4EPZA

Crystal structure of a transcription anti-terminator antagonist upxz (bacuni_04315) from bacteroides uniformis atcc 8492 at 1.68 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
160
structure length
154
Chain Sequence
NSLLSRALELQRMAHELMYLIYSDEFCRLNKEVLTRSDSLFSEQSSDIEEEGNLCLALLMGYNATIYDNGDKERKKQVILDRIYNIMSQLPASLLKMRLLTWGYSETYDEELAHEAHQLIETWNISDLTDEQKEIIEELRNFEENQYPWEEVQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcription anti-terminator antagonist UpxZ
publication title Crystal structure of a transcription anti-terminator antagonist UpxZ (BACUNI_04315) from Bacteroides uniformis ATCC 8492 at 1.68 A resolution
rcsb
source organism Bacteroides uniformis atcc 8492
molecule tags Transcription
total genus 61
structure length 154
sequence length 160
ec nomenclature
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06603 UpxZ UpxZ family of transcription anti-terminator antagonists
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.810 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4epzA00
4EPZA
chains in the Genus database with same CATH superfamily
4F53A 2XHEA 5AENA 4F1PA 4GTPA 4L23A 5HKPA 4HRLA 3QK0A 3ZRHA 4HNAD 3SO8A 5H7PA 4AXHA 4AY5A 3L17A 3CQCB 2P58C 2P9LG 3DSUA 4ZFHA 4JZYA 5G05C 1UW4B 3UT4A 1MX4A 2MRIA 4C0MA 1O1RA 2ZGDA 1IQRA 4U04A 3FWVA 4Z68A 3PUKA 2J07A 4LRZA 1TEZA 1U3CA 3BU8A 4G23A 5DBKA 4N3AA 4U96D 3Q78A 4GZ6A 2CHXA 1UG3A 3T9KA 1H2TC 2J49A 4LNGA 3L08A 4U8HA 1FCHA 5LX8A 4HRMB 1TJCA 4HFGA 5ARFA 3ASNE 4G2VA 2LSVA 3FU0A 5ARGA 4GTTA 2X3MA 3TWQA 3OXLA 4GTOA 4U07A 1KT1A 2DZNA 3FTSA 5FT9A 3FTXA 4C9BB 3SFXA 2EINE 3D9KA 3HXEA 3SGHA 3L54A 4HOQA 2LAHA 4CYMD 1Z3YA 3RU0A 4I43A 3T5VA 3PEUB 1H6KA 1SA5A 5G55A 3TWUA 3GW4A 1OXJA 5FINA 5A6CA 3HRAA 2DZOA 3ONLA 2WPVA 3C72A 5AJDA 5AQ7A 1SW6A 3SBSA 1MQSA 3I4RB 1NI1A 3U66A 3DSVA 4URKA 4GTRA 4HBDA 3X2QE 3CSTA 4NQ0A 3JQ1A 2YHCA 3QWVA 4KVOA 2V5QC 1JCSA 5HRYA 4I9CA 4QQIA 5CHEE 2KCVA 2C0LA 4BSXA 4XZ4A 3FP3A 4TXRA 4AEZC 1E8XA 5AJLA 4HS2A 3SZ7A 4NACA 5JHBA 1NFIE 3Q79A 3CVNA 3D9IA 2VGEA 4J8SA 1MJ0A 2KCLA 3R9AB 5ENRD 3PH0C 1D8DA 3VLFA 3S2AA 3QWWA 2WB2A 4KBQA 3FTUA 3LYAA 3TL5A 1N0RA 3ABME 3B7UX 4N5QA 2L0TB 1ZU2A 4L9PA 2X6IA 1TNUA 3CVWA 4MRUA 3EHRA 5CBOA 4FC8A 3TXNA 1Y8MA 4K5CA 2VGXB 3T8MA 3VTYA 3D9LA 2XEHA 4GAAA 3OAWA 3N71A 3CGHA 3EUVA 3TWXA 1H19A 2WM9A 1YCSB 3MZLB 4KT6B 3GZSA 1EF1C 3ABKE 3NZUA 3TGOA 4JA9A 3SFYA 4DI4A 4G1TA 3MYVA 1LD7A 5C1DA 3LVQE 2R2LA 3CHRA 3ZHEB 4XKBA 2AXZA 4I1MA 4BTAA 2VGXA 4B93B 3R7QA 2B6CA 3TWVA 1SQMA 5G04C 3FU5A 5CMYA 4U0SA 5ENOD 5AIJA 3TWWA 1OWNA 2AVPA 1IHGA 2AXUA 4O1PA 4AY6A 1HX8A 5AYWD 4HOSA 3TWRA 3KSQA 1LF8A 4DRXE 4JHRA 5EN5D 1ELKA 2QY7A 5ENSD 4XX5A 3ZHEA 4HORA 4UWLA 3RJVA 2IO3C 2HE0A 3ZFWA 1SVXA 1K1AA 4FLBA 3ZXPA 2NSZA 2E0IA 2PM7A 3AAAC 3CKBA 4G8KA 4K03A 4G26A 4BT8A 4MKTA 2VSXE 3QAQA 4I9EA 4GMRA 4ANUA 2YINA 3L16A 4KZCA 3MKQB 4GMJA 2HR2A 3G2VA 2OCCE 2RFAA 5ENQD 5EX3A 1OCOE 3TJPA 2WQ6A 1DC2A 3D3MA 3RO2A 1TNBA 4B89A 1NA0A 1NP7A 4DX7D 4I17A 4CGVA 4NIKA 3ESLA 4I6EA 5D2MC 4APOA 4ILGA 5B3SE 1E90A 3CVXA 3Q73A 5E76A 5EX0A 2A5EA 4WNDA 5BPPA 5BXOA 3CEQA 3MKQA 5LP0A 3GZ1A 4U0UA 4JC8A 3RKVA 4CZ2D 4J7WA 3LCAA 3ZNGA 5G05J 3O4ZA 4OVVA 4HRNA 3BG0B 3F6QA 4JXTA 4TUUA 1LTXA 3UMVA 2H6IA 5LCWC 2QZAA 4U0ZA 2KZTA 3IEGA 2WXNA 4N3CA 2V4LA 4KMOA 4YVOA 4YDYA 3NF1A 2KATA 2LUHA 2F0YA 1HXIA 2X6FA 3PE3A 3FUFA 3ZU7B 4XE0A 3CHOA 3HIZA 4B94A 2FI7A 3L9TA 3URZA 1EYHA 3CHPA 4FU3A 2VTBB 2WXJA 3UX4A 3W9FA 4EBAA 3S7DA 2VSYA 3NZSA 4WAFA 4EBAG 4FHJA 1K8KG 4HOTA 4JPSA 4C48B 1N4QA 4RG6A 4X8QA 3DSSA 2AW6A 3V2XA 2WMNA 2CG3A 3ZUVB 3JYSA 4HVBA 1E8ZA 5BUZA 3S7BA 4GCOA 3UTMA 4CDMA 3DXMG 4U7EB 1FPPA 4V3IA 3CLJA 2X38A 3QDNA 5BV1A 4NURA 3TWTA 3E30A 4JD2G 1HU3A 3DPDA 2XEEA 1QNFA 4CCAA 3NB2A 4U63A 4RSYA 1NZNA 2EQXA 2IFUA 2YQ8A 3E34A 1BI8B 3L22A 2ONDA 1RZ4A 4IYPA 4WWPA 3IHYA 5EYPF 3PZ4A 2GRQB 4AVXA 3TAXA 5CCLA 4YNDA 2QC9A 1UN8A 1VDYA 2WQHA 2X6HA 3NQPA 4FULA 2DYRE 4HLLA 2IO2C 1SA4A 3QB2A 3PS6A 4I1OB 2VSOE 4JA7A 2XQ0A 3ZYKA 3CHQA 4KVMA 4J0UA 4JW1A 3T5XA 5CMWA 4BETA 4TXPA 3D9PA 3Q75A 2WXHA 4TXQA 3Q5MA 2AXVA 3CK7A 4XIFA 2Y69E 4LSZE 3ENEA 4AIFA 2WXQA 1UOHA 5KWDA 3IV0A 3FUEA 2ETBA 2XPYA 2ZISA 2XS8A 2CHZA 2QYJA 4BY6A 2YNQA 2Y4TA 1HFAA 3PEVB 4PDXA 1DVPA 4HB5A 2KC7A 1XNFA 3MJWA 1LD8A 3LY9A 3FUKA 3LY8A 1IQUA 3PUJA 1S63A 2DIWA 4EZKA 4P29A 5ENTD 3NOCD 3B7BA 4BTBA 4PUCA 3ML8A 3CIAA 4L7TA 3LJNA 4DUIA 3B7SA 1OUVA 4HXIA 4DX1A 3UI2A 3CVVA 2P9NG 3I3NA 3B7RL 4CT4A 4G24A 3GYZA 2PQRA 3AJIA 3OTNA 1TNOA 4DK5A 4XEIG 3ZYQA 5CCMA 3DXKG 2ZGGA 1SZ9A 3ZW3A 5FQ4A 1Z5SC 2DWZA 1U2VG 5G04J 5BT1A 1QYMA 1N52A 4D10C 4EECA 3QJZA 1RW2A 1YMPA 2BF0X 5CRUA 4GA2A 3G2WA 5KNHD 4CT0A 3ASGA 3AG1E 3UT7A 3D9OA 1KLXA 4ATZD 3PRZA 4O6FA 3LY7A 1SZAA 3ML9A 4GA0A 4AOFA 3HXFA 4UUCA 2R03A 3UM3A 2IF4A 1IKND 2Q7FA 1HH8A 3PNLB 4GYOA 4JEHA 4CDNA 2H6GA 2IU1A 3EHNA 4J8FA 1OWPA 3LKUA 3UQ3A 2JEKA 1MHQA 3V30A 1ELRA 5CRVA 1N4RA 5ENNA 2AJAA 2R05A 5LOZA 2OVFA 3JXJA 4XI9A 3APDA 4OVUA 5G2NA 3SD5A 2LO6A 4KZ0A 1HG2A 3HXBA 1H0AA 1FVHA 4I6JA 3RRNB 2P9KG 4GYWA 4JVSA 3CVUA 4B0ZA 4JB8P 4LERA 1G3NB 3FUMA 3JXIA 3PZDA 2P9UG 4DX2A 2GRRB 4DX5D 2I1JA 1E8WA 2XGSA 3LS8A 4O60A 4CDRA 2FF4A 3ULEG 3V31A 3DRAA 1N0QA 3TXMA 3D9NA 1EPUA 4EHMA 1HE8A 3ASFA 4A1GA 4XI0A 1A5EA 3PVLA 1IHBA 4AP2A 2GROB 4CRWA 2CFZA 3V79K 1EDUA 1L5JA 1Y6IA 2EILE 2UWJG 3JQ0A 4Y6CA 5HI7A 3S7FA 4CEMA 3FULA 5EILA 5J90A 5FZRA 4Q69A 1H6OA 3B95A 3RO3A 4GZ5A 5AAOA 4F7AA 4LG6A 2OEWA 2BEDA 2DYSE 4FHKA 4B8CB 1MX2A 5JHAA 1NL4A 2QFCA 4YDOA 4MLPA 5LCWJ 2F8XK 3SHFA 5D0QD 4GB9A 3JUEA 2XPIA 4R7LA 2MYOA 1BLXB 2VGYA 2DBAA 4GTMA 2KCKA 2VSNA 3NOGD 2P9PG 2EIJE 4ANWA 3DEPA 4M3OA 3BUAA 1DCQA 2RD0A 3Q7AA 1TR4A 1HO8A 1OY3D 4BERA 3HG0D 5JJTA 1QZ2A 3PDNA 3TG4A 3E4BA 3RRMB 3HDXA 3FH7A 1FVFA 5JMND 1HS6A 3KD7A 3DSXA 4E6HA 2GRMA 5B1AE 2WXIA 1PC2A 3BEEA 3JUIA 2ZIRA 5DIZA 4ACLA 2P2CP 3EHMA 3MA5A 3L13A 4GYYA 1KZOA 3TG5A 5D0OD 1B89A 3FUHA 2XS1A 1UJKA 4FADA 4ILIA 4RQIA 5KCMA 3HVEB 3Q9NC 1P5QA 2XRZA 1TN7A 1S0PA 3FH5A 4GCNA 4UI9K 1AP7A 2KZTB 4FP7A 3LEWA 4JHJA 4U8YD 3CQGB 3Q4AB 4N2QA 4ATGA 2IONA 4EZLA 3CVLA 1WG0A 2PL2A 4GPKA 4N3BA 3PZ2A 4UI9C 2BKGA 2OOEA 1JUQA 1TNYA 2LXMA 4I6GA 3R7RA 4LUNU 2H6FA 5JJ6A 3S7JA 4J8DA 4UWFA 4PS3A 3HVEA 3QNKA 3PREA 3UINC 4WUYA 4E85A 3SI5A 5ITZF 2JABA 2R17C 4KYOB 4IULA 3ZYMA 4W9RA 4F3VA 3SBTB 3LXUX 3L82A 1K1BA 2UY1A 3ASOE 4UQZA 5B1BE 2EIKE 3AG4E 3V2OA 1UN9A 4DJAA 3UM2A 3EJNA 5AQBA 1N54A 5BW8C 5EDSA 3IKOB 3LVRE 4HOUA 2LNIA 3FEYA 1KPSB 1O5MA 5A23A 4DX6D 4OAUC 2MOWA 2RG8A 4A1SA 2XZTG 5CEAA 4YVQC 3B13A 4GZ3A 2C2LA 4DLOA 4AV7A 4HLEA 4GTVA 3VLDA 2J4BA 5J08A 3FUNA 5FIOA 4GTQA 2FULA 2GRLA 3CR3A 3ULQA 3PZ3A 3EIQC 2A5UA 2L6BA 2IEJA 4A55A 1O1SA 3UM0A 1N95A 3UUXA 3NBNB 5EIDA 4J8YA 5AQ9A 3JCKC 2VQ2A 3G2UA 2L9BA 3ASDA 1YA0A 4I2WA 3FHEA 1S70B 2XCBA 1N94A 3ZKJA 3GZ2A 1H6PA 4L1BA 3DSWA 2WXPA 2XENA 2F8YA 1TNZA 1BPOA 1XGWA 2IQCA 4APFA 2FEZA 3CSFA 3FDHA 4PS7A 3FU6A 4JL0A 3RAUA 3U64A 4PS8A 1N9AA 5KJNA 3D9HA 4B8AA 3Q49B 1D9SA 3B7TA 1GW6A 3APFA 5EKQD 2PQNA 3Q47B 4K0RA 4TRQA 1HZ4A 3ZPJA 3I4GA 3ABLE 3Q15A 3FUJA 5AQAA 1FT1A 2IJGX 3L6AA 1S64A 3ZEFA 4IN3B 4EPZA 2H6HA 4ACKA 2XPZA 2QYUA 2WXMA 4F6RD 4ANXA 3E37A 2VYIA 3ZVVA 3FEXA 3CK8A 4FJZA 4LCTA 2HO1A 2MHKA 2GRPB 2BUGA 4YDEA 3MCXA 3P2BA 3QWPA 4N5CA 3CVYA 4K5AB 2GRNB 3FUIA 4BFRA 1D8EA 3K9IA 3CKCA 4L2LA 4A63B 3CV0A 2HYZA 3FY4A 4FJYA 4GTSA 5M72A 5JA4D 3HHMA 5LFAA 3LPZA 2V0PA 2LSUA 3FUDA 1X5BA 5BV0A 3ZXSA 1DNPA 2PNNA 2OEVA 3DBSA 2JLBA 4ME2A 4KXKB 3KAEA 3P1UA 2I9CA 2XZDG 2FO1E 3ASHA 2RKKA 4DLQA 1N4SA 5T8IA 1INZA 4TV3A 1UJJA 4BX8A 1OCCE 2Y1LE 1FT2A 4BWRA 4A3VA 2B0OE 1JPLA 5FWQA 4O1OA 1E96B 3MV3B 3FTYA 3SQVA 1OT8A 3G2SA 2J08A 5HS0A 1MZCA 2X6KA 2LAIA 2P9SG 2R5SA 2CHWA 3VTXA 3QC1A 1E7UA 3MV2B 3UM1A 5ENPD 2XRYA 1HF8A 2OVBA 4F1SA 3DPYA 4N2SA 3FU3A 3MKRA 5FQ8A 3G2TA 3VLEA 3BG1B 2I6HA 3UIPC 3BQOA 2KXPC 2PZIA 3UIOC 2WQ7A 2BTDA 5D66A 3U4TA 5KJMA 4ANVA 1PY1A 2KBXA 4Y6WA 3DSTA 1TN8A 4I2ZA 3E33A 1YYHA 4OYSA 3PNTB 5KJKA 3SFZA 4AM9A 1KZPA 3J5PA 3AG3E 3W9GA 3ZIMA 4BX9A 3SF4A 3RRUA 2Y4UA 3IHVA 1TN6A 1V54E 2ILRA 2CFUA 4L2YA 4HQDA 3DWLG 3KS2A 4H7XA 2GGFA 1Z3XA 4ABNA 2YHEA 1ELWA 4HI8A 1PAQA 2CG2A 3EIJA 4GPMA 3QARA 2F37A 5AARA 3HXCA 1JCRA 2WXRA 3AU5A 4WWNA 1AWCB 4TUMA 4GA1A 1E8YA 1IYGA 5T3RA 1OCZE 5A7DB 2J4DA 2PM6A 2RFMA 3LDZA 3UXGA 4ZHBA 4GZDA 2I1KA 4BEPA 5IY5E 1ZB1A 1Z6TA 3R9MA 4U8VD 4WNFA 4UI9J 2L6JA 2I2OA 5AN8A 1X81A 5FZSA 2BKKB 5FQ6A 2R59A 3AG2E 5CERB 1BD8A 2WXFA 2ETCA 2GW1A 3AS8A 3PE4A 2FBNA 3FH8A 1IXVA 3FTVA 2AWIA 2ZU6B 5EIBE 3AS5A 3C3RA 2IOLA 2L0IA 2EIME 3QOUA 4G25A 5FZQA 3FTWA 5T4YA 3CVPA 2P9IG 3TWSA 5BXUA 1V55E 2R02A 2WVIA 3U3WA 4BT9A 3EU9A 3EU5A 2A4ZA 3KSLA 5EYLA 3MGBA 4GMLA 5CBNA 3CVQA 2WXLA 2X6JA 4LEUA 4NRHB 5FJYA 3ZGQA 3ESKA 4DI3A 1JWFA 4OAVB 1Q2ZA 3C3OA 4UWKA 4WNEA 1BI7B 2V8SE 1MYOA 3C5RA 5BNWA 4QFVA 2KM4A 3I5PA 4Q94A 4K5BA 5CEDB 2XGMA 3D9MA 1WM5A 3ULYA 4FLHA 2WXKA 2XCCA 2HM8A 3KEZA 4UWHA 4G8LA 2XGOA 4RLYA 1JWGA 2WMOA 2FO7A 3MEKA 4BESA 3UPVA 3UT8A 4UWGA 4WWOA 1JCQA 1QQEA 4ILHB 5HQ8A 3WG7E 3NAWA 1OWOA 1KT0A 1E7VA 3RSEG 2M63A 3EDTB 3Q9UC 2IOSA 3MX3A 4JEUA 3DEOA 1U3DA 2UY1B 2LXLA 5FQ7A 3LJ3A 3ISMC 4LNUD 3SNXA 2C0MA 5KNGA 4M7CA 4IRUA 3PZ1A 4J8EA 2V4HC 4RG9A 3CHSA 2NC9A 4I1AA 2VJ8A 1K3ZD 5E75A 1A17A 1WDYA 3EHQA 4LNBA 3IBEA 4G11A 2Y3AA 3C98A 4Q96A 4C0EA 1NA3A 2ETAA 3KEAA 2Y0BG 1O1TA 3OXFA 2J09A 3OXGA 1WY6A 5KJLA 3O48A 3HYMB 1N11A 2ZXWE 2NXPA 2XEVA 1ZBPA 2E2EA 4UQYA 4AJWA 2NYJA 1TJFA 3AU4A 4PH4B 5JJ7A 2DCPA 3ONKA 4WNGA 4CGWA 4U95D 1N4PA 3HXDA 1QBQA 3C3QA 3ZYLA 5ANRA 3UKUG 4JHKA 3RIBA 3FTZA 4BSZB 4A3TA 5FTPA 5CECB 3FFLA 2J9QA 3U9WA 3Q7FA 3CK9A 4MBGA 1H2UA 1WAO1 4RVBA 1OWMA 3T8KA 4H7YA 2J8SD 5C2YA 3IXEA 2IY0C 1OWLA 3APCA 4GZCA 1TYQG 3ZN3A 2WXOA 4FA6A 4XKCA 5KBAA 3UKRG 1DCEA 3WXXA 1MX6A 4UQXA 4N39A 4EZJA 2VTBA 4HI9A 3AS4A 3J5QB 2OV8A 2V5FA 1BU9A 1H2VC 3SY2A 5ANLA 3D9JA 3QKYA 2WXGA 3RK6A 3CHMA 1HG5A 1W3BA 4EQFA 3E32A 4DPRA 4GU5A 4MS6A 2DVWA 4YDWA 1OCRE 4J6IA
chains in the Genus database with same CATH topology
2I6HA 3SHFA 2XHEA 5D0QD 4F53A 5AENA 4OVVA 4GB9A 3BG0B 4L23A 2PZIA 3QK0A 3ZRHA 4JXTA 4AXHA 4TUUA 4AY5A 2WQ7A 3L17A 2XPIA 3CQCB 4R7LA 2P58C 2BTDA 3UMVA 3U4TA 2VGYA 4JZYA 5KJMA 5LCWC 2DBAA 4ANVA 1PY1A 2KCKA 2KZTA 4U0ZA 1UW4B 3IEGA 4Y6WA 5G05C 3UT4A 2WXNA 2VSNA 2V4LA 2MRIA 4I2ZA 4KMOA 4N3CA 4YVOA 4ANWA 3NF1A 4C0MA 4OYSA 3PNTB 5KJKA 1IQRA 2KATA 4M3OA 4U04A 1HXIA 3SFZA 3FWVA 4AM9A 2X6FA 3PE3A 3FUFA 2J07A 3PUKA 2RD0A 4LRZA 3ZIMA 4XE0A 4BX9A 1TEZA 3SF4A 3CHOA 3HIZA 1U3CA 3RRUA 2FI7A 4G23A 1HO8A 5DBKA 4B94A 3URZA 4N3AA 1EYHA 2Y4UA 3CHPA 4FU3A 3IHVA 5JJTA 2VTBB 2WXJA 1QZ2A 2ILRA 2CFUA 3PDNA 4L2YA 3E4BA 3RRMB 3TG4A 3UX4A 4GZ6A 4EBAA 3HDXA 3KS2A 3FH7A 2CHXA 4H7XA 1UG3A 1Z3XA 1FVFA 2GGFA 2VSYA 1HS6A 2YHEA 1H2TC 3NZSA 3KD7A 4WAFA 4ABNA 4EBAG 4FHJA 4HOTA 1ELWA 2J49A 4E6HA 1PAQA 2CG2A 2GRMA 3EIJA 4JPSA 2WXIA 3L08A 1FCHA 4U8HA 3QARA 5LX8A 4RG6A 1PC2A 1TJCA 4HFGA 5ARFA 3BEEA 3JUIA 4G2VA 2WXRA 2AW6A 2LSVA 3AU5A 3FU0A 4WWNA 5DIZA 4ACLA 4GA1A 3EHMA 1E8YA 5ARGA 2WMNA 3MA5A 2CG3A 1IYGA 3L13A 2X3MA 4GYYA 3JYSA 5T3RA 3TG5A 5A7DB 4HVBA 3OXLA 1E8ZA 4U07A 5BUZA 5D0OD 1B89A 3FUHA 1KT1A 2J4DA 2PM6A 3S7BA 1UJKA 3FTSA 3LDZA 4GCOA 5FT9A 3FTXA 4FADA 4ILIA 4CDMA 4C9BB 4GZDA 5KCMA 2I1KA 3D9KA 3HVEB 3SGHA 1P5QA 3L54A 4HOQA 2LAHA 2XRZA 4V3IA 3CLJA 2X38A 1Z3YA 1S0PA 3QDNA 3FH5A 1Z6TA 5BV1A 4NURA 4GCNA 4UI9K 3RU0A 4WNFA 4UI9J 2L6JA 2I2OA 4I43A 3T5VA 1HU3A 3DPDA 3PEUB 1QNFA 5FZSA 1H6KA 5G55A 2KZTB 4CCAA 4FP7A 3LEWA 3GW4A 4JHJA 4U63A 4RSYA 3CQGB 1NZNA 5FQ6A 2R59A 2EQXA 2IFUA 3Q4AB 5A6CA 4N2QA 2YQ8A 2WXFA 4ATGA 3ONLA 2WPVA 2IONA 3L22A 2GW1A 2ONDA 5AJDA 4EZLA 3CVLA 4IYPA 2PL2A 4GPKA 4WWPA 3AS8A 3PE4A 4N3BA 4UI9C 3SBSA 3IHYA 1MQSA 3I4RB 2OOEA 1JUQA 2FBNA 3FH8A 4AVXA 3TAXA 5CCLA 3FTVA 3U66A 4YNDA 1UN8A 2AWIA 2ZU6B 4I6GA 4URKA 1VDYA 3R7RA 2WQHA 4LUNU 2X6HA 3AS5A 2IOLA 2L0IA 3NQPA 5JJ6A 4FULA 3QOUA 4G25A 3S7JA 5FZQA 3FTWA 4J8DA 5T4YA 3CSTA 4NQ0A 4UWFA 3QB2A 3JQ1A 3CVPA 4PS3A 2YHCA 3HVEA 3QWVA 3PS6A 4KVOA 4I1OB 2VSOE 3QNKA 4JA7A 2XQ0A 3PREA 2WVIA 3ZYKA 3CHQA 4I9CA 3U3WA 4WUYA 4E85A 3SI5A 4KVMA 5CHEE 4J0UA 4BT9A 4JW1A 3T5XA 5CMWA 2KCVA 2R17C 2C0LA 4BSXA 2A4ZA 4XZ4A 3FP3A 4KYOB 4IULA 3ZYMA 4W9RA 4F3VA 4AEZC 1E8XA 3SBTB 3LXUX 2UY1A 4UQZA 4HS2A 5AJLA 3SZ7A 4NACA 3MGBA 4GMLA 5JHBA 3D9PA 2WXHA 3CVQA 3CVNA 1UN9A 3D9IA 2WXLA 4DJAA 3Q5MA 4J8SA 2X6JA 2AXVA 3CK7A 4LEUA 4XIFA 3EJNA 2KCLA 3R9AB 4NRHB 1N54A 3PH0C 5FJYA 3ZGQA 3ENEA 5BW8C 4AIFA 2WXQA 5EDSA 3IV0A 3FUEA 3ESKA 2XPYA 3IKOB 4DI3A 3LVRE 3VLFA 1JWFA 4HOUA 2LNIA 3FEYA 3S2AA 4UWKA 4WNEA 2CHZA 3QWWA 2WB2A 2V8SE 5A23A 4KBQA 5BNWA 4QFVA 2KM4A 3FTUA 3I5PA 4Q94A 4BY6A 2XGMA 2YNQA 3LYAA 2MOWA 3D9MA 1WM5A 3TL5A 2Y4TA 4FLHA 2WXKA 1HFAA 2RG8A 3PEVB 2XCCA 3B7UX 4PDXA 4A1SA 1DVPA 2KC7A 2HM8A 2L0TB 1ZU2A 1XNFA 3KEZA 3MJWA 4YVQC 4UWHA 2X6IA 2XGOA 3B13A 3LY9A 3FUKA 3LY8A 4GZ3A 3CVWA 2C2LA 4MRUA 4AV7A 1JWGA 4DLOA 4HLEA 2WMOA 3VLDA 2J4BA 2FO7A 5J08A 3MEKA 1IQUA 3FUNA 3PUJA 4FC8A 2DIWA 3UPVA 2FULA 2GRLA 4J6IA 3TXNA 3UT8A 3CR3A 3ULQA 1Y8MA 2VGXB 4UWGA 4WWOA 3EIQC 3T8MA 2A5UA 3VTYA 1QQEA 4ILHB 4EZKA 5HQ8A 3D9LA 4P29A 4A55A 1OWOA 4BTBA 3UUXA 4PUCA 4GAAA 1KT0A 1E7VA 3ML8A 3OAWA 3N71A 3CGHA 3CIAA 2M63A 4L7TA 3B7SA 3EDTB 3JCKC 1H19A 2WM9A 1OUVA 4HXIA 3CVVA 2VQ2A 3I3NA 3G2UA 3MZLB 3B7RL 2L9BA 3ASDA 1YA0A 4KT6B 2IOSA 4CT4A 4G24A 3GZSA 3GYZA 4I2WA 3FHEA 1EF1C 3MX3A 2PQRA 2XCBA 3OTNA 4JEUA 4DK5A 3NZUA 3TGOA 3ZYQA 5CCMA 1U3DA 2UY1B 3GZ2A 5FQ7A 4JA9A 4DI4A 1SZ9A 3LJ3A 3ZW3A 4G1TA 4L1BA 2WXPA 3MYVA 5FQ4A 3SNXA 3VLEA 5C1DA 1BPOA 1XGWA 2C0MA 2IQCA 3LVQE 4APFA 5G04J 5BT1A 1N52A 2FEZA 3CSFA 4D10C 3QJZA 3FDHA 4PS7A 4EECA 3CHRA 3FU6A 4JL0A 3U64A 3ZHEB 2BF0X 4XKBA 4IRUA 4PS8A 2AXZA 4I1MA 4J8EA 4BTAA 5KJNA 2VGXA 4GA2A 4B8AA 3Q49B 3G2WA 4RG9A 3CHSA 3B7TA 3R7QA 1GW6A 4CT0A 3APFA 3ASGA 5EKQD 3UT7A 3D9OA 2PQNA 3Q47B 1KLXA 1SQMA 4K0RA 4TRQA 1HZ4A 3FU5A 5G04C 2NC9A 3PRZA 4I1AA 3LY7A 4O6FA 1SZAA 3ZPJA 2VJ8A 3ML9A 4GA0A 5CMYA 5E75A 4AOFA 1A17A 4U0SA 3I4GA 2IF4A 3Q15A 3FUJA 2Q7FA 2IJGX 1HH8A 3IBEA 5AIJA 3L6AA 4G11A 2Y3AA 1OWNA 3C98A 4Q96A 3ZEFA 4C0EA 3PNLB 4IN3B 4EPZA 4GYOA 4JEHA 1NA3A 4ACKA 2XPZA 2WXMA 4CDNA 2AVPA 1IHGA 2AXUA 2IU1A 4AY6A 1HX8A 5AYWD 4HOSA 4ANXA 3OXFA 3EHNA 4J8FA 1OWPA 2VYIA 2J09A 3FEXA 1LF8A 3OXGA 3ZVVA 3CK8A 3LKUA 4FJZA 4LCTA 1WY6A 3UQ3A 5KJLA 3O48A 2JEKA 2HO1A 2MHKA 4JHRA 1MHQA 3HYMB 1ELKA 2XEVA 2BUGA 2NXPA 1ELRA 1ZBPA 2QY7A 2E2EA 4UQYA 4XX5A 3MCXA 3P2BA 3ZHEA 4AJWA 4HORA 4UWLA 1TJFA 5ENNA 3AU4A 3QWPA 5LOZA 4N5CA 3RJVA 3CVYA 4PH4B 5JJ7A 2OVFA 4XI9A 3FUIA 4BFRA 2DCPA 3K9IA 3CKCA 4L2LA 3ZFWA 3APDA 3ONKA 4OVUA 4FLBA 4WNGA 3CV0A 4CGWA 5G2NA 2HYZA 2NSZA 3SD5A 3FY4A 4FJYA 2LO6A 2E0IA 4KZ0A 1HG2A 5M72A 1H0AA 3ZYLA 3HHMA 1FVHA 5ANRA 2PM7A 4I6JA 3RRNB 5LFAA 3LPZA 2V0PA 4GYWA 4JVSA 3CKBA 3CVUA 2LSUA 4JHKA 4B0ZA 3RIBA 3FTZA 4K03A 3FUDA 4G26A 1X5BA 4LERA 4BT8A 4A3TA 5BV0A 5FTPA 4MKTA 2VSXE 3ZXSA 3QAQA 1DNPA 4I9EA 3FFLA 2J9QA 3FUMA 3U9WA 3PZDA 4ANUA 2YINA 3DBSA 3L16A 2JLBA 4ME2A 2I1JA 4KXKB 3CK9A 3KAEA 1E8WA 4KZCA 2XGSA 3LS8A 3P1UA 1H2UA 2I9CA 2FF4A 1WAO1 3MKQB 4RVBA 4GMJA 4CDRA 1OWMA 3ASHA 2HR2A 3G2VA 4DLQA 4H7YA 5T8IA 1INZA 3TXMA 5C2YA 4TV3A 1UJJA 3D9NA 1EPUA 4BX8A 1OWLA 3APCA 5EX3A 4GZCA 3ZN3A 2WXOA 3TJPA 1HE8A 3ASFA 4FA6A 4A1GA 4XKCA 2WQ6A 4XI0A 3PVLA 4BWRA 3D3MA 3RO2A 4A3VA 4AP2A 4B89A 1JPLA 5FWQA 4CRWA 1NA0A 2CFZA 3S7DA 1E96B 1EDUA 1L5JA 1Y6IA 1NP7A 3WXXA 5G05J 2UWJG 3JQ0A 4UQXA 4I17A 4N39A 4Y6CA 4EZJA 4CGVA 5HI7A 2VTBA 3MV3B 3S7FA 4CEMA 3AS4A 3FTYA 3ESLA 4I6EA 2OV8A 5LCWJ 4APOA 2V5FA 4ILGA 1E90A 3G2SA 3FULA 1H2VC 5J90A 5ANLA 3D9JA 2J08A 3QKYA 5FZRA 4Q69A 3CVXA 3RO3A 4GZ5A 2X6KA 2LAIA 2WXGA 3RK6A 2R5SA 5E76A 3CHMA 1HG5A 5EX0A 2CHWA 3VTXA 3QC1A 1W3BA 1E7UA 3MV2B 4F7AA 4EQFA 4WNDA 5BPPA 5LP0A 3CEQA 3MKQA 4DPRA 3GZ1A 4U0UA 2XRYA 1HF8A 4GU5A 4JC8A 2OVBA 4FHKA 4MS6A 4B8CB 4F1SA 3RKVA 5JHAA 4N2SA 3FU3A 3LCAA 3MKRA 2QFCA 5FQ8A 4MLPA 3G2TA 3O4ZA 3BG1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EPZ A; 
#chains in the Genus database with same CATH topology
 4F53 A;  2XHE A;  5AEN A;  4F1P A;  4GTP A;  4L23 A;  5HKP A;  4HRL A;  3QK0 A;  3ZRH A;  4HNA D;  3SO8 A;  5H7P A;  4AXH A;  4AY5 A;  3L17 A;  3CQC B;  2P58 C;  2P9L G;  3DSU A;  4ZFH A;  4JZY A;  5G05 C;  1UW4 B;  3UT4 A;  1MX4 A;  2MRI A;  4C0M A;  1O1R A;  2ZGD A;  1IQR A;  4U04 A;  3FWV A;  4Z68 A;  3PUK A;  2J07 A;  4LRZ A;  1TEZ A;  1U3C A;  3BU8 A;  4G23 A;  5DBK A;  4N3A A;  4U96 D;  3Q78 A;  4GZ6 A;  2CHX A;  1UG3 A;  3T9K A;  1H2T C;  2J49 A;  4LNG A;  3L08 A;  4U8H A;  1FCH A;  5LX8 A;  4HRM B;  1TJC A;  4HFG A;  5ARF A;  3ASN E;  4G2V A;  2LSV A;  3FU0 A;  5ARG A;  4GTT A;  2X3M A;  3TWQ A;  3OXL A;  4GTO A;  4U07 A;  1KT1 A;  2DZN A;  3FTS A;  5FT9 A;  3FTX A;  4C9B B;  3SFX A;  2EIN E;  3D9K A;  3HXE A;  3SGH A;  3L54 A;  4HOQ A;  2LAH A;  4CYM D;  1Z3Y A;  3RU0 A;  4I43 A;  3T5V A;  3PEU B;  1H6K A;  1SA5 A;  5G55 A;  3TWU A;  3GW4 A;  1OXJ A;  5FIN A;  5A6C A;  3HRA A;  2DZO A;  3ONL A;  2WPV A;  3C72 A;  5AJD A;  5AQ7 A;  1SW6 A;  3SBS A;  1MQS A;  3I4R B;  1NI1 A;  3U66 A;  3DSV A;  4URK A;  4GTR A;  4HBD A;  3X2Q E;  3CST A;  4NQ0 A;  3JQ1 A;  2YHC A;  3QWV A;  4KVO A;  2V5Q C;  1JCS A;  5HRY A;  4I9C A;  4QQI A;  5CHE E;  2KCV A;  2C0L A;  4BSX A;  4XZ4 A;  3FP3 A;  4TXR A;  4AEZ C;  1E8X A;  5AJL A;  4HS2 A;  3SZ7 A;  4NAC A;  5JHB A;  1NFI E;  3Q79 A;  3CVN A;  3D9I A;  2VGE A;  4J8S A;  1MJ0 A;  2KCL A;  3R9A B;  5ENR D;  3PH0 C;  1D8D A;  3VLF A;  3S2A A;  3QWW A;  2WB2 A;  4KBQ A;  3FTU A;  3LYA A;  3TL5 A;  1N0R A;  3ABM E;  3B7U X;  4N5Q A;  2L0T B;  1ZU2 A;  4L9P A;  2X6I A;  1TNU A;  3CVW A;  4MRU A;  3EHR A;  5CBO A;  4FC8 A;  3TXN A;  1Y8M A;  4K5C A;  2VGX B;  3T8M A;  3VTY A;  3D9L A;  2XEH A;  4GAA A;  3OAW A;  3N71 A;  3CGH A;  3EUV A;  3TWX A;  1H19 A;  2WM9 A;  1YCS B;  3MZL B;  4KT6 B;  3GZS A;  1EF1 C;  3ABK E;  3NZU A;  3TGO A;  4JA9 A;  3SFY A;  4DI4 A;  4G1T A;  3MYV A;  1LD7 A;  5C1D A;  3LVQ E;  2R2L A;  3CHR A;  3ZHE B;  4XKB A;  2AXZ A;  4I1M A;  4BTA A;  2VGX A;  4B93 B;  3R7Q A;  2B6C A;  3TWV A;  1SQM A;  5G04 C;  3FU5 A;  5CMY A;  4U0S A;  5ENO D;  5AIJ A;  3TWW A;  1OWN A;  2AVP A;  1IHG A;  2AXU A;  4O1P A;  4AY6 A;  1HX8 A;  5AYW D;  4HOS A;  3TWR A;  3KSQ A;  1LF8 A;  4DRX E;  4JHR A;  5EN5 D;  1ELK A;  2QY7 A;  5ENS D;  4XX5 A;  3ZHE A;  4HOR A;  4UWL A;  3RJV A;  2IO3 C;  2HE0 A;  3ZFW A;  1SVX A;  1K1A A;  4FLB A;  3ZXP A;  2NSZ A;  2E0I A;  2PM7 A;  3AAA C;  3CKB A;  4G8K A;  4K03 A;  4G26 A;  4BT8 A;  4MKT A;  2VSX E;  3QAQ A;  4I9E A;  4GMR A;  4ANU A;  2YIN A;  3L16 A;  4KZC A;  3MKQ B;  4GMJ A;  2HR2 A;  3G2V A;  2OCC E;  2RFA A;  5ENQ D;  5EX3 A;  1OCO E;  3TJP A;  2WQ6 A;  1DC2 A;  3D3M A;  3RO2 A;  1TNB A;  4B89 A;  1NA0 A;  1NP7 A;  4DX7 D;  4I17 A;  4CGV A;  4NIK A;  3ESL A;  4I6E A;  5D2M C;  4APO A;  4ILG A;  5B3S E;  1E90 A;  3CVX A;  3Q73 A;  5E76 A;  5EX0 A;  2A5E A;  4WND A;  5BPP A;  5BXO A;  3CEQ A;  3MKQ A;  5LP0 A;  3GZ1 A;  4U0U A;  4JC8 A;  3RKV A;  4CZ2 D;  4J7W A;  3LCA A;  3ZNG A;  5G05 J;  3O4Z A;  4OVV A;  4HRN A;  3BG0 B;  3F6Q A;  4JXT A;  4TUU A;  1LTX A;  3UMV A;  2H6I A;  5LCW C;  2QZA A;  4U0Z A;  2KZT A;  3IEG A;  2WXN A;  4N3C A;  2V4L A;  4KMO A;  4YVO A;  4YDY A;  3NF1 A;  2KAT A;  2LUH A;  2F0Y A;  1HXI A;  2X6F A;  3PE3 A;  3FUF A;  3ZU7 B;  4XE0 A;  3CHO A;  3HIZ A;  4B94 A;  2FI7 A;  3L9T A;  3URZ A;  1EYH A;  3CHP A;  4FU3 A;  2VTB B;  2WXJ A;  3UX4 A;  3W9F A;  4EBA A;  3S7D A;  2VSY A;  3NZS A;  4WAF A;  4EBA G;  4FHJ A;  1K8K G;  4HOT A;  4JPS A;  4C48 B;  1N4Q A;  4RG6 A;  4X8Q A;  3DSS A;  2AW6 A;  3V2X A;  2WMN A;  2CG3 A;  3ZUV B;  3JYS A;  4HVB A;  1E8Z A;  5BUZ A;  3S7B A;  4GCO A;  3UTM A;  4CDM A;  3DXM G;  4U7E B;  1FPP A;  4V3I A;  3CLJ A;  2X38 A;  3QDN A;  5BV1 A;  4NUR A;  3TWT A;  3E30 A;  4JD2 G;  1HU3 A;  3DPD A;  2XEE A;  1QNF A;  4CCA A;  3NB2 A;  4U63 A;  4RSY A;  1NZN A;  2EQX A;  2IFU A;  2YQ8 A;  3E34 A;  1BI8 B;  3L22 A;  2OND A;  1RZ4 A;  4IYP A;  4WWP A;  3IHY A;  5EYP F;  3PZ4 A;  2GRQ B;  4AVX A;  3TAX A;  5CCL A;  4YND A;  2QC9 A;  1UN8 A;  1VDY A;  2WQH A;  2X6H A;  3NQP A;  4FUL A;  2DYR E;  4HLL A;  2IO2 C;  1SA4 A;  3QB2 A;  3PS6 A;  4I1O B;  2VSO E;  4JA7 A;  2XQ0 A;  3ZYK A;  3CHQ A;  4KVM A;  4J0U A;  4JW1 A;  3T5X A;  5CMW A;  4BET A;  4TXP A;  3D9P A;  3Q75 A;  2WXH A;  4TXQ A;  3Q5M A;  2AXV A;  3CK7 A;  4XIF A;  2Y69 E;  4LSZ E;  3ENE A;  4AIF A;  2WXQ A;  1UOH A;  5KWD A;  3IV0 A;  3FUE A;  2ETB A;  2XPY A;  2ZIS A;  2XS8 A;  2CHZ A;  2QYJ A;  4BY6 A;  2YNQ A;  2Y4T A;  1HFA A;  3PEV B;  4PDX A;  1DVP A;  4HB5 A;  2KC7 A;  1XNF A;  3MJW A;  1LD8 A;  3LY9 A;  3FUK A;  3LY8 A;  1IQU A;  3PUJ A;  1S63 A;  2DIW A;  4EZK A;  4P29 A;  5ENT D;  3NOC D;  3B7B A;  4BTB A;  4PUC A;  3ML8 A;  3CIA A;  4L7T A;  3LJN A;  4DUI A;  3B7S A;  1OUV A;  4HXI A;  4DX1 A;  3UI2 A;  3CVV A;  2P9N G;  3I3N A;  3B7R L;  4CT4 A;  4G24 A;  3GYZ A;  2PQR A;  3AJI A;  3OTN A;  1TNO A;  4DK5 A;  4XEI G;  3ZYQ A;  5CCM A;  3DXK G;  2ZGG A;  1SZ9 A;  3ZW3 A;  5FQ4 A;  1Z5S C;  2DWZ A;  1U2V G;  5G04 J;  5BT1 A;  1QYM A;  1N52 A;  4D10 C;  4EEC A;  3QJZ A;  1RW2 A;  1YMP A;  2BF0 X;  5CRU A;  4GA2 A;  3G2W A;  5KNH D;  4CT0 A;  3ASG A;  3AG1 E;  3UT7 A;  3D9O A;  1KLX A;  4ATZ D;  3PRZ A;  4O6F A;  3LY7 A;  1SZA A;  3ML9 A;  4GA0 A;  4AOF A;  3HXF A;  4UUC A;  2R03 A;  3UM3 A;  2IF4 A;  1IKN D;  2Q7F A;  1HH8 A;  3PNL B;  4GYO A;  4JEH A;  4CDN A;  2H6G A;  2IU1 A;  3EHN A;  4J8F A;  1OWP A;  3LKU A;  3UQ3 A;  2JEK A;  1MHQ A;  3V30 A;  1ELR A;  5CRV A;  1N4R A;  5ENN A;  2AJA A;  2R05 A;  5LOZ A;  2OVF A;  3JXJ A;  4XI9 A;  3APD A;  4OVU A;  5G2N A;  3SD5 A;  2LO6 A;  4KZ0 A;  1HG2 A;  3HXB A;  1H0A A;  1FVH A;  4I6J A;  3RRN B;  2P9K G;  4GYW A;  4JVS A;  3CVU A;  4B0Z A;  4JB8 P;  4LER A;  1G3N B;  3FUM A;  3JXI A;  3PZD A;  2P9U G;  4DX2 A;  2GRR B;  4DX5 D;  2I1J A;  1E8W A;  2XGS A;  3LS8 A;  4O60 A;  4CDR A;  2FF4 A;  3ULE G;  3V31 A;  3DRA A;  1N0Q A;  3TXM A;  3D9N A;  1EPU A;  4EHM A;  1HE8 A;  3ASF A;  4A1G A;  4XI0 A;  1A5E A;  3PVL A;  1IHB A;  4AP2 A;  2GRO B;  4CRW A;  2CFZ A;  3V79 K;  1EDU A;  1L5J A;  1Y6I A;  2EIL E;  2UWJ G;  3JQ0 A;  4Y6C A;  5HI7 A;  3S7F A;  4CEM A;  3FUL A;  5EIL A;  5J90 A;  5FZR A;  4Q69 A;  1H6O A;  3B95 A;  3RO3 A;  4GZ5 A;  5AAO A;  4F7A A;  4LG6 A;  2OEW A;  2BED A;  2DYS E;  4FHK A;  4B8C B;  1MX2 A;  5JHA A;  1NL4 A;  2QFC A;  4YDO A;  4MLP A;  5LCW J;  2F8X K;  3SHF A;  5D0Q D;  4GB9 A;  3JUE A;  2XPI A;  4R7L A;  2MYO A;  1BLX B;  2VGY A;  2DBA A;  4GTM A;  2KCK A;  2VSN A;  3NOG D;  2P9P G;  2EIJ E;  4ANW A;  3DEP A;  4M3O A;  3BUA A;  1DCQ A;  2RD0 A;  3Q7A A;  1TR4 A;  1HO8 A;  1OY3 D;  4BER A;  3HG0 D;  5JJT A;  1QZ2 A;  3PDN A;  3TG4 A;  3E4B A;  3RRM B;  3HDX A;  3FH7 A;  1FVF A;  5JMN D;  1HS6 A;  3KD7 A;  3DSX A;  4E6H A;  2GRM A;  5B1A E;  2WXI A;  1PC2 A;  3BEE A;  3JUI A;  2ZIR A;  5DIZ A;  4ACL A;  2P2C P;  3EHM A;  3MA5 A;  3L13 A;  4GYY A;  1KZO A;  3TG5 A;  5D0O D;  1B89 A;  3FUH A;  2XS1 A;  1UJK A;  4FAD A;  4ILI A;  4RQI A;  5KCM A;  3HVE B;  3Q9N C;  1P5Q A;  2XRZ A;  1TN7 A;  1S0P A;  3FH5 A;  4GCN A;  4UI9 K;  1AP7 A;  2KZT B;  4FP7 A;  3LEW A;  4JHJ A;  4U8Y D;  3CQG B;  3Q4A B;  4N2Q A;  4ATG A;  2ION A;  4EZL A;  3CVL A;  1WG0 A;  2PL2 A;  4GPK A;  4N3B A;  3PZ2 A;  4UI9 C;  2BKG A;  2OOE A;  1JUQ A;  1TNY A;  2LXM A;  4I6G A;  3R7R A;  4LUN U;  2H6F A;  5JJ6 A;  3S7J A;  4J8D A;  4UWF A;  4PS3 A;  3HVE A;  3QNK A;  3PRE A;  3UIN C;  4WUY A;  4E85 A;  3SI5 A;  5ITZ F;  2JAB A;  2R17 C;  4KYO B;  4IUL A;  3ZYM A;  4W9R A;  4F3V A;  3SBT B;  3LXU X;  3L82 A;  1K1B A;  2UY1 A;  3ASO E;  4UQZ A;  5B1B E;  2EIK E;  3AG4 E;  3V2O A;  1UN9 A;  4DJA A;  3UM2 A;  3EJN A;  5AQB A;  1N54 A;  5BW8 C;  5EDS A;  3IKO B;  3LVR E;  4HOU A;  2LNI A;  3FEY A;  1KPS B;  1O5M A;  5A23 A;  4DX6 D;  4OAU C;  2MOW A;  2RG8 A;  4A1S A;  2XZT G;  5CEA A;  4YVQ C;  3B13 A;  4GZ3 A;  2C2L A;  4DLO A;  4AV7 A;  4HLE A;  4GTV A;  3VLD A;  2J4B A;  5J08 A;  3FUN A;  5FIO A;  4GTQ A;  2FUL A;  2GRL A;  3CR3 A;  3ULQ A;  3PZ3 A;  3EIQ C;  2A5U A;  2L6B A;  2IEJ A;  4A55 A;  1O1S A;  3UM0 A;  1N95 A;  3UUX A;  3NBN B;  5EID A;  4J8Y A;  5AQ9 A;  3JCK C;  2VQ2 A;  3G2U A;  2L9B A;  3ASD A;  1YA0 A;  4I2W A;  3FHE A;  1S70 B;  2XCB A;  1N94 A;  3ZKJ A;  3GZ2 A;  1H6P A;  4L1B A;  3DSW A;  2WXP A;  2XEN A;  2F8Y A;  1TNZ A;  1BPO A;  1XGW A;  2IQC A;  4APF A;  2FEZ A;  3CSF A;  3FDH A;  4PS7 A;  3FU6 A;  4JL0 A;  3RAU A;  3U64 A;  4PS8 A;  1N9A A;  5KJN A;  3D9H A;  4B8A A;  3Q49 B;  1D9S A;  3B7T A;  1GW6 A;  3APF A;  5EKQ D;  2PQN A;  3Q47 B;  4K0R A;  4TRQ A;  1HZ4 A;  3ZPJ A;  3I4G A;  3ABL E;  3Q15 A;  3FUJ A;  5AQA A;  1FT1 A;  2IJG X;  3L6A A;  1S64 A;  3ZEF A;  4IN3 B;  4EPZ A;  2H6H A;  4ACK A;  2XPZ A;  2QYU A;  2WXM A;  4F6R D;  4ANX A;  3E37 A;  2VYI A;  3ZVV A;  3FEX A;  3CK8 A;  4FJZ A;  4LCT A;  2HO1 A;  2MHK A;  2GRP B;  2BUG A;  4YDE A;  3MCX A;  3P2B A;  3QWP A;  4N5C A;  3CVY A;  4K5A B;  2GRN B;  3FUI A;  4BFR A;  1D8E A;  3K9I A;  3CKC A;  4L2L A;  4A63 B;  3CV0 A;  2HYZ A;  3FY4 A;  4FJY A;  4GTS A;  5M72 A;  5JA4 D;  3HHM A;  5LFA A;  3LPZ A;  2V0P A;  2LSU A;  3FUD A;  1X5B A;  5BV0 A;  3ZXS A;  1DNP A;  2PNN A;  2OEV A;  3DBS A;  2JLB A;  4ME2 A;  4KXK B;  3KAE A;  3P1U A;  2I9C A;  2XZD G;  2FO1 E;  3ASH A;  2RKK A;  4DLQ A;  1N4S A;  5T8I A;  1INZ A;  4TV3 A;  1UJJ A;  4BX8 A;  1OCC E;  2Y1L E;  1FT2 A;  4BWR A;  4A3V A;  2B0O E;  1JPL A;  5FWQ A;  4O1O A;  1E96 B;  3MV3 B;  3FTY A;  3SQV A;  1OT8 A;  3G2S A;  2J08 A;  5HS0 A;  1MZC A;  2X6K A;  2LAI A;  2P9S G;  2R5S A;  2CHW A;  3VTX A;  3QC1 A;  1E7U A;  3MV2 B;  3UM1 A;  5ENP D;  2XRY A;  1HF8 A;  2OVB A;  4F1S A;  3DPY A;  4N2S A;  3FU3 A;  3MKR A;  5FQ8 A;  3G2T A;  3VLE A;  3BG1 B;  2I6H A;  3UIP C;  3BQO A;  2KXP C;  2PZI A;  3UIO C;  2WQ7 A;  2BTD A;  5D66 A;  3U4T A;  5KJM A;  4ANV A;  1PY1 A;  2KBX A;  4Y6W A;  3DST A;  1TN8 A;  4I2Z A;  3E33 A;  1YYH A;  4OYS A;  3PNT B;  5KJK A;  3SFZ A;  4AM9 A;  1KZP A;  3J5P A;  3AG3 E;  3W9G A;  3ZIM A;  4BX9 A;  3SF4 A;  3RRU A;  2Y4U A;  3IHV A;  1TN6 A;  1V54 E;  2ILR A;  2CFU A;  4L2Y A;  4HQD A;  3DWL G;  3KS2 A;  4H7X A;  2GGF A;  1Z3X A;  4ABN A;  2YHE A;  1ELW A;  4HI8 A;  1PAQ A;  2CG2 A;  3EIJ A;  4GPM A;  3QAR A;  2F37 A;  5AAR A;  3HXC A;  1JCR A;  2WXR A;  3AU5 A;  4WWN A;  1AWC B;  4TUM A;  4GA1 A;  1E8Y A;  1IYG A;  5T3R A;  1OCZ E;  5A7D B;  2J4D A;  2PM6 A;  2RFM A;  3LDZ A;  3UXG A;  4ZHB A;  4GZD A;  2I1K A;  4BEP A;  5IY5 E;  1ZB1 A;  1Z6T A;  3R9M A;  4U8V D;  4WNF A;  4UI9 J;  2L6J A;  2I2O A;  5AN8 A;  1X81 A;  5FZS A;  2BKK B;  5FQ6 A;  2R59 A;  3AG2 E;  5CER B;  1BD8 A;  2WXF A;  2ETC A;  2GW1 A;  3AS8 A;  3PE4 A;  2FBN A;  3FH8 A;  1IXV A;  3FTV A;  2AWI A;  2ZU6 B;  5EIB E;  3AS5 A;  3C3R A;  2IOL A;  2L0I A;  2EIM E;  3QOU A;  4G25 A;  5FZQ A;  3FTW A;  5T4Y A;  3CVP A;  2P9I G;  3TWS A;  5BXU A;  1V55 E;  2R02 A;  2WVI A;  3U3W A;  4BT9 A;  3EU9 A;  3EU5 A;  2A4Z A;  3KSL A;  5EYL A;  3MGB A;  4GML A;  5CBN A;  3CVQ A;  2WXL A;  2X6J A;  4LEU A;  4NRH B;  5FJY A;  3ZGQ A;  3ESK A;  4DI3 A;  1JWF A;  4OAV B;  1Q2Z A;  3C3O A;  4UWK A;  4WNE A;  1BI7 B;  2V8S E;  1MYO A;  3C5R A;  5BNW A;  4QFV A;  2KM4 A;  3I5P A;  4Q94 A;  4K5B A;  5CED B;  2XGM A;  3D9M A;  1WM5 A;  3ULY A;  4FLH A;  2WXK A;  2XCC A;  2HM8 A;  3KEZ A;  4UWH A;  4G8L A;  2XGO A;  4RLY A;  1JWG A;  2WMO A;  2FO7 A;  3MEK A;  4BES A;  3UPV A;  3UT8 A;  4UWG A;  4WWO A;  1JCQ A;  1QQE A;  4ILH B;  5HQ8 A;  3WG7 E;  3NAW A;  1OWO A;  1KT0 A;  1E7V A;  3RSE G;  2M63 A;  3EDT B;  3Q9U C;  2IOS A;  3MX3 A;  4JEU A;  3DEO A;  1U3D A;  2UY1 B;  2LXL A;  5FQ7 A;  3LJ3 A;  3ISM C;  4LNU D;  3SNX A;  2C0M A;  5KNG A;  4M7C A;  4IRU A;  3PZ1 A;  4J8E A;  2V4H C;  4RG9 A;  3CHS A;  2NC9 A;  4I1A A;  2VJ8 A;  1K3Z D;  5E75 A;  1A17 A;  1WDY A;  3EHQ A;  4LNB A;  3IBE A;  4G11 A;  2Y3A A;  3C98 A;  4Q96 A;  4C0E A;  1NA3 A;  2ETA A;  3KEA A;  2Y0B G;  1O1T A;  3OXF A;  2J09 A;  3OXG A;  1WY6 A;  5KJL A;  3O48 A;  3HYM B;  1N11 A;  2ZXW E;  2NXP A;  2XEV A;  1ZBP A;  2E2E A;  4UQY A;  4AJW A;  2NYJ A;  1TJF A;  3AU4 A;  4PH4 B;  5JJ7 A;  2DCP A;  3ONK A;  4WNG A;  4CGW A;  4U95 D;  1N4P A;  3HXD A;  1QBQ A;  3C3Q A;  3ZYL A;  5ANR A;  3UKU G;  4JHK A;  3RIB A;  3FTZ A;  4BSZ B;  4A3T A;  5FTP A;  5CEC B;  3FFL A;  2J9Q A;  3U9W A;  3Q7F A;  3CK9 A;  4MBG A;  1H2U A;  1WAO 1;  4RVB A;  1OWM A;  3T8K A;  4H7Y A;  2J8S D;  5C2Y A;  3IXE A;  2IY0 C;  1OWL A;  3APC A;  4GZC A;  1TYQ G;  3ZN3 A;  2WXO A;  4FA6 A;  4XKC A;  5KBA A;  3UKR G;  1DCE A;  3WXX A;  1MX6 A;  4UQX A;  4N39 A;  4EZJ A;  2VTB A;  4HI9 A;  3AS4 A;  3J5Q B;  2OV8 A;  2V5F A;  1BU9 A;  1H2V C;  3SY2 A;  5ANL A;  3D9J A;  3QKY A;  2WXG A;  3RK6 A;  3CHM A;  1HG5 A;  1W3B A;  4EQF A;  3E32 A;  4DPR A;  4GU5 A;  4MS6 A;  2DVW A;  4YDW A;  1OCR E;  4J6I A; 
#chains in the Genus database with same CATH homology
 2I6H A;  3SHF A;  2XHE A;  5D0Q D;  4F53 A;  5AEN A;  4OVV A;  4GB9 A;  3BG0 B;  4L23 A;  2PZI A;  3QK0 A;  3ZRH A;  4JXT A;  4AXH A;  4TUU A;  4AY5 A;  2WQ7 A;  3L17 A;  2XPI A;  3CQC B;  4R7L A;  2P58 C;  2BTD A;  3UMV A;  3U4T A;  2VGY A;  4JZY A;  5KJM A;  5LCW C;  2DBA A;  4ANV A;  1PY1 A;  2KCK A;  2KZT A;  4U0Z A;  1UW4 B;  3IEG A;  4Y6W A;  5G05 C;  3UT4 A;  2WXN A;  2VSN A;  2V4L A;  2MRI A;  4I2Z A;  4KMO A;  4N3C A;  4YVO A;  4ANW A;  3NF1 A;  4C0M A;  4OYS A;  3PNT B;  5KJK A;  1IQR A;  2KAT A;  4M3O A;  4U04 A;  1HXI A;  3SFZ A;  3FWV A;  4AM9 A;  2X6F A;  3PE3 A;  3FUF A;  2J07 A;  3PUK A;  2RD0 A;  4LRZ A;  3ZIM A;  4XE0 A;  4BX9 A;  1TEZ A;  3SF4 A;  3CHO A;  3HIZ A;  1U3C A;  3RRU A;  2FI7 A;  4G23 A;  1HO8 A;  5DBK A;  4B94 A;  3URZ A;  4N3A A;  1EYH A;  2Y4U A;  3CHP A;  4FU3 A;  3IHV A;  5JJT A;  2VTB B;  2WXJ A;  1QZ2 A;  2ILR A;  2CFU A;  3PDN A;  4L2Y A;  3E4B A;  3RRM B;  3TG4 A;  3UX4 A;  4GZ6 A;  4EBA A;  3HDX A;  3KS2 A;  3FH7 A;  2CHX A;  4H7X A;  1UG3 A;  1Z3X A;  1FVF A;  2GGF A;  2VSY A;  1HS6 A;  2YHE A;  1H2T C;  3NZS A;  3KD7 A;  4WAF A;  4ABN A;  4EBA G;  4FHJ A;  4HOT A;  1ELW A;  2J49 A;  4E6H A;  1PAQ A;  2CG2 A;  2GRM A;  3EIJ A;  4JPS A;  2WXI A;  3L08 A;  1FCH A;  4U8H A;  3QAR A;  5LX8 A;  4RG6 A;  1PC2 A;  1TJC A;  4HFG A;  5ARF A;  3BEE A;  3JUI A;  4G2V A;  2WXR A;  2AW6 A;  2LSV A;  3AU5 A;  3FU0 A;  4WWN A;  5DIZ A;  4ACL A;  4GA1 A;  3EHM A;  1E8Y A;  5ARG A;  2WMN A;  3MA5 A;  2CG3 A;  1IYG A;  3L13 A;  2X3M A;  4GYY A;  3JYS A;  5T3R A;  3TG5 A;  5A7D B;  4HVB A;  3OXL A;  1E8Z A;  4U07 A;  5BUZ A;  5D0O D;  1B89 A;  3FUH A;  1KT1 A;  2J4D A;  2PM6 A;  3S7B A;  1UJK A;  3FTS A;  3LDZ A;  4GCO A;  5FT9 A;  3FTX A;  4FAD A;  4ILI A;  4CDM A;  4C9B B;  4GZD A;  5KCM A;  2I1K A;  3D9K A;  3HVE B;  3SGH A;  1P5Q A;  3L54 A;  4HOQ A;  2LAH A;  2XRZ A;  4V3I A;  3CLJ A;  2X38 A;  1Z3Y A;  1S0P A;  3QDN A;  3FH5 A;  1Z6T A;  5BV1 A;  4NUR A;  4GCN A;  4UI9 K;  3RU0 A;  4WNF A;  4UI9 J;  2L6J A;  2I2O A;  4I43 A;  3T5V A;  1HU3 A;  3DPD A;  3PEU B;  1QNF A;  5FZS A;  1H6K A;  5G55 A;  2KZT B;  4CCA A;  4FP7 A;  3LEW A;  3GW4 A;  4JHJ A;  4U63 A;  4RSY A;  3CQG B;  1NZN A;  5FQ6 A;  2R59 A;  2EQX A;  2IFU A;  3Q4A B;  5A6C A;  4N2Q A;  2YQ8 A;  2WXF A;  4ATG A;  3ONL A;  2WPV A;  2ION A;  3L22 A;  2GW1 A;  2OND A;  5AJD A;  4EZL A;  3CVL A;  4IYP A;  2PL2 A;  4GPK A;  4WWP A;  3AS8 A;  3PE4 A;  4N3B A;  4UI9 C;  3SBS A;  3IHY A;  1MQS A;  3I4R B;  2OOE A;  1JUQ A;  2FBN A;  3FH8 A;  4AVX A;  3TAX A;  5CCL A;  3FTV A;  3U66 A;  4YND A;  1UN8 A;  2AWI A;  2ZU6 B;  4I6G A;  4URK A;  1VDY A;  3R7R A;  2WQH A;  4LUN U;  2X6H A;  3AS5 A;  2IOL A;  2L0I A;  3NQP A;  5JJ6 A;  4FUL A;  3QOU A;  4G25 A;  3S7J A;  5FZQ A;  3FTW A;  4J8D A;  5T4Y A;  3CST A;  4NQ0 A;  4UWF A;  3QB2 A;  3JQ1 A;  3CVP A;  4PS3 A;  2YHC A;  3HVE A;  3QWV A;  3PS6 A;  4KVO A;  4I1O B;  2VSO E;  3QNK A;  4JA7 A;  2XQ0 A;  3PRE A;  2WVI A;  3ZYK A;  3CHQ A;  4I9C A;  3U3W A;  4WUY A;  4E85 A;  3SI5 A;  4KVM A;  5CHE E;  4J0U A;  4BT9 A;  4JW1 A;  3T5X A;  5CMW A;  2KCV A;  2R17 C;  2C0L A;  4BSX A;  2A4Z A;  4XZ4 A;  3FP3 A;  4KYO B;  4IUL A;  3ZYM A;  4W9R A;  4F3V A;  4AEZ C;  1E8X A;  3SBT B;  3LXU X;  2UY1 A;  4UQZ A;  4HS2 A;  5AJL A;  3SZ7 A;  4NAC A;  3MGB A;  4GML A;  5JHB A;  3D9P A;  2WXH A;  3CVQ A;  3CVN A;  1UN9 A;  3D9I A;  2WXL A;  4DJA A;  3Q5M A;  4J8S A;  2X6J A;  2AXV A;  3CK7 A;  4LEU A;  4XIF A;  3EJN A;  2KCL A;  3R9A B;  4NRH B;  1N54 A;  3PH0 C;  5FJY A;  3ZGQ A;  3ENE A;  5BW8 C;  4AIF A;  2WXQ A;  5EDS A;  3IV0 A;  3FUE A;  3ESK A;  2XPY A;  3IKO B;  4DI3 A;  3LVR E;  3VLF A;  1JWF A;  4HOU A;  2LNI A;  3FEY A;  3S2A A;  4UWK A;  4WNE A;  2CHZ A;  3QWW A;  2WB2 A;  2V8S E;  5A23 A;  4KBQ A;  5BNW A;  4QFV A;  2KM4 A;  3FTU A;  3I5P A;  4Q94 A;  4BY6 A;  2XGM A;  2YNQ A;  3LYA A;  2MOW A;  3D9M A;  1WM5 A;  3TL5 A;  2Y4T A;  4FLH A;  2WXK A;  1HFA A;  2RG8 A;  3PEV B;  2XCC A;  3B7U X;  4PDX A;  4A1S A;  1DVP A;  2KC7 A;  2HM8 A;  2L0T B;  1ZU2 A;  1XNF A;  3KEZ A;  3MJW A;  4YVQ C;  4UWH A;  2X6I A;  2XGO A;  3B13 A;  3LY9 A;  3FUK A;  3LY8 A;  4GZ3 A;  3CVW A;  2C2L A;  4MRU A;  4AV7 A;  1JWG A;  4DLO A;  4HLE A;  2WMO A;  3VLD A;  2J4B A;  2FO7 A;  5J08 A;  3MEK A;  1IQU A;  3FUN A;  3PUJ A;  4FC8 A;  2DIW A;  3UPV A;  2FUL A;  2GRL A;  4J6I A;  3TXN A;  3UT8 A;  3CR3 A;  3ULQ A;  1Y8M A;  2VGX B;  4UWG A;  4WWO A;  3EIQ C;  3T8M A;  2A5U A;  3VTY A;  1QQE A;  4ILH B;  4EZK A;  5HQ8 A;  3D9L A;  4P29 A;  4A55 A;  1OWO A;  4BTB A;  3UUX A;  4PUC A;  4GAA A;  1KT0 A;  1E7V A;  3ML8 A;  3OAW A;  3N71 A;  3CGH A;  3CIA A;  2M63 A;  4L7T A;  3B7S A;  3EDT B;  3JCK C;  1H19 A;  2WM9 A;  1OUV A;  4HXI A;  3CVV A;  2VQ2 A;  3I3N A;  3G2U A;  3MZL B;  3B7R L;  2L9B A;  3ASD A;  1YA0 A;  4KT6 B;  2IOS A;  4CT4 A;  4G24 A;  3GZS A;  3GYZ A;  4I2W A;  3FHE A;  1EF1 C;  3MX3 A;  2PQR A;  2XCB A;  3OTN A;  4JEU A;  4DK5 A;  3NZU A;  3TGO A;  3ZYQ A;  5CCM A;  1U3D A;  2UY1 B;  3GZ2 A;  5FQ7 A;  4JA9 A;  4DI4 A;  1SZ9 A;  3LJ3 A;  3ZW3 A;  4G1T A;  4L1B A;  2WXP A;  3MYV A;  5FQ4 A;  3SNX A;  3VLE A;  5C1D A;  1BPO A;  1XGW A;  2C0M A;  2IQC A;  3LVQ E;  4APF A;  5G04 J;  5BT1 A;  1N52 A;  2FEZ A;  3CSF A;  4D10 C;  3QJZ A;  3FDH A;  4PS7 A;  4EEC A;  3CHR A;  3FU6 A;  4JL0 A;  3U64 A;  3ZHE B;  2BF0 X;  4XKB A;  4IRU A;  4PS8 A;  2AXZ A;  4I1M A;  4J8E A;  4BTA A;  5KJN A;  2VGX A;  4GA2 A;  4B8A A;  3Q49 B;  3G2W A;  4RG9 A;  3CHS A;  3B7T A;  3R7Q A;  1GW6 A;  4CT0 A;  3APF A;  3ASG A;  5EKQ D;  3UT7 A;  3D9O A;  2PQN A;  3Q47 B;  1KLX A;  1SQM A;  4K0R A;  4TRQ A;  1HZ4 A;  3FU5 A;  5G04 C;  2NC9 A;  3PRZ A;  4I1A A;  3LY7 A;  4O6F A;  1SZA A;  3ZPJ A;  2VJ8 A;  3ML9 A;  4GA0 A;  5CMY A;  5E75 A;  4AOF A;  1A17 A;  4U0S A;  3I4G A;  2IF4 A;  3Q15 A;  3FUJ A;  2Q7F A;  2IJG X;  1HH8 A;  3IBE A;  5AIJ A;  3L6A A;  4G11 A;  2Y3A A;  1OWN A;  3C98 A;  4Q96 A;  3ZEF A;  4C0E A;  3PNL B;  4IN3 B;  4EPZ A;  4GYO A;  4JEH A;  1NA3 A;  4ACK A;  2XPZ A;  2WXM A;  4CDN A;  2AVP A;  1IHG A;  2AXU A;  2IU1 A;  4AY6 A;  1HX8 A;  5AYW D;  4HOS A;  4ANX A;  3OXF A;  3EHN A;  4J8F A;  1OWP A;  2VYI A;  2J09 A;  3FEX A;  1LF8 A;  3OXG A;  3ZVV A;  3CK8 A;  3LKU A;  4FJZ A;  4LCT A;  1WY6 A;  3UQ3 A;  5KJL A;  3O48 A;  2JEK A;  2HO1 A;  2MHK A;  4JHR A;  1MHQ A;  3HYM B;  1ELK A;  2XEV A;  2BUG A;  2NXP A;  1ELR A;  1ZBP A;  2QY7 A;  2E2E A;  4UQY A;  4XX5 A;  3MCX A;  3P2B A;  3ZHE A;  4AJW A;  4HOR A;  4UWL A;  1TJF A;  5ENN A;  3AU4 A;  3QWP A;  5LOZ A;  4N5C A;  3RJV A;  3CVY A;  4PH4 B;  5JJ7 A;  2OVF A;  4XI9 A;  3FUI A;  4BFR A;  2DCP A;  3K9I A;  3CKC A;  4L2L A;  3ZFW A;  3APD A;  3ONK A;  4OVU A;  4FLB A;  4WNG A;  3CV0 A;  4CGW A;  5G2N A;  2HYZ A;  2NSZ A;  3SD5 A;  3FY4 A;  4FJY A;  2LO6 A;  2E0I A;  4KZ0 A;  1HG2 A;  5M72 A;  1H0A A;  3ZYL A;  3HHM A;  1FVH A;  5ANR A;  2PM7 A;  4I6J A;  3RRN B;  5LFA A;  3LPZ A;  2V0P A;  4GYW A;  4JVS A;  3CKB A;  3CVU A;  2LSU A;  4JHK A;  4B0Z A;  3RIB A;  3FTZ A;  4K03 A;  3FUD A;  4G26 A;  1X5B A;  4LER A;  4BT8 A;  4A3T A;  5BV0 A;  5FTP A;  4MKT A;  2VSX E;  3ZXS A;  3QAQ A;  1DNP A;  4I9E A;  3FFL A;  2J9Q A;  3FUM A;  3U9W A;  3PZD A;  4ANU A;  2YIN A;  3DBS A;  3L16 A;  2JLB A;  4ME2 A;  2I1J A;  4KXK B;  3CK9 A;  3KAE A;  1E8W A;  4KZC A;  2XGS A;  3LS8 A;  3P1U A;  1H2U A;  2I9C A;  2FF4 A;  1WAO 1;  3MKQ B;  4RVB A;  4GMJ A;  4CDR A;  1OWM A;  3ASH A;  2HR2 A;  3G2V A;  4DLQ A;  4H7Y A;  5T8I A;  1INZ A;  3TXM A;  5C2Y A;  4TV3 A;  1UJJ A;  3D9N A;  1EPU A;  4BX8 A;  1OWL A;  3APC A;  5EX3 A;  4GZC A;  3ZN3 A;  2WXO A;  3TJP A;  1HE8 A;  3ASF A;  4FA6 A;  4A1G A;  4XKC A;  2WQ6 A;  4XI0 A;  3PVL A;  4BWR A;  3D3M A;  3RO2 A;  4A3V A;  4AP2 A;  4B89 A;  1JPL A;  5FWQ A;  4CRW A;  1NA0 A;  2CFZ A;  3S7D A;  1E96 B;  1EDU A;  1L5J A;  1Y6I A;  1NP7 A;  3WXX A;  5G05 J;  2UWJ G;  3JQ0 A;  4UQX A;  4I17 A;  4N39 A;  4Y6C A;  4EZJ A;  4CGV A;  5HI7 A;  2VTB A;  3MV3 B;  3S7F A;  4CEM A;  3AS4 A;  3FTY A;  3ESL A;  4I6E A;  2OV8 A;  5LCW J;  4APO A;  2V5F A;  4ILG A;  1E90 A;  3G2S A;  3FUL A;  1H2V C;  5J90 A;  5ANL A;  3D9J A;  2J08 A;  3QKY A;  5FZR A;  4Q69 A;  3CVX A;  3RO3 A;  4GZ5 A;  2X6K A;  2LAI A;  2WXG A;  3RK6 A;  2R5S A;  5E76 A;  3CHM A;  1HG5 A;  5EX0 A;  2CHW A;  3VTX A;  3QC1 A;  1W3B A;  1E7U A;  3MV2 B;  4F7A A;  4EQF A;  4WND A;  5BPP A;  5LP0 A;  3CEQ A;  3MKQ A;  4DPR A;  3GZ1 A;  4U0U A;  2XRY A;  1HF8 A;  4GU5 A;  4JC8 A;  2OVB A;  4FHK A;  4MS6 A;  4B8C B;  4F1S A;  3RKV A;  5JHA A;  4N2S A;  3FU3 A;  3LCA A;  3MKR A;  2QFC A;  5FQ8 A;  4MLP A;  3G2T A;  3O4Z A;  3BG1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...