4EPZA

Crystal structure of a transcription anti-terminator antagonist upxz (bacuni_04315) from bacteroides uniformis atcc 8492 at 1.68 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
160
structure length
154
Chain Sequence
NSLLSRALELQRMAHELMYLIYSDEFCRLNKEVLTRSDSLFSEQSSDIEEEGNLCLALLMGYNATIYDNGDKERKKQVILDRIYNIMSQLPASLLKMRLLTWGYSETYDEELAHEAHQLIETWNISDLTDEQKEIIEELRNFEENQYPWEEVQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords transcription anti-terminator antagonist UpxZ
publication title Crystal structure of a transcription anti-terminator antagonist UpxZ (BACUNI_04315) from Bacteroides uniformis ATCC 8492 at 1.68 A resolution
rcsb
source organism Bacteroides uniformis atcc 8492
total genus 61
structure length 154
sequence length 160
ec nomenclature
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06603 UpxZ UpxZ family of transcription anti-terminator antagonists
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.810 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4epzA00
4EPZA
chains in the Genus database with same CATH superfamily
4U0UA 2WXIA 4EBAA 2WXHA 1IKND 3V2OA 3HXFA 3ASHA 2R02A 5FQ7A 2V8SE 2J09A 2PQRA 4N3BA 5G05J 2A5EA 3TGOA 1OY3D 2Y3AA 5CMYA 4BERA 4B93B 1UJJA 3CK7A 3FUFA 2KZTB 4XE0A 2B0OE 4GZCA 2V5FA 2MYOA 2WXPA 4HI8A 3X2QE 4ZHBA 4P29A 1OCZE 2J9QA 2AXUA 3Q5MA 4GTSA 2H6GA 1TR4A 3SBTB 2L6BA 5CECB 1UJKA 3DSVA 3JQ0A 2X6KA 2XPZA 1S63A 3Q15A 3KAEA 4BX9A 4PH4B 4GYWA 4G11A 2VTBA 1DC2A 5T8IA 2X3MA 4GZ5A 5JJ6A 4RQIA 2VGEA 4MBGA 4KT6B 4C0MA 1V55E 4AY6A 3Q9UC 3HHMA 2I1JA 4JA7A 3ULEG 4O1PA 2WXMA 5E76A 4GCNA 2BUGA 4J8DA 4ACLA 4RVBA 5CBNA 2KXPC 1MX2A 4JL0A 2FO7A 1YA0A 1QBQA 4GMRA 1N94A 3L22A 1NA3A 1HO8A 2NXPA 4JXTA 3HXCA 4G8KA 2KATA 5FQ8A 3U64A 2Y0BG 4WNEA 4EZLA 1KZPA 4GZ6A 1MQSA 1PAQA 5AYWD 3LVQE 5M72A 2AXVA 2YHCA 2IEJA 1MHQA 1HZ4A 2CG3A 3PS6A 1FVHA 4WNGA 3DEPA 2XCCA 1E8WA 3SZ7A 3CHMA 3U4TA 5JA4D 3QOUA 5ENTD 3QWVA 4EQFA 3DSTA 1SVXA 3CVLA 4ATZD 3PZ3A 5HKPA 3NOCD 3MA5A 4G24A 2WQ7A 1H6KA 4LNGA 2CHXA 4OYSA 1FT1A 2RD0A 5ENPD 1E8XA 4ANXA 3R9AB 3RSEG 3SI5A 4Z68A 1JCQA 5E75A 5EIBE 1UOHA 3D9PA 3UX4A 5LX8A 3B7UX 3RRNB 1WY6A 1ELKA 1KT0A 4JZYA 2GRMA 5G55A 3PZ2A 4MRUA 1YYHA 1RW2A 1OXJA 4CDNA 3GZ1A 3UM3A 2AXZA 4L2YA 3Q75A 3ISMC 4BSXA 3S7DA 4F3VA 4X8QA 1HXIA 4CGWA 4B94A 2H6HA 4GMJA 4FHJA 3EHNA 2X6HA 3EU5A 4Y6WA 3U3WA 5ENSD 1EF1C 3CVQA 4IRUA 4XKBA 4NRHB 1HU3A 4CDMA 3PUKA 3J5QB 3ML9A 3ULYA 3EU9A 5ARFA 3ASGA 3QB2A 2OEWA 5FWQA 3I4GA 4E85A 3UT8A 1HF8A 4BEPA 4I6JA 4KMOA 3CK8A 4DX5D 1HH8A 3LY8A 3ZYMA 2R59A 2XPYA 4RLYA 3WXXA 4F1SA 2R17C 4WWNA 4BESA 5AJLA 4UWLA 3PRZA 4HOTA 2CHZA 1FPPA 4MS6A 5G04C 3KEZA 2QYJA 1N11A 3S2AA 4G8LA 2XRZA 3ZYKA 3T5VA 3E32A 3FULA 4LNUD 4MKTA 4R7LA 4J8SA 2WMOA 4A3VA 3Q78A 3G2TA 5FT9A 1BPOA 2AWIA 2IOLA 2V4HC 3E34A 3CV0A 4AIFA 2WB2A 3MV2B 4ATGA 3KSLA 2YQ8A 5EDSA 4TXQA 2WXKA 3QDNA 4GPKA 1SA5A 2VTBB 3UI2A 2VJ8A 2BKGA 5BV0A 5BNWA 4BTAA 3HRAA 3V31A 4D10C 3ENEA 1N0QA 5CCMA 3I3NA 5G2NA 4J6IA 4RG6A 3J5PA 5CRVA 3EIJA 3D9NA 1FCHA 1MX4A 3IEGA 1HS6A 4KXKB 2LAHA 2A4ZA 4I2WA 1L5JA 5CHEE 3FH5A 4L9PA 1JCSA 1IQUA 4RG9A 3AS8A 4I6EA 3PZDA 5JMND 3FFLA 4BFRA 5LCWJ 5AN8A 5EN5D 3CQCB 4GB9A 3BG0B 4JEHA 3PEUB 3ZEFA 2IU1A 3ZU7B 1UN8A 5ENRD 4HVBA 2XS8A 4GA1A 2V5QC 1B89A 3T8KA 1A5EA 3D9LA 3UIOC 4PS3A 3L08A 3URZA 3RRUA 5CCLA 4CEMA 4WAFA 4GAAA 5KJNA 2GRRB 3IHVA 2P9KG 2ZXWE 2JABA 2HE0A 3NQPA 3D9MA 1INZA 4FHKA 1X5BA 3UT7A 2KC7A 4M3OA 3FP3A 1H19A 2V0PA 2FF4A 2OV8A 3PZ4A 3QJZA 1U2VG 3W9FA 4JC8A 4NACA 3MKRA 5EILA 2XGMA 1P5QA 3CHSA 1U3DA 4AOFA 4UWHA 5ENOD 3LEWA 4I1AA 4DLOA 3AG4E 4JW1A 4I43A 3FTUA 3VLEA 3TWXA 1NA0A 4J7WA 4UQZA 5AQ7A 3VLDA 4TXPA 2WXQA 3L82A 2KCLA 3P1UA 2WXNA 4G26A 3Q9NC 4XKCA 4BTBA 2CFZA 4U95D 3ABME 3ASDA 5CEAA 3E37A 4M7CA 4QFVA 4B8AA 3APFA 2IFUA 3CVWA 3PREA 4EZKA 4XEIG 5LFAA 4G1TA 1BI7B 1BLXB 4TRQA 1U3CA 4TXRA 4GCOA 5BPPA 3VTYA 4F6RD 3C72A 2ZISA 4H7XA 4TV3A 1N54A 2AJAA 2PNNA 3MCXA 1E96B 4C0EA 4I9EA 4UWFA 3L54A 1TNBA 3FY4A 4RSYA 3PNTB 3PNLB 4U07A 4GZDA 2DVWA 5CBOA 2QC9A 3D9KA 2P58C 1NP7A 3MYVA 3Q7AA 2ILRA 3IKOB 3UMVA 2EINE 3V79K 3UIPC 4YDOA 3QC1A 3CSTA 4Q96A 5ITZF 3FUDA 1EDUA 2VSXE 3ZHEA 2VYIA 4JEUA 3RK6A 2WXOA 2FULA 3S7FA 1A17A 4ACKA 2L9BA 4HLEA 4UI9K 2XQ0A 4KBQA 3CGHA 3SHFA 3LY9A 2XHEA 2XGSA 4GTPA 5ENQD 1N4PA 3IXEA 2RKKA 4L23A 4HRLA 2P9IG 2PM6A 3EHQA 2MHKA 4J8FA 4FU3A 4EBAG 2F8YA 2BTDA 3UINC 4GTVA 3JQ1A 3C5RA 3N71A 4V3IA 2HM8A 1NFIE 4IYPA 2WXRA 2BF0X 2DWZA 5A23A 4YDWA 3TJPA 1WM5A 2Y4TA 1N9AA 1OWMA 3C3RA 2I1KA 1S0PA 2Y1LE 4UQXA 3G2WA 5H7PA 5EX0A 4GYYA 3CVYA 1OUVA 4G25A 2OVBA 5C2YA 3LY7A 4IULA 3ASNE 1D8DA 3AG3E 3B7SA 3FUHA 1IXVA 4U7EB 3CEQA 2I9CA 3KS2A 4I6GA 3T8MA 3Q73A 2M63A 1E8ZA 5CRUA 3SFYA 3DSXA 1JWFA 3FTWA 2C0LA 2C0MA 1HG5A 3ZKJA 4XX5A 2WVIA 3FH7A 1JPLA 4E6HA 1PY1A 2WXFA 5KNHD 2HYZA 4CYMD 4F7AA 3TL5A 4KVOA 4CRWA 3JUIA 1NZNA 4HOUA 5D0QD 5HS0A 3RAUA 2IOSA 1BD8A 3MX3A 3SQVA 2P9LG 1DVPA 5DIZA 1H2UA 4O6FA 4FA6A 3AJIA 3DBSA 1OCOE 1SZ9A 3JUEA 4ANVA 1N52A 2WMNA 3SNXA 1SZAA 3APDA 3AG1E 4F1PA 3FUMA 3FTYA 3VLFA 4UI9J 3FTZA 2GRQB 3ZW3A 4KYOB 4U63A 3D9HA 3NAWA 3CR3A 3L9TA 3ZUVB 3TWVA 2MOWA 1QQEA 3AG2E 2NSZA 4J8EA 2DIWA 4AJWA 5BT1A 4ANWA 4OAVB 1GW6A 4EECA 4N3CA 4YVQC 4Q94A 1O1SA 2YNQA 3FEYA 3U66A 3FTXA 1AWCB 4G23A 4WWPA 4AP2A 1DCQA 2H6FA 2GW1A 4L2LA 1TN7A 3ZFWA 2RG8A 4BWRA 4DK5A 2X6JA 4L1BA 3R9MA 4HRMB 1SQMA 3DWLG 3SGHA 3TWWA 4FJZA 5IY5E 1Z3YA 3CHQA 3LKUA 4HRNA 3CHRA 2VSYA 2FO1E 3BG1B 3RIBA 2EQXA 5AAOA 4UQYA 5BUZA 2CFUA 4OVVA 4KZ0A 4I9CA 4XZ4A 2F0YA 5EIDA 3CK9A 1SA4A 2DYRE 2UY1A 3UXGA 4GTQA 4GTMA 2LSUA 3V2XA 3AS4A 4HORA 2QY7A 1N4QA 5BV1A 4K5CA 1EYHA 3ABKE 3DPYA 3ZPJA 1TNUA 4HS2A 4WNFA 5CERB 2H6IA 3APCA 4ILGA 4UWGA 2BEDA 1OWLA 2XEHA 3ZHEB 2P2CP 1Z3XA 3MEKA 3HIZA 5AQAA 2KCKA 5FTPA 1D8EA 2ETCA 3ONKA 3SO8A 5G05C 4U8VD 4FP7A 4U8HA 3Q79A 3ZYLA 4A3TA 4AVXA 2LXMA 1MX6A 4U0SA 3B13A 1N4SA 3FUJA 4LG6A 4LCTA 4XI9A 2NYJA 4ZFHA 2I6HA 5FINA 3BQOA 3CIAA 4GU5A 3DXMG 3UM0A 2UWJG 4LSZE 4FADA 3OXFA 2X6FA 2P9UG 3PE3A 5FZQA 4BETA 3K9IA 4YDEA 4MLPA 3FDHA 3UPVA 1TNOA 2LXLA 4KVMA 3F6QA 3D9OA 5HI7A 3LPZA 4YNDA 3LYAA 3RO2A 3PH0C 3FUEA 4K03A 2CHWA 5LOZA 2WXLA 3G2VA 2J4BA 5FJYA 3DSUA 1JUQA 4DPRA 4GPMA 2LNIA 2VSNA 1IYGA 3FEXA 3Q4AB 4CT4A 2XZDG 4JD2G 5KBAA 4WUYA 4APOA 1NL4A 4HOQA 1WDYA 3LDZA 4Q69A 3NZSA 4LNBA 1ZBPA 5BXUA 5KWDA 3FTSA 5ANRA 4HB5A 2V4LA 4DX6D 4TUUA 3AU5A 4CGVA 1E7UA 3B95A 4OVUA 1NI1A 2LUHA 2MRIA 3ABLE 2OEVA 1Q2ZA 3HXEA 1E8YA 2P9NG 4EHMA 4DUIA 4HBDA 4CZ2D 3CVVA 2RFAA 5ARGA 5HQ8A 4PS7A 3ZYQA 4GTRA 1K3ZD 4NIKA 3FU3A 3Q47B 4UWKA 3RO3A 2ETBA 4A55A 4XI0A 2QZAA 3TXNA 2GRNB 4JHKA 3SD5A 5CEDB 3EHMA 3CQGB 3JYSA 2PL2A 3FU6A 4NQ0A 5T3RA 4I1OB 5J90A 4N5CA 1LTXA 3DSWA 3NB2A 5D66A 4U04A 3OAWA 3BU8A 1IHGA 2VQ2A 2FBNA 5B1BE 1X81A 5KJLA 3CVXA 3ASOE 3OXLA 3TWQA 4JA9A 1KLXA 2EILE 3FU0A 3KEAA 2X38A 1KT1A 2KCVA 4O60A 3CVUA 5AARA 5AQBA 2ZGGA 3ZXSA 2NC9A 1K1AA 1IHBA 1FT2A 3ZXPA 3D3MA 4GTTA 3CHPA 1TJFA 4FC8A 3TWUA 1FVFA 2EIJE 5JHBA 3E30A 3R7QA 2P9PG 3AU4A 1JCRA 2B6CA 3FUNA 4ABNA 3DXKG 1Z6TA 3S7JA 3ONLA 2OVFA 4I1MA 4BT9A 3TAXA 3MKQA 3C3OA 2UY1B 3TWRA 3FUKA 5G04J 4HLLA 1N0RA 4JVSA 3NF1A 2HO1A 3BEEA 1O1RA 3QWWA 3QAQA 2J4DA 4JHRA 3SFZA 3EHRA 4I17A 2Y4UA 2QFCA 3ZN3A 4NURA 1N4RA 1H0AA 2XPIA 5AQ9A 3GW4A 1OT8A 2P9SG 2EIME 3IBEA 2XEEA 2L0TB 3VTXA 1HG2A 1D9SA 2DZNA 4HQDA 2IO2C 5J08A 2R03A 3ZGQA 4BSZB 2PQNA 1K1BA 2EIKE 3HDXA 2GRPB 4GMLA 3MZLB 3FH8A 3Q7FA 3ZIMA 3C98A 3ML8A 1JWGA 1HE8A 2WPVA 4H7YA 2GRLA 3PUJA 2FEZA 1PC2A 3B7TA 1OWPA 2LAIA 1UW4B 3RU0A 3LS8A 3L16A 2F37A 4N3AA 1QYMA 2J07A 2JLBA 3ESKA 4DX2A 3RJVA 2VSOE 4L7TA 1N95A 2BKKB 4URKA 3ZNGA 4U8YD 2R05A 3GZ2A 2OCCE 5AIJA 2VGYA 4DLQA 2AW6A 2RFMA 1H6OA 3D9JA 3CVPA 1S64A 1ZU2A 3TWSA 2J08A 5JJTA 3E4BA 1TJCA 4IN3B 3AAAC 4C48B 4AV7A 4I2ZA 5LCWC 4DI4A 3HVEA 2IJGX 3TG5A 3TWTA 2XGOA 1V54E 4AY5A 1OWOA 5KNGA 3DEOA 5B3SE 4HXIA 2J8SD 1ELWA 3I4RB 4GTOA 3T9KA 1EPUA 1Y8MA 3UQ3A 2DYSE 4HI9A 2L0IA 2ZIRA 3RRMB 5HRYA 3KSQA 5JHAA 1O5MA 3ESLA 1QNFA 1IQRA 3IHYA 5EYLA 1KZOA 5EKQD 3UM2A 1TNYA 4CT0A 3AS5A 3NBNB 1UG3A 2AVPA 1MZCA 1QZ2A 3CVNA 1HX8A 1RZ4A 3UTMA 1KPSB 3CLJA 3LVRE 3IV0A 2WQ6A 1BI8B 2X6IA 1UN9A 1WG0A 4W9RA 4K5BA 1OCRE 4WNDA 4C9BB 1WAO1 2LO6A 3MV3B 4CDRA 4B8CB 2WXJA 2JEKA 2I2OA 4A1SA 3B7BA 3JCKC 3RKVA 1E7VA 4TUMA 3C3QA 5ANLA 3QK0A 3UKRG 1XGWA 3GZSA 4YVOA 3U9WA 3DRAA 4FJYA 2XS1A 3PZ1A 5A6CA 2ONDA 3R7RA 3O4ZA 3PVLA 4UUCA 1OCCE 4JHJA 3T5XA 2DBAA 4O1OA 3MKQB 2VGXA 4FULA 1LD8A 5A7DB 5FIOA 2LSVA 3UM1A 1H2TC 2HR2A 1O1TA 4PS8A 4ME2A 2R2LA 2CG2A 2PM7A 2FI7A 4K5AB 5KJMA 2IY0C 4DRXE 3EIQC 4F53A 3DSSA 2L6JA 2OOEA 1S70B 3CKCA 5CMWA 4Y6CA 5C1DA 4XIFA 3B7RL 2GROB 2KZTA 4A1GA 3KD7A 4WWOA 3TXMA 2IF4A 3FU5A 2ZU6B 4HFGA 4JB8P 4DJAA 5LP0A 5ENNA 3MJWA 3WG7E 2XRYA 4GZ3A 2Q7FA 3LCAA 1E90A 3OTNA 5AENA 3QNKA 4AEZC 4ILHB 3W9GA 5FZRA 4A63B 5D2MC 1LF8A 5FQ6A 3S7BA 2E2EA 3BUAA 3FHEA 4J8YA 2XZTG 3V30A 1K8KG 3CSFA 3GYZA 3SF4A 1H6PA 4JPSA 1LD7A 3HYMB 1H2VC 1W3BA 3O48A 1G3NB 4U96D 3JXJA 4N2SA 3P2BA 4ILIA 4B89A 4G2VA 4DX7D 2PZIA 2WM9A 1YCSB 1Z5SC 3EUVA 5KCMA 3EDTB 4HNAD 2ETAA 4HOSA 3PEVB 5BXOA 3SY2A 3FTVA 1ELRA 2GGFA 4AM9A 3NZUA 1MYOA 4PUCA 5JJ7A 3ZVVA 2DZOA 2YHEA 5AJDA 4QQIA 2XENA 3CHOA 5B1AE 3I5PA 4LEUA 1TYQG 2IQCA 2KM4A 3JXIA 3ASFA 2YINA 2IONA 5BW8C 4B0ZA 3HVEB 1VDYA 3TG4A 1OWNA 2A5UA 1SW6A 4YDYA 3FUIA 1TNZA 2WQHA 2C2LA 3E33A 3G2SA 3G2UA 1HFAA 4LERA 3HXBA 1AP7A 4U0ZA 3PE4A 5FZSA 4DX1A 4EZJA 5DBKA 1YMPA 3LJ3A 4PDXA 1TEZA 4J0UA 5FQ4A 3HXDA 3QWPA 4BX8A 2KBXA 3MGBA 4LUNU 3CKBA 3NOGD 4AXHA 2DCPA 2WXGA 4OAUC 2J49A 2XEVA 1DCEA 3SBSA 3SFXA 5T4YA 4EPZA 2ZGDA 4BT8A 3UT4A 2R5SA 1Y6IA 3QKYA 4BY6A 3UKUG 4CCAA 4GA0A 4N2QA 3UUXA 1TN6A 1ZB1A 3Q49B 2Y69E 2F8XK 4UI9C 4APFA 4DI3A 4ANUA 4FLBA 3EJNA 5EYPF 1XNFA 4N39A 4GYOA 3ULQA 4N5QA 5EX3A 3HG0D 3DPDA 1DNPA 3LJNA 3FWVA 4LRZA 4FLHA 1MJ0A 5KJKA 3PDNA 3OXGA 1TN8A 3D9IA 3L13A 2XCBA 2IO3C 3L6AA 5D0OD 2E0IA 2VGXB 3ZRHA 3LXUX 1BU9A 4K0RA 2QYUA 4KZCA 3L17A 3QARA 4GA2A
chains in the Genus database with same CATH topology
4U0UA 5KJNA 2WXIA 4EBAA 2WXHA 3IHVA 1EYHA 3ZPJA 4HXIA 4HS2A 3ASHA 4WNFA 1ELWA 5FQ7A 3NQPA 3I4RB 2V8SE 3APCA 3D9MA 4ILGA 1EPUA 2J09A 2PQRA 4N3BA 5G05J 1INZA 3TGOA 4UWGA 1Y8MA 4FHKA 3UQ3A 2Y3AA 5CMYA 1X5BA 1OWLA 3UT7A 2KC7A 1UJJA 3ZHEB 2L0IA 3CK7A 3FUFA 2KZTB 4M3OA 3RRMB 1Z3XA 3FP3A 4XE0A 1H19A 2V0PA 3MEKA 2V5FA 3HIZA 4GZCA 2WXPA 2FF4A 2KCKA 5FTPA 2OV8A 5JHAA 3QJZA 3ESLA 4P29A 4JC8A 1QNFA 4NACA 1IQRA 3IHYA 3MKRA 3ONKA 5G05C 2XGMA 1P5QA 2J9QA 3CHSA 2AXUA 4FP7A 3Q5MA 4U8HA 1U3DA 5EKQD 4AOFA 4UWHA 3ZYLA 4A3TA 4AVXA 3LEWA 4I1AA 4U0SA 3SBTB 3B13A 3AS5A 4CT0A 4DLOA 3FUJA 4XI9A 4LCTA 4JW1A 4I43A 2I6HA 3FTUA 1UG3A 2AVPA 3VLEA 1UJKA 3CIAA 3JQ0A 4GU5A 2X6KA 1NA0A 2XPZA 1QZ2A 3CVNA 2UWJG 4FADA 4UQZA 3VLDA 1HX8A 2X6FA 3OXFA 2WXQA 3PE3A 2KCLA 3Q15A 3KAEA 3CLJA 4BX9A 4PH4B 3P1UA 3LVRE 5FZQA 2WXNA 4GYWA 4G11A 2VTBA 3IV0A 3K9IA 4G26A 2WQ6A 5T8IA 4XKCA 4BTBA 2CFZA 2X3MA 4GZ5A 2X6IA 4MLPA 3FDHA 1UN9A 5JJ6A 3UPVA 3ASDA 4W9RA 4KVMA 4KT6B 4QFVA 3D9OA 4B8AA 3APFA 2IFUA 5HI7A 4C0MA 3CVWA 3LPZA 3PREA 4YNDA 4EZKA 3LYAA 3RO2A 4WNDA 4C9BB 1WAO1 2LO6A 3PH0C 3MV3B 3FUEA 4CDRA 5LFAA 4G1TA 4B8CB 4AY6A 2WXJA 2JEKA 2CHWA 4K03A 5LOZA 3HHMA 2I1JA 2WXLA 2I2OA 4TRQA 3G2VA 4A1SA 1U3CA 4JA7A 2J4BA 5FJYA 3JCKC 3RKVA 1E7VA 2WXMA 4GCOA 5ANLA 5BPPA 3VTYA 3QK0A 1JUQA 4DPRA 1XGWA 3GZSA 4YVOA 5E76A 3U9WA 4GCNA 2BUGA 4FJYA 4J8DA 4ACLA 2LNIA 2VSNA 5A6CA 4RVBA 1IYGA 2ONDA 3FEXA 3Q4AB 4CT4A 4H7XA 3R7RA 4TV3A 1N54A 4WUYA 3O4ZA 4APOA 4HOQA 3MCXA 1E96B 4JL0A 4C0EA 2FO7A 1YA0A 3LDZA 3PVLA 4I9EA 4UWFA 4JHJA 3L54A 3T5XA 4Q69A 3NZSA 1ZBPA 2DBAA 3FTSA 3L22A 3MKQB 2VGXA 5ANRA 1NA3A 3FY4A 4FULA 4RSYA 3PNTB 2V4LA 3PNLB 4U07A 4GZDA 4TUUA 5A7DB 1HO8A 2LSVA 2NXPA 4JXTA 3AU5A 4CGVA 2KATA 1E7UA 1H2TC 3D9KA 4OVUA 5FQ8A 2P58C 1NP7A 2HR2A 3U64A 4PS8A 4ME2A 4WNEA 2CG2A 2MRIA 4EZLA 3MYVA 2ILRA 2PM7A 2FI7A 4GZ6A 1MQSA 1PAQA 3IKOB 3UMVA 5KJMA 5AYWD 3LVQE 5M72A 2AXVA 5HQ8A 1E8YA 2YHCA 1MHQA 3EIQC 4F53A 3QC1A 3CSTA 2L6JA 4Q96A 1HZ4A 2OOEA 3FUDA 2CG3A 3CKCA 3PS6A 1FVHA 1EDUA 4WNGA 5CMWA 2VSXE 4Y6CA 5C1DA 4XIFA 3ZHEA 3CVVA 3B7RL 2VYIA 1E8WA 2XCCA 5ARGA 4JEUA 2KZTA 4A1GA 4PS7A 3RK6A 2WXOA 3KD7A 4WWOA 3TXMA 3ZYQA 3SZ7A 3CHMA 2IF4A 3U4TA 3FU3A 3FU5A 2FULA 3Q47B 3QOUA 3QWVA 4UWKA 2ZU6B 4EQFA 3RO3A 3CVLA 4HFGA 4A55A 3S7FA 4XI0A 4DJAA 1A17A 5ENNA 5LP0A 3MA5A 2L9BA 3MJWA 4G24A 3TXNA 4ACKA 4UI9K 4HLEA 2WQ7A 2XRYA 1H6KA 4GZ3A 2Q7FA 4JHKA 2CHXA 3LCAA 4OYSA 3SD5A 1E90A 3OTNA 5AENA 3EHMA 2RD0A 3CQGB 1E8XA 2XQ0A 2PL2A 3JYSA 3QNKA 3FU6A 4AEZC 4ILHB 4NQ0A 5T3RA 4I1OB 3R9AB 5FZRA 4ANXA 4KBQA 5J90A 3SI5A 3CGHA 3SHFA 3LY9A 4N5CA 2XHEA 2XGSA 1LF8A 5FQ6A 3S7BA 4U04A 3OAWA 1IHGA 2E2EA 5E75A 2VQ2A 3FHEA 2FBNA 3D9PA 3UX4A 4L23A 3CSFA 3GYZA 3SF4A 2PM6A 5KJLA 5LX8A 3CVXA 2MHKA 4J8FA 4FU3A 4EBAG 3OXLA 4JPSA 3HYMB 4JA9A 1KLXA 3FU0A 1H2VC 1W3BA 2X38A 1KT1A 3O48A 2BTDA 3B7UX 2KCVA 3RRNB 1WY6A 4N2SA 1ELKA 3CVUA 1KT0A 3JQ1A 3P2BA 4ILIA 4JZYA 2GRMA 3N71A 5G55A 4B89A 4G2VA 4V3IA 2HM8A 2PZIA 2WM9A 4IYPA 2WXRA 4MRUA 3ZXSA 2BF0X 2NC9A 5KCMA 3EDTB 5A23A 4HOSA 3PEVB 3TJPA 4CDNA 3GZ1A 1WM5A 2Y4TA 3D3MA 3FTVA 1ELRA 1OWMA 2GGFA 4AM9A 2AXZA 4L2YA 2I1KA 3CHPA 1TJFA 3NZUA 3S7DA 4BSXA 1S0PA 4F3VA 1HXIA 4FC8A 4CGWA 4PUCA 5JJ7A 4B94A 4GMJA 4FHJA 3ZVVA 1FVFA 4UQXA 3EHNA 3G2WA 2YHEA 5EX0A 4GYYA 3CVYA 5AJDA 1OUVA 4G25A 5JHBA 2OVBA 2X6HA 5C2YA 4Y6WA 3U3WA 3LY7A 4IULA 1EF1C 3CHOA 3R7QA 3I5PA 3CVQA 4IRUA 4LEUA 3B7SA 3AU4A 2IQCA 4NRHB 1HU3A 4XKBA 3FUHA 4CDMA 3PUKA 2KM4A 3ML9A 3FUNA 4ABNA 3CEQA 1Z6TA 5ARFA 3ASGA 3ASFA 3QB2A 3S7JA 2I9CA 3ONLA 3KS2A 4I6GA 2YINA 3I4GA 2OVFA 4I1MA 5FWQA 2IONA 3TAXA 3MKQA 3T8MA 3UT8A 5BW8C 4BT9A 1HF8A 4B0ZA 2M63A 1E8ZA 2UY1B 3FUKA 4I6JA 4KMOA 5G04J 3HVEB 1VDYA 3TG4A 3CK8A 1OWNA 1HH8A 2A5UA 4JVSA 3LY8A 1JWFA 3NF1A 3FTWA 3ZYMA 2R59A 3FUIA 2WQHA 2C0LA 4E85A 2C0MA 2C2LA 1HG5A 2XPYA 3WXXA 2HO1A 3BEEA 4F1SA 2R17C 4WWNA 3G2SA 4XX5A 3G2UA 1HFAA 5AJLA 4LERA 2WVIA 3FH7A 4UWLA 1JPLA 3PRZA 3QWWA 3QAQA 4E6HA 1PY1A 2CHZA 4MS6A 2WXFA 5G04C 4HOTA 2J4DA 4JHRA 4U0ZA 3PE4A 3SFZA 2HYZA 4I17A 3KEZA 2Y4UA 5FZSA 4EZJA 4F7AA 2QFCA 3ZN3A 5DBKA 3TL5A 3S2AA 4NURA 4KVOA 1H0AA 3ZYKA 4CRWA 3JUIA 2XPIA 2XRZA 3LJ3A 4PDXA 1NZNA 3T5VA 3GW4A 1TEZA 3FULA 4HOUA 5D0QD 4MKTA 4R7LA 4J8SA 4J0UA 2IOSA 5FQ4A 2WMOA 3IBEA 4A3VA 3G2TA 5FT9A 3MX3A 1DVPA 3QWPA 4BX8A 2L0TB 5DIZA 1BPOA 3MGBA 4LUNU 1H2UA 3CKBA 3VTXA 1HG2A 4O6FA 4AXHA 2DCPA 2WXGA 4FA6A 2AWIA 2IOLA 3DBSA 5J08A 2J49A 3CV0A 1SZ9A 2XEVA 3SBSA 3ZGQA 2PQNA 4ANVA 4AIFA 1N52A 2WMNA 3HDXA 3SNXA 4GMLA 1SZAA 5T4YA 3MV2B 3APDA 3FH8A 3MZLB 4ATGA 4EPZA 2WB2A 3FUMA 3FTYA 4BT8A 3VLFA 2YQ8A 3UT4A 3ZIMA 3C98A 5EDSA 3ML8A 2WXKA 1JWGA 3QDNA 1HE8A 2WPVA 4GPKA 4UI9J 4H7YA 3FTZA 2GRLA 2R5SA 4KYOB 4U63A 3ZW3A 2VTBB 3CR3A 1Y6IA 3QKYA 2VJ8A 2MOWA 1QQEA 2NSZA 3PUJA 2FEZA 4BY6A 4J8EA 1PC2A 2DIWA 5BV0A 4AJWA 3B7TA 1OWPA 2LAIA 4CCAA 5BT1A 4GA0A 4BTAA 5BNWA 4N2QA 3UUXA 1UW4B 3RU0A 4ANWA 1GW6A 3LS8A 3L16A 4EECA 4N3CA 4D10C 4YVQC 3Q49B 4Q94A 3ENEA 4UI9C 2YNQA 4APFA 3FEYA 5CCMA 3I3NA 4N3AA 5G2NA 4J6IA 3U66A 3FTXA 4DI3A 4RG6A 4G23A 2J07A 2JLBA 3ESKA 4WWPA 3EIJA 4ANUA 3D9NA 4AP2A 1FCHA 3IEGA 3RJVA 2VSOE 4L7TA 1HS6A 2GW1A 4FLBA 2LAHA 4KXKB 4L2LA 2A4ZA 4I2WA 1L5JA 5CHEE 3EJNA 3FH5A 1XNFA 4N39A 1IQUA 2RG8A 3ZFWA 4URKA 4GYOA 4RG9A 4BWRA 3AS8A 4DK5A 2X6JA 3ULQA 4I6EA 4L1BA 3PZDA 3FFLA 3GZ2A 5EX3A 4BFRA 5AIJA 2VGYA 1SQMA 3DPDA 4DLQA 2AW6A 1DNPA 3SGHA 3FWVA 5LCWJ 4LRZA 4FLHA 3CQCB 4FJZA 5KJKA 3PDNA 3D9JA 1Z3YA 3CHQA 3CVPA 3OXGA 3D9IA 3LKUA 4GB9A 1ZU2A 3BG0B 4JEHA 3PEUB 3CHRA 3ZEFA 2J08A 2VSYA 3BG1B 5JJTA 3RIBA 2IU1A 3L13A 1UN8A 2EQXA 2XCBA 3E4BA 4UQYA 4HVBA 4GA1A 1TJCA 5BUZA 4IN3B 2CFUA 4OVVA 4KZ0A 3L6AA 4I9CA 4XZ4A 4AV7A 1B89A 4I2ZA 5D0OD 2E0IA 5LCWC 3CK9A 4DI4A 3D9LA 2VGXB 4PS3A 2UY1A 3ZRHA 3L08A 3LXUX 3HVEA 3URZA 4K0RA 2IJGX 2LSUA 3TG5A 4KZCA 3L17A 3RRUA 3AS4A 5CCLA 4CEMA 4WAFA 4HORA 2QY7A 5BV1A 2XGOA 4AY5A 1OWOA 3QARA 4GA2A 4GAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EPZ A; 
#chains in the Genus database with same CATH topology
 4U0U A;  2WXI A;  4EBA A;  2WXH A;  1IKN D;  3V2O A;  3HXF A;  3ASH A;  2R02 A;  5FQ7 A;  2V8S E;  2J09 A;  2PQR A;  4N3B A;  5G05 J;  2A5E A;  3TGO A;  1OY3 D;  2Y3A A;  5CMY A;  4BER A;  4B93 B;  1UJJ A;  3CK7 A;  3FUF A;  2KZT B;  4XE0 A;  2B0O E;  4GZC A;  2V5F A;  2MYO A;  2WXP A;  4HI8 A;  3X2Q E;  4ZHB A;  4P29 A;  1OCZ E;  2J9Q A;  2AXU A;  3Q5M A;  4GTS A;  2H6G A;  1TR4 A;  3SBT B;  2L6B A;  5CEC B;  1UJK A;  3DSV A;  3JQ0 A;  2X6K A;  2XPZ A;  1S63 A;  3Q15 A;  3KAE A;  4BX9 A;  4PH4 B;  4GYW A;  4G11 A;  2VTB A;  1DC2 A;  5T8I A;  2X3M A;  4GZ5 A;  5JJ6 A;  4RQI A;  2VGE A;  4MBG A;  4KT6 B;  4C0M A;  1V55 E;  4AY6 A;  3Q9U C;  3HHM A;  2I1J A;  4JA7 A;  3ULE G;  4O1P A;  2WXM A;  5E76 A;  4GCN A;  2BUG A;  4J8D A;  4ACL A;  4RVB A;  5CBN A;  2KXP C;  1MX2 A;  4JL0 A;  2FO7 A;  1YA0 A;  1QBQ A;  4GMR A;  1N94 A;  3L22 A;  1NA3 A;  1HO8 A;  2NXP A;  4JXT A;  3HXC A;  4G8K A;  2KAT A;  5FQ8 A;  3U64 A;  2Y0B G;  4WNE A;  4EZL A;  1KZP A;  4GZ6 A;  1MQS A;  1PAQ A;  5AYW D;  3LVQ E;  5M72 A;  2AXV A;  2YHC A;  2IEJ A;  1MHQ A;  1HZ4 A;  2CG3 A;  3PS6 A;  1FVH A;  4WNG A;  3DEP A;  2XCC A;  1E8W A;  3SZ7 A;  3CHM A;  3U4T A;  5JA4 D;  3QOU A;  5ENT D;  3QWV A;  4EQF A;  3DST A;  1SVX A;  3CVL A;  4ATZ D;  3PZ3 A;  5HKP A;  3NOC D;  3MA5 A;  4G24 A;  2WQ7 A;  1H6K A;  4LNG A;  2CHX A;  4OYS A;  1FT1 A;  2RD0 A;  5ENP D;  1E8X A;  4ANX A;  3R9A B;  3RSE G;  3SI5 A;  4Z68 A;  1JCQ A;  5E75 A;  5EIB E;  1UOH A;  3D9P A;  3UX4 A;  5LX8 A;  3B7U X;  3RRN B;  1WY6 A;  1ELK A;  1KT0 A;  4JZY A;  2GRM A;  5G55 A;  3PZ2 A;  4MRU A;  1YYH A;  1RW2 A;  1OXJ A;  4CDN A;  3GZ1 A;  3UM3 A;  2AXZ A;  4L2Y A;  3Q75 A;  3ISM C;  4BSX A;  3S7D A;  4F3V A;  4X8Q A;  1HXI A;  4CGW A;  4B94 A;  2H6H A;  4GMJ A;  4FHJ A;  3EHN A;  2X6H A;  3EU5 A;  4Y6W A;  3U3W A;  5ENS D;  1EF1 C;  3CVQ A;  4IRU A;  4XKB A;  4NRH B;  1HU3 A;  4CDM A;  3PUK A;  3J5Q B;  3ML9 A;  3ULY A;  3EU9 A;  5ARF A;  3ASG A;  3QB2 A;  2OEW A;  5FWQ A;  3I4G A;  4E85 A;  3UT8 A;  1HF8 A;  4BEP A;  4I6J A;  4KMO A;  3CK8 A;  4DX5 D;  1HH8 A;  3LY8 A;  3ZYM A;  2R59 A;  2XPY A;  4RLY A;  3WXX A;  4F1S A;  2R17 C;  4WWN A;  4BES A;  5AJL A;  4UWL A;  3PRZ A;  4HOT A;  2CHZ A;  1FPP A;  4MS6 A;  5G04 C;  3KEZ A;  2QYJ A;  1N11 A;  3S2A A;  4G8L A;  2XRZ A;  3ZYK A;  3T5V A;  3E32 A;  3FUL A;  4LNU D;  4MKT A;  4R7L A;  4J8S A;  2WMO A;  4A3V A;  3Q78 A;  3G2T A;  5FT9 A;  1BPO A;  2AWI A;  2IOL A;  2V4H C;  3E34 A;  3CV0 A;  4AIF A;  2WB2 A;  3MV2 B;  4ATG A;  3KSL A;  2YQ8 A;  5EDS A;  4TXQ A;  2WXK A;  3QDN A;  4GPK A;  1SA5 A;  2VTB B;  3UI2 A;  2VJ8 A;  2BKG A;  5BV0 A;  5BNW A;  4BTA A;  3HRA A;  3V31 A;  4D10 C;  3ENE A;  1N0Q A;  5CCM A;  3I3N A;  5G2N A;  4J6I A;  4RG6 A;  3J5P A;  5CRV A;  3EIJ A;  3D9N A;  1FCH A;  1MX4 A;  3IEG A;  1HS6 A;  4KXK B;  2LAH A;  2A4Z A;  4I2W A;  1L5J A;  5CHE E;  3FH5 A;  4L9P A;  1JCS A;  1IQU A;  4RG9 A;  3AS8 A;  4I6E A;  3PZD A;  5JMN D;  3FFL A;  4BFR A;  5LCW J;  5AN8 A;  5EN5 D;  3CQC B;  4GB9 A;  3BG0 B;  4JEH A;  3PEU B;  3ZEF A;  2IU1 A;  3ZU7 B;  1UN8 A;  5ENR D;  4HVB A;  2XS8 A;  4GA1 A;  2V5Q C;  1B89 A;  3T8K A;  1A5E A;  3D9L A;  3UIO C;  4PS3 A;  3L08 A;  3URZ A;  3RRU A;  5CCL A;  4CEM A;  4WAF A;  4GAA A;  5KJN A;  2GRR B;  3IHV A;  2P9K G;  2ZXW E;  2JAB A;  2HE0 A;  3NQP A;  3D9M A;  1INZ A;  4FHK A;  1X5B A;  3UT7 A;  2KC7 A;  4M3O A;  3FP3 A;  1H19 A;  2V0P A;  2FF4 A;  2OV8 A;  3PZ4 A;  3QJZ A;  1U2V G;  3W9F A;  4JC8 A;  4NAC A;  3MKR A;  5EIL A;  2XGM A;  1P5Q A;  3CHS A;  1U3D A;  4AOF A;  4UWH A;  5ENO D;  3LEW A;  4I1A A;  4DLO A;  3AG4 E;  4JW1 A;  4I43 A;  3FTU A;  3VLE A;  3TWX A;  1NA0 A;  4J7W A;  4UQZ A;  5AQ7 A;  3VLD A;  4TXP A;  2WXQ A;  3L82 A;  2KCL A;  3P1U A;  2WXN A;  4G26 A;  3Q9N C;  4XKC A;  4BTB A;  2CFZ A;  4U95 D;  3ABM E;  3ASD A;  5CEA A;  3E37 A;  4M7C A;  4QFV A;  4B8A A;  3APF A;  2IFU A;  3CVW A;  3PRE A;  4EZK A;  4XEI G;  5LFA A;  4G1T A;  1BI7 B;  1BLX B;  4TRQ A;  1U3C A;  4TXR A;  4GCO A;  5BPP A;  3VTY A;  4F6R D;  3C72 A;  2ZIS A;  4H7X A;  4TV3 A;  1N54 A;  2AJA A;  2PNN A;  3MCX A;  1E96 B;  4C0E A;  4I9E A;  4UWF A;  3L54 A;  1TNB A;  3FY4 A;  4RSY A;  3PNT B;  3PNL B;  4U07 A;  4GZD A;  2DVW A;  5CBO A;  2QC9 A;  3D9K A;  2P58 C;  1NP7 A;  3MYV A;  3Q7A A;  2ILR A;  3IKO B;  3UMV A;  2EIN E;  3V79 K;  3UIP C;  4YDO A;  3QC1 A;  3CST A;  4Q96 A;  5ITZ F;  3FUD A;  1EDU A;  2VSX E;  3ZHE A;  2VYI A;  4JEU A;  3RK6 A;  2WXO A;  2FUL A;  3S7F A;  1A17 A;  4ACK A;  2L9B A;  4HLE A;  4UI9 K;  2XQ0 A;  4KBQ A;  3CGH A;  3SHF A;  3LY9 A;  2XHE A;  2XGS A;  4GTP A;  5ENQ D;  1N4P A;  3IXE A;  2RKK A;  4L23 A;  4HRL A;  2P9I G;  2PM6 A;  3EHQ A;  2MHK A;  4J8F A;  4FU3 A;  4EBA G;  2F8Y A;  2BTD A;  3UIN C;  4GTV A;  3JQ1 A;  3C5R A;  3N71 A;  4V3I A;  2HM8 A;  1NFI E;  4IYP A;  2WXR A;  2BF0 X;  2DWZ A;  5A23 A;  4YDW A;  3TJP A;  1WM5 A;  2Y4T A;  1N9A A;  1OWM A;  3C3R A;  2I1K A;  1S0P A;  2Y1L E;  4UQX A;  3G2W A;  5H7P A;  5EX0 A;  4GYY A;  3CVY A;  1OUV A;  4G25 A;  2OVB A;  5C2Y A;  3LY7 A;  4IUL A;  3ASN E;  1D8D A;  3AG3 E;  3B7S A;  3FUH A;  1IXV A;  4U7E B;  3CEQ A;  2I9C A;  3KS2 A;  4I6G A;  3T8M A;  3Q73 A;  2M63 A;  1E8Z A;  5CRU A;  3SFY A;  3DSX A;  1JWF A;  3FTW A;  2C0L A;  2C0M A;  1HG5 A;  3ZKJ A;  4XX5 A;  2WVI A;  3FH7 A;  1JPL A;  4E6H A;  1PY1 A;  2WXF A;  5KNH D;  2HYZ A;  4CYM D;  4F7A A;  3TL5 A;  4KVO A;  4CRW A;  3JUI A;  1NZN A;  4HOU A;  5D0Q D;  5HS0 A;  3RAU A;  2IOS A;  1BD8 A;  3MX3 A;  3SQV A;  2P9L G;  1DVP A;  5DIZ A;  1H2U A;  4O6F A;  4FA6 A;  3AJI A;  3DBS A;  1OCO E;  1SZ9 A;  3JUE A;  4ANV A;  1N52 A;  2WMN A;  3SNX A;  1SZA A;  3APD A;  3AG1 E;  4F1P A;  3FUM A;  3FTY A;  3VLF A;  4UI9 J;  3FTZ A;  2GRQ B;  3ZW3 A;  4KYO B;  4U63 A;  3D9H A;  3NAW A;  3CR3 A;  3L9T A;  3ZUV B;  3TWV A;  2MOW A;  1QQE A;  3AG2 E;  2NSZ A;  4J8E A;  2DIW A;  4AJW A;  5BT1 A;  4ANW A;  4OAV B;  1GW6 A;  4EEC A;  4N3C A;  4YVQ C;  4Q94 A;  1O1S A;  2YNQ A;  3FEY A;  3U66 A;  3FTX A;  1AWC B;  4G23 A;  4WWP A;  4AP2 A;  1DCQ A;  2H6F A;  2GW1 A;  4L2L A;  1TN7 A;  3ZFW A;  2RG8 A;  4BWR A;  4DK5 A;  2X6J A;  4L1B A;  3R9M A;  4HRM B;  1SQM A;  3DWL G;  3SGH A;  3TWW A;  4FJZ A;  5IY5 E;  1Z3Y A;  3CHQ A;  3LKU A;  4HRN A;  3CHR A;  2VSY A;  2FO1 E;  3BG1 B;  3RIB A;  2EQX A;  5AAO A;  4UQY A;  5BUZ A;  2CFU A;  4OVV A;  4KZ0 A;  4I9C A;  4XZ4 A;  2F0Y A;  5EID A;  3CK9 A;  1SA4 A;  2DYR E;  2UY1 A;  3UXG A;  4GTQ A;  4GTM A;  2LSU A;  3V2X A;  3AS4 A;  4HOR A;  2QY7 A;  1N4Q A;  5BV1 A;  4K5C A;  1EYH A;  3ABK E;  3DPY A;  3ZPJ A;  1TNU A;  4HS2 A;  4WNF A;  5CER B;  2H6I A;  3APC A;  4ILG A;  4UWG A;  2BED A;  1OWL A;  2XEH A;  3ZHE B;  2P2C P;  1Z3X A;  3MEK A;  3HIZ A;  5AQA A;  2KCK A;  5FTP A;  1D8E A;  2ETC A;  3ONK A;  3SO8 A;  5G05 C;  4U8V D;  4FP7 A;  4U8H A;  3Q79 A;  3ZYL A;  4A3T A;  4AVX A;  2LXM A;  1MX6 A;  4U0S A;  3B13 A;  1N4S A;  3FUJ A;  4LG6 A;  4LCT A;  4XI9 A;  2NYJ A;  4ZFH A;  2I6H A;  5FIN A;  3BQO A;  3CIA A;  4GU5 A;  3DXM G;  3UM0 A;  2UWJ G;  4LSZ E;  4FAD A;  3OXF A;  2X6F A;  2P9U G;  3PE3 A;  5FZQ A;  4BET A;  3K9I A;  4YDE A;  4MLP A;  3FDH A;  3UPV A;  1TNO A;  2LXL A;  4KVM A;  3F6Q A;  3D9O A;  5HI7 A;  3LPZ A;  4YND A;  3LYA A;  3RO2 A;  3PH0 C;  3FUE A;  4K03 A;  2CHW A;  5LOZ A;  2WXL A;  3G2V A;  2J4B A;  5FJY A;  3DSU A;  1JUQ A;  4DPR A;  4GPM A;  2LNI A;  2VSN A;  1IYG A;  3FEX A;  3Q4A B;  4CT4 A;  2XZD G;  4JD2 G;  5KBA A;  4WUY A;  4APO A;  1NL4 A;  4HOQ A;  1WDY A;  3LDZ A;  4Q69 A;  3NZS A;  4LNB A;  1ZBP A;  5BXU A;  5KWD A;  3FTS A;  5ANR A;  4HB5 A;  2V4L A;  4DX6 D;  4TUU A;  3AU5 A;  4CGV A;  1E7U A;  3B95 A;  4OVU A;  1NI1 A;  2LUH A;  2MRI A;  3ABL E;  2OEV A;  1Q2Z A;  3HXE A;  1E8Y A;  2P9N G;  4EHM A;  4DUI A;  4HBD A;  4CZ2 D;  3CVV A;  2RFA A;  5ARG A;  5HQ8 A;  4PS7 A;  3ZYQ A;  4GTR A;  1K3Z D;  4NIK A;  3FU3 A;  3Q47 B;  4UWK A;  3RO3 A;  2ETB A;  4A55 A;  4XI0 A;  2QZA A;  3TXN A;  2GRN B;  4JHK A;  3SD5 A;  5CED B;  3EHM A;  3CQG B;  3JYS A;  2PL2 A;  3FU6 A;  4NQ0 A;  5T3R A;  4I1O B;  5J90 A;  4N5C A;  1LTX A;  3DSW A;  3NB2 A;  5D66 A;  4U04 A;  3OAW A;  3BU8 A;  1IHG A;  2VQ2 A;  2FBN A;  5B1B E;  1X81 A;  5KJL A;  3CVX A;  3ASO E;  3OXL A;  3TWQ A;  4JA9 A;  1KLX A;  2EIL E;  3FU0 A;  3KEA A;  2X38 A;  1KT1 A;  2KCV A;  4O60 A;  3CVU A;  5AAR A;  5AQB A;  2ZGG A;  3ZXS A;  2NC9 A;  1K1A A;  1IHB A;  1FT2 A;  3ZXP A;  3D3M A;  4GTT A;  3CHP A;  1TJF A;  4FC8 A;  3TWU A;  1FVF A;  2EIJ E;  5JHB A;  3E30 A;  3R7Q A;  2P9P G;  3AU4 A;  1JCR A;  2B6C A;  3FUN A;  4ABN A;  3DXK G;  1Z6T A;  3S7J A;  3ONL A;  2OVF A;  4I1M A;  4BT9 A;  3TAX A;  3MKQ A;  3C3O A;  2UY1 B;  3TWR A;  3FUK A;  5G04 J;  4HLL A;  1N0R A;  4JVS A;  3NF1 A;  2HO1 A;  3BEE A;  1O1R A;  3QWW A;  3QAQ A;  2J4D A;  4JHR A;  3SFZ A;  3EHR A;  4I17 A;  2Y4U A;  2QFC A;  3ZN3 A;  4NUR A;  1N4R A;  1H0A A;  2XPI A;  5AQ9 A;  3GW4 A;  1OT8 A;  2P9S G;  2EIM E;  3IBE A;  2XEE A;  2L0T B;  3VTX A;  1HG2 A;  1D9S A;  2DZN A;  4HQD A;  2IO2 C;  5J08 A;  2R03 A;  3ZGQ A;  4BSZ B;  2PQN A;  1K1B A;  2EIK E;  3HDX A;  2GRP B;  4GML A;  3MZL B;  3FH8 A;  3Q7F A;  3ZIM A;  3C98 A;  3ML8 A;  1JWG A;  1HE8 A;  2WPV A;  4H7Y A;  2GRL A;  3PUJ A;  2FEZ A;  1PC2 A;  3B7T A;  1OWP A;  2LAI A;  1UW4 B;  3RU0 A;  3LS8 A;  3L16 A;  2F37 A;  4N3A A;  1QYM A;  2J07 A;  2JLB A;  3ESK A;  4DX2 A;  3RJV A;  2VSO E;  4L7T A;  1N95 A;  2BKK B;  4URK A;  3ZNG A;  4U8Y D;  2R05 A;  3GZ2 A;  2OCC E;  5AIJ A;  2VGY A;  4DLQ A;  2AW6 A;  2RFM A;  1H6O A;  3D9J A;  3CVP A;  1S64 A;  1ZU2 A;  3TWS A;  2J08 A;  5JJT A;  3E4B A;  1TJC A;  4IN3 B;  3AAA C;  4C48 B;  4AV7 A;  4I2Z A;  5LCW C;  4DI4 A;  3HVE A;  2IJG X;  3TG5 A;  3TWT A;  2XGO A;  1V54 E;  4AY5 A;  1OWO A;  5KNG A;  3DEO A;  5B3S E;  4HXI A;  2J8S D;  1ELW A;  3I4R B;  4GTO A;  3T9K A;  1EPU A;  1Y8M A;  3UQ3 A;  2DYS E;  4HI9 A;  2L0I A;  2ZIR A;  3RRM B;  5HRY A;  3KSQ A;  5JHA A;  1O5M A;  3ESL A;  1QNF A;  1IQR A;  3IHY A;  5EYL A;  1KZO A;  5EKQ D;  3UM2 A;  1TNY A;  4CT0 A;  3AS5 A;  3NBN B;  1UG3 A;  2AVP A;  1MZC A;  1QZ2 A;  3CVN A;  1HX8 A;  1RZ4 A;  3UTM A;  1KPS B;  3CLJ A;  3LVR E;  3IV0 A;  2WQ6 A;  1BI8 B;  2X6I A;  1UN9 A;  1WG0 A;  4W9R A;  4K5B A;  1OCR E;  4WND A;  4C9B B;  1WAO 1;  2LO6 A;  3MV3 B;  4CDR A;  4B8C B;  2WXJ A;  2JEK A;  2I2O A;  4A1S A;  3B7B A;  3JCK C;  3RKV A;  1E7V A;  4TUM A;  3C3Q A;  5ANL A;  3QK0 A;  3UKR G;  1XGW A;  3GZS A;  4YVO A;  3U9W A;  3DRA A;  4FJY A;  2XS1 A;  3PZ1 A;  5A6C A;  2OND A;  3R7R A;  3O4Z A;  3PVL A;  4UUC A;  1OCC E;  4JHJ A;  3T5X A;  2DBA A;  4O1O A;  3MKQ B;  2VGX A;  4FUL A;  1LD8 A;  5A7D B;  5FIO A;  2LSV A;  3UM1 A;  1H2T C;  2HR2 A;  1O1T A;  4PS8 A;  4ME2 A;  2R2L A;  2CG2 A;  2PM7 A;  2FI7 A;  4K5A B;  5KJM A;  2IY0 C;  4DRX E;  3EIQ C;  4F53 A;  3DSS A;  2L6J A;  2OOE A;  1S70 B;  3CKC A;  5CMW A;  4Y6C A;  5C1D A;  4XIF A;  3B7R L;  2GRO B;  2KZT A;  4A1G A;  3KD7 A;  4WWO A;  3TXM A;  2IF4 A;  3FU5 A;  2ZU6 B;  4HFG A;  4JB8 P;  4DJA A;  5LP0 A;  5ENN A;  3MJW A;  3WG7 E;  2XRY A;  4GZ3 A;  2Q7F A;  3LCA A;  1E90 A;  3OTN A;  5AEN A;  3QNK A;  4AEZ C;  4ILH B;  3W9G A;  5FZR A;  4A63 B;  5D2M C;  1LF8 A;  5FQ6 A;  3S7B A;  2E2E A;  3BUA A;  3FHE A;  4J8Y A;  2XZT G;  3V30 A;  1K8K G;  3CSF A;  3GYZ A;  3SF4 A;  1H6P A;  4JPS A;  1LD7 A;  3HYM B;  1H2V C;  1W3B A;  3O48 A;  1G3N B;  4U96 D;  3JXJ A;  4N2S A;  3P2B A;  4ILI A;  4B89 A;  4G2V A;  4DX7 D;  2PZI A;  2WM9 A;  1YCS B;  1Z5S C;  3EUV A;  5KCM A;  3EDT B;  4HNA D;  2ETA A;  4HOS A;  3PEV B;  5BXO A;  3SY2 A;  3FTV A;  1ELR A;  2GGF A;  4AM9 A;  3NZU A;  1MYO A;  4PUC A;  5JJ7 A;  3ZVV A;  2DZO A;  2YHE A;  5AJD A;  4QQI A;  2XEN A;  3CHO A;  5B1A E;  3I5P A;  4LEU A;  1TYQ G;  2IQC A;  2KM4 A;  3JXI A;  3ASF A;  2YIN A;  2ION A;  5BW8 C;  4B0Z A;  3HVE B;  1VDY A;  3TG4 A;  1OWN A;  2A5U A;  1SW6 A;  4YDY A;  3FUI A;  1TNZ A;  2WQH A;  2C2L A;  3E33 A;  3G2S A;  3G2U A;  1HFA A;  4LER A;  3HXB A;  1AP7 A;  4U0Z A;  3PE4 A;  5FZS A;  4DX1 A;  4EZJ A;  5DBK A;  1YMP A;  3LJ3 A;  4PDX A;  1TEZ A;  4J0U A;  5FQ4 A;  3HXD A;  3QWP A;  4BX8 A;  2KBX A;  3MGB A;  4LUN U;  3CKB A;  3NOG D;  4AXH A;  2DCP A;  2WXG A;  4OAU C;  2J49 A;  2XEV A;  1DCE A;  3SBS A;  3SFX A;  5T4Y A;  4EPZ A;  2ZGD A;  4BT8 A;  3UT4 A;  2R5S A;  1Y6I A;  3QKY A;  4BY6 A;  3UKU G;  4CCA A;  4GA0 A;  4N2Q A;  3UUX A;  1TN6 A;  1ZB1 A;  3Q49 B;  2Y69 E;  2F8X K;  4UI9 C;  4APF A;  4DI3 A;  4ANU A;  4FLB A;  3EJN A;  5EYP F;  1XNF A;  4N39 A;  4GYO A;  3ULQ A;  4N5Q A;  5EX3 A;  3HG0 D;  3DPD A;  1DNP A;  3LJN A;  3FWV A;  4LRZ A;  4FLH A;  1MJ0 A;  5KJK A;  3PDN A;  3OXG A;  1TN8 A;  3D9I A;  3L13 A;  2XCB A;  2IO3 C;  3L6A A;  5D0O D;  2E0I A;  2VGX B;  3ZRH A;  3LXU X;  1BU9 A;  4K0R A;  2QYU A;  4KZC A;  3L17 A;  3QAR A;  4GA2 A; 
#chains in the Genus database with same CATH homology
 4U0U A;  5KJN A;  2WXI A;  4EBA A;  2WXH A;  3IHV A;  1EYH A;  3ZPJ A;  4HXI A;  4HS2 A;  3ASH A;  4WNF A;  1ELW A;  5FQ7 A;  3NQP A;  3I4R B;  2V8S E;  3APC A;  3D9M A;  4ILG A;  1EPU A;  2J09 A;  2PQR A;  4N3B A;  5G05 J;  1INZ A;  3TGO A;  4UWG A;  1Y8M A;  4FHK A;  3UQ3 A;  2Y3A A;  5CMY A;  1X5B A;  1OWL A;  3UT7 A;  2KC7 A;  1UJJ A;  3ZHE B;  2L0I A;  3CK7 A;  3FUF A;  2KZT B;  4M3O A;  3RRM B;  1Z3X A;  3FP3 A;  4XE0 A;  1H19 A;  2V0P A;  3MEK A;  2V5F A;  3HIZ A;  4GZC A;  2WXP A;  2FF4 A;  2KCK A;  5FTP A;  2OV8 A;  5JHA A;  3QJZ A;  3ESL A;  4P29 A;  4JC8 A;  1QNF A;  4NAC A;  1IQR A;  3IHY A;  3MKR A;  3ONK A;  5G05 C;  2XGM A;  1P5Q A;  2J9Q A;  3CHS A;  2AXU A;  4FP7 A;  3Q5M A;  4U8H A;  1U3D A;  5EKQ D;  4AOF A;  4UWH A;  3ZYL A;  4A3T A;  4AVX A;  3LEW A;  4I1A A;  4U0S A;  3SBT B;  3B13 A;  3AS5 A;  4CT0 A;  4DLO A;  3FUJ A;  4XI9 A;  4LCT A;  4JW1 A;  4I43 A;  2I6H A;  3FTU A;  1UG3 A;  2AVP A;  3VLE A;  1UJK A;  3CIA A;  3JQ0 A;  4GU5 A;  2X6K A;  1NA0 A;  2XPZ A;  1QZ2 A;  3CVN A;  2UWJ G;  4FAD A;  4UQZ A;  3VLD A;  1HX8 A;  2X6F A;  3OXF A;  2WXQ A;  3PE3 A;  2KCL A;  3Q15 A;  3KAE A;  3CLJ A;  4BX9 A;  4PH4 B;  3P1U A;  3LVR E;  5FZQ A;  2WXN A;  4GYW A;  4G11 A;  2VTB A;  3IV0 A;  3K9I A;  4G26 A;  2WQ6 A;  5T8I A;  4XKC A;  4BTB A;  2CFZ A;  2X3M A;  4GZ5 A;  2X6I A;  4MLP A;  3FDH A;  1UN9 A;  5JJ6 A;  3UPV A;  3ASD A;  4W9R A;  4KVM A;  4KT6 B;  4QFV A;  3D9O A;  4B8A A;  3APF A;  2IFU A;  5HI7 A;  4C0M A;  3CVW A;  3LPZ A;  3PRE A;  4YND A;  4EZK A;  3LYA A;  3RO2 A;  4WND A;  4C9B B;  1WAO 1;  2LO6 A;  3PH0 C;  3MV3 B;  3FUE A;  4CDR A;  5LFA A;  4G1T A;  4B8C B;  4AY6 A;  2WXJ A;  2JEK A;  2CHW A;  4K03 A;  5LOZ A;  3HHM A;  2I1J A;  2WXL A;  2I2O A;  4TRQ A;  3G2V A;  4A1S A;  1U3C A;  4JA7 A;  2J4B A;  5FJY A;  3JCK C;  3RKV A;  1E7V A;  2WXM A;  4GCO A;  5ANL A;  5BPP A;  3VTY A;  3QK0 A;  1JUQ A;  4DPR A;  1XGW A;  3GZS A;  4YVO A;  5E76 A;  3U9W A;  4GCN A;  2BUG A;  4FJY A;  4J8D A;  4ACL A;  2LNI A;  2VSN A;  5A6C A;  4RVB A;  1IYG A;  2OND A;  3FEX A;  3Q4A B;  4CT4 A;  4H7X A;  3R7R A;  4TV3 A;  1N54 A;  4WUY A;  3O4Z A;  4APO A;  4HOQ A;  3MCX A;  1E96 B;  4JL0 A;  4C0E A;  2FO7 A;  1YA0 A;  3LDZ A;  3PVL A;  4I9E A;  4UWF A;  4JHJ A;  3L54 A;  3T5X A;  4Q69 A;  3NZS A;  1ZBP A;  2DBA A;  3FTS A;  3L22 A;  3MKQ B;  2VGX A;  5ANR A;  1NA3 A;  3FY4 A;  4FUL A;  4RSY A;  3PNT B;  2V4L A;  3PNL B;  4U07 A;  4GZD A;  4TUU A;  5A7D B;  1HO8 A;  2LSV A;  2NXP A;  4JXT A;  3AU5 A;  4CGV A;  2KAT A;  1E7U A;  1H2T C;  3D9K A;  4OVU A;  5FQ8 A;  2P58 C;  1NP7 A;  2HR2 A;  3U64 A;  4PS8 A;  4ME2 A;  4WNE A;  2CG2 A;  2MRI A;  4EZL A;  3MYV A;  2ILR A;  2PM7 A;  2FI7 A;  4GZ6 A;  1MQS A;  1PAQ A;  3IKO B;  3UMV A;  5KJM A;  5AYW D;  3LVQ E;  5M72 A;  2AXV A;  5HQ8 A;  1E8Y A;  2YHC A;  1MHQ A;  3EIQ C;  4F53 A;  3QC1 A;  3CST A;  2L6J A;  4Q96 A;  1HZ4 A;  2OOE A;  3FUD A;  2CG3 A;  3CKC A;  3PS6 A;  1FVH A;  1EDU A;  4WNG A;  5CMW A;  2VSX E;  4Y6C A;  5C1D A;  4XIF A;  3ZHE A;  3CVV A;  3B7R L;  2VYI A;  1E8W A;  2XCC A;  5ARG A;  4JEU A;  2KZT A;  4A1G A;  4PS7 A;  3RK6 A;  2WXO A;  3KD7 A;  4WWO A;  3TXM A;  3ZYQ A;  3SZ7 A;  3CHM A;  2IF4 A;  3U4T A;  3FU3 A;  3FU5 A;  2FUL A;  3Q47 B;  3QOU A;  3QWV A;  4UWK A;  2ZU6 B;  4EQF A;  3RO3 A;  3CVL A;  4HFG A;  4A55 A;  3S7F A;  4XI0 A;  4DJA A;  1A17 A;  5ENN A;  5LP0 A;  3MA5 A;  2L9B A;  3MJW A;  4G24 A;  3TXN A;  4ACK A;  4UI9 K;  4HLE A;  2WQ7 A;  2XRY A;  1H6K A;  4GZ3 A;  2Q7F A;  4JHK A;  2CHX A;  3LCA A;  4OYS A;  3SD5 A;  1E90 A;  3OTN A;  5AEN A;  3EHM A;  2RD0 A;  3CQG B;  1E8X A;  2XQ0 A;  2PL2 A;  3JYS A;  3QNK A;  3FU6 A;  4AEZ C;  4ILH B;  4NQ0 A;  5T3R A;  4I1O B;  3R9A B;  5FZR A;  4ANX A;  4KBQ A;  5J90 A;  3SI5 A;  3CGH A;  3SHF A;  3LY9 A;  4N5C A;  2XHE A;  2XGS A;  1LF8 A;  5FQ6 A;  3S7B A;  4U04 A;  3OAW A;  1IHG A;  2E2E A;  5E75 A;  2VQ2 A;  3FHE A;  2FBN A;  3D9P A;  3UX4 A;  4L23 A;  3CSF A;  3GYZ A;  3SF4 A;  2PM6 A;  5KJL A;  5LX8 A;  3CVX A;  2MHK A;  4J8F A;  4FU3 A;  4EBA G;  3OXL A;  4JPS A;  3HYM B;  4JA9 A;  1KLX A;  3FU0 A;  1H2V C;  1W3B A;  2X38 A;  1KT1 A;  3O48 A;  2BTD A;  3B7U X;  2KCV A;  3RRN B;  1WY6 A;  4N2S A;  1ELK A;  3CVU A;  1KT0 A;  3JQ1 A;  3P2B A;  4ILI A;  4JZY A;  2GRM A;  3N71 A;  5G55 A;  4B89 A;  4G2V A;  4V3I A;  2HM8 A;  2PZI A;  2WM9 A;  4IYP A;  2WXR A;  4MRU A;  3ZXS A;  2BF0 X;  2NC9 A;  5KCM A;  3EDT B;  5A23 A;  4HOS A;  3PEV B;  3TJP A;  4CDN A;  3GZ1 A;  1WM5 A;  2Y4T A;  3D3M A;  3FTV A;  1ELR A;  1OWM A;  2GGF A;  4AM9 A;  2AXZ A;  4L2Y A;  2I1K A;  3CHP A;  1TJF A;  3NZU A;  3S7D A;  4BSX A;  1S0P A;  4F3V A;  1HXI A;  4FC8 A;  4CGW A;  4PUC A;  5JJ7 A;  4B94 A;  4GMJ A;  4FHJ A;  3ZVV A;  1FVF A;  4UQX A;  3EHN A;  3G2W A;  2YHE A;  5EX0 A;  4GYY A;  3CVY A;  5AJD A;  1OUV A;  4G25 A;  5JHB A;  2OVB A;  2X6H A;  5C2Y A;  4Y6W A;  3U3W A;  3LY7 A;  4IUL A;  1EF1 C;  3CHO A;  3R7Q A;  3I5P A;  3CVQ A;  4IRU A;  4LEU A;  3B7S A;  3AU4 A;  2IQC A;  4NRH B;  1HU3 A;  4XKB A;  3FUH A;  4CDM A;  3PUK A;  2KM4 A;  3ML9 A;  3FUN A;  4ABN A;  3CEQ A;  1Z6T A;  5ARF A;  3ASG A;  3ASF A;  3QB2 A;  3S7J A;  2I9C A;  3ONL A;  3KS2 A;  4I6G A;  2YIN A;  3I4G A;  2OVF A;  4I1M A;  5FWQ A;  2ION A;  3TAX A;  3MKQ A;  3T8M A;  3UT8 A;  5BW8 C;  4BT9 A;  1HF8 A;  4B0Z A;  2M63 A;  1E8Z A;  2UY1 B;  3FUK A;  4I6J A;  4KMO A;  5G04 J;  3HVE B;  1VDY A;  3TG4 A;  3CK8 A;  1OWN A;  1HH8 A;  2A5U A;  4JVS A;  3LY8 A;  1JWF A;  3NF1 A;  3FTW A;  3ZYM A;  2R59 A;  3FUI A;  2WQH A;  2C0L A;  4E85 A;  2C0M A;  2C2L A;  1HG5 A;  2XPY A;  3WXX A;  2HO1 A;  3BEE A;  4F1S A;  2R17 C;  4WWN A;  3G2S A;  4XX5 A;  3G2U A;  1HFA A;  5AJL A;  4LER A;  2WVI A;  3FH7 A;  4UWL A;  1JPL A;  3PRZ A;  3QWW A;  3QAQ A;  4E6H A;  1PY1 A;  2CHZ A;  4MS6 A;  2WXF A;  5G04 C;  4HOT A;  2J4D A;  4JHR A;  4U0Z A;  3PE4 A;  3SFZ A;  2HYZ A;  4I17 A;  3KEZ A;  2Y4U A;  5FZS A;  4EZJ A;  4F7A A;  2QFC A;  3ZN3 A;  5DBK A;  3TL5 A;  3S2A A;  4NUR A;  4KVO A;  1H0A A;  3ZYK A;  4CRW A;  3JUI A;  2XPI A;  2XRZ A;  3LJ3 A;  4PDX A;  1NZN A;  3T5V A;  3GW4 A;  1TEZ A;  3FUL A;  4HOU A;  5D0Q D;  4MKT A;  4R7L A;  4J8S A;  4J0U A;  2IOS A;  5FQ4 A;  2WMO A;  3IBE A;  4A3V A;  3G2T A;  5FT9 A;  3MX3 A;  1DVP A;  3QWP A;  4BX8 A;  2L0T B;  5DIZ A;  1BPO A;  3MGB A;  4LUN U;  1H2U A;  3CKB A;  3VTX A;  1HG2 A;  4O6F A;  4AXH A;  2DCP A;  2WXG A;  4FA6 A;  2AWI A;  2IOL A;  3DBS A;  5J08 A;  2J49 A;  3CV0 A;  1SZ9 A;  2XEV A;  3SBS A;  3ZGQ A;  2PQN A;  4ANV A;  4AIF A;  1N52 A;  2WMN A;  3HDX A;  3SNX A;  4GML A;  1SZA A;  5T4Y A;  3MV2 B;  3APD A;  3FH8 A;  3MZL B;  4ATG A;  4EPZ A;  2WB2 A;  3FUM A;  3FTY A;  4BT8 A;  3VLF A;  2YQ8 A;  3UT4 A;  3ZIM A;  3C98 A;  5EDS A;  3ML8 A;  2WXK A;  1JWG A;  3QDN A;  1HE8 A;  2WPV A;  4GPK A;  4UI9 J;  4H7Y A;  3FTZ A;  2GRL A;  2R5S A;  4KYO B;  4U63 A;  3ZW3 A;  2VTB B;  3CR3 A;  1Y6I A;  3QKY A;  2VJ8 A;  2MOW A;  1QQE A;  2NSZ A;  3PUJ A;  2FEZ A;  4BY6 A;  4J8E A;  1PC2 A;  2DIW A;  5BV0 A;  4AJW A;  3B7T A;  1OWP A;  2LAI A;  4CCA A;  5BT1 A;  4GA0 A;  4BTA A;  5BNW A;  4N2Q A;  3UUX A;  1UW4 B;  3RU0 A;  4ANW A;  1GW6 A;  3LS8 A;  3L16 A;  4EEC A;  4N3C A;  4D10 C;  4YVQ C;  3Q49 B;  4Q94 A;  3ENE A;  4UI9 C;  2YNQ A;  4APF A;  3FEY A;  5CCM A;  3I3N A;  4N3A A;  5G2N A;  4J6I A;  3U66 A;  3FTX A;  4DI3 A;  4RG6 A;  4G23 A;  2J07 A;  2JLB A;  3ESK A;  4WWP A;  3EIJ A;  4ANU A;  3D9N A;  4AP2 A;  1FCH A;  3IEG A;  3RJV A;  2VSO E;  4L7T A;  1HS6 A;  2GW1 A;  4FLB A;  2LAH A;  4KXK B;  4L2L A;  2A4Z A;  4I2W A;  1L5J A;  5CHE E;  3EJN A;  3FH5 A;  1XNF A;  4N39 A;  1IQU A;  2RG8 A;  3ZFW A;  4URK A;  4GYO A;  4RG9 A;  4BWR A;  3AS8 A;  4DK5 A;  2X6J A;  3ULQ A;  4I6E A;  4L1B A;  3PZD A;  3FFL A;  3GZ2 A;  5EX3 A;  4BFR A;  5AIJ A;  2VGY A;  1SQM A;  3DPD A;  4DLQ A;  2AW6 A;  1DNP A;  3SGH A;  3FWV A;  5LCW J;  4LRZ A;  4FLH A;  3CQC B;  4FJZ A;  5KJK A;  3PDN A;  3D9J A;  1Z3Y A;  3CHQ A;  3CVP A;  3OXG A;  3D9I A;  3LKU A;  4GB9 A;  1ZU2 A;  3BG0 B;  4JEH A;  3PEU B;  3CHR A;  3ZEF A;  2J08 A;  2VSY A;  3BG1 B;  5JJT A;  3RIB A;  2IU1 A;  3L13 A;  1UN8 A;  2EQX A;  2XCB A;  3E4B A;  4UQY A;  4HVB A;  4GA1 A;  1TJC A;  5BUZ A;  4IN3 B;  2CFU A;  4OVV A;  4KZ0 A;  3L6A A;  4I9C A;  4XZ4 A;  4AV7 A;  1B89 A;  4I2Z A;  5D0O D;  2E0I A;  5LCW C;  3CK9 A;  4DI4 A;  3D9L A;  2VGX B;  4PS3 A;  2UY1 A;  3ZRH A;  3L08 A;  3LXU X;  3HVE A;  3URZ A;  4K0R A;  2IJG X;  2LSU A;  3TG5 A;  4KZC A;  3L17 A;  3RRU A;  3AS4 A;  5CCL A;  4CEM A;  4WAF A;  4HOR A;  2QY7 A;  5BV1 A;  2XGO A;  4AY5 A;  1OWO A;  3QAR A;  4GA2 A;  4GAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...