4DX7D

Transport of drugs by the multidrug transporter acrb involves an access and a deep binding pocket that are separated by a switch-loop
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Acriflavine resistance protein B
publication title Transport of drugs by the multidrug transporter AcrB involves an access and a deep binding pocket that are separated by a switch-loop.
pubmed doi rcsb
source organism Escherichia coli
total genus 51
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4dx7D00
2V4HC 3AAAC 4J8YA 1BLXB 5CEDB 5AN8A 3D9HA 5EYLA 1AP7A 5CEAA 1IHBA 3ZKJA 1A5EA 4G8LA 4U96D 4K5AB 5AARA 2RFAA 1N0QA 1K3ZD 3NBNB 1K1AA 1NFIE 1BI8B 5KWDA 2DVWA 5ITZF 1BI7B 4CZ2D 4YDYA 5D66A 4O60A 5BXUA 2BKGA 4A63B 5HKPA 4HLLA 1MX6A 1UOHA 5FIOA 2KXPC 2XEHA 5EIBE 3T9KA 4BSZB 4GPMA 4DUIA 4YDWA 1DCQA 3DEPA 2L6BA 4OAVB 4TUMA 3KEAA 3V30A 4BETA 2F8XK 2J8SD 5AQ7A 2B0OE 5KNHD 2KBXA 1YCSB 2DZOA 3W9GA 3V31A 1WG0A 5ENQD 1OY3D 3NOGD 4K5BA 2ZGDA 3ZUVB 2XEEA 4DX2A 5JA4D 5ENTD 3TWRA 3EHRA 4BEPA 5BXOA 4BESA 2QYJA 3ZU7B 3DEOA 4OAUC 1D9SA 1N0RA 4DRXE 5HS0A 1N11A 2XZTG 4LG6A 1DC2A 2BKKB 4LNUD 4CYMD 1IXVA 1BD8A 2P2CP 4HRMB 3TWQA 1TR4A 1WDYA 3LJNA 3TWTA 4UUCA 5CERB 3EHQA 4ATZD 4K5CA 5CBOA 3AJIA 3EU9A 4U95D 3HG0D 4F1PA 2F37A 4Z68A 4HRNA 5HRYA 4G8KA 4U8YD 1YMPA 4J7WA 2XZDG 3B7BA 4HRLA 1MX2A 3NOCD 2Y1LE 4B93B 5ENPD 3TWUA 5CBNA 1QYMA 5AQBA 4DX1A 1MX4A 3C5RA 2A5EA 2ETAA 2JABA 3JXJA 3TWXA 4HNAD 1OT8A 3ZNGA 3B95A 4QFVA 2ETBA 4ZHBA 2Y0BG 4LSZE 1MYOA 3F6QA 4HI9A 4RLYA 5JMND 2XENA 4DX5D 1SVXA 1IKND 2MYOA 3IXEA 5KBAA 3Q9NC 4U8VD 4HI8A 2NYJA 3UI2A 3UTMA 4O1OA 3V79K 2ZGGA 4C48B 4HQDA 5ENOD 3T8KA 2FO1E 2QC9A 4HBDA 3JUEA 2V5QC 3JXIA 3TWWA 1AWCB 3Q9UC 3TWSA 4HB5A 4QQIA 5KNGA 5ENRD 3J5PA 2DZNA 4F6RD 5AAOA 2PNNA 5AQAA 5FINA 4GMRA 1SW6A 4N5QA 4DX6D 5ENSD 3HRAA 4NIKA 5CECB 2HE0A 4O1PA 5EILA 2F8YA 2AJAA 5EN5D 3TWVA 1BU9A 4BERA 1MJ0A 2DWZA 4DX7D 3J5QB 5EYPF 1K1BA 1S70B 3V2OA 4ZFHA 1G3NB 3V2XA 3SO8A 2VGEA 5AQ9A 1YYHA 2RFMA 3W9FA 5EIDA 2ETCA 3UXGA 4JB8P
chains in the Genus database with same CATH superfamily
5FJYA 4LCTA 3TG4A 1TJCA 4AY6A 3RSEG 1QBQA 3SF4A 5JJTA 5BV1A 4O60A 3PUKA 2WXKA 3BQOA 3HXCA 4GTQA 1E7VA 3ABKE 3L17A 1DCEA 2J8SD 4KZCA 3FTYA 3W9GA 3T5VA 1O5MA 4DX2A 4GCOA 4E85A 4BESA 2QYJA 3ZU7B 3T5XA 3P2BA 4IN3B 4YNDA 4OVUA 3L16A 2OEVA 5CERB 4JC8A 4JHRA 3JCKC 4K5CA 2LSUA 1ZBPA 2F37A 3I3NA 2Y1LE 2CFUA 2ETAA 4B0ZA 3FU6A 3UMVA 4V3IA 3CGHA 1HG5A 2FEZA 3CVQA 1OCRE 2V0PA 2NYJA 3LYAA 4F7AA 3TWSA 3OXGA 1UG3A 2GGFA 2GRMA 3EHMA 5AQAA 4HFGA 1S63A 3E34A 4GMRA 3TAXA 3ASDA 2LSVA 3ASHA 1N52A 3CSTA 1NZNA 2F8YA 3ABLE 4IYPA 3QB2A 3J5QB 3PE3A 4HVBA 2HYZA 1YYHA 5T3RA 2DCPA 1XNFA 4I6JA 1TNOA 1U3CA 3ZYMA 1BI8B 2HO1A 4HLLA 4F3VA 2XEHA 3AS4A 4G25A 4JPSA 1WAO1 4OAVB 4ANVA 3ZHEB 5J08A 3WG7E 3ZYQA 2PM6A 2DBAA 4PS7A 1OY3D 3B13A 4I2WA 4GMLA 4J8FA 2B6CA 1D9SA 2XGMA 3I4GA 3L9TA 4AM9A 3LJ3A 1DC2A 1YA0A 5H7PA 1FVFA 4FP7A 3MX3A 2RG8A 4HORA 4JEHA 4I6GA 2GROB 3LXUX 3CK8A 3EDTB 4ILGA 3RO3A 1ELKA 3URZA 1YMPA 2AXZA 3B7BA 4HRLA 4OVVA 3DSXA 2V4LA 3Q7AA 4N3CA 1E8XA 4Y6CA 4ZHBA 2Y0BG 2L9BA 2V8SE 5T8IA 4B8AA 4C48B 4HQDA 4CGWA 4HBDA 2AXVA 4ATGA 1AWCB 2PM7A 2V5FA 2R2LA 3CVLA 4HB5A 2UWJG 3ZPJA 3SGHA 3MKQA 2I9CA 1TN6A 4NACA 3Q4AB 4BERA 2X6IA 3CVNA 3IKOB 2OCCE 4JA9A 2ZISA 4UQZA 4KBQA 2X6HA 4GYOA 4FJYA 2XEVA 4CCAA 3S7BA 3UT4A 3NBNB 2UY1B 2WM9A 4G24A 4KVMA 4A63B 1MX6A 2P9SG 2XGSA 4F53A 1EYHA 4TUMA 3BG1B 3CQGB 3FU3A 2WXGA 3UQ3A 1FT2A 4N39A 2HM8A 5FZRA 3PH0C 3HIZA 2DZOA 3SY2A 4C9BB 4BEPA 4K0RA 4E6HA 4LG6A 3CVWA 3D9MA 1KZOA 3KSQA 2WXQA 3EHQA 3Q47B 3SD5A 3TL5A 1N54A 4YDEA 4EECA 2XZDG 3PVLA 3EHNA 4I1AA 5FWQA 3FUDA 4C0MA 2IOLA 1Z3YA 5ANLA 4CEMA 5BUZA 5E76A 3U9WA 5LP0A 3FTUA 3FUMA 3V79K 2KCKA 1ELWA 5DBKA 4I2ZA 4TRQA 2ZU6B 3NAWA 2Y4UA 5FT9A 2L0TB 3AS8A 5BV0A 4MKTA 4ILHB 3S7FA 3LVQE 4ANUA 4Q69A 1DNPA 3CK7A 5EYPF 4U0UA 2E0IA 1SZAA 2OOEA 4LNBA 5AQ9A 4APFA 3GZ1A 3W9FA 4MLPA 1MZCA 4J8YA 3QAQA 3RKVA 2WVIA 4KMOA 4UQYA 3ZHEA 5JJ6A 5ITZF 1BI7B 2P9IG 5BXUA 5FQ7A 5HKPA 3KEZA 5EIBE 1JCSA 5G05J 4AY5A 3CVYA 3PDNA 3ML9A 1UJKA 4JVSA 4K03A 2XEEA 3AU5A 3ZYLA 3E33A 4DJAA 2WB2A 4AEZC 1WM5A 2IOSA 3QDNA 2P2CP 3Q49B 4L2YA 1N95A 2GRRB 4RVBA 3B7RL 5AYWD 2LAHA 4FA6A 5ENNA 4HRNA 1H6OA 4AV7A 3UX4A 2X6FA 2GRPB 2BF0X 5CCMA 2YINA 1BPOA 1PC2A 1FCHA 3KAEA 3RRUA 4ACKA 2P58C 3SFXA 3FUJA 1LF8A 4XKCA 1H2UA 2DZNA 3HRAA 4JXTA 2WPVA 3L6AA 1IHGA 5C2YA 3QOUA 4A55A 1UJJA 4OYSA 4R7LA 2KM4A 2LNIA 1TYQG 2UY1A 1WY6A 2F0YA 3UXGA 2P9KG 3ESKA 1OWNA 2J9QA 2YHEA 4WAFA 3D9KA 4GZ5A 4K5AB 1H6KA 1N0QA 3FTWA 4CZ2D 3HXEA 3PNLB 2FO7A 4BSXA 2C2LA 3UT7A 5G05C 3CHQA 1D8EA 1SA4A 4WNFA 4RQIA 3D9JA 3SFZA 1HS6A 1YCSB 1N94A 3R9MA 3NOGD 4GMJA 5AJLA 3DSVA 3VLDA 3PEVB 5FZSA 3DEOA 5J90A 5EX0A 1O1SA 2BKKB 1O1RA 5G55A 5CRUA 4FHKA 1JUQA 3DSTA 3ZIMA 5KJLA 5HRYA 3L08A 4J7WA 3ULEG 4B94A 4TXRA 2P9UG 2ILRA 4HNAD 3B95A 4KYOB 4EQFA 5JMND 1IKND 2VQ2A 3IXEA 3UTMA 4O1OA 5C1DA 2CHXA 1KPSB 5CRVA 4L2LA 2IU1A 5KNGA 4PS3A 1FPPA 2XS8A 4JEUA 2VSYA 3LDZA 4XEIG 3JUIA 3JQ1A 3PRZA 3BG0B 1BU9A 3G2WA 3U4TA 2H6HA 1MJ0A 4DX7D 5LCWJ 3BEEA 2DYSE 3FUKA 4ZFHA 4L7TA 5G04J 1G3NB 3NZUA 4DI4A 3ABME 1HF8A 2WMNA 2L0IA 4YDOA 2IY0C 3ZYKA 4WUYA 3UKUG 5CEAA 4A3VA 5A23A 2IONA 2GW1A 4LUNU 3ONKA 2R5SA 3LCAA 4RG9A 4GZ3A 3CV0A 1X5BA 1N4RA 1OCOE 3Q73A 3D9OA 2MOWA 2BTDA 3AU4A 3ULYA 4GZDA 5JJ7A 3C72A 3FUIA 3UT8A 2OV8A 4C0EA 2P9NG 3R9AB 1KT1A 3PZ3A 3LJNA 3B7TA 3OTNA 1NL4A 5JHAA 3EJNA 1MHQA 3NOCD 2I6HA 5CBNA 2H6IA 5AQBA 4EZJA 2ETBA 4PDXA 4TXPA 4GYYA 1SVXA 4HI8A 3TWWA 3IHVA 3CVUA 4HOQA 4XIFA 3LPZA 2P9PG 4GCNA 3DPYA 3QWPA 1XGWA 3FULA 2HE0A 4O1PA 3IV0A 4BWRA 5EILA 3APCA 5EN5D 4GAAA 1Y8MA 4G26A 2R03A 5CMWA 4Y6WA 4RSYA 4ME2A 1S70B 4U63A 4J8SA 3D3MA 3FH5A 2QZAA 1BLXB 3NF1A 5EYLA 2M63A 1AP7A 1ZB1A 2AXUA 3CHPA 4J8DA 3U3WA 4WWOA 1JPLA 5ARGA 3DWLG 4XX5A 4YDYA 4I43A 2HR2A 5CHEE 3HYMB 2CFZA 1DCQA 3UIOC 3Q15A 3V31A 3LKUA 4KVOA 3ZW3A 2AW6A 2QYUA 2IEJA 3C3RA 3TWQA 3Q78A 1TR4A 3GW4A 2WXHA 4AXHA 4U8YD 1JCQA 3CVPA 3EIQC 3N71A 3UKRG 3C5RA 2JABA 4JA7A 3ZNGA 3G2VA 1DVPA 3RRMB 1V55E 3B7SA 4LNGA 2EIKE 2CHWA 4LEUA 1QZ2A 3APFA 3FFLA 3VTYA 3ESLA 1NA0A 2MRIA 1TN7A 4UI9J 4FULA 2LXLA 2DYRE 2I1JA 3FTSA 2V4HC 5CEDB 4G11A 3ZKJA 4IRUA 2EIME 5LOZA 1H19A 4PH4B 1PAQA 2JEKA 5D66A 3RO2A 3DXKG 3VTXA 2LUHA 4FHJA 4GZCA 2XCCA 5AJDA 4DK5A 5EDSA 5T4YA 4WWNA 3HHMA 2Q7FA 5KJNA 3EIJA 3CHSA 1H6PA 2J4BA 2J09A 4A1GA 2XS1A 3MJWA 5B1BE 4DRXE 1N11A 3E4BA 5FTPA 3RAUA 1HXIA 2Y3AA 3PUJA 2IFUA 3OXFA 3JQ0A 5ENPD 3UM0A 4FADA 4FJZA 4EHMA 3HVEB 3AG1E 2R59A 2J4DA 2VSXE 2E2EA 1IQUA 3UI2A 3G2TA 1OWOA 1OWMA 1L5JA 5JHBA 3ENEA 3VLEA 1KZPA 2C0MA 4DX6D 2WXFA 1Z3XA 3TWVA 1RZ4A 1JWFA 3ASOE 3SHFA 3FU5A 4UI9C 3ZEFA 2OEWA 1LTXA 4U04A 4JZYA 2J08A 1A17A 3ISMC 4KT6B 3QWWA 5LFAA 4JL0A 3SNXA 4F1SA 1A5EA 4EBAG 5AARA 2RFAA 3RU0A 1K1AA 2WXOA 5A7DB 4JHKA 3MCXA 4BY6A 4W9RA 1HZ4A 1Y6IA 2WQ6A 5ARFA 2F8XK 2KBXA 1OWLA 1ZU2A 2XRZA 2KATA 3HDXA 3MEKA 3TXMA 1K8KG 3QNKA 1N0RA 3SQVA 2VTBB 4ATZD 3CKBA 2LO6A 1H2TC 2I1KA 4UQXA 3EU5A 4I6EA 2GRQB 4N5CA 2A5EA 4WNDA 3CR3A 3F6QA 4HI9A 4N2QA 2A5UA 3HXBA 2ZIRA 1Z6TA 5ENOD 3P1UA 4AJWA 1FT1A 4QQIA 2WQHA 1E96B 4WNGA 4AP2A 2WXRA 1EPUA 4GTPA 1RW2A 4KXKB 2WQ7A 2ONDA 4JB8P 1W3BA 4AVXA 3RK6A 5FQ4A 1SA5A 4L9PA 3BUAA 3NB2A 3OAWA 3DBSA 3CLJA 1KLXA 3DEPA 4HXIA 3ZXSA 1B89A 4L1BA 4LRZA 2B0OE 1WG0A 5A6CA 3ZUVB 1Q2ZA 3O4ZA 3ZFWA 4H7YA 5BT1A 4I17A 3HVEA 5D0OD 3ASGA 4F1PA 1EDUA 1N9AA 2KCVA 4G8KA 4DI3A 2XQ0A 5B1AE 2KZTB 4A1SA 4DX1A 3TWXA 3JXJA 4N3BA 2CHZA 2XENA 2NXPA 5KCMA 2MYOA 3T8KA 1NI1A 2QC9A 5CCLA 3AG3E 2WXIA 4MRUA 1VDYA 1QNFA 5HI7A 2AJAA 5DIZA 3UM1A 1JWGA 3TGOA 3V2OA 4Q94A 4H7XA 4WWPA 4YVOA 3ZN3A 2R05A 2EQXA 2OVBA 4HLEA 4XI9A 3AS5A 1OWPA 4U96D 3ZRHA 1NFIE 3SI5A 5KWDA 1JCRA 2OVFA 2GRLA 2PL2A 3MA5A 4CDMA 4GTSA 2PQRA 2XCBA 3V30A 4BETA 5ENQD 1GW6A 2VTBA 5FQ8A 5M72A 3NZSA 4ANWA 1TNUA 4EPZA 3TWTA 2IF4A 2YQ8A 4PUCA 2PQNA 5IY5E 2XRYA 4XZ4A 1UN8A 5KJKA 2VSNA 1EF1C 2P9LG 1IQRA 4MBGA 4DX5D 3PNTB 5G2NA 2LAIA 3FTVA 3Q9NC 4HS2A 4U8VD 3O48A 2FO1E 3JXIA 1O1TA 3J5PA 1S64A 4F6RD 3IEGA 1SZ9A 2PNNA 3L13A 2R02A 1SW6A 3MGBA 1MQSA 4EBAA 5CECB 3TG5A 4BTAA 2H6GA 4UWFA 3B7UX 1KT0A 2DWZA 2XHEA 5AENA 3LY8A 3V2XA 3CVXA 2ETCA 4YVQC 3AAAC 5AIJA 3CHOA 5AN8A 2BUGA 4GTRA 4CRWA 1K3ZD 4TV3A 3ASFA 4N3AA 2BKGA 3Q7FA 4CT0A 3SFYA 5LCWC 4DPRA 3ML8A 2X6KA 4YDWA 5G04C 3HXFA 3C3QA 1X81A 3CKCA 3DSUA 4FC8A 3U64A 4GTVA 4L23A 2AVPA 2ZGDA 4U8HA 3ASNE 1TEZA 2KZTA 1E90A 1WDYA 4XKBA 2VYIA 1S0PA 1U3DA 3FH7A 3AG2E 2GRNB 3AJIA 5BPPA 4U95D 4GA0A 5D2MC 1TNBA 4B93B 1MX2A 3VLFA 4XE0A 1NA3A 3DRAA 2MHKA 4EZLA 3LS8A 3FP3A 2ZXWE 3FY4A 4O6FA 3FUFA 3CEQA 3QARA 4B89A 1E8ZA 4J0UA 3UINC 4UWGA 2VJ8A 3PREA 4G2VA 2XGOA 4URKA 3OXLA 1TNYA 4I9CA 3FDHA 3D9PA 3DPDA 4BT9A 1HO8A 2CG3A 3KSLA 1IHBA 2FBNA 1D8DA 4G8LA 2IQCA 4BT8A 4U0SA 3FTZA 2DVWA 3APDA 5EX3A 4HOSA 3EUVA 3MZLB 3KS2A 4DUIA 3E37A 4GPKA 3DSWA 2FF4A 4X8QA 2KCLA 4ABNA 1H0AA 2XPIA 3ZVVA 2WXNA 2QY7A 2WXMA 4HOUA 4CDRA 3G2UA 5JA4D 3TWRA 3HXDA 4RG6A 1V54E 3S7JA 3UIPC 4LNUD 4WNEA 4CYMD 3PS6A 3FTXA 2VGYA 3PE4A 3WXXA 4Q96A 1P5QA 2Y69E 3PEUB 3CK9A 4UWHA 3I5PA 2LXMA 3FUHA 3CHRA 4I1OB 4GTMA 4QFVA 1MYOA 5HQ8A 2YHCA 3UUXA 4NQ0A 3Q75A 2C0LA 3DSSA 4N2SA 2YNQA 3S7DA 2R17C 3Q9UC 4BFRA 5ENRD 4HOTA 3UM3A 5AAOA 3MV2B 5ENSD 1QQEA 4DLOA 5CMYA 3LVRE 5BNWA 1U2VG 2IO3C 3ULQA 5E75A 2FI7A 2VGEA 5EIDA 4BX8A 1FVHA 2WXLA 2AWIA 3Q79A 5D0QD 4GA1A 4BX9A 3IBEA 3E32A 3UPVA 3R7RA 5FIOA 1H2VC 3FU0A 3KEAA 2RD0A 3BU8A 3KD7A 2X38A 1E8YA 2Y4TA 3DXMG 4K5BA 4GB9A 1E7UA 3EHRA 4GTOA 2EINE 4GYWA 5BXOA 3AG4E 4M7CA 4TUUA 2A4ZA 3E30A 3QWVA 1BD8A 1IYGA 4I1MA 4UUCA 3SZ7A 3ONLA 5FQ6A 3HG0D 5B3SE 3SBTB 3D9LA 4JD2G 2CG2A 1LD8A 3RRNB 4RLYA 3I4RB 3NQPA 1N4PA 3LY7A 2ZGGA 4J8EA 3D9NA 2V5QC 2VGXB 2EILE 4EZKA 3JYSA 1HFAA 3QKYA 4UWKA 3PZDA 3FWVA 3C3OA 4U0ZA 5FINA 4IULA 1OXJA 2H6FA 2BEDA 3R7QA 3RIBA 1N4SA 1HX8A 2X6JA 3L54A 3RJVA 3QK0A 4CT4A 5BW8C 3G2SA 5ANRA 3FHEA 3TJPA 3GYZA 1OCCE 4CDNA 3ZGQA 1UOHA 3T9KA 3D9IA 1OCZE 2L6BA 4LERA 1HU3A 3T8MA 5KJMA 1PY1A 4NRHB 1HE8A 5KNHD 4D10C 4FLBA 4PS8A 5ENTD 4AIFA 2FULA 2IJGX 4ILIA 4GA2A 5LX8A 4UI9K 4ACLA 4JHJA 3PZ4A 3Q5MA 1UN9A 3ZXPA 2KC7A 4B8CB 3MYVA 3EU9A 1TJFA 1HG2A 4Z68A 2PZIA 1OUVA 1INZA 3TWUA 3LY9A 4CGVA 1QYMA 1MX4A 1OT8A 4LSZE 4TXQA 4A3TA 2VSOE 5KBAA 2DIWA 1HH8A 2JLBA 4APOA 2NC9A 3JUEA 3K9IA 4I9EA 3MV3B 4M3OA 4UWLA 2EIJE 2XPYA 3U66A 3FUNA 3IHYA 3X2QE 2IO2C 1K1BA 3FUEA 3C98A 3CIAA 4G23A 4GU5A 2WXPA 4J6IA 3D9HA 2XPZA 3QC1A 2WXJA 5FZQA 3PZ2A 3L22A 2KXPC 4BSZB 4GPMA 1TN8A 1TNZA 3L82A 3CQCB 4G1TA 4XI0A 1Z5SC 2NSZA 4P29A 5AQ7A 4GZ6A 3GZSA 3S2AA 3PZ1A 3SBSA 1NP7A 1N4QA 3FEXA 3CHMA 2QFCA 4OAUC 4BTBA 2WMOA 5HS0A 2XZTG 4AOFA 1LD7A 1IXVA 4FLHA 4HRMB 3MKRA 5EKQD 3LEWA 4U07A 1SQMA 3TXNA 5CBOA 3CVVA 3GZ2A 4JW1A 2VGXA 1ELRA 3FEYA 3FH8A 3UM2A 4MS6A 4U7EB 2X3MA 4KZ0A 4NURA 1E8WA 4N5QA 2J07A 1UW4B 4NIKA 4GTTA 3QJZA 4ANXA 4DLQA 2RKKA 4FU3A 3MKQB 2J49A 2L6JA 3SO8A 3CSFA 2RFMA 2I2OA
chains in the Genus database with same CATH topology
2V4HC 3AAAC 4J8YA 1BLXB 5CEDB 5AN8A 3D9HA 5EYLA 1AP7A 5CEAA 1IHBA 3ZKJA 1A5EA 4G8LA 4U96D 4K5AB 5AARA 2RFAA 1N0QA 1K3ZD 3NBNB 1K1AA 1NFIE 1BI8B 5KWDA 2DVWA 5ITZF 1BI7B 4CZ2D 4YDYA 5D66A 4O60A 5BXUA 2BKGA 4A63B 5HKPA 4HLLA 1MX6A 1UOHA 5FIOA 2KXPC 2XEHA 5EIBE 3T9KA 4BSZB 4GPMA 4DUIA 4YDWA 1DCQA 3DEPA 2L6BA 4OAVB 4TUMA 3KEAA 3V30A 4BETA 2F8XK 2J8SD 5AQ7A 2B0OE 5KNHD 2KBXA 1YCSB 2DZOA 3W9GA 3V31A 1WG0A 5ENQD 1OY3D 3NOGD 4K5BA 2ZGDA 3ZUVB 2XEEA 4DX2A 5JA4D 5ENTD 3TWRA 3EHRA 4BEPA 5BXOA 4BESA 2QYJA 3ZU7B 3DEOA 4OAUC 1D9SA 1N0RA 4DRXE 5HS0A 1N11A 2XZTG 4LG6A 1DC2A 2BKKB 4LNUD 4CYMD 1IXVA 1BD8A 2P2CP 4HRMB 3TWQA 1TR4A 1WDYA 3LJNA 3TWTA 4UUCA 5CERB 3EHQA 4ATZD 4K5CA 5CBOA 3AJIA 3EU9A 4U95D 3HG0D 4F1PA 2F37A 4Z68A 4HRNA 5HRYA 4G8KA 4U8YD 1YMPA 4J7WA 2XZDG 3B7BA 4HRLA 1MX2A 3NOCD 2Y1LE 4B93B 5ENPD 3TWUA 5CBNA 1QYMA 5AQBA 4DX1A 1MX4A 3C5RA 2A5EA 2ETAA 2JABA 3JXJA 3TWXA 4HNAD 1OT8A 3ZNGA 3B95A 4QFVA 2ETBA 4ZHBA 2Y0BG 4LSZE 1MYOA 3F6QA 4HI9A 4RLYA 5JMND 2XENA 4DX5D 1SVXA 1IKND 2MYOA 3IXEA 5KBAA 3Q9NC 4U8VD 4HI8A 2NYJA 3UI2A 3UTMA 4O1OA 3V79K 2ZGGA 4C48B 4HQDA 5ENOD 3T8KA 2FO1E 2QC9A 4HBDA 3JUEA 2V5QC 3JXIA 3TWWA 1AWCB 3Q9UC 3TWSA 4HB5A 4QQIA 5KNGA 5ENRD 3J5PA 2DZNA 4F6RD 5AAOA 2PNNA 5AQAA 5FINA 4GMRA 1SW6A 4N5QA 4DX6D 5ENSD 3HRAA 4NIKA 5CECB 2HE0A 4O1PA 5EILA 2F8YA 2AJAA 5EN5D 3TWVA 1BU9A 4BERA 1MJ0A 2DWZA 4DX7D 3J5QB 5EYPF 1K1BA 1S70B 3V2OA 4ZFHA 1G3NB 3V2XA 3SO8A 2VGEA 5AQ9A 1YYHA 2RFMA 3W9FA 5EIDA 2ETCA 3UXGA 4JB8P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4H C;  3AAA C;  4J8Y A;  1BLX B;  5CED B;  5AN8 A;  3D9H A;  5EYL A;  1AP7 A;  5CEA A;  1IHB A;  3ZKJ A;  1A5E A;  4G8L A;  4U96 D;  4K5A B;  5AAR A;  2RFA A;  1N0Q A;  1K3Z D;  3NBN B;  1K1A A;  1NFI E;  1BI8 B;  5KWD A;  2DVW A;  5ITZ F;  1BI7 B;  4CZ2 D;  4YDY A;  5D66 A;  4O60 A;  5BXU A;  2BKG A;  4A63 B;  5HKP A;  4HLL A;  1MX6 A;  1UOH A;  5FIO A;  2KXP C;  2XEH A;  5EIB E;  3T9K A;  4BSZ B;  4GPM A;  4DUI A;  4YDW A;  1DCQ A;  3DEP A;  2L6B A;  4OAV B;  4TUM A;  3KEA A;  3V30 A;  4BET A;  2F8X K;  2J8S D;  5AQ7 A;  2B0O E;  5KNH D;  2KBX A;  1YCS B;  2DZO A;  3W9G A;  3V31 A;  1WG0 A;  5ENQ D;  1OY3 D;  3NOG D;  4K5B A;  2ZGD A;  3ZUV B;  2XEE A;  4DX2 A;  5JA4 D;  5ENT D;  3TWR A;  3EHR A;  4BEP A;  5BXO A;  4BES A;  2QYJ A;  3ZU7 B;  3DEO A;  4OAU C;  1D9S A;  1N0R A;  4DRX E;  5HS0 A;  1N11 A;  2XZT G;  4LG6 A;  1DC2 A;  2BKK B;  4LNU D;  4CYM D;  1IXV A;  1BD8 A;  2P2C P;  4HRM B;  3TWQ A;  1TR4 A;  1WDY A;  3LJN A;  3TWT A;  4UUC A;  5CER B;  3EHQ A;  4ATZ D;  4K5C A;  5CBO A;  3AJI A;  3EU9 A;  4U95 D;  3HG0 D;  4F1P A;  2F37 A;  4Z68 A;  4HRN A;  5HRY A;  4G8K A;  4U8Y D;  1YMP A;  4J7W A;  2XZD G;  3B7B A;  4HRL A;  1MX2 A;  3NOC D;  2Y1L E;  4B93 B;  5ENP D;  3TWU A;  5CBN A;  1QYM A;  5AQB A;  4DX1 A;  1MX4 A;  3C5R A;  2A5E A;  2ETA A;  2JAB A;  3JXJ A;  3TWX A;  4HNA D;  1OT8 A;  3ZNG A;  3B95 A;  4QFV A;  2ETB A;  4ZHB A;  2Y0B G;  4LSZ E;  1MYO A;  3F6Q A;  4HI9 A;  4RLY A;  5JMN D;  2XEN A;  4DX5 D;  1SVX A;  1IKN D;  2MYO A;  3IXE A;  5KBA A;  3Q9N C;  4U8V D;  4HI8 A;  2NYJ A;  3UI2 A;  3UTM A;  4O1O A;  3V79 K;  2ZGG A;  4C48 B;  4HQD A;  5ENO D;  3T8K A;  2FO1 E;  2QC9 A;  4HBD A;  3JUE A;  2V5Q C;  3JXI A;  3TWW A;  1AWC B;  3Q9U C;  3TWS A;  4HB5 A;  4QQI A;  5KNG A;  5ENR D;  3J5P A;  2DZN A;  4F6R D;  5AAO A;  2PNN A;  5AQA A;  5FIN A;  4GMR A;  1SW6 A;  4N5Q A;  4DX6 D;  5ENS D;  3HRA A;  4NIK A;  5CEC B;  2HE0 A;  4O1P A;  5EIL A;  2F8Y A;  2AJA A;  5EN5 D;  3TWV A;  1BU9 A;  4BER A;  1MJ0 A;  2DWZ A;  4DX7 D;  3J5Q B;  5EYP F;  1K1B A;  1S70 B;  3V2O A;  4ZFH A;  1G3N B;  3V2X A;  3SO8 A;  2VGE A;  5AQ9 A;  1YYH A;  2RFM A;  3W9F A;  5EID A;  2ETC A;  3UXG A;  4JB8 P; 
#chains in the Genus database with same CATH topology
 5FJY A;  4LCT A;  3TG4 A;  1TJC A;  4AY6 A;  3RSE G;  1QBQ A;  3SF4 A;  5JJT A;  5BV1 A;  4O60 A;  3PUK A;  2WXK A;  3BQO A;  3HXC A;  4GTQ A;  1E7V A;  3ABK E;  3L17 A;  1DCE A;  2J8S D;  4KZC A;  3FTY A;  3W9G A;  3T5V A;  1O5M A;  4DX2 A;  4GCO A;  4E85 A;  4BES A;  2QYJ A;  3ZU7 B;  3T5X A;  3P2B A;  4IN3 B;  4YND A;  4OVU A;  3L16 A;  2OEV A;  5CER B;  4JC8 A;  4JHR A;  3JCK C;  4K5C A;  2LSU A;  1ZBP A;  2F37 A;  3I3N A;  2Y1L E;  2CFU A;  2ETA A;  4B0Z A;  3FU6 A;  3UMV A;  4V3I A;  3CGH A;  1HG5 A;  2FEZ A;  3CVQ A;  1OCR E;  2V0P A;  2NYJ A;  3LYA A;  4F7A A;  3TWS A;  3OXG A;  1UG3 A;  2GGF A;  2GRM A;  3EHM A;  5AQA A;  4HFG A;  1S63 A;  3E34 A;  4GMR A;  3TAX A;  3ASD A;  2LSV A;  3ASH A;  1N52 A;  3CST A;  1NZN A;  2F8Y A;  3ABL E;  4IYP A;  3QB2 A;  3J5Q B;  3PE3 A;  4HVB A;  2HYZ A;  1YYH A;  5T3R A;  2DCP A;  1XNF A;  4I6J A;  1TNO A;  1U3C A;  3ZYM A;  1BI8 B;  2HO1 A;  4HLL A;  4F3V A;  2XEH A;  3AS4 A;  4G25 A;  4JPS A;  1WAO 1;  4OAV B;  4ANV A;  3ZHE B;  5J08 A;  3WG7 E;  3ZYQ A;  2PM6 A;  2DBA A;  4PS7 A;  1OY3 D;  3B13 A;  4I2W A;  4GML A;  4J8F A;  2B6C A;  1D9S A;  2XGM A;  3I4G A;  3L9T A;  4AM9 A;  3LJ3 A;  1DC2 A;  1YA0 A;  5H7P A;  1FVF A;  4FP7 A;  3MX3 A;  2RG8 A;  4HOR A;  4JEH A;  4I6G A;  2GRO B;  3LXU X;  3CK8 A;  3EDT B;  4ILG A;  3RO3 A;  1ELK A;  3URZ A;  1YMP A;  2AXZ A;  3B7B A;  4HRL A;  4OVV A;  3DSX A;  2V4L A;  3Q7A A;  4N3C A;  1E8X A;  4Y6C A;  4ZHB A;  2Y0B G;  2L9B A;  2V8S E;  5T8I A;  4B8A A;  4C48 B;  4HQD A;  4CGW A;  4HBD A;  2AXV A;  4ATG A;  1AWC B;  2PM7 A;  2V5F A;  2R2L A;  3CVL A;  4HB5 A;  2UWJ G;  3ZPJ A;  3SGH A;  3MKQ A;  2I9C A;  1TN6 A;  4NAC A;  3Q4A B;  4BER A;  2X6I A;  3CVN A;  3IKO B;  2OCC E;  4JA9 A;  2ZIS A;  4UQZ A;  4KBQ A;  2X6H A;  4GYO A;  4FJY A;  2XEV A;  4CCA A;  3S7B A;  3UT4 A;  3NBN B;  2UY1 B;  2WM9 A;  4G24 A;  4KVM A;  4A63 B;  1MX6 A;  2P9S G;  2XGS A;  4F53 A;  1EYH A;  4TUM A;  3BG1 B;  3CQG B;  3FU3 A;  2WXG A;  3UQ3 A;  1FT2 A;  4N39 A;  2HM8 A;  5FZR A;  3PH0 C;  3HIZ A;  2DZO A;  3SY2 A;  4C9B B;  4BEP A;  4K0R A;  4E6H A;  4LG6 A;  3CVW A;  3D9M A;  1KZO A;  3KSQ A;  2WXQ A;  3EHQ A;  3Q47 B;  3SD5 A;  3TL5 A;  1N54 A;  4YDE A;  4EEC A;  2XZD G;  3PVL A;  3EHN A;  4I1A A;  5FWQ A;  3FUD A;  4C0M A;  2IOL A;  1Z3Y A;  5ANL A;  4CEM A;  5BUZ A;  5E76 A;  3U9W A;  5LP0 A;  3FTU A;  3FUM A;  3V79 K;  2KCK A;  1ELW A;  5DBK A;  4I2Z A;  4TRQ A;  2ZU6 B;  3NAW A;  2Y4U A;  5FT9 A;  2L0T B;  3AS8 A;  5BV0 A;  4MKT A;  4ILH B;  3S7F A;  3LVQ E;  4ANU A;  4Q69 A;  1DNP A;  3CK7 A;  5EYP F;  4U0U A;  2E0I A;  1SZA A;  2OOE A;  4LNB A;  5AQ9 A;  4APF A;  3GZ1 A;  3W9F A;  4MLP A;  1MZC A;  4J8Y A;  3QAQ A;  3RKV A;  2WVI A;  4KMO A;  4UQY A;  3ZHE A;  5JJ6 A;  5ITZ F;  1BI7 B;  2P9I G;  5BXU A;  5FQ7 A;  5HKP A;  3KEZ A;  5EIB E;  1JCS A;  5G05 J;  4AY5 A;  3CVY A;  3PDN A;  3ML9 A;  1UJK A;  4JVS A;  4K03 A;  2XEE A;  3AU5 A;  3ZYL A;  3E33 A;  4DJA A;  2WB2 A;  4AEZ C;  1WM5 A;  2IOS A;  3QDN A;  2P2C P;  3Q49 B;  4L2Y A;  1N95 A;  2GRR B;  4RVB A;  3B7R L;  5AYW D;  2LAH A;  4FA6 A;  5ENN A;  4HRN A;  1H6O A;  4AV7 A;  3UX4 A;  2X6F A;  2GRP B;  2BF0 X;  5CCM A;  2YIN A;  1BPO A;  1PC2 A;  1FCH A;  3KAE A;  3RRU A;  4ACK A;  2P58 C;  3SFX A;  3FUJ A;  1LF8 A;  4XKC A;  1H2U A;  2DZN A;  3HRA A;  4JXT A;  2WPV A;  3L6A A;  1IHG A;  5C2Y A;  3QOU A;  4A55 A;  1UJJ A;  4OYS A;  4R7L A;  2KM4 A;  2LNI A;  1TYQ G;  2UY1 A;  1WY6 A;  2F0Y A;  3UXG A;  2P9K G;  3ESK A;  1OWN A;  2J9Q A;  2YHE A;  4WAF A;  3D9K A;  4GZ5 A;  4K5A B;  1H6K A;  1N0Q A;  3FTW A;  4CZ2 D;  3HXE A;  3PNL B;  2FO7 A;  4BSX A;  2C2L A;  3UT7 A;  5G05 C;  3CHQ A;  1D8E A;  1SA4 A;  4WNF A;  4RQI A;  3D9J A;  3SFZ A;  1HS6 A;  1YCS B;  1N94 A;  3R9M A;  3NOG D;  4GMJ A;  5AJL A;  3DSV A;  3VLD A;  3PEV B;  5FZS A;  3DEO A;  5J90 A;  5EX0 A;  1O1S A;  2BKK B;  1O1R A;  5G55 A;  5CRU A;  4FHK A;  1JUQ A;  3DST A;  3ZIM A;  5KJL A;  5HRY A;  3L08 A;  4J7W A;  3ULE G;  4B94 A;  4TXR A;  2P9U G;  2ILR A;  4HNA D;  3B95 A;  4KYO B;  4EQF A;  5JMN D;  1IKN D;  2VQ2 A;  3IXE A;  3UTM A;  4O1O A;  5C1D A;  2CHX A;  1KPS B;  5CRV A;  4L2L A;  2IU1 A;  5KNG A;  4PS3 A;  1FPP A;  2XS8 A;  4JEU A;  2VSY A;  3LDZ A;  4XEI G;  3JUI A;  3JQ1 A;  3PRZ A;  3BG0 B;  1BU9 A;  3G2W A;  3U4T A;  2H6H A;  1MJ0 A;  4DX7 D;  5LCW J;  3BEE A;  2DYS E;  3FUK A;  4ZFH A;  4L7T A;  5G04 J;  1G3N B;  3NZU A;  4DI4 A;  3ABM E;  1HF8 A;  2WMN A;  2L0I A;  4YDO A;  2IY0 C;  3ZYK A;  4WUY A;  3UKU G;  5CEA A;  4A3V A;  5A23 A;  2ION A;  2GW1 A;  4LUN U;  3ONK A;  2R5S A;  3LCA A;  4RG9 A;  4GZ3 A;  3CV0 A;  1X5B A;  1N4R A;  1OCO E;  3Q73 A;  3D9O A;  2MOW A;  2BTD A;  3AU4 A;  3ULY A;  4GZD A;  5JJ7 A;  3C72 A;  3FUI A;  3UT8 A;  2OV8 A;  4C0E A;  2P9N G;  3R9A B;  1KT1 A;  3PZ3 A;  3LJN A;  3B7T A;  3OTN A;  1NL4 A;  5JHA A;  3EJN A;  1MHQ A;  3NOC D;  2I6H A;  5CBN A;  2H6I A;  5AQB A;  4EZJ A;  2ETB A;  4PDX A;  4TXP A;  4GYY A;  1SVX A;  4HI8 A;  3TWW A;  3IHV A;  3CVU A;  4HOQ A;  4XIF A;  3LPZ A;  2P9P G;  4GCN A;  3DPY A;  3QWP A;  1XGW A;  3FUL A;  2HE0 A;  4O1P A;  3IV0 A;  4BWR A;  5EIL A;  3APC A;  5EN5 D;  4GAA A;  1Y8M A;  4G26 A;  2R03 A;  5CMW A;  4Y6W A;  4RSY A;  4ME2 A;  1S70 B;  4U63 A;  4J8S A;  3D3M A;  3FH5 A;  2QZA A;  1BLX B;  3NF1 A;  5EYL A;  2M63 A;  1AP7 A;  1ZB1 A;  2AXU A;  3CHP A;  4J8D A;  3U3W A;  4WWO A;  1JPL A;  5ARG A;  3DWL G;  4XX5 A;  4YDY A;  4I43 A;  2HR2 A;  5CHE E;  3HYM B;  2CFZ A;  1DCQ A;  3UIO C;  3Q15 A;  3V31 A;  3LKU A;  4KVO A;  3ZW3 A;  2AW6 A;  2QYU A;  2IEJ A;  3C3R A;  3TWQ A;  3Q78 A;  1TR4 A;  3GW4 A;  2WXH A;  4AXH A;  4U8Y D;  1JCQ A;  3CVP A;  3EIQ C;  3N71 A;  3UKR G;  3C5R A;  2JAB A;  4JA7 A;  3ZNG A;  3G2V A;  1DVP A;  3RRM B;  1V55 E;  3B7S A;  4LNG A;  2EIK E;  2CHW A;  4LEU A;  1QZ2 A;  3APF A;  3FFL A;  3VTY A;  3ESL A;  1NA0 A;  2MRI A;  1TN7 A;  4UI9 J;  4FUL A;  2LXL A;  2DYR E;  2I1J A;  3FTS A;  2V4H C;  5CED B;  4G11 A;  3ZKJ A;  4IRU A;  2EIM E;  5LOZ A;  1H19 A;  4PH4 B;  1PAQ A;  2JEK A;  5D66 A;  3RO2 A;  3DXK G;  3VTX A;  2LUH A;  4FHJ A;  4GZC A;  2XCC A;  5AJD A;  4DK5 A;  5EDS A;  5T4Y A;  4WWN A;  3HHM A;  2Q7F A;  5KJN A;  3EIJ A;  3CHS A;  1H6P A;  2J4B A;  2J09 A;  4A1G A;  2XS1 A;  3MJW A;  5B1B E;  4DRX E;  1N11 A;  3E4B A;  5FTP A;  3RAU A;  1HXI A;  2Y3A A;  3PUJ A;  2IFU A;  3OXF A;  3JQ0 A;  5ENP D;  3UM0 A;  4FAD A;  4FJZ A;  4EHM A;  3HVE B;  3AG1 E;  2R59 A;  2J4D A;  2VSX E;  2E2E A;  1IQU A;  3UI2 A;  3G2T A;  1OWO A;  1OWM A;  1L5J A;  5JHB A;  3ENE A;  3VLE A;  1KZP A;  2C0M A;  4DX6 D;  2WXF A;  1Z3X A;  3TWV A;  1RZ4 A;  1JWF A;  3ASO E;  3SHF A;  3FU5 A;  4UI9 C;  3ZEF A;  2OEW A;  1LTX A;  4U04 A;  4JZY A;  2J08 A;  1A17 A;  3ISM C;  4KT6 B;  3QWW A;  5LFA A;  4JL0 A;  3SNX A;  4F1S A;  1A5E A;  4EBA G;  5AAR A;  2RFA A;  3RU0 A;  1K1A A;  2WXO A;  5A7D B;  4JHK A;  3MCX A;  4BY6 A;  4W9R A;  1HZ4 A;  1Y6I A;  2WQ6 A;  5ARF A;  2F8X K;  2KBX A;  1OWL A;  1ZU2 A;  2XRZ A;  2KAT A;  3HDX A;  3MEK A;  3TXM A;  1K8K G;  3QNK A;  1N0R A;  3SQV A;  2VTB B;  4ATZ D;  3CKB A;  2LO6 A;  1H2T C;  2I1K A;  4UQX A;  3EU5 A;  4I6E A;  2GRQ B;  4N5C A;  2A5E A;  4WND A;  3CR3 A;  3F6Q A;  4HI9 A;  4N2Q A;  2A5U A;  3HXB A;  2ZIR A;  1Z6T A;  5ENO D;  3P1U A;  4AJW A;  1FT1 A;  4QQI A;  2WQH A;  1E96 B;  4WNG A;  4AP2 A;  2WXR A;  1EPU A;  4GTP A;  1RW2 A;  4KXK B;  2WQ7 A;  2OND A;  4JB8 P;  1W3B A;  4AVX A;  3RK6 A;  5FQ4 A;  1SA5 A;  4L9P A;  3BUA A;  3NB2 A;  3OAW A;  3DBS A;  3CLJ A;  1KLX A;  3DEP A;  4HXI A;  3ZXS A;  1B89 A;  4L1B A;  4LRZ A;  2B0O E;  1WG0 A;  5A6C A;  3ZUV B;  1Q2Z A;  3O4Z A;  3ZFW A;  4H7Y A;  5BT1 A;  4I17 A;  3HVE A;  5D0O D;  3ASG A;  4F1P A;  1EDU A;  1N9A A;  2KCV A;  4G8K A;  4DI3 A;  2XQ0 A;  5B1A E;  2KZT B;  4A1S A;  4DX1 A;  3TWX A;  3JXJ A;  4N3B A;  2CHZ A;  2XEN A;  2NXP A;  5KCM A;  2MYO A;  3T8K A;  1NI1 A;  2QC9 A;  5CCL A;  3AG3 E;  2WXI A;  4MRU A;  1VDY A;  1QNF A;  5HI7 A;  2AJA A;  5DIZ A;  3UM1 A;  1JWG A;  3TGO A;  3V2O A;  4Q94 A;  4H7X A;  4WWP A;  4YVO A;  3ZN3 A;  2R05 A;  2EQX A;  2OVB A;  4HLE A;  4XI9 A;  3AS5 A;  1OWP A;  4U96 D;  3ZRH A;  1NFI E;  3SI5 A;  5KWD A;  1JCR A;  2OVF A;  2GRL A;  2PL2 A;  3MA5 A;  4CDM A;  4GTS A;  2PQR A;  2XCB A;  3V30 A;  4BET A;  5ENQ D;  1GW6 A;  2VTB A;  5FQ8 A;  5M72 A;  3NZS A;  4ANW A;  1TNU A;  4EPZ A;  3TWT A;  2IF4 A;  2YQ8 A;  4PUC A;  2PQN A;  5IY5 E;  2XRY A;  4XZ4 A;  1UN8 A;  5KJK A;  2VSN A;  1EF1 C;  2P9L G;  1IQR A;  4MBG A;  4DX5 D;  3PNT B;  5G2N A;  2LAI A;  3FTV A;  3Q9N C;  4HS2 A;  4U8V D;  3O48 A;  2FO1 E;  3JXI A;  1O1T A;  3J5P A;  1S64 A;  4F6R D;  3IEG A;  1SZ9 A;  2PNN A;  3L13 A;  2R02 A;  1SW6 A;  3MGB A;  1MQS A;  4EBA A;  5CEC B;  3TG5 A;  4BTA A;  2H6G A;  4UWF A;  3B7U X;  1KT0 A;  2DWZ A;  2XHE A;  5AEN A;  3LY8 A;  3V2X A;  3CVX A;  2ETC A;  4YVQ C;  3AAA C;  5AIJ A;  3CHO A;  5AN8 A;  2BUG A;  4GTR A;  4CRW A;  1K3Z D;  4TV3 A;  3ASF A;  4N3A A;  2BKG A;  3Q7F A;  4CT0 A;  3SFY A;  5LCW C;  4DPR A;  3ML8 A;  2X6K A;  4YDW A;  5G04 C;  3HXF A;  3C3Q A;  1X81 A;  3CKC A;  3DSU A;  4FC8 A;  3U64 A;  4GTV A;  4L23 A;  2AVP A;  2ZGD A;  4U8H A;  3ASN E;  1TEZ A;  2KZT A;  1E90 A;  1WDY A;  4XKB A;  2VYI A;  1S0P A;  1U3D A;  3FH7 A;  3AG2 E;  2GRN B;  3AJI A;  5BPP A;  4U95 D;  4GA0 A;  5D2M C;  1TNB A;  4B93 B;  1MX2 A;  3VLF A;  4XE0 A;  1NA3 A;  3DRA A;  2MHK A;  4EZL A;  3LS8 A;  3FP3 A;  2ZXW E;  3FY4 A;  4O6F A;  3FUF A;  3CEQ A;  3QAR A;  4B89 A;  1E8Z A;  4J0U A;  3UIN C;  4UWG A;  2VJ8 A;  3PRE A;  4G2V A;  2XGO A;  4URK A;  3OXL A;  1TNY A;  4I9C A;  3FDH A;  3D9P A;  3DPD A;  4BT9 A;  1HO8 A;  2CG3 A;  3KSL A;  1IHB A;  2FBN A;  1D8D A;  4G8L A;  2IQC A;  4BT8 A;  4U0S A;  3FTZ A;  2DVW A;  3APD A;  5EX3 A;  4HOS A;  3EUV A;  3MZL B;  3KS2 A;  4DUI A;  3E37 A;  4GPK A;  3DSW A;  2FF4 A;  4X8Q A;  2KCL A;  4ABN A;  1H0A A;  2XPI A;  3ZVV A;  2WXN A;  2QY7 A;  2WXM A;  4HOU A;  4CDR A;  3G2U A;  5JA4 D;  3TWR A;  3HXD A;  4RG6 A;  1V54 E;  3S7J A;  3UIP C;  4LNU D;  4WNE A;  4CYM D;  3PS6 A;  3FTX A;  2VGY A;  3PE4 A;  3WXX A;  4Q96 A;  1P5Q A;  2Y69 E;  3PEU B;  3CK9 A;  4UWH A;  3I5P A;  2LXM A;  3FUH A;  3CHR A;  4I1O B;  4GTM A;  4QFV A;  1MYO A;  5HQ8 A;  2YHC A;  3UUX A;  4NQ0 A;  3Q75 A;  2C0L A;  3DSS A;  4N2S A;  2YNQ A;  3S7D A;  2R17 C;  3Q9U C;  4BFR A;  5ENR D;  4HOT A;  3UM3 A;  5AAO A;  3MV2 B;  5ENS D;  1QQE A;  4DLO A;  5CMY A;  3LVR E;  5BNW A;  1U2V G;  2IO3 C;  3ULQ A;  5E75 A;  2FI7 A;  2VGE A;  5EID A;  4BX8 A;  1FVH A;  2WXL A;  2AWI A;  3Q79 A;  5D0Q D;  4GA1 A;  4BX9 A;  3IBE A;  3E32 A;  3UPV A;  3R7R A;  5FIO A;  1H2V C;  3FU0 A;  3KEA A;  2RD0 A;  3BU8 A;  3KD7 A;  2X38 A;  1E8Y A;  2Y4T A;  3DXM G;  4K5B A;  4GB9 A;  1E7U A;  3EHR A;  4GTO A;  2EIN E;  4GYW A;  5BXO A;  3AG4 E;  4M7C A;  4TUU A;  2A4Z A;  3E30 A;  3QWV A;  1BD8 A;  1IYG A;  4I1M A;  4UUC A;  3SZ7 A;  3ONL A;  5FQ6 A;  3HG0 D;  5B3S E;  3SBT B;  3D9L A;  4JD2 G;  2CG2 A;  1LD8 A;  3RRN B;  4RLY A;  3I4R B;  3NQP A;  1N4P A;  3LY7 A;  2ZGG A;  4J8E A;  3D9N A;  2V5Q C;  2VGX B;  2EIL E;  4EZK A;  3JYS A;  1HFA A;  3QKY A;  4UWK A;  3PZD A;  3FWV A;  3C3O A;  4U0Z A;  5FIN A;  4IUL A;  1OXJ A;  2H6F A;  2BED A;  3R7Q A;  3RIB A;  1N4S A;  1HX8 A;  2X6J A;  3L54 A;  3RJV A;  3QK0 A;  4CT4 A;  5BW8 C;  3G2S A;  5ANR A;  3FHE A;  3TJP A;  3GYZ A;  1OCC E;  4CDN A;  3ZGQ A;  1UOH A;  3T9K A;  3D9I A;  1OCZ E;  2L6B A;  4LER A;  1HU3 A;  3T8M A;  5KJM A;  1PY1 A;  4NRH B;  1HE8 A;  5KNH D;  4D10 C;  4FLB A;  4PS8 A;  5ENT D;  4AIF A;  2FUL A;  2IJG X;  4ILI A;  4GA2 A;  5LX8 A;  4UI9 K;  4ACL A;  4JHJ A;  3PZ4 A;  3Q5M A;  1UN9 A;  3ZXP A;  2KC7 A;  4B8C B;  3MYV A;  3EU9 A;  1TJF A;  1HG2 A;  4Z68 A;  2PZI A;  1OUV A;  1INZ A;  3TWU A;  3LY9 A;  4CGV A;  1QYM A;  1MX4 A;  1OT8 A;  4LSZ E;  4TXQ A;  4A3T A;  2VSO E;  5KBA A;  2DIW A;  1HH8 A;  2JLB A;  4APO A;  2NC9 A;  3JUE A;  3K9I A;  4I9E A;  3MV3 B;  4M3O A;  4UWL A;  2EIJ E;  2XPY A;  3U66 A;  3FUN A;  3IHY A;  3X2Q E;  2IO2 C;  1K1B A;  3FUE A;  3C98 A;  3CIA A;  4G23 A;  4GU5 A;  2WXP A;  4J6I A;  3D9H A;  2XPZ A;  3QC1 A;  2WXJ A;  5FZQ A;  3PZ2 A;  3L22 A;  2KXP C;  4BSZ B;  4GPM A;  1TN8 A;  1TNZ A;  3L82 A;  3CQC B;  4G1T A;  4XI0 A;  1Z5S C;  2NSZ A;  4P29 A;  5AQ7 A;  4GZ6 A;  3GZS A;  3S2A A;  3PZ1 A;  3SBS A;  1NP7 A;  1N4Q A;  3FEX A;  3CHM A;  2QFC A;  4OAU C;  4BTB A;  2WMO A;  5HS0 A;  2XZT G;  4AOF A;  1LD7 A;  1IXV A;  4FLH A;  4HRM B;  3MKR A;  5EKQ D;  3LEW A;  4U07 A;  1SQM A;  3TXN A;  5CBO A;  3CVV A;  3GZ2 A;  4JW1 A;  2VGX A;  1ELR A;  3FEY A;  3FH8 A;  3UM2 A;  4MS6 A;  4U7E B;  2X3M A;  4KZ0 A;  4NUR A;  1E8W A;  4N5Q A;  2J07 A;  1UW4 B;  4NIK A;  4GTT A;  3QJZ A;  4ANX A;  4DLQ A;  2RKK A;  4FU3 A;  3MKQ B;  2J49 A;  2L6J A;  3SO8 A;  3CSF A;  2RFM A;  2I2O A; 
#chains in the Genus database with same CATH homology
 2V4H C;  3AAA C;  4J8Y A;  1BLX B;  5CED B;  5AN8 A;  3D9H A;  5EYL A;  1AP7 A;  5CEA A;  1IHB A;  3ZKJ A;  1A5E A;  4G8L A;  4U96 D;  4K5A B;  5AAR A;  2RFA A;  1N0Q A;  1K3Z D;  3NBN B;  1K1A A;  1NFI E;  1BI8 B;  5KWD A;  2DVW A;  5ITZ F;  1BI7 B;  4CZ2 D;  4YDY A;  5D66 A;  4O60 A;  5BXU A;  2BKG A;  4A63 B;  5HKP A;  4HLL A;  1MX6 A;  1UOH A;  5FIO A;  2KXP C;  2XEH A;  5EIB E;  3T9K A;  4BSZ B;  4GPM A;  4DUI A;  4YDW A;  1DCQ A;  3DEP A;  2L6B A;  4OAV B;  4TUM A;  3KEA A;  3V30 A;  4BET A;  2F8X K;  2J8S D;  5AQ7 A;  2B0O E;  5KNH D;  2KBX A;  1YCS B;  2DZO A;  3W9G A;  3V31 A;  1WG0 A;  5ENQ D;  1OY3 D;  3NOG D;  4K5B A;  2ZGD A;  3ZUV B;  2XEE A;  4DX2 A;  5JA4 D;  5ENT D;  3TWR A;  3EHR A;  4BEP A;  5BXO A;  4BES A;  2QYJ A;  3ZU7 B;  3DEO A;  4OAU C;  1D9S A;  1N0R A;  4DRX E;  5HS0 A;  1N11 A;  2XZT G;  4LG6 A;  1DC2 A;  2BKK B;  4LNU D;  4CYM D;  1IXV A;  1BD8 A;  2P2C P;  4HRM B;  3TWQ A;  1TR4 A;  1WDY A;  3LJN A;  3TWT A;  4UUC A;  5CER B;  3EHQ A;  4ATZ D;  4K5C A;  5CBO A;  3AJI A;  3EU9 A;  4U95 D;  3HG0 D;  4F1P A;  2F37 A;  4Z68 A;  4HRN A;  5HRY A;  4G8K A;  4U8Y D;  1YMP A;  4J7W A;  2XZD G;  3B7B A;  4HRL A;  1MX2 A;  3NOC D;  2Y1L E;  4B93 B;  5ENP D;  3TWU A;  5CBN A;  1QYM A;  5AQB A;  4DX1 A;  1MX4 A;  3C5R A;  2A5E A;  2ETA A;  2JAB A;  3JXJ A;  3TWX A;  4HNA D;  1OT8 A;  3ZNG A;  3B95 A;  4QFV A;  2ETB A;  4ZHB A;  2Y0B G;  4LSZ E;  1MYO A;  3F6Q A;  4HI9 A;  4RLY A;  5JMN D;  2XEN A;  4DX5 D;  1SVX A;  1IKN D;  2MYO A;  3IXE A;  5KBA A;  3Q9N C;  4U8V D;  4HI8 A;  2NYJ A;  3UI2 A;  3UTM A;  4O1O A;  3V79 K;  2ZGG A;  4C48 B;  4HQD A;  5ENO D;  3T8K A;  2FO1 E;  2QC9 A;  4HBD A;  3JUE A;  2V5Q C;  3JXI A;  3TWW A;  1AWC B;  3Q9U C;  3TWS A;  4HB5 A;  4QQI A;  5KNG A;  5ENR D;  3J5P A;  2DZN A;  4F6R D;  5AAO A;  2PNN A;  5AQA A;  5FIN A;  4GMR A;  1SW6 A;  4N5Q A;  4DX6 D;  5ENS D;  3HRA A;  4NIK A;  5CEC B;  2HE0 A;  4O1P A;  5EIL A;  2F8Y A;  2AJA A;  5EN5 D;  3TWV A;  1BU9 A;  4BER A;  1MJ0 A;  2DWZ A;  4DX7 D;  3J5Q B;  5EYP F;  1K1B A;  1S70 B;  3V2O A;  4ZFH A;  1G3N B;  3V2X A;  3SO8 A;  2VGE A;  5AQ9 A;  1YYH A;  2RFM A;  3W9F A;  5EID A;  2ETC A;  3UXG A;  4JB8 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...