4DX7D

Transport of drugs by the multidrug transporter acrb involves an access and a deep binding pocket that are separated by a switch-loop
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
156
structure length
156
Chain Sequence
b'GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acriflavine resistance protein B
publication title Transport of drugs by the multidrug transporter AcrB involves an access and a deep binding pocket that are separated by a switch-loop.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein, transport protein
total genus 51
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4dx7D00
4CYMD 5CECB 2VGEA 4BERA 4ZFHA 2FO1E 4G8LA 5ENSD 5HS0A 5FIOA 2A5EA 1G3NB 3EHQA 1MJ0A 1BI8B 2KXPC 4HB5A 5ENRD 3ZU7B 2ZGGA 3HG0D 5KNHD 3TWTA 2XEHA 3D9HA 5EILA 4GMRA 3TWVA 4ATZD 1YYHA 3Q9NC 5AARA 2F37A 1SW6A 5AQAA 1BLXB 2XENA 3Q9UC 4CZ2D 4G8KA 3B95A 2J8SD 4DRXE 1MX6A 5EIBE 2P2CP 3T9KA 4BESA 3NBNB 2HE0A 1IXVA 3SO8A 3ZUVB 4DUIA 1N0RA 1S70B 2V5QC 2BKKB 4HNAD 1WDYA 3DEPA 3IXEA 3J5QB 3NOGD 4K5AB 4O1OA 3TWWA 1MX2A 4DX6D 2AJAA 2F8YA 2NYJA 5ENPD 5D66A 4DX5D 4N5QA 3JUEA 3TWQA 3UXGA 2Y1LE 5JA4D 1IKND 3ZKJA 5CBOA 5FINA 4U96D 4BETA 1AP7A 2L6BA 3UI2A 1MX4A 4HI8A 2F8XK 2ETCA 1N11A 5KNGA 3T8KA 1MYOA 4DX1A 3JXJA 4HBDA 2MYOA 4OAUC 4C48B 5AQ7A 4QQIA 4LSZE 3TWSA 3V79K 5KBAA 1K1BA 4U8YD 1N0QA 2KBXA 1WG0A 4JB8P 5HRYA 5ENOD 5CERB 3W9FA 4DX7D 3F6QA 5AQBA 3V2XA 1DC2A 4A63B 4B93B 3LJNA 4O60A 3UTMA 3EHRA 1AWCB 4OAVB 4BSZB 4K5BA 3DEOA 1A5EA 3EU9A 4F1PA 4HRNA 5CEDB 5EYLA 4NIKA 2JABA 2DVWA 1DCQA 4TUMA 5EYPF 1BU9A 1YCSB 2ZGDA 4U8VD 4ZHBA 3KEAA 5JMND 1TR4A 4F6RD 3TWUA 1YMPA 2XEEA 1NFIE 2ETBA 3HRAA 3TWXA 4HI9A 1OT8A 2DZOA 3AJIA 3NOCD 2B0OE 2Y0BG 5KWDA 2DWZA 1BI7B 4LNUD 3W9GA 4Z68A 2XZDG 4HRMB 4YDWA 4J8YA 5ITZF 4YDYA 4J7WA 5AQ9A 2QC9A 2XZTG 5CEAA 4UUCA 1D9SA 3AAAC 3B7BA 1OY3D 3J5PA 5BXUA 3JXIA 4U95D 4HLLA 4K5CA 4HRLA 4LG6A 1K3ZD 3V30A 1K1AA 4GPMA 5CBNA 5AN8A 1IHBA 1UOHA 5EN5D 5HKPA 3V2OA 2PNNA 2QYJA 4O1PA 5EIDA 3ZNGA 4BEPA 2DZNA 3V31A 5AAOA 2ETAA 3TWRA 4DX2A 5BXOA 4RLYA 4QFVA 5ENQD 1SVXA 1QYMA 2RFAA 4HQDA 2BKGA 2RFMA 5ENTD 1BD8A 3C5RA 2V4HC
chains in the Genus database with same CATH superfamily
4CYMD 3QARA 3FDHA 3RRMB 5FIOA 3DSWA 1UG3A 4KVOA 2FBNA 2R02A 3EIQC 2C2LA 2EIJE 3IEGA 1DNPA 1LF8A 3E32A 3NBNB 3PDNA 4X8QA 4YVQC 4H7XA 2MHKA 4KBQA 3TGOA 2P9KG 2VSYA 4E85A 5CMWA 3U9WA 3UM0A 5LCWJ 3CKBA 2X38A 3FUMA 1KZPA 2WXIA 3T8KA 4LSZE 3MA5A 4U7EB 4XEIG 5KJLA 4DI3A 4M3OA 5FQ7A 1EDUA 2YHEA 3ABKE 4APOA 3SHFA 4GTSA 4BSZB 4PUCA 3SGHA 4GYOA 4U8VD 4GZ6A 3FUIA 1HO8A 3CVUA 2EINE 1EYHA 2OVBA 3UT4A 4KZCA 3S7JA 2QC9A 3AAAC 3LDZA 4U8HA 5CBNA 2WMNA 2OCCE 3I4RB 4GB9A 3AG3E 2DYSE 5ENQD 3S7FA 3T8MA 4JHRA 2GRPB 2VQ2A 2X6JA 3C5RA 5CECB 1NA0A 3ZXSA 4MS6A 2L6JA 4G25A 1IYGA 1G3NB 2PM6A 3L13A 3PZ2A 3ZHEB 3FEXA 3PE4A 4GMJA 3NAWA 4GMRA 2V0PA 4JC8A 4FHKA 3RRUA 4I9CA 1N95A 4ILHB 3PE3A 3Q4AB 3NOGD 1HU3A 3B7SA 5HQ8A 5AYWD 3B7RL 2H6HA 2KC7A 2WXRA 3GZSA 1MX4A 3U4TA 3ZGQA 3HXBA 4HVBA 4C48B 5AQ7A 5LFAA 3L22A 2WPVA 1H2VC 4AJWA 3PUKA 2X6KA 1K8KG 5ENOD 4K0RA 2B6CA 4GMLA 3PNLB 1YCSB 3GZ2A 4ZHBA 3KEAA 1MQSA 4Q94A 3CQCB 4AY5A 1NFIE 3CSTA 2P9UG 3CVVA 4UI9J 4TXPA 4HFGA 3B7BA 3FTUA 1NP7A 3FUFA 3EHMA 5EN5D 3V31A 3SD5A 3C72A 3FUJA 3LKUA 2XCBA 4B8AA 1OUVA 1H2TC 3G2SA 1U3DA 1TN6A 4BSXA 2A5EA 3CHOA 4RG6A 3CVYA 3Q7AA 3CHSA 4NRHB 3CSFA 4GTRA 3DPDA 3FUKA 2X6FA 3B95A 3E33A 3HXDA 1MX6A 1ZBPA 3EDTB 5ENNA 4HNAD 5M72A 1FT1A 3NB2A 2AJAA 2Y4TA 1ELRA 3UPVA 5EKQD 4WNGA 4C0MA 4IYPA 1AP7A 1OCZE 5EDSA 3TG4A 1SZAA 4QQIA 3TG5A 2L9BA 2KBXA 1WG0A 4FU3A 4XIFA 3MJWA 4XX5A 2WXQA 4G24A 3QWWA 3DEOA 3D3MA 1A5EA 3FUHA 4CCAA 4NIKA 4CDNA 5JMND 4GAAA 5G05J 2X3MA 3U3WA 4TUUA 3TL5A 4HLLA 1H6OA 4GPMA 3CVXA 4AP2A 2KATA 3L82A 2GRQB 1OWMA 3U64A 4IN3B 2QFCA 4YVOA 5G04C 4EBAA 1TNBA 3X2QE 1IQRA 4M7CA 1NZNA 5T4YA 4N3BA 4HOQA 3MKRA 3HHMA 4GA2A 2Y69E 5EILA 2IY0C 1SW6A 5AQAA 1Q2ZA 2BEDA 2WQ7A 2UY1B 3MV2B 3Q5MA 4U0UA 4A1SA 3DEPA 2V4LA 2ZIRA 4LRZA 4PS8A 3NF1A 3T5XA 2AXZA 4GA1A 1N11A 4IULA 4HBDA 4GTMA 3HXFA 4ACLA 3ML9A 2P9PG 2WXLA 2XRZA 4J8SA 5KJKA 3W9FA 5AQBA 3UQ3A 2DYRE 2ONDA 3ASNE 4F1PA 4HRNA 3JUIA 4NQ0A 1A17A 3AU5A 3IHYA 1OWOA 4XKBA 2Y0BG 4LUNU 4J8YA 3AS4A 3R7RA 4U95D 1O1RA 3ASHA 4C9BB 4ME2A 1HZ4A 2RKKA 3LXUX 2FEZA 2IOSA 2P9IG 4L2LA 3HXCA 4I1OB 3LEWA 2R5SA 3PEVB 1E90A 4B89A 3D9LA 4JL0A 3HG0D 3C3QA 3FFLA 4CZ2D 2HE0A 3Q47B 1N0RA 5G2NA 2GROB 1O1TA 3MX3A 4U07A 4O1OA 4PDXA 2FO7A 3TWQA 4A1GA 3UT8A 4RG9A 3AG1E 5AENA 4U96D 3UKRG 4WWNA 4OYSA 5A6CA 5D0QD 3K9IA 3SFZA 3OXFA 5BNWA 5KNGA 4OAUC 4I2WA 3PRZA 4WWPA 3UX4A 3T5VA 4JB8P 4DX7D 4HOTA 1VDYA 4PS7A 4EHMA 1UW4B 1HS6A 5H7PA 2I2OA 2R05A 3HDXA 4I2ZA 5FQ6A 5G55A 4F6RD 4TV3A 5B1AE 4V3IA 3BG1B 3FP3A 1H6KA 3ZIMA 2B0OE 2OV8A 1TJCA 2R03A 2XEVA 5CEAA 3VTYA 1D8EA 3CVPA 3UT7A 1HXIA 4YDOA 4RLYA 3QKYA 2YQ8A 2WXHA 3Q7FA 1S63A 1U3CA 5C1DA 3L08A 3OAWA 2GRLA 4JPSA 1FT2A 4F7AA 1FPPA 5EX0A 4A3VA 3FWVA 3TXMA 4G26A 3SO8A 2I6HA 4U0ZA 2OEVA 3FU0A 3RRNB 4F1SA 1NL4A 2IJGX 2PQRA 4GZ5A 2V8SE 4GPKA 5FT9A 3ASGA 3UI2A 3ONLA 4BY6A 1OCOE 2CFUA 4TXQA 3EIJA 2L0IA 3JXJA 3Q79A 3G2VA 3TWSA 2Q7FA 4DI4A 2PZIA 2BTDA 2HM8A 2UWJG 2L0TB 2CHXA 3FULA 2A5UA 4J8EA 4I1MA 3RK6A 5EYLA 3ABLE 4WNDA 4GYYA 2FULA 1QNFA 3G2TA 5BW8C 1E7UA 2XEEA 4WWOA 1H19A 4BX8A 4HRMB 1GW6A 2XZTG 4UUCA 3ASOE 1K3ZD 4UQZA 2VSOE 2NXPA 4APFA 3GYZA 1Y6IA 2VGYA 2XPIA 1UJKA 1KLXA 3ZYKA 5HI7A 3CHQA 3O48A 5JJTA 5ENTD 2RFMA 1KZOA 2VGEA 4BERA 5HS0A 4U04A 2KXPC 5BUZA 3FU5A 5E76A 5KNHD 1ZB1A 3PZ3A 5CRVA 5AARA 4BX9A 2YINA 4DRXE 5EIBE 3UIPC 1S70B 2E2EA 1N4RA 3Q75A 3O4ZA 3RAUA 3PEUB 2A4ZA 3FTZA 5LCWC 4AY6A 3G2WA 3UXGA 1FVFA 3FH5A 2JLBA 3TAXA 4J6IA 1JWFA 5FQ8A 3UMVA 2HR2A 5CBOA 3ENEA 4J8DA 2J07A 2P58C 3NZUA 3EU5A 4GTQA 4U8YD 2AVPA 3MEKA 1U2VG 3L6AA 5KJNA 3CVNA 3ZFWA 1JUQA 2DVWA 5CHEE 3RIBA 1DCQA 5EYPF 3SZ7A 1XGWA 2WM9A 2IU1A 3IKOB 4EECA 4LNUD 3DXKG 1D9SA 3UM3A 3JXIA 1D8DA 1K1AA 5AN8A 3QOUA 5FJYA 5EIDA 2V5FA 1JPLA 4MBGA 3SFYA 3SF4A 4XZ4A 4UWLA 4R7LA 2VGXA 2P9NG 3D9MA 2CFZA 2GRRB 4JHJA 2HYZA 3UINC 4L2YA 4DUIA 4FA6A 4K5AB 2J49A 3SI5A 2KCLA 3PUJA 3ULQA 1E8WA 2VGXB 4KXKB 1TN7A 1V54E 3PNTB 2F8XK 3FUEA 3RU0A 4ABNA 3P1UA 4AM9A 1TEZA 3CQGB 3QNKA 4RQIA 1UJJA 1PAQA 3OXLA 2XCCA 3LVRE 4WUYA 4N5CA 1BU9A 3R9MA 1TR4A 3ESKA 3GZ1A 3TWUA 1BPOA 1N4QA 4UI9C 3FTSA 1S64A 3OXGA 4Z68A 4C0EA 4URKA 1H6PA 1O5MA 1N4SA 3LPZA 4GTPA 3KAEA 3ZNGA 3SBTB 3LY7A 2XS1A 3PS6A 4I6JA 4KZ0A 1L5JA 1QYMA 2AXVA 3BG0B 2C0LA 1LD8A 4JW1A 4ZFHA 4G8LA 4HB5A 5ENRD 1HE8A 4UWFA 3ML8A 3MKQA 2WQHA 1HFAA 1KPSB 2LXLA 4FULA 2WXNA 2FI7A 3DBSA 2KCKA 3D9IA 4I1AA 2P2CP 3L9TA 3ZUVB 4OVUA 1DVPA 1WDYA 3J5QB 2RG8A 1INZA 5T8IA 4ILGA 4CDRA 4N5QA 1OCRE 4N2SA 3MKQB 2WXPA 4L23A 4DLOA 2EILE 2I1KA 5CCMA 3NZSA 4TXRA 2VYIA 4JXTA 4DK5A 4A3TA 5FWQA 1QBQA 3RJVA 3TXNA 3QWPA 1ELKA 1DC2A 1V55E 1Z6TA 3UTMA 1NI1A 4UWGA 5J90A 1TNZA 3LS8A 3ZYLA 1DCEA 4N3CA 5FZQA 5G05C 4FJZA 3TWXA 3CVLA 5A23A 1E8ZA 1BI7B 2DWZA 3AS5A 4UWHA 4WNEA 5B1BE 1SQMA 1UOHA 2PNNA 4WAFA 4XKCA 5AAOA 4QFVA 3KS2A 2AXUA 4GTTA 3QDNA 2HO1A 3APDA 5BT1A 2BKGA 1BD8A 2WXJA 4B8CB 1MZCA 1JCRA 4GCNA 1Y8MA 2ZGGA 4H7YA 3RSEG 4N2QA 1YYHA 3CVQA 2XENA 3LJ3A 1EPUA 4FP7A 4CDMA 3FHEA 4AOFA 3DSSA 3KSQA 4KYOB 5LP0A 5ARGA 3VTXA 3JUEA 2Y1LE 4E6HA 3LY9A 4BETA 3PVLA 4CEMA 1E8YA 2MYOA 2IO3C 1X81A 1SZ9A 3FUNA 4KMOA 5HRYA 3V2XA 3LCAA 3AS8A 3FTYA 2VSNA 2IONA 1OWLA 3JCKC 2CG2A 3ZN3A 4MLPA 3FEYA 2ZGDA 3DWLG 4MKTA 5CCLA 4L1BA 1YMPA 1ZU2A 2ETBA 3D9KA 5FZSA 2WXGA 4ILIA 4I17A 1Z3YA 3W9GA 2R17C 4IRUA 1QZ2A 3DRAA 3G2UA 4HRLA 4LG6A 1SA4A 3ONKA 5HKPA 4CT4A 4FLBA 1UN8A 4LCTA 4LERA 4ANWA 4BTAA 3I5PA 4JA7A 2WMOA 4HQDA 4GTVA 3MZLB 5AJLA 3FTWA 3EHQA 1BI8B 1LD7A 4Y6WA 5ARFA 3D9HA 4J8FA 4ATZD 2CHZA 2JEKA 3FH8A 4EPZA 2V5QC 3TWWA 2LSUA 3NQPA 4WNFA 3CHRA 3RO2A 2KZTA 3FY4A 2DIWA 3CLJA 3KEZA 5DIZA 4DX1A 3ZEFA 1TJFA 3C3OA 2M63A 5KBAA 1N0QA 2Y3AA 5C2YA 4F3VA 3B7UX 3HIZA 1N94A 3DSVA 4A63B 3LJNA 2KZTB 5BV0A 3ESLA 3N71A 3ZPJA 4BFRA 4I43A 2IQCA 2AWIA 2JABA 4FLHA 1OWPA 3DSTA 3ZXPA 5BV1A 5LOZA 4UQXA 3HRAA 3AU4A 4A55A 5KWDA 2MRIA 1TNOA 3CK9A 2X6HA 1OY3D 4JD2G 3D9NA 5JJ6A 4G23A 4O1PA 4EQFA 3DSUA 2GW1A 3FTXA 4F53A 4N39A 2VJ8A 1OWNA 1MJ0A 5ANRA 2AW6A 5D0OD 3HXEA 2ZXWE 5ANLA 2KM4A 3FH7A 2R2LA 3Q9UC 3T9KA 2J08A 4JVSA 4GYWA 2WVIA 2FF4A 2J4BA 4DX5D 1RW2A 4GU5A 3EHNA 5JHAA 3FU3A 3Q78A 4FADA 1KT0A 5FTPA 1QQEA 4NACA 2EQXA 2GGFA 3OTNA 3HYMB 3SY2A 3IBEA 3L17A 3UM2A 3I3NA 4Q96A 1WM5A 3E30A 4B93B 4JZYA 1HG2A 3C98A 4DPRA 1N54A 4XI9A 3ZHEA 4YNDA 3S7DA 2GRNB 2WXFA 4J0UA 1OXJA 3ISMC 2KCVA 2X6IA 4OVVA 3R9AB 4DLQA 2WXOA 3NOCD 1UN9A 3ZYMA 2RD0A 3BUAA 4ANUA 2IO2C 2DCPA 4BTBA 2PM7A 1JCQA 1LTXA 4B0ZA 1Z3XA 2QYJA 4UQYA 3APFA 1W3BA 3VLFA 4LNGA 4GCOA 3CR3A 4G1TA 5KCMA 2P9SG 4I9EA 2P9LG 2QZAA 2PQNA 2E0IA 3ZW3A 4KT6B 4XE0A 4FC8A 3TWVA 3D9JA 3WG7E 4TRQA 4Y6CA 3CHPA 3WXXA 3C3RA 3FU6A 2WXMA 3IXEA 3Q15A 4GZCA 2LO6A 2H6IA 5JA4D 3PZ4A 2VSXE 4GTOA 3CIAA 4ANVA 4EBAG 1MYOA 3L54A 1HH8A 3QWVA 1B89A 5AJDA 4I6GA 4JEUA 1IQUA 3SNXA 4ATGA 3E37A 1AWCB 5BPPA 1TN8A 3U66A 3EU9A 5CEDB 4TUMA 3PZDA 4RVBA 1RZ4A 2DZOA 2Y4UA 1OCCE 2EIME 3I4GA 3BU8A 1NA3A 4J7WA 5AQ9A 3QK0A 5BXUA 3CGHA 3ASFA 2LAHA 5E75A 4AEZC 4BWRA 1PC2A 3PH0C 2OVFA 3EUVA 4D10C 5DBKA 3GW4A 1N9AA 3RO3A 1MHQA 4HORA 4HLEA 5D2MC 1SVXA 3AG2E 4FJYA 2IFUA 1JWGA 2FO1E 2MOWA 5G04J 2J4DA 3CHMA 3E34A 2XRYA 3BEEA 3ZVVA 4G8KA 3JQ0A 5IY5E 2J09A 2EIKE 4ACKA 2WQ6A 5KJMA 2BKKB 1TNYA 1MX2A 2NYJA 4Q69A 4P29A 5D66A 3TJPA 3EJNA 4AXHA 1IKND 2H6GA 4U63A 1E8XA 2BUGA 3CKCA 1H0AA 2ETCA 1Z5SC 2QYUA 2PL2A 3ZRHA 4GZ3A 1YA0A 3JQ1A 1IHGA 3JYSA 1K1BA 2BF0X 1E7VA 3ABME 5CERB 3Q73A 3SBSA 4PS3A 4OAVB 2OEWA 3D9PA 4BT9A 4UI9K 2LXMA 1SA5A 4L7TA 1H2UA 3L16A 4AVXA 4HI9A 3AJIA 3SQVA 2UY1A 2IF4A 4HXIA 3FUDA 4MRUA 3PREA 4YDWA 3QAQA 2NSZA 3J5PA 3CK8A 4RSYA 3BQOA 2LNIA 3P2BA 2DZNA 3MCXA 3QJZA 4DX2A 2YNQA 4JEHA 4BT8A 4K03A 4LNBA 5CRUA 3Q49B 1N4PA 4L9PA 3ASDA 4FHJA 3ZU7B 3SFXA 3CVWA 3Q9NC 2F37A 1BLXB 4XI0A 4G2VA 2LSVA 2DBAA 3QC1A 2YHCA 4HS2A 4DX6D 4CRWA 1S0PA 4U0SA 2IEJA 2XGMA 5J08A 3URZA 4HOSA 2L6BA 4W9RA 3VLEA 2WB2A 3UKUG 5JHBA 3D9OA 5AIJA 4EZJA 2LAIA 3F6QA 4O60A 3HVEA 4AIFA 2XQ0A 4K5BA 3FTVA 4JHKA 3CK7A 4B94A 2XPYA 3DPYA 2CG3A 1N52A 3MGBA 2CHWA 2ILRA 4LEUA 2I1JA 5LX8A 1TNUA 3UUXA 2IOLA 3MYVA 1TYQG 2XZDG 3HVEB 3PZ1A 3CV0A 4NURA 2XHEA 3CEQA 3V30A 1EF1C 1IHBA 4G11A 3V2OA 3S7BA 2XS8A 2OOEA 3KSLA 3LY8A 4GA0A 2ETAA 2LUHA 3TWRA 5BXOA 1PY1A 1P5QA 3IHVA 3ULYA 3RKVA 3B13A 5ENSD 1FCHA 1XNFA 3LYAA 5FQ4A 3TWTA 2XEHA 3IV0A 1O1SA 2J9QA 2I9CA 2ZU6B 4PH4B 4JA9A 4I6EA 4GZDA 1WY6A 3B7TA 2J8SD 5CMYA 5B3SE 4YDEA 2XGOA 4BESA 3E4BA 1IXVA 2GRMA 4N3AA 1KT1A 3ULEG 1HG5A 2F8YA 2H6FA 2QY7A 5ENPD 1X5BA 3ZKJA 5FINA 2NC9A 2ZISA 4EZLA 1FVHA 4HI8A 3UIOC 3VLDA 1ELWA 3DXMG 4ANXA 3V79K 2C0MA 3R7QA 4HOUA 4CGVA 5FZRA 1WAO1 3AG4E 4CT0A 3EHRA 2WXKA 4CGWA 2R59A 4AV7A 1HX8A 3DSXA 3UM1A 2F0YA 5EX3A 1OT8A 4KVMA 4DJAA 1E96B 2VTBA 4O6FA 3KD7A 4YDYA 5ITZF 5JJ7A 4K5CA 3MV3B 3S2AA 1HF8A 4EZKA 1JCSA 4BEPA 3LVQE 2XGSA 3APCA 5A7DB 2XPZA 3QB2A 3ZYQA 2RFAA 2VTBB 5T3RA 2V4HC 4UWKA
chains in the Genus database with same CATH topology
4CYMD 5CECB 2VGEA 4BERA 4ZFHA 2FO1E 4G8LA 5ENSD 5HS0A 5FIOA 2A5EA 1G3NB 3EHQA 1MJ0A 1BI8B 2KXPC 4HB5A 5ENRD 3ZU7B 2ZGGA 3HG0D 5KNHD 3TWTA 2XEHA 3D9HA 5EILA 4GMRA 3TWVA 4ATZD 1YYHA 3Q9NC 5AARA 2F37A 1SW6A 5AQAA 1BLXB 2XENA 3Q9UC 4CZ2D 4G8KA 3B95A 2J8SD 4DRXE 1MX6A 5EIBE 2P2CP 3T9KA 4BESA 3NBNB 2HE0A 1IXVA 3SO8A 3ZUVB 4DUIA 1N0RA 1S70B 2V5QC 2BKKB 4HNAD 1WDYA 3DEPA 3IXEA 3J5QB 3NOGD 4K5AB 4O1OA 3TWWA 1MX2A 4DX6D 2AJAA 2F8YA 2NYJA 5ENPD 5D66A 4DX5D 4N5QA 3JUEA 3TWQA 3UXGA 2Y1LE 5JA4D 1IKND 3ZKJA 5CBOA 5FINA 4U96D 4BETA 1AP7A 2L6BA 3UI2A 1MX4A 4HI8A 2F8XK 2ETCA 1N11A 5KNGA 3T8KA 1MYOA 4DX1A 3JXJA 4HBDA 2MYOA 4OAUC 4C48B 5AQ7A 4QQIA 4LSZE 3TWSA 3V79K 5KBAA 1K1BA 4U8YD 1N0QA 2KBXA 1WG0A 4JB8P 5HRYA 5ENOD 5CERB 3W9FA 4DX7D 3F6QA 5AQBA 3V2XA 1DC2A 4A63B 4B93B 3LJNA 4O60A 3UTMA 3EHRA 1AWCB 4OAVB 4BSZB 4K5BA 3DEOA 1A5EA 3EU9A 4F1PA 4HRNA 5CEDB 5EYLA 4NIKA 2JABA 2DVWA 1DCQA 4TUMA 5EYPF 1BU9A 1YCSB 2ZGDA 4U8VD 4ZHBA 3KEAA 5JMND 1TR4A 4F6RD 3TWUA 1YMPA 2XEEA 1NFIE 2ETBA 3HRAA 3TWXA 4HI9A 1OT8A 2DZOA 3AJIA 3NOCD 2B0OE 2Y0BG 5KWDA 2DWZA 1BI7B 4LNUD 3W9GA 4Z68A 2XZDG 4HRMB 4YDWA 4J8YA 5ITZF 4YDYA 4J7WA 5AQ9A 2QC9A 2XZTG 5CEAA 4UUCA 1D9SA 3AAAC 3B7BA 1OY3D 3J5PA 5BXUA 3JXIA 4U95D 4HLLA 4K5CA 4HRLA 4LG6A 1K3ZD 3V30A 1K1AA 4GPMA 5CBNA 5AN8A 1IHBA 1UOHA 5EN5D 5HKPA 3V2OA 2PNNA 2QYJA 4O1PA 5EIDA 3ZNGA 4BEPA 2DZNA 3V31A 5AAOA 2ETAA 3TWRA 4DX2A 5BXOA 4RLYA 4QFVA 5ENQD 1SVXA 1QYMA 2RFAA 4HQDA 2BKGA 2RFMA 5ENTD 1BD8A 3C5RA 2V4HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYM D;  5CEC B;  2VGE A;  4BER A;  4ZFH A;  2FO1 E;  4G8L A;  5ENS D;  5HS0 A;  5FIO A;  2A5E A;  1G3N B;  3EHQ A;  1MJ0 A;  1BI8 B;  2KXP C;  4HB5 A;  5ENR D;  3ZU7 B;  2ZGG A;  3HG0 D;  5KNH D;  3TWT A;  2XEH A;  3D9H A;  5EIL A;  4GMR A;  3TWV A;  4ATZ D;  1YYH A;  3Q9N C;  5AAR A;  2F37 A;  1SW6 A;  5AQA A;  1BLX B;  2XEN A;  3Q9U C;  4CZ2 D;  4G8K A;  3B95 A;  2J8S D;  4DRX E;  1MX6 A;  5EIB E;  2P2C P;  3T9K A;  4BES A;  3NBN B;  2HE0 A;  1IXV A;  3SO8 A;  3ZUV B;  4DUI A;  1N0R A;  1S70 B;  2V5Q C;  2BKK B;  4HNA D;  1WDY A;  3DEP A;  3IXE A;  3J5Q B;  3NOG D;  4K5A B;  4O1O A;  3TWW A;  1MX2 A;  4DX6 D;  2AJA A;  2F8Y A;  2NYJ A;  5ENP D;  5D66 A;  4DX5 D;  4N5Q A;  3JUE A;  3TWQ A;  3UXG A;  2Y1L E;  5JA4 D;  1IKN D;  3ZKJ A;  5CBO A;  5FIN A;  4U96 D;  4BET A;  1AP7 A;  2L6B A;  3UI2 A;  1MX4 A;  4HI8 A;  2F8X K;  2ETC A;  1N11 A;  5KNG A;  3T8K A;  1MYO A;  4DX1 A;  3JXJ A;  4HBD A;  2MYO A;  4OAU C;  4C48 B;  5AQ7 A;  4QQI A;  4LSZ E;  3TWS A;  3V79 K;  5KBA A;  1K1B A;  4U8Y D;  1N0Q A;  2KBX A;  1WG0 A;  4JB8 P;  5HRY A;  5ENO D;  5CER B;  3W9F A;  4DX7 D;  3F6Q A;  5AQB A;  3V2X A;  1DC2 A;  4A63 B;  4B93 B;  3LJN A;  4O60 A;  3UTM A;  3EHR A;  1AWC B;  4OAV B;  4BSZ B;  4K5B A;  3DEO A;  1A5E A;  3EU9 A;  4F1P A;  4HRN A;  5CED B;  5EYL A;  4NIK A;  2JAB A;  2DVW A;  1DCQ A;  4TUM A;  5EYP F;  1BU9 A;  1YCS B;  2ZGD A;  4U8V D;  4ZHB A;  3KEA A;  5JMN D;  1TR4 A;  4F6R D;  3TWU A;  1YMP A;  2XEE A;  1NFI E;  2ETB A;  3HRA A;  3TWX A;  4HI9 A;  1OT8 A;  2DZO A;  3AJI A;  3NOC D;  2B0O E;  2Y0B G;  5KWD A;  2DWZ A;  1BI7 B;  4LNU D;  3W9G A;  4Z68 A;  2XZD G;  4HRM B;  4YDW A;  4J8Y A;  5ITZ F;  4YDY A;  4J7W A;  5AQ9 A;  2QC9 A;  2XZT G;  5CEA A;  4UUC A;  1D9S A;  3AAA C;  3B7B A;  1OY3 D;  3J5P A;  5BXU A;  3JXI A;  4U95 D;  4HLL A;  4K5C A;  4HRL A;  4LG6 A;  1K3Z D;  3V30 A;  1K1A A;  4GPM A;  5CBN A;  5AN8 A;  1IHB A;  1UOH A;  5EN5 D;  5HKP A;  3V2O A;  2PNN A;  2QYJ A;  4O1P A;  5EID A;  3ZNG A;  4BEP A;  2DZN A;  3V31 A;  5AAO A;  2ETA A;  3TWR A;  4DX2 A;  5BXO A;  4RLY A;  4QFV A;  5ENQ D;  1SVX A;  1QYM A;  2RFA A;  4HQD A;  2BKG A;  2RFM A;  5ENT D;  1BD8 A;  3C5R A;  2V4H C; 
#chains in the Genus database with same CATH topology
 4CYM D;  3QAR A;  3FDH A;  3RRM B;  5FIO A;  3DSW A;  1UG3 A;  4KVO A;  2FBN A;  2R02 A;  3EIQ C;  2C2L A;  2EIJ E;  3IEG A;  1DNP A;  1LF8 A;  3E32 A;  3NBN B;  3PDN A;  4X8Q A;  4YVQ C;  4H7X A;  2MHK A;  4KBQ A;  3TGO A;  2P9K G;  2VSY A;  4E85 A;  5CMW A;  3U9W A;  3UM0 A;  5LCW J;  3CKB A;  2X38 A;  3FUM A;  1KZP A;  2WXI A;  3T8K A;  4LSZ E;  3MA5 A;  4U7E B;  4XEI G;  5KJL A;  4DI3 A;  4M3O A;  5FQ7 A;  1EDU A;  2YHE A;  3ABK E;  4APO A;  3SHF A;  4GTS A;  4BSZ B;  4PUC A;  3SGH A;  4GYO A;  4U8V D;  4GZ6 A;  3FUI A;  1HO8 A;  3CVU A;  2EIN E;  1EYH A;  2OVB A;  3UT4 A;  4KZC A;  3S7J A;  2QC9 A;  3AAA C;  3LDZ A;  4U8H A;  5CBN A;  2WMN A;  2OCC E;  3I4R B;  4GB9 A;  3AG3 E;  2DYS E;  5ENQ D;  3S7F A;  3T8M A;  4JHR A;  2GRP B;  2VQ2 A;  2X6J A;  3C5R A;  5CEC B;  1NA0 A;  3ZXS A;  4MS6 A;  2L6J A;  4G25 A;  1IYG A;  1G3N B;  2PM6 A;  3L13 A;  3PZ2 A;  3ZHE B;  3FEX A;  3PE4 A;  4GMJ A;  3NAW A;  4GMR A;  2V0P A;  4JC8 A;  4FHK A;  3RRU A;  4I9C A;  1N95 A;  4ILH B;  3PE3 A;  3Q4A B;  3NOG D;  1HU3 A;  3B7S A;  5HQ8 A;  5AYW D;  3B7R L;  2H6H A;  2KC7 A;  2WXR A;  3GZS A;  1MX4 A;  3U4T A;  3ZGQ A;  3HXB A;  4HVB A;  4C48 B;  5AQ7 A;  5LFA A;  3L22 A;  2WPV A;  1H2V C;  4AJW A;  3PUK A;  2X6K A;  1K8K G;  5ENO D;  4K0R A;  2B6C A;  4GML A;  3PNL B;  1YCS B;  3GZ2 A;  4ZHB A;  3KEA A;  1MQS A;  4Q94 A;  3CQC B;  4AY5 A;  1NFI E;  3CST A;  2P9U G;  3CVV A;  4UI9 J;  4TXP A;  4HFG A;  3B7B A;  3FTU A;  1NP7 A;  3FUF A;  3EHM A;  5EN5 D;  3V31 A;  3SD5 A;  3C72 A;  3FUJ A;  3LKU A;  2XCB A;  4B8A A;  1OUV A;  1H2T C;  3G2S A;  1U3D A;  1TN6 A;  4BSX A;  2A5E A;  3CHO A;  4RG6 A;  3CVY A;  3Q7A A;  3CHS A;  4NRH B;  3CSF A;  4GTR A;  3DPD A;  3FUK A;  2X6F A;  3B95 A;  3E33 A;  3HXD A;  1MX6 A;  1ZBP A;  3EDT B;  5ENN A;  4HNA D;  5M72 A;  1FT1 A;  3NB2 A;  2AJA A;  2Y4T A;  1ELR A;  3UPV A;  5EKQ D;  4WNG A;  4C0M A;  4IYP A;  1AP7 A;  1OCZ E;  5EDS A;  3TG4 A;  1SZA A;  4QQI A;  3TG5 A;  2L9B A;  2KBX A;  1WG0 A;  4FU3 A;  4XIF A;  3MJW A;  4XX5 A;  2WXQ A;  4G24 A;  3QWW A;  3DEO A;  3D3M A;  1A5E A;  3FUH A;  4CCA A;  4NIK A;  4CDN A;  5JMN D;  4GAA A;  5G05 J;  2X3M A;  3U3W A;  4TUU A;  3TL5 A;  4HLL A;  1H6O A;  4GPM A;  3CVX A;  4AP2 A;  2KAT A;  3L82 A;  2GRQ B;  1OWM A;  3U64 A;  4IN3 B;  2QFC A;  4YVO A;  5G04 C;  4EBA A;  1TNB A;  3X2Q E;  1IQR A;  4M7C A;  1NZN A;  5T4Y A;  4N3B A;  4HOQ A;  3MKR A;  3HHM A;  4GA2 A;  2Y69 E;  5EIL A;  2IY0 C;  1SW6 A;  5AQA A;  1Q2Z A;  2BED A;  2WQ7 A;  2UY1 B;  3MV2 B;  3Q5M A;  4U0U A;  4A1S A;  3DEP A;  2V4L A;  2ZIR A;  4LRZ A;  4PS8 A;  3NF1 A;  3T5X A;  2AXZ A;  4GA1 A;  1N11 A;  4IUL A;  4HBD A;  4GTM A;  3HXF A;  4ACL A;  3ML9 A;  2P9P G;  2WXL A;  2XRZ A;  4J8S A;  5KJK A;  3W9F A;  5AQB A;  3UQ3 A;  2DYR E;  2OND A;  3ASN E;  4F1P A;  4HRN A;  3JUI A;  4NQ0 A;  1A17 A;  3AU5 A;  3IHY A;  1OWO A;  4XKB A;  2Y0B G;  4LUN U;  4J8Y A;  3AS4 A;  3R7R A;  4U95 D;  1O1R A;  3ASH A;  4C9B B;  4ME2 A;  1HZ4 A;  2RKK A;  3LXU X;  2FEZ A;  2IOS A;  2P9I G;  4L2L A;  3HXC A;  4I1O B;  3LEW A;  2R5S A;  3PEV B;  1E90 A;  4B89 A;  3D9L A;  4JL0 A;  3HG0 D;  3C3Q A;  3FFL A;  4CZ2 D;  2HE0 A;  3Q47 B;  1N0R A;  5G2N A;  2GRO B;  1O1T A;  3MX3 A;  4U07 A;  4O1O A;  4PDX A;  2FO7 A;  3TWQ A;  4A1G A;  3UT8 A;  4RG9 A;  3AG1 E;  5AEN A;  4U96 D;  3UKR G;  4WWN A;  4OYS A;  5A6C A;  5D0Q D;  3K9I A;  3SFZ A;  3OXF A;  5BNW A;  5KNG A;  4OAU C;  4I2W A;  3PRZ A;  4WWP A;  3UX4 A;  3T5V A;  4JB8 P;  4DX7 D;  4HOT A;  1VDY A;  4PS7 A;  4EHM A;  1UW4 B;  1HS6 A;  5H7P A;  2I2O A;  2R05 A;  3HDX A;  4I2Z A;  5FQ6 A;  5G55 A;  4F6R D;  4TV3 A;  5B1A E;  4V3I A;  3BG1 B;  3FP3 A;  1H6K A;  3ZIM A;  2B0O E;  2OV8 A;  1TJC A;  2R03 A;  2XEV A;  5CEA A;  3VTY A;  1D8E A;  3CVP A;  3UT7 A;  1HXI A;  4YDO A;  4RLY A;  3QKY A;  2YQ8 A;  2WXH A;  3Q7F A;  1S63 A;  1U3C A;  5C1D A;  3L08 A;  3OAW A;  2GRL A;  4JPS A;  1FT2 A;  4F7A A;  1FPP A;  5EX0 A;  4A3V A;  3FWV A;  3TXM A;  4G26 A;  3SO8 A;  2I6H A;  4U0Z A;  2OEV A;  3FU0 A;  3RRN B;  4F1S A;  1NL4 A;  2IJG X;  2PQR A;  4GZ5 A;  2V8S E;  4GPK A;  5FT9 A;  3ASG A;  3UI2 A;  3ONL A;  4BY6 A;  1OCO E;  2CFU A;  4TXQ A;  3EIJ A;  2L0I A;  3JXJ A;  3Q79 A;  3G2V A;  3TWS A;  2Q7F A;  4DI4 A;  2PZI A;  2BTD A;  2HM8 A;  2UWJ G;  2L0T B;  2CHX A;  3FUL A;  2A5U A;  4J8E A;  4I1M A;  3RK6 A;  5EYL A;  3ABL E;  4WND A;  4GYY A;  2FUL A;  1QNF A;  3G2T A;  5BW8 C;  1E7U A;  2XEE A;  4WWO A;  1H19 A;  4BX8 A;  4HRM B;  1GW6 A;  2XZT G;  4UUC A;  3ASO E;  1K3Z D;  4UQZ A;  2VSO E;  2NXP A;  4APF A;  3GYZ A;  1Y6I A;  2VGY A;  2XPI A;  1UJK A;  1KLX A;  3ZYK A;  5HI7 A;  3CHQ A;  3O48 A;  5JJT A;  5ENT D;  2RFM A;  1KZO A;  2VGE A;  4BER A;  5HS0 A;  4U04 A;  2KXP C;  5BUZ A;  3FU5 A;  5E76 A;  5KNH D;  1ZB1 A;  3PZ3 A;  5CRV A;  5AAR A;  4BX9 A;  2YIN A;  4DRX E;  5EIB E;  3UIP C;  1S70 B;  2E2E A;  1N4R A;  3Q75 A;  3O4Z A;  3RAU A;  3PEU B;  2A4Z A;  3FTZ A;  5LCW C;  4AY6 A;  3G2W A;  3UXG A;  1FVF A;  3FH5 A;  2JLB A;  3TAX A;  4J6I A;  1JWF A;  5FQ8 A;  3UMV A;  2HR2 A;  5CBO A;  3ENE A;  4J8D A;  2J07 A;  2P58 C;  3NZU A;  3EU5 A;  4GTQ A;  4U8Y D;  2AVP A;  3MEK A;  1U2V G;  3L6A A;  5KJN A;  3CVN A;  3ZFW A;  1JUQ A;  2DVW A;  5CHE E;  3RIB A;  1DCQ A;  5EYP F;  3SZ7 A;  1XGW A;  2WM9 A;  2IU1 A;  3IKO B;  4EEC A;  4LNU D;  3DXK G;  1D9S A;  3UM3 A;  3JXI A;  1D8D A;  1K1A A;  5AN8 A;  3QOU A;  5FJY A;  5EID A;  2V5F A;  1JPL A;  4MBG A;  3SFY A;  3SF4 A;  4XZ4 A;  4UWL A;  4R7L A;  2VGX A;  2P9N G;  3D9M A;  2CFZ A;  2GRR B;  4JHJ A;  2HYZ A;  3UIN C;  4L2Y A;  4DUI A;  4FA6 A;  4K5A B;  2J49 A;  3SI5 A;  2KCL A;  3PUJ A;  3ULQ A;  1E8W A;  2VGX B;  4KXK B;  1TN7 A;  1V54 E;  3PNT B;  2F8X K;  3FUE A;  3RU0 A;  4ABN A;  3P1U A;  4AM9 A;  1TEZ A;  3CQG B;  3QNK A;  4RQI A;  1UJJ A;  1PAQ A;  3OXL A;  2XCC A;  3LVR E;  4WUY A;  4N5C A;  1BU9 A;  3R9M A;  1TR4 A;  3ESK A;  3GZ1 A;  3TWU A;  1BPO A;  1N4Q A;  4UI9 C;  3FTS A;  1S64 A;  3OXG A;  4Z68 A;  4C0E A;  4URK A;  1H6P A;  1O5M A;  1N4S A;  3LPZ A;  4GTP A;  3KAE A;  3ZNG A;  3SBT B;  3LY7 A;  2XS1 A;  3PS6 A;  4I6J A;  4KZ0 A;  1L5J A;  1QYM A;  2AXV A;  3BG0 B;  2C0L A;  1LD8 A;  4JW1 A;  4ZFH A;  4G8L A;  4HB5 A;  5ENR D;  1HE8 A;  4UWF A;  3ML8 A;  3MKQ A;  2WQH A;  1HFA A;  1KPS B;  2LXL A;  4FUL A;  2WXN A;  2FI7 A;  3DBS A;  2KCK A;  3D9I A;  4I1A A;  2P2C P;  3L9T A;  3ZUV B;  4OVU A;  1DVP A;  1WDY A;  3J5Q B;  2RG8 A;  1INZ A;  5T8I A;  4ILG A;  4CDR A;  4N5Q A;  1OCR E;  4N2S A;  3MKQ B;  2WXP A;  4L23 A;  4DLO A;  2EIL E;  2I1K A;  5CCM A;  3NZS A;  4TXR A;  2VYI A;  4JXT A;  4DK5 A;  4A3T A;  5FWQ A;  1QBQ A;  3RJV A;  3TXN A;  3QWP A;  1ELK A;  1DC2 A;  1V55 E;  1Z6T A;  3UTM A;  1NI1 A;  4UWG A;  5J90 A;  1TNZ A;  3LS8 A;  3ZYL A;  1DCE A;  4N3C A;  5FZQ A;  5G05 C;  4FJZ A;  3TWX A;  3CVL A;  5A23 A;  1E8Z A;  1BI7 B;  2DWZ A;  3AS5 A;  4UWH A;  4WNE A;  5B1B E;  1SQM A;  1UOH A;  2PNN A;  4WAF A;  4XKC A;  5AAO A;  4QFV A;  3KS2 A;  2AXU A;  4GTT A;  3QDN A;  2HO1 A;  3APD A;  5BT1 A;  2BKG A;  1BD8 A;  2WXJ A;  4B8C B;  1MZC A;  1JCR A;  4GCN A;  1Y8M A;  2ZGG A;  4H7Y A;  3RSE G;  4N2Q A;  1YYH A;  3CVQ A;  2XEN A;  3LJ3 A;  1EPU A;  4FP7 A;  4CDM A;  3FHE A;  4AOF A;  3DSS A;  3KSQ A;  4KYO B;  5LP0 A;  5ARG A;  3VTX A;  3JUE A;  2Y1L E;  4E6H A;  3LY9 A;  4BET A;  3PVL A;  4CEM A;  1E8Y A;  2MYO A;  2IO3 C;  1X81 A;  1SZ9 A;  3FUN A;  4KMO A;  5HRY A;  3V2X A;  3LCA A;  3AS8 A;  3FTY A;  2VSN A;  2ION A;  1OWL A;  3JCK C;  2CG2 A;  3ZN3 A;  4MLP A;  3FEY A;  2ZGD A;  3DWL G;  4MKT A;  5CCL A;  4L1B A;  1YMP A;  1ZU2 A;  2ETB A;  3D9K A;  5FZS A;  2WXG A;  4ILI A;  4I17 A;  1Z3Y A;  3W9G A;  2R17 C;  4IRU A;  1QZ2 A;  3DRA A;  3G2U A;  4HRL A;  4LG6 A;  1SA4 A;  3ONK A;  5HKP A;  4CT4 A;  4FLB A;  1UN8 A;  4LCT A;  4LER A;  4ANW A;  4BTA A;  3I5P A;  4JA7 A;  2WMO A;  4HQD A;  4GTV A;  3MZL B;  5AJL A;  3FTW A;  3EHQ A;  1BI8 B;  1LD7 A;  4Y6W A;  5ARF A;  3D9H A;  4J8F A;  4ATZ D;  2CHZ A;  2JEK A;  3FH8 A;  4EPZ A;  2V5Q C;  3TWW A;  2LSU A;  3NQP A;  4WNF A;  3CHR A;  3RO2 A;  2KZT A;  3FY4 A;  2DIW A;  3CLJ A;  3KEZ A;  5DIZ A;  4DX1 A;  3ZEF A;  1TJF A;  3C3O A;  2M63 A;  5KBA A;  1N0Q A;  2Y3A A;  5C2Y A;  4F3V A;  3B7U X;  3HIZ A;  1N94 A;  3DSV A;  4A63 B;  3LJN A;  2KZT B;  5BV0 A;  3ESL A;  3N71 A;  3ZPJ A;  4BFR A;  4I43 A;  2IQC A;  2AWI A;  2JAB A;  4FLH A;  1OWP A;  3DST A;  3ZXP A;  5BV1 A;  5LOZ A;  4UQX A;  3HRA A;  3AU4 A;  4A55 A;  5KWD A;  2MRI A;  1TNO A;  3CK9 A;  2X6H A;  1OY3 D;  4JD2 G;  3D9N A;  5JJ6 A;  4G23 A;  4O1P A;  4EQF A;  3DSU A;  2GW1 A;  3FTX A;  4F53 A;  4N39 A;  2VJ8 A;  1OWN A;  1MJ0 A;  5ANR A;  2AW6 A;  5D0O D;  3HXE A;  2ZXW E;  5ANL A;  2KM4 A;  3FH7 A;  2R2L A;  3Q9U C;  3T9K A;  2J08 A;  4JVS A;  4GYW A;  2WVI A;  2FF4 A;  2J4B A;  4DX5 D;  1RW2 A;  4GU5 A;  3EHN A;  5JHA A;  3FU3 A;  3Q78 A;  4FAD A;  1KT0 A;  5FTP A;  1QQE A;  4NAC A;  2EQX A;  2GGF A;  3OTN A;  3HYM B;  3SY2 A;  3IBE A;  3L17 A;  3UM2 A;  3I3N A;  4Q96 A;  1WM5 A;  3E30 A;  4B93 B;  4JZY A;  1HG2 A;  3C98 A;  4DPR A;  1N54 A;  4XI9 A;  3ZHE A;  4YND A;  3S7D A;  2GRN B;  2WXF A;  4J0U A;  1OXJ A;  3ISM C;  2KCV A;  2X6I A;  4OVV A;  3R9A B;  4DLQ A;  2WXO A;  3NOC D;  1UN9 A;  3ZYM A;  2RD0 A;  3BUA A;  4ANU A;  2IO2 C;  2DCP A;  4BTB A;  2PM7 A;  1JCQ A;  1LTX A;  4B0Z A;  1Z3X A;  2QYJ A;  4UQY A;  3APF A;  1W3B A;  3VLF A;  4LNG A;  4GCO A;  3CR3 A;  4G1T A;  5KCM A;  2P9S G;  4I9E A;  2P9L G;  2QZA A;  2PQN A;  2E0I A;  3ZW3 A;  4KT6 B;  4XE0 A;  4FC8 A;  3TWV A;  3D9J A;  3WG7 E;  4TRQ A;  4Y6C A;  3CHP A;  3WXX A;  3C3R A;  3FU6 A;  2WXM A;  3IXE A;  3Q15 A;  4GZC A;  2LO6 A;  2H6I A;  5JA4 D;  3PZ4 A;  2VSX E;  4GTO A;  3CIA A;  4ANV A;  4EBA G;  1MYO A;  3L54 A;  1HH8 A;  3QWV A;  1B89 A;  5AJD A;  4I6G A;  4JEU A;  1IQU A;  3SNX A;  4ATG A;  3E37 A;  1AWC B;  5BPP A;  1TN8 A;  3U66 A;  3EU9 A;  5CED B;  4TUM A;  3PZD A;  4RVB A;  1RZ4 A;  2DZO A;  2Y4U A;  1OCC E;  2EIM E;  3I4G A;  3BU8 A;  1NA3 A;  4J7W A;  5AQ9 A;  3QK0 A;  5BXU A;  3CGH A;  3ASF A;  2LAH A;  5E75 A;  4AEZ C;  4BWR A;  1PC2 A;  3PH0 C;  2OVF A;  3EUV A;  4D10 C;  5DBK A;  3GW4 A;  1N9A A;  3RO3 A;  1MHQ A;  4HOR A;  4HLE A;  5D2M C;  1SVX A;  3AG2 E;  4FJY A;  2IFU A;  1JWG A;  2FO1 E;  2MOW A;  5G04 J;  2J4D A;  3CHM A;  3E34 A;  2XRY A;  3BEE A;  3ZVV A;  4G8K A;  3JQ0 A;  5IY5 E;  2J09 A;  2EIK E;  4ACK A;  2WQ6 A;  5KJM A;  2BKK B;  1TNY A;  1MX2 A;  2NYJ A;  4Q69 A;  4P29 A;  5D66 A;  3TJP A;  3EJN A;  4AXH A;  1IKN D;  2H6G A;  4U63 A;  1E8X A;  2BUG A;  3CKC A;  1H0A A;  2ETC A;  1Z5S C;  2QYU A;  2PL2 A;  3ZRH A;  4GZ3 A;  1YA0 A;  3JQ1 A;  1IHG A;  3JYS A;  1K1B A;  2BF0 X;  1E7V A;  3ABM E;  5CER B;  3Q73 A;  3SBS A;  4PS3 A;  4OAV B;  2OEW A;  3D9P A;  4BT9 A;  4UI9 K;  2LXM A;  1SA5 A;  4L7T A;  1H2U A;  3L16 A;  4AVX A;  4HI9 A;  3AJI A;  3SQV A;  2UY1 A;  2IF4 A;  4HXI A;  3FUD A;  4MRU A;  3PRE A;  4YDW A;  3QAQ A;  2NSZ A;  3J5P A;  3CK8 A;  4RSY A;  3BQO A;  2LNI A;  3P2B A;  2DZN A;  3MCX A;  3QJZ A;  4DX2 A;  2YNQ A;  4JEH A;  4BT8 A;  4K03 A;  4LNB A;  5CRU A;  3Q49 B;  1N4P A;  4L9P A;  3ASD A;  4FHJ A;  3ZU7 B;  3SFX A;  3CVW A;  3Q9N C;  2F37 A;  1BLX B;  4XI0 A;  4G2V A;  2LSV A;  2DBA A;  3QC1 A;  2YHC A;  4HS2 A;  4DX6 D;  4CRW A;  1S0P A;  4U0S A;  2IEJ A;  2XGM A;  5J08 A;  3URZ A;  4HOS A;  2L6B A;  4W9R A;  3VLE A;  2WB2 A;  3UKU G;  5JHB A;  3D9O A;  5AIJ A;  4EZJ A;  2LAI A;  3F6Q A;  4O60 A;  3HVE A;  4AIF A;  2XQ0 A;  4K5B A;  3FTV A;  4JHK A;  3CK7 A;  4B94 A;  2XPY A;  3DPY A;  2CG3 A;  1N52 A;  3MGB A;  2CHW A;  2ILR A;  4LEU A;  2I1J A;  5LX8 A;  1TNU A;  3UUX A;  2IOL A;  3MYV A;  1TYQ G;  2XZD G;  3HVE B;  3PZ1 A;  3CV0 A;  4NUR A;  2XHE A;  3CEQ A;  3V30 A;  1EF1 C;  1IHB A;  4G11 A;  3V2O A;  3S7B A;  2XS8 A;  2OOE A;  3KSL A;  3LY8 A;  4GA0 A;  2ETA A;  2LUH A;  3TWR A;  5BXO A;  1PY1 A;  1P5Q A;  3IHV A;  3ULY A;  3RKV A;  3B13 A;  5ENS D;  1FCH A;  1XNF A;  3LYA A;  5FQ4 A;  3TWT A;  2XEH A;  3IV0 A;  1O1S A;  2J9Q A;  2I9C A;  2ZU6 B;  4PH4 B;  4JA9 A;  4I6E A;  4GZD A;  1WY6 A;  3B7T A;  2J8S D;  5CMY A;  5B3S E;  4YDE A;  2XGO A;  4BES A;  3E4B A;  1IXV A;  2GRM A;  4N3A A;  1KT1 A;  3ULE G;  1HG5 A;  2F8Y A;  2H6F A;  2QY7 A;  5ENP D;  1X5B A;  3ZKJ A;  5FIN A;  2NC9 A;  2ZIS A;  4EZL A;  1FVH A;  4HI8 A;  3UIO C;  3VLD A;  1ELW A;  3DXM G;  4ANX A;  3V79 K;  2C0M A;  3R7Q A;  4HOU A;  4CGV A;  5FZR A;  1WAO 1;  3AG4 E;  4CT0 A;  3EHR A;  2WXK A;  4CGW A;  2R59 A;  4AV7 A;  1HX8 A;  3DSX A;  3UM1 A;  2F0Y A;  5EX3 A;  1OT8 A;  4KVM A;  4DJA A;  1E96 B;  2VTB A;  4O6F A;  3KD7 A;  4YDY A;  5ITZ F;  5JJ7 A;  4K5C A;  3MV3 B;  3S2A A;  1HF8 A;  4EZK A;  1JCS A;  4BEP A;  3LVQ E;  2XGS A;  3APC A;  5A7D B;  2XPZ A;  3QB2 A;  3ZYQ A;  2RFA A;  2VTB B;  5T3R A;  2V4H C;  4UWK A; 
#chains in the Genus database with same CATH homology
 4CYM D;  5CEC B;  2VGE A;  4BER A;  4ZFH A;  2FO1 E;  4G8L A;  5ENS D;  5HS0 A;  5FIO A;  2A5E A;  1G3N B;  3EHQ A;  1MJ0 A;  1BI8 B;  2KXP C;  4HB5 A;  5ENR D;  3ZU7 B;  2ZGG A;  3HG0 D;  5KNH D;  3TWT A;  2XEH A;  3D9H A;  5EIL A;  4GMR A;  3TWV A;  4ATZ D;  1YYH A;  3Q9N C;  5AAR A;  2F37 A;  1SW6 A;  5AQA A;  1BLX B;  2XEN A;  3Q9U C;  4CZ2 D;  4G8K A;  3B95 A;  2J8S D;  4DRX E;  1MX6 A;  5EIB E;  2P2C P;  3T9K A;  4BES A;  3NBN B;  2HE0 A;  1IXV A;  3SO8 A;  3ZUV B;  4DUI A;  1N0R A;  1S70 B;  2V5Q C;  2BKK B;  4HNA D;  1WDY A;  3DEP A;  3IXE A;  3J5Q B;  3NOG D;  4K5A B;  4O1O A;  3TWW A;  1MX2 A;  4DX6 D;  2AJA A;  2F8Y A;  2NYJ A;  5ENP D;  5D66 A;  4DX5 D;  4N5Q A;  3JUE A;  3TWQ A;  3UXG A;  2Y1L E;  5JA4 D;  1IKN D;  3ZKJ A;  5CBO A;  5FIN A;  4U96 D;  4BET A;  1AP7 A;  2L6B A;  3UI2 A;  1MX4 A;  4HI8 A;  2F8X K;  2ETC A;  1N11 A;  5KNG A;  3T8K A;  1MYO A;  4DX1 A;  3JXJ A;  4HBD A;  2MYO A;  4OAU C;  4C48 B;  5AQ7 A;  4QQI A;  4LSZ E;  3TWS A;  3V79 K;  5KBA A;  1K1B A;  4U8Y D;  1N0Q A;  2KBX A;  1WG0 A;  4JB8 P;  5HRY A;  5ENO D;  5CER B;  3W9F A;  4DX7 D;  3F6Q A;  5AQB A;  3V2X A;  1DC2 A;  4A63 B;  4B93 B;  3LJN A;  4O60 A;  3UTM A;  3EHR A;  1AWC B;  4OAV B;  4BSZ B;  4K5B A;  3DEO A;  1A5E A;  3EU9 A;  4F1P A;  4HRN A;  5CED B;  5EYL A;  4NIK A;  2JAB A;  2DVW A;  1DCQ A;  4TUM A;  5EYP F;  1BU9 A;  1YCS B;  2ZGD A;  4U8V D;  4ZHB A;  3KEA A;  5JMN D;  1TR4 A;  4F6R D;  3TWU A;  1YMP A;  2XEE A;  1NFI E;  2ETB A;  3HRA A;  3TWX A;  4HI9 A;  1OT8 A;  2DZO A;  3AJI A;  3NOC D;  2B0O E;  2Y0B G;  5KWD A;  2DWZ A;  1BI7 B;  4LNU D;  3W9G A;  4Z68 A;  2XZD G;  4HRM B;  4YDW A;  4J8Y A;  5ITZ F;  4YDY A;  4J7W A;  5AQ9 A;  2QC9 A;  2XZT G;  5CEA A;  4UUC A;  1D9S A;  3AAA C;  3B7B A;  1OY3 D;  3J5P A;  5BXU A;  3JXI A;  4U95 D;  4HLL A;  4K5C A;  4HRL A;  4LG6 A;  1K3Z D;  3V30 A;  1K1A A;  4GPM A;  5CBN A;  5AN8 A;  1IHB A;  1UOH A;  5EN5 D;  5HKP A;  3V2O A;  2PNN A;  2QYJ A;  4O1P A;  5EID A;  3ZNG A;  4BEP A;  2DZN A;  3V31 A;  5AAO A;  2ETA A;  3TWR A;  4DX2 A;  5BXO A;  4RLY A;  4QFV A;  5ENQ D;  1SVX A;  1QYM A;  2RFA A;  4HQD A;  2BKG A;  2RFM A;  5ENT D;  1BD8 A;  3C5R A;  2V4H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...