4EPZA

Crystal structure of a transcription anti-terminator antagonist upxz (bacuni_04315) from bacteroides uniformis atcc 8492 at 1.68 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
160
structure length
154
Chain Sequence
b'NSLLSRALELQRMAHELMYLIYSDEFCRLNKEVLTRSDSLFSEQSSDIEEEGNLCLALLMGYNATIYDNGDKERKKQVILDRIYNIMSQLPASLLKMRLLTWGYSETYDEELAHEAHQLIETWNISDLTDEQKEIIEELRNFEENQYPWEEVQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcription anti-terminator antagonist UpxZ
publication title Crystal structure of a transcription anti-terminator antagonist UpxZ (BACUNI_04315) from Bacteroides uniformis ATCC 8492 at 1.68 A resolution
rcsb
source organism Bacteroides uniformis atcc 8492
molecule tags Transcription
total genus 61
structure length 154
sequence length 160
ec nomenclature
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06603 UpxZ UpxZ family of transcription anti-terminator antagonists
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.810 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4epzA00
4EPZA
chains in the Genus database with same CATH superfamily
1BI8B 3GZ1A 4FULA 1NA3A 2LUHA 3HRAA 3MV3B 3PZ1A 4Q96A 2JLBA 4G8LA 2P58C 1SVXA 3C3OA 5FQ7A 5BXOA 4B8CB 1LD7A 4GZCA 1ZBPA 1ELWA 1S70B 3ZGQA 3PE4A 2ZXWE 4B8AA 3MZLB 3ESLA 1LTXA 2PM6A 4ANXA 2AWIA 3B7UX 3HXCA 1DCQA 5ENPD 1NZNA 3PH0C 3SD5A 4I6EA 1NFIE 1TNOA 3F6QA 4DLQA 3ZHEB 3FTUA 2PQRA 1MYOA 5H7PA 3ZNGA 2ZISA 4C9BB 5BNWA 3PUKA 4B89A 3S7JA 4W9RA 5BUZA 3UKUG 3I4GA 4FLBA 4N39A 2J08A 1TJFA 4Z68A 5C1DA 1H2VC 3ABLE 5JJ7A 1DCEA 3RRUA 5AIJA 3B13A 3CSFA 1HE8A 2F37A 4JL0A 3L9TA 5CHEE 2YHEA 4GPMA 4YDEA 2VSNA 3G2SA 5JJ6A 3CHOA 5ENRD 1DNPA 2LNIA 1TNBA 4U96D 4D10C 4FU3A 3V2OA 2DIWA 3ZYMA 4G25A 1LD8A 1KT0A 5ENSD 2GRRB 4UQXA 3U9WA 3E4BA 4UI9K 3PZDA 5EDSA 2ILRA 1NA0A 2KZTB 4HI8A 2WQ7A 2C0MA 4U8HA 2GROB 3CK7A 3FEYA 4Q94A 4U7EB 3SBSA 4LNUD 1MX4A 1TNYA 2DYRE 2V4LA 1HZ4A 5DBKA 3BQOA 4O1PA 2OOEA 5EN5D 1K1BA 3ZIMA 1N4RA 4XZ4A 3BU8A 3EDTB 3LVQE 4U95D 4HRLA 5AQAA 4Y6CA 5D0OD 3UT7A 2WMNA 2EIKE 2RD0A 1E7UA 3RSEG 4URKA 5EIDA 3LDZA 4OVUA 1BU9A 1SW6A 3I5PA 4XEIG 3ZPJA 3EHQA 2XPZA 1A17A 3QDNA 3RRMB 3CGHA 4UQYA 5D66A 2XGSA 1MZCA 4GA2A 1E8WA 2BUGA 5C2YA 2IONA 2VQ2A 4V3IA 2VYIA 2XEVA 3DPDA 1U3CA 3R7RA 1TN6A 1QZ2A 2V0PA 4BT8A 5KJKA 3AG3E 2GRQB 1IYGA 3FTYA 1OCZE 5LP0A 1K8KG 3DEOA 3BUAA 2XGOA 1JWGA 1YA0A 4J8SA 3IXEA 3EJNA 2M63A 3C98A 2FI7A 2XPIA 3E30A 1TJCA 3CHQA 3AS8A 4XI9A 3UM0A 2I1JA 5CBOA 1QNFA 2HYZA 2XQ0A 2HE0A 3QC1A 3JCKC 2J4BA 3QK0A 2CFUA 5LX8A 2KM4A 3EU5A 4FHJA 4N3CA 1IQUA 4G24A 2J07A 4JEHA 3W9GA 4HLEA 4FJYA 1N95A 4GB9A 4P29A 5BV1A 3KSQA 3UM3A 3ZYKA 2WXQA 2KC7A 4I1OB 4KZCA 1OUVA 4N3BA 2GRNB 4RG6A 3FUDA 4AM9A 2WXPA 3J5PA 2R17C 4GTTA 3CK9A 3SO8A 2IU1A 2QY7A 3FUHA 3ULQA 3UMVA 3PUJA 3S7BA 3LXUX 5FZRA 2EQXA 5G55A 3FTSA 4IYPA 1UN9A 4EPZA 5FTPA 3PZ4A 4AXHA 3PNLB 3ONKA 5JA4D 5G05J 3CQCB 5CECB 4GCOA 2P2CP 4G1TA 1Z5SC 3LS8A 2B0OE 1MX6A 5AN8A 3TJPA 4BSZB 3QWVA 2P9SG 1QQEA 2XEHA 4I17A 5FINA 3D9HA 4ANVA 2WB2A 4E6HA 3ZYQA 5T3RA 5AAOA 4TRQA 1OXJA 2V4HC 1X5BA 1PC2A 3ULYA 4J8EA 3D9JA 3DSSA 1QYMA 4MLPA 1TEZA 4NIKA 3RIBA 1VDYA 1JCRA 2QYJA 4KT6B 2ONDA 3QARA 3HHMA 4Q69A 2WQHA 3CVPA 2VGXA 5KJNA 1O1RA 2ZGGA 4GA0A 5CERB 4GZ3A 3AAAC 3V2XA 4ANWA 3E34A 4HOQA 2EILE 2VTBA 5EILA 2HM8A 3LVRE 4H7XA 2MHKA 1NP7A 4YNDA 3CQGB 3ZKJA 4C48B 5B1BE 2WXRA 5HKPA 2X38A 2C0LA 2WXHA 3U4TA 4KBQA 3CKCA 5ENOD 3KS2A 4N2QA 3CHPA 3V30A 3ASHA 3NZSA 4NQ0A 3RU0A 4FHKA 1HO8A 2Y4TA 4GTPA 3TG4A 3FH7A 3RRNB 2UY1B 2H6HA 4LEUA 3G2VA 3LYAA 2NC9A 5AQ9A 3RJVA 1OCCE 4PUCA 4BY6A 5BT1A 5AARA 1FT1A 4LRZA 1HH8A 2Y1LE 4HQDA 3B7BA 3CIAA 3JQ1A 3PZ2A 4GZDA 3FTZA 3GZSA 4JVSA 2WXIA 3APFA 2A5EA 3MCXA 1NL4A 4N5CA 5B1AE 4XX5A 1DC2A 4EZKA 3R9MA 2CG2A 4HNAD 1P5QA 1OCRE 3LY8A 5BPPA 5CBNA 5DIZA 5LCWJ 3FUEA 1Q2ZA 4WNFA 2YNQA 2IO3C 3Q7FA 2Q7FA 4CGVA 2ZIRA 4GTSA 2J4DA 2HR2A 1UOHA 4F53A 4U8VD 4B93B 4CCAA 3D9PA 3MEKA 3FULA 3TWXA 4BFRA 3L54A 3UM1A 2AW6A 2IOSA 5AJLA 1U3DA 3IBEA 4GYYA 1N4QA 5FJYA 3PZ3A 4XI0A 3TWWA 3CVLA 2LAIA 1JWFA 3LCAA 3SNXA 3CVWA 2OVFA 3MV2B 2P9PG 2MRIA 1BD8A 4GTQA 1N52A 4F7AA 2L0IA 3ZXPA 2R59A 2LXMA 3DSWA 2GRPB 3Q78A 2L0TB 1H2TC 4PS3A 3B7RL 2R02A 4CDMA 4JC8A 3I3NA 4ME2A 4I2WA 2A4ZA 4F3VA 2OV8A 2BEDA 5T4YA 3SY2A 4MS6A 3PE3A 2L6JA 5BW8C 4KMOA 4EBAA 2P9LG 1EDUA 1AWCB 2OEVA 3DEPA 1KZPA 2J09A 2LXLA 3U3WA 4A3VA 2DVWA 3DPYA 1V55E 4DX7D 3D9OA 2LSVA 3J5QB 1OCOE 2F8YA 3ZUVB 1Y8MA 4UWHA 1K1AA 1HS6A 2WXFA 3DBSA 1UG3A 2XHEA 4JB8P 4PS7A 3FUFA 1OY3D 1N4PA 3ENEA 4AIFA 4F1PA 2XEEA 5CMWA 4AEZC 4M3OA 3KAEA 3FFLA 2V8SE 1FT2A 4K5BA 4J0UA 3Q15A 4OAUC 3Q75A 3AJIA 1FVFA 3UPVA 3Q79A 5EKQD 4B94A 2JEKA 2P9NG 2IJGX 4ILGA 1WY6A 5CRUA 3NB2A 4I6GA 3VTXA 5B3SE 2I1KA 3UXGA 5FZQA 4PDXA 4JA7A 4TXQA 4BEPA 3FU3A 2IF4A 3C3RA 4UWGA 2VGXB 2ETAA 4ABNA 1KLXA 1N54A 3SQVA 4JA9A 4HS2A 4BSXA 2VTBB 4JPSA 5ENTD 2OCCE 4BWRA 1N4SA 1TYQG 3EHNA 4JHRA 3JUEA 3G2WA 5EX3A 2X3MA 1ZU2A 4X8QA 4FA6A 4N5QA 3WG7E 3IHYA 3JQ0A 5FQ6A 3VLEA 2XCCA 1WAO1 1D9SA 3UX4A 2XCBA 5EX0A 2X6JA 4AJWA 1TN7A 3KEZA 2ETBA 1D8EA 3CVNA 3ZVVA 2BKKB 1H6PA 2AXZA 2H6FA 3DWLG 3VLFA 5HQ8A 4ATZD 5HS0A 3QNKA 3HIZA 4UWKA 2PM7A 2I2OA 2BTDA 3E37A 3CK8A 3ASGA 4U0UA 2KBXA 5AYWD 3TAXA 5AQBA 3UT8A 1QBQA 3HXBA 2V5QC 4NURA 5LFAA 4TXRA 1XGWA 4K0RA 3SI5A 2FO1E 3FTWA 3LY9A 4PS8A 5D2MC 2XS8A 3UM2A 4MKTA 1NI1A 1MJ0A 1S64A 1JPLA 5CCLA 1E7VA 4DJAA 4GA1A 1D8DA 4HOTA 2KCLA 1BLXB 3BG0B 1U2VG 2CG3A 4HI9A 5KCMA 2QFCA 4CGWA 4RG9A 3FWVA 3DRAA 3T8KA 1UJJA 4FP7A 3DSUA 3TXNA 3ULEG 3CVXA 3HYMB 3PDNA 2VSOE 4GYWA 2AXVA 2H6IA 2L6BA 3D9LA 1HU3A 2EINE 4JD2G 1Z3XA 1ELKA 2XPYA 5J90A 1N9AA 4DI4A 3TWQA 5JJTA 3P1UA 3ZEFA 3UIPC 5CRVA 4QFVA 3B7SA 5KNGA 2RFAA 4UQZA 4I1MA 3DSTA 2VGEA 2YINA 3WXXA 2IQCA 4L2YA 5G04J 3TXMA 4CEMA 1UN8A 5CEDB 3EU9A 4L1BA 3ZHEA 3ISMC 2R05A 5CCMA 4JHKA 2J8SD 4I43A 4L7TA 4LG6A 3S7DA 4WWNA 1KZOA 4GMLA 3OXFA 2F0YA 5ENNA 4HB5A 3PVLA 3CVYA 1B89A 1YYHA 2WMOA 4L23A 3E32A 1HG2A 2R03A 3ONLA 1EYHA 3MA5A 3NQPA 4WWOA 5FQ8A 5A6CA 3CSTA 3PREA 4ANUA 5ITZF 4AY6A 1G3NB 2I9CA 2WVIA 4E85A 4APOA 3CHSA 3ZN3A 4IN3B 3FTXA 3MKQA 1H6KA 4IULA 2X6HA 3L17A 4A63B 2GGFA 2KZTA 3LY7A 1UJKA 4FLHA 3D9IA 3V31A 3ZW3A 3QOUA 3IEGA 2Y69E 3FTVA 4EQFA 3SGHA 2WM9A 4ZHBA 4ILIA 4KZ0A 3S7FA 4JXTA 4JHJA 2DZNA 2QC9A 3LJ3A 2JABA 3AU4A 1UW4B 2ETCA 1IKND 1N94A 1E8YA 4YDWA 3Q47B 3C3QA 4TUUA 4O60A 3TWRA 2DYSE 4EZJA 1W3BA 1XNFA 4PH4B 1S0PA 1AP7A 4WAFA 4F6RD 3RO2A 3QAQA 4AVXA 3MYVA 4HRNA 3UUXA 2WXLA 4MRUA 3BG1B 4YDOA 3AS5A 2IY0C 4FC8A 3HXDA 4GPKA 2I6HA 2RKKA 2QZAA 3UT4A 2WXMA 3CVQA 2MYOA 1HG5A 3JYSA 1L5JA 1E96B 3L22A 2AJAA 4K5CA 4RQIA 3ZFWA 3TWVA 2XGMA 5EYLA 1O5MA 1OWOA 5FWQA 2FBNA 4I2ZA 3RKVA 4EZLA 3PS6A 4B0ZA 4CDNA 2BF0X 3HDXA 3ZU7B 3RK6A 3D3MA 3KD7A 2WXNA 4NACA 3OXGA 1MX2A 4XKCA 2J9QA 1MQSA 1JUQA 1SQMA 2CFZA 2MOWA 4G26A 4BETA 3N71A 3LKUA 3PEVB 2P9KG 1HX8A 3FUNA 2R5SA 2GRLA 3HVEA 5G05C 1X81A 2AVPA 3Q4AB 4F1SA 1YMPA 3HXFA 3CR3A 4BX9A 1K3ZD 1SZAA 3CVVA 3G2UA 3JXJA 3UI2A 2WQ6A 5FZSA 4CT4A 2Y0BG 2KXPC 2NSZA 4HXIA 3FH8A 5ARFA 5AENA 1PY1A 3TWTA 3EIQC 3NZUA 2XENA 3SHFA 3ZYLA 1SA4A 3Q49B 4HFGA 3DXKG 1E90A 4L2LA 4XE0A 3TL5A 1SA5A 3HG0D 2Y3AA 1O1SA 3MJWA 3GW4A 4RVBA 4DK5A 3SFXA 3ASDA 3IHVA 4DRXE 3FUJA 4G23A 4Y6WA 3LJNA 3QWWA 2ZU6B 2DWZA 5CMYA 4BTBA 4GTVA 1YCSB 3MKRA 3MGBA 1WM5A 4I6JA 4K5AB 4UI9J 4ACKA 3B7TA 4UWLA 4JW1A 4GCNA 1RZ4A 4CZ2D 2L9BA 1KT1A 4HORA 4HVBA 4ZFHA 5ANRA 4EECA 3ASFA 3L16A 3ABKE 4O1OA 2V5FA 3B95A 3FUIA 4DX2A 2VSYA 5ENQD 3HXEA 1O1TA 2GRMA 4CYMD 2WXOA 2KCVA 1TN8A 1N11A 1S63A 4LSZE 3RAUA 3S2AA 2E2EA 4NRHB 4R7LA 3FEXA 4U04A 5KNHD 3QB2A 3DXMG 3L08A 2PL2A 3Q9NC 2NXPA 3LPZA 5G2NA 3SFYA 2IEJA 2BKGA 2DBAA 3L13A 1H6OA 1Z3YA 2R2LA 3MKQB 5JHBA 3CV0A 3GYZA 2WXJA 2FO7A 1KPSB 3NOCD 3ESKA 4KVOA 3FH5A 4TXPA 2X6KA 4EHMA 4A3TA 2X6FA 4RLYA 4I9CA 1JCQA 3T5VA 4A55A 4CT0A 2KATA 4AP2A 1OWMA 4HOUA 4J8FA 2HO1A 5A23A 5LCWC 2UY1A 1TR4A 1MHQA 4GMJA 1BPOA 2CHWA 1HFAA 5JHAA 1H0AA 3UQ3A 4XKBA 4WNDA 1V54E 2RG8A 4DPRA 2XRZA 4U8YD 3QWPA 4L9PA 4I1AA 3K9IA 3IV0A 3TGOA 1IQRA 4KYOB 5LOZA 4WUYA 2LO6A 4IRUA 3Q7AA 1ZB1A 1HF8A 1OWNA 3EHMA 3U66A 2PQNA 4LUNU 3OXLA 5E76A 3AG4E 2P9UG 4ATGA 4YDYA 5D0QD 4ACLA 2VGYA 4JEUA 5AJDA 3CHMA 4N3AA 2QYUA 4J7WA 3URZA 5A7DB 2WPVA 1SZ9A 5BXUA 4WWPA 3ZRHA 3PNTB 5IY5E 5FT9A 4GAAA 4EBAG 3DSVA 1GW6A 2EIME 3Q73A 4OAVB 3QJZA 3ML9A 4A1GA 3FP3A 4HRMB 3L6AA 3Q9UC 4U0SA 1FVHA 5ARGA 3GZ2A 3NF1A 4C0MA 3ASOE 3PRZA 3I4RB 4DX6D 3V79K 1WG0A 3FUKA 4J8DA 4CDRA 5KJLA 4J8YA 3OAWA 4GU5A 2WXGA 4WNEA 4U63A 3NOGD 4GTOA 3ML8A 2VJ8A 4APFA 4WNGA 5KJMA 3R7QA 4JZYA 1EPUA 3AS4A 3NAWA 3FU6A 4U07A 3W9FA 1A5EA 3HVEB 4GZ6A 2GW1A 3QKYA 4UI9C 3TWSA 3U64A 3SBTB 3E33A 4HLLA 3UIOC 2E0IA 3SZ7A 4O6FA 1JCSA 2A5UA 2FF4A 3LEWA 2OVBA 4OVVA 1BI7B 3APCA 3EUVA 3PEUB 4DUIA 3KSLA 4FJZA 3SF4A 3T5XA 2YHCA 1TNZA 3ZXSA 4BX8A 2ZGDA 1Y6IA 5KWDA 4H7YA 2Y4UA 4UWFA 4DI3A 3BEEA 4C0EA 3AU5A 4DX5D 2AXUA 2IFUA 2XZDG 4J6IA 4M7CA 3AG2E 3CHRA 4BTAA 3L82A 1WDYA 4AOFA 4TUMA 4QQIA 4BESA 4LCTA 4ILHB 5KBAA 2EIJE 1H19A 2CHXA 3DSXA 2IOLA 4I9EA 4AV7A 3TWUA 1E8ZA 4OYSA 5FIOA 3TG5A 2H6GA 3SFZA 1FCHA 2NYJA 1IHGA 3OTNA 3VTYA 2XS1A 4G8KA 3T9KA 3C5RA 3EIJA 3D9MA 4LNBA 1OWPA 3D9NA 5T8IA 2F8XK 3FY4A 3FU5A 3X2QE 3D9KA 5JMND 3ASNE 1EF1C 4XIFA 3VLDA 2YQ8A 2KCKA 4CRWA 2WXKA 2CHZA 4KXKB 3FDHA 1N0RA 4GTRA 3CLJA 2FULA 1LF8A 4GMRA 5M72A 4HBDA 3UKRG 2DZOA 4FADA 2FEZA 4HOSA 3IKOB 4DX1A 2DCPA 4U0ZA 5J08A 3JXIA 3UTMA 5FQ4A 4TV3A 3MX3A 2C2LA 1PAQA 1RW2A 4UUCA 2RFMA 1Z6TA 5AQ7A 3ABME 3G2TA 4MBGA 5HI7A 3FU0A 3CVUA 3T8MA 2B6CA 2P9IG 4DLOA 3NBNB 1IHBA 4A1SA 3O4ZA 4N2SA 4BT9A 3FHEA 1TNUA 1INZA 3C72A 2XRYA 5HRYA 5ANLA 4YVOA 4G11A 2XZTG 3Q5MA 3KEAA 4GZ5A 4G2VA 2PZIA 1N0QA 1E8XA 5E75A 2J49A 1OWLA 3CKBA 4BERA 2OEWA 1OT8A 1IXVA 1ELRA 1DVPA 3CEQA 3O48A 3RO3A 5EIBE 1H2UA 5EYPF 4KVMA 3APDA 3R9AB 3UINC 2UWJG 2LAHA 2X6IA 5BV0A 3JUIA 4YVQC 3FUMA 2VSXE 2LSUA 1HXIA 2IO2C 2PNNA 3EHRA 4GYOA 5G04C 4GTMA 5CEAA 1FPPA 4RSYA 4AY5A 4LNGA 3AG1E 4LERA 3P2BA 4K03A
chains in the Genus database with same CATH topology
2HM8A 4RG9A 3GZ1A 3LVRE 4FULA 1NA3A 3FWVA 4H7XA 2MHKA 1NP7A 3MV3B 2JLBA 4Q96A 4YNDA 3CQGB 1UJJA 4FP7A 3ESKA 2P58C 3TXNA 2WXRA 2X38A 5FQ7A 3CVXA 4KVOA 2C0LA 3FH5A 3HYMB 3PDNA 2VSOE 2WXHA 2X6KA 3U4TA 4A3TA 4KBQA 2X6FA 4GYWA 2AXVA 4B8CB 4I9CA 3D9LA 3CKCA 1HU3A 3T5VA 4GZCA 1ZBPA 4A55A 3KS2A 1Z3XA 1ELWA 1ELKA 2KATA 3CHPA 4AP2A 4CT0A 4N2QA 2XPYA 1OWMA 4HOUA 3ASHA 4J8FA 5J90A 2HO1A 3NZSA 4NQ0A 4DI4A 5A23A 3RU0A 5LCWC 2UY1A 5JJTA 3P1UA 1MHQA 4GMJA 4FHKA 1HO8A 2Y4TA 1BPOA 3ZEFA 2CHWA 1HFAA 3ZGQA 5JHAA 1H0AA 3UQ3A 4XKBA 3PE4A 4WNDA 3TG4A 4B8AA 2RG8A 3FH7A 3MZLB 3RRNB 2UY1B 4QFVA 3B7SA 3ESLA 4UQZA 4DPRA 4LEUA 2XRZA 3G2VA 4I1MA 3QWPA 3LYAA 4I1AA 3K9IA 3IV0A 3TGOA 2YINA 1IQRA 2NC9A 2PM6A 4KYOB 3RJVA 5LOZA 3WXXA 2AWIA 4ANXA 3B7UX 4WUYA 2IQCA 4PUCA 4BY6A 2LO6A 5BT1A 4L2YA 5G04J 4IRUA 3TXMA 4LRZA 1HH8A 1HF8A 4CEMA 1OWNA 3EHMA 1UN8A 3U66A 1NZNA 2PQNA 3PH0C 4LUNU 4L1BA 3ZHEA 3OXLA 5CCMA 5E76A 3SD5A 4JHKA 4I6EA 3CIAA 4I43A 4ATGA 4L7TA 3JQ1A 4GZDA 3S7DA 5D0QD 3FTZA 3GZSA 4ACLA 4WWNA 2VGYA 4DLQA 4GMLA 4JEUA 3OXFA 3ZHEB 4JVSA 5AJDA 3CHMA 2WXIA 4N3AA 3APFA 3FTUA 2PQRA 3URZA 5ENNA 5A7DB 2WPVA 4C9BB 1SZ9A 3PVLA 3CVYA 3MCXA 4WWPA 1B89A 4N5CA 5BNWA 3PUKA 4B89A 3ZRHA 3PNTB 3S7JA 5FT9A 4GAAA 4W9RA 4XX5A 4EZKA 5BUZA 4EBAG 2WMOA 4L23A 3I4GA 2CG2A 1GW6A 1P5QA 3QJZA 1HG2A 3LY8A 4FLBA 2J08A 4N39A 5BPPA 3ONLA 1EYHA 1TJFA 5DIZA 3ML9A 5LCWJ 3FUEA 3MA5A 5C1DA 3NQPA 1H2VC 4WNFA 4WWOA 2YNQA 5JJ7A 4A1GA 3RRUA 3FP3A 5FQ8A 5AIJA 3B13A 3CSFA 3L6AA 2Q7FA 1HE8A 5A6CA 4JL0A 3CSTA 3PREA 4ANUA 4AY6A 5CHEE 4CGVA 2YHEA 2I9CA 2J4DA 4U0SA 2WVIA 2VSNA 3G2SA 1FVHA 5ARGA 5JJ6A 2HR2A 3GZ2A 4F53A 3CHOA 3NF1A 4E85A 4C0MA 3PRZA 3D9PA 4APOA 4CCAA 3CHSA 1DNPA 3ZN3A 2LNIA 3MEKA 3FULA 4IN3B 3FTXA 3L54A 4BFRA 3MKQA 4D10C 2AW6A 1H6KA 2IOSA 3I4RB 4FU3A 4IULA 5AJLA 1U3DA 3IBEA 4GYYA 2DIWA 3FUKA 4J8DA 3ZYMA 5FJYA 4G25A 4XI0A 4CDRA 2X6HA 5KJLA 3L17A 1KT0A 2GGFA 2KZTA 3OAWA 4GU5A 2WXGA 4UQXA 3E4BA 3U9WA 4WNEA 3LY7A 3CVLA 4U63A 3PZDA 4UI9K 1UJKA 5EDSA 2ILRA 2LAIA 1JWFA 1NA0A 3ML8A 4FLHA 2VJ8A 3LCAA 4APFA 2KZTB 4WNGA 3D9IA 3SNXA 2WQ7A 5KJMA 2C0MA 4U8HA 3CVWA 3R7QA 3ZW3A 3CK7A 3QOUA 2OVFA 3IEGA 3FEYA 3MV2B 4JZYA 3FTVA 4Q94A 3SBSA 4EQFA 1EPUA 3AS4A 2MRIA 3SGHA 2WM9A 3FU6A 4ILIA 4KZ0A 3S7FA 4U07A 3HVEB 4JXTA 4JHJA 1N52A 4F7AA 2L0IA 2V4LA 3LJ3A 2R59A 4GZ6A 1HZ4A 2GW1A 3AU4A 5DBKA 3QKYA 1UW4B 4UI9C 2OOEA 3U64A 3SBTB 3ZIMA 1E8YA 2L0TB 4XZ4A 1H2TC 3EDTB 3LVQE 3Q47B 4PS3A 4TUUA 4EZJA 4Y6CA 1W3BA 1XNFA 5D0OD 3B7RL 3UT7A 2WMNA 2E0IA 4PH4B 2RD0A 4CDMA 3SZ7A 1S0PA 4O6FA 4JC8A 4WAFA 1E7UA 3I3NA 4ME2A 4I2WA 4URKA 2A4ZA 2A5UA 4F3VA 3LDZA 4OVUA 2FF4A 3RO2A 2OV8A 3QAQA 5T4YA 4MS6A 3LEWA 3I5PA 2L6JA 2OVBA 3PE3A 4OVVA 3ZPJA 4AVXA 3APCA 5BW8C 3MYVA 3PEUB 2XPZA 4FJZA 4KMOA 3SF4A 4EBAA 1A17A 1EDUA 3QDNA 2YHCA 3RRMB 2WXLA 3CGHA 3T5XA 3UUXA 4MRUA 4UQYA 3BG1B 2XGSA 3ZXSA 4BX8A 3AS5A 4FC8A 4GA2A 2J09A 1E8WA 2BUGA 5C2YA 4GPKA 1Y6IA 2IONA 3U3WA 4H7YA 2Y4UA 2I6HA 2VQ2A 4UWFA 3UT4A 4DI3A 3BEEA 4V3IA 4A3VA 4C0EA 2WXMA 3AU5A 3CVQA 2VYIA 2XEVA 2AXUA 3D9OA 3DPDA 2LSVA 1U3CA 3R7RA 2IFUA 1QZ2A 1HG5A 2V0PA 4J6IA 3JYSA 4BT8A 1L5JA 5KJKA 1E96B 1Y8MA 4UWHA 3L22A 1IYGA 1HS6A 3CHRA 3FTYA 3ZFWA 4BTAA 2WXFA 3DBSA 5LP0A 1UG3A 2XHEA 2XGMA 1OWOA 4PS7A 4AOFA 3FUFA 4LCTA 5FWQA 2XGOA 4ILHB 3ENEA 4AIFA 2FBNA 4I2ZA 1JWGA 5CMWA 3RKVA 4AEZC 4M3OA 3KAEA 1YA0A 3FFLA 3PS6A 4EZLA 4B0ZA 4CDNA 2V8SE 1H19A 2BF0X 4J0UA 4J8SA 2CHXA 3EJNA 3Q15A 2M63A 3HDXA 2IOLA 3C98A 2FI7A 1E8ZA 4I9EA 4OYSA 1FVFA 2XPIA 1TJCA 3TG5A 4AV7A 3UPVA 3RK6A 3CHQA 3AS8A 3SFZA 3D3MA 4XI9A 3KD7A 2I1JA 2WXNA 4NACA 1FCHA 3OXGA 5EKQD 4B94A 1QNFA 2JEKA 1IHGA 4XKCA 3OTNA 3VTYA 2HYZA 2J9QA 1MQSA 2XQ0A 3QC1A 3JCKC 1JUQA 1SQMA 2CFZA 2J4BA 2MOWA 3QK0A 4G26A 3EIJA 2CFUA 2IJGX 3D9MA 4ILGA 5LX8A 1OWPA 3D9NA 2KM4A 1WY6A 5T8IA 3N71A 3LKUA 3PEVB 4FHJA 3FY4A 4I6GA 4N3CA 3FU5A 3VTXA 1IQUA 1HX8A 2I1KA 3FUNA 2R5SA 4G24A 5FZQA 2J07A 2GRLA 4JEHA 4JA7A 4PDXA 3HVEA 5G05C 4HLEA 4FJYA 3FU3A 2IF4A 2AVPA 3Q4AB 4GB9A 3D9KA 4P29A 2VGXB 4UWGA 1EF1C 4F1SA 4ABNA 5BV1A 1KLXA 4XIFA 3VLDA 1N54A 3CR3A 4BX9A 3ZYKA 2WXQA 2YQ8A 2KC7A 1SZAA 2KCKA 4I1OB 4CRWA 2WXKA 3CVVA 4JA9A 3G2UA 4HS2A 2CHZA 4KZCA 4BSXA 4KXKB 2WQ6A 3FDHA 2VTBB 1OUVA 4JPSA 5FZSA 4N3BA 4RG6A 3FUDA 3CLJA 4AM9A 2FULA 4CT4A 2NSZA 1LF8A 4HXIA 4BWRA 5M72A 2WXPA 3EHNA 3FH8A 5ARFA 5AENA 4JHRA 3G2WA 5EX3A 2R17C 4FADA 2X3MA 2FEZA 4HOSA 3CK9A 1PY1A 1ZU2A 2IU1A 3IKOB 2QY7A 3EIQC 2DCPA 3NZUA 4FA6A 3FUHA 3ULQA 4U0ZA 3SHFA 3IHYA 5J08A 3UMVA 3JQ0A 3PUJA 4TV3A 5FQ4A 3ZYLA 5FQ6A 3MX3A 3Q49B 3S7BA 2C2LA 1PAQA 4HFGA 3VLEA 1E90A 3LXUX 2XCCA 2EQXA 4L2LA 4XE0A 1WAO1 3FTSA 5FZRA 5G55A 3UX4A 2XCBA 4IYPA 1UN9A 1Z6TA 4EPZA 5EX0A 2X6JA 3TL5A 5FTPA 4AJWA 3KEZA 2Y3AA 3MJWA 3GW4A 4RVBA 4AXHA 3PNLB 3ONKA 3G2TA 5G05J 4DK5A 3CQCB 3ASDA 3IHVA 4GCOA 3CVNA 3FU0A 3FUJA 4G23A 4Y6WA 5HI7A 3T8MA 3CVUA 3QWWA 4G1TA 2ZU6B 3ZVVA 3LS8A 4DLOA 2AXZA 3VLFA 5HQ8A 5CMYA 4BTBA 4A1SA 3O4ZA 3MKRA 4BT9A 3FHEA 4N2SA 3QNKA 3TJPA 3MGBA 1INZA 3HIZA 1WM5A 3QWVA 4I6JA 4UWKA 4UI9J 4ACKA 2PM7A 2XRYA 1QQEA 3B7TA 4I17A 4UWLA 2I2OA 4JW1A 2BTDA 5ANLA 4ANVA 4GCNA 4YVOA 2WB2A 3CK8A 2L9BA 1KT1A 4G11A 4E6HA 4HORA 3ZYQA 3Q5MA 3ASGA 4GZ5A 4U0UA 4HVBA 4G2VA 5ANRA 2PZIA 5T3RA 4EECA 1E8XA 5E75A 2J49A 1OWLA 3CKBA 3ASFA 3L16A 4TRQA 5AYWD 1X5BA 3TAXA 2V5FA 1PC2A 3FUIA 2VSYA 3UT8A 1ELRA 1DVPA 3CEQA 2GRMA 4J8EA 3O48A 3D9JA 2WXOA 2KCVA 3RO3A 1H2UA 4KVMA 3APDA 4NURA 4MLPA 3S2AA 1TEZA 5LFAA 1XGWA 3R9AB 3RIBA 1VDYA 2UWJG 4K0RA 3SI5A 2E2EA 2LAHA 2X6IA 4KT6B 2ONDA 3FTWA 5BV0A 3JUIA 3LY9A 4NRHB 4R7LA 3FEXA 4PS8A 4YVQC 4U04A 3QARA 3FUMA 3HHMA 4Q69A 3QB2A 3L08A 2VSXE 2WQHA 4MKTA 3CVPA 1JPLA 5CCLA 2PL2A 1E7VA 2NXPA 2VGXA 4DJAA 2LSUA 1HXIA 4GA1A 5KJNA 4GYOA 3LPZA 5G2NA 4HOTA 4GA0A 5G04C 4GZ3A 2DBAA 4RSYA 4AY5A 2KCLA 3L13A 3BG0B 2CG3A 4ANWA 1Z3YA 3MKQB 4LERA 5KCMA 5JHBA 3CV0A 2QFCA 4HOQA 3GYZA 3P2BA 4CGWA 2VTBA 2WXJA 4K03A 2FO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EPZ A; 
#chains in the Genus database with same CATH topology
 1BI8 B;  3GZ1 A;  4FUL A;  1NA3 A;  2LUH A;  3HRA A;  3MV3 B;  3PZ1 A;  4Q96 A;  2JLB A;  4G8L A;  2P58 C;  1SVX A;  3C3O A;  5FQ7 A;  5BXO A;  4B8C B;  1LD7 A;  4GZC A;  1ZBP A;  1ELW A;  1S70 B;  3ZGQ A;  3PE4 A;  2ZXW E;  4B8A A;  3MZL B;  3ESL A;  1LTX A;  2PM6 A;  4ANX A;  2AWI A;  3B7U X;  3HXC A;  1DCQ A;  5ENP D;  1NZN A;  3PH0 C;  3SD5 A;  4I6E A;  1NFI E;  1TNO A;  3F6Q A;  4DLQ A;  3ZHE B;  3FTU A;  2PQR A;  1MYO A;  5H7P A;  3ZNG A;  2ZIS A;  4C9B B;  5BNW A;  3PUK A;  4B89 A;  3S7J A;  4W9R A;  5BUZ A;  3UKU G;  3I4G A;  4FLB A;  4N39 A;  2J08 A;  1TJF A;  4Z68 A;  5C1D A;  1H2V C;  3ABL E;  5JJ7 A;  1DCE A;  3RRU A;  5AIJ A;  3B13 A;  3CSF A;  1HE8 A;  2F37 A;  4JL0 A;  3L9T A;  5CHE E;  2YHE A;  4GPM A;  4YDE A;  2VSN A;  3G2S A;  5JJ6 A;  3CHO A;  5ENR D;  1DNP A;  2LNI A;  1TNB A;  4U96 D;  4D10 C;  4FU3 A;  3V2O A;  2DIW A;  3ZYM A;  4G25 A;  1LD8 A;  1KT0 A;  5ENS D;  2GRR B;  4UQX A;  3U9W A;  3E4B A;  4UI9 K;  3PZD A;  5EDS A;  2ILR A;  1NA0 A;  2KZT B;  4HI8 A;  2WQ7 A;  2C0M A;  4U8H A;  2GRO B;  3CK7 A;  3FEY A;  4Q94 A;  4U7E B;  3SBS A;  4LNU D;  1MX4 A;  1TNY A;  2DYR E;  2V4L A;  1HZ4 A;  5DBK A;  3BQO A;  4O1P A;  2OOE A;  5EN5 D;  1K1B A;  3ZIM A;  1N4R A;  4XZ4 A;  3BU8 A;  3EDT B;  3LVQ E;  4U95 D;  4HRL A;  5AQA A;  4Y6C A;  5D0O D;  3UT7 A;  2WMN A;  2EIK E;  2RD0 A;  1E7U A;  3RSE G;  4URK A;  5EID A;  3LDZ A;  4OVU A;  1BU9 A;  1SW6 A;  3I5P A;  4XEI G;  3ZPJ A;  3EHQ A;  2XPZ A;  1A17 A;  3QDN A;  3RRM B;  3CGH A;  4UQY A;  5D66 A;  2XGS A;  1MZC A;  4GA2 A;  1E8W A;  2BUG A;  5C2Y A;  2ION A;  2VQ2 A;  4V3I A;  2VYI A;  2XEV A;  3DPD A;  1U3C A;  3R7R A;  1TN6 A;  1QZ2 A;  2V0P A;  4BT8 A;  5KJK A;  3AG3 E;  2GRQ B;  1IYG A;  3FTY A;  1OCZ E;  5LP0 A;  1K8K G;  3DEO A;  3BUA A;  2XGO A;  1JWG A;  1YA0 A;  4J8S A;  3IXE A;  3EJN A;  2M63 A;  3C98 A;  2FI7 A;  2XPI A;  3E30 A;  1TJC A;  3CHQ A;  3AS8 A;  4XI9 A;  3UM0 A;  2I1J A;  5CBO A;  1QNF A;  2HYZ A;  2XQ0 A;  2HE0 A;  3QC1 A;  3JCK C;  2J4B A;  3QK0 A;  2CFU A;  5LX8 A;  2KM4 A;  3EU5 A;  4FHJ A;  4N3C A;  1IQU A;  4G24 A;  2J07 A;  4JEH A;  3W9G A;  4HLE A;  4FJY A;  1N95 A;  4GB9 A;  4P29 A;  5BV1 A;  3KSQ A;  3UM3 A;  3ZYK A;  2WXQ A;  2KC7 A;  4I1O B;  4KZC A;  1OUV A;  4N3B A;  2GRN B;  4RG6 A;  3FUD A;  4AM9 A;  2WXP A;  3J5P A;  2R17 C;  4GTT A;  3CK9 A;  3SO8 A;  2IU1 A;  2QY7 A;  3FUH A;  3ULQ A;  3UMV A;  3PUJ A;  3S7B A;  3LXU X;  5FZR A;  2EQX A;  5G55 A;  3FTS A;  4IYP A;  1UN9 A;  4EPZ A;  5FTP A;  3PZ4 A;  4AXH A;  3PNL B;  3ONK A;  5JA4 D;  5G05 J;  3CQC B;  5CEC B;  4GCO A;  2P2C P;  4G1T A;  1Z5S C;  3LS8 A;  2B0O E;  1MX6 A;  5AN8 A;  3TJP A;  4BSZ B;  3QWV A;  2P9S G;  1QQE A;  2XEH A;  4I17 A;  5FIN A;  3D9H A;  4ANV A;  2WB2 A;  4E6H A;  3ZYQ A;  5T3R A;  5AAO A;  4TRQ A;  1OXJ A;  2V4H C;  1X5B A;  1PC2 A;  3ULY A;  4J8E A;  3D9J A;  3DSS A;  1QYM A;  4MLP A;  1TEZ A;  4NIK A;  3RIB A;  1VDY A;  1JCR A;  2QYJ A;  4KT6 B;  2OND A;  3QAR A;  3HHM A;  4Q69 A;  2WQH A;  3CVP A;  2VGX A;  5KJN A;  1O1R A;  2ZGG A;  4GA0 A;  5CER B;  4GZ3 A;  3AAA C;  3V2X A;  4ANW A;  3E34 A;  4HOQ A;  2EIL E;  2VTB A;  5EIL A;  2HM8 A;  3LVR E;  4H7X A;  2MHK A;  1NP7 A;  4YND A;  3CQG B;  3ZKJ A;  4C48 B;  5B1B E;  2WXR A;  5HKP A;  2X38 A;  2C0L A;  2WXH A;  3U4T A;  4KBQ A;  3CKC A;  5ENO D;  3KS2 A;  4N2Q A;  3CHP A;  3V30 A;  3ASH A;  3NZS A;  4NQ0 A;  3RU0 A;  4FHK A;  1HO8 A;  2Y4T A;  4GTP A;  3TG4 A;  3FH7 A;  3RRN B;  2UY1 B;  2H6H A;  4LEU A;  3G2V A;  3LYA A;  2NC9 A;  5AQ9 A;  3RJV A;  1OCC E;  4PUC A;  4BY6 A;  5BT1 A;  5AAR A;  1FT1 A;  4LRZ A;  1HH8 A;  2Y1L E;  4HQD A;  3B7B A;  3CIA A;  3JQ1 A;  3PZ2 A;  4GZD A;  3FTZ A;  3GZS A;  4JVS A;  2WXI A;  3APF A;  2A5E A;  3MCX A;  1NL4 A;  4N5C A;  5B1A E;  4XX5 A;  1DC2 A;  4EZK A;  3R9M A;  2CG2 A;  4HNA D;  1P5Q A;  1OCR E;  3LY8 A;  5BPP A;  5CBN A;  5DIZ A;  5LCW J;  3FUE A;  1Q2Z A;  4WNF A;  2YNQ A;  2IO3 C;  3Q7F A;  2Q7F A;  4CGV A;  2ZIR A;  4GTS A;  2J4D A;  2HR2 A;  1UOH A;  4F53 A;  4U8V D;  4B93 B;  4CCA A;  3D9P A;  3MEK A;  3FUL A;  3TWX A;  4BFR A;  3L54 A;  3UM1 A;  2AW6 A;  2IOS A;  5AJL A;  1U3D A;  3IBE A;  4GYY A;  1N4Q A;  5FJY A;  3PZ3 A;  4XI0 A;  3TWW A;  3CVL A;  2LAI A;  1JWF A;  3LCA A;  3SNX A;  3CVW A;  2OVF A;  3MV2 B;  2P9P G;  2MRI A;  1BD8 A;  4GTQ A;  1N52 A;  4F7A A;  2L0I A;  3ZXP A;  2R59 A;  2LXM A;  3DSW A;  2GRP B;  3Q78 A;  2L0T B;  1H2T C;  4PS3 A;  3B7R L;  2R02 A;  4CDM A;  4JC8 A;  3I3N A;  4ME2 A;  4I2W A;  2A4Z A;  4F3V A;  2OV8 A;  2BED A;  5T4Y A;  3SY2 A;  4MS6 A;  3PE3 A;  2L6J A;  5BW8 C;  4KMO A;  4EBA A;  2P9L G;  1EDU A;  1AWC B;  2OEV A;  3DEP A;  1KZP A;  2J09 A;  2LXL A;  3U3W A;  4A3V A;  2DVW A;  3DPY A;  1V55 E;  4DX7 D;  3D9O A;  2LSV A;  3J5Q B;  1OCO E;  2F8Y A;  3ZUV B;  1Y8M A;  4UWH A;  1K1A A;  1HS6 A;  2WXF A;  3DBS A;  1UG3 A;  2XHE A;  4JB8 P;  4PS7 A;  3FUF A;  1OY3 D;  1N4P A;  3ENE A;  4AIF A;  4F1P A;  2XEE A;  5CMW A;  4AEZ C;  4M3O A;  3KAE A;  3FFL A;  2V8S E;  1FT2 A;  4K5B A;  4J0U A;  3Q15 A;  4OAU C;  3Q75 A;  3AJI A;  1FVF A;  3UPV A;  3Q79 A;  5EKQ D;  4B94 A;  2JEK A;  2P9N G;  2IJG X;  4ILG A;  1WY6 A;  5CRU A;  3NB2 A;  4I6G A;  3VTX A;  5B3S E;  2I1K A;  3UXG A;  5FZQ A;  4PDX A;  4JA7 A;  4TXQ A;  4BEP A;  3FU3 A;  2IF4 A;  3C3R A;  4UWG A;  2VGX B;  2ETA A;  4ABN A;  1KLX A;  1N54 A;  3SQV A;  4JA9 A;  4HS2 A;  4BSX A;  2VTB B;  4JPS A;  5ENT D;  2OCC E;  4BWR A;  1N4S A;  1TYQ G;  3EHN A;  4JHR A;  3JUE A;  3G2W A;  5EX3 A;  2X3M A;  1ZU2 A;  4X8Q A;  4FA6 A;  4N5Q A;  3WG7 E;  3IHY A;  3JQ0 A;  5FQ6 A;  3VLE A;  2XCC A;  1WAO 1;  1D9S A;  3UX4 A;  2XCB A;  5EX0 A;  2X6J A;  4AJW A;  1TN7 A;  3KEZ A;  2ETB A;  1D8E A;  3CVN A;  3ZVV A;  2BKK B;  1H6P A;  2AXZ A;  2H6F A;  3DWL G;  3VLF A;  5HQ8 A;  4ATZ D;  5HS0 A;  3QNK A;  3HIZ A;  4UWK A;  2PM7 A;  2I2O A;  2BTD A;  3E37 A;  3CK8 A;  3ASG A;  4U0U A;  2KBX A;  5AYW D;  3TAX A;  5AQB A;  3UT8 A;  1QBQ A;  3HXB A;  2V5Q C;  4NUR A;  5LFA A;  4TXR A;  1XGW A;  4K0R A;  3SI5 A;  2FO1 E;  3FTW A;  3LY9 A;  4PS8 A;  5D2M C;  2XS8 A;  3UM2 A;  4MKT A;  1NI1 A;  1MJ0 A;  1S64 A;  1JPL A;  5CCL A;  1E7V A;  4DJA A;  4GA1 A;  1D8D A;  4HOT A;  2KCL A;  1BLX B;  3BG0 B;  1U2V G;  2CG3 A;  4HI9 A;  5KCM A;  2QFC A;  4CGW A;  4RG9 A;  3FWV A;  3DRA A;  3T8K A;  1UJJ A;  4FP7 A;  3DSU A;  3TXN A;  3ULE G;  3CVX A;  3HYM B;  3PDN A;  2VSO E;  4GYW A;  2AXV A;  2H6I A;  2L6B A;  3D9L A;  1HU3 A;  2EIN E;  4JD2 G;  1Z3X A;  1ELK A;  2XPY A;  5J90 A;  1N9A A;  4DI4 A;  3TWQ A;  5JJT A;  3P1U A;  3ZEF A;  3UIP C;  5CRV A;  4QFV A;  3B7S A;  5KNG A;  2RFA A;  4UQZ A;  4I1M A;  3DST A;  2VGE A;  2YIN A;  3WXX A;  2IQC A;  4L2Y A;  5G04 J;  3TXM A;  4CEM A;  1UN8 A;  5CED B;  3EU9 A;  4L1B A;  3ZHE A;  3ISM C;  2R05 A;  5CCM A;  4JHK A;  2J8S D;  4I43 A;  4L7T A;  4LG6 A;  3S7D A;  4WWN A;  1KZO A;  4GML A;  3OXF A;  2F0Y A;  5ENN A;  4HB5 A;  3PVL A;  3CVY A;  1B89 A;  1YYH A;  2WMO A;  4L23 A;  3E32 A;  1HG2 A;  2R03 A;  3ONL A;  1EYH A;  3MA5 A;  3NQP A;  4WWO A;  5FQ8 A;  5A6C A;  3CST A;  3PRE A;  4ANU A;  5ITZ F;  4AY6 A;  1G3N B;  2I9C A;  2WVI A;  4E85 A;  4APO A;  3CHS A;  3ZN3 A;  4IN3 B;  3FTX A;  3MKQ A;  1H6K A;  4IUL A;  2X6H A;  3L17 A;  4A63 B;  2GGF A;  2KZT A;  3LY7 A;  1UJK A;  4FLH A;  3D9I A;  3V31 A;  3ZW3 A;  3QOU A;  3IEG A;  2Y69 E;  3FTV A;  4EQF A;  3SGH A;  2WM9 A;  4ZHB A;  4ILI A;  4KZ0 A;  3S7F A;  4JXT A;  4JHJ A;  2DZN A;  2QC9 A;  3LJ3 A;  2JAB A;  3AU4 A;  1UW4 B;  2ETC A;  1IKN D;  1N94 A;  1E8Y A;  4YDW A;  3Q47 B;  3C3Q A;  4TUU A;  4O60 A;  3TWR A;  2DYS E;  4EZJ A;  1W3B A;  1XNF A;  4PH4 B;  1S0P A;  1AP7 A;  4WAF A;  4F6R D;  3RO2 A;  3QAQ A;  4AVX A;  3MYV A;  4HRN A;  3UUX A;  2WXL A;  4MRU A;  3BG1 B;  4YDO A;  3AS5 A;  2IY0 C;  4FC8 A;  3HXD A;  4GPK A;  2I6H A;  2RKK A;  2QZA A;  3UT4 A;  2WXM A;  3CVQ A;  2MYO A;  1HG5 A;  3JYS A;  1L5J A;  1E96 B;  3L22 A;  2AJA A;  4K5C A;  4RQI A;  3ZFW A;  3TWV A;  2XGM A;  5EYL A;  1O5M A;  1OWO A;  5FWQ A;  2FBN A;  4I2Z A;  3RKV A;  4EZL A;  3PS6 A;  4B0Z A;  4CDN A;  2BF0 X;  3HDX A;  3ZU7 B;  3RK6 A;  3D3M A;  3KD7 A;  2WXN A;  4NAC A;  3OXG A;  1MX2 A;  4XKC A;  2J9Q A;  1MQS A;  1JUQ A;  1SQM A;  2CFZ A;  2MOW A;  4G26 A;  4BET A;  3N71 A;  3LKU A;  3PEV B;  2P9K G;  1HX8 A;  3FUN A;  2R5S A;  2GRL A;  3HVE A;  5G05 C;  1X81 A;  2AVP A;  3Q4A B;  4F1S A;  1YMP A;  3HXF A;  3CR3 A;  4BX9 A;  1K3Z D;  1SZA A;  3CVV A;  3G2U A;  3JXJ A;  3UI2 A;  2WQ6 A;  5FZS A;  4CT4 A;  2Y0B G;  2KXP C;  2NSZ A;  4HXI A;  3FH8 A;  5ARF A;  5AEN A;  1PY1 A;  3TWT A;  3EIQ C;  3NZU A;  2XEN A;  3SHF A;  3ZYL A;  1SA4 A;  3Q49 B;  4HFG A;  3DXK G;  1E90 A;  4L2L A;  4XE0 A;  3TL5 A;  1SA5 A;  3HG0 D;  2Y3A A;  1O1S A;  3MJW A;  3GW4 A;  4RVB A;  4DK5 A;  3SFX A;  3ASD A;  3IHV A;  4DRX E;  3FUJ A;  4G23 A;  4Y6W A;  3LJN A;  3QWW A;  2ZU6 B;  2DWZ A;  5CMY A;  4BTB A;  4GTV A;  1YCS B;  3MKR A;  3MGB A;  1WM5 A;  4I6J A;  4K5A B;  4UI9 J;  4ACK A;  3B7T A;  4UWL A;  4JW1 A;  4GCN A;  1RZ4 A;  4CZ2 D;  2L9B A;  1KT1 A;  4HOR A;  4HVB A;  4ZFH A;  5ANR A;  4EEC A;  3ASF A;  3L16 A;  3ABK E;  4O1O A;  2V5F A;  3B95 A;  3FUI A;  4DX2 A;  2VSY A;  5ENQ D;  3HXE A;  1O1T A;  2GRM A;  4CYM D;  2WXO A;  2KCV A;  1TN8 A;  1N11 A;  1S63 A;  4LSZ E;  3RAU A;  3S2A A;  2E2E A;  4NRH B;  4R7L A;  3FEX A;  4U04 A;  5KNH D;  3QB2 A;  3DXM G;  3L08 A;  2PL2 A;  3Q9N C;  2NXP A;  3LPZ A;  5G2N A;  3SFY A;  2IEJ A;  2BKG A;  2DBA A;  3L13 A;  1H6O A;  1Z3Y A;  2R2L A;  3MKQ B;  5JHB A;  3CV0 A;  3GYZ A;  2WXJ A;  2FO7 A;  1KPS B;  3NOC D;  3ESK A;  4KVO A;  3FH5 A;  4TXP A;  2X6K A;  4EHM A;  4A3T A;  2X6F A;  4RLY A;  4I9C A;  1JCQ A;  3T5V A;  4A55 A;  4CT0 A;  2KAT A;  4AP2 A;  1OWM A;  4HOU A;  4J8F A;  2HO1 A;  5A23 A;  5LCW C;  2UY1 A;  1TR4 A;  1MHQ A;  4GMJ A;  1BPO A;  2CHW A;  1HFA A;  5JHA A;  1H0A A;  3UQ3 A;  4XKB A;  4WND A;  1V54 E;  2RG8 A;  4DPR A;  2XRZ A;  4U8Y D;  3QWP A;  4L9P A;  4I1A A;  3K9I A;  3IV0 A;  3TGO A;  1IQR A;  4KYO B;  5LOZ A;  4WUY A;  2LO6 A;  4IRU A;  3Q7A A;  1ZB1 A;  1HF8 A;  1OWN A;  3EHM A;  3U66 A;  2PQN A;  4LUN U;  3OXL A;  5E76 A;  3AG4 E;  2P9U G;  4ATG A;  4YDY A;  5D0Q D;  4ACL A;  2VGY A;  4JEU A;  5AJD A;  3CHM A;  4N3A A;  2QYU A;  4J7W A;  3URZ A;  5A7D B;  2WPV A;  1SZ9 A;  5BXU A;  4WWP A;  3ZRH A;  3PNT B;  5IY5 E;  5FT9 A;  4GAA A;  4EBA G;  3DSV A;  1GW6 A;  2EIM E;  3Q73 A;  4OAV B;  3QJZ A;  3ML9 A;  4A1G A;  3FP3 A;  4HRM B;  3L6A A;  3Q9U C;  4U0S A;  1FVH A;  5ARG A;  3GZ2 A;  3NF1 A;  4C0M A;  3ASO E;  3PRZ A;  3I4R B;  4DX6 D;  3V79 K;  1WG0 A;  3FUK A;  4J8D A;  4CDR A;  5KJL A;  4J8Y A;  3OAW A;  4GU5 A;  2WXG A;  4WNE A;  4U63 A;  3NOG D;  4GTO A;  3ML8 A;  2VJ8 A;  4APF A;  4WNG A;  5KJM A;  3R7Q A;  4JZY A;  1EPU A;  3AS4 A;  3NAW A;  3FU6 A;  4U07 A;  3W9F A;  1A5E A;  3HVE B;  4GZ6 A;  2GW1 A;  3QKY A;  4UI9 C;  3TWS A;  3U64 A;  3SBT B;  3E33 A;  4HLL A;  3UIO C;  2E0I A;  3SZ7 A;  4O6F A;  1JCS A;  2A5U A;  2FF4 A;  3LEW A;  2OVB A;  4OVV A;  1BI7 B;  3APC A;  3EUV A;  3PEU B;  4DUI A;  3KSL A;  4FJZ A;  3SF4 A;  3T5X A;  2YHC A;  1TNZ A;  3ZXS A;  4BX8 A;  2ZGD A;  1Y6I A;  5KWD A;  4H7Y A;  2Y4U A;  4UWF A;  4DI3 A;  3BEE A;  4C0E A;  3AU5 A;  4DX5 D;  2AXU A;  2IFU A;  2XZD G;  4J6I A;  4M7C A;  3AG2 E;  3CHR A;  4BTA A;  3L82 A;  1WDY A;  4AOF A;  4TUM A;  4QQI A;  4BES A;  4LCT A;  4ILH B;  5KBA A;  2EIJ E;  1H19 A;  2CHX A;  3DSX A;  2IOL A;  4I9E A;  4AV7 A;  3TWU A;  1E8Z A;  4OYS A;  5FIO A;  3TG5 A;  2H6G A;  3SFZ A;  1FCH A;  2NYJ A;  1IHG A;  3OTN A;  3VTY A;  2XS1 A;  4G8K A;  3T9K A;  3C5R A;  3EIJ A;  3D9M A;  4LNB A;  1OWP A;  3D9N A;  5T8I A;  2F8X K;  3FY4 A;  3FU5 A;  3X2Q E;  3D9K A;  5JMN D;  3ASN E;  1EF1 C;  4XIF A;  3VLD A;  2YQ8 A;  2KCK A;  4CRW A;  2WXK A;  2CHZ A;  4KXK B;  3FDH A;  1N0R A;  4GTR A;  3CLJ A;  2FUL A;  1LF8 A;  4GMR A;  5M72 A;  4HBD A;  3UKR G;  2DZO A;  4FAD A;  2FEZ A;  4HOS A;  3IKO B;  4DX1 A;  2DCP A;  4U0Z A;  5J08 A;  3JXI A;  3UTM A;  5FQ4 A;  4TV3 A;  3MX3 A;  2C2L A;  1PAQ A;  1RW2 A;  4UUC A;  2RFM A;  1Z6T A;  5AQ7 A;  3ABM E;  3G2T A;  4MBG A;  5HI7 A;  3FU0 A;  3CVU A;  3T8M A;  2B6C A;  2P9I G;  4DLO A;  3NBN B;  1IHB A;  4A1S A;  3O4Z A;  4N2S A;  4BT9 A;  3FHE A;  1TNU A;  1INZ A;  3C72 A;  2XRY A;  5HRY A;  5ANL A;  4YVO A;  4G11 A;  2XZT G;  3Q5M A;  3KEA A;  4GZ5 A;  4G2V A;  2PZI A;  1N0Q A;  1E8X A;  5E75 A;  2J49 A;  1OWL A;  3CKB A;  4BER A;  2OEW A;  1OT8 A;  1IXV A;  1ELR A;  1DVP A;  3CEQ A;  3O48 A;  3RO3 A;  5EIB E;  1H2U A;  5EYP F;  4KVM A;  3APD A;  3R9A B;  3UIN C;  2UWJ G;  2LAH A;  2X6I A;  5BV0 A;  3JUI A;  4YVQ C;  3FUM A;  2VSX E;  2LSU A;  1HXI A;  2IO2 C;  2PNN A;  3EHR A;  4GYO A;  5G04 C;  4GTM A;  5CEA A;  1FPP A;  4RSY A;  4AY5 A;  4LNG A;  3AG1 E;  4LER A;  3P2B A;  4K03 A; 
#chains in the Genus database with same CATH homology
 2HM8 A;  4RG9 A;  3GZ1 A;  3LVR E;  4FUL A;  1NA3 A;  3FWV A;  4H7X A;  2MHK A;  1NP7 A;  3MV3 B;  2JLB A;  4Q96 A;  4YND A;  3CQG B;  1UJJ A;  4FP7 A;  3ESK A;  2P58 C;  3TXN A;  2WXR A;  2X38 A;  5FQ7 A;  3CVX A;  4KVO A;  2C0L A;  3FH5 A;  3HYM B;  3PDN A;  2VSO E;  2WXH A;  2X6K A;  3U4T A;  4A3T A;  4KBQ A;  2X6F A;  4GYW A;  2AXV A;  4B8C B;  4I9C A;  3D9L A;  3CKC A;  1HU3 A;  3T5V A;  4GZC A;  1ZBP A;  4A55 A;  3KS2 A;  1Z3X A;  1ELW A;  1ELK A;  2KAT A;  3CHP A;  4AP2 A;  4CT0 A;  4N2Q A;  2XPY A;  1OWM A;  4HOU A;  3ASH A;  4J8F A;  5J90 A;  2HO1 A;  3NZS A;  4NQ0 A;  4DI4 A;  5A23 A;  3RU0 A;  5LCW C;  2UY1 A;  5JJT A;  3P1U A;  1MHQ A;  4GMJ A;  4FHK A;  1HO8 A;  2Y4T A;  1BPO A;  3ZEF A;  2CHW A;  1HFA A;  3ZGQ A;  5JHA A;  1H0A A;  3UQ3 A;  4XKB A;  3PE4 A;  4WND A;  3TG4 A;  4B8A A;  2RG8 A;  3FH7 A;  3MZL B;  3RRN B;  2UY1 B;  4QFV A;  3B7S A;  3ESL A;  4UQZ A;  4DPR A;  4LEU A;  2XRZ A;  3G2V A;  4I1M A;  3QWP A;  3LYA A;  4I1A A;  3K9I A;  3IV0 A;  3TGO A;  2YIN A;  1IQR A;  2NC9 A;  2PM6 A;  4KYO B;  3RJV A;  5LOZ A;  3WXX A;  2AWI A;  4ANX A;  3B7U X;  4WUY A;  2IQC A;  4PUC A;  4BY6 A;  2LO6 A;  5BT1 A;  4L2Y A;  5G04 J;  4IRU A;  3TXM A;  4LRZ A;  1HH8 A;  1HF8 A;  4CEM A;  1OWN A;  3EHM A;  1UN8 A;  3U66 A;  1NZN A;  2PQN A;  3PH0 C;  4LUN U;  4L1B A;  3ZHE A;  3OXL A;  5CCM A;  5E76 A;  3SD5 A;  4JHK A;  4I6E A;  3CIA A;  4I43 A;  4ATG A;  4L7T A;  3JQ1 A;  4GZD A;  3S7D A;  5D0Q D;  3FTZ A;  3GZS A;  4ACL A;  4WWN A;  2VGY A;  4DLQ A;  4GML A;  4JEU A;  3OXF A;  3ZHE B;  4JVS A;  5AJD A;  3CHM A;  2WXI A;  4N3A A;  3APF A;  3FTU A;  2PQR A;  3URZ A;  5ENN A;  5A7D B;  2WPV A;  4C9B B;  1SZ9 A;  3PVL A;  3CVY A;  3MCX A;  4WWP A;  1B89 A;  4N5C A;  5BNW A;  3PUK A;  4B89 A;  3ZRH A;  3PNT B;  3S7J A;  5FT9 A;  4GAA A;  4W9R A;  4XX5 A;  4EZK A;  5BUZ A;  4EBA G;  2WMO A;  4L23 A;  3I4G A;  2CG2 A;  1GW6 A;  1P5Q A;  3QJZ A;  1HG2 A;  3LY8 A;  4FLB A;  2J08 A;  4N39 A;  5BPP A;  3ONL A;  1EYH A;  1TJF A;  5DIZ A;  3ML9 A;  5LCW J;  3FUE A;  3MA5 A;  5C1D A;  3NQP A;  1H2V C;  4WNF A;  4WWO A;  2YNQ A;  5JJ7 A;  4A1G A;  3RRU A;  3FP3 A;  5FQ8 A;  5AIJ A;  3B13 A;  3CSF A;  3L6A A;  2Q7F A;  1HE8 A;  5A6C A;  4JL0 A;  3CST A;  3PRE A;  4ANU A;  4AY6 A;  5CHE E;  4CGV A;  2YHE A;  2I9C A;  2J4D A;  4U0S A;  2WVI A;  2VSN A;  3G2S A;  1FVH A;  5ARG A;  5JJ6 A;  2HR2 A;  3GZ2 A;  4F53 A;  3CHO A;  3NF1 A;  4E85 A;  4C0M A;  3PRZ A;  3D9P A;  4APO A;  4CCA A;  3CHS A;  1DNP A;  3ZN3 A;  2LNI A;  3MEK A;  3FUL A;  4IN3 B;  3FTX A;  3L54 A;  4BFR A;  3MKQ A;  4D10 C;  2AW6 A;  1H6K A;  2IOS A;  3I4R B;  4FU3 A;  4IUL A;  5AJL A;  1U3D A;  3IBE A;  4GYY A;  2DIW A;  3FUK A;  4J8D A;  3ZYM A;  5FJY A;  4G25 A;  4XI0 A;  4CDR A;  2X6H A;  5KJL A;  3L17 A;  1KT0 A;  2GGF A;  2KZT A;  3OAW A;  4GU5 A;  2WXG A;  4UQX A;  3E4B A;  3U9W A;  4WNE A;  3LY7 A;  3CVL A;  4U63 A;  3PZD A;  4UI9 K;  1UJK A;  5EDS A;  2ILR A;  2LAI A;  1JWF A;  1NA0 A;  3ML8 A;  4FLH A;  2VJ8 A;  3LCA A;  4APF A;  2KZT B;  4WNG A;  3D9I A;  3SNX A;  2WQ7 A;  5KJM A;  2C0M A;  4U8H A;  3CVW A;  3R7Q A;  3ZW3 A;  3CK7 A;  3QOU A;  2OVF A;  3IEG A;  3FEY A;  3MV2 B;  4JZY A;  3FTV A;  4Q94 A;  3SBS A;  4EQF A;  1EPU A;  3AS4 A;  2MRI A;  3SGH A;  2WM9 A;  3FU6 A;  4ILI A;  4KZ0 A;  3S7F A;  4U07 A;  3HVE B;  4JXT A;  4JHJ A;  1N52 A;  4F7A A;  2L0I A;  2V4L A;  3LJ3 A;  2R59 A;  4GZ6 A;  1HZ4 A;  2GW1 A;  3AU4 A;  5DBK A;  3QKY A;  1UW4 B;  4UI9 C;  2OOE A;  3U64 A;  3SBT B;  3ZIM A;  1E8Y A;  2L0T B;  4XZ4 A;  1H2T C;  3EDT B;  3LVQ E;  3Q47 B;  4PS3 A;  4TUU A;  4EZJ A;  4Y6C A;  1W3B A;  1XNF A;  5D0O D;  3B7R L;  3UT7 A;  2WMN A;  2E0I A;  4PH4 B;  2RD0 A;  4CDM A;  3SZ7 A;  1S0P A;  4O6F A;  4JC8 A;  4WAF A;  1E7U A;  3I3N A;  4ME2 A;  4I2W A;  4URK A;  2A4Z A;  2A5U A;  4F3V A;  3LDZ A;  4OVU A;  2FF4 A;  3RO2 A;  2OV8 A;  3QAQ A;  5T4Y A;  4MS6 A;  3LEW A;  3I5P A;  2L6J A;  2OVB A;  3PE3 A;  4OVV A;  3ZPJ A;  4AVX A;  3APC A;  5BW8 C;  3MYV A;  3PEU B;  2XPZ A;  4FJZ A;  4KMO A;  3SF4 A;  4EBA A;  1A17 A;  1EDU A;  3QDN A;  2YHC A;  3RRM B;  2WXL A;  3CGH A;  3T5X A;  3UUX A;  4MRU A;  4UQY A;  3BG1 B;  2XGS A;  3ZXS A;  4BX8 A;  3AS5 A;  4FC8 A;  4GA2 A;  2J09 A;  1E8W A;  2BUG A;  5C2Y A;  4GPK A;  1Y6I A;  2ION A;  3U3W A;  4H7Y A;  2Y4U A;  2I6H A;  2VQ2 A;  4UWF A;  3UT4 A;  4DI3 A;  3BEE A;  4V3I A;  4A3V A;  4C0E A;  2WXM A;  3AU5 A;  3CVQ A;  2VYI A;  2XEV A;  2AXU A;  3D9O A;  3DPD A;  2LSV A;  1U3C A;  3R7R A;  2IFU A;  1QZ2 A;  1HG5 A;  2V0P A;  4J6I A;  3JYS A;  4BT8 A;  1L5J A;  5KJK A;  1E96 B;  1Y8M A;  4UWH A;  3L22 A;  1IYG A;  1HS6 A;  3CHR A;  3FTY A;  3ZFW A;  4BTA A;  2WXF A;  3DBS A;  5LP0 A;  1UG3 A;  2XHE A;  2XGM A;  1OWO A;  4PS7 A;  4AOF A;  3FUF A;  4LCT A;  5FWQ A;  2XGO A;  4ILH B;  3ENE A;  4AIF A;  2FBN A;  4I2Z A;  1JWG A;  5CMW A;  3RKV A;  4AEZ C;  4M3O A;  3KAE A;  1YA0 A;  3FFL A;  3PS6 A;  4EZL A;  4B0Z A;  4CDN A;  2V8S E;  1H19 A;  2BF0 X;  4J0U A;  4J8S A;  2CHX A;  3EJN A;  3Q15 A;  2M63 A;  3HDX A;  2IOL A;  3C98 A;  2FI7 A;  1E8Z A;  4I9E A;  4OYS A;  1FVF A;  2XPI A;  1TJC A;  3TG5 A;  4AV7 A;  3UPV A;  3RK6 A;  3CHQ A;  3AS8 A;  3SFZ A;  3D3M A;  4XI9 A;  3KD7 A;  2I1J A;  2WXN A;  4NAC A;  1FCH A;  3OXG A;  5EKQ D;  4B94 A;  1QNF A;  2JEK A;  1IHG A;  4XKC A;  3OTN A;  3VTY A;  2HYZ A;  2J9Q A;  1MQS A;  2XQ0 A;  3QC1 A;  3JCK C;  1JUQ A;  1SQM A;  2CFZ A;  2J4B A;  2MOW A;  3QK0 A;  4G26 A;  3EIJ A;  2CFU A;  2IJG X;  3D9M A;  4ILG A;  5LX8 A;  1OWP A;  3D9N A;  2KM4 A;  1WY6 A;  5T8I A;  3N71 A;  3LKU A;  3PEV B;  4FHJ A;  3FY4 A;  4I6G A;  4N3C A;  3FU5 A;  3VTX A;  1IQU A;  1HX8 A;  2I1K A;  3FUN A;  2R5S A;  4G24 A;  5FZQ A;  2J07 A;  2GRL A;  4JEH A;  4JA7 A;  4PDX A;  3HVE A;  5G05 C;  4HLE A;  4FJY A;  3FU3 A;  2IF4 A;  2AVP A;  3Q4A B;  4GB9 A;  3D9K A;  4P29 A;  2VGX B;  4UWG A;  1EF1 C;  4F1S A;  4ABN A;  5BV1 A;  1KLX A;  4XIF A;  3VLD A;  1N54 A;  3CR3 A;  4BX9 A;  3ZYK A;  2WXQ A;  2YQ8 A;  2KC7 A;  1SZA A;  2KCK A;  4I1O B;  4CRW A;  2WXK A;  3CVV A;  4JA9 A;  3G2U A;  4HS2 A;  2CHZ A;  4KZC A;  4BSX A;  4KXK B;  2WQ6 A;  3FDH A;  2VTB B;  1OUV A;  4JPS A;  5FZS A;  4N3B A;  4RG6 A;  3FUD A;  3CLJ A;  4AM9 A;  2FUL A;  4CT4 A;  2NSZ A;  1LF8 A;  4HXI A;  4BWR A;  5M72 A;  2WXP A;  3EHN A;  3FH8 A;  5ARF A;  5AEN A;  4JHR A;  3G2W A;  5EX3 A;  2R17 C;  4FAD A;  2X3M A;  2FEZ A;  4HOS A;  3CK9 A;  1PY1 A;  1ZU2 A;  2IU1 A;  3IKO B;  2QY7 A;  3EIQ C;  2DCP A;  3NZU A;  4FA6 A;  3FUH A;  3ULQ A;  4U0Z A;  3SHF A;  3IHY A;  5J08 A;  3UMV A;  3JQ0 A;  3PUJ A;  4TV3 A;  5FQ4 A;  3ZYL A;  5FQ6 A;  3MX3 A;  3Q49 B;  3S7B A;  2C2L A;  1PAQ A;  4HFG A;  3VLE A;  1E90 A;  3LXU X;  2XCC A;  2EQX A;  4L2L A;  4XE0 A;  1WAO 1;  3FTS A;  5FZR A;  5G55 A;  3UX4 A;  2XCB A;  4IYP A;  1UN9 A;  1Z6T A;  4EPZ A;  5EX0 A;  2X6J A;  3TL5 A;  5FTP A;  4AJW A;  3KEZ A;  2Y3A A;  3MJW A;  3GW4 A;  4RVB A;  4AXH A;  3PNL B;  3ONK A;  3G2T A;  5G05 J;  4DK5 A;  3CQC B;  3ASD A;  3IHV A;  4GCO A;  3CVN A;  3FU0 A;  3FUJ A;  4G23 A;  4Y6W A;  5HI7 A;  3T8M A;  3CVU A;  3QWW A;  4G1T A;  2ZU6 B;  3ZVV A;  3LS8 A;  4DLO A;  2AXZ A;  3VLF A;  5HQ8 A;  5CMY A;  4BTB A;  4A1S A;  3O4Z A;  3MKR A;  4BT9 A;  3FHE A;  4N2S A;  3QNK A;  3TJP A;  3MGB A;  1INZ A;  3HIZ A;  1WM5 A;  3QWV A;  4I6J A;  4UWK A;  4UI9 J;  4ACK A;  2PM7 A;  2XRY A;  1QQE A;  3B7T A;  4I17 A;  4UWL A;  2I2O A;  4JW1 A;  2BTD A;  5ANL A;  4ANV A;  4GCN A;  4YVO A;  2WB2 A;  3CK8 A;  2L9B A;  1KT1 A;  4G11 A;  4E6H A;  4HOR A;  3ZYQ A;  3Q5M A;  3ASG A;  4GZ5 A;  4U0U A;  4HVB A;  4G2V A;  5ANR A;  2PZI A;  5T3R A;  4EEC A;  1E8X A;  5E75 A;  2J49 A;  1OWL A;  3CKB A;  3ASF A;  3L16 A;  4TRQ A;  5AYW D;  1X5B A;  3TAX A;  2V5F A;  1PC2 A;  3FUI A;  2VSY A;  3UT8 A;  1ELR A;  1DVP A;  3CEQ A;  2GRM A;  4J8E A;  3O48 A;  3D9J A;  2WXO A;  2KCV A;  3RO3 A;  1H2U A;  4KVM A;  3APD A;  4NUR A;  4MLP A;  3S2A A;  1TEZ A;  5LFA A;  1XGW A;  3R9A B;  3RIB A;  1VDY A;  2UWJ G;  4K0R A;  3SI5 A;  2E2E A;  2LAH A;  2X6I A;  4KT6 B;  2OND A;  3FTW A;  5BV0 A;  3JUI A;  3LY9 A;  4NRH B;  4R7L A;  3FEX A;  4PS8 A;  4YVQ C;  4U04 A;  3QAR A;  3FUM A;  3HHM A;  4Q69 A;  3QB2 A;  3L08 A;  2VSX E;  2WQH A;  4MKT A;  3CVP A;  1JPL A;  5CCL A;  2PL2 A;  1E7V A;  2NXP A;  2VGX A;  4DJA A;  2LSU A;  1HXI A;  4GA1 A;  5KJN A;  4GYO A;  3LPZ A;  5G2N A;  4HOT A;  4GA0 A;  5G04 C;  4GZ3 A;  2DBA A;  4RSY A;  4AY5 A;  2KCL A;  3L13 A;  3BG0 B;  2CG3 A;  4ANW A;  1Z3Y A;  3MKQ B;  4LER A;  5KCM A;  5JHB A;  3CV0 A;  2QFC A;  4HOQ A;  3GYZ A;  3P2B A;  4CGW A;  2VTB A;  2WXJ A;  4K03 A;  2FO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...