4EPZA

Crystal structure of a transcription anti-terminator antagonist upxz (bacuni_04315) from bacteroides uniformis atcc 8492 at 1.68 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
160
structure length
154
Chain Sequence
NSLLSRALELQRMAHELMYLIYSDEFCRLNKEVLTRSDSLFSEQSSDIEEEGNLCLALLMGYNATIYDNGDKERKKQVILDRIYNIMSQLPASLLKMRLLTWGYSETYDEELAHEAHQLIETWNISDLTDEQKEIIEELRNFEENQYPWEEVQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a transcription anti-terminator antagonist UpxZ (BACUNI_04315) from Bacteroides uniformis ATCC 8492 at 1.68 A resolution
rcsb
source organism Bacteroides uniformis atcc 8492
molecule tags Transcription
molecule keywords transcription anti-terminator antagonist UpxZ
total genus 61
structure length 154
sequence length 160
ec nomenclature
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06603 UpxZ UpxZ family of transcription anti-terminator antagonists
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.810 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4epzA00
4EPZA
chains in the Genus database with same CATH superfamily
2FBNA 4U07A 1N0QA 2L6BA 2WXMA 3CKBA 3PVLA 3TG5A 3RRUA 2BEDA 1O1TA 3CEQA 5ENOD 4N5CA 5KNGA 3L9TA 3U64A 5AQBA 3UT7A 2H6FA 4FJYA 4ANWA 4GYWA 4DX6D 4N3CA 3Q5MA 5BXUA 3ISMC 3AU5A 4RSYA 2AXZA 5JMND 2X6HA 4J6IA 3AS5A 3ULQA 2RFMA 1TYQG 4NIKA 3NF1A 5KJLA 3WXXA 1TN7A 1TJFA 3ZIMA 2HE0A 3UINC 4ILIA 3ABKE 4BT9A 4BFRA 3FTVA 2I1KA 3Q7AA 4K5AB 4GU5A 4HS2A 1K3ZD 4GZ5A 5AYWD 5CEAA 1MX2A 4GTMA 1AP7A 2R03A 2X6IA 1UW4B 3G2WA 2IF4A 4I43A 3L16A 3JQ0A 3QWPA 2XQ0A 4JHKA 1O1RA 3R9AB 5KJMA 1WG0A 4OAUC 4GYYA 5BNWA 3FU6A 4HRLA 3FU0A 5KCMA 2V8SE 1DC2A 3FTXA 4ANXA 2IY0C 4I6GA 4CEMA 2MYOA 3DPDA 3D9HA 3TWXA 2YHCA 5ENQD 4FHJA 4EBAG 4K5BA 3Q7FA 2KATA 4UWHA 3LVQE 4I1OB 4HBDA 3OXGA 2L6JA 3OAWA 3IV0A 3PUJA 4B8AA 4N39A 1N11A 1N54A 2HR2A 2P9KG 3VLFA 5AIJA 4UI9K 3GW4A 2NXPA 2AW6A 3QJZA 5LOZA 2KM4A 4OVVA 3CIAA 4ACKA 3FTYA 3LCAA 4JHRA 4CT4A 4O60A 4XI0A 1OCCE 3KEAA 2YINA 3L08A 1U3DA 5CCLA 2QYJA 3JXIA 4I2ZA 4YDEA 3T8MA 2ILRA 5JHBA 3ABME 1E8WA 2PQNA 4J0UA 3FHEA 1MJ0A 3RK6A 3V79K 2DYSE 3AG1E 4UWKA 3ESKA 2WB2A 3JXJA 2EQXA 5AENA 4HRMB 4FHKA 2OOEA 1FCHA 1HG5A 5C1DA 3K9IA 3I5PA 3CVYA 5JJ6A 1TR4A 4C48B 1TNOA 3Q47B 3Q49B 4GTVA 3FWVA 5BT1A 2AVPA 1OY3D 4C0EA 3MJWA 2GW1A 2L9BA 4L2YA 2MRIA 2H6HA 2WVIA 1IKND 4O6FA 1D8DA 4U8YD 3BG1B 2KCVA 5DBKA 3ZGQA 1HO8A 2H6IA 2Y4TA 3JUEA 1NA0A 1H19A 3ZXSA 3ZYKA 5AQAA 3AAAC 4NACA 1INZA 1N95A 2V5FA 4JVSA 3UTMA 3FUEA 1TEZA 2AJAA 4D10C 1OWNA 2IFUA 3TWVA 1X81A 4LUNU 1WDYA 2MOWA 2Y0BG 3ML8A 5A7DB 4XKCA 4QQIA 1G3NB 2YQ8A 3L22A 3DWLG 4GZCA 2BKGA 1L5JA 3BU8A 3DEPA 3EIJA 1HS6A 4F7AA 1NFIE 4FP7A 3S7DA 3QK0A 2UY1B 3D9KA 1ELWA 2C0LA 1UJJA 3NZUA 1H0AA 1FPPA 3GZ2A 2R2LA 4WUYA 3ZHEA 3DBSA 4IN3B 2WMOA 3NOGD 1ZBPA 5BV0A 3V30A 4F3VA 2ZXWE 3SO8A 4B93B 4Q69A 3RJVA 2XGMA 2WQ6A 3PNTB 2IONA 4HOUA 2FULA 3X2QE 2DZOA 4XKBA 2OEWA 3APDA 4HOSA 3L54A 1D9SA 5T8IA 2XEVA 2WXPA 3G2VA 1E7VA 2Y3AA 2ZU6B 4GAAA 2LUHA 3AG4E 3WG7E 3CHSA 4J8EA 3OTNA 3SY2A 1IXVA 4Q94A 3SNXA 3JUIA 4J8DA 3I4GA 2VJ8A 3ZEFA 1HF8A 3DRAA 3PZ2A 4XE0A 4HI8A 1E8XA 1Y8MA 1KPSB 4ABNA 1KLXA 1Q2ZA 4OAVB 4GMRA 5AAOA 3Q15A 4HQDA 1Z3YA 2AXVA 1UG3A 3MV3B 3B7UX 1BI7B 4Z68A 2IOSA 4ACLA 1H6KA 3CHRA 4U63A 4R7LA 3GYZA 4EECA 3UT8A 2DWZA 1SA5A 4N3AA 4XIFA 3ZXPA 4FC8A 2XGSA 3C98A 5KJNA 5LFAA 3PZ4A 2WM9A 3CVVA 5ENTD 2CG2A 5FQ8A 3FDHA 4EBAA 4L23A 5G55A 2J9QA 2X6KA 4FLBA 4HXIA 2GRPB 5D2MC 4AOFA 4XX5A 3L17A 4TV3A 3UQ3A 2JLBA 4GTRA 3HVEA 3JQ1A 3EU9A 5JJ7A 3CHQA 3QOUA 3HRAA 4GTQA 4L9PA 3DPYA 5H7PA 2CHZA 2F0YA 1K8KG 3E32A 3QARA 2IEJA 2XRYA 4UI9C 3TL5A 4JL0A 5FQ7A 4PS8A 5CHEE 1K1AA 1N9AA 1YCSB 1YA0A 3T8KA 1NA3A 2R02A 3KEZA 4Q96A 5FIOA 3Q4AB 3DEOA 4DLQA 4ATGA 1WM5A 3TG4A 1A17A 2MHKA 4CGVA 1TNZA 2IO2C 1XNFA 3SFYA 5FTPA 3E30A 1E90A 2VGXA 5KWDA 3SFZA 2FF4A 1NI1A 4KT6B 3QAQA 2VTBA 4B89A 3SQVA 4BX9A 3GZSA 5D0OD 1TNYA 5EDSA 3EHRA 5BV1A 4YVOA 3DXKG 4H7XA 3EHMA 1OXJA 3E34A 3ZNGA 5KNHD 3TXMA 5CBNA 3FTWA 3HDXA 2ZGGA 2HO1A 5ENSD 3G2SA 3ZVVA 1U2VG 2DZNA 3HVEB 3APCA 3SGHA 5HQ8A 4DX5D 3VTXA 3PZ1A 4GTSA 1JPLA 3ASFA 3J5PA 4J8FA 2IU1A 3U4TA 5BUZA 2PNNA 2ETCA 4WNEA 1Z5SC 4A63B 1SA4A 1W3BA 2C2LA 3HXFA 1ZU2A 4XEIG 1WAO1 4KMOA 4FA6A 2WQ7A 5D66A 3QWVA 3UIOC 4I1AA 3FFLA 4XZ4A 3FUJA 4F6RD 3UM1A 3E4BA 3W9FA 2Y1LE 2LXLA 4APOA 2R5SA 3CK7A 4CCAA 1LD8A 3L13A 3ZW3A 5AARA 5EYPF 3ZPJA 3FUMA 1SZ9A 1OWOA 3ULYA 3NAWA 3CVUA 4B0ZA 4GTPA 4BEPA 4F1SA 3BUAA 2WXRA 1UOHA 3SF4A 3AG2E 1AWCB 3ENEA 2F37A 1JCRA 3EUVA 3MYVA 1RW2A 4FJZA 2P2CP 2GRLA 2FI7A 4EPZA 2J07A 4K0RA 2A4ZA 2CHXA 4YDWA 3B95A 4HLEA 2GRQB 2QY7A 4BTBA 3UUXA 5BXOA 5A23A 2P58C 1HG2A 2KBXA 4HORA 4G8LA 2Y69E 3O4ZA 3BEEA 4DLOA 4U8HA 4BERA 4GZ6A 3VLEA 3OXLA 1LF8A 2UY1A 3C5RA 3SI5A 4YNDA 3LDZA 5EX3A 4GCNA 3FTZA 3NOCD 2XZTG 4GYOA 1HFAA 4UUCA 2IOLA 2JABA 3HIZA 1D8EA 4EQFA 2VGYA 1OCOE 4K5CA 1JWGA 2JEKA 4GZ3A 4XI9A 3RU0A 2IO3C 3D9OA 4IULA 4CZ2D 3SBSA 5BW8C 4A1GA 2X6JA 3ASHA 3DSUA 5AQ9A 5AQ7A 5FZQA 4JPSA 5G05J 4NRHB 2AXUA 1Z6TA 5G04C 2FEZA 4GTTA 1Z3XA 2FO7A 4HI9A 1DNPA 1N4QA 2V4HC 3E37A 2RFAA 3U9WA 4CT0A 4DX7D 3UIPC 1A5EA 4PUCA 2GROB 3CVPA 3C3RA 5FT9A 3TWSA 5CCMA 2VSXE 3IHYA 3S7FA 4YVQC 3KSQA 3SD5A 5FZSA 1O1SA 3PE3A 3MA5A 3UM3A 3FUDA 1B89A 3JYSA 1XGWA 3CSTA 3N71A 4HOTA 1MX6A 4BT8A 4QFVA 2P9NG 3ASDA 4APFA 1SZAA 5CERB 2I2OA 3V2OA 2DYRE 3RO2A 1NL4A 4DRXE 4G24A 5FINA 2I6HA 2VTBB 4AM9A 1OWLA 1JUQA 3MKQB 3FEYA 3HXEA 2CFUA 4IRUA 3FH7A 2P9LG 4TXPA 4TXRA 1EPUA 2KCLA 1SVXA 3UX4A 4G26A 3T5VA 4BTAA 1IHBA 3D9JA 5CMYA 2WXLA 4A3VA 3J5QB 2NSZA 3VLDA 3QC1A 4J7WA 3DSXA 4JW1A 4F53A 5JA4D 3LY7A 1EYHA 3TAXA 4BWRA 3FULA 4AEZC 2XZDG 5EIDA 3QWWA 1BLXB 4RVBA 2VSYA 3CK9A 3CV0A 2PM6A 4N3BA 4OVUA 4IYPA 2VQ2A 3TGOA 3D3MA 4P29A 4FULA 5HKPA 3DSWA 1PAQA 4HB5A 2XRZA 4KXKB 1N4RA 1YMPA 4KZCA 2B0OE 1LTXA 1E96B 5LP0A 4A3TA 4GMLA 3LS8A 2KC7A 3B7TA 4DJAA 4GA0A 3Q75A 5EYLA 4JXTA 2OVFA 4UQXA 3RSEG 3GZ1A 4U04A 1HX8A 2BKKB 4DX1A 4WWNA 3EHNA 2AWIA 1GW6A 3CVWA 3D9MA 3R7RA 4URKA 2FO1E 4I6EA 1HE8A 5A6CA 3FY4A 4AIFA 4MS6A 4H7YA 3ML9A 4WNFA 4LERA 2RKKA 2OV8A 3AS8A 3MKRA 4YDOA 2P9UG 3B7SA 3P1UA 3IXEA 3UXGA 3CHPA 3ZKJA 1S63A 2B6CA 1HZ4A 3TWRA 3FUHA 2BUGA 1E8YA 1U3CA 1TNBA 3NQPA 2CFZA 4U0UA 4DI3A 2XPZA 4EZLA 4A55A 2Y4UA 3LEWA 3CVQA 1TN6A 4BX8A 1N4PA 4LEUA 3R9MA 1MX4A 3D9PA 4PDXA 2H6GA 4CGWA 3RRMB 3EDTB 1DCQA 2OVBA 4CRWA 4ZFHA 2L0TB 4WWPA 1OCZE 5M72A 5HS0A 5CBOA 4KZ0A 2R05A 3U66A 4ANUA 4ME2A 1IYGA 3EIQC 3UI2A 2P9SG 1QNFA 3UPVA 4DI4A 2WPVA 3Q73A 3FTUA 3UKRG 5B1AE 2L0IA 4M7CA 1MYOA 5T4YA 5ENRD 5ENNA 1OWPA 4L1BA 3S7BA 1IHGA 3RIBA 4U7EB 4GMJA 4J8YA 2VSOE 1HXIA 3LYAA 3PH0C 4CDNA 3PZ3A 4O1OA 3LPZA 4B8CB 2ETAA 3NBNB 4GPKA 2WXOA 4GA2A 3Q9UC 2OEVA 2LAIA 2HM8A 2LNIA 3BG0B 2I9CA 4F1PA 3PRZA 3ONKA 3ASNE 5E75A 3ABLE 3B13A 5FWQA 4TRQA 1V55E 4AVXA 5EKQD 4W9RA 2PL2A 3IBEA 4UWFA 3SZ7A 3RKVA 4JA9A 2XPYA 3IEGA 2XGOA 4TXQA 4AY5A 2V4LA 5CECB 2NYJA 2QYUA 5HRYA 1S70B 5J08A 2C0MA 1V54E 2KZTA 2XCBA 3TXNA 3FP3A 1JCSA 3RO3A 4A1SA 3PUKA 2DIWA 2YNQA 3JCKC 1IQRA 3O48A 3CQGB 3VTYA 4WAFA 3L6AA 4DK5A 3ASGA 1FT2A 5AJDA 1K1BA 4JA7A 5JJTA 5BPPA 3V31A 3LY8A 3B7BA 5HI7A 4U8VD 5D0QD 2KCKA 4UQZA 3CK8A 4U96D 2DCPA 4CDRA 3ZYLA 3RAUA 3TWTA 1OT8A 4EHMA 1H2VC 3W9GA 3LKUA 4FU3A 2QC9A 3ASOE 3AU4A 3FH8A 3CGHA 3L82A 4JD2G 3PREA 3DSVA 3G2UA 4RLYA 1BPOA 4KYOB 1JWFA 4PS3A 2ONDA 4G25A 4OYSA 4RG6A 2M63A 3T5XA 2F8XK 3RRNB 2J4BA 4JEHA 3MEKA 5LX8A 1N4SA 3C72A 4G8KA 4BY6A 4L7TA 5ANRA 1HU3A 3CLJA 4ANVA 3FU5A 4MLPA 2J08A 3DSSA 3LXUX 3ZYQA 3HYMB 2EIKE 3AG3E 3MGBA 3CSFA 2LO6A 4NURA 5ITZF 4HOQA 2LXMA 2YHEA 2PQRA 3Q9NC 2WMNA 3APFA 1BI8B 1OCRE 5G05C 4X8QA 3AS4A 2V0PA 3U3WA 3V2XA 3F6QA 2ZIRA 2WXQA 3OXFA 1YYHA 3BQOA 5ENPD 2GGFA 2UWJG 1EF1C 3C3QA 3TWUA 1JCQA 2A5EA 4GZDA 5G04J 4HVBA 2WXGA 4C0MA 4MRUA 4BETA 3MV2B 4HFGA 3S2AA 1S64A 4Y6CA 2XS8A 5ANLA 2WXKA 3MZLB 3PEUB 4DX2A 3FH5A 5ARGA 3HXDA 5E76A 3IKOB 2QZAA 5EX0A 4HNAD 3LY9A 3SBTB 4E85A 1RZ4A 5IY5E 2J8SD 4G11A 2KXPC 2R59A 3FU3A 3NB2A 3DXMG 1IQUA 4JHJA 5DIZA 1N0RA 1NP7A 3ZYMA 1QBQA 2A5UA 3KD7A 2F8YA 2RG8A 4AV7A 4JZYA 1SQMA 5LCWJ 1MQSA 1E7UA 5FJYA 3ZU7B 2J09A 3URZA 4CDMA 4AY6A 1HH8A 4I17A 4ILHB 3TWQA 4I1MA 4UQYA 3ONLA 1OUVA 2WXFA 2ETBA 2X6FA 1H6OA 4PH4B 3TWWA 1FVHA 5FQ4A 2EILE 2HYZA 4M3OA 4GTOA 1S0PA 2OCCE 3C3OA 3UKUG 2ZISA 1KZOA 2LSVA 1QZ2A 2X38A 2XS1A 2IQCA 2LAHA 2WXJA 2P9IG 4G1TA 3CHMA 4FLHA 3CR3A 3EU5A 5JHAA 3B7RL 4B94A 2PZIA 5EILA 1H2TC 3PNLB 2XEEA 4J8SA 2GRNB 3KS2A 4LNUD 2J4DA 3ZFWA 5FQ6A 4AP2A 3IHVA 3CQCB 1EDUA 4YDYA 4MBGA 3FUFA 3I3NA 4LSZE 1H6PA 2ZGDA 5ARFA 3HXCA 4MKTA 1OWMA 5CRUA 4UI9J 3P2BA 3T9KA 5B1BE 4GA1A 1O5MA 1QYMA 4WWOA 4ILGA 1WY6A 3QNKA 2BF0X 2EIME 4G23A 4N2SA 3KAEA 4ZHBA 2WXIA 4JB8P 4BSZB 5KBAA 3LVRE 1QQEA 1KT1A 1TNUA 4AXHA 1PC2A 4HRNA 4O1PA 3EJNA 2XEHA 4GCOA 3ZN3A 4TUUA 4E6HA 3Q79A 4C9BB 5LCWC 2IJGX 2I1JA 4LG6A 1PY1A 3CHOA 5KJKA 2PM7A 5FZRA 5J90A 2WXNA 3PE4A 2QFCA 3CVLA 2CG3A 1UN8A 4LRZA 1MHQA 4EZJA 3DSTA 3FUNA 4WNGA 1MZCA 2WXHA 3UM0A 2DVWA 3ULEG 3FTSA 3UT4A 3FEXA 4LNGA 3HG0D 4GB9A 3SFXA 4RQIA 3TJPA 1ZB1A 1X5BA 3LJ3A 3KSLA 1SW6A 3MX3A 2KZTB 2WQHA 5G2NA 4CYMD 3Q78A 2XPIA 3CVXA 1DVPA 3QKYA 1NZNA 4TUMA 1BU9A 3HXBA 3PEVB 3EHQA 4PS7A 4N5QA 4V3IA 2CHWA 3E33A 1LD7A 5C2YA 4KVOA 4ATZD 3D9LA 3MCXA 1N52A 2DBAA 3ESLA 4U0SA 4DPRA 1DCEA 4KBQA 1KT0A 1BD8A 2GRMA 1FVFA 2V5QC 3HHMA 4Y6WA 3G2TA 2X3MA 2VYIA 2E0IA 5B3SE 3SHFA 3FUKA 1UN9A 4RG9A 4I6JA 5CMWA 3FUIA 2VGEA 2XENA 1VDYA 4U95D 2R17C 4LCTA 3UM2A 1P5QA 4K03A 4DUIA 2GRRB 1ELKA 3D9NA 1N94A 3QB2A 3ZHEB 3UMVA 4AJWA 4NQ0A 4LNBA 4FADA 1Y6IA 4JC8A 2BTDA 4WNDA 5EIBE 4GPMA 3PDNA 3MKQA 2Q7FA 2EINE 4I2WA 3ZRHA 1ELRA 2XHEA 4G2VA 4UWGA 3R7QA 3QDNA 1H2UA 3ZUVB 2LSUA 5CRVA 2EIJE 5EN5D 3LJNA 2VSNA 2P9PG 4BESA 4EZKA 4I9CA 2NC9A 1UJKA 2E2EA 4JEUA 4U0ZA 4L2LA 2VGXB 3D9IA 2RD0A 3I4RB 3AJIA 4KVMA 4N2QA 4BSXA 1FT1A 3CKCA 3NZSA 1KZPA 5CEDB 5AN8A 1E8ZA 4HLLA 4UWLA 5T3RA 1TN8A 3PS6A 5AJLA 3PZDA 1TJCA 4I9EA 3S7JA 2J49A 3CVNA 2XCCA
chains in the Genus database with same CATH topology
2WXKA 4F53A 2IOSA 2FBNA 4ACLA 3LY7A 3MZLB 1EYHA 4U07A 1H6KA 3TAXA 3PEUB 3CHRA 3FH5A 5ARGA 2WXMA 3CKBA 5E76A 3PVLA 4U63A 4BWRA 3IKOB 4R7LA 3GYZA 4EECA 3FULA 3UT8A 4AEZC 5EX0A 3TG5A 3QWWA 3RRUA 3LY9A 3SBTB 4RVBA 4E85A 4N3AA 2VSYA 3CK9A 3CV0A 2PM6A 4N3BA 4OVUA 4IYPA 4XIFA 2VQ2A 3CEQA 3TGOA 4N5CA 3D3MA 4G11A 4P29A 4FC8A 2R59A 3FU3A 4FULA 2XGSA 3U64A 3C98A 1IQUA 4JHJA 5DIZA 4FJYA 2WM9A 3UT7A 4ANWA 5KJNA 1PAQA 5LFAA 2CG2A 3CVVA 5FQ8A 4GYWA 3FDHA 4N3CA 4EBAA 3Q5MA 2XRZA 1NP7A 4KXKB 4L23A 3ZYMA 4KZCA 3AU5A 4RSYA 2AXZA 5G55A 2X6HA 1E96B 2J9QA 2X6KA 4FLBA 4J6IA 4HXIA 3AS5A 5LP0A 3ULQA 2A5UA 4A3TA 4GMLA 3KD7A 3LS8A 2KC7A 3NF1A 3B7TA 2RG8A 5KJLA 4AOFA 4AV7A 4JZYA 4DJAA 1SQMA 4XX5A 3L17A 4TV3A 4GA0A 3WXXA 5LCWJ 3UQ3A 1MQSA 1E7UA 2JLBA 5FJYA 1TJFA 4JXTA 3ZIMA 3HVEA 3JQ1A 2J09A 5JJ7A 2OVFA 3CHQA 4UQXA 3GZ1A 4ILIA 4U04A 3QOUA 1HX8A 4BT9A 4WWNA 3EHNA 3URZA 2AWIA 4BFRA 4CDMA 1GW6A 4AY6A 3CVWA 2CHZA 3D9MA 3R7RA 4URKA 3FTVA 2I1KA 1HH8A 4I6EA 1HE8A 5A6CA 4I17A 4ILHB 3FY4A 4GU5A 4HS2A 4GZ5A 5AYWD 4I1MA 4UQYA 3ONLA 1OUVA 3QARA 2WXFA 2XRYA 2X6FA 2X6IA 4AIFA 4UI9C 1UW4B 4MS6A 3TL5A 4PH4B 3G2WA 4H7YA 2IF4A 4JL0A 3ML9A 4I43A 4LERA 4WNFA 3L16A 5FQ7A 2OV8A 3AS8A 4PS8A 3JQ0A 5CHEE 1FVHA 3QWPA 2XQ0A 1YA0A 4JHKA 5FQ4A 1NA3A 2HYZA 4M3OA 3KEZA 3MKRA 4Q96A 3R9AB 5KJMA 3B7SA 4GYYA 3P1UA 3Q4AB 5BNWA 3FU6A 4DLQA 3FU0A 1S0PA 5KCMA 4ATGA 3CHPA 2V8SE 3FTXA 1HZ4A 4ANXA 1WM5A 2LSVA 3TG4A 1A17A 2MHKA 4I6GA 4CGVA 1QZ2A 3FUHA 4CEMA 2BUGA 2X38A 2IQCA 1E8YA 1U3CA 2LAHA 3NQPA 1XNFA 2WXJA 4G1TA 5FTPA 1E90A 2VGXA 3SFZA 3CHMA 2FF4A 3DPDA 2CFZA 4U0UA 4FLHA 3CR3A 4DI3A 2XPZA 4EZLA 4A55A 4KT6B 2Y4UA 2YHCA 3LEWA 3B7RL 5JHAA 3QAQA 2VTBA 3CVQA 4FHJA 4B89A 4B94A 2PZIA 1H2TC 3PNLB 4EBAG 4J8SA 3KS2A 4BX9A 2KATA 3GZSA 5D0OD 4BX8A 2J4DA 5EDSA 3ZFWA 4LEUA 4YVOA 5BV1A 4H7XA 5FQ6A 3EHMA 4UWHA 4AP2A 3D9PA 4PDXA 3LVQE 3IHVA 4I1OB 4CGWA 3TXMA 3CQCB 1EDUA 3RRMB 3OXGA 3EDTB 2L6JA 3FTWA 3OAWA 3HDXA 3IV0A 2OVBA 3PUJA 4B8AA 4CRWA 2HO1A 2L0TB 4WWPA 3FUFA 3I3NA 4N39A 5ARFA 1N54A 5M72A 3G2SA 4KZ0A 3ZVVA 2HR2A 4MKTA 3HVEB 3APCA 1OWMA 3SGHA 5HQ8A 3U66A 4UI9J 3P2BA 3VTXA 3VLFA 4GA1A 4ANUA 1JPLA 4WWOA 3ASFA 4ME2A 5AIJA 4ILGA 4UI9K 1IYGA 1WY6A 3EIQC 3QNKA 1QNFA 2BF0X 3GW4A 3UPVA 4G23A 2NXPA 2AW6A 4J8FA 4DI4A 4N2SA 3KAEA 2WPVA 3QJZA 2WXIA 2IU1A 5LOZA 3U4TA 3FTUA 2KM4A 5BUZA 4OVVA 4WNEA 2L0IA 3CIAA 3LVRE 5T4YA 1QQEA 1KT1A 4ACKA 1W3BA 2C2LA 3FTYA 4AXHA 1PC2A 1ZU2A 1WAO1 3LCAA 4JHRA 4KMOA 4CT4A 4FA6A 2WQ7A 5ENNA 1OWPA 4L1BA 4XI0A 2YINA 3EJNA 3L08A 1U3DA 4GCOA 3S7BA 5CCLA 3ZN3A 3QWVA 1IHGA 4I1AA 3FFLA 3RIBA 4TUUA 4GMJA 4I2ZA 4E6HA 3T8MA 2ILRA 5JHBA 4C9BB 2VSOE 1HXIA 2IJGX 3LYAA 5LCWC 4XZ4A 3PH0C 1E8WA 2I1JA 3FUJA 4CDNA 2PQNA 4J0UA 3FHEA 3LPZA 1PY1A 3E4BA 3RK6A 4B8CB 3CHOA 4APOA 5KJKA 2PM7A 2R5SA 5FZRA 5J90A 4GPKA 2WXOA 3CK7A 2WXNA 4CCAA 4UWKA 3PE4A 2QFCA 3CVLA 3ESKA 2CG3A 4GA2A 1UN8A 4LRZA 1MHQA 4EZJA 2LAIA 2HM8A 3FUNA 3L13A 3ZW3A 2WB2A 4WNGA 2EQXA 2LNIA 5AENA 4FHKA 3BG0B 2I9CA 2OOEA 3ZPJA 3PRZA 2WXHA 1FCHA 3FUMA 1HG5A 1SZ9A 5C1DA 3ONKA 1OWOA 5E75A 3CVUA 3FTSA 3UT4A 3FEXA 3K9IA 4B0ZA 4F1SA 4GB9A 3I5PA 3CVYA 3TJPA 5JJ6A 3B13A 2WXRA 3SF4A 5FWQA 4TRQA 3Q47B 4AVXA 3ENEA 3MYVA 1X5BA 5EKQD 3LJ3A 4W9RA 3Q49B 4FJZA 2PL2A 3IBEA 2GRLA 4UWFA 3SZ7A 3RKVA 4JA9A 3FWVA 2FI7A 4EPZA 2XPYA 2J07A 3IEGA 5BT1A 2XGOA 5ANLA 4K0RA 2AVPA 4AY5A 2A4ZA 2CHXA 4C0EA 2V4LA 4HLEA 3MX3A 2KZTB 2WQHA 3MJWA 2GW1A 2L9BA 5G2NA 2QY7A 4L2YA 4BTBA 2XPIA 3CVXA 5J08A 2C0MA 3UUXA 2MRIA 1DVPA 3QKYA 1NZNA 2WVIA 5A23A 2P58C 4O6FA 2KZTA 1HG2A 2XCBA 3TXNA 3PEVB 4HORA 3FP3A 3RO3A 4PS7A 4A1SA 3O4ZA 3PUKA 3BG1B 3BEEA 2CHWA 4V3IA 4U8HA 4DLOA 4GZ6A 2KCVA 5DBKA 3VLEA 3ZGQA 1HO8A 2DIWA 2YNQA 3OXLA 5C2YA 1LF8A 3JCKC 2Y4TA 4KVOA 2UY1A 3D9LA 3MCXA 3SI5A 1IQRA 1N52A 1NA0A 1H19A 2DBAA 3ESLA 3O48A 3CQGB 4U0SA 4YNDA 3LDZA 4DPRA 5EX3A 4KBQA 3ZXSA 4GCNA 1KT0A 3ZYKA 3VTYA 4WAFA 3FTZA 4NACA 1INZA 3L6AA 2GRMA 3ASGA 1FVFA 2V5FA 4JVSA 4DK5A 3HHMA 3FUEA 3G2TA 4GYOA 1HFAA 4JA7A 4Y6WA 5AJDA 2IOLA 2X3MA 1TEZA 4D10C 1OWNA 3HIZA 2VYIA 2IFUA 5JJTA 5BPPA 2E0IA 5A7DB 4LUNU 4EQFA 2MOWA 3ML8A 3LY8A 4XKCA 2VGYA 5HI7A 3SHFA 1JWGA 2YQ8A 5D0QD 2JEKA 2KCKA 1UN9A 3FUKA 3L22A 4GZ3A 4I6JA 4RG9A 4XI9A 3RU0A 4UQZA 3CK8A 3D9OA 4IULA 2DCPA 4GZCA 3ZYLA 4CDRA 3SBSA 5CMWA 1L5JA 3FUIA 1H2VC 5BW8C 3LKUA 4FU3A 3EIJA 1HS6A 4A1GA 1VDYA 2X6JA 4F7AA 3ASHA 4FP7A 3S7DA 3AU4A 2R17C 3QK0A 2UY1B 3CGHA 3FH8A 4LCTA 3D9KA 1P5QA 1ELWA 4K03A 5FZQA 2C0LA 4JPSA 5G05J 3PREA 4NRHB 1UJJA 1ELKA 2AXUA 3D9NA 3NZUA 1Z6TA 1H0AA 3G2UA 5G04C 2FEZA 3GZ2A 3QB2A 1BPOA 4KYOB 3ZHEB 1Z3XA 3UMVA 4WUYA 3ZHEA 2FO7A 3DBSA 1DNPA 1JWFA 4IN3B 4PS3A 2ONDA 4G25A 2WMOA 4OYSA 4AJWA 1ZBPA 4NQ0A 2M63A 4RG6A 4F3VA 5BV0A 4FADA 3T5XA 3U9WA 4CT0A 1Y6IA 4PUCA 4JC8A 2BTDA 2J4BA 3CVPA 3RRNB 4JEHA 5FT9A 3MEKA 4WNDA 3PDNA 3MKQA 2Q7FA 5CCMA 5LX8A 2VSXE 3RJVA 4Q69A 3IHYA 4L7TA 4BY6A 3S7FA 4YVQC 3SD5A 2XGMA 5ANRA 3PNTB 2WQ6A 5FZSA 1HU3A 3CLJA 2IONA 3PE3A 3MA5A 4I2WA 3ZRHA 4HOUA 2FULA 3FUDA 4ANVA 3FU5A 1ELRA 2XHEA 4MLPA 1B89A 4G2VA 4XKBA 2J08A 4UWGA 3R7QA 3APDA 4HOSA 3QDNA 3LXUX 3L54A 3JYSA 5T8IA 1XGWA 2XEVA 3CSTA 1H2UA 3ZYQA 3N71A 2LSUA 4HOTA 4BT8A 4QFVA 2WXPA 3G2VA 3HYMB 3MGBA 3ASDA 3CSFA 1E7VA 2Y3AA 4APFA 1SZAA 2LO6A 2I2OA 2VSNA 2ZU6B 4NURA 4GAAA 4EZKA 4HOQA 4I9CA 3RO2A 3CHSA 4J8EA 2YHEA 3OTNA 2PQRA 2NC9A 1UJKA 4G24A 2WMNA 2E2EA 4JEUA 2I6HA 4U0ZA 3APFA 4L2LA 2VGXB 2VTBB 3D9IA 2RD0A 3I4RB 4Q94A 5G05C 4AM9A 3SNXA 1OWLA 1JUQA 3MKQB 4KVMA 4N2QA 4BSXA 3JUIA 3AS4A 3FEYA 4J8DA 2CFUA 4IRUA 2V0PA 3CKCA 3I4GA 2VJ8A 3ZEFA 1HF8A 3U3WA 3NZSA 3FH7A 4XE0A 1E8ZA 2WXQA 3OXFA 4UWLA 5T3RA 1EPUA 2KCLA 1E8XA 1Y8MA 2GGFA 3UX4A 2UWJG 4G26A 3T5VA 4BTAA 1EF1C 4ABNA 3PS6A 1KLXA 5AJLA 3D9JA 3PZDA 4GZDA 5CMYA 5G04J 2WXGA 4HVBA 2WXLA 4C0MA 4A3VA 4MRUA 3Q15A 1TJCA 2NSZA 3MV2B 4HFGA 4I9EA 1Z3YA 3VLDA 2AXVA 1UG3A 2J49A 3MV3B 3QC1A 3S2AA 4Y6CA 4JW1A 3S7JA 3B7UX 3CVNA 2XCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EPZ A; 
#chains in the Genus database with same CATH topology
 2FBN A;  4U07 A;  1N0Q A;  2L6B A;  2WXM A;  3CKB A;  3PVL A;  3TG5 A;  3RRU A;  2BED A;  1O1T A;  3CEQ A;  5ENO D;  4N5C A;  5KNG A;  3L9T A;  3U64 A;  5AQB A;  3UT7 A;  2H6F A;  4FJY A;  4ANW A;  4GYW A;  4DX6 D;  4N3C A;  3Q5M A;  5BXU A;  3ISM C;  3AU5 A;  4RSY A;  2AXZ A;  5JMN D;  2X6H A;  4J6I A;  3AS5 A;  3ULQ A;  2RFM A;  1TYQ G;  4NIK A;  3NF1 A;  5KJL A;  3WXX A;  1TN7 A;  1TJF A;  3ZIM A;  2HE0 A;  3UIN C;  4ILI A;  3ABK E;  4BT9 A;  4BFR A;  3FTV A;  2I1K A;  3Q7A A;  4K5A B;  4GU5 A;  4HS2 A;  1K3Z D;  4GZ5 A;  5AYW D;  5CEA A;  1MX2 A;  4GTM A;  1AP7 A;  2R03 A;  2X6I A;  1UW4 B;  3G2W A;  2IF4 A;  4I43 A;  3L16 A;  3JQ0 A;  3QWP A;  2XQ0 A;  4JHK A;  1O1R A;  3R9A B;  5KJM A;  1WG0 A;  4OAU C;  4GYY A;  5BNW A;  3FU6 A;  4HRL A;  3FU0 A;  5KCM A;  2V8S E;  1DC2 A;  3FTX A;  4ANX A;  2IY0 C;  4I6G A;  4CEM A;  2MYO A;  3DPD A;  3D9H A;  3TWX A;  2YHC A;  5ENQ D;  4FHJ A;  4EBA G;  4K5B A;  3Q7F A;  2KAT A;  4UWH A;  3LVQ E;  4I1O B;  4HBD A;  3OXG A;  2L6J A;  3OAW A;  3IV0 A;  3PUJ A;  4B8A A;  4N39 A;  1N11 A;  1N54 A;  2HR2 A;  2P9K G;  3VLF A;  5AIJ A;  4UI9 K;  3GW4 A;  2NXP A;  2AW6 A;  3QJZ A;  5LOZ A;  2KM4 A;  4OVV A;  3CIA A;  4ACK A;  3FTY A;  3LCA A;  4JHR A;  4CT4 A;  4O60 A;  4XI0 A;  1OCC E;  3KEA A;  2YIN A;  3L08 A;  1U3D A;  5CCL A;  2QYJ A;  3JXI A;  4I2Z A;  4YDE A;  3T8M A;  2ILR A;  5JHB A;  3ABM E;  1E8W A;  2PQN A;  4J0U A;  3FHE A;  1MJ0 A;  3RK6 A;  3V79 K;  2DYS E;  3AG1 E;  4UWK A;  3ESK A;  2WB2 A;  3JXJ A;  2EQX A;  5AEN A;  4HRM B;  4FHK A;  2OOE A;  1FCH A;  1HG5 A;  5C1D A;  3K9I A;  3I5P A;  3CVY A;  5JJ6 A;  1TR4 A;  4C48 B;  1TNO A;  3Q47 B;  3Q49 B;  4GTV A;  3FWV A;  5BT1 A;  2AVP A;  1OY3 D;  4C0E A;  3MJW A;  2GW1 A;  2L9B A;  4L2Y A;  2MRI A;  2H6H A;  2WVI A;  1IKN D;  4O6F A;  1D8D A;  4U8Y D;  3BG1 B;  2KCV A;  5DBK A;  3ZGQ A;  1HO8 A;  2H6I A;  2Y4T A;  3JUE A;  1NA0 A;  1H19 A;  3ZXS A;  3ZYK A;  5AQA A;  3AAA C;  4NAC A;  1INZ A;  1N95 A;  2V5F A;  4JVS A;  3UTM A;  3FUE A;  1TEZ A;  2AJA A;  4D10 C;  1OWN A;  2IFU A;  3TWV A;  1X81 A;  4LUN U;  1WDY A;  2MOW A;  2Y0B G;  3ML8 A;  5A7D B;  4XKC A;  4QQI A;  1G3N B;  2YQ8 A;  3L22 A;  3DWL G;  4GZC A;  2BKG A;  1L5J A;  3BU8 A;  3DEP A;  3EIJ A;  1HS6 A;  4F7A A;  1NFI E;  4FP7 A;  3S7D A;  3QK0 A;  2UY1 B;  3D9K A;  1ELW A;  2C0L A;  1UJJ A;  3NZU A;  1H0A A;  1FPP A;  3GZ2 A;  2R2L A;  4WUY A;  3ZHE A;  3DBS A;  4IN3 B;  2WMO A;  3NOG D;  1ZBP A;  5BV0 A;  3V30 A;  4F3V A;  2ZXW E;  3SO8 A;  4B93 B;  4Q69 A;  3RJV A;  2XGM A;  2WQ6 A;  3PNT B;  2ION A;  4HOU A;  2FUL A;  3X2Q E;  2DZO A;  4XKB A;  2OEW A;  3APD A;  4HOS A;  3L54 A;  1D9S A;  5T8I A;  2XEV A;  2WXP A;  3G2V A;  1E7V A;  2Y3A A;  2ZU6 B;  4GAA A;  2LUH A;  3AG4 E;  3WG7 E;  3CHS A;  4J8E A;  3OTN A;  3SY2 A;  1IXV A;  4Q94 A;  3SNX A;  3JUI A;  4J8D A;  3I4G A;  2VJ8 A;  3ZEF A;  1HF8 A;  3DRA A;  3PZ2 A;  4XE0 A;  4HI8 A;  1E8X A;  1Y8M A;  1KPS B;  4ABN A;  1KLX A;  1Q2Z A;  4OAV B;  4GMR A;  5AAO A;  3Q15 A;  4HQD A;  1Z3Y A;  2AXV A;  1UG3 A;  3MV3 B;  3B7U X;  1BI7 B;  4Z68 A;  2IOS A;  4ACL A;  1H6K A;  3CHR A;  4U63 A;  4R7L A;  3GYZ A;  4EEC A;  3UT8 A;  2DWZ A;  1SA5 A;  4N3A A;  4XIF A;  3ZXP A;  4FC8 A;  2XGS A;  3C98 A;  5KJN A;  5LFA A;  3PZ4 A;  2WM9 A;  3CVV A;  5ENT D;  2CG2 A;  5FQ8 A;  3FDH A;  4EBA A;  4L23 A;  5G55 A;  2J9Q A;  2X6K A;  4FLB A;  4HXI A;  2GRP B;  5D2M C;  4AOF A;  4XX5 A;  3L17 A;  4TV3 A;  3UQ3 A;  2JLB A;  4GTR A;  3HVE A;  3JQ1 A;  3EU9 A;  5JJ7 A;  3CHQ A;  3QOU A;  3HRA A;  4GTQ A;  4L9P A;  3DPY A;  5H7P A;  2CHZ A;  2F0Y A;  1K8K G;  3E32 A;  3QAR A;  2IEJ A;  2XRY A;  4UI9 C;  3TL5 A;  4JL0 A;  5FQ7 A;  4PS8 A;  5CHE E;  1K1A A;  1N9A A;  1YCS B;  1YA0 A;  3T8K A;  1NA3 A;  2R02 A;  3KEZ A;  4Q96 A;  5FIO A;  3Q4A B;  3DEO A;  4DLQ A;  4ATG A;  1WM5 A;  3TG4 A;  1A17 A;  2MHK A;  4CGV A;  1TNZ A;  2IO2 C;  1XNF A;  3SFY A;  5FTP A;  3E30 A;  1E90 A;  2VGX A;  5KWD A;  3SFZ A;  2FF4 A;  1NI1 A;  4KT6 B;  3QAQ A;  2VTB A;  4B89 A;  3SQV A;  4BX9 A;  3GZS A;  5D0O D;  1TNY A;  5EDS A;  3EHR A;  5BV1 A;  4YVO A;  3DXK G;  4H7X A;  3EHM A;  1OXJ A;  3E34 A;  3ZNG A;  5KNH D;  3TXM A;  5CBN A;  3FTW A;  3HDX A;  2ZGG A;  2HO1 A;  5ENS D;  3G2S A;  3ZVV A;  1U2V G;  2DZN A;  3HVE B;  3APC A;  3SGH A;  5HQ8 A;  4DX5 D;  3VTX A;  3PZ1 A;  4GTS A;  1JPL A;  3ASF A;  3J5P A;  4J8F A;  2IU1 A;  3U4T A;  5BUZ A;  2PNN A;  2ETC A;  4WNE A;  1Z5S C;  4A63 B;  1SA4 A;  1W3B A;  2C2L A;  3HXF A;  1ZU2 A;  4XEI G;  1WAO 1;  4KMO A;  4FA6 A;  2WQ7 A;  5D66 A;  3QWV A;  3UIO C;  4I1A A;  3FFL A;  4XZ4 A;  3FUJ A;  4F6R D;  3UM1 A;  3E4B A;  3W9F A;  2Y1L E;  2LXL A;  4APO A;  2R5S A;  3CK7 A;  4CCA A;  1LD8 A;  3L13 A;  3ZW3 A;  5AAR A;  5EYP F;  3ZPJ A;  3FUM A;  1SZ9 A;  1OWO A;  3ULY A;  3NAW A;  3CVU A;  4B0Z A;  4GTP A;  4BEP A;  4F1S A;  3BUA A;  2WXR A;  1UOH A;  3SF4 A;  3AG2 E;  1AWC B;  3ENE A;  2F37 A;  1JCR A;  3EUV A;  3MYV A;  1RW2 A;  4FJZ A;  2P2C P;  2GRL A;  2FI7 A;  4EPZ A;  2J07 A;  4K0R A;  2A4Z A;  2CHX A;  4YDW A;  3B95 A;  4HLE A;  2GRQ B;  2QY7 A;  4BTB A;  3UUX A;  5BXO A;  5A23 A;  2P58 C;  1HG2 A;  2KBX A;  4HOR A;  4G8L A;  2Y69 E;  3O4Z A;  3BEE A;  4DLO A;  4U8H A;  4BER A;  4GZ6 A;  3VLE A;  3OXL A;  1LF8 A;  2UY1 A;  3C5R A;  3SI5 A;  4YND A;  3LDZ A;  5EX3 A;  4GCN A;  3FTZ A;  3NOC D;  2XZT G;  4GYO A;  1HFA A;  4UUC A;  2IOL A;  2JAB A;  3HIZ A;  1D8E A;  4EQF A;  2VGY A;  1OCO E;  4K5C A;  1JWG A;  2JEK A;  4GZ3 A;  4XI9 A;  3RU0 A;  2IO3 C;  3D9O A;  4IUL A;  4CZ2 D;  3SBS A;  5BW8 C;  4A1G A;  2X6J A;  3ASH A;  3DSU A;  5AQ9 A;  5AQ7 A;  5FZQ A;  4JPS A;  5G05 J;  4NRH B;  2AXU A;  1Z6T A;  5G04 C;  2FEZ A;  4GTT A;  1Z3X A;  2FO7 A;  4HI9 A;  1DNP A;  1N4Q A;  2V4H C;  3E37 A;  2RFA A;  3U9W A;  4CT0 A;  4DX7 D;  3UIP C;  1A5E A;  4PUC A;  2GRO B;  3CVP A;  3C3R A;  5FT9 A;  3TWS A;  5CCM A;  2VSX E;  3IHY A;  3S7F A;  4YVQ C;  3KSQ A;  3SD5 A;  5FZS A;  1O1S A;  3PE3 A;  3MA5 A;  3UM3 A;  3FUD A;  1B89 A;  3JYS A;  1XGW A;  3CST A;  3N71 A;  4HOT A;  1MX6 A;  4BT8 A;  4QFV A;  2P9N G;  3ASD A;  4APF A;  1SZA A;  5CER B;  2I2O A;  3V2O A;  2DYR E;  3RO2 A;  1NL4 A;  4DRX E;  4G24 A;  5FIN A;  2I6H A;  2VTB B;  4AM9 A;  1OWL A;  1JUQ A;  3MKQ B;  3FEY A;  3HXE A;  2CFU A;  4IRU A;  3FH7 A;  2P9L G;  4TXP A;  4TXR A;  1EPU A;  2KCL A;  1SVX A;  3UX4 A;  4G26 A;  3T5V A;  4BTA A;  1IHB A;  3D9J A;  5CMY A;  2WXL A;  4A3V A;  3J5Q B;  2NSZ A;  3VLD A;  3QC1 A;  4J7W A;  3DSX A;  4JW1 A;  4F53 A;  5JA4 D;  3LY7 A;  1EYH A;  3TAX A;  4BWR A;  3FUL A;  4AEZ C;  2XZD G;  5EID A;  3QWW A;  1BLX B;  4RVB A;  2VSY A;  3CK9 A;  3CV0 A;  2PM6 A;  4N3B A;  4OVU A;  4IYP A;  2VQ2 A;  3TGO A;  3D3M A;  4P29 A;  4FUL A;  5HKP A;  3DSW A;  1PAQ A;  4HB5 A;  2XRZ A;  4KXK B;  1N4R A;  1YMP A;  4KZC A;  2B0O E;  1LTX A;  1E96 B;  5LP0 A;  4A3T A;  4GML A;  3LS8 A;  2KC7 A;  3B7T A;  4DJA A;  4GA0 A;  3Q75 A;  5EYL A;  4JXT A;  2OVF A;  4UQX A;  3RSE G;  3GZ1 A;  4U04 A;  1HX8 A;  2BKK B;  4DX1 A;  4WWN A;  3EHN A;  2AWI A;  1GW6 A;  3CVW A;  3D9M A;  3R7R A;  4URK A;  2FO1 E;  4I6E A;  1HE8 A;  5A6C A;  3FY4 A;  4AIF A;  4MS6 A;  4H7Y A;  3ML9 A;  4WNF A;  4LER A;  2RKK A;  2OV8 A;  3AS8 A;  3MKR A;  4YDO A;  2P9U G;  3B7S A;  3P1U A;  3IXE A;  3UXG A;  3CHP A;  3ZKJ A;  1S63 A;  2B6C A;  1HZ4 A;  3TWR A;  3FUH A;  2BUG A;  1E8Y A;  1U3C A;  1TNB A;  3NQP A;  2CFZ A;  4U0U A;  4DI3 A;  2XPZ A;  4EZL A;  4A55 A;  2Y4U A;  3LEW A;  3CVQ A;  1TN6 A;  4BX8 A;  1N4P A;  4LEU A;  3R9M A;  1MX4 A;  3D9P A;  4PDX A;  2H6G A;  4CGW A;  3RRM B;  3EDT B;  1DCQ A;  2OVB A;  4CRW A;  4ZFH A;  2L0T B;  4WWP A;  1OCZ E;  5M72 A;  5HS0 A;  5CBO A;  4KZ0 A;  2R05 A;  3U66 A;  4ANU A;  4ME2 A;  1IYG A;  3EIQ C;  3UI2 A;  2P9S G;  1QNF A;  3UPV A;  4DI4 A;  2WPV A;  3Q73 A;  3FTU A;  3UKR G;  5B1A E;  2L0I A;  4M7C A;  1MYO A;  5T4Y A;  5ENR D;  5ENN A;  1OWP A;  4L1B A;  3S7B A;  1IHG A;  3RIB A;  4U7E B;  4GMJ A;  4J8Y A;  2VSO E;  1HXI A;  3LYA A;  3PH0 C;  4CDN A;  3PZ3 A;  4O1O A;  3LPZ A;  4B8C B;  2ETA A;  3NBN B;  4GPK A;  2WXO A;  4GA2 A;  3Q9U C;  2OEV A;  2LAI A;  2HM8 A;  2LNI A;  3BG0 B;  2I9C A;  4F1P A;  3PRZ A;  3ONK A;  3ASN E;  5E75 A;  3ABL E;  3B13 A;  5FWQ A;  4TRQ A;  1V55 E;  4AVX A;  5EKQ D;  4W9R A;  2PL2 A;  3IBE A;  4UWF A;  3SZ7 A;  3RKV A;  4JA9 A;  2XPY A;  3IEG A;  2XGO A;  4TXQ A;  4AY5 A;  2V4L A;  5CEC B;  2NYJ A;  2QYU A;  5HRY A;  1S70 B;  5J08 A;  2C0M A;  1V54 E;  2KZT A;  2XCB A;  3TXN A;  3FP3 A;  1JCS A;  3RO3 A;  4A1S A;  3PUK A;  2DIW A;  2YNQ A;  3JCK C;  1IQR A;  3O48 A;  3CQG B;  3VTY A;  4WAF A;  3L6A A;  4DK5 A;  3ASG A;  1FT2 A;  5AJD A;  1K1B A;  4JA7 A;  5JJT A;  5BPP A;  3V31 A;  3LY8 A;  3B7B A;  5HI7 A;  4U8V D;  5D0Q D;  2KCK A;  4UQZ A;  3CK8 A;  4U96 D;  2DCP A;  4CDR A;  3ZYL A;  3RAU A;  3TWT A;  1OT8 A;  4EHM A;  1H2V C;  3W9G A;  3LKU A;  4FU3 A;  2QC9 A;  3ASO E;  3AU4 A;  3FH8 A;  3CGH A;  3L82 A;  4JD2 G;  3PRE A;  3DSV A;  3G2U A;  4RLY A;  1BPO A;  4KYO B;  1JWF A;  4PS3 A;  2OND A;  4G25 A;  4OYS A;  4RG6 A;  2M63 A;  3T5X A;  2F8X K;  3RRN B;  2J4B A;  4JEH A;  3MEK A;  5LX8 A;  1N4S A;  3C72 A;  4G8K A;  4BY6 A;  4L7T A;  5ANR A;  1HU3 A;  3CLJ A;  4ANV A;  3FU5 A;  4MLP A;  2J08 A;  3DSS A;  3LXU X;  3ZYQ A;  3HYM B;  2EIK E;  3AG3 E;  3MGB A;  3CSF A;  2LO6 A;  4NUR A;  5ITZ F;  4HOQ A;  2LXM A;  2YHE A;  2PQR A;  3Q9N C;  2WMN A;  3APF A;  1BI8 B;  1OCR E;  5G05 C;  4X8Q A;  3AS4 A;  2V0P A;  3U3W A;  3V2X A;  3F6Q A;  2ZIR A;  2WXQ A;  3OXF A;  1YYH A;  3BQO A;  5ENP D;  2GGF A;  2UWJ G;  1EF1 C;  3C3Q A;  3TWU A;  1JCQ A;  2A5E A;  4GZD A;  5G04 J;  4HVB A;  2WXG A;  4C0M A;  4MRU A;  4BET A;  3MV2 B;  4HFG A;  3S2A A;  1S64 A;  4Y6C A;  2XS8 A;  5ANL A;  2WXK A;  3MZL B;  3PEU B;  4DX2 A;  3FH5 A;  5ARG A;  3HXD A;  5E76 A;  3IKO B;  2QZA A;  5EX0 A;  4HNA D;  3LY9 A;  3SBT B;  4E85 A;  1RZ4 A;  5IY5 E;  2J8S D;  4G11 A;  2KXP C;  2R59 A;  3FU3 A;  3NB2 A;  3DXM G;  1IQU A;  4JHJ A;  5DIZ A;  1N0R A;  1NP7 A;  3ZYM A;  1QBQ A;  2A5U A;  3KD7 A;  2F8Y A;  2RG8 A;  4AV7 A;  4JZY A;  1SQM A;  5LCW J;  1MQS A;  1E7U A;  5FJY A;  3ZU7 B;  2J09 A;  3URZ A;  4CDM A;  4AY6 A;  1HH8 A;  4I17 A;  4ILH B;  3TWQ A;  4I1M A;  4UQY A;  3ONL A;  1OUV A;  2WXF A;  2ETB A;  2X6F A;  1H6O A;  4PH4 B;  3TWW A;  1FVH A;  5FQ4 A;  2EIL E;  2HYZ A;  4M3O A;  4GTO A;  1S0P A;  2OCC E;  3C3O A;  3UKU G;  2ZIS A;  1KZO A;  2LSV A;  1QZ2 A;  2X38 A;  2XS1 A;  2IQC A;  2LAH A;  2WXJ A;  2P9I G;  4G1T A;  3CHM A;  4FLH A;  3CR3 A;  3EU5 A;  5JHA A;  3B7R L;  4B94 A;  2PZI A;  5EIL A;  1H2T C;  3PNL B;  2XEE A;  4J8S A;  2GRN B;  3KS2 A;  4LNU D;  2J4D A;  3ZFW A;  5FQ6 A;  4AP2 A;  3IHV A;  3CQC B;  1EDU A;  4YDY A;  4MBG A;  3FUF A;  3I3N A;  4LSZ E;  1H6P A;  2ZGD A;  5ARF A;  3HXC A;  4MKT A;  1OWM A;  5CRU A;  4UI9 J;  3P2B A;  3T9K A;  5B1B E;  4GA1 A;  1O5M A;  1QYM A;  4WWO A;  4ILG A;  1WY6 A;  3QNK A;  2BF0 X;  2EIM E;  4G23 A;  4N2S A;  3KAE A;  4ZHB A;  2WXI A;  4JB8 P;  4BSZ B;  5KBA A;  3LVR E;  1QQE A;  1KT1 A;  1TNU A;  4AXH A;  1PC2 A;  4HRN A;  4O1P A;  3EJN A;  2XEH A;  4GCO A;  3ZN3 A;  4TUU A;  4E6H A;  3Q79 A;  4C9B B;  5LCW C;  2IJG X;  2I1J A;  4LG6 A;  1PY1 A;  3CHO A;  5KJK A;  2PM7 A;  5FZR A;  5J90 A;  2WXN A;  3PE4 A;  2QFC A;  3CVL A;  2CG3 A;  1UN8 A;  4LRZ A;  1MHQ A;  4EZJ A;  3DST A;  3FUN A;  4WNG A;  1MZC A;  2WXH A;  3UM0 A;  2DVW A;  3ULE G;  3FTS A;  3UT4 A;  3FEX A;  4LNG A;  3HG0 D;  4GB9 A;  3SFX A;  4RQI A;  3TJP A;  1ZB1 A;  1X5B A;  3LJ3 A;  3KSL A;  1SW6 A;  3MX3 A;  2KZT B;  2WQH A;  5G2N A;  4CYM D;  3Q78 A;  2XPI A;  3CVX A;  1DVP A;  3QKY A;  1NZN A;  4TUM A;  1BU9 A;  3HXB A;  3PEV B;  3EHQ A;  4PS7 A;  4N5Q A;  4V3I A;  2CHW A;  3E33 A;  1LD7 A;  5C2Y A;  4KVO A;  4ATZ D;  3D9L A;  3MCX A;  1N52 A;  2DBA A;  3ESL A;  4U0S A;  4DPR A;  1DCE A;  4KBQ A;  1KT0 A;  1BD8 A;  2GRM A;  1FVF A;  2V5Q C;  3HHM A;  4Y6W A;  3G2T A;  2X3M A;  2VYI A;  2E0I A;  5B3S E;  3SHF A;  3FUK A;  1UN9 A;  4RG9 A;  4I6J A;  5CMW A;  3FUI A;  2VGE A;  2XEN A;  1VDY A;  4U95 D;  2R17 C;  4LCT A;  3UM2 A;  1P5Q A;  4K03 A;  4DUI A;  2GRR B;  1ELK A;  3D9N A;  1N94 A;  3QB2 A;  3ZHE B;  3UMV A;  4AJW A;  4NQ0 A;  4LNB A;  4FAD A;  1Y6I A;  4JC8 A;  2BTD A;  4WND A;  5EIB E;  4GPM A;  3PDN A;  3MKQ A;  2Q7F A;  2EIN E;  4I2W A;  3ZRH A;  1ELR A;  2XHE A;  4G2V A;  4UWG A;  3R7Q A;  3QDN A;  1H2U A;  3ZUV B;  2LSU A;  5CRV A;  2EIJ E;  5EN5 D;  3LJN A;  2VSN A;  2P9P G;  4BES A;  4EZK A;  4I9C A;  2NC9 A;  1UJK A;  2E2E A;  4JEU A;  4U0Z A;  4L2L A;  2VGX B;  3D9I A;  2RD0 A;  3I4R B;  3AJI A;  4KVM A;  4N2Q A;  4BSX A;  1FT1 A;  3CKC A;  3NZS A;  1KZP A;  5CED B;  5AN8 A;  1E8Z A;  4HLL A;  4UWL A;  5T3R A;  1TN8 A;  3PS6 A;  5AJL A;  3PZD A;  1TJC A;  4I9E A;  3S7J A;  2J49 A;  3CVN A;  2XCC A; 
#chains in the Genus database with same CATH homology
 2WXK A;  4F53 A;  2IOS A;  2FBN A;  4ACL A;  3LY7 A;  3MZL B;  1EYH A;  4U07 A;  1H6K A;  3TAX A;  3PEU B;  3CHR A;  3FH5 A;  5ARG A;  2WXM A;  3CKB A;  5E76 A;  3PVL A;  4U63 A;  4BWR A;  3IKO B;  4R7L A;  3GYZ A;  4EEC A;  3FUL A;  3UT8 A;  4AEZ C;  5EX0 A;  3TG5 A;  3QWW A;  3RRU A;  3LY9 A;  3SBT B;  4RVB A;  4E85 A;  4N3A A;  2VSY A;  3CK9 A;  3CV0 A;  2PM6 A;  4N3B A;  4OVU A;  4IYP A;  4XIF A;  2VQ2 A;  3CEQ A;  3TGO A;  4N5C A;  3D3M A;  4G11 A;  4P29 A;  4FC8 A;  2R59 A;  3FU3 A;  4FUL A;  2XGS A;  3U64 A;  3C98 A;  1IQU A;  4JHJ A;  5DIZ A;  4FJY A;  2WM9 A;  3UT7 A;  4ANW A;  5KJN A;  1PAQ A;  5LFA A;  2CG2 A;  3CVV A;  5FQ8 A;  4GYW A;  3FDH A;  4N3C A;  4EBA A;  3Q5M A;  2XRZ A;  1NP7 A;  4KXK B;  4L23 A;  3ZYM A;  4KZC A;  3AU5 A;  4RSY A;  2AXZ A;  5G55 A;  2X6H A;  1E96 B;  2J9Q A;  2X6K A;  4FLB A;  4J6I A;  4HXI A;  3AS5 A;  5LP0 A;  3ULQ A;  2A5U A;  4A3T A;  4GML A;  3KD7 A;  3LS8 A;  2KC7 A;  3NF1 A;  3B7T A;  2RG8 A;  5KJL A;  4AOF A;  4AV7 A;  4JZY A;  4DJA A;  1SQM A;  4XX5 A;  3L17 A;  4TV3 A;  4GA0 A;  3WXX A;  5LCW J;  3UQ3 A;  1MQS A;  1E7U A;  2JLB A;  5FJY A;  1TJF A;  4JXT A;  3ZIM A;  3HVE A;  3JQ1 A;  2J09 A;  5JJ7 A;  2OVF A;  3CHQ A;  4UQX A;  3GZ1 A;  4ILI A;  4U04 A;  3QOU A;  1HX8 A;  4BT9 A;  4WWN A;  3EHN A;  3URZ A;  2AWI A;  4BFR A;  4CDM A;  1GW6 A;  4AY6 A;  3CVW A;  2CHZ A;  3D9M A;  3R7R A;  4URK A;  3FTV A;  2I1K A;  1HH8 A;  4I6E A;  1HE8 A;  5A6C A;  4I17 A;  4ILH B;  3FY4 A;  4GU5 A;  4HS2 A;  4GZ5 A;  5AYW D;  4I1M A;  4UQY A;  3ONL A;  1OUV A;  3QAR A;  2WXF A;  2XRY A;  2X6F A;  2X6I A;  4AIF A;  4UI9 C;  1UW4 B;  4MS6 A;  3TL5 A;  4PH4 B;  3G2W A;  4H7Y A;  2IF4 A;  4JL0 A;  3ML9 A;  4I43 A;  4LER A;  4WNF A;  3L16 A;  5FQ7 A;  2OV8 A;  3AS8 A;  4PS8 A;  3JQ0 A;  5CHE E;  1FVH A;  3QWP A;  2XQ0 A;  1YA0 A;  4JHK A;  5FQ4 A;  1NA3 A;  2HYZ A;  4M3O A;  3KEZ A;  3MKR A;  4Q96 A;  3R9A B;  5KJM A;  3B7S A;  4GYY A;  3P1U A;  3Q4A B;  5BNW A;  3FU6 A;  4DLQ A;  3FU0 A;  1S0P A;  5KCM A;  4ATG A;  3CHP A;  2V8S E;  3FTX A;  1HZ4 A;  4ANX A;  1WM5 A;  2LSV A;  3TG4 A;  1A17 A;  2MHK A;  4I6G A;  4CGV A;  1QZ2 A;  3FUH A;  4CEM A;  2BUG A;  2X38 A;  2IQC A;  1E8Y A;  1U3C A;  2LAH A;  3NQP A;  1XNF A;  2WXJ A;  4G1T A;  5FTP A;  1E90 A;  2VGX A;  3SFZ A;  3CHM A;  2FF4 A;  3DPD A;  2CFZ A;  4U0U A;  4FLH A;  3CR3 A;  4DI3 A;  2XPZ A;  4EZL A;  4A55 A;  4KT6 B;  2Y4U A;  2YHC A;  3LEW A;  3B7R L;  5JHA A;  3QAQ A;  2VTB A;  3CVQ A;  4FHJ A;  4B89 A;  4B94 A;  2PZI A;  1H2T C;  3PNL B;  4EBA G;  4J8S A;  3KS2 A;  4BX9 A;  2KAT A;  3GZS A;  5D0O D;  4BX8 A;  2J4D A;  5EDS A;  3ZFW A;  4LEU A;  4YVO A;  5BV1 A;  4H7X A;  5FQ6 A;  3EHM A;  4UWH A;  4AP2 A;  3D9P A;  4PDX A;  3LVQ E;  3IHV A;  4I1O B;  4CGW A;  3TXM A;  3CQC B;  1EDU A;  3RRM B;  3OXG A;  3EDT B;  2L6J A;  3FTW A;  3OAW A;  3HDX A;  3IV0 A;  2OVB A;  3PUJ A;  4B8A A;  4CRW A;  2HO1 A;  2L0T B;  4WWP A;  3FUF A;  3I3N A;  4N39 A;  5ARF A;  1N54 A;  5M72 A;  3G2S A;  4KZ0 A;  3ZVV A;  2HR2 A;  4MKT A;  3HVE B;  3APC A;  1OWM A;  3SGH A;  5HQ8 A;  3U66 A;  4UI9 J;  3P2B A;  3VTX A;  3VLF A;  4GA1 A;  4ANU A;  1JPL A;  4WWO A;  3ASF A;  4ME2 A;  5AIJ A;  4ILG A;  4UI9 K;  1IYG A;  1WY6 A;  3EIQ C;  3QNK A;  1QNF A;  2BF0 X;  3GW4 A;  3UPV A;  4G23 A;  2NXP A;  2AW6 A;  4J8F A;  4DI4 A;  4N2S A;  3KAE A;  2WPV A;  3QJZ A;  2WXI A;  2IU1 A;  5LOZ A;  3U4T A;  3FTU A;  2KM4 A;  5BUZ A;  4OVV A;  4WNE A;  2L0I A;  3CIA A;  3LVR E;  5T4Y A;  1QQE A;  1KT1 A;  4ACK A;  1W3B A;  2C2L A;  3FTY A;  4AXH A;  1PC2 A;  1ZU2 A;  1WAO 1;  3LCA A;  4JHR A;  4KMO A;  4CT4 A;  4FA6 A;  2WQ7 A;  5ENN A;  1OWP A;  4L1B A;  4XI0 A;  2YIN A;  3EJN A;  3L08 A;  1U3D A;  4GCO A;  3S7B A;  5CCL A;  3ZN3 A;  3QWV A;  1IHG A;  4I1A A;  3FFL A;  3RIB A;  4TUU A;  4GMJ A;  4I2Z A;  4E6H A;  3T8M A;  2ILR A;  5JHB A;  4C9B B;  2VSO E;  1HXI A;  2IJG X;  3LYA A;  5LCW C;  4XZ4 A;  3PH0 C;  1E8W A;  2I1J A;  3FUJ A;  4CDN A;  2PQN A;  4J0U A;  3FHE A;  3LPZ A;  1PY1 A;  3E4B A;  3RK6 A;  4B8C B;  3CHO A;  4APO A;  5KJK A;  2PM7 A;  2R5S A;  5FZR A;  5J90 A;  4GPK A;  2WXO A;  3CK7 A;  2WXN A;  4CCA A;  4UWK A;  3PE4 A;  2QFC A;  3CVL A;  3ESK A;  2CG3 A;  4GA2 A;  1UN8 A;  4LRZ A;  1MHQ A;  4EZJ A;  2LAI A;  2HM8 A;  3FUN A;  3L13 A;  3ZW3 A;  2WB2 A;  4WNG A;  2EQX A;  2LNI A;  5AEN A;  4FHK A;  3BG0 B;  2I9C A;  2OOE A;  3ZPJ A;  3PRZ A;  2WXH A;  1FCH A;  3FUM A;  1HG5 A;  1SZ9 A;  5C1D A;  3ONK A;  1OWO A;  5E75 A;  3CVU A;  3FTS A;  3UT4 A;  3FEX A;  3K9I A;  4B0Z A;  4F1S A;  4GB9 A;  3I5P A;  3CVY A;  3TJP A;  5JJ6 A;  3B13 A;  2WXR A;  3SF4 A;  5FWQ A;  4TRQ A;  3Q47 B;  4AVX A;  3ENE A;  3MYV A;  1X5B A;  5EKQ D;  3LJ3 A;  4W9R A;  3Q49 B;  4FJZ A;  2PL2 A;  3IBE A;  2GRL A;  4UWF A;  3SZ7 A;  3RKV A;  4JA9 A;  3FWV A;  2FI7 A;  4EPZ A;  2XPY A;  2J07 A;  3IEG A;  5BT1 A;  2XGO A;  5ANL A;  4K0R A;  2AVP A;  4AY5 A;  2A4Z A;  2CHX A;  4C0E A;  2V4L A;  4HLE A;  3MX3 A;  2KZT B;  2WQH A;  3MJW A;  2GW1 A;  2L9B A;  5G2N A;  2QY7 A;  4L2Y A;  4BTB A;  2XPI A;  3CVX A;  5J08 A;  2C0M A;  3UUX A;  2MRI A;  1DVP A;  3QKY A;  1NZN A;  2WVI A;  5A23 A;  2P58 C;  4O6F A;  2KZT A;  1HG2 A;  2XCB A;  3TXN A;  3PEV B;  4HOR A;  3FP3 A;  3RO3 A;  4PS7 A;  4A1S A;  3O4Z A;  3PUK A;  3BG1 B;  3BEE A;  2CHW A;  4V3I A;  4U8H A;  4DLO A;  4GZ6 A;  2KCV A;  5DBK A;  3VLE A;  3ZGQ A;  1HO8 A;  2DIW A;  2YNQ A;  3OXL A;  5C2Y A;  1LF8 A;  3JCK C;  2Y4T A;  4KVO A;  2UY1 A;  3D9L A;  3MCX A;  3SI5 A;  1IQR A;  1N52 A;  1NA0 A;  1H19 A;  2DBA A;  3ESL A;  3O48 A;  3CQG B;  4U0S A;  4YND A;  3LDZ A;  4DPR A;  5EX3 A;  4KBQ A;  3ZXS A;  4GCN A;  1KT0 A;  3ZYK A;  3VTY A;  4WAF A;  3FTZ A;  4NAC A;  1INZ A;  3L6A A;  2GRM A;  3ASG A;  1FVF A;  2V5F A;  4JVS A;  4DK5 A;  3HHM A;  3FUE A;  3G2T A;  4GYO A;  1HFA A;  4JA7 A;  4Y6W A;  5AJD A;  2IOL A;  2X3M A;  1TEZ A;  4D10 C;  1OWN A;  3HIZ A;  2VYI A;  2IFU A;  5JJT A;  5BPP A;  2E0I A;  5A7D B;  4LUN U;  4EQF A;  2MOW A;  3ML8 A;  3LY8 A;  4XKC A;  2VGY A;  5HI7 A;  3SHF A;  1JWG A;  2YQ8 A;  5D0Q D;  2JEK A;  2KCK A;  1UN9 A;  3FUK A;  3L22 A;  4GZ3 A;  4I6J A;  4RG9 A;  4XI9 A;  3RU0 A;  4UQZ A;  3CK8 A;  3D9O A;  4IUL A;  2DCP A;  4GZC A;  3ZYL A;  4CDR A;  3SBS A;  5CMW A;  1L5J A;  3FUI A;  1H2V C;  5BW8 C;  3LKU A;  4FU3 A;  3EIJ A;  1HS6 A;  4A1G A;  1VDY A;  2X6J A;  4F7A A;  3ASH A;  4FP7 A;  3S7D A;  3AU4 A;  2R17 C;  3QK0 A;  2UY1 B;  3CGH A;  3FH8 A;  4LCT A;  3D9K A;  1P5Q A;  1ELW A;  4K03 A;  5FZQ A;  2C0L A;  4JPS A;  5G05 J;  3PRE A;  4NRH B;  1UJJ A;  1ELK A;  2AXU A;  3D9N A;  3NZU A;  1Z6T A;  1H0A A;  3G2U A;  5G04 C;  2FEZ A;  3GZ2 A;  3QB2 A;  1BPO A;  4KYO B;  3ZHE B;  1Z3X A;  3UMV A;  4WUY A;  3ZHE A;  2FO7 A;  3DBS A;  1DNP A;  1JWF A;  4IN3 B;  4PS3 A;  2OND A;  4G25 A;  2WMO A;  4OYS A;  4AJW A;  1ZBP A;  4NQ0 A;  2M63 A;  4RG6 A;  4F3V A;  5BV0 A;  4FAD A;  3T5X A;  3U9W A;  4CT0 A;  1Y6I A;  4PUC A;  4JC8 A;  2BTD A;  2J4B A;  3CVP A;  3RRN B;  4JEH A;  5FT9 A;  3MEK A;  4WND A;  3PDN A;  3MKQ A;  2Q7F A;  5CCM A;  5LX8 A;  2VSX E;  3RJV A;  4Q69 A;  3IHY A;  4L7T A;  4BY6 A;  3S7F A;  4YVQ C;  3SD5 A;  2XGM A;  5ANR A;  3PNT B;  2WQ6 A;  5FZS A;  1HU3 A;  3CLJ A;  2ION A;  3PE3 A;  3MA5 A;  4I2W A;  3ZRH A;  4HOU A;  2FUL A;  3FUD A;  4ANV A;  3FU5 A;  1ELR A;  2XHE A;  4MLP A;  1B89 A;  4G2V A;  4XKB A;  2J08 A;  4UWG A;  3R7Q A;  3APD A;  4HOS A;  3QDN A;  3LXU X;  3L54 A;  3JYS A;  5T8I A;  1XGW A;  2XEV A;  3CST A;  1H2U A;  3ZYQ A;  3N71 A;  2LSU A;  4HOT A;  4BT8 A;  4QFV A;  2WXP A;  3G2V A;  3HYM B;  3MGB A;  3ASD A;  3CSF A;  1E7V A;  2Y3A A;  4APF A;  1SZA A;  2LO6 A;  2I2O A;  2VSN A;  2ZU6 B;  4NUR A;  4GAA A;  4EZK A;  4HOQ A;  4I9C A;  3RO2 A;  3CHS A;  4J8E A;  2YHE A;  3OTN A;  2PQR A;  2NC9 A;  1UJK A;  4G24 A;  2WMN A;  2E2E A;  4JEU A;  2I6H A;  4U0Z A;  3APF A;  4L2L A;  2VGX B;  2VTB B;  3D9I A;  2RD0 A;  3I4R B;  4Q94 A;  5G05 C;  4AM9 A;  3SNX A;  1OWL A;  1JUQ A;  3MKQ B;  4KVM A;  4N2Q A;  4BSX A;  3JUI A;  3AS4 A;  3FEY A;  4J8D A;  2CFU A;  4IRU A;  2V0P A;  3CKC A;  3I4G A;  2VJ8 A;  3ZEF A;  1HF8 A;  3U3W A;  3NZS A;  3FH7 A;  4XE0 A;  1E8Z A;  2WXQ A;  3OXF A;  4UWL A;  5T3R A;  1EPU A;  2KCL A;  1E8X A;  1Y8M A;  2GGF A;  3UX4 A;  2UWJ G;  4G26 A;  3T5V A;  4BTA A;  1EF1 C;  4ABN A;  3PS6 A;  1KLX A;  5AJL A;  3D9J A;  3PZD A;  4GZD A;  5CMY A;  5G04 J;  2WXG A;  4HVB A;  2WXL A;  4C0M A;  4A3V A;  4MRU A;  3Q15 A;  1TJC A;  2NSZ A;  3MV2 B;  4HFG A;  4I9E A;  1Z3Y A;  3VLD A;  2AXV A;  1UG3 A;  2J49 A;  3MV3 B;  3QC1 A;  3S2A A;  4Y6C A;  4JW1 A;  3S7J A;  3B7U X;  3CVN A;  2XCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...