3LS8 A;  3LKU A;  3V30 A;  5KJK A;  2WXH A;  4HRL A;  3QB2 A;  4XIF A;  4GTQ A;  3MX3 A;  5KJM A;  1N9A A;  3D9N A;  1V55 E;  3CV0 A;  5BXU A;  4U04 A;  1K1A A;  2L0I A;  4DRX E;  4GZ5 A;  1Z3X A;  2OEW A;  4WAF A;  1XNF A;  1D8D A;  3DSU A;  4KBQ A;  1N4S A;  3ZKJ A;  4AJW A;  4MRU A;  3SI5 A;  3CKB A;  3RRN B;  5KNH D;  4N2S A;  1D9S A;  3V31 A;  2IU1 A;  5ENN A;  3ZNG A;  3QJZ A;  2B6C A;  3SGH A;  4PS3 A;  3RSE G;  3UM3 A;  2F0Y A;  2I2O A;  4J8F A;  3FH5 A;  3CVY A;  1S63 A;  2DVW A;  5DBK A;  2R03 A;  1RW2 A;  4JD2 G;  3IKO B;  2CG3 A;  3C72 A;  1DC2 A;  3D9I A;  3ESL A;  3V2X A;  3RRM B;  5JHB A;  3JUI A;  5D66 A;  2YQ8 A;  2R5S A;  3OXL A;  4UQZ A;  4JL0 A;  1P5Q A;  5FTP A;  1O5M A;  4AXH A;  3QWP A;  4HOT A;  1Z3Y A;  2CHX A;  3ABL E;  4CT0 A;  2XEN A;  2EIM E;  3FUL A;  1DCQ A;  4LER A;  2FO1 E;  3G2W A;  4K5A B;  3Q4A B;  3ZXS A;  4TV3 A;  3MA5 A;  2X6H A;  3ZN3 A;  4GA0 A;  4JHK A;  1HU3 A;  4EEC A;  3ASG A;  3RRU A;  1L5J A;  4C0E A;  2FBN A;  4GTT A;  3JQ0 A;  5T3R A;  2IY0 C;  4RLY A;  4GYO A;  3FUD A;  1SVX A;  3C5R A;  3ZXP A;  3RJV A;  4JC8 A;  5CHE E;  4PH4 B;  4B0Z A;  2C0M A;  4CDM A;  5C2Y A;  4C9B B;  2VSY A;  4I43 A;  4J8D A;  4ACL A;  3UXG A;  1E7U A;  4N3A A;  3ZW3 A;  3ESK A;  2CG2 A;  2MYO A;  3DSW A;  3ZHE B;  2OOE A;  3FUH A;  4JA7 A;  1K1B A;  2DYR E;  3R7Q A;  5BPP A;  3BUA A;  3PEV B;  5G04 C;  3EJN A;  4NQ0 A;  3ML8 A;  5D0Q D;  4GTO A;  2ZGD A;  3JQ1 A;  1E7V A;  5CMW A;  3CSF A;  2YHE A;  2VGY A;  4YDY A;  5AEN A;  2X6K A;  4EQF A;  2GRL A;  2CHW A;  2KC7 A;  1TN6 A;  1Q2Z A;  5AIJ A;  1NI1 A;  1QNF A;  4OVV A;  5B1A E;  4N2Q A;  2H6I A;  5CCM A;  3FFL A;  3FEX A;  2XEV A;  3TXM A;  1OWN A;  4DPR A;  2GW1 A;  4L2L A;  5FQ6 A;  1UW4 B;  2FI7 A;  1N4P A;  1PC2 A;  4I2Z A;  2B0O E;  2DZO A;  3DBS A;  5JHA A;  3KSQ A;  5ANL A;  3LY7 A;  4AIF A;  4I9E A;  3ZYM A;  4DLO A;  3SF4 A;  3UM0 A;  3T9K A;  3MJW A;  5FQ4 A;  3ZFW A;  3JXI A;  1E8Z A;  4J0U A;  4U0S A;  3HYM B;  3RU0 A;  3TWU A;  1HG5 A;  1PY1 A;  4NRH B;  1OXJ A;  2FO7 A;  3HXB A;  3HG0 D;  3B95 A;  4AOF A;  4J8Y A;  4JEH A;  3ZGQ A;  4GAA A;  4DI4 A;  1FT1 A;  4U8Y D;  1WDY A;  3I5P A;  1JCR A;  1N94 A;  3PUK A;  1BD8 A;  1IQU A;  2WXQ A;  2BKK B;  3PVL A;  2J4B A;  4FLB A;  2LAI A;  5CBO A;  1H6K A;  2XS1 A;  3LEW A;  3HXE A;  1S64 A;  3FUK A;  1X81 A;  3EIQ C;  5BW8 C;  4ANV A;  4N39 A;  5E75 A;  3FY4 A;  3PZ2 A;  3MKR A;  4U8V D;  5E76 A;  1TNU A;  1W3B A;  5G05 J;  3E37 A;  2I6H A;  1JWG A;  3FWV A;  4CRW A;  2NYJ A;  1DNP A;  1WM5 A;  2WXJ A;  4XI9 A;  1WG0 A;  2RG8 A;  4FLH A;  2DWZ A;  2WMN A;  4GTS A;  2BUG A;  3PUJ A;  2KZT A;  5AQ9 A;  4BY6 A;  2HE0 A;  4NUR A;  5LOZ A;  3E30 A;  1BI8 B;  1HH8 A;  4I17 A;  2AWI A;  3Q7F A;  2UWJ G;  5J90 A;  2YNQ A;  3JUE A;  3UX4 A;  4XX5 A;  3CEQ A;  1IKN D;  3AU5 A;  2R59 A;  5KJN A;  1ZBP A;  2J09 A;  5ITZ F;  5JJ7 A;  4YND A;  4OVU A;  4FHK A;  3O4Z A;  4BX9 A;  3TWW A;  3OXG A;  4KZC A;  4XEI G;  1UJJ A;  4YDO A;  3L9T A;  3TWT A;  4F6R D;  5CBN A;  2PZI A;  1FCH A;  3E34 A;  2XS8 A;  3AJI A;  3LJN A;  4LUN U;  2WXR A;  4G24 A;  5KJL A;  2PM7 A;  4HOR A;  2Y4U A;  3UT7 A;  4B8C B;  3ASD A;  2QY7 A;  5FWQ A;  4XKC A;  4ANX A;  3FUJ A;  1TR4 A;  3CHP A;  2I1K A;  2VJ8 A;  1DVP A;  3FTW A;  4UWF A;  4I6E A;  4Y6W A;  3ASF A;  4FJY A;  2Q7F A;  5FQ7 A;  3BEE A;  4HRN A;  5BT1 A;  5M72 A;  3TWV A;  4GTM A;  3FTS A;  2RFM A;  2XZD G;  1UN8 A;  4BX8 A;  1QBQ A;  3ABM E;  2V0P A;  1E96 B;  2DBA A;  4C48 B;  5AAR A;  4M7C A;  4J6I A;  3NBN B;  3C3Q A;  2ZXW E;  4PUC A;  4GA1 A;  4N5Q A;  2DZN A;  3ULQ A;  2IF4 A;  5CED B;  1OCC E;  2VSX E;  1SA5 A;  1N4R A;  4DJA A;  4DX2 A;  5LCW J;  1UOH A;  3T8K A;  2GRN B;  3FU6 A;  1N4Q A;  3LXU X;  1UG3 A;  2E0I A;  3EHM A;  5EX3 A;  3PNL B;  2BED A;  5EN5 D;  4HOS A;  3AG1 E;  4KMO A;  1UN9 A;  4BER A;  2KXP C;  2P9K G;  2XQ0 A;  4ME2 A;  3NZS A;  2CFZ A;  4X8Q A;  4D10 C;  4TUM A;  3D9H A;  3Q75 A;  1H6O A;  5ARF A;  3DPD A;  1AWC B;  3PZ4 A;  3QC1 A;  2IO3 C;  4Q69 A;  1LF8 A;  3UM1 A;  4CEM A;  2BTD A;  5LX8 A;  3S7J A;  4G26 A;  2WXI A;  2ETB A;  4QFV A;  1TYQ G;  3AG3 E;  3UI2 A;  4K5B A;  2AW6 A;  5DIZ A;  1NP7 A;  1EF1 C;  1OCO E;  5B3S E;  4A1S A;  3FHE A;  3NZU A;  3CQG B;  3VLD A;  1OWP A;  1OCR E;  5AQA A;  1O1T A;  2XPZ A;  2WQH A;  3D9O A;  2FEZ A;  3URZ A;  4GPK A;  3DEP A;  3D9P A;  3EHN A;  2WPV A;  4UI9 J;  4WNE A;  2IFU A;  3UKU G;  4JW1 A;  2PL2 A;  5T4Y A;  3JYS A;  2GRQ B;  5HQ8 A;  4GZC A;  4KZ0 A;  2Y69 E;  4MKT A;  4I1A A;  3AS4 A;  1O1S A;  3ULE G;  2QFC A;  2L6B A;  4FC8 A;  4V3I A;  3SBS A;  4FAD A;  2BF0 X;  1SA4 A;  4GMJ A;  4A3T A;  4GYW A;  1BPO A;  3CIA A;  3HXF A;  4LRZ A;  4EPZ A;  1HE8 A;  4U8H A;  1NFI E;  1S70 B;  1MX4 A;  2EIJ E;  2XZT G;  2ETC A;  2XGM A;  1INZ A;  2HO1 A;  4UI9 K;  3Q47 B;  1Y8M A;  5FZR A;  3QNK A;  3SNX A;  2GGF A;  3S7F A;  5D0O D;  3FH7 A;  2V5Q C;  2Y0B G;  4U7E B;  5ENR D;  4DUI A;  5JMN D;  3UTM A;  2V4L A;  4DK5 A;  2CHZ A;  2L0T B;  5G05 C;  3MKQ A;  1WY6 A;  3CVV A;  3CHO A;  3L54 A;  3Q7A A;  1N95 A;  4UWL A;  5D2M C;  5ENQ D;  3ENE A;  1EYH A;  4JXT A;  1QZ2 A;  3SQV A;  3TXN A;  4GPM A;  3KSL A;  2J8S D;  3EHR A;  4K0R A;  3VTX A;  2I9C A;  4WWO A;  3P2B A;  1HG2 A;  1HS6 A;  2KCK A;  3EHQ A;  1JPL A;  4HLL A;  1OWL A;  1HO8 A;  3APF A;  1FT2 A;  3I4G A;  3FUM A;  1LTX A;  3LYA A;  5H7P A;  2LUH A;  3G2V A;  4JEU A;  4N5C A;  2KZT B;  2WXO A;  2F8X K;  2J08 A;  3C3O A;  4J8E A;  1NZN A;  1IHG A;  3DPY A;  2VYI A;  4ILI A;  2VGX B;  3HXD A;  4XI0 A;  4P29 A;  2J07 A;  3LDZ A;  2L9B A;  1QQE A;  4I6J A;  5G2N A;  1N0Q A;  2XRY A;  3PZD A;  3RK6 A;  3T8M A;  5FQ8 A;  5CRV A;  3O48 A;  3QAQ A;  3MV2 B;  3PEU B;  1MJ0 A;  5CMY A;  5FIN A;  2XRZ A;  2LAH A;  4HB5 A;  3R7R A;  2KBX A;  3CHS A;  4EZJ A;  2OVF A;  4LNG A;  2ZIS A;  2UY1 A;  1OY3 D;  3I4R B;  3L22 A;  3AAA C;  5AJL A;  4J8S A;  3W9F A;  4WND A;  3Q15 A;  4B93 B;  4BSX A;  3NB2 A;  5ENT D;  2WM9 A;  4MS6 A;  3AG4 E;  4YVQ C;  3B7U X;  5AN8 A;  4GYY A;  3FTV A;  3IXE A;  2L6J A;  2ILR A;  1IXV A;  3L13 A;  3ML9 A;  1H6P A;  4WNG A;  3G2S A;  2WXG A;  3D9M A;  3FP3 A;  4GML A;  5FZQ A;  2OVB A;  3ABK E;  4WNF A;  3TGO A;  2VGE A;  2GRP B;  2P9P G;  4GA2 A;  2Y3A A;  5LCW C;  3LVQ E;  4G8L A;  2X3M A;  1U2V G;  3F6Q A;  2V4H C;  3S7B A;  2R05 A;  3NQP A;  4R7L A;  3V2O A;  1TN7 A;  1IHB A;  4EZL A;  2VSN A;  4TRQ A;  3SY2 A;  5CER B;  4FP7 A;  4UQY A;  3ZYL A;  1NA0 A;  3SFY A;  5KWD A;  4UUC A;  2ETA A;  4N3C A;  2PQN A;  3TWS A;  4AEZ C;  4AVX A;  1JWF A;  3ZEF A;  4BES A;  4CYM D;  2X6J A;  1KT0 A;  3J5P A;  2R17 C;  4GTP A;  4UQX A;  3VTY A;  5ENS D;  3FUN A;  5KCM A;  1IQR A;  1HXI A;  5JA4 D;  5EYL A;  3KAE A;  3CK7 A;  3NOG D;  4ABN A;  2AVP A;  3U9W A;  1TNY A;  3LPZ A;  3LCA A;  1AP7 A;  4JHJ A;  3TL5 A;  4U96 D;  5CEC B;  4HFG A;  2X38 A;  4UI9 C;  4WUY A;  4HLE A;  4BTA A;  4DLQ A;  4YVO A;  4I6G A;  2XEE A;  5BUZ A;  4G8K A;  4HI9 A;  4I1M A;  1E8W A;  4NAC A;  5EX0 A;  5EKQ D;  5KNG A;  1Y6I A;  3MYV A;  1K8K G;  4J7W A;  4CGV A;  2P9I G;  1Z5S C;  4UWH A;  1S0P A;  2IEJ A;  1SZ9 A;  5A23 A;  3TAX A;  3ASN E;  4ATG A;  3PH0 C;  2PM6 A;  3BQO A;  3HIZ A;  2VGX A;  4URK A;  3L08 A;  2AJA A;  3NF1 A;  5ENO D;  1U3D A;  3W9G A;  5CEA A;  3SHF A;  3QDN A;  1OUV A;  1V54 E;  5FZS A;  5HI7 A;  3SFZ A;  3RO2 A;  2P2C P;  1E8X A;  2C0L A;  4KYO B;  5EID A;  4RQI A;  5EIB E;  1TNB A;  4MBG A;  4EBA G;  4BWR A;  4RVB A;  3ZU7 B;  3U66 A;  1YA0 A;  5ENP D;  3RIB A;  1OWM A;  3FH8 A;  2E2E A;  5T8I A;  4G1T A;  4HOQ A;  4G23 A;  3JCK C;  4TXR A;  3EDT B;  2WQ6 A;  4B8A A;  1YYH A;  4APF A;  3UUX A;  2P58 C;  4LNB A;  3Q49 B;  3L16 A;  5HKP A;  1N11 A;  3MKQ B;  3UM2 A;  3ASH A;  1H2U A;  4TXQ A;  4G11 A;  2LO6 A;  1BU9 A;  3FU5 A;  3IEG A;  4H7X A;  4PS7 A;  4G2V A;  4DX7 D;  4L7T A;  3FEY A;  4ANU A;  4FJZ A;  2KCV A;  2JAB A;  2P9S G;  4GTR A;  1FPP A;  3APC A;  4L2Y A;  1HF8 A;  2LSU A;  3T5V A;  2HYZ A;  2RFA A;  2M63 A;  4YDE A;  5BXO A;  4KXK B;  3CVX A;  4EBA A;  1MYO A;  3VLF A;  4LG6 A;  1IYG A;  5EDS A;  4GZ6 A;  2FUL A;  5EYP F;  4CGW A;  1TNZ A;  3SBT B;  3Q78 A;  4OAV B;  2AXZ A;  3MZL B;  2GRR B;  3RAU A;  5AQB A;  1N52 A;  4QQI A;  4U0U A;  2WQ7 A;  3MEK A;  1NL4 A;  4O1P A;  1H0A A;  5IY5 E;  2VTB A;  2UY1 B;  5JJ6 A;  3CK9 A;  3CKC A;  4K03 A;  2KCL A;  4RSY A;  1YMP A;  4RG9 A;  2EIN E;  3OAW A;  3DRA A;  3ZIM A;  1JCQ A;  3HDX A;  4G25 A;  4GZD A;  5C1D A;  4BSZ B;  1KLX A;  4A1G A;  5CCL A;  3C3R A;  2BKG A;  4GZ3 A;  2VSO E;  2KAT A;  4XKB A;  3D9K A;  3HRA A;  3RO3 A;  1KZO A;  2WXM A;  5FJY A;  3E33 A;  2J49 A;  3CVP A;  3E32 A;  2A4Z A;  4IRU A;  4N3B A;  2WXP A;  5G55 A;  4HOU A;  4YDW A;  5CRU A;  4BFR A;  2WXF A;  1OT8 A;  1JCS A;  4A3V A;  4WWP A;  3FTY A;  5A7D B;  3LJ3 A;  3TWX A;  5J08 A;  4I9C A;  3K9I A;  3ASO E;  3Q9U C;  2KM4 A;  5AJD A;  2RKK A;  2X6I A;  4ZFH A;  4BT9 A;  3Q9N C;  3Q5M A;  3EIJ A; 
#chains in the Genus database with same CATH homology
 1TN6 A;  4GTM A;  2H6F A;  1NI1 A;  1TNU A;  3Q7A A;  1QBQ A;  1TNY A;  3E37 A;  1N95 A;  1NL4 A;  2H6I A;  2R2L A;  4GTQ A;  3PZ3 A;  1O1T A;  1N9A A;  1KZP A;  4LNB A;  3KSL A;  4GTS A;  1N4P A;  4EHM A;  3EUV A;  1SA5 A;  1D8D A;  3DRA A;  3DST A;  1JCQ A;  3KSQ A;  4GTT A;  2ZIR A;  3E30 A;  3DSU A;  1N4R A;  3DSS A;  3Q7F A;  1N4S A;  1DCE A;  1LD7 A;  1TNO A;  1O1S A;  1FT2 A;  1LTX A;  3EU5 A;  1TN7 A;  1N4Q A;  4GTV A;  4GTR A;  1FPP A;  1SA4 A;  1KZO A;  2F0Y A;  3E33 A;  2IEJ A;  2BED A;  3E32 A;  1TN8 A;  3HXF A;  3DSV A;  4YDO A;  1O1R A;  3HXB A;  1MZC A;  4YDE A;  1S63 A;  3SFY A;  3DPY A;  3DSW A;  3HXD A;  3E34 A;  3C72 A;  1FT1 A;  3Q73 A;  1JCS A;  1JCR A;  1LD8 A;  1N94 A;  4L9P A;  1D8E A;  2H6H A;  2H6G A;  3Q75 A;  3HXC A;  3HXE A;  3PZ4 A;  1S64 A;  4LNG A;  4GTP A;  1TNZ A;  2ZIS A;  1O5M A;  1X81 A;  4GTO A;  3Q78 A;  3SFX A;  3Q79 A;  3PZ1 A;  1TNB A;  4MBG A;  3PZ2 A;  3DSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...