1N11A

D34 region of human ankyrin-r and linker
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
408
structure length
404
Chain Sequence
LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLHRMSFPETVDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Ankyrin
publication title Crystal structure of a 12 ANK repeat stack from human ankyrinR
pubmed doi rcsb
source organism Homo sapiens
total genus 122
structure length 404
sequence length 408
ec nomenclature
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1n11A00
4TUMA 2RFMA 4LSZE 1N11A 4ATZD 2XENA 4G8LA 4LNUD 5EIDA 1K1BA 3JXIA 4HI9A 4N5QA 5ENSD 1N0QA 4U95D 2F8XK 4DX6D 1MX2A 1QYMA 3UTMA 1NFIE 3ZKJA 1UOHA 3DEPA 4DUIA 4U8VD 2Y0BG 3V31A 1S70B 3C5RA 4J8YA 5KNHD 5D66A 3ZUVB 2ETCA 5BXUA 4K5AB 2ZGDA 3B95A 4ZFHA 2AJAA 5CECB 1BLXB 2BKGA 4YDYA 5ENQD 5ENPD 1K1AA 2VGEA 4DRXE 3DEOA 2DWZA 3EHQA 3KEAA 2L6BA 5AARA 3B7BA 3V30A 5EN5D 5EYPF 3W9FA 3F6QA 4HRNA 4BEPA 1WDYA 1BI8B 5EILA 4CZ2D 3TWQA 1BD8A 5KNGA 2KBXA 3V2XA 3ZNGA 3AJIA 5ENTD 4CYMD 4UUCA 4HBDA 2DZOA 1G3NB 4U96D 2BKKB 3TWSA 1N0RA 5AQ7A 3UXGA 4BETA 1YYHA 2MYOA 3TWUA 3TWXA 1K3ZD 2NYJA 4HLLA 3V79K 4DX7D 5JA4D 4HQDA 5CEDB 3EHRA 5ITZF 3IXEA 2QYJA 1YMPA 5AQAA 2QC9A 4NIKA 5CEAA 1SVXA 3JXJA 1OY3D 4Z68A 3NBNB 3Q9UC 3TWVA 5EIBE 4HI8A 4F1PA 3HG0D 1OT8A 3J5QB 3TWTA 2J8SD 2F37A 2HE0A 2V5QC 4K5BA 4RLYA 5FIOA 2ZGGA 2DVWA 2DZNA 2XEEA 4YDWA 2A5EA 4HB5A 3NOCD 4HRMB 1AWCB 3D9HA 1AP7A 1BU9A 4K5CA 5AQ9A 3TWWA 4O60A 3Q9NC 2JABA 1YCSB 1MX6A 1DCQA 4O1PA 3V2OA 5CBNA 3T8KA 1A5EA 2B0OE 2P2CP 2Y1LE 4GMRA 4O1OA 1MJ0A 4A63B 2FO1E 2XEHA 2XZTG 1MX4A 1BI7B 5EYLA 4J7WA 2ETBA 2ETAA 5ENOD 4BESA 1DC2A 5AN8A 2XZDG 1IKND 4G8KA 4BSZB 3AAAC 4LG6A 4U8YD 3W9GA 4HRLA 5HRYA 1SW6A 3UI2A 4OAVB 4QQIA 5CERB 4C48B 4OAUC 4F6RD 5HKPA 5AAOA 5FINA 2KXPC 5ENRD 5JMND 5BXOA 4DX1A 4BERA 1MYOA 3J5PA 3SO8A 2F8YA 5KWDA 5CBOA 5KBAA 4DX5D 4DX2A 3T9KA 5AQBA 3HRAA 1IXVA 1WG0A 3LJNA 4B93B 4ZHBA 4GPMA 3JUEA 2PNNA 3ZU7B 3TWRA 2V4HC 4HNAD 1D9SA 1TR4A 1IHBA 5HS0A 3EU9A 2RFAA 3NOGD 4JB8P 4QFVA
chains in the Genus database with same CATH superfamily
4AVXA 3RIBA 2BF0X 2H6HA 4AIFA 2F8XK 1JUQA 4F7AA 2CHXA 2LXMA 5BXUA 4Q96A 5EX0A 3P1UA 3CQCB 2IF4A 1Z6TA 4BT8A 3MKRA 1H2UA 3TJPA 4B8CB 2UWJG 3Q4AB 3WG7E 2KBXA 3PE3A 4J0UA 2Q7FA 3EHRA 4WWNA 1YMPA 5B3SE 2UY1B 5CEAA 3D9IA 3TAXA 3ZYLA 3HXEA 4LNBA 1JPLA 4GTSA 1ZU2A 2R03A 2ZGGA 2KZTB 1UN8A 3Q15A 2Y4TA 3RU0A 4XE0A 5AYWD 2WM9A 3V2OA 5EKQD 1KPSB 1MJ0A 2FI7A 2J49A 1BI7B 3KSQA 4J7WA 3GZ2A 2XZDG 4U8YD 3FH8A 2I1KA 1HG2A 2WXOA 3MYVA 4BERA 3EIQC 2DYSE 3MA5A 4GPMA 3AS8A 4J8DA 3PE4A 1INZA 1LD7A 2WXPA 5DBKA 4EBAG 1DCEA 1N11A 1D8EA 2XENA 3Q7FA 1N0QA 1SA4A 3CHOA 3FUFA 3RJVA 3TXNA 1Q2ZA 3RRMB 1EPUA 3L6AA 3HXFA 2BKGA 4GZ5A 1HXIA 3TG4A 4G26A 3U3WA 4GTOA 3EDTB 3UM3A 1UJKA 4KVMA 2HR2A 5BUZA 3DSWA 5CMYA 1XNFA 3MV2B 4CDMA 2YNQA 5JHBA 4A3TA 3QOUA 1K3ZD 4A3VA 4CT0A 3BG0B 1Y8MA 5KJMA 1NZNA 1K8KG 3QAQA 1QZ2A 4F1PA 3D3MA 4V3IA 2KM4A 2A5EA 3SF4A 2XPYA 1TNBA 1YCSB 2Y4UA 2X6JA 1A5EA 5JHAA 3G2VA 1E96B 4CDRA 2WXGA 1DC2A 3CHRA 3MJWA 3HXCA 3RO2A 1NL4A 3FUIA 4GYYA 4OAVB 4HORA 3OAWA 4KBQA 4URKA 1TN7A 2IONA 4HOQA 1N4PA 5BT1A 3I3NA 3EHNA 1IHBA 3NF1A 1PAQA 4ATZD 5G2NA 5ENSD 3ZYKA 3SFXA 3ZKJA 1UOHA 1L5JA 3L08A 2J4DA 4U8VD 1HG5A 2I9CA 2VGXA 4I2WA 2KATA 2ETCA 2GRRB 4XIFA 5C2YA 4U7EB 4IYPA 5AARA 1NI1A 3FTZA 5EILA 1S64A 3DSUA 2XCCA 4HXIA 4JA7A 3ABLE 1N94A 1B89A 5LX8A 1LF8A 2MYOA 4J8SA 2IOLA 3S7FA 5G05J 3QJZA 5CEDB 2IO2C 4UI9J 2NC9A 2VTBA 4PH4B 4HOUA 1X5BA 2WVIA 3NBNB 4PUCA 3J5QB 2F37A 4CT4A 1OCZE 1U3DA 1ELWA 1IYGA 3GW4A 3CHPA 2B0OE 4G23A 4GYWA 4GMRA 2FO1E 2I2OA 4J6IA 2E2EA 3CHSA 4PS7A 4Q69A 4C0EA 3W9GA 5LOZA 2OOEA 3NB2A 4N3CA 5AAOA 3CQGB 3DSTA 5KWDA 1UJJA 4XZ4A 2DYRE 3JUEA 5LP0A 4HNAD 4A1GA 4M7CA 3ASFA 3EU9A 2P9LG 2RFMA 3S7DA 4CGWA 2KCKA 3FTUA 1E7UA 2IU1A 4DUIA 2DBAA 4XEIG 3G2UA 2VGXB 4P29A 2LSUA 2AJAA 4I1MA 4TRQA 4E6HA 2VGEA 2WXIA 4N5CA 3FY4A 2FO7A 3FUDA 3AG2E 2X38A 3OXGA 1G3NB 4U96D 3UXGA 4Y6CA 1OCOE 4GZCA 2X3MA 1OWOA 5JJ6A 3JUIA 2OV8A 2QYJA 3B7TA 1DNPA 4A55A 4DI3A 1OY3D 3DWLG 1JCSA 4GTQA 3DPDA 3HG0D 2V5QC 1IQRA 3IHVA 1UN9A 3TG5A 3HIZA 2HM8A 4I6GA 5BW8C 4BX8A 3QKYA 3T5VA 1HE8A 5CBNA 2PQRA 4CDNA 3TGOA 3ASGA 4UQXA 4BESA 1TNOA 4JL0A 4TXQA 3JQ0A 4JVSA 1WAO1 2GGFA 2YHEA 2LXLA 3I5PA 5HQ8A 1SQMA 3J5PA 1N95A 1H0AA 3MCXA 3NZSA 3ZHEA 4JHRA 4GA0A 2KCLA 4Q94A 4HB5A 3TWWA 1KT0A 4QFVA 3FU0A 2OVFA 5BV1A 3AG3E 2EIJE 1NFIE 4KMOA 2XHEA 4FADA 3CKBA 3AS5A 3EU5A 3UKUG 4AM9A 2P9NG 3Q49B 3SFYA 3RSEG 2VSOE 5FQ7A 2MOWA 4WWOA 1BD8A 5ENTD 5G04C 1N0RA 1YYHA 1N54A 1TYQG 3TWXA 2NYJA 3FTYA 3MKQA 2P9SG 3RAUA 2WXHA 4FU3A 1OCCE 1H2VC 1OWLA 4HI8A 4KZCA 3UM1A 5T3RA 3E30A 2VSYA 2LO6A 5FIOA 3FULA 4YDOA 2OEWA 4NRHB 1AP7A 1BU9A 2I6HA 2JABA 4U63A 2HYZA 5EDSA 1PY1A 4XI9A 2ILRA 3CVYA 4JEHA 4LUNU 4GTMA 1LTXA 3PZ4A 1S0PA 3ULYA 3IHYA 4YNDA 2WXJA 4BSZB 4MBGA 3UI2A 3LS8A 1Y6IA 2BTDA 2GRQB 2XGOA 2EIME 4C48B 2J4BA 3URZA 4AY5A 4ILGA 5BV0A 1JWGA 3LJNA 4B93B 3E4BA 2V4LA 3ENEA 3E34A 4AY6A 2QYUA 1TR4A 2BUGA 5LCWC 3FUHA 5ANRA 5EIDA 4G8LA 3OXLA 1ELRA 3CK7A 3V31A 1DVPA 2QZAA 4XX5A 4XI0A 3B95A 3UT8A 2XGMA 5KCMA 4YVQC 4DRXE 5HI7A 4GMLA 4HRNA 4CZ2D 4JXTA 4G25A 3FTWA 4GTRA 2DZOA 3TWUA 2CG3A 2IOSA 4NURA 3L9TA 4DLQA 2A5UA 5D2MC 2X6IA 4WNDA 2HO1A 1A17A 2QC9A 4WWPA 1SVXA 4UWHA 1EF1C 4Z68A 2HE0A 5LFAA 1TJFA 2RG8A 2B6CA 4GCOA 4N3AA 3D9HA 2BEDA 2GRPB 2GRNB 4B0ZA 4OYSA 4XKCA 4I43A 4O1OA 3FP3A 1KZOA 5CRUA 5EYLA 3S7BA 1OWMA 5FT9A 5M72A 4JZYA 1TNUA 2MHKA 2L0IA 4G24A 5J08A 1WM5A 1HU3A 4DX1A 3U9WA 2M63A 2V8SE 2KC7A 3U66A 2VJ8A 3MEKA 2CFZA 3CR3A 3S2AA 4CRWA 4JC8A 4B8AA 1N9AA 3CKCA 2ZISA 4UWKA 2PL2A 4U95D 1TJCA 4I6JA 3Q79A 4JHKA 2PQNA 3OTNA 5ENNA 1S63A 5FQ6A 3APCA 3SD5A 2XCBA 3E33A 4MS6A 2DWZA 5FZQA 4GA1A 3F6QA 3FU6A 2ZU6B 3I4GA 3LEWA 3TWQA 3PEUB 3HHMA 4N39A 4ME2A 5KJKA 4LEUA 3CHQA 3NAWA 4N2SA 4LERA 2IY0C 3KS2A 1FT2A 1KT1A 3LPZA 5EIBE 3PUKA 4EPZA 3UM2A 4F53A 1HO8A 2DVWA 3VLFA 3GZ1A 3CVWA 2XPIA 1U3CA 3NOCD 1N4QA 4O60A 3IV0A 4G11A 4YVOA 2WXKA 4E85A 1DCQA 3U4TA 4GB9A 2Y3AA 4K0RA 2R2LA 3AU4A 3CV0A 4M3OA 3NQPA 1SW6A 2WXNA 4WNGA 3CK8A 4L7TA 3APFA 1H2TC 4FJYA 4NACA 1OCRE 4H7XA 4HOSA 3HRAA 1IXVA 3RO3A 1IHGA 3LY7A 4CEMA 2R05A 2QY7A 2MRIA 3R7RA 4HS2A 3C3OA 4PS3A 3K9IA 2H6FA 3MV3B 1NA3A 2LUHA 2Y0BG 4J8YA 3UM0A 2VYIA 1SZAA 3L22A 5C1DA 4UWFA 4WUYA 4R7LA 3SBTB 2XGSA 3SFZA 5ARGA 1FPPA 3ESKA 3B7BA 4EBAA 4G2VA 3NZUA 4HLEA 3FH7A 2LSVA 4CYMD 4LCTA 3PNLB 4I1OB 3ZGQA 4FLBA 3D9KA 4PDXA 3AG4E 3O48A 4GTVA 5H7PA 3ZVVA 4O6FA 3D9MA 4W9RA 4I1AA 3PS6A 1HX8A 3CIAA 4YDWA 2CHWA 2GRLA 4HRMB 1E8ZA 3B7SA 1XGWA 2IFUA 1ZB1A 4GAAA 2H6IA 3SBSA 3DXKG 2WXLA 4U0ZA 3AAAC 3CEQA 3QWPA 4ILIA 2C0LA 4QQIA 2R59A 2VGYA 4I9CA 1E8YA 2I1JA 1U2VG 2R02A 3PZDA 2XS1A 2PNNA 4TUUA 3MX3A 4C9BB 2V5FA 3D9JA 5HS0A 4U07A 4UQYA 4L2LA 3T5XA 5AIJA 2YQ8A 4DX6D 1MX2A 3GZSA 1IQUA 4OVVA 4XKBA 1S70B 3R9MA 2AVPA 3DXMG 3PRZA 5ENQD 3TXMA 4RG6A 3ZPJA 2XRZA 4ANUA 4ACKA 4LRZA 3C72A 1O5MA 1E8WA 3GYZA 3V79K 5KJNA 3L16A 5G04J 1TN8A 3Q78A 3DSVA 3ABKE 3B7RL 1V54E 5J90A 3FHEA 2J8SD 5CMWA 1OUVA 3CSFA 4ANXA 3FEXA 3E32A 5E76A 5D0QD 4YDEA 2VQ2A 3G2WA 1TEZA 3DBSA 3UPVA 2XEHA 5ENOD 3APDA 4F1SA 2VTBB 4GU5A 1W3BA 3FU5A 3FUKA 1D8DA 5CERB 1WY6A 4TV3A 3QK0A 3SGHA 4A1SA 4F6RD 3UMVA 4BY6A 4KVOA 3VTXA 5EX3A 1MYOA 3T9KA 5FWQA 4BX9A 4DLOA 3ZU7B 2J9QA 4TXRA 4WNEA 1QBQA 4GA2A 5D0OD 2IJGX 5E75A 4LSZE 2EILE 4RSYA 5LCWJ 3O4ZA 2J09A 3DEPA 4FLHA 3PZ2A 3EJNA 2IQCA 3HVEA 3ISMC 1QNFA 1X81A 4ZFHA 5ANLA 2LNIA 3UT7A 3DEOA 4EECA 4KT6B 3ZNGA 4C0MA 3AJIA 1FCHA 5AQ7A 3BU8A 4HLLA 5B1BE 5JA4D 2J08A 2GW1A 3ZXSA 3LDZA 4IULA 1TNZA 3D9PA 3HDXA 2DZNA 2OCCE 4N2QA 4FULA 3ASOE 3LXUX 4O1PA 3UINC 3QDNA 4JPSA 3ZFWA 4A63B 3ONLA 1UG3A 3DSXA 2X6KA 2P9PG 1Z5SC 3QC1A 3PVLA 2KXPC 5CCLA 4EZKA 4I2ZA 5KBAA 4GTPA 3FDHA 3UT4A 3JYSA 3G2TA 1N4RA 1QQEA 4I17A 5BPPA 4MRUA 4EHMA 4TUMA 2KCVA 2EINE 4LNUD 4HI9A 4ANVA 3SNXA 3N71A 3IBEA 2Y69E 5AJDA 2WXRA 5KNHD 3AS4A 3RK6A 4LNGA 3ZYQA 3ZHEB 2R17C 2XEVA 1JWFA 3CGHA 3CK9A 3Q5MA 2FBNA 4X8QA 4UI9K 3DSSA 1P5QA 4GZ3A 4AXHA 5ITZF 3P2BA 4MKTA 4BFRA 5CRVA 2CHZA 3JXJA 4GZDA 4AJWA 3Q9UC 3CVUA 3SY2A 2AWIA 5DIZA 3L54A 4HVBA 2XEEA 2AXUA 4UWLA 4J8FA 3PZ3A 1MX6A 2P9KG 5AENA 3MKQB 4DI4A 2ETAA 3UIPC 2WMOA 4HRLA 2VSXE 3LY9A 3OXFA 3PREA 3ULQA 3SO8A 2F8YA 3CVPA 3ASDA 4DX2A 5AQBA 4BT9A 2LAIA 3PUJA 2DIWA 3FTSA 3LJ3A 4U0UA 1H6OA 2ONDA 4JB8P 4RG9A 1BPOA 5A23A 3Q73A 3C3QA 4J8EA 4BTAA 2WXMA 5CECB 1BLXB 2C0MA 4GPKA 1H19A 1O1TA 3PDNA 4GZ6A 1BI8B 3CVXA 3LVQE 2NXPA 2AW6A 3SHFA 4HBDA 4WNFA 3T8MA 3ZRHA 3VTYA 4APOA 2PM7A 1GW6A 4UQZA 3SZ7A 2WXFA 4NIKA 3RRNB 5FJYA 1OT8A 3CVVA 4RLYA 3FUEA 1E8XA 1KLXA 3CSTA 4K5CA 3CVQA 3LKUA 4U04A 3ZXPA 1EDUA 4EZLA 2GROB 2XRYA 2P2CP 2Y1LE 4TXPA 2ETBA 4HFGA 5CHEE 1IKND 2IEJA 3CLJA 3FFLA 4L2YA 1ELKA 5HRYA 3PNTB 3ZW3A 4L1BA 3IEGA 3L13A 2WB2A 1E7VA 4IN3B 5JMND 1KZPA 5CBOA 3VLDA 4DX5D 3FUMA 2WQHA 2PZIA 1HH8A 3PZ1A 4H7YA 2DCPA 4APFA 2L9BA 3NOGD 3VLEA 4I9EA 3C3RA 1HFAA 1NA0A 3JXIA 5JJTA 4N5QA 3ZIMA 5JJ7A 4GCNA 3S7JA 3MGBA 3AG1E 4YDYA 2FEZA 3KEAA 3V30A 5EN5D 3HXBA 4B94A 1WDYA 5T8IA 4G1TA 3V2XA 2ZXWE 3R9AB 2BKKB 3ZEFA 3U64A 2VSNA 2AXZA 4EQFA 3IXEA 1HZ4A 3TWVA 1JCQA 4AEZC 5AJLA 2WQ7A 1SZ9A 3JCKC 4AOFA 1FVFA 2JLBA 3ZYMA 2XPZA 4GMJA 2WQ6A 1FT1A 2XZTG 4DPRA 5AN8A 3LCAA 5ARFA 4L9PA 2R5SA 4LG6A 3QNKA 2WPVA 3BUAA 3HXDA 3LVRE 1N4SA 5B1AE 3FTXA 5FTPA 4FP7A 3KEZA 2WXQA 4AV7A 4JW1A 3UTMA 3ML9A 3B13A 2CFUA 1NP7A 2NSZA 3SQVA 2OVBA 2C2LA 3ASNE 3CVLA 4ANWA 2X6FA 5KNGA 2RKKA 4WAFA 4BETA 1O1SA 3BQOA 4FHJA 1Z3XA 3BG1B 5AQAA 2EIKE 4BSXA 4NQ0A 4D10C 4FC8A 1H6KA 3FUNA 1AWCB 4HOTA 3G2SA 2P9UG 5A7DB 3ABME 4EZJA 1TN6A 2A4ZA 1RW2A 3Q7AA 3ZN3A 3DPYA 4OAUC 4DJAA 3Q47B 3ESLA 2JEKA 4IRUA 5FZSA 4FJZA 3EIJA 1JCRA 1MQSA 5T4YA 3EUVA 2RFAA 1TNYA 1LD8A 4DX7D 1RZ4A 2E0IA 1K1BA 5IY5E 3B7UX 4GTTA 1QYMA 4BWRA 3UIOC 5CCMA 3Q75A 4ACLA 2ZGDA 5G55A 5FQ8A 3EHQA 5A6CA 3BEEA 4BEPA 2X6HA 1VDYA 5G05C 3PEVB 4JA9A 3L82A 4UI9C 3TWSA 1O1RA 1Z3YA 2GRMA 3FTVA 3LY8A 4AP2A 5FQ4A 3D9OA 3TWTA 4K5BA 1MZCA 4MLPA 5FZRA 3RKVA 3ML8A 4BTBA 5AQ9A 3FWVA 1ZBPA 3DRAA 1PC2A 3D9NA 3WXXA 4CCAA 3T8KA 3SI5A 4U8HA 1MHQA 3IKOB 4U0SA 3HYMB 4JD2G 3ASHA 1E90A 3CHMA 2XS8A 1N52A 1FVHA 4ILHB 3AU5A 5BNWA 2LAHA 2CG2A 1EYHA 1OXJA 5ENRD 2P9IG 5BXOA 4L23A 3CVNA 2YINA 1HS6A 4ZHBA 3MZLB 3E37A 3LYAA 3TWRA 4ATGA 1YA0A 4CGVA 2P58C 2WMNA 3PH0C 3UUXA 2QFCA 2ZIRA 4ABNA 2F0YA 4KZ0A 4F3VA 1H6PA 4I6EA 3C5RA 3RRUA 5D66A 3ZUVB 2FULA 4DK5A 4Y6WA 4K5AB 3JQ1A 2YHCA 1OWPA 5ENPD 1K1AA 2H6GA 2V0PA 1HF8A 2L6BA 5EYPF 2EQXA 3W9FA 4B89A 3L17A 3R7QA 3C98A 4JHJA 4UUCA 3FU3A 4RQIA 1V55E 2L6JA 4FA6A 4HQDA 4JEUA 2UY1A 3HVEB 3QB2A 1OWNA 3ONKA 5KJLA 3FH5A 4FHKA 4PS8A 2RD0A 3ULEG 2KZTA 4KXKB 2OEVA 3I4RB 3UX4A 2L0TB 3KD7A 3Q9NC 3UKRG 2IO3C 3UQ3A 4OVUA 3FEYA 2XQ0A 1MX4A 2FF4A 3QWVA 3KSLA 4G8KA 3EHMA 3QARA 3D9LA 3QWWA 4RVBA 5HKPA 5FINA 3KAEA 3FUJA 3X2QE 1UW4B 1WG0A 2J07A 1SA5A 4UWGA 2V4HC 4GYOA 2PM6A 3TL5A 1D9SA 4KYOB 4K03A 4N3BA 2AXVA
chains in the Genus database with same CATH topology
4TUMA 2RFMA 4LSZE 1N11A 4ATZD 2XENA 4G8LA 4LNUD 5EIDA 1K1BA 3JXIA 4HI9A 4N5QA 5ENSD 1N0QA 4U95D 2F8XK 4DX6D 1MX2A 1QYMA 3UTMA 1NFIE 3ZKJA 1UOHA 3DEPA 4DUIA 4U8VD 2Y0BG 3V31A 1S70B 3C5RA 4J8YA 5KNHD 5D66A 3ZUVB 2ETCA 5BXUA 4K5AB 2ZGDA 3B95A 4ZFHA 2AJAA 5CECB 1BLXB 2BKGA 4YDYA 5ENQD 5ENPD 1K1AA 2VGEA 4DRXE 3DEOA 2DWZA 3EHQA 3KEAA 2L6BA 5AARA 3B7BA 3V30A 5EN5D 5EYPF 3W9FA 3F6QA 4HRNA 4BEPA 1WDYA 1BI8B 5EILA 4CZ2D 3TWQA 1BD8A 5KNGA 2KBXA 3V2XA 3ZNGA 3AJIA 5ENTD 4CYMD 4UUCA 4HBDA 2DZOA 1G3NB 4U96D 2BKKB 3TWSA 1N0RA 5AQ7A 3UXGA 4BETA 1YYHA 2MYOA 3TWUA 3TWXA 1K3ZD 2NYJA 4HLLA 3V79K 4DX7D 5JA4D 4HQDA 5CEDB 3EHRA 5ITZF 3IXEA 2QYJA 1YMPA 5AQAA 2QC9A 4NIKA 5CEAA 1SVXA 3JXJA 1OY3D 4Z68A 3NBNB 3Q9UC 3TWVA 5EIBE 4HI8A 4F1PA 3HG0D 1OT8A 3J5QB 3TWTA 2J8SD 2F37A 2HE0A 2V5QC 4K5BA 4RLYA 5FIOA 2ZGGA 2DVWA 2DZNA 2XEEA 4YDWA 2A5EA 4HB5A 3NOCD 4HRMB 1AWCB 3D9HA 1AP7A 1BU9A 4K5CA 5AQ9A 3TWWA 4O60A 3Q9NC 2JABA 1YCSB 1MX6A 1DCQA 4O1PA 3V2OA 5CBNA 3T8KA 1A5EA 2B0OE 2P2CP 2Y1LE 4GMRA 4O1OA 1MJ0A 4A63B 2FO1E 2XEHA 2XZTG 1MX4A 1BI7B 5EYLA 4J7WA 2ETBA 2ETAA 5ENOD 4BESA 1DC2A 5AN8A 2XZDG 1IKND 4G8KA 4BSZB 3AAAC 4LG6A 4U8YD 3W9GA 4HRLA 5HRYA 1SW6A 3UI2A 4OAVB 4QQIA 5CERB 4C48B 4OAUC 4F6RD 5HKPA 5AAOA 5FINA 2KXPC 5ENRD 5JMND 5BXOA 4DX1A 4BERA 1MYOA 3J5PA 3SO8A 2F8YA 5KWDA 5CBOA 5KBAA 4DX5D 4DX2A 3T9KA 5AQBA 3HRAA 1IXVA 1WG0A 3LJNA 4B93B 4ZHBA 4GPMA 3JUEA 2PNNA 3ZU7B 3TWRA 2V4HC 4HNAD 1D9SA 1TR4A 1IHBA 5HS0A 3EU9A 2RFAA 3NOGD 4JB8P 4QFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TUM A;  2RFM A;  4LSZ E;  1N11 A;  4ATZ D;  2XEN A;  4G8L A;  4LNU D;  5EID A;  1K1B A;  3JXI A;  4HI9 A;  4N5Q A;  5ENS D;  1N0Q A;  4U95 D;  2F8X K;  4DX6 D;  1MX2 A;  1QYM A;  3UTM A;  1NFI E;  3ZKJ A;  1UOH A;  3DEP A;  4DUI A;  4U8V D;  2Y0B G;  3V31 A;  1S70 B;  3C5R A;  4J8Y A;  5KNH D;  5D66 A;  3ZUV B;  2ETC A;  5BXU A;  4K5A B;  2ZGD A;  3B95 A;  4ZFH A;  2AJA A;  5CEC B;  1BLX B;  2BKG A;  4YDY A;  5ENQ D;  5ENP D;  1K1A A;  2VGE A;  4DRX E;  3DEO A;  2DWZ A;  3EHQ A;  3KEA A;  2L6B A;  5AAR A;  3B7B A;  3V30 A;  5EN5 D;  5EYP F;  3W9F A;  3F6Q A;  4HRN A;  4BEP A;  1WDY A;  1BI8 B;  5EIL A;  4CZ2 D;  3TWQ A;  1BD8 A;  5KNG A;  2KBX A;  3V2X A;  3ZNG A;  3AJI A;  5ENT D;  4CYM D;  4UUC A;  4HBD A;  2DZO A;  1G3N B;  4U96 D;  2BKK B;  3TWS A;  1N0R A;  5AQ7 A;  3UXG A;  4BET A;  1YYH A;  2MYO A;  3TWU A;  3TWX A;  1K3Z D;  2NYJ A;  4HLL A;  3V79 K;  4DX7 D;  5JA4 D;  4HQD A;  5CED B;  3EHR A;  5ITZ F;  3IXE A;  2QYJ A;  1YMP A;  5AQA A;  2QC9 A;  4NIK A;  5CEA A;  1SVX A;  3JXJ A;  1OY3 D;  4Z68 A;  3NBN B;  3Q9U C;  3TWV A;  5EIB E;  4HI8 A;  4F1P A;  3HG0 D;  1OT8 A;  3J5Q B;  3TWT A;  2J8S D;  2F37 A;  2HE0 A;  2V5Q C;  4K5B A;  4RLY A;  5FIO A;  2ZGG A;  2DVW A;  2DZN A;  2XEE A;  4YDW A;  2A5E A;  4HB5 A;  3NOC D;  4HRM B;  1AWC B;  3D9H A;  1AP7 A;  1BU9 A;  4K5C A;  5AQ9 A;  3TWW A;  4O60 A;  3Q9N C;  2JAB A;  1YCS B;  1MX6 A;  1DCQ A;  4O1P A;  3V2O A;  5CBN A;  3T8K A;  1A5E A;  2B0O E;  2P2C P;  2Y1L E;  4GMR A;  4O1O A;  1MJ0 A;  4A63 B;  2FO1 E;  2XEH A;  2XZT G;  1MX4 A;  1BI7 B;  5EYL A;  4J7W A;  2ETB A;  2ETA A;  5ENO D;  4BES A;  1DC2 A;  5AN8 A;  2XZD G;  1IKN D;  4G8K A;  4BSZ B;  3AAA C;  4LG6 A;  4U8Y D;  3W9G A;  4HRL A;  5HRY A;  1SW6 A;  3UI2 A;  4OAV B;  4QQI A;  5CER B;  4C48 B;  4OAU C;  4F6R D;  5HKP A;  5AAO A;  5FIN A;  2KXP C;  5ENR D;  5JMN D;  5BXO A;  4DX1 A;  4BER A;  1MYO A;  3J5P A;  3SO8 A;  2F8Y A;  5KWD A;  5CBO A;  5KBA A;  4DX5 D;  4DX2 A;  3T9K A;  5AQB A;  3HRA A;  1IXV A;  1WG0 A;  3LJN A;  4B93 B;  4ZHB A;  4GPM A;  3JUE A;  2PNN A;  3ZU7 B;  3TWR A;  2V4H C;  4HNA D;  1D9S A;  1TR4 A;  1IHB A;  5HS0 A;  3EU9 A;  2RFA A;  3NOG D;  4JB8 P;  4QFV A; 
#chains in the Genus database with same CATH topology
 4AVX A;  3RIB A;  2BF0 X;  2H6H A;  4AIF A;  2F8X K;  1JUQ A;  4F7A A;  2CHX A;  2LXM A;  5BXU A;  4Q96 A;  5EX0 A;  3P1U A;  3CQC B;  2IF4 A;  1Z6T A;  4BT8 A;  3MKR A;  1H2U A;  3TJP A;  4B8C B;  2UWJ G;  3Q4A B;  3WG7 E;  2KBX A;  3PE3 A;  4J0U A;  2Q7F A;  3EHR A;  4WWN A;  1YMP A;  5B3S E;  2UY1 B;  5CEA A;  3D9I A;  3TAX A;  3ZYL A;  3HXE A;  4LNB A;  1JPL A;  4GTS A;  1ZU2 A;  2R03 A;  2ZGG A;  2KZT B;  1UN8 A;  3Q15 A;  2Y4T A;  3RU0 A;  4XE0 A;  5AYW D;  2WM9 A;  3V2O A;  5EKQ D;  1KPS B;  1MJ0 A;  2FI7 A;  2J49 A;  1BI7 B;  3KSQ A;  4J7W A;  3GZ2 A;  2XZD G;  4U8Y D;  3FH8 A;  2I1K A;  1HG2 A;  2WXO A;  3MYV A;  4BER A;  3EIQ C;  2DYS E;  3MA5 A;  4GPM A;  3AS8 A;  4J8D A;  3PE4 A;  1INZ A;  1LD7 A;  2WXP A;  5DBK A;  4EBA G;  1DCE A;  1N11 A;  1D8E A;  2XEN A;  3Q7F A;  1N0Q A;  1SA4 A;  3CHO A;  3FUF A;  3RJV A;  3TXN A;  1Q2Z A;  3RRM B;  1EPU A;  3L6A A;  3HXF A;  2BKG A;  4GZ5 A;  1HXI A;  3TG4 A;  4G26 A;  3U3W A;  4GTO A;  3EDT B;  3UM3 A;  1UJK A;  4KVM A;  2HR2 A;  5BUZ A;  3DSW A;  5CMY A;  1XNF A;  3MV2 B;  4CDM A;  2YNQ A;  5JHB A;  4A3T A;  3QOU A;  1K3Z D;  4A3V A;  4CT0 A;  3BG0 B;  1Y8M A;  5KJM A;  1NZN A;  1K8K G;  3QAQ A;  1QZ2 A;  4F1P A;  3D3M A;  4V3I A;  2KM4 A;  2A5E A;  3SF4 A;  2XPY A;  1TNB A;  1YCS B;  2Y4U A;  2X6J A;  1A5E A;  5JHA A;  3G2V A;  1E96 B;  4CDR A;  2WXG A;  1DC2 A;  3CHR A;  3MJW A;  3HXC A;  3RO2 A;  1NL4 A;  3FUI A;  4GYY A;  4OAV B;  4HOR A;  3OAW A;  4KBQ A;  4URK A;  1TN7 A;  2ION A;  4HOQ A;  1N4P A;  5BT1 A;  3I3N A;  3EHN A;  1IHB A;  3NF1 A;  1PAQ A;  4ATZ D;  5G2N A;  5ENS D;  3ZYK A;  3SFX A;  3ZKJ A;  1UOH A;  1L5J A;  3L08 A;  2J4D A;  4U8V D;  1HG5 A;  2I9C A;  2VGX A;  4I2W A;  2KAT A;  2ETC A;  2GRR B;  4XIF A;  5C2Y A;  4U7E B;  4IYP A;  5AAR A;  1NI1 A;  3FTZ A;  5EIL A;  1S64 A;  3DSU A;  2XCC A;  4HXI A;  4JA7 A;  3ABL E;  1N94 A;  1B89 A;  5LX8 A;  1LF8 A;  2MYO A;  4J8S A;  2IOL A;  3S7F A;  5G05 J;  3QJZ A;  5CED B;  2IO2 C;  4UI9 J;  2NC9 A;  2VTB A;  4PH4 B;  4HOU A;  1X5B A;  2WVI A;  3NBN B;  4PUC A;  3J5Q B;  2F37 A;  4CT4 A;  1OCZ E;  1U3D A;  1ELW A;  1IYG A;  3GW4 A;  3CHP A;  2B0O E;  4G23 A;  4GYW A;  4GMR A;  2FO1 E;  2I2O A;  4J6I A;  2E2E A;  3CHS A;  4PS7 A;  4Q69 A;  4C0E A;  3W9G A;  5LOZ A;  2OOE A;  3NB2 A;  4N3C A;  5AAO A;  3CQG B;  3DST A;  5KWD A;  1UJJ A;  4XZ4 A;  2DYR E;  3JUE A;  5LP0 A;  4HNA D;  4A1G A;  4M7C A;  3ASF A;  3EU9 A;  2P9L G;  2RFM A;  3S7D A;  4CGW A;  2KCK A;  3FTU A;  1E7U A;  2IU1 A;  4DUI A;  2DBA A;  4XEI G;  3G2U A;  2VGX B;  4P29 A;  2LSU A;  2AJA A;  4I1M A;  4TRQ A;  4E6H A;  2VGE A;  2WXI A;  4N5C A;  3FY4 A;  2FO7 A;  3FUD A;  3AG2 E;  2X38 A;  3OXG A;  1G3N B;  4U96 D;  3UXG A;  4Y6C A;  1OCO E;  4GZC A;  2X3M A;  1OWO A;  5JJ6 A;  3JUI A;  2OV8 A;  2QYJ A;  3B7T A;  1DNP A;  4A55 A;  4DI3 A;  1OY3 D;  3DWL G;  1JCS A;  4GTQ A;  3DPD A;  3HG0 D;  2V5Q C;  1IQR A;  3IHV A;  1UN9 A;  3TG5 A;  3HIZ A;  2HM8 A;  4I6G A;  5BW8 C;  4BX8 A;  3QKY A;  3T5V A;  1HE8 A;  5CBN A;  2PQR A;  4CDN A;  3TGO A;  3ASG A;  4UQX A;  4BES A;  1TNO A;  4JL0 A;  4TXQ A;  3JQ0 A;  4JVS A;  1WAO 1;  2GGF A;  2YHE A;  2LXL A;  3I5P A;  5HQ8 A;  1SQM A;  3J5P A;  1N95 A;  1H0A A;  3MCX A;  3NZS A;  3ZHE A;  4JHR A;  4GA0 A;  2KCL A;  4Q94 A;  4HB5 A;  3TWW A;  1KT0 A;  4QFV A;  3FU0 A;  2OVF A;  5BV1 A;  3AG3 E;  2EIJ E;  1NFI E;  4KMO A;  2XHE A;  4FAD A;  3CKB A;  3AS5 A;  3EU5 A;  3UKU G;  4AM9 A;  2P9N G;  3Q49 B;  3SFY A;  3RSE G;  2VSO E;  5FQ7 A;  2MOW A;  4WWO A;  1BD8 A;  5ENT D;  5G04 C;  1N0R A;  1YYH A;  1N54 A;  1TYQ G;  3TWX A;  2NYJ A;  3FTY A;  3MKQ A;  2P9S G;  3RAU A;  2WXH A;  4FU3 A;  1OCC E;  1H2V C;  1OWL A;  4HI8 A;  4KZC A;  3UM1 A;  5T3R A;  3E30 A;  2VSY A;  2LO6 A;  5FIO A;  3FUL A;  4YDO A;  2OEW A;  4NRH B;  1AP7 A;  1BU9 A;  2I6H A;  2JAB A;  4U63 A;  2HYZ A;  5EDS A;  1PY1 A;  4XI9 A;  2ILR A;  3CVY A;  4JEH A;  4LUN U;  4GTM A;  1LTX A;  3PZ4 A;  1S0P A;  3ULY A;  3IHY A;  4YND A;  2WXJ A;  4BSZ B;  4MBG A;  3UI2 A;  3LS8 A;  1Y6I A;  2BTD A;  2GRQ B;  2XGO A;  2EIM E;  4C48 B;  2J4B A;  3URZ A;  4AY5 A;  4ILG A;  5BV0 A;  1JWG A;  3LJN A;  4B93 B;  3E4B A;  2V4L A;  3ENE A;  3E34 A;  4AY6 A;  2QYU A;  1TR4 A;  2BUG A;  5LCW C;  3FUH A;  5ANR A;  5EID A;  4G8L A;  3OXL A;  1ELR A;  3CK7 A;  3V31 A;  1DVP A;  2QZA A;  4XX5 A;  4XI0 A;  3B95 A;  3UT8 A;  2XGM A;  5KCM A;  4YVQ C;  4DRX E;  5HI7 A;  4GML A;  4HRN A;  4CZ2 D;  4JXT A;  4G25 A;  3FTW A;  4GTR A;  2DZO A;  3TWU A;  2CG3 A;  2IOS A;  4NUR A;  3L9T A;  4DLQ A;  2A5U A;  5D2M C;  2X6I A;  4WND A;  2HO1 A;  1A17 A;  2QC9 A;  4WWP A;  1SVX A;  4UWH A;  1EF1 C;  4Z68 A;  2HE0 A;  5LFA A;  1TJF A;  2RG8 A;  2B6C A;  4GCO A;  4N3A A;  3D9H A;  2BED A;  2GRP B;  2GRN B;  4B0Z A;  4OYS A;  4XKC A;  4I43 A;  4O1O A;  3FP3 A;  1KZO A;  5CRU A;  5EYL A;  3S7B A;  1OWM A;  5FT9 A;  5M72 A;  4JZY A;  1TNU A;  2MHK A;  2L0I A;  4G24 A;  5J08 A;  1WM5 A;  1HU3 A;  4DX1 A;  3U9W A;  2M63 A;  2V8S E;  2KC7 A;  3U66 A;  2VJ8 A;  3MEK A;  2CFZ A;  3CR3 A;  3S2A A;  4CRW A;  4JC8 A;  4B8A A;  1N9A A;  3CKC A;  2ZIS A;  4UWK A;  2PL2 A;  4U95 D;  1TJC A;  4I6J A;  3Q79 A;  4JHK A;  2PQN A;  3OTN A;  5ENN A;  1S63 A;  5FQ6 A;  3APC A;  3SD5 A;  2XCB A;  3E33 A;  4MS6 A;  2DWZ A;  5FZQ A;  4GA1 A;  3F6Q A;  3FU6 A;  2ZU6 B;  3I4G A;  3LEW A;  3TWQ A;  3PEU B;  3HHM A;  4N39 A;  4ME2 A;  5KJK A;  4LEU A;  3CHQ A;  3NAW A;  4N2S A;  4LER A;  2IY0 C;  3KS2 A;  1FT2 A;  1KT1 A;  3LPZ A;  5EIB E;  3PUK A;  4EPZ A;  3UM2 A;  4F53 A;  1HO8 A;  2DVW A;  3VLF A;  3GZ1 A;  3CVW A;  2XPI A;  1U3C A;  3NOC D;  1N4Q A;  4O60 A;  3IV0 A;  4G11 A;  4YVO A;  2WXK A;  4E85 A;  1DCQ A;  3U4T A;  4GB9 A;  2Y3A A;  4K0R A;  2R2L A;  3AU4 A;  3CV0 A;  4M3O A;  3NQP A;  1SW6 A;  2WXN A;  4WNG A;  3CK8 A;  4L7T A;  3APF A;  1H2T C;  4FJY A;  4NAC A;  1OCR E;  4H7X A;  4HOS A;  3HRA A;  1IXV A;  3RO3 A;  1IHG A;  3LY7 A;  4CEM A;  2R05 A;  2QY7 A;  2MRI A;  3R7R A;  4HS2 A;  3C3O A;  4PS3 A;  3K9I A;  2H6F A;  3MV3 B;  1NA3 A;  2LUH A;  2Y0B G;  4J8Y A;  3UM0 A;  2VYI A;  1SZA A;  3L22 A;  5C1D A;  4UWF A;  4WUY A;  4R7L A;  3SBT B;  2XGS A;  3SFZ A;  5ARG A;  1FPP A;  3ESK A;  3B7B A;  4EBA A;  4G2V A;  3NZU A;  4HLE A;  3FH7 A;  2LSV A;  4CYM D;  4LCT A;  3PNL B;  4I1O B;  3ZGQ A;  4FLB A;  3D9K A;  4PDX A;  3AG4 E;  3O48 A;  4GTV A;  5H7P A;  3ZVV A;  4O6F A;  3D9M A;  4W9R A;  4I1A A;  3PS6 A;  1HX8 A;  3CIA A;  4YDW A;  2CHW A;  2GRL A;  4HRM B;  1E8Z A;  3B7S A;  1XGW A;  2IFU A;  1ZB1 A;  4GAA A;  2H6I A;  3SBS A;  3DXK G;  2WXL A;  4U0Z A;  3AAA C;  3CEQ A;  3QWP A;  4ILI A;  2C0L A;  4QQI A;  2R59 A;  2VGY A;  4I9C A;  1E8Y A;  2I1J A;  1U2V G;  2R02 A;  3PZD A;  2XS1 A;  2PNN A;  4TUU A;  3MX3 A;  4C9B B;  2V5F A;  3D9J A;  5HS0 A;  4U07 A;  4UQY A;  4L2L A;  3T5X A;  5AIJ A;  2YQ8 A;  4DX6 D;  1MX2 A;  3GZS A;  1IQU A;  4OVV A;  4XKB A;  1S70 B;  3R9M A;  2AVP A;  3DXM G;  3PRZ A;  5ENQ D;  3TXM A;  4RG6 A;  3ZPJ A;  2XRZ A;  4ANU A;  4ACK A;  4LRZ A;  3C72 A;  1O5M A;  1E8W A;  3GYZ A;  3V79 K;  5KJN A;  3L16 A;  5G04 J;  1TN8 A;  3Q78 A;  3DSV A;  3ABK E;  3B7R L;  1V54 E;  5J90 A;  3FHE A;  2J8S D;  5CMW A;  1OUV A;  3CSF A;  4ANX A;  3FEX A;  3E32 A;  5E76 A;  5D0Q D;  4YDE A;  2VQ2 A;  3G2W A;  1TEZ A;  3DBS A;  3UPV A;  2XEH A;  5ENO D;  3APD A;  4F1S A;  2VTB B;  4GU5 A;  1W3B A;  3FU5 A;  3FUK A;  1D8D A;  5CER B;  1WY6 A;  4TV3 A;  3QK0 A;  3SGH A;  4A1S A;  4F6R D;  3UMV A;  4BY6 A;  4KVO A;  3VTX A;  5EX3 A;  1MYO A;  3T9K A;  5FWQ A;  4BX9 A;  4DLO A;  3ZU7 B;  2J9Q A;  4TXR A;  4WNE A;  1QBQ A;  4GA2 A;  5D0O D;  2IJG X;  5E75 A;  4LSZ E;  2EIL E;  4RSY A;  5LCW J;  3O4Z A;  2J09 A;  3DEP A;  4FLH A;  3PZ2 A;  3EJN A;  2IQC A;  3HVE A;  3ISM C;  1QNF A;  1X81 A;  4ZFH A;  5ANL A;  2LNI A;  3UT7 A;  3DEO A;  4EEC A;  4KT6 B;  3ZNG A;  4C0M A;  3AJI A;  1FCH A;  5AQ7 A;  3BU8 A;  4HLL A;  5B1B E;  5JA4 D;  2J08 A;  2GW1 A;  3ZXS A;  3LDZ A;  4IUL A;  1TNZ A;  3D9P A;  3HDX A;  2DZN A;  2OCC E;  4N2Q A;  4FUL A;  3ASO E;  3LXU X;  4O1P A;  3UIN C;  3QDN A;  4JPS A;  3ZFW A;  4A63 B;  3ONL A;  1UG3 A;  3DSX A;  2X6K A;  2P9P G;  1Z5S C;  3QC1 A;  3PVL A;  2KXP C;  5CCL A;  4EZK A;  4I2Z A;  5KBA A;  4GTP A;  3FDH A;  3UT4 A;  3JYS A;  3G2T A;  1N4R A;  1QQE A;  4I17 A;  5BPP A;  4MRU A;  4EHM A;  4TUM A;  2KCV A;  2EIN E;  4LNU D;  4HI9 A;  4ANV A;  3SNX A;  3N71 A;  3IBE A;  2Y69 E;  5AJD A;  2WXR A;  5KNH D;  3AS4 A;  3RK6 A;  4LNG A;  3ZYQ A;  3ZHE B;  2R17 C;  2XEV A;  1JWF A;  3CGH A;  3CK9 A;  3Q5M A;  2FBN A;  4X8Q A;  4UI9 K;  3DSS A;  1P5Q A;  4GZ3 A;  4AXH A;  5ITZ F;  3P2B A;  4MKT A;  4BFR A;  5CRV A;  2CHZ A;  3JXJ A;  4GZD A;  4AJW A;  3Q9U C;  3CVU A;  3SY2 A;  2AWI A;  5DIZ A;  3L54 A;  4HVB A;  2XEE A;  2AXU A;  4UWL A;  4J8F A;  3PZ3 A;  1MX6 A;  2P9K G;  5AEN A;  3MKQ B;  4DI4 A;  2ETA A;  3UIP C;  2WMO A;  4HRL A;  2VSX E;  3LY9 A;  3OXF A;  3PRE A;  3ULQ A;  3SO8 A;  2F8Y A;  3CVP A;  3ASD A;  4DX2 A;  5AQB A;  4BT9 A;  2LAI A;  3PUJ A;  2DIW A;  3FTS A;  3LJ3 A;  4U0U A;  1H6O A;  2OND A;  4JB8 P;  4RG9 A;  1BPO A;  5A23 A;  3Q73 A;  3C3Q A;  4J8E A;  4BTA A;  2WXM A;  5CEC B;  1BLX B;  2C0M A;  4GPK A;  1H19 A;  1O1T A;  3PDN A;  4GZ6 A;  1BI8 B;  3CVX A;  3LVQ E;  2NXP A;  2AW6 A;  3SHF A;  4HBD A;  4WNF A;  3T8M A;  3ZRH A;  3VTY A;  4APO A;  2PM7 A;  1GW6 A;  4UQZ A;  3SZ7 A;  2WXF A;  4NIK A;  3RRN B;  5FJY A;  1OT8 A;  3CVV A;  4RLY A;  3FUE A;  1E8X A;  1KLX A;  3CST A;  4K5C A;  3CVQ A;  3LKU A;  4U04 A;  3ZXP A;  1EDU A;  4EZL A;  2GRO B;  2XRY A;  2P2C P;  2Y1L E;  4TXP A;  2ETB A;  4HFG A;  5CHE E;  1IKN D;  2IEJ A;  3CLJ A;  3FFL A;  4L2Y A;  1ELK A;  5HRY A;  3PNT B;  3ZW3 A;  4L1B A;  3IEG A;  3L13 A;  2WB2 A;  1E7V A;  4IN3 B;  5JMN D;  1KZP A;  5CBO A;  3VLD A;  4DX5 D;  3FUM A;  2WQH A;  2PZI A;  1HH8 A;  3PZ1 A;  4H7Y A;  2DCP A;  4APF A;  2L9B A;  3NOG D;  3VLE A;  4I9E A;  3C3R A;  1HFA A;  1NA0 A;  3JXI A;  5JJT A;  4N5Q A;  3ZIM A;  5JJ7 A;  4GCN A;  3S7J A;  3MGB A;  3AG1 E;  4YDY A;  2FEZ A;  3KEA A;  3V30 A;  5EN5 D;  3HXB A;  4B94 A;  1WDY A;  5T8I A;  4G1T A;  3V2X A;  2ZXW E;  3R9A B;  2BKK B;  3ZEF A;  3U64 A;  2VSN A;  2AXZ A;  4EQF A;  3IXE A;  1HZ4 A;  3TWV A;  1JCQ A;  4AEZ C;  5AJL A;  2WQ7 A;  1SZ9 A;  3JCK C;  4AOF A;  1FVF A;  2JLB A;  3ZYM A;  2XPZ A;  4GMJ A;  2WQ6 A;  1FT1 A;  2XZT G;  4DPR A;  5AN8 A;  3LCA A;  5ARF A;  4L9P A;  2R5S A;  4LG6 A;  3QNK A;  2WPV A;  3BUA A;  3HXD A;  3LVR E;  1N4S A;  5B1A E;  3FTX A;  5FTP A;  4FP7 A;  3KEZ A;  2WXQ A;  4AV7 A;  4JW1 A;  3UTM A;  3ML9 A;  3B13 A;  2CFU A;  1NP7 A;  2NSZ A;  3SQV A;  2OVB A;  2C2L A;  3ASN E;  3CVL A;  4ANW A;  2X6F A;  5KNG A;  2RKK A;  4WAF A;  4BET A;  1O1S A;  3BQO A;  4FHJ A;  1Z3X A;  3BG1 B;  5AQA A;  2EIK E;  4BSX A;  4NQ0 A;  4D10 C;  4FC8 A;  1H6K A;  3FUN A;  1AWC B;  4HOT A;  3G2S A;  2P9U G;  5A7D B;  3ABM E;  4EZJ A;  1TN6 A;  2A4Z A;  1RW2 A;  3Q7A A;  3ZN3 A;  3DPY A;  4OAU C;  4DJA A;  3Q47 B;  3ESL A;  2JEK A;  4IRU A;  5FZS A;  4FJZ A;  3EIJ A;  1JCR A;  1MQS A;  5T4Y A;  3EUV A;  2RFA A;  1TNY A;  1LD8 A;  4DX7 D;  1RZ4 A;  2E0I A;  1K1B A;  5IY5 E;  3B7U X;  4GTT A;  1QYM A;  4BWR A;  3UIO C;  5CCM A;  3Q75 A;  4ACL A;  2ZGD A;  5G55 A;  5FQ8 A;  3EHQ A;  5A6C A;  3BEE A;  4BEP A;  2X6H A;  1VDY A;  5G05 C;  3PEV B;  4JA9 A;  3L82 A;  4UI9 C;  3TWS A;  1O1R A;  1Z3Y A;  2GRM A;  3FTV A;  3LY8 A;  4AP2 A;  5FQ4 A;  3D9O A;  3TWT A;  4K5B A;  1MZC A;  4MLP A;  5FZR A;  3RKV A;  3ML8 A;  4BTB A;  5AQ9 A;  3FWV A;  1ZBP A;  3DRA A;  1PC2 A;  3D9N A;  3WXX A;  4CCA A;  3T8K A;  3SI5 A;  4U8H A;  1MHQ A;  3IKO B;  4U0S A;  3HYM B;  4JD2 G;  3ASH A;  1E90 A;  3CHM A;  2XS8 A;  1N52 A;  1FVH A;  4ILH B;  3AU5 A;  5BNW A;  2LAH A;  2CG2 A;  1EYH A;  1OXJ A;  5ENR D;  2P9I G;  5BXO A;  4L23 A;  3CVN A;  2YIN A;  1HS6 A;  4ZHB A;  3MZL B;  3E37 A;  3LYA A;  3TWR A;  4ATG A;  1YA0 A;  4CGV A;  2P58 C;  2WMN A;  3PH0 C;  3UUX A;  2QFC A;  2ZIR A;  4ABN A;  2F0Y A;  4KZ0 A;  4F3V A;  1H6P A;  4I6E A;  3C5R A;  3RRU A;  5D66 A;  3ZUV B;  2FUL A;  4DK5 A;  4Y6W A;  4K5A B;  3JQ1 A;  2YHC A;  1OWP A;  5ENP D;  1K1A A;  2H6G A;  2V0P A;  1HF8 A;  2L6B A;  5EYP F;  2EQX A;  3W9F A;  4B89 A;  3L17 A;  3R7Q A;  3C98 A;  4JHJ A;  4UUC A;  3FU3 A;  4RQI A;  1V55 E;  2L6J A;  4FA6 A;  4HQD A;  4JEU A;  2UY1 A;  3HVE B;  3QB2 A;  1OWN A;  3ONK A;  5KJL A;  3FH5 A;  4FHK A;  4PS8 A;  2RD0 A;  3ULE G;  2KZT A;  4KXK B;  2OEV A;  3I4R B;  3UX4 A;  2L0T B;  3KD7 A;  3Q9N C;  3UKR G;  2IO3 C;  3UQ3 A;  4OVU A;  3FEY A;  2XQ0 A;  1MX4 A;  2FF4 A;  3QWV A;  3KSL A;  4G8K A;  3EHM A;  3QAR A;  3D9L A;  3QWW A;  4RVB A;  5HKP A;  5FIN A;  3KAE A;  3FUJ A;  3X2Q E;  1UW4 B;  1WG0 A;  2J07 A;  1SA5 A;  4UWG A;  2V4H C;  4GYO A;  2PM6 A;  3TL5 A;  1D9S A;  4KYO B;  4K03 A;  4N3B A;  2AXV A; 
#chains in the Genus database with same CATH homology
 4TUM A;  2RFM A;  4LSZ E;  1N11 A;  4ATZ D;  2XEN A;  4G8L A;  4LNU D;  5EID A;  1K1B A;  3JXI A;  4HI9 A;  4N5Q A;  5ENS D;  1N0Q A;  4U95 D;  2F8X K;  4DX6 D;  1MX2 A;  1QYM A;  3UTM A;  1NFI E;  3ZKJ A;  1UOH A;  3DEP A;  4DUI A;  4U8V D;  2Y0B G;  3V31 A;  1S70 B;  3C5R A;  4J8Y A;  5KNH D;  5D66 A;  3ZUV B;  2ETC A;  5BXU A;  4K5A B;  2ZGD A;  3B95 A;  4ZFH A;  2AJA A;  5CEC B;  1BLX B;  2BKG A;  4YDY A;  5ENQ D;  5ENP D;  1K1A A;  2VGE A;  4DRX E;  3DEO A;  2DWZ A;  3EHQ A;  3KEA A;  2L6B A;  5AAR A;  3B7B A;  3V30 A;  5EN5 D;  5EYP F;  3W9F A;  3F6Q A;  4HRN A;  4BEP A;  1WDY A;  1BI8 B;  5EIL A;  4CZ2 D;  3TWQ A;  1BD8 A;  5KNG A;  2KBX A;  3V2X A;  3ZNG A;  3AJI A;  5ENT D;  4CYM D;  4UUC A;  4HBD A;  2DZO A;  1G3N B;  4U96 D;  2BKK B;  3TWS A;  1N0R A;  5AQ7 A;  3UXG A;  4BET A;  1YYH A;  2MYO A;  3TWU A;  3TWX A;  1K3Z D;  2NYJ A;  4HLL A;  3V79 K;  4DX7 D;  5JA4 D;  4HQD A;  5CED B;  3EHR A;  5ITZ F;  3IXE A;  2QYJ A;  1YMP A;  5AQA A;  2QC9 A;  4NIK A;  5CEA A;  1SVX A;  3JXJ A;  1OY3 D;  4Z68 A;  3NBN B;  3Q9U C;  3TWV A;  5EIB E;  4HI8 A;  4F1P A;  3HG0 D;  1OT8 A;  3J5Q B;  3TWT A;  2J8S D;  2F37 A;  2HE0 A;  2V5Q C;  4K5B A;  4RLY A;  5FIO A;  2ZGG A;  2DVW A;  2DZN A;  2XEE A;  4YDW A;  2A5E A;  4HB5 A;  3NOC D;  4HRM B;  1AWC B;  3D9H A;  1AP7 A;  1BU9 A;  4K5C A;  5AQ9 A;  3TWW A;  4O60 A;  3Q9N C;  2JAB A;  1YCS B;  1MX6 A;  1DCQ A;  4O1P A;  3V2O A;  5CBN A;  3T8K A;  1A5E A;  2B0O E;  2P2C P;  2Y1L E;  4GMR A;  4O1O A;  1MJ0 A;  4A63 B;  2FO1 E;  2XEH A;  2XZT G;  1MX4 A;  1BI7 B;  5EYL A;  4J7W A;  2ETB A;  2ETA A;  5ENO D;  4BES A;  1DC2 A;  5AN8 A;  2XZD G;  1IKN D;  4G8K A;  4BSZ B;  3AAA C;  4LG6 A;  4U8Y D;  3W9G A;  4HRL A;  5HRY A;  1SW6 A;  3UI2 A;  4OAV B;  4QQI A;  5CER B;  4C48 B;  4OAU C;  4F6R D;  5HKP A;  5AAO A;  5FIN A;  2KXP C;  5ENR D;  5JMN D;  5BXO A;  4DX1 A;  4BER A;  1MYO A;  3J5P A;  3SO8 A;  2F8Y A;  5KWD A;  5CBO A;  5KBA A;  4DX5 D;  4DX2 A;  3T9K A;  5AQB A;  3HRA A;  1IXV A;  1WG0 A;  3LJN A;  4B93 B;  4ZHB A;  4GPM A;  3JUE A;  2PNN A;  3ZU7 B;  3TWR A;  2V4H C;  4HNA D;  1D9S A;  1TR4 A;  1IHB A;  5HS0 A;  3EU9 A;  2RFA A;  3NOG D;  4JB8 P;  4QFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...