4GU5A

Structure of full-length drosophila cryptochrome
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
537
structure length
537
Chain Sequence
TRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLRACVRGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Updated structure of Drosophila cryptochrome.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
molecule keywords Cryptochrome-1
total genus 200
structure length 537
sequence length 537
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4gu5A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gu5A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4gu5A01
1OD6A 1ZJWA 3CVYA 3JXEA 2D54A 3H9CA 3SEZA 4ND7A 1ZH6A 3K32A 3ND6A 4DNXA 5FO1A 1K97A 1G59A 2CYCA 3DO8A 1K92A 2GOYA 1X6VA 3OTWA 1GTRA 1LW7A 4JYZA 3CVUA 3FDXA 2YY5A 1WY5A 1IQUA 3ZIUA 5J58A 3FNRA 1O96B 2X3FA 4MUNA 3IDFA 1H3EA 2J08A 1G8FA 3CLTC 1KKUA 4MQ6A 4J76A 1O97C 4BWVA 2CV1A 3CLUD 4NATA 4EG7A 1X8XA 4R2LA 3TNJA 3UY4A 4MW7A 1M1ZA 2QUHA 3DV2A 3OP1A 1J1ZA 3TS1A 4YBRA 2XRZA 2QUKA 1H1TA 3CVVA 3H97A 1TYBE 5BNZA 1ZUNA 3N8HA 5J59A 1TYDE 2IELA 1FFYA 2J07A 1YULA 4ZCPA 3KFLA 4XFJA 2PIDA 4PBSA 3CA8A 3CVWA 1JIJA 3PNBA 3VRHA 4NDAA 4MUFA 3DPIA 1JHDA 3AFHA 1N2HA 1YIAA 4H3SA 4G5FA 1WOYA 3A04A 4ZCQA 4R2MA 1OBHA 2E18A 1QNFA 2PG3A 3COZA 1EFPB 3TZEA 5J5AA 4OJMX 4ARIA 5H7XA 3IVCA 1QQTA 1PG2A 5AHWA 1QRTA 1WQ4A 2DEUA 3PNYA 1WJGA 3H99A 1N2EA 1VBMA 4ZT2A 1KQPA 3QE4A 4MULA 1N77A 1Q11A 4P2BA 4MWEA 4RPIA 3S3TA 2DR2A 4EGAA 1EUYA 3X1KA 2DUMA 3CLTD 1U7DA 1EUQA 1KAMA 1KP2A 1K4KA 3COVA 1UFVA 1U7XA 4DDHA 4EG4A 5KWVA 4QRDA 4MLPA 1M8FA 3RK1A 3FI0A 1JMVA 4MWCA 4MUEA 1VBNA 2PXHA 4PBTA 3FH0A 2A1TR 3HZRA 3MLBA 4EFKA 1GPMA 1KR2A 2EL7A 4JFAA 1NUUA 1IRXA 1OBCA 3X1MA 2NSYA 2IP1A 4EG5A 4KR7A 2A86A 5HG0A 2DETA 5K0TA 4HJXA 4MW6A 1N1DA 3IH5A 1T6ZA 1I6KA 3LE8A 4G6ZA 5IJXA 1F7VA 1IVSA 1H3FA 1J09A 4YP5A 2PZAA 2PFSA 4ARCA 3CR8A 5TEWA 3HGMA 4R0NA 1EXDA 5DEOA 1DNPA 1NURA 4S1OA 3FWKA 3M5WA 2PZBA 2B7LA 1G8HA 4XFDA 1TYAE 2A1UB 3AG6A 4DDMA 2CSXA 1PFUA 2JAXA 2A84A 3N05A 1GAXA 4QBTA 2CV2A 4CQNA 2QTRA 1OWPA 1EFVA 1NUQA 3IMCA 3TQOA 3IVXA 2BTEA 1M8JA 4MVCA 1IHOA 1MAWA 1IQRA 1R6XA 3MLAA 4XSVA 1NSYA 1WXEA 3U1VA 1QRUA 3CVXA 1H3NA 5DASA 3KT0A 1T6XA 4ZT7A 3BL5A 3P0HA 1CT9A 3C8ZA 3LCJA 1MC1A 2A1UA 3CLRC 3ZJTA 4A91A 1WZ2A 4F3RA 4KR9A 3AKZA 3P52A 3FHJA 1TFUA 1OWLA 3KT8A 1MBZA 3H05A 4TS1A 1N75A 3ZXSA 5IHXA 2X1LA 3VGJA 5LFAA 2CYBA 5JBNA 2NZ2A 2VTBB 2H29A 5EKDA 1RQGA 1XNGA 1N2BA 4EG1A 1R6TA 4QREA 4JXXA 4AQ7A 1JIIA 4GU5A 1T9GR 3RBAA 1T6YA 2OQ2A 1QU3A 4MWBA 1GLNA 2HGZA 1XNJA 1WXFA 3N2YA 1N78A 2ZUEA 3UK2A 1IQ0A 1PFVA 3Q4GA 4ZT3A 1F7UA 4X0EA 1T9GS 1ILEA 3RK0A 1O94C 2DPLA 1GTSA 1WKBA 2CFOA 2Z3VA 5KCMA 1I2DA 2VTBA 2XRYA 4MVXA 1MAUA 1O95D 1N2IA 3L93A 3IUEA 5F23A 4ZCSA 5K0SA 1COZA 2V0GA 2E0IA 3NBKA 3SEQA 4K0RA 3IUBA 1TYCA 2WSIA 1TQ8A 2HZ7A 4KPUA 4HJRA 1JZQA 1JEDA 3FOCA 2Z09A 3TZLA 4F4HA 3IOBA 2CV0A 5TEVA 3DLAA 4MWDA 2ZUFA 1EFPA 1NUSA 1I6LA 2JANA 3ELBA 2QUIA 4I6JA 4UZFA 5HUHA 1KP3A 1EJ2A 1TEZA 2WQ7A 1KH1A 1QJCA 1U3CA 1F4LA 3G5AA 3K9WA 4MW4A 4NAHA 5LM3A 1O0BA 1KORA 3PXUA 4J75A 1MJHA 5KHAA 3SZ3A 1NYLA 1SURA 4AS1A 3COWA 2BYTA 1P7PA 1KAQA 3IMGA 1BS2A 1YI8A 4KPUB 3ZJUA 1YUMA 4EG3A 3KT6A 2QJOA 4ZCRA 3IMEA 4OUDB 4JZYA 2OV4A 5LLTA 1O5TA 4HK4A 3NBAA 1K4MA 3AG5A 1QTQA 3A2KA 2PZ8A 3UC5A 2A1TS 1ZH0A 4I6GA 3X1JA 1KH2A 4ZT6A 1NUPA 4YP6A 3RHSA 4YMIA 1JIKA 1N2JA 1M8PA 1O0CA 2WQ6A 2G36A 4CDNA 1OWNA 1O94D 3PRHA 1J20A 1MOPA 3SZGA 3IOCA 4DJAA 3QTBA 1Q15A 3RJZA 1LI5A 2DXIA 1MB9A 4G5YA 3MXTA 4ND6A 4Q93A 2A4MA 4MVYA 3IVGA 4JXZA 3G59A 3N9IA 2CT8A 1YUNA 4MW9A 4KKVA 1V8FA 2J5BA 4MW1A 3QTTA 4MUJA 2C5SA 2QJFA 3GMIA 4E1AA 5HUJA 1J70A 3P0JA 4DDKA 4UZEA 4MW2A 1KQOA 1VBKA 2AKEA 4U8HA 3A05A 3Q10A 1N3LA 2IJGX 1Y42X 3P0IA 5H16A 2JA2A 3FETA 1IFXA 2QJTA 1NZJA 3ILVA 4ZT4A 3HMQA 2WB2A 3MUEA 1QRSA 2QTNA 4U7JA 1O97D 1HYBA 1JEEA 2J09A 1VL2A 1JGTA 1IH8A 2DERA 4L2IA 1YIDA 1JZSA 2YXNA 2ZP1A 1PG0A 1WXIA 4FZJA 4L2IB 4NX2A 2E21A 1LI7A 4DLPA 4MUHA 1MB2A 2QTMA 1PFYA 2RE8A 4EF6A 3ND5A 1FYDA 2YWBA 2RD2A 3VU8A 4MUIA 5TS2A 1U3DA 3UMVA 2D13A 5DB4A 1QU2A 1F9AA 2CYAA 4CT0A 3TQIA 3E27A 2AZXA 2O5RA 2R5WA 1O95C 2QUJA 3KT3A 3SYTA 4MW5A 4WSOA 5FNZA 4ZCTA 1NUTA 4CDMA 1NI5A 2E89A 3GLVA 2X1MA 3G6KA 4MAFA 1M83A 1JECA 3CLUC 4PBRA 3Q12A 1J21A 1WXGA 1V47A 4Q16A 1KQNA 1O96A 1J1UA 2X0KA 5TGTA 1N2GA 4MUGA 3ISJA 3F3MA 3AL0C 3RFFA 3IODA 2H2AA 2VXOA 5FO0A 3ZGZA 4RUKA 1XNHA 3IOEA 4HPWA 4GRIA 4MW0A 1KH3A 1ULHA 3FY4A 2V0CA 1U0BB 1G8GA 3SP1A 1A8HA 4ZT5A 4DE5A 3COYA 1PFWA 1GZUA 2J4DA 2GKSA 4K03A 3CLSC 2A88A 1GN8A 2D5BA 4EG6A 1EFVB 4NAUA 3SDBA 3HL4A 3I05A 4OUDA 1M8KA 3AIIA 1O6BA 2A7XA 4YP7A 1VLHA 2DLCX 1NP7A 4PY2A 1S4MA 3INNA 2HMAA 3CLRD 1XJQA 1OWOA 4KR6A 4I6EA 3D6VA 2O8VA 3CLSD 1Q19A 4MUKA 3UOWA 1M8GA 3D6UA 3HFJA 3ZUGA 3ND7A 4MVWA 2I1LA 4U63A 1I6MA 5DK4A 1MRZA 2AG6A 4WNYA 1D2RA 1EE1A 4NZPA 3NV7A 3L92A 1Q77A 3H9BA 2TS1A 3FIUA 3LOQA 2Z08A 2CUZA 3A4IA 2EJCA 2YWCA 1WXHA 1B6TA 1JILA 1R6UA 1N2OA 3ZJVA 3HV0A 3MMXA 2GM3A 3PNVA 1OWMA 1WQ3A 3GUZA 3ZXIA 4EG8A 3FG9A
chains in the Genus database with same CATH superfamily
2GERA 2ROQA 1E77A 1E7MA 4OK3A 5JMOA 1OD6A 3NOOA 4IILA 3WGIA 4YR9A 5IXJA 3MCWA 1XMJA 5HE8A 4Z7JA 1U7UA 4TM7A 3IAHA 1JG2A 1GUYA 4DZRA 2VF5X 3OWXA 1U0TA 1YDHA 3PIIA 1X6VA 3WK9A 4ASUD 1GTRA 5JECA 2MT9A 5T8KA 4J7AA 3S44A 3TR0A 2R03A 1H2RS 1UPFA 4KOAA 5JLAA 2WMOA 2HQOA 2ZTLA 2B4AA 5D5QA 2WIFA 4F96A 1ZKMA 3T61A 5AOBA 4MQ4A 3BRSA 1QYIA 1PFKA 3QJZA 4BNTA 1ATIA 2O4UX 3PRKE 4U0JA 1YZHA 2JAQA 3OH8A 4IWXA 4ETNA 3FPHA 4CT4A 1UXIA 5DXFA 3WYAA 2XA2A 2D2EA 5BRAA 3FZYA 1M2VB 5IAOA 3X1XA 2I67A 2JFQA 4EG7A 4JN6B 4AY6A 1T8TA 2BPOA 2CWWA 3K09A 5JJ7A 3MV3B 1MD9A 3K9HA 5AVOA 3TLCA 4CTJA 1P5FA 1RQ2A 3ECSA 2CDAA 1XT6A 3OXFA 2QAGC 3BMQB 1RYBA 5EN4A 1EXNA 1P7VA 2EIXA 3NEJA 4H2DA 4Q9NA 3SVLA 2QQGA 1H23A 4ZREA 3TS1A 3FYHA 3ZPXA 4C89A 3Q7AA 1OH8A 5C34B 4E11A 2CGEA 2QUKA 2IBTA 4H18A 3I92A 4GHWA 1L7DA 4ZO7A 3M6XA 5EIDA 5FX2A 3RKSA 5AICA 5J59A 1QLHA 5HK8A 2WJJA 1FFYA 1J9ZA 1R4AA 5DWVA 4ZCPA 2AWIA 1JT2A 2SBTA 3IUPA 4GGPA 1ZNYA 3IKVA 4L8VA 1OH7A 3FUMA 4WK4B 1SIOA 1NM5C 2E4VA 1R12A 2RGEA 2V59A 2WZBA 2XTNA 4AIIA 1BMQA 5A9SB 5M2QA 4PNZA 3L1UA 3IILA 4S0XA 4YX9A 2XUIA 2PH1A 3DWEX 1PNVA 3AFHA 3BB4A 3DYBA 3E3AA 4PPQA 5KDLA 4M7PA 4IH9A 5CVCA 3GUUA 2I2WA 4XGIA 4BFTA 4LNAA 3MOIA 1J0BA 3VOTA 1T3GA 4FEEA 4TTRA 1OZFA 5AIJA 2I55A 3RIGA 2XMGA 3GEEA 1U9JA 3PA8A 2FUCA 4UEWA 1XF9A 5FBZA 4X45A 4YAWA 1NVKA 3PQ8A 2XD4A 3KBOA 4YCLA 2PZKA 2DEUA 4I2ZA 4L3OA 3OO0A 4EPZA 3H99A 3LW8A 1NY6A 3QEJA 4YRPA 5FL7D 4EO7A 5C9ZA 2Y1WA 4LIPD 4QKQA 1ZLXA 4WZBA 3V00A 3WAKA 1QVVA 5CXXA 4B46A 3IEVA 1RRCA 4JJ7A 4DLWA 1Z12A 2ISSD 2QAGA 3U26A 5AHKA 4D3SA 2WFLA 1F48A 5ENQD 3I09A 3GJ6A 3NOXA 1ZRNA 2A4KA 2K5UA 4RMGA 1Z3YA 3NNNA 1SC6A 4ZN6A 4JNCA 4HQOA 3L54A 1OIVA 1XUOA 1Q3TA 2E7ZA 3GZNB 5EFZA 4OU4A 5JAIA 2EFHB 5HE9A 1G63A 3ERCA 1V4VA 3V1MA 1RMYA 1JIXA 4J7CA 4FYJA 1N9AA 4A3VA 1L4NA 2UVQA 1G60A 5ES3A 2ZT6A 3O5AA 1U6KA 4HZIA 4O4LB 3RBZA 2I4IA 2NAPA 1LTHR 3OTIA 4XM1A 1REQA 1KR2A 5I7FA 4YHHB 4MRUA 2LW7A 2R6FA 2NT3A 1NUUA 2PGJA 4IGIA 1M1NA 4XGQA 5F4BA 4UM9B 1RU3A 3ESRA 2A5UA 5K3OA 2OL4A 5K0TA 5CW1A 4NENA 3WLAA 2GETA 1UMCB 4G97A 4OFZA 2R2LA 3P8ZA 5JJLA 4OMUA 1QGOA 4RF5A 1JDPA 2QLFA 3FIJA 2LGJA 2OHHA 3IT0A 3ZV4A 3U7EB 1FDTA 2FN9A 4U7TB 4ARCA 3CHMA 1EZZA 1MU0A 1V3VA 3F4KA 3ZU2A 3HY3A 1SD1A 4DIFA 4P7FA 1FT2A 4CMGA 2G9UA 2X8LA 3WMGA 4M1OA 3U4MA 1YB5A 3RFTA 3NT2A 3OZBA 1J42A 5C81A 1V8DA 3ADDA 1Q0SA 1D5CA 1T8UA 4MQEA 2GBPA 4JBIA 2HSGA 3KX2A 2A84A 4U5XA 2XWSA 3CZPA 5CX4A 1B8OA 1XU4A 1L5YA 2AJCA 3CX6A 4Q66C 5EE9A 1BDMA 2H4ZA 4QOEA 4KRYA 2J0SA 2JASA 1ISRA 2OZEA 1KE1A 2ZSKA 3HG7A 1J2EA 3AOEC 3TQOA 2JLUA 4MVCA 5CVJA 2Y0BG 1GZ3A 5DTJA 2AE1A 5L51A 1PHRA 3TEFA 1FDRA 1Z2PX 4II2A 4N3GA 5DYWA 4PHHA 4D3YA 4H6PA 3QOWA 4N49A 5KOYA 4Q3BA 2X6RA 1T6XA 5A6CA 1QVAA 2X4GA 2YMLA 4FS3A 1QVZA 1JEYA 3LDGA 3LUPA 3GRVA 2P5UA 3MGKA 1CT9A 1DTSA 1FU7A 1R15A 2EKPA 2F3PA 2LCIA 3CG4A 4HF7A 2Q50A 4TMWA 2O2HA 4FP7A 2VP4A 2WXRA 3PQ7A 1XWWA 4YALA 3QFRA 4L50A 3WX0A 1TIKA 1NQTA 5D8DA 3D8UA 2H1WA 4HLUC 5ALYA 3IA2A 2QYSA 4XJSA 2NIPA 3Q5GA 4F4IA 5E4TA 1P5JA 2PU5A 2ZBDA 4AVXA 4QFDA 3T5TA 4M9CA 4BMZA 4C0EA 3H05A 2WPDD 3DVAA 2HWKA 2R05A 2H17A 3H1AA 3FDFA 3VU3A 3CNEA 3C3BA 4ZVSA 1A1VA 4B1FA 1KQGA 1WEHA 1Q2ZA 1QC5B 4QUBA 4Y0NA 1CRPA 5FFNA 1A97A 5C80A 2IUEA 3WBJA 2H29A 1QIMA 1YU6A 1O6GA 2H5JA 3L9XA 2QRKA 4LNUD 3SJUA 2BKAA 2LD4A 1CUHA 1RPAA 3NOCD 4EQZA 3ICQB 4RQAA 4G5OA 3JD2A 4R2WA 3A58B 2CJPA 4B3XA 4MWBA 5EWLB 1ZMOA 3ONFA 2HGZA 5EQDA 1UADA 2B8JA 1XNJA 2QTFA 3CNLA 3RVMA 2J3MA 1QQ7A 3TK1A 4YAGA 5CBKA 2AOWA 3EAGA 1UOPA 4L6CA 3BGWA 5IP5A 4IXWA 4KLZA 4BMSA 2C7OA 5CB6A 4GL2A 1RABA 3FN4A 5A4MS 1MC4A 1QDUA 3KYCA 3UN1A 4ZOEA 3CNHA 2VQ3A 4BB6A 1HTBA 3PWZA 2IYAA 1DI0A 1WXDA 2ZI3A 5ILOA 1P2TA 4XI9A 3AU9A 3HHEA 2ZROA 3ENVA 1Y8RA 5AKXA 2VTBA 4RQBA 3RYTC 3S7ZA 4BZWA 1P1JA 5FIOA 1LCIA 2VJPA 1N2IA 2Q1YA 3B95A 1IZYA 5F23A 2B25A 4RXUA 1MEEA 2Q5OA 4C1BA 5KTTA 1OBFO 3D3KA 3H9GA 4KB5A 4A1OA 3IUBA 3NYWA 2GTPA 1G3RA 4E12A 4ZK2A 2P77A 3CTMA 4MI1A 3O8QB 2C2LA 1IVYA 3I62A 4JOSA 3SKXA 1BWQA 3I1IA 2QLBA 4A26A 3FYCA 2VQDA 4TVSA 3NU1A 2YWDA 5CXUA 3EDQA 1M0SA 1O5MA 2HXSA 4EPVA 3HXKA 3BXOA 1Z3IX 2FHSA 4WNCA 4BZQA 3Q7SA 1ISMA 4I6JA 1GA6A 2IEDA 5F5XA 1TFRA 1IZ7A 2XYRA 2KBEA 3CB4A 1JHUA 4MJLA 4EFDA 3MB5A 5BMOA 4B5LA 4E70A 3PFIA 2DYSE 1IPHA 3RUEA 1LB1B 4LZJA 4J1TA 5CFMA 3F1LA 2BYTA 1M1YB 2IW3A 1N7HA 3DZIA 3M6FA 4G09A 3U13A 4RTKA 5ALLA 3O8QA 1P62B 2XX3A 3U4QA 3KT6A 4ZCRA 4KUHA 3H7AA 4L3WA 1EDZA 3LQ1A 3FUUA 5KSWB 2X6HA 4AYXA 3TWRA 1ACMA 2EZ8A 5EHZA 1Y3HA 2B6HA 3HS3A 1W52X 2NO7A 4OHZA 1A9ZA 3DUFA 3EEFA 4XX0A 3AF4A 3IHYA 1W4CA 1Z83A 2KYRA 2UZ1B 1WW8A 3BXPA 1ZU2A 1VI5A 3VDNB 2H8GA 3L8CA 2WG0A 1VHWA 4JVOA 4WNFA 1UK6A 3UHAA 2BV3A 5HDQA 3R9WA 3CR3A 3I9OA 3CRMA 4Y1EA 4Q19A 5BT8A 4G4SP 3S1SA 4KLCA 5CPFA 1TEHA 3GAAA 2BR5A 2W4IA 1NW7A 4M9QA 5BRNA 4QEDA 1N6KA 1YE8A 5KYTA 1RWBA 4X6UA 3MNFA 1O54A 1YZUA 3CEQA 3PNQA 3L6UA 4NZOA 1GPNA 2D2FA 4G1UC 5JATA 1Z68A 4G5YA 3KB1A 4HQDA 3I04A 2HHJA 4RL4A 3VAYA 4Q93A 1D03A 3MHTA 4YRAA 3DZBA 1CB7A 4PZAA 3HXDA 3ULQA 4URVR 3I3NA 5GP1A 2XUKA 4K2AA 3FUTA 1HG0A 2CLKB 2CVOA 3HWX1 2ZIXB 3O74A 1SCKA 1F51E 1SZDA 2PNJA 4KQJA 3UCXA 2WJ6A 3QF4B 3ZHEB 4B32A 1QIGA 4DCUA 4AN4A 3PSHA 4KGXA 1MV5A 1U8FO 3FNFA 4FX2A 4H7KA 3EVDA 4RAOA 1XB2A 3MW8A 3V8RA 1VFNA 4U8HA 2ZSJA 3IURA 3KLMX 4WKBA 1IHDA 4JA0A 1NR7A 4Q7KA 1XMSA 3P9NA 2A35A 2IJGX 3CHYA 4B47A 2COUA 3MJFA 5EZSA 4JR0A 2PQMA 1C0PA 2NQ8A 1AVTA 1GYPA 2IC5A 2VEOA 4ANUA 2R59A 1VHLA 3LXXA 4MUBA 2ZRFA 3H0KA 4C0WA 3EXG1 2NGRA 4BNGA 1U65A 3DD5A 3LCAA 1BDBA 3Q87B 4JOQA 4L0QA 4O02B 3VR4H 4BMDA 2YRFA 4DLRA 1B23P 3CZRA 4P4GA 1XHEA 5JS6A 1M2GA 1Z4IA 2PZFA 3CINA 4TLDA 4ZWNA 1HH8A 3PUYA 1XZIA 4UEJA 4KQ6A 2GX6A 4ATZD 1ARZA 4BGDA 2IOSA 1VL2A 4A8PA 1SVNA 2ANCA 4N7BA 2VNSA 3FCCA 3WB9A 3R6GA 1FPQA 2D06A 3IAM1 5IDVA 1HQDA 3VH2A 4E2ZA 5KNBD 2W2TA 2EW8A 4EZLA 1EXVA 3DKVA 4H3VA 3T8KA 1V8ZA 4K6HA 1Y6JA 2IPNA 3VKWA 4WKOA 3JU3A 2FPPA 2PLNA 4LVUA 4ZPXA 3L0CA 4N8EA 1W4LA 5FR2A 3UPVA 4JKYA 4E14A 1FSPA 3EA0A 4TLBA 1PJZA 3VU8A 4MUIA 3NCHA 1Z33A 4Q21A 1JTFA 4XWAA 1F9AA 3VSCA 5JU6A 5FH9A 2IUFA 3TQIA 3HCDA 3ONLA 3GA0A 4HY3A 4EI9A 3LDFA 2WV7A 2QY9A 2JCXA 5F77A 4Z0TA 4H9GA 4BNVA 4OLBA 2HA7A 2YXEA 2YY7A 4M89A 4PZPA 2I65A 1LLCA 5J1TB 3W7AA 1Q0ZA 1HLPA 5JLJA 2YQ8A 4LOAA 3A3PA 1K89A 2X1MA 3OU2A 5IH7A 3AUJB 4ON9A 5TXGA 4TWAA 5KEIA 3MA5A 4NIMA 1WXGA 4H7PA 2W8BB 2J30A 2QR5A 4F0JA 3BQNB 3OKCA 4U6NA 1JG1A 4R7ZA 2AW6A 2GRRB 5HKPA 1EDOA 2NZ8A 5BQFA 2O54A 1UP6A 1E4EB 4OHCA 5FIUA 2C3UA 1MEOA 3AEQA 3D3QA 5EWJB 1FS4A 3AQIA 3N5CA 3RRZA 5JCOC 4MIYA 5EDSA 4WAFA 1Z4QA 2IIVA 3W0LB 2GAAA 3L9TA 1PR4A 3AKDA 1G8GA 3GHYA 3AHHA 3TBKA 3QJ5A 4EW6A 3O4IA 2A3RA 5LXTF 1KZ1A 3TR5A 1EU1A 4KFSA 16PKA 3DFUA 1T1JA 4WXPA 1W9HA 4DZTA 5AVTA 1YDWA 2A88A 3SX4A 1YL5A 2PLRA 3E4CA 1DC4A 2JAPA 3C98A 2B1IA 1Z4LA 3IUQA 4QTTB 3R6WA 4J8SA 3NC1C 3RSOA 3LPCA 1GU1A 3KSRA 4D0NA 3SJZA 4NOLA 2IEBA 4QXOA 4RBNA 4X62B 4IGAA 3ZJ4A 1OZ0A 3KJHA 1SK9A 4FA6A 2ZYDA 4JELA 3LY7A 1UQRA 5DEIA 1NP7A 2NX2A 1S4MA 4MYUA 3VBCA 1F6DA 1YJAA 2BGUA 3TL3A 1OWOA 4RKEA 2OYCA 3UT5B 3WRXC 3WQBA 4KQ1A 4PYLA 4YJGB 1NXXA 1HA3A 2H1FA 3L5OA 5COBA 1DG9A 4TLAA 3TQFA 1G55A 1WDKA 4U5QA 2XUOA 4MUKA 1NOKA 5LOVF 4BSXA 2X5JO 1ADGA 1ESCA 1ZRMA 1EXMA 3BCSA 2ZYUX 4G07A 4W9NA 1P45A 1XEXA 4MXDA 4OJYA 1EK5A 2IDJA 1A8PA 3EJNA 1BCRA 2NVBA 3LLMA 3VNVA 1QF7A 3B1FA 4UCXA 3BWXA 3K15A 1TZKA 3NRBA 3RGGA 1MNQA 2XUGA 5HIAA 2JGIA 1KIFA 1PSZA 3HKCA 2O7QA 4B4OA 3RNLA 1LD8A 5KB3A 1ZAKA 3ACCA 4WVLA 1WWKA 3WJ7A 4EECA 2Q3LA 2C4HA 3LWNA 1XDSA 2VCEA 4P1ZA 3EC2A 1DTWA 1W88A 1JCRA 1JR3A 4M1KA 3S2EA 3W6ZA 4YA6A 3ZY5A 2BSXA 2G4VA 3GROA 4I9GA 4F12A 3QVKA 3V4LA 3HSKA 4U9IS 2PJZA 4G2VA 3GAZA 1KI7A 4YRDA 1YRQA 2XXJA 4N3NA 1RR6A 1RZUA 1X1AA 2IUUA 1U90A 2PVPA 5EC8A 2JDIA 5LQCA 1Q95A 3ZGQA 4ZFHA 2AMVA 5E3HA 2MHCA 1Z2AA 1UWCA 2A33A 1ZK2A 4IIBA 3NVKI 2WXKA 2D0PB 4MLDA 1CWUA 3ZI4A 2DBAA 2X22A 1ZOOA 3PFBA 4FJ1A 4CFZA 3T1TA 5IWAB 4COKA 5AKGA 3IQFA 2A5LA 4TV9A 4UCQA 3O91A 3PUZA 5C4IA 3ZBUA 1I51A 1XWIA 3T5XA 1D5WA 1K97A 1YL7A 4AY4A 2CVPA 2ECFA 2FW0A 1L7MA 1S63A 2GOYA 2XXBA 3BL6A 1ZNWA 3K6KA 3KKKA 5E75A 3X43A 4LZAA 5LYJF 2FMTA 2ETXA 2A67A 2ZVQX 4MR8B 2J67A 5TPWB 5KQLA 4UUPA 4X91A 4MIEA 5DYIA 3GT7A 3PXCX 3CT4A 4MUNA 1RIFA 1Z17A 2NUTA 4AZ3B 2ZB4A 1NI4B 4Y8VA 1JA1A 4YT8A 3BD6A 1H3EA 1GPBA 3F67A 4NDNE 1MJ0A 3PRZA 1PS9A 1L7OA 1WF3A 1TM4E 1EP3B 2AC2A 2ZAYA 3CVJA 4HWKA 4RG6A 1XROA 3GFOA 4KWIA 5CA1F 1LNQA 3OFJA 3RWBA 1GL6A 3DTVD 4O1OA 3FDIA 2QPOA 2BGNA 4L5BA 3DKRA 4MX8A 4S0ZA 4BVGA 4LWZA 2V9CA 5DGDA 5MN6A 1JHPA 4NCIA 3V8PA 3KR0A 3DW3X 3R8CA 4D3FA 4GPD1 2EW2A 3BTVA 1W36C 4TTQA 2XRZA 1IDOA 1IPEA 2SNIE 5FQ7A 3FMPB 4MRNA 2JPDA 3THSA 4HV4A 3KQKA 3SVZA 2P2CP 5AVJA 1DFHA 4EO9A 3JALB 3SXUA 3LK6A 2JKYA 3OKPA 3BAZA 3D9NA 1JEJA 3MWEA 3RSZA 5FA5A 2XVMA 5H7XA 2GBFA 2JIBA 4OK5A 3M34A 4TQUS 3RC3A 3U3KA 4Q3DA 4DMRA 3E5NA 1BI7B 3GIDA 2ZE8A 5LBIA 3KYJB 3IUMA 2W6QA 1OX5A 4P7JA 4Y1RA 1QE5A 1TVKA 1EHYA 1RXSA 2B8NA 2B37A 2JKVA 4JLAA 2W83A 2XQ0A 2HSWA 1Y8AA 5ECGC 1ZYUA 1CCWA 1NVXQ 2BHRA 5HGXA 3NI2A 4W1PA 2I2OA 4I19A 2ZBGA 3LBFA 4HLLA 1A4RA 3ZGVA 4EY4A 4KTVE 3WP1B 1T43A 1GVHA 2I3AA 3RS2A 2WILA 4DMHA 1I2CA 5TMDA 3C4QA 4L7TA 3HXCA 1YQEA 4MS6A 3GXOA 3NHYA 3P20A 3W3AA 4AWBA 3AVWA 1UT5A 5LWQA 2BEJA 3H2JA 4IKOA 3KTAB 2J4BA 2JH9A 5FWQA 3MAJA 3ROQA 4L4UA 1B76A 1BZYA 3ETGA 3AY6A 4F2DA 4KRFA 1Q7TA 4C7OB 1EK6A 1A9QA 2OCYC 3GCXA 1IHBA 2H4JA 3DBHA 4P3YA 4GFDA 3RODA 1C1DB 1YL6A 2QVZX 3P0EA 1IJBA 2PL1A 3PZ2A 1NLFA 3ES9A 4REQB 1V8PA 1Z6TA 2RH5A 2Z4SA 2HI0A 1Z7EA 4UTZA 1E1NA 4POAA 4IQ8A 2W2QA 3QG5A 4GE3A 1B0AA 1NFQA 4RPIA 5H80A 1SVKA 1RMQA 4P29A 3NKVA 2O1SA 3QE9Y 1EUYA 2JI7A 3VYVA 2C5BA 1CR6A 3NBZC 3OCYA 3X1KA 2Z83A 3X0DA 4B5KA 2Q5QA 2Z8XA 4PIPA 4PGMA 1W4BA 3MYVA 5HMLA 4KLAA 4ROSA 4CEHB 3K4HA 1K4KA 2AG1A 4MWZA 1XTRA 2I6QA 4JJ8A 1GPYA 4LJ7A 3SDZA 4DR2B 5ENDA 3CBQA 3WR5A 4MQBA 4MRRA 4UHJA 4L3VA 1C4KA 1QRRA 1X87A 3QFFA 4MUEA 4OAQA 3A4NA 4QYIA 4KOEC 4BATA 2LTAA 4RQUA 2P79A 4PFJA 3RS3A 2LKDA 4CIWA 3T7SA 1XTTA 5CLFA 1W19A 3KUXA 3FEYA 2JFPA 3TUZC 3BTOA 3VJLA 3REQB 4BAGA 1XZJA 2P69A 4JI8B 2C1EA 5JMTA 1VPTA 1N1DA 1NVFA 1DXYA 2F1KA 3KQSA 3L79A 2Y6UA 3V5NA 3PFNA 3A9TA 4DI4A 1JG3A 1RC1A 2EIKE 2PX2A 2WJGA 1TQ6A 3LUKA 2I54A 3NTUA 4ANXA 1RXEA 3HJTA 2B9EA 1KO1A 2R62A 1MPTA 4IKPA 5FXMA 4C78A 3RYIB 3O9ZA 3P1UA 7REQA 3ZGOA 3OX4A 3AUUA 5CX1B 3I01M 4EBAA 1HKHA 3M6AA 1EA7A 1WV1A 4RWZA 5HZMA 4JENA 1NURA 4YQYA 4G8DA 4XZ4A 4X6XA 4YMLA 3IP9A 4PX9A 4IXMA 2G4LA 1E8WA 3C5HA 4FONA 3VU9B 4LJSA 3WBKA 1G8HA 2YQZA 3PGMA 4IV5A 4B7ZA 3EGWA 2EWMA 4NL4H 4DI3A 1WMAA 2GN4A 4DDMA 2CSXA 5DHFA 3MF4A 5GADl 4CHGA 3ZHOA 1SZPA 1P1BA 1DC3A 3QOUA 2WICA 3OT1B 4EW1A 1ABBA 3AR6A 3KZKA 2W2PA 5JXGA 2A5YB 1DB3A 3KC2A 4UJ3A 4V1CA 4KUGA 4DCPA 4P7KA 1DO8A 1TMKA 3H6KA 2XITA 1E1KA 4QDTA 2B7BA 3ANLA 1NSYA 3G2PA 4F8YA 3U1VA 3LC7O 3U37A 1DO0A 1FVOA 3KT0A 4OIFA 4X66B 1N3YA 2M9MA 2Q21A 4NNOA 4ZTBA 2HMYB 3TQSA 3OE1A 3VHLB 3IR5A 3RVLA 3EEIA 5IN5A 1ZC3A 2LAHA 3AU5A 3DO6A 2CHGA 4FQ5A 3WYBA 4KFCA 2Q3JA 4B73A 3GPIA 4S12A 3RPEA 3ZDRA 2BKEA 1RPJA 3EIWA 4F93B 1GKIA 2OORA 2KC7A 1P4GA 4G89A 4OQLA 3B36A 1CJUC 1U3VA 1G5QA 1VSQA 1XDWA 3FYTA 1OWLA 1XZ8A 3KUUA 3GEBA 4E07A 3IE1A 4J29A 1KY5A 1CFJA 5E6RB 3H1TA 5TQ0B 4O6FA 3K5IA 1GL9B 4LRQA 3QX9A 4OB6A 3VR6A 1BSVA 1YB6A 1DVRA 1GG5A 1W4RA 4FBGA 4E0BA 1V37A 2R8PA 3Q7PA 3RVBA 4F6RB 3B8EA 3PX3A 4MGKR 4D42A 4XD7A 2LCQA 4DBZA 5BN4A 1C8VB 1A1SA 1CY6A 2W6ID 4IBOA 4NJEB 3D9LA 1KFBB 2XOEA 3ONDA 3L0PA 4DSTA 1GV0A 3I4GA 5A5VA 2G71A 2X86A 4BNKA 5JHHB 4B4KA 4YMTA 2QL9A 4F7WA 1ABFA 2P9JA 3DYVA 4B6PA 4R68A 2BDEA 3AR7A 3KCNA 4Z9XA 3M4NA 2OQ2A 3OSZA 4RD2A 4XJXA 3UOGA 4G63A 5JVDA 2PLFA 3TSCA 3CRW1 3QPWA 2CHEA 3CGWA 2CNDA 1TVKB 4LSZA 2QGZA 2X42A 4EYEA 3VLEA 3R77A 5IM4A 2JBWA 3B7UX 1ADCA 3LUAA 3OCZA 3MT0A 1DCEA 3JYNA 1J90A 3IAS6 3PVCA 4UVDA 3ZY6A 1C3OB 6YASA 1KBZA 1UAGA 4OIMA 3OPYI 1WCWA 3DSTA 3MKQA 2HA2A 2GMWA 3ENEA 2H7CA 4DJTA 1JB9A 1WKBA 3CEAA 3R3UA 1TAGA 1QDEA 3HWSA 4DEVA 5FL7A 4DLXA 4EB6B 1DEKA 4CLDA 2HAEA 4MHOA 2ZJ8A 2I5PO 4FNOA 3SZUA 3NXKA 4UI9C 1QYDA 1K98A 1CZKA 4GWGA 5H83A 3VZPA 1DQPA 4Y2UA 4CM7A 2VHTA 4ODIA 2BRUC 1MZPA 1LD3A 1RCTE 1T4MA 1PG5A 4TQGA 2OXTA 3SEQA 3VPGA 1A4UA 1SHZA 1RQNA 4QG3A 2WTNA 2I29A 3LLVA 4AK9A 4Q05A 3VR1A 4KYIB 5E1DA 1J2RA 3TECE 1HG2A 2HBRA 1RM3A 5F1YA 2D1SA 1JEDA 4CM4B 1GRCA 1NI4A 5CD1A 3GRFA 1X8KA 1INLA 2DH5A 3PNLB 1ZXBA 1Q44A 3ASDA 4NI5A 3D7NA 2D3WA 1VQ1A 2GBCA 2VPQA 4KAJA 4YCDA 4DRXE 1XAHA 2QYHA 4CZ2A 5AW1A 1HFEL 1YJ5A 4G4SO 4JL6A 4P3XA 1AE1A 1YQDA 1NAHA 3NHRA 1HNZB 1G42A 5NULA 3ZV3A 2J0UA 4NKRA 4ZKDA 1RYEA 4PYMA 3NBXX 3MG9A 1V5IA 2SKEA 4R1LA 3VOSA 3CUEF 1FFBA 1U7ZA 1FFDA 3FFTA 3NKLA 4IG9A 4ME6A 3B1KA 3NHWA 4RULA 1KAQA 2Y99A 5BORA 4X3CA 1KMHB 3FYUA 4HS9A 2EIME 1RE0A 2P2GA 4QASA 4BO1A 2ARKA 3VDQA 1N9ZA 1OBOA 1OLOA 2G04A 3NFYA 3TG8A 1TGVA 4LJRA 2FOLA 2X1VA 3DOOA 4NQZA 4B6FA 1QH1B 2A57A 1N6IA 3ZD6A 1I4EB 2LBPA 4CKWB 4JP2A 5I9NA 2YNQA 1WDYA 4YFYA 4O63O 1E3DA 4Q94A 2V5AA 4B6OA 5EIXA 1E5DA 1YKGA 4GWLA 1QTQA 4EVIA 3QELA 5B4VA 5KTSA 4U7DA 2WYWA 1I10A 3TW0A 3U39A 1J6UA 1KO8A 3RHSA 1XA3A 1UBHS 4C4RA 2XDAA 2WIGA 2J41A 3JR7A 4JKIA 2Q41A 2QMUA 4X8LA 4XVRA 5T3UA 4C6SA 4CTOA 5LN1A 4FHZA 5KYXA 1H2BA 2XEHA 1AZWA 2AI3A 4HI9A 4CDNA 4U96D 2ZS8A 4EHNA 1VSBA 2XUAA 5JAOA 3SQWA 3PTZA 3L4EA 3MILA 3O9MA 3PR2B 5D3MB 5F1PA 2XSZD 3MFQA 4ZCMA 3NEYA 1URPA 4CKXA 9GPBA 1EFRD 5JE8A 5LWHA 2PYZA 4JQYA 1ZJ6A 2H11A 2NM0A 2V7UA 3FKQA 1LBTA 4A16A 5I7HA 5KYWB 4GPTA 4LF5B 2NXJA 4YDRA 2A4MA 1H2FA 2J59A 4KVGA 4ZVUA 2GEJA 3L8ZA 3RIXA 3RAUA 2AFIB 3GPBA 3PFCA 4R7LA 4E5VA 2PRSA 2R2GA 4I1SA 3R9MA 5GONF 1QO9A 4ARSA 1PJLA 1XLUA 3B12A 3UT8A 2Y9MB 3TBHA 3C3PA 3MWDB 4D8WA 4ZEVA 3S2AA 2XEVA 1SKBA 1S0UA 4PLHA 4I81A 5HUJA 5D51S 1FSZA 3CSTA 1A2QA 4R3NA 5T4FA 2M1XA 4DNOA 2WLTA 2HKIA 2QMOA 4MW2A 3HDVA 2J6IA 3CW9A 3GH3A 4BZXA 5KX5F 4D92A 4H60A 4ZXPA 3VPXA 1QQBA 5FNVF 2DTDA 4XIGS 1U0SY 5A3SA 3FUKA 3OEYA 1X19A 3M6LA 2AZ4A 3DD1A 4L8YA 3UJ7A 1SBNE 4ZT4A 3BXXA 4EPWA 1P9LA 4X5OA 2AXQA 2FSVC 2VYNA 3R7NA 2WHXA 2ECQA 1XGWA 2DQKA 4W6QA 3FEXA 5T8IA 3IHWA 1GTL1 1A69A 4JT4A 3WHIA 1Z63A 4Z1MD 5EZQA 3L1VA 2HUPA 3V7FA 3G02A 4ZIRA 4LRXA 2O2CA 4JJ4A 3SC4A 4HI8A 3RU9A 1SKAA 1C30A 3R1IA 3FVRA 3PJRA 3N2EA 1RVDA 2Z8YA 3EBPA 3LI2A 4J03A 2H16A 5A3JA 3CNOA 3C4VA 2NTEA 3LBHA 2NZVG 4RY8A 4DJFC 1OI4A 2H2DA 2QRZA 3TPFA 4RSMA 3VNUA 4TVKA 2VF4X 1PVVA 3JVEA 5B1IA 3HDTA 4LBYA 4DLPA 3A8TA 4P98A 3GFQA 3HEAA 4Y2PA 2I1JA 2X5XA 4M76B 2VH2A 4QTXA 3TSAA 2PX0A 5CIYA 3L4KA 1WHTB 2KX7A 3H9EO 5CFQA 4G5XA 4U0ZA 1H2ZA 4NEQA 1X7ZA 1RRKA 3SBEA 4XPIB 5CNJA 1EXWA 1NR5A 1Z2OX 2XJ9A 3E3LA 4XOUA 2P27A 1OE0A 3RLFA 1PTJC 1QANA 1WF6A 1H2WA 2Z6QA 3K9IA 1I4TD 1N9GA 1T36B 2ZTVA 1PT7A 3BRCA 4DCOA 1GNVA 1Q2UA 2GCIA 5J2TB 1M2EA 4MW5A 2JCBA 1JUDA 3QK0A 3DPUA 2Y1FA 4O5OA 4CLOA 1RM4A 3WMXA 1GM5A 4AY2A 4D4GA 1S3FA 3HR4A 1H2YA 5AFSA 3FGNA 4QTUB 3OLZA 3OMWA 3HCCA 4FU0A 2VGXA 3X1DA 2JFYA 2PGNA 3ZE9A 2B1RA 2ODPA 3SM3A 1U7WA 1DDGA 4AJ4A 4UTPA 2JLYA 2P9HA 1TF2A 1U7TA 2AEEA 2FPPB 1YR1A 4GGOA 5CW2A 4J1TC 4BJHB 4LYHA 3VUEA 1UKBA 2V1XA 5B1AE 3U40A 2ZYGA 3LK7A 4CM3A 2H06A 4RTJA 3QEAZ 1JFTA 1RJGA 4HATA 3ZWAA 3CO5A 5CG2A 4F3KA 2H4HA 3GO4A 5EG5A 1P61B 1JNYA 4YECA 5FWNA 2W2MA 3T7DA 1SBCA 4J8DA 4LTDA 1U0BB 3RSHA 5J4HA 5B7PA 1A3CA 3Q0TA 1RAAA 4INOA 4OFWA 1DAOA 1T4GA 4N8SA 5EN5D 3V1LA 1YVDA 2Z3WA 1KDOA 2ZCUA 2ZUUA 2BD0A 4UM7A 5HF5A 5IBCA 1X0XA 5JYEA 3LDAA 3HFSA 3ROMA 2G9QA 1E3MA 3PWKA 2BKUA 2PY6A 2BP7B 1CVRA 2VKQA 1V1MB 3AEKA 1ES9A 3DWIA 1M3SA 2IDMA 3CYFA 4DANA 2IIPA 3JWEA 5K6RA 1ABEA 1QFYA 2YJ6A 3MWKA 4E31A 4R71A 1UK8A 1CFZA 3GJZA 1B6GA 3ZI7A 1L3IA 2EIHA 3ICPA 4RCZA 1JT9A 3QB2A 5TVKA 3VNQA 2BEVA 2HMAA 3DR3A 3K4QA 4PYQA 5EP2A 3QLTA 1JUQA 4M54A 1T24A 1NULA 4C3ZA 5KSYA 2R8ZA 2AOUB 3WAGA 5BW6B 2H1LA 1FP1D 2BJHA 4JQOA 3RU7A 2XIJA 1K5HA 1KZ4A 2EDCA 2ZANA 3LGXA 4RY0A 1TR4A 1SQFA 1WMSA 1TCCA 5ILGA 5FT9A 4E4TA 1BVYF 4PC7A 1NQWA 1T4CA 2AG6A 1D2RA 1NMXA 2OY0A 4B33A 3ZQ4A 1GPJA 1LDBA 1SFRA 4DUIA 1AC5A 4D9KA 3AFMA 3BWVA 2C5FA 4HX9A 3GJ8A 2FGKA 5EA2A 2X3MA 3CN9A 1K3FA 1YCHA 2JKZA 3AYZB 1E89A 4PO1A 1W4AA 3AB3A 1AKQA 4GOLD 4A5SA 4KQMA 4OHUA 1II9A 1FFXA 1TOAA 1QHIA 2VPZA 2ETVA 4TRJA 5CH5A 4AKEA 2DH6A 3TX6A 1OQAA 5DNVA 2YWCA 3U4CA 1WXHA 2OAEA 2YXPX 3ER6A 1D2EA 1JILA 1CJSA 3M33A 4Q00A 4X1IA 5ALPA 4EHAA 2X0RA 4F1KA 3ASZA 2PMCA 1JKIA 5LYYA 4INZA 5HZHA 5TS3A 1CLUA 3SNHA 3QC1A 3CZ5A 3VC2A 2OECA 2A0FA 1J8QA 4G2NA 4IXDA 1KQ3A 5DMXA 4BWFB 2VSOE 3KAPA 4XE5A 5TB5A 4CLHA 3BILA 4X54A 4NE9A 5ALMA 3ZXIA 1EYZA 3D1VA 3C24A 2AGVA 1V71A 3TNLA 5COQA 2RJOA 1FRVA 2ADOA 2BZSA 4CE6A 1D1TA 3ZK7A 4RA9B 1ZH6A 3BIJA 2O07A 2HF9A 4W5HA 4LYYA 3UHPA 4FTWA 4EHLA 5DDIP 2ATVA 5J5CA 1BFUA 1B43A 2J9QA 4IGKA 2Q7OE 3B2QA 1K92A 1SXIA 3Q4AB 4OMCA 2P41A 4EABA 1KRWA 1NOIA 1AUPA 1XR3A 4FWBA 4J3FA 3OQMA 4A2CA 3ZCPA 4JYZA 3I73A 5IF3A 2XQVA 4IHJB 4HEHA 2VHQA 1U7PA 2IXFA 2IOFA 3EG5A 3GRCA 1UPBA 2W8ZA 1OC2A 3BXGA 2FMHA 4IVRA 2JH8A 2NNLD 3MWFA 1UDCA 3NYQA 4L9SA 4QGAA 5AXBA 2W4QA 5I01A 2BEWA 3PKJA 4EI2A 1CZHA 4FR0A 4IP0A 4QOFA 4BNXA 1U81A 2NN3C 2G28A 3CEJA 1MN6A 3EPJA 1NJFA 1BJKA 2FPMA 2RAUA 4K8OA 2EJTA 5E9WA 4CFSA 3PDIA 4NATA 2DHQA 4P6VF 5E2AA 4EHFA 3K70B 1TQ4A 2HCTA 4RKFA 3X2EA 2CNWD 3L6CA 1VCMA 1VJTA 4DG9A 1N4PA 621PA 2AJAA 1KFEB 2IW1A 2PGIA 2DZNA 3A28A 2CMGA 2IQIA 2VJCA 3E7FA 3OP1A 3VHQA 2WVIA 3HVRA 3PTAA 4OYRA 2QTWB 3HPQA 3I12A 1Y8RB 3HBFA 3M8KA 3NTOA 4H16A 2JGDB 3I9KA 1P5QA 3PFWO 2JI8A 3LKBA 4RD4A 3ZU6A 3IX7A 1DFGA 4BQEA 3ZY3A 5CEJA 1JEOA 3E1KA 4M1TA 2VSXA 2MSNA 2Y0EA 3AM5A 2H4FA 3QWIA 3TGOA 2OLKA 3D81A 3QLEA 2BGLA 3TXXA 1C1XA 3CSUA 1NVGA 1ZNQO 3Q2KA 1U2EA 4KR0A 1PZXA 1NX9A 3NHPA 5IXYA 2IZ7A 3KG2A 3PHHA 2FJUA 1U8XX 5JY1A 3NWJA 4LRTB 3CA8A 3IIJA 1JIJA 4LJLA 1E3LA 4HYQA 1GTVA 2JA1A 2K2WA 3EH2A 3JQ8B 1Y98A 1N7GA 4G1MB 4IR7A 3V8QA 3L4JA 2EXXA 1IOWA 5BRJA 1BC5A 3DYIA 1M6VB 3VTZA 1L6RA 4I5GA 1QXSA 5B36A 3GPDG 3L0OA 5ESDA 4ZOCA 3KD7A 2FZEA 2VCHA 2D3TA 1E18A 3A04A 3BOSA 3QJYA 4QG7A 3S4YA 2H92A 3AUYA 3RSCA 2E4YA 3VJRA 2BBSA 2BDTA 2BONA 2O7RA 2IZ0A 3C6BA 5IBRA 4ARVA 1Y4UA 4FCVA 3UMYA 5BP7A 5E4FA 5GVSA 2IKQA 1T1SA 3C87A 3DCIA 4RF2A 3G7SA 2EC5A 2HL6A 2QVXX 2WTAA 3KU4A 1HDEA 2IYZA 2QSUA 3GR6A 3PI7A 1NQVA 4H6WA 1B8NA 4HBZA 4YWHA 4RSRA 3SSMA 4A6XA 4ZOLB 4JEUA 1A7UA 3AHGA 3DOFA 3FTDA 1JJBA 3JQCA 2FPUA 1EVEA 2HJHA 1E5XA 2VPYA 1HZ4A 1YRWA 1UJKA 1A9RA 4MIKA 4LJ9A 3ZBPA 4W5QA 1YRYE 1OFUX 2VRWA 2UZ1A 1VKJA 4NYJR 4XDHA 3L0DA 3P7MA 3B6MA 4CM5A 4DIOA 4PGAA 3KEQA 4K46A 2YJTD 4XQGA 2JHGA 3W7VA 5CCEA 1KAMA 3EWSA 5HOQA 4I1OB 3BRQA 1OSNA 1U7XA 1ULZA 2G09A 1SOVA 3EULA 1DS6A 3EZ9A 1TRKA 4LY6A 5K01A 3A2NA 2JLXA 1L7BA 1UBCA 2SCUA 2PJUA 3CV3A 2RB5A 1AGPA 3HSYA 4PBTA 3QA3E 2OD7A 4LDRA 3HJHA 1NI3A 3CHOA 5CEDB 1ZX1A 4WNIA 1GPMA 3BWEA 2ZSEA 4MMXB 4JHKA 3KHUA 4HSGA 2GW1A 2Q07A 4HDNB 5IYZA 4FDTA 1P74A 3JQAD 1ONBA 2UV8A 3Q3GE 4GVPA 4MW6A 3SU8A 1QG0A 4UBJA 2R751 3IA7A 1TNYA 5GY7A 4QDKA 4OBBA 2YL2A 1ZCFA 1YDMA 4MJXA 3UMRA 4B3HA 3DAYA 2J4CA 2ZJYA 1E4OA 1EMDA 4FFSA 3H3JA 4KACA 3ZQJA 4DA4A 3LHDA 4AMVA 3I8XA 2V6FA 1IJEA 3A6LA 3P4XA 5JANA 3MJ4A 3I2YX 5BXOA 3BULA 3II6X 4JIGA 2E1PA 3RVSA 4WZ6A 1FLNA 3ORRA 4ZO6A 3TJMA 5KJ1A 1NNEA 1N0RA 1Y4ZA 4G0YA 3AG6A 3HWRA 3COJA 2QP4A 3MKQB 1PFUA 2GCGA 3OOYA 3DZFA 4RHTA 1SVOA 4UJ5A 1G5PA 4HMOA 5I7VA 1U9IA 3R3VA 3REFA 5K2MA 4MHSA 3GA7A 1XQ1A 1HV8A 3N0VA 3UIEA 3HCNA 2VHUA 4AKIA 3L4SO 5KWIA 2AJLI 4JP8A 1ZU5A 3KSLA 1IN6A 1I30A 4LDZA 4YUVA 2QPLA 3MLAA 1T3HA 4JR1A 1B6RA 2AOXA 1YI1A 1X7YA 3L1JA 5DASA 2NSZA 3EZFA 1FYWA 2BIFA 3BL5A 3MEKA 4ZV9A 1FDOA 2JCGA 3MD0A 1B4DA 3ONVA 4L7VA 3K1TA 4AM9A 5AN8A 1TK3A 3AY7A 3D6TB 1NLYA 1Z7GA 2HBYA 2BT4A 2QYJA 3R3ZA 4CMEA 4KO8A 4QNRA 3EEOA 4D3XA 1KZGB 3L8FA 4MQFA 1HYQA 1XQXA 1ZIXA 3DQZA 2AOUA 1U94A 2OGWA 3RBVA 5CRVA 5K8UA 1DAGA 1MBZA 3DDWA 4OXXA 4TS1A 5ANRB 1OZAA 2GZRA 1IXSB 3DE5X 3R5KA 1AMUA 2IYXA 1NL3A 3OPNA 2D5LA 1ESEA 3CPSA 1WDWB 1DXHA 3DVAB 4P3PA 1VJRA 4KXMA 4ZA2A 2IXBA 4BFWA 4EELA 1N8TA 4JBWA 5AVRA 1CJCA 1BIFA 5HKOA 1XAGA 1R16A 1UFKA 2QD4A 5AH0A 4NCBA 4UU8A 3EXHC 3EOBI 4B81A 2BUGA 2BZ1A 1GKKA 4IAOA 2O7VA 1R8YA 5EXSA 2HRQA 1P44A 2QZJA 3WGHA 1OLXA 2X5KO 2Y68A 3BEOA 1JBEA 4LI0A 4UBNA 4ZALA 3CE9A 3DWFA 4GVXA 1HGXA 5KYVA 1R4NA 5B12A 1AQJA 4DCMA 2VZ9A 1OAOC 3DTTA 4AUKA 1JHXA 4HPXB 2JBHA 1Z8HA 2VP3A 2XYHA 3UUXA 4D8XA 1Y4DE 2V5FA 3ISTA 5FP0A 4DTIA 4JSYA 4X8MA 4RZHA 3RKRA 4CT5A 1R88A 1VDYA 2XH8A 3RK0A 3G2VA 4J0JA 1VCHA 4R1QA 2GPSA 1B16A 1FRNA 2FSFA 1ZH4A 3DCJA 4D5EA 1T5LA 1HF8A 3GVIA 3IDSA 4P86A 3HB9A 3Q9UA 2A30A 4II7A 4M2LA 3PUXA 3R7DA 3V9PA 2Z3VA 5FEUA 1Z08A 5GIPE 2F4VB 1KPHA 1I7NA 1NY5A 1BCSB 4EF4A 5JV5A 1VJ0A 1BKYA 3V34A 2P3LA 3HBNA 2ZDQA 2AK2A 4C07A 2IE8A 1JJIA 4L0DA 3L16A 1HORA 2JGRA 1G66A 4URKA 2Q3EA 3D59A 3GAMA 1ULBA 3Q7IA 2P9PG 3MC1A 4PSKA 1PUXA 1EINA 4MIOA 2GHIA 5D84A 2IXAA 5EUBA 4DRZA 3BZBA 3LHSA 3RT7A 3RUDA 3K0EA 2IUYA 4GX0A 3BIXA 1PJCA 2Z09A 3JQRA 1ZWKA 3PQ2A 3R3WA 2OEWA 4LYJA 5CFLA 4PAWA 2ATCA 1K3ZD 2JLQA 2FI1A 4GOND 1JQDA 2FUEA 2PH7A 3NRJA 5B3JC 1K6XA 4ZKEA 4G85A 5WRFA 3WOVA 1JXQA 3KQWA 2PX3A 3R9IA 1TEZA 2QZPA 3ZUVB 3ICCA 4TLEA 2V3VA 3TTWA 1BX1A 1ZMTA 1GAWA 4JPSA 2AE2A 5IJAA 2P2ZA 5TX7A 2N75A 4CIXA 1WD7A 4J75A 1BCRB 3VJKA 3BPSA 3BUAA 1GPDG 1Z6AA 2GRAA 3H5OA 3IS3A 5SZIA 4P08A 3ZNQA 5F7XA 1NLMA 2QQFA 2B92A 1P6XA 1YUMA 4IF4A 5DPMA 1YZLA 5I4BA 4A15A 2QPTA 4FGSA 2D5IA 2IYVA 3K9NA 2RARA 1AV7A 4FXPA 2XBUA 1TU3A 3AG5A 3CUVA 4PZEA 2WY2D 4DL9A 3SNXA 2O8EA 1DC6A 5ECDA 4L0MA 2ISQA 1KI9A 3CJQA 3HYCA 2QAGB 4FHJA 1XLTC 1CUVA 1FVXA 2FOIA 1K6MA 1M8PA 2C42A 4NR0A 4OH7A 2I6HA 2G36A 3OFNA 3D6FA 3ESLA 1LFDB 2BTQB 2HDNB 2PGLA 2QRLA 1T9CA 2HFKA 4IUCS 2NZYA 3JWPA 4OQDA 2FW1A 1XLWA 2GPNA 4D6YA 1BWRA 2QVBA 1ORDA 5IJ9B 1KMHA 2IEGA 3FYUB 4ZEMA 1DUSA 1P3JA 1MB9A 5ECWA 4LYFA 1M2FA 4FMCF 4B0PA 2Q2VA 2IU3A 1UCFA 4R9NA 4ZYTA 4IDPA 1ZIDA 5EHGA 3ZXXA 1N8NA 2HIGA 4YCMA 1PR0A 2PUAA 2NSDA 4L7QA 3NEPX 4GNKA 2GEFA 2XZTA 3QKTA 4BLPA 5JAUA 4B6SA 4DLOA 2JK0A 1W47A 2EJUA 4TRRA 4YXFA 1MFZA 2CLLB 4BQQA 5H9WA 1WSBA 3E15A 4AJPA 1W5AA 1QIDA 4G8LA 4WERA 2DB3A 4PONA 4CIVA 2ZSBA 2PLAA 1KEWA 2QC9A 4AP2A 3B8HA 3B7BA 1HH4A 3C15C 4LHSA 4U6SA 2XXAB 4JVSA 3A1CA 3O2NA 3PD0A 4JP3A 4UU7A 5FD8A 1GR1A 4OBEA 1XYVA 2CJFA 1JRLA 4FMBB 5C5IA 1JU3A 3EFOA 5EY5B 3FETA 1PE0A 5F21A 3TLXA 2XE4A 3L1IA 4DQXA 1BDHA 3ER8A 2WB2A 4KODA 2OCLA 1HKUA 2B61A 1O97D 1HE8B 2VWQA 3B60A 1BX0A 5TT0A 1CR4A 1JAXA 1OAOA 2GEUA 2OGZA 5EIAA 5KNHD 2PS1A 2CN1A 4MAAA 4P8RA 4FLMA 4PLVA 5FI3A 2VBGA 1L7QA 1W96A 1UDXA 2ZU6B 1RXIA 4BRZA 3LCUA 5SV2A 1UKZA 3KV3O 5AW5A 4QYSA 1GD1O 3RRBA 1JPJA 1NONA 2QBYB 2YXNA 1TNDA 4P81A 5CLHA 2B30A 1QO0A 2XDQB 1V2HE 1KK0A 3WG7E 1ULUA 2E21A 2IFUA 5DF1A 3GZ2A 3GLFB 2CB9A 3M6IA 4IH1A 3UPDA 3CO0S 5A4FS 2PKQO 2VYND 4HRVA 1HE5A 3HBLA 3LT1A 3QI2A 2KSQA 3L0SA 5J4LA 1JU9A 1YACA 2RC6A 2YWBA 3G2NA 4FJZA 1D09A 4JA2A 4WLUA 4EITA 5BW5A 2QRPA 5DLQC 2BFOA 1QLWA 4BO3A 3QNWA 3JCKC 1C7JA 5DSZA 1BE1A 3E27A 4AZVA 1QIJA 1RLJA 4BECA 4J4TA 1R9GA 5FBKA 2Y4NA 2P2YA 4RZXA 3Q49B 1NBIA 5KQGA 5I7SA 1RJFA 4BBAA 4NG4A 3MBOA 3GGJA 3BMCA 2ZQZA 1G4HA 1VM6A 2NV6A 4MRMA 3IXLA 4RS4A 1GUBA 3JAWA 1PNTA 3TEMA 1W6UA 2V4HC 1MF7A 2QVCA 1MFPA 3FP3A 3HDQA 2PJDA 4EKIA 2OC9A 2C7QA 4E5YA 1SCUA 4KIFA 1AGYA 4GPBA 4L27A 5GQSA 4AROA 4U9UA 5FBRB 1GJRA 2ET6A 4XWTA 1HE3A 3BJRA 5B1EA 2P5TB 4LXUA 2BH2A 1ETUA 5G4KA 2A7QA 3RS8A 4ABNA 1N2GA 2G06A 1YZQA 3CNNA 1X7ZB 2LXMA 5IW8A 3D02A 3UM3A 4F84A 5FO0A 3UTCA 3HUEA 4NQ0A 5HF8A 2BGRA 3KOMA 1JLKA 1IY1A 4XTRA 4CN8A 5KC8A 2HZBA 3ABIA 2ZUBA 1OW3B 2H3EA 2N42A 4GRIA 3MA0A 1BQ4A 1TT7A 4LXYA 4BLRA 3GJRA 1M34E 1ESNA 2P6NA 2YR0A 4AWAA 4BKOA 2FKNA 4RLFA 4G0MA 2OO5C 2OEVA 4ZCLA 3TIXB 5JS8A 1T3SA 2IH5A 2AMJA 2GZDA 2PMFA 2IBSA 3OD5A 721PA 3V30A 1NN0A 1KGSA 1MORA 2NU7B 3BREA 2X0FA 3HU5A 1H2VC 4F8EA 2DTXA 1QK5A 3WNZA 4W5TA 1HDRA 1Z4MA 2ZTHA 3MTAA 2ZYIA 4NV1A 3KQUA 3TWWA 5DV9A 1U7OA 2NVUB 2P75A 1G5TA 2B78A 3JAWB 2ZPTX 1O6BA 4UU0A 3GLSA 4O2LA 1OCOE 1AS2A 2VHCA 2EILE 3T5VA 2QX9A 2WYUA 3GY0A 2V4ZA 5TF0A 5J2UA 4MKXA 2OM6A 1W1UA 4JJZA 3AB7A 2C4VA 4QU8A 4J7XA 2Z9DA 3I76A 4FYWA 3V42A 2O57A 4CG1A 3WV4A 3ZG6A 4AL4A 2VSYA 3A06A 4BTEA 4ETWA 1JQBA 4ER6A 4KEAA 4KIWA 1YZYA 3BCUA 4W1SA 5E38A 3DEIA 3DV0B 1O2DA 1P60A 4QDJA 3TXNA 4U63A 2VHZA 3I1JA 3O83A 4G1VA 2OQVA 5BNZA 1I13A 3FF4A 3H5IA 4YAOA 1JPNA 1MRZA 4PHGA 4WNYA 1TUEA 5AJLA 4GG1A 2CHFA 3ITKA 3L2OB 4MROA 3RTAA 3UB3A 4FK8A 4KK3A 5GGXA 3FROA 3ANNA 3S1AB 3HB4X 4XOIA 2BCEA 3HYLA 2JFNA 4PQGA 3MS4A 3GI1A 3W2EA 5JWOA 1IB0A 3SMQA 1PR6A 1W6RA 3ZX5A 4DUGA 4G4GA 1U0OC 3EF3A 4XJTA 2Z2IA 5EHXA 3FRJA 1WBJB 2IEYA 4RVGA 4UHKA 5D5HA 1SWVA 1P7WA 2F1JA 2F6RA 5DMHA 5E7QA 3TLYA 3I9LA 1ODSA 2RGRA 4BSZB 1NASA 4OFXA 4TTTS 4YPVA 1YHZA 1OLSA 4G1CA 3E7PA 3EEYA 5JDIC 4FOLA 4KO4S 5K0BA 5BV0A 4EB0A 1BHJA 3NT4A 1ZA1A 3SQOA 2L18A 1C0LA 5BXYA 3NTQA 4JSRA 4CEJA 4KE6A 4WESA 1B0UA 3PHGA 5DYNA 4J8FA 5JD5A 4E6PA 4UWLA 4GLOA 4JUIA 2UYHA 4FYHA 1Z2NX 3IIKA 3LHKA 3M4JA 3V4OA 4ZJPA 5TQ2B 4IFTA 1QRSA 3EXIA 1L5MA 3QWHA 5KMGB 3FCOA 4J3JA 1EE9A 3KYIB 3EAQA 1P9RA 2CYCA 1SRRA 1OILA 3DO8A 1MG0A 4C3VA 2BHSA 4ZZ0A 3HHMA 3RSQA 3RK6A 1M75A 3EEBA 1EVLA 3QKIA 3QU4A 1J97A 3AJ8A 1EVZA 3GBPA 3A9VA 1R18A 3FDXA 1SZ9A 4K9MA 2YRXA 3NCTA 4TSFA 4AOFA 2HM7A 2X3FA 3L6BA 1H0KA 3ZDEA 1LPNA 3IDFA 3UV6A 2O48X 4P3KA 1S3GA 2Z58A 1LPPA 4KDCA 1Z07A 4ZI7B 2BF0X 1KKUA 5IABA 4IQFA 4FHGA 2BBTA 4UDOA 2H59A 4A2WA 1NMYA 2Y76A 4RV4A 1WLSA 2I1KA 1M7BA 2DPXA 1JDJA 3H4MA 3SEAA 3PQDA 5ES4B 3EXG2 4Z4GA 2W6PA 4DJJA 2ZUVA 1JVSA 2WU0A 2BP7A 5FORA 3B53X 1I6WA 4G5QA 1WS6A 3LQKA 4Q0MA 3VSBA 3K73O 4MLCA 2O0HA 5CA0F 4K2HA 1QGUB 2V8BA 4BO9A 3R9XB 3F6QA 1I3KA 3HSSA 2DETA 3GLHE 2J7PD 3HLKA 3ZGNA 5AOAA 5B3AA 4YN3A 4CMKA 1JMYA 1G20B 1RYFA 4LV5B 2X38A 3BRWD 3B3AA 2BTOA 2L0IA 2JZCA 4U2CA 1MAHA 3DB1A 2G08A 3KOUA 4KMSA 5IDYA 1XEAA 4N5CA 5IYZF 3WK7A 4BRWA 4Y3UA 1A8UA 1P4AA 3Q6IA 4M99A 4M55A 4Y1RB 1TAHA 3MCXA 3HE3A 1YCSB 4UHFA 1UH5A 4GBGA 1N25A 5A6SB 2V0NA 1CUIA 3V3TA 4GR4A 3DQQA 3L05A 3UANA 4CCWA 3ROKA 1NF8A 1P1CA 4R2MA 4XFKA 2PUJA 2PG3A 2NT4A 4GZDA 1L7NA 3B7GA 5DGXA 3CSFA 4J0KA 1VCOA 1EWRA 4N5QA 2ZJ2A 1B0PA 3SNKA 1E94E 3G0IA 5CNIA 3C70A 2ZREA 4AZ0A 4ER7A 4BN4A 3Q3IA 3T54A 2R68A 3CUYA 3IOYA 2L2QA 4PC6A 2OBYA 3JYPA 4L75A 1WQ4A 5AARA 3PNYA 1YJQA 1FJGB 4LY0A 4EX7A 1E69A 5F3RA 3CHPA 1KARA 4FW8A 3QE4A 1DJLA 4FYVA 4G81A 3CNBA 1JALA 1AHNA 2PO7A 3FRHA 1Y8CA 3WICA 2BHTA 1PJAA 1ADFA 3KOOA 5G0UA 2BKVA 3QVLA 3J5PA 4MICA 4YASA 3RRJA 1FX1A 3L08A 1XAIA 2DQZA 2QTZA 4IS2A 4XIJA 1IULA 1SHLA 5JXHA 2H6HA 3OIGA 1KDVA 2F4NA 1XZBA 2DUMA 2X6QA 3CTPA 1SXJE 1UMCA 5JSQA 1RRMA 1WBDA 1QK4A 5F3WB 3K6JA 1T1IA 2L19A 3GT3A 4JHXA 3QH4A 2PGAA 5JMWA 1AB5A 3OT4A 5FZQA 1U9YA 1YZTA 3ME5A 3ZWQA 2W2XA 3M9WA 1O9BA 1RJDA 4EG4A 1SQMA 1M7GA 2GO1A 2DBYA 1E0KA 1V4BA 1L5WA 3R20A 6CHYA 4GNRA 5CYPA 5CDFA 1UZAA 3HK2A 1DBSA 2QXYA 5DM60 1KT1A 3K96A 4DLZA 3GLGA 4X7MA 1Z5GA 1ICEA 2HGSA 2R87A 3W9UA 1PZMA 4JC4A 4YRBA 3H16A 5CK4A 3TJPA 1Q83A 4WLEA 2GH1A 4XM2A 3W5IA 4IIJF 4CLXA 1Z7BA 4I9FA 1S7CA 1ZCZA 2J45A 3NONA 3RYHB 3O94A 2P5SA 1YJCA 1ZSVA 2HF8A 4A5OA 5HG0A 2X41A 3CR3C 4LUNU 1VZ3A 3D9HA 1VSUA 1X81A 1LBSA 3E0QA 5ALDA 1BH6A 1V11B 1TC1A 5IJXA 1S8AA 3Q8XB 5ICFA 2PXCA 4B2YA 3U4TA 1K8ZB 2DBQA 4O4IA 4DXAA 4F3NA 5H4GA 1ULTA 4HAWA 2MJLA 1NGSA 4IINA 2GILA 2GK4A 3M7IA 4FJYA 5ALGA 1QR6A 3KPUA 5D87A 4H1WA 3ZHRA 3G8CA 2Z6VA 1PWHA 2GWHA 3MJDA 1X86B 1VYUA 1DNPA 3TIGA 1U02A 4BV8A 3LM8A 4BUJA 3PGJA 1UJ5A 1YE5A 3L6DA 4PHFA 4B74A 2EZ9A 1FP7A 4K8RB 2RMKA 2Q6OA 1BCSA 3A10A 3H83A 5C8DA 3QVOA 3TOXA 2BMVA 1YU9A 4D10C 2Z6AA 1XJCA 5ENNA 5IMSA 1IAVA 4XCVA 1SC4A 2QNBA 3E61A 2CDRA 4FKBA 3ZHSA 5DNYB 1V2GA 6GPBA 4J0FA 3U5ZB 1MOSA 1CS0B 5I9IA 3FHEA 1OTYA 3GWGA 1T6BY 4FDLA 2EF0A 4TWIA 4FI3F 5IASA 1ELRA 4DV4B 3UAGA 3ZUPA 4JMLA 5T41A 3M3DA 4N9QA 2PL9A 3ZNNA 4V02A 4F5DA 4NNJA 4KXYA 4N0EA 4RM3A 5KOIA 3BIFA 2X14A 3R09A 3NB0A 1PLKA 2EKBA 1FW8A 4DRXA 1E8YA 3VHXA 1YF3A 3U44B 1NW4A 1CD5A 1CS4C 1F17A 1ELWA 1JAHA 1JJ7A 4J0UA 1R8XA 3PDNA 2HC9A 3L0IB 4GWKA 4ADSG 4OSPA 5DNUA 3ZGXA 5GV7A 2WSLA 3E8XA 2QUBA 3P52A 3FHJA 1IJFA 1TFUA 5I45A 2PQRA 4L2LA 2GESA 3NBFA 2NZUG 3KD3A 2ONCA 5EMMA 4ZV7A 3H1BA 2GBIA 2F59A 1V9SA 3ZXSA 2V7PA 3T3NA 1OTHA 2CYBA 3O8LA 3OO1A 4U2DA 2NVWA 2Q4DA 4QL3A 1W0KD 1PCXA 1QGYA 3UEOA 6REQA 5JSZB 1FMLA 1Z4PX 5SZJA 3WGJA 2VTBB 1KAHA 4GSKA 3EU9A 1RQGA 2FN3A 2W6NA 4LHVA 3SPXA 4DA7A 4N2QA 3N76A 4QREA 2XPIA 2X8JA 4UOQA 4W9NC 4XX1A 4E32A 5I6DA 2ZISA 2FB9A 4JL8A 3UJCA 2QBYA 1G3QA 1P1IA 4OGFA 1VPWA 3T3PB 4WLNA 1EE2A 4DQ0A 1XDUA 1A76A 2GJ8A 4Z8YA 4E5SA 5EHNA 5TARA 2MDTA 3N2YA 1TEXA 3PQFA 2P9KG 3D0RA 4G1FA 2DZOA 4RKYA 5K3SA 4X0EA 5C8YB 2FVYA 1MQSA 3DLCA 2G6TA 3Q7EA 4LQDA 3SSOA 4QDUA 3T12A 4EMBA 4D26A 4I1OA 5IT0A 1IY8A 5G04C 1WCV1 3Q41A 5HF6A 5DI9A 3HJFA 4UI9J 1DVPA 1S2NA 1XCOA 3FGOA 4BTAA 1FZQA 3ABSB 2XHEA 2ADFA 3MWEB 2A9OA 4BN0A 2A4ZA 2ZYHA 3KKPA 4EB6A 3DMYA 4REOA 1BA2A 4NMLA 4JI2B 2H6EA 2ZYVX 1NATA 2GKGA 2FETA 2XQFA 4PRLA 3FUIA 3SQNA 5CB4A 2E0IA 5IYZB 2I91A 4K0RA 3L6AA 3E4BA 4JHJA 2QX8A 4KPUA 3U4QB 1FDIA 1R0XA 3QUBA 4U0UA 4HWOA 4R2XA 4Q4AA 3LWDA 3WNBA 1RWWA 1JFFB 2CV0A 1GQOA 1Y9DA 1TJFA 2FPOA 1Z0UA 2EX0A 2JL1A 3JZAA 3Q79A 1E9EA 3D8TA 3GUYA 3ZD9A 4F7DA 1QKJA 5AI8A 5HUHA 1EFCA 5CJPA 4C88A 1ZBDA 2ZVJA 3JVIA 5FV7A 1YQXA 4M60A 4V03A 2HREA 4MEBA 5BSKA 1GGNA 1LTKA 3TCXB 3GMSA 3INTA 2G0TA 3IMGA 3FTCA 4XIFA 4X8QA 4GL4A 4NONA 1ENYA 4NYMQ 4PXYA 1E3QA 1D2AA 4DLBA 5F35A 1TCAA 2ERXA 4HQFA 2AI2A 4DFDA 1GARA 1AK1A 2GDZA 1SZAA 3DTYA 4P53A 3GGCA 4RXTA 1AUQA 5H8WA 4O3MA 4MPPA 1NDUA 2D2XA 4FW9A 1SPXA 2H1SA 1YUBA 3QP9A 2VLBA 1K7CA 4YB8A 5GOZA 2GYVA 3PXGA 2O0MA 1KMCA 1U04A 1VBFA 2WZCA 2DVWA 4LZWA 4U7WA 2YINA 1JIKA 3FBTA 4RDIA 3RE1A 5ECYA 5EXEA 2C00A 3D54D 1M34B 4I9EA 2OCIA 4MP6A 1XWFA 5CIWA 5DH9A 4RJJA 3MJSA 3PRHA 2WXOA 3GNSA 4C04A 1I4DD 5JAPA 3UM2A 2CNOA 3B1YA 1UXGA 5A2GA 1JFLA 1I8TA 2G5TA 2R5NA 3WKAA 4P33A 4G8JA 4RORA 3WRXA 4H4CA 5LA6A 4J0IA 1WKCA 3Q3EA 2V9PA 3K2IA 1HT3A 1LD7A 1N6OA 2O1XA 4O2BB 5D3ZA 3D1JA 4HC4A 1QQEA 4AAYA 2F3SA 3ZYLA 2OBNA 2OQRA 2ORIA 4UNIA 1CB0A 4URYR 1LV8A 5ENZA 1HG5A 2HRZA 1R9JA 2IUTA 3MSXA 3ESAA 3QOFA 3ANYB 4RPCA 5JYCA 4OL0A 4UCWA 4MW1A 3T7EA 2XCIA 3TXAA 3H8SA 4MUJA 1OLXB 1KFCB 3BD8A 3Q0EA 4CNQA 1T0JB 2BFBB 3PVZA 4QODA 4CMJA 4RJTA 5CDTA 5K4AA 3CM0A 3D2AA 4TQ9A 1Z37A 3RYIA 2ZR0A 1CZOA 3WL8A 2OKGA 3L43A 2ACWA 5ALIA 1T2EA 1VCIA 1TYQG 2R4UA 4PC3A 3DF9A 5AUQA 2VYVA 3VR5H 4JLDA 4KX3A 4U3JA 2WQZA 5DHQA 2VJDA 1X1RA 2XZOA 4JX9A 1F1JA 4XQCA 4GR9A 4FDAA 2C0MA 4YLGA 3B6IA 2JGDA 3ZTWA 1QQAA 3QQ5A 4JROA 4F5WA 3BQMB 3P9PA 4X6YA 2PX5A 2RB4A 3V6LA 5C7OO 3FDZA 4DA8A 3CF4G 4HWTA 2C7GA 5HKKD 4KE7A 4HS4A 2DVMA 3KB8A 3WLMA 1T26A 3CQCB 1QO7A 1Z29A 1XIVA 2GNPA 5TF4A 5EEGA 4RA6B 4E88A 5L53A 1FMFA 1LY1A 3L7YA 3NHBA 2I3GA 3VYSB 3SE0A 4MKIA 3WB0A 4YDWA 3PDCA 1FPMA 1DJPA 3QVWA 4KV9A 1H4TA 5J43A 4ZEXA 2KHZA 2PKCA 4DBVO 3HUUA 1O1TA 3B51X 4KVFA 1NPDA 1GU7A 2C07A 4R2KA 5A71A 1RHRA 4M9RA 1Q7GA 2RSLA 2C1XA 5DM2A 4AS2A 4CL8A 4RANA 5CDUA 3OIWA 1MYOA 3QTLA 5TS2A 2HOQA 3I6YA 4EW2A 4HYEA 1CHDA 1E61A 1JMKC 1ZUWA 1NN3A 2V58A 3JQAA 3OIYA 1TYEB 2QM8A 4H7IA 1SD5A 4HB2A 4U7HA 3GRAA 3W5JA 4CMIA 2XRFA 4O5AA 2O05A 3PFFA 1BQ3A 1BWSA 1XL0A 4MDYA 4JH0A 2J8ZA 2CXOA 5COAA 4ACKA 4RPHA 4J7WA 2CHUA 1KU6A 2CUNA 3GD5A 4CDMA 3GJTA 4FGJA 5GWXA 5I3CA 1RYNA 4OH1A 2OC4A 3MJTA 5D01A 5A3VA 2YCBA 3D9KA 4YJHA 2JVIA 1XXHE 1RJ9B 4D82A 1IN7A 2DLNA 4Q1BA 5DX1A 1P2GA 4QGBA 3FPGA 1U99A 1X1DA 4GI5A 3PNOA 3OZXA 3F3MA 1TRHA 5MGNA 4ZMBA 2P9GA 2R60A 4J4BA 4C4PA 1W0JA 2CXRA 2MYUA 1ITZA 4TMYA 5J90A 2GI4A 5AXAA 3EZ2A 3QY9A 3WBBA 4QNMA 1KH3A 4MWOA 3NTVA 5K8LA 1N2ZA 3DAFA 2SCUB 4E33A 4JK3A 1PFWA 2ZT8A 2J4DA 3NAWA 1K1EA 1XEWY 3TR6A 4UOZA 3CZAA 1LTXA 1O6ZA 3D9OA 2D7CA 5CEEA 1SUCA 2HXYA 2C0LA 1EFVB 2X2PA 3D0KA 1POXA 3KOZA 3KKMA 4UXJA 1HLGA 4W7IA 4Q9JA 2VIIA 1QZ3A 2Z2JA 3BRWA 4CQMD 2WM3A 1E7UA 1KYQA 2O2XA 2HJSA 2WUVA 3V3KA 2P4QA 4EHDA 3BM5A 2GVDC 2F3RA 1TIPA 1NLUA 2GPWA 3H13A 3L01A 2Q4OA 3LVQE 4ILKA 5CHEA 4FYMA 2W6JD 1NPTO 1W35A 3SF8B 3WFZA 5ALQA 4BASA 2PL3A 1QOPB 1SEVA 3WY9A 1HZZC 1LX6A 4LXQA 4AKGA 1TQDA 3MRSA 3FR8A 4QARA 3N8GA 2QRJA 5BUSA 3TKLA 3F8TA 4LJYA 3CK9A 1JEQB 1T9BA 2A78A 1WY7A 1IXYA 5IUKC 3AVOA 3GEDA 3HFJA 3JX9A 2EV9A 1QIIA 2P9TA 1NQOA 4JLJA 4F46A 1I7DA 3AW9A 3ED1A 3C16C 2CY0A 1E59A 1ZJ5A 1ORIA 3I3OA 3EIEA 5T4HA 4LAFA 4U2EA 3HXEA 4AM8A 1MJGA 4ZYVA 4LMPA 2UWJG 1AKVA 1HDGO 2Q5FA 1U2TA 2HRCA 2XYQA 3BKXA 3CF6R 3DAOA 3PDHA 1E1YA 3ZE7A 3A1FA 1LF5A 3UAVA 1V5FA 1UBSB 4G4IA 2CUZA 3UH0A 1W48A 2ETCA 2VAWA 1U11A 1NNSA 1Y5LA 4AMGA 3T3OA 1ZD9A 2HLHA 1PL8A 5LCXA 2YVLA 3UBMA 2MIIA 5F5LA 4FMDB 1R6UA 2IYWA 3A1TA 3E70C 1BE8A 2TMKA 3QVGB 5A7DB 3V80A 5K0FA 2QX4A 4R83A 4Q9IA 1P9NA 3CZCA 3MTJA 3KNZA 2CUTA 2FO1E 4WY2A 1ENOA 2F8XK 2HBZA 5G3YA 1GPAA 4QUAA 1FW6A 4S35A 5IK2D 5K3AA 2WXMA 4E85A 2YIMA 4INAA 2WT8A 3GUZA 1JHAA 3OZ7A 2YJ5A 4QOHA 4IG4A 3WJ1A 3KEAA 1C14A 4CCYA 3FG9A 1YZGA 2BHNA 3LS2A 3KKZA 3WNDA 1UDBA 3NBNB 4D9HA 2JH3A 4B3RB 4XYBA 1Y37A 3HN6A 3D4BA 2VOJA 4I1YA 2WE7A 3F96A 3U7JA 4C7MA 2AR7A 4F6LA 4WOKA 3TWXA 4P7GA 4NIKA 1DWQA 2IXEA 3EGVA 4M83A 1Z5NA 4MAMA 5E3IA 4AZ0B 5BUZA 2MCFA 5K7SA 5A2QA 1NYQA 2VAMA 2NLOA 2F3TA 4RX1A 5EKTA 4P2GA 1UDRA 3UKOA 4AKSA 3H75A 4Q4CA 2JW5A 4CV0A 2BW0A 121PA 2PRIA 3C8MA 3CV0A 2VUIB 3MT9A 2F55A 4IS3A 2UYCA 3G82C 4K28A 2BWJA 4BAUA 2NO9A 3UYKA 2GZ2A 3BSSA 3SHVA 2W2KA 1HBJA 2OFXA 3CWCA 3TRHA 2F43A 3W2FA 1G8FA 4IV8A 3ZLJA 4GZCA 2GRUA 1VGQA 3N86A 1WB6A 3O8RA 2Z1MA 5IJWA 1DU4A 4A8HA 4RFLA 4EI7A 2PZIA 2P9EA 1RI3A 4YS6A 1SBHA 5ABPA 8ATCA 1OHHD 5IRCD 4LOJA 3BSFA 4GZMA 3T38A 4GCOA 4BEWA 3IXEA 1WY6A 3IP3A 3ET5A 4ND1A 1C9YA 4I8XA 4HRMB 1E1DA 4OVUA 1QYMA 2ZSFA 1I32A 1UMBA 2X9LA 4QU9A 1HY3A 2RG7A 4UAGA 4FLHA 2DSNA 3FOWA 2CMKA 2ICAA 4S2EA 5BVHA 4LF8B 2XEEA 5GTDA 5T3RA 3IV0A 5KI6A 4HVLA 1H1TA 1IAQA 1YOVB 3H97A 2GN1A 4KO1S 1ZUNA 1NZNA 2W2OA 3B9PA 4B8YA 1CR2A 2YBDA 2CDCA 2TECE 2ASEA 1Z82A 3C1AA 3G17A 4LQCA 4YUAA 4RYDA 3AJAA 4KR3A 1YULA 3KFLA 4DSZA 4RK7A 2PIDA 1PR5A 1F2TA 4OHPA 1BMFD 4ZVVA 4A2QA 1W73A 1WG8A 4C0XA 3LMKA 1L5NA 3DUWA 2IVFA 3RYFA 3ADCA 5BSMA 5K6TA 5F9HA 2E5WA 5CAEB 1IYZA 2ZBPA 2IY9A 4N6OA 2ZZNA 1N2HA 3S81A 3G9QA 1Z36A 3ZW8A 1HF3A 3E9EA 4EJSA 3IT2A 1IK6A 5TV2A 1RRGA 2OHXA 3LIIA 4UM5A 3W8RA 4H77A 5KVAA 2GRNB 5ITSA 1XDZA 3ILYA 1EFPB 4DZZA 3SS9X 2D8AA 3AP2A 1A9PA 2V4UA 5EJ7A 1FFWA 1CF4A 4RH0A 4O25A 3D3WB 4UMEA 4UUBA 4N47A 4YMUA 1PEDA 5GM2A 1MRNA 3KB6A 1OGYA 3LSTA 4H1UA 4NLLA 5AJVB 2BEDA 1WJGA 4FILA 1CF2O 2YHEA 2XGJA 5KJMA 3EZNA 1I1HA 1YMPA 2WD7A 2Z5LA 1D2MA 3BTSA 1X9GA 4O4JB 2FF4A 2HMVA 2I1QA 2AUMA 2JAOA 3F8WA 4YBZA 5CFNA 1C4XA 3LH5A 5EYPF 1Y3BE 4FNAA 4TZKA 1SA4A 2YOFA 4Z86A 2C94A 2I0FA 3NYIA 5LYJA 5HRUA 1DBIA 2YNMA 1QH8B 1E7YA 4BU0A 2Z30A 1MHPA 1XJ0A 4NENB 3GWZA 2FU5C 4AEZC 4HQNA 3VI4B 3W79A 4C87A 4B7XA 5G4LA 5KDOA 2QM7A 5CCBA 1ZMXA 3HB1A 1U63A 2B3TA 2MINB 3COVA 2X2OA 1FVFA 3NOGD 3PXXA 3S2GA 2EGGA 1XNRB 5LP6F 5GINE 1IN4A 2B0OE 5J3JA 1C9NA 4QELA 5BPHA 3RK1A 2AFHA 3IYLW 2OO7A 2IYEA 5EIBE 2PXHA 3EXIB 1H9BA 3HO6A 4FGUA 2VUSA 3IDOA 3SHQA 5LQJA 3ZHZA 3OCWA 4IIGA 4CYMA 4EHKA 3HZRA 1I4OA 3M4XA 4DCSA 4ROTA 1BD8A 2F62A 4TLLB 4MVJG 2IWHA 2BE9A 1SXJC 2RGNC 3O3OB 3C6QA 3OOWA 1AZLA 2DWCA 2BMDA 3P4UA 3SFYA 4IJWA 4LQ4A 1C1YA 1GRNA 1MX3A 1R6VA 2Q8NA 3JW8A 3EC1A 2OZVA 4KDEA 5JAZA 4ZRMA 3CVLA 4OYSA 2B8TA 2BBOA 2FMUA 4RVBA 2OXFA 3O95A 1NQUA 1OCRE 2BDUA 2XMQA 3HGMA 3WXMA 1TJCA 1P17A 1LS1A 2VYQA 5CT9A 2C31A 2F00A 3RIHA 2DPMA 3JD0A 4KG7A 3PUJA 2VAPA 3JWGA 1Z45A 4RZIA 3VKFA 1KWKA 4TWRA 1NYRA 3F5MA 4TMVA 2NYUA 3ZKWA 4KR2A 4P9NA 3IPLA 3NW9A 4XB2A 2WT9A 2ZRMA 4WLOA 4P31A 1N94A 1EDEA 4AZTA 3T3DA 3MCUA 2CKDA 3O7WA 4QXPA 3HP7A 2X9GA 1VKHA 1YASA 4J43A 5JASA 5DKFA 3FPEA 3UXEA 4ENPA 3K2BA 3GVHA 2CEKA 5BV7A 5FUXA 3A2MA 5TNXA 2R00C 4ZXFA 2CXHA 1GY8A 3LPMA 3PQ3A 4KUEA 4GD3Q 1BRMA 4U00A 3EUEA 4FWIB 4XSVA 4GMKA 4WCFA 1E5QA 3KQNA 2B20A 4D80A 4DPKA 2MSKA 1UW4B 4KJ