4GU5A

Structure of full-length drosophila cryptochrome
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
537
structure length
537
Chain Sequence
b'TRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLRACVRGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWLAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cryptochrome-1
molecule tags Signaling protein
source organism Drosophila melanogaster
publication title Updated structure of Drosophila cryptochrome.
pubmed doi rcsb
total genus 200
structure length 537
sequence length 537
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4gu5A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gu5A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4gu5A01
2ZP1A 1COZA 1OWPA 2E89A 3TS1A 3A2KA 3H9CA 1J70A 5J59A 1EFPA 3NV7A 4MUGA 2CV1A 4YP5A 2Z09A 1I6MA 2X0KA 1MAUA 1WJGA 4XSVA 3COWA 1JGTA 2J4DA 1D2RA 4K0RA 3TZLA 2DETA 3ND5A 3U1VA 5DEOA 3IOEA 2IP1A 4TS1A 4X0EA 4RUKA 4MAFA 4ZT7A 1M83A 1M8GA 4Q16A 3UK2A 3SP1A 5BNZA 1PFWA 2CSXA 4JZYA 1O94D 1X8XA 1WKBA 1NUTA 1IFXA 1WXEA 3GLVA 2QUKA 1OWNA 1FFYA 1ULHA 1MRZA 4E1AA 1GZUA 1QJCA 2A1UA 3DV2A 3IVXA 4MWEA 1UFVA 3ZXSA 1EXDA 2CV2A 4QBTA 1NP7A 5FNZA 1M8KA 3G59A 4MUFA 3L92A 1G8FA 3E27A 2O5RA 2WQ6A 3QE4A 3CVXA 4MW5A 4OUDA 2RD2A 1KQPA 4OUDB 4GU5A 4R2LA 4EG5A 1QNFA 3Q4GA 1NZJA 4ZT3A 3FH0A 3SZ3A 3DPIA 3ZXIA 2WB2A 3Q10A 4JYZA 5FO1A 4EFKA 3CVVA 3INNA 1TYDE 3ZJVA 1M8FA 1P7PA 3RFFA 3CA8A 5K0TA 3X1JA 3CLRC 1U3CA 1T6ZA 2YXNA 4MW2A 5IJXA 2HGZA 3PNYA 1WOYA 3UOWA 1R6TA 1U7XA 1N1DA 4MUEA 2XRZA 4R2MA 3FI0A 4MW9A 2C5SA 4ZT5A 4DE5A 1MB2A 3CLTD 4AQ7A 2DEUA 1ZJWA 2E0IA 1JMVA 3TZEA 4HK4A 2PXHA 3N8HA 1EE1A 4CDMA 2PZBA 3VU8A 4CDNA 4GRIA 4MVYA 4NAHA 2VXOA 5KWVA 1WXHA 2E18A 1G59A 1X6VA 4NDAA 1EFPB 1KAMA 3AIIA 4KR9A 3CLRD 2VTBB 3L93A 4DJAA 3TQIA 4EGAA 1YUMA 4UZEA 3S3TA 4JFAA 4ZCPA 3SDBA 4U8HA 3PRHA 3TQOA 1KH2A 2YWCA 3H05A 4G5FA 3ND6A 1WXFA 2EJCA 4AS1A 3D6UA 4RPIA 1TYAE 4CQNA 2D5BA 4ZCSA 1T6XA 4PBTA 5TGTA 4MUNA 1XJQA 3MUEA 1VBNA 4XFDA 3CR8A 3M5WA 1IQRA 3P0IA 1QTQA 3CLSC 1LI7A 3DO8A 1MC1A 3UC5A 1NURA 1MAWA 3D6VA 3RBAA 1G8GA 1HYBA 4ZCRA 2ZUEA 1WQ4A 3KT8A 1QRUA 3IUEA 4NZPA 3P0HA 1VBKA 4HJRA 4YP6A 1G8HA 1T6YA 2XRYA 2QTRA 4KKVA 2GM3A 1EUQA 3ZJTA 2J5BA 2OQ2A 3HFJA 4P2BA 4EG8A 4WNYA 4ZCTA 3MLBA 3ZJUA 2JANA 5K0SA 1KAQA 4KR7A 5H7XA 1M8JA 1XNJA 1KH1A 3PNVA 1JILA 1K4KA 2GKSA 1O94C 5IHXA 3N05A 3AKZA 1H1TA 4DNXA 4J75A 2VTBA 3FETA 4UZFA 2YY5A 3I05A 4PY2A 1F4LA 3PXUA 5TS2A 2A7XA 3IVGA 2A86A 2CYAA 1MOPA 4L2IA 4DDMA 2V0GA 4KPUA 1N2JA 1WXGA 2J08A 4FZJA 4ND6A 1NSYA 1EFVA 1Q15A 3JXEA 2RE8A 1ZUNA 1K97A 2E21A 4J76A 1I6LA 4H3SA 4MWCA 1IHOA 2DUMA 2IJGX 4I6JA 3A04A 4ZT6A 5HG0A 2CUZA 4EG6A 1PG2A 4DDKA 1WY5A 1CT9A 3FDXA 1MB9A 5J5AA 1FYDA 1PFYA 3SEQA 1K92A 1N78A 3X1KA 1YIDA 3FHJA 4EG3A 3ZIUA 3HV0A 1N75A 2J07A 2TS1A 4YP7A 2EL7A 2BTEA 4KR6A 3IVCA 2PZ8A 1VBMA 1LI5A 4PBSA 3C8ZA 4ZT4A 2NZ2A 2H29A 3DLAA 1TYCA 3PNBA 2QUIA 4MUJA 2ZUFA 1ILEA 5HUJA 3K32A 1OWLA 3ZGZA 1U0BB 4YBRA 3IH5A 1RQGA 2DR2A 1VLHA 4JXZA 1TQ8A 1J09A 1F9AA 3N9IA 3Q12A 5J58A 1IQUA 1V8FA 3AL0C 1O0CA 3CLSD 2CYBA 5KHAA 1A8HA 4EG4A 5DASA 1KQNA 3CVYA 4EG1A 1GTRA 1U3DA 1Q11A 5DK4A 2WQ7A 1OBCA 1N2IA 4I6EA 2CYCA 2X1LA 3SEZA 1N2HA 4MULA 3QTBA 1TYBE 3H9BA 4G6ZA 3FIUA 1O97C 2R5WA 3CLUD 1I6KA 3KT3A 5TEWA 3GUZA 1R6UA 2CFOA 1Y42X 2NSYA 1TEZA 4HJXA 4U63A 4R0NA 2DXIA 1N3LA 4QRDA 1NI5A 5FO0A 3MMXA 1PFUA 2DPLA 4MW1A 3BL5A 1QU2A 1GPMA 1H3FA 2H2AA 3HGMA 3RHSA 3CVUA 1M1ZA 4EG7A 1OWOA 1XNGA 4PBRA 1JHDA 2A4MA 1IVSA 2PZAA 4DDHA 3AG5A 3FG9A 2QJFA 2GOYA 1JEDA 4EF6A 4MVCA 5HUHA 2Z3VA 4MUIA 2WSIA 3OP1A 4U7JA 1WXIA 1KH3A 2B7LA 1OD6A 2QJOA 3SZGA 5F23A 4G5YA 3TNJA 1PG0A 1J1ZA 1EUYA 1O0BA 2PIDA 3AG6A 2O8VA 1O95C 1EFVB 3KT0A 3LCJA 3N2YA 2G36A 1EJ2A 3X1MA 4NX2A 4XFJA 3VGJA 1WZ2A 2DLCX 1IQ0A 5DB4A 3COZA 3COYA 2QTMA 2A1TR 3HL4A 1SURA 3KFLA 3ELBA 3IMCA 4MLPA 2X3FA 4ARIA 3K9WA 2QUJA 3RK0A 1O5TA 3F3MA 3IUBA 2CV0A 1YI8A 1F7UA 1VL2A 5EKDA 1BS2A 1B6TA 2D54A 3LOQA 4MWDA 2OV4A 3QTTA 3LE8A 4L2IB 2QUHA 1N2OA 3OTWA 1O96A 4MQ6A 2A88A 2A84A 1H3EA 3KT6A 1QRSA 4I6GA 1N2EA 3A4IA 3H99A 4MVXA 1JEEA 1IRXA 2I1LA 4MW6A 2DERA 1NUUA 3IOCA 1GLNA 4MUHA 3NBAA 3RJZA 4A91A 1GN8A 1GTSA 1XNHA 1T9GS 1F7VA 4DLPA 3G5AA 3ILVA 1JZQA 3P0JA 1KKUA 3SYTA 3G6KA 1K4MA 1N77A 1NUSA 2PFSA 1YUNA 5LFAA 3ISJA 2AZXA 2Z08A 3VRHA 1H3NA 2QJTA 4S1OA 5JBNA 1Q19A 4ND7A 3IODA 4MVWA 4ZCQA 1YULA 1N2BA 1O97D 4MUKA 3HMQA 2JAXA 3CLUC 1J20A 1JIKA 3A05A 2CT8A 4F4HA 3FY4A 2YWBA 1KORA 4MW7A 1I2DA 1MJHA 4ARCA 2J09A 3UMVA 5AHWA 1NUPA 4YMIA 1J21A 1JIJA 1WQ3A 1S4MA 2PG3A 2HZ7A 5KCMA 3MXTA 4OJMX 1M8PA 5H16A 4NATA 3IMEA 1IH8A 3FOCA 2A1UB 3NBKA 1YIAA 2HMAA 3ND7A 4NAUA 3RK1A 4JXXA 4WSOA 4CT0A 5LM3A 1QQTA 4MW4A 3CLTC 3AFHA 2AKEA 2X1MA 1OBHA 2JA2A 1T9GR 2A1TS 1J1UA 4F3RA 1O6BA 3IOBA 5LLTA 3MLAA 1ZH6A 1QU3A 1PFVA 1DNPA 3IDFA 4K03A 3FWKA 1JIIA 1KQOA 1R6XA 1U7DA 3UY4A 1MBZA 4ZT2A 1V47A 3IMGA 1O95D 3CVWA 1GAXA 3FNRA 1KP2A 2D13A 1ZH0A 1OWMA 2V0CA 3COVA 3P52A 3ZUGA 4MW0A 4MWBA 2BYTA 4KPUB 1QRTA 1NUQA 3HZRA 1N2GA 5TEVA 1LW7A 2QTNA 4Q93A 4QREA 4BWVA 1Q77A 2AG6A 1JECA 1O96B 1JZSA 1KR2A 4HPWA 3H97A 1TFUA 1NYLA 2IELA 1KP3A 3GMIA
chains in the Genus database with same CATH superfamily
2V6JA 3CX8A 1S3SA 3W9FA 2XVXA 1ESZA 1Z5ZA 2DFPA 2PGJA 3I53A 4L95C 5JZMA 5MDHA 3GRRA 1MENA 5HIJA 3I0ZA 4QU5A 5FL7A 4YP5A 1M54A 4DRZA 4HSEA 4M87A 3KLOA 3VSEA 2SICE 2VN8A 1NW6A 1JA1A 1WPQA 4EB3A 1OBVA 2JH9A 3TLCA 2Q0HA 4FHEA 1BU8A 2GSDA 4X0EA 1HZJA 5CCMA 1X7XA 4DDTA 2GCIA 3WBBA 3ESXA 2PJDA 3FFXA 4HPXB 3LMKA 3V79K 4FZ5A 4Q5IA 2PYZA 4KAJA 5C1OA 3U7HB 3TFOA 2H4HA 3DHYA 3MQFA 2LTAA 1BGXT 2RFAA 3EC1A 3GFTA 3AFGA 3KTAA 2FRXA 3NHWA 4ZARA 4DBLE 1EGQA 1JJVA 3NHZA 4KOAA 4MKIA 4OHOA 3WIBA 4X7PA 1SY7A 1ZU5A 1IAQA 2N47A 3NPMA 4AMZA 1QKJA 3V6MA 3S5JA 4OKIA 1SXJC 2J9XB 3FPEA 3KXDA 4PLZA 4WD3A 4X24A 3PDJA 1RQPA 2O6HA 3HB0A 1DBWA 3OZGA 3DSTA 4NZ9A 2QTLA 3OZRA 4LBWA 4D98A 3C7TA 1F48A 1M8KA 2F8LA 4LCEA 3LQ4A 3EUEA 5H3LA 3VH1A 3F6RA 4WNFA 3KSZO 1JQBA 3F0TA 2RH5A 5T7BA 4JLBA 1CUFA 4QG3A 3DAGA 3F5SA 3SXUA 4MNTA 2DSTA 2P30A 4N54A 4OCZA 2M32A 4GHWA 4REMA 4Y2HA 3KAQA 4DDWA 1E92A 4B6RA 3F6YA 5ENDA 2HF9A 1FYFA 2H7CA 1JLRA 4ZAXA 2AWIA 4HDKA 3ZE2B 2WAXA 5JMPA 5CGZA 1E9RA 3NQ41 1PO7A 4RFVA 2BEVB 1CR6A 2EFJA 3T3GA 2GPWA 3JQGB 4L5AA 1RS0A 2O14A 2Z3WA 4LJ7A 1T8PA 2IU6A 3I9V6 5K0LA 4AN0A 1U28C 2IEBA 3KEAA 3RTEA 3HJRA 1LS1A 3KTDA 5L95A 3OZAA 2A9PA 1V9LA 4J0DA 4OQXA 4HAWA 3EWNA 4P53A 1JFFB 4GUDA 1PJ3A 4IXDA 4X93A 5TF0A 5FQ4A 1KSJA 1KWKA 3DBIA 3QBEA 2VAMA 4BP8A 3NW9A 2A30A 2WMYA 3B5EA 1E9SA 4X54A 1EE1A 1OTYA 3UJNA 3L1UA 3DHNA 4LE1A 2YZ2A 5LYJF 4P84A 5FBRB 1DG3A 2B5WA 4EYOA 4ZZIA 1WXHA 3I8SA 1SA4A 4OI4A 3TSOA 5CCEA 1LV8A 2P41A 5IX8A 3FWHA 3CGGA 5A9RA 3FCAA 4IOLA 2QTBA 1Y3IA 3T99A 5K8VA 1H2FA 4LRQA 3NYWA 1FTWA 3BC1A 4P6VF 5CPBA 4FD2A 4B1FA 3U60B 1USUA 4E7OA 5A4MS 2IHBA 1HDRA 5CT4A 2PLAA 2ZBFA 1KU6A 2C8JA 3S3TA 1XTIA 3SBDA 1CF9A 2BGRA 2GF0A 4HD8A 1GQYA 3EODA 3CVPA 1LSUA 1ULUA 2HA6A 3M3DA 2XYQA 1U02A 1Z38A 2WF8A 5EIBD 4B4UA 5LD2B 1T34A 2KHZA 5JZVA 4L72A 1X87A 3SSAA 2XGOA 1N2ZA 1DWPA 1OFTA 4C0SA 2IE0A 1XJQA 4OLHA 2LKDA 4LPSA 4MRRA 1VDZA 2QSYA 1IQRA 4J3FA 1BU9A 3PKIA 3MCWA 4YRSA 4UUBA 5AIAA 1RRKA 1JA0A 5D51S 5K3AA 1Y81A 4B3TB 4LPKA 4ENUA 1PK8A 1T10A 1XVAA 2FP4A 2FX5A 3K8YA 4M3OA 3SR3A 3VYWA 1H0HA 2FDXA 2DPHA 2VBCA 2RGDA 2G71A 2ERCA 2QU7A 4URHA 2QYSA 3WQQA 2F62A 4ZI2A 2ONZA 4WINA 1WCXA 1V5WA 4UASA 4C05A 4CM6A 3T5AA 4Q9NA 4REOA 4EKYA 5EE1A 4EL5A 4L9PA 5KAMA 1QWOA 3E7XA 4M8SA 1PQPA 4RM3A 2D3TA 4DIFA 3R74A 3H5WA 4CLDA 4IDHA 1T3HA 4UE6A 2L6BA 3AVTA 4EW1A 4JJAA 5CLJA 3QPDA 1YWGO 2ZJ0A 1Q0LA 2BDEA 1MOZA 4P34A 1UM9B 1VTKA 4R7ZA 2RBKA 3WB2A 4ISCA 1DEHA 1FC0A 2VKQA 2PSJA 3AHIA 3PQFA 3S81A 3QV1A 2IOFK 2Z5VA 4Q1DA 4RY2A 4DPKA 1F6DA 3GLGE 2WTUA 5KTTA 1HLFA 4XVQA 1F2UB 1TT5B 1Z4QA 2EJTA 3TRHA 5KYUA 4BC1A 3FGPA 4J8YA 5IDXA 2QL6A 1MX6A 3K53A 2H2DA 5I5GA 1JLLB 1NLFA 1H1TA 1WHSB 5CP8A 5JZSA 3WBKA 1MA0A 3B20A 4LJRA 1GQSA 3QI7A 2YWHA 3DWIA 3HRKA 3K72B 5D00A 3GBVA 1A69A 1C9KA 2JCBA 1A72A 5E6SB 9LDBA 1SUFA 1ZCBA 4ZKEA 2GKGA 3A3NA 4GI3A 3BL6A 2IPXA 2W6JA 3VR6H 4FC8A 5LLTA 3GFPA 1THTA 3KXPA 4G8CA 4UPDA 5KJEA 5KSPA 2Z6QA 1X42A 4NYIQ 4FINA 3TNFA 1WS6A 4OBXA 2CYAA 2H6EA 4IDGA 2CNBA 1Q7RA 3C6YA 3EN0A 5EEGA 2QRQA 1W4ZA 3LGSA 1AZLA 3T5DA 2GN9A 3WMGA 1JDBC 1E1RD 2DCPA 4LF6B 4YYZA 4KO4S 4RLFA 1F0YA 1DP4A 4CQMB 2P9PG 4CYMA 1BMDA 4IPTA 1DADA 1H5NA 1N94A 1X77A 5AKJA 4RW0A 5B4TA 3EIFA 4BGEA 2V5UA 4GOXA 4MVJD 1C4OA 3EEYA 4DG9A 1V9SA 3MWDA 3GFSA 4C0QC 4RPGA 2QLLA 4N65A 1U65A 1RLOA 3VXKA 2RC6A 5FV4A 1NI4A 4M9QA 1R8XA 1N6LA 1W581 2YINC 3LP6A 3JQ7A 5F1OA 4PLHA 4LQDA 2W2PA 1XMIA 1MB9A 1NNUA 3RAUA 3IGFA 1V1JA 1KZPA 1RWOA 5A06A 1IJEA 4XB2A 2QUZA 3PJDA 5ENTD 5ICMA 1RM4A 1XLTA 3TAXA 1TVEA 4XI9A 2AEMA 3AKEA 3F6CA 4LCTA 1T4MA 2BFAA 1AP7A 2YV5A 1USGA 4JKIA 4LJSA 4QDTA 3LHIA 1GU1A 5BN4B 1JLKA 2BAGA 4HLLA 3UI2A 1NR5A 2RAVA 4RMIA 4V1CB 1SCUA 5D3ZA 3GUUA 2VSOE 5EQDA 4Z1MD 5KYGA 3CF6R 3RGWS 1LI5A 4JOBA 4M7CA 2MCFA 5K8CA 4MI6A 3NNSA 5F35A 1PZEA 1W85A 2FI1A 2RHOA 3LPAA 4KGXA 4RZHA 3TL2A 1ZMRA 1XZMA 1I4DD 4YP0A 3IL2A 3R6WA 3ICOA 5BR1A 1TQ6A 2V9ZA 4OKNA 3K32A 4D4IA 1HY3A 5B2FA 2YJGA 5JA4D 1VJ5A 3WFJA 4EPZA 3PZBA 2YCBA 5DSZA 4D43A 4CODB 4OLAA 4MWSA 4JXZA 2ZETA 2GYYA 3AF6A 3HCDA 2R1VB 4P3PA 5EJEA 3T9DA 2XT9A 4YRPA 1ISRA 4GOKA 1EWQA 1V8FA 2DH6A 3MYRA 3O3CA 2AVPA 2OA0A 1NR1A 5EGSA 1BXGB 5TY0A 2ZTMA 3WRXC 2Z9CA 4J1QA 2V3VA 4JLJA 4L1BA 1G5QA 4L4RA 4KODA 2IWRA 2ZIVB 1A7KA 2F0YA 1PKEA 3CZ4A 3FM9A 3QVUA 5GJCA 1TU4A 1NQUA 1ZRHA 3OZTA 4GLOA 1E2EA 3R7AA 3FIUA 1ZFNA 1T5LA 1TQHA 3SHVA 1DSSG 4DSUA 3IEGA 4WXRA 3KR9A 3GDHA 4QJ4A 2IYLD 2JF0A 4QOIA 1GR1A 2ZATA 4L5BA 1QHHB 1IEQA 1CLUA 1QORA 2WIAA 1N9AA 4I19A 4DMMA 1XCOA 2HO5A 2WOOA 4UDYX 5B1DA 4D4GA 3PFWO 3CUTA 3EXHB 2Q1UA 1ECFA 2BCGY 3D1VA 4OHZA 1JBEA 4N3CA 2YXBA 2XZTG 2HBQA 1JLHA 4MS1B 3TUZC 3ORQA 1Z5UA 1YJAA 3EIHA 3E3OA 4I9GA 4WNIA 4YAOA 3TNYA 1LWOA 1SBNE 2QTCA 3GJYA 3CVUA 1P8AA 4Q7JB 2I71A 4DMGA 1UDRA 3MTDA 4KN5A 1FPQA 3A6LA 5JQGF 2GJAA 3HNRA 1DRUA 1HH8A 1IOZA 5EZSA 2IGBA 3L7IA 2GJ8A 2GXUA 5ES3A 1VCIA 3H5RA 4CM9D 2UVQA 2GGFA 2JIQA 4EGQA 5FWNA 4M37A 1PV1A 3D8SA 3DKPA 3BDVA 4XTCS 1LKZA 3KE8A 1AMNA 5IFKA 1X5BA 2ZYUX 4FYVA 3APCA 5DPMA 4EARA 4RIFA 5EIXA 5E9AA 3W2GA 1EFAA 13PKA 3TAHA 1WY7A 2AHOA 1ZUHA 2VHXA 4J0FA 3EQ9A 1KI7A 1QFSA 1WTCA 3SNKA 2UYQA 3RIEA 3WLPA 4EI8A 2CC2A 3O90A 4JVNA 5EYLA 1J1ZA 4F9TA 1KI9A 2PIDA 3DJFA 4EELA 4UI9C 2GBGA 2GVNA 1Y98A 3T7KA 1I4EB 1E3MA 2ZWAA 1E6KA 4TTTS 2JVKA 4FTWA 5THKA 3HBJA 1TRKA 4UBNA 3GOHA 3S7JA 3BRCA 1BE1A 1M5UA 2HX1A 3PF8A 2OG2A 4U2DA 3FW1A 1DO8A 3LLVA 2V6FA 4RANA 1E59A 1L1RA 3HJAA 3CK9A 4KQXA 4BVGA 821PA 3QX9A 3U4QB 4Q39A 3VR4H 1I80A 1OLOA 2IU0A 1VJ0A 1S2GA 4U1RA 3OQIA 4FEEA 4K6OA 3ZYZA 4C7OB 2JGIA 4MQEA 4F4DA 1TX4B 2ZU6A 3VNSA 2PRJA 1GRCA 4F2HA 3IUBA 2I1WA 4F6RA 1FRVA 4TXPA 1M1YB 2CLIB 2YVLA 3E9DA 1J4AA 4FGLA 4FUQA 4GLLA 4PAOA 4WIAA 3IQWA 4CEIA 1XGWA 2W90A 3TM4A 4OHFA 1WV0A 5ALNA 3ESQA 1DMRA 2QD3A 3COJA 2B1RA 4LG1A 2R97A 1WNTA 1HURA 3FP3A 1JEAA 1LLUA 1RJDA 4EB0A 5HOQA 5COBA 1QTRA 3FIJA 3QVKA 3ODPA 4F91B 2Z83A 5A3JA 4KYIB 1T5SA 3WXMA 1I13A 2WICA 3UIEA 4MVXA 4IEEA 4OX9Y 4EABA 2FJ0A 3BBPA 4RMJA 4HNVA 3OCJA 1GLNA 3O0DA 3CB4A 2ZULA 1J42A 2AI1A 4ZGWA 1P7CA 4U2BA 2XCTB 5I7FA 2EBWA 2Q7XA 3A9TA 2FZLA 3NBAA 4FKBA 4D3DA 4CKWA 4A91A 2UY1B 1AKEA 3BCHA 3ENNA 4GVXA 4Y2PA 4S05A 2A9OA 1K7FB 1NQTA 1R3UA 2H4YA 3RTDA 1RCUA 1BOOA 2FSIA 2QA5A 3SFTA 1OXXK 2IL1A 3A3PA 2HLDD 2PNJA 4BHTA 4TM7A 2XCSB 3ET4A 3M1YA 3PXDA 2GO7A 5LQKA 4UFPA 4PAMA 3FKJA 1FYWA 2BGJA 1NFFA 3H65A 3OHPA 3ID6C 3LW8A 4J2TA 5EIHA 1RYNA 5JYBA 3UPTA 3U7FB 2H6GA 5ICSA 5IN5A 2IF0A 1E2IA 3SOZA 4EYEA 4J0JA 2R8BA 5JBNA 3DAYA 4O4JA 4ANXA 4O2BB 4EW2A 5BV7A 5JUWA 3L7CA 5KB3A 2BKAA 4XIJA 1RWKA 4DJEC 2E1PA 4DV5B 5D87A 3BWDD 3MAAC 4JMLA 4EKNB 1QVZA 1YULA 2ZR8A 1E6CA 3LWNA 1I10A 4B82A 1SBIA 2PS9A 1RJEA 4K3VA 3WRYA 2YDXA 5FNVF 4MA5A 1JAZA 3DHWC 1J20A 1QGYA 1P0PA 4HVBA 2OCBA 3A05A 3BE4A 1ONBA 2PX2A 4JLUA 3SS7X 4LCJA 3H0EA 1SC9A 4EKGA 1RXWA 1KJ9A 2EBUA 3RC1A 2J09A 2YL2A 1MR3F 3BFJA 3NBUA 1ZM9A 4HH0A 5DYTA 5HMLA 3TK1A 1R4NA 1J21A 1JIJA 4M0DA 4ALMA 4EYSA 1IULA 2J41A 4FSDA 5FAKA 2G88A 3IEKA 1I3CA 2MSDB 4B3HA 4KRXA 5G41A 2VRCA 2IDKA 2I6QA 2F67A 2IVFA 3ICQB 5AD1A 3VNUA 2XUDA 4FT2A 3QVSA 2D1TA 5E38A 2GF2A 3FTSA 3D7KA 1S2IA 3ETNA 3EIXA 2ZYRA 2QNIA 1MOSA 1UZMA 3FOCA 2L2QA 5CLFA 1KRXA 1VLVA 1BZYA 4JP3A 2J30A 3C7AA 1G5HA 4AXBA 1PZXA 1YIAA 5JS2A 2C29D 1Y5LA 2X4IA 4BQFA 3DLHA 1G8SA 3PK0A 3MRTA 4L5CA 4COKA 1BNCA 1F17A 3EXFA 3H6HA 1PFKA 4CN8A 1KK2A 1V37A 2Q45A 1J07A 1GD1O 3C6QA 2VSXA 3DDHA 3JQGA 3LA6A 3NBQA 3QF7A 5DBOA 5H5JA 4GTPA 3DMTA 3U7RA 4Q3AA 1NASA 3SFXA 1SQ6A 2OCAA 3SZOA 5FUWA 4LC0A 1OBHA 4QDUA 3YASA 1XDWA 2PX4A 1JQEA 1WABA 1N0IA 2A1TS 3JQAB 3QH4A 3IE2A 3L1VA 3QNMA 1A8QA 1B0AA 2J59A 2V8OA 4KXMA 4WKBA 4NC9A 3WYDA 3GAAA 3KVVA 4CU2A 3WK5A 1W49A 4KUHA 3RYFB 5L4LA 2BFCB 1GRNA 1QQ5A 5LUBA 3WJ7A 4TV8F 2NG1A 2VJ8A 5FTMA 2NWQA 1GGEA 4FC7A 3WMXA 4HAZA 3F5MA 2P5UA 4JITA 3U2QA 2OKGA 2I6UA 4QTUB 3ZEAA 4YUAA 2OEWA 1E4OA 4OHMA 3WGJA 1T13A 3COSA 5AHXA 3JQBC 4MW0A 1N2CE 4MWBA 4I4CA 5BWCA 3CCFA 1J7KA 5BYBA 1LTXA 4JP5A 1D1SA 4XX0A 3FHEA 1IB6A 2J67A 3VPCA 2R17C 3R75A 2XZOA 1XVVA 2AMJA 2GZDA 3OT1B 4AJ2A 1U7UA 3T7CA 3APDA 1U3FA 1E99A 1SIBE 2C2BA 3DKIA 3GUCA 4FYYA 5HS4A 1NYLA 4V24A 3T0FA 4BO8A 4FZVA 3Q9NA 4UDNA 3DTYA 2ZP1A 1COZA 1RPNA 5LZ8A 2OR3A 3SEAA 1U0EA 5IBCA 1ELKA 1GV1A 1CUEA 2VP4A 3C4JA 4KXWA 4QEKA 5GTDA 1TECE 3IPRA 1T24A 3NWBA 4UQXA 1NLZA 1PKXA 2GRRB 4TGLA 3P4UA 1D0IA 1SQ0A 1NQ5A 1VPEA 3PA6A 2RG7A 3TWUA 4FGZA 2G4CA 3HB1A 4HNAA 1QRDA 3T9CA 3U44B 4DCGA 2B9EA 2IP1A 3GPIA 3B9PA 1RW2A 1L4YA 1N6RA 2V6MA 3FEYA 4CZ2D 2HDWA 3AEUA 4ZT7A 4CETA 2XEEA 1LNSA 4IIXA 4JWKA 3RM3A 3FFWA 5DV9A 4A16A 3PWKA 3AIKA 2DRIA 3PE6A 2C99A 3ZY3A 4F85A 2BLLA 4IMIB 1FXWF 1L5HB 1WKBA 4UEJA 2H6HA 1WXEA 2Q8NA 3GLVA 4AJLA 1L5VA 1NBMA 2A0XA 4IZOA 4E0BA 3AVOA 3QBJA 5CYGA 5FUQA 1MRZA 2I78A 2AOTA 2G9UA 1PC2A 2J9QA 1TN7A 2Q5QA 1A71A 2ZIUB 2BI8A 2YHCA 1DAMA 1Z22A 2FR8A 4YPOA 1WB9A 4K81B 4DNFA 4FP9A 4EJMA 4WLUA 3PQ3A 3FPHA 3VU3A 4BV3A 4BIMA 2YX1A 4FLMA 4A1GA 5A0FA 5EQFA 1ZMTA 3DBRA 3L92A 4CIVA 1QC5B 3Q6NA 5IJ0A 3TCNA 4HMPA 3QSGA 4DCJA 4EH1A 5LVAA 3OJEA 1A8SA 2CNDA 4U7FA 2EFEB 5ECYA 4WLEA 2NXWA 1EA5A 3M6AA 3RYHB 3TEJA 3Q75A 3L49A 3N2ZB 3PPIA 4ZYYA 3QJZA 5CH3A 3HS3A 4GH5A 3B8EA 2PLRA 5AW3A 2FPKA 3V7UA 1G3NB 3VDXA 3KC2A 3UAWA 4EFKA 1ZJJA 1WHTB 4M21A 5E8JA 2YYZA 3ZW7A 2RI1A 4FD3A 2WD9A 1M8FA 1PYOA 1OCZE 2FEZA 1G2QA 1MAAA 1ZYUA 2CMDA 1OW3B 2JEOA 2WUEA 4EWLA 3AOEC 4M9UA 5K3FA 2PA0A 3MSXA 5E7QA 3HSKA 2XUHA 4JLOA 4UMEA 4H7EA 3LXUX 3CMMA 1JKIA 1Y48E 2B4QA 3PTAA 2W6NA 3OPMA 4JK3A 1QHIA 2IOHA 1O95A 4WBNA 3P19A 1G6OA 1N1DA 2OP1A 3E1GA 3WLOA 1TKBA 1Y6RA 2XRZA 4HXGA 3TQSA 2BM0A 4DQXA 1VE9A 3O8QA 1U8XX 4XCXA 5HQ3A 3LXMA 1PG5A 2QQ0A 2ISQA 2WBLC 1V25A 1GAEO 2IY9A 4F3KA 2VHQA 4IVQA 3V8QA 5ITWA 3KD7A 4RF5A 5LP6F 4N5QA 2HCRA 4OQDA 1AGRA 4GRIA 1Q0ZA 1ZC4A 2A0FA 5J47A 3HJCA 4HZGA 5CK4A 3MJVA 3OZFA 4JEMA 1NXTA 2ACWA 3WGZA 1LSJA 3OIYA 4D8UA 2X2OA 3O31A 2SKCA 2KMLA 2P3SA 3K9IA 2P4HX 1MGOA 1VI2A 4NDNE 2WTXA 1SOMA 2OCCE 2ZJ6A 3PZRA 1CQIB 3DOCA 4A0QA 4ACBA 1J06A 1NHWA 1UWVA 2WKSA 2R6AA 3EMDA 4KPEC 1X86B 4X7MA 4BXOB 1U1DA 4LF5B 1U2DA 4M0FA 5DN6D 3UWKA 3LT2A 3LUAA 4Q1EA 5A7DB 1IMOA 3N0VA 3V4SA 1WXFA 1M72A 2MINA 1G8AA 4M1EA 5DT9A 4IL5A 2FWPA 3JAKB 1HBJA 4TV9A 5FL7D 5DGXA 1GHTA 1G16A 4FGKA 1CEYA 3FWPA 3P4YA 5D6NA 4DMCA 3DMPA 1NNEA 4Y8VA 1F1BA 2OBMA 2QX6A 3OLYA 1K2WA 2BONA 2HEGA 1CPYA 2PGNA 4BAZA 5EWJA 1JSRA 1KZ7B 3REQA 1M7GA 2AW3A 5E4YA 1QVRA 1GDTA 3UAYA 1G8GA 4JI2B 4N5IX 1P45A 3QPUA 1WMDA 2QW0X 2QAGC 1ACMA 3R5KA 5B7QA 4ZYZA 3KB8A 1RCFA 4GEGA 2ZUBA 3SF8B 3QVMA 1DIHA 5KBAA 1PRYA 2A5FA 4G5SA 3LUFA 1UMBB 1JNYA 1M0WA 3H2BA 4HRAA 2GSWA 4EQZA 5GIOE 4YMHA 1GLVA 3UW1A 1U2ZA 1P0FA 3T8YA 3Q7SA 1Q7GA 3R5SA 1EF1C 1TXGA 3GH3A 1ELRA 4LMRA 5ALKA 5C3UA 2H1OA 3D9OA 4DV3B 4BJ6A 1R9NA 1IN7A 4OQYA 1KFKB 4Z99A 1JILA 1R8JA 1W9MA 1XTQA 5C34B 5HKOA 4H6WA 4AKGA 3NANA 3OLCX 2QENA 1WSAA 4HSGA 1ADFA 1NMZA 3PHLA 4RNDB 2E9SA 4Y2VA 3ADDA 3PP8A 2X7JA 3QJGA 4LVNA 1OCRE 2ZTSA 2G1PA 5CEAA 4WLOA 5JJKA 3DZGA 4JUDX 1ZCJA 4X8HA 4EG0A 4JLNA 3ITDA 5CMYA 1CDZA 1MJGA 5DM4A 3TL6A 3O8CA 1U2PA 3JD3A 4Q4HB 4QTZA 4QVKA 1VLLA 1JPLA 1REQB 2O8CA 3VR6D 1HMYA 4EBAA 3ZVRA 4IRUA 5E9JA 1N6HA 1XPUA 1F38A 4IIHA 3SZMA 4CV2A 3B6EA 4DANA 2EJWA 3B3AA 4YH1A 5JSFA 1UKYA 5C9ZA 1CQIA 1L5FA 2B7BA 2ZRDA 3CH6A 4FZJA 4P4NA 4B75A 1Q15A 1SD1A 2C4TA 1KAOA 3BSSA 4GXNA 5IT9A 3HM9A 5EY5B 4KLNA 3OM9A 3LC7O 3H9UA 5TGDA 2O8BB 4OB8A 1QWSA 1LF0A 1EE9A 1U5BB 3RF7A 3FMFA 2BFNA 2HH9A 4UM9D 5EZ6B 3ZS9A 3ICCA 2C5LA 3IT0A 1SA5A 4WCFB 4V02A 1JVSA 1RKQA 5EXSA 1ZNWA 1J8VA 4O6VA 3DEAA 1E1MA 4W8HA 3HE3A 1DWOA 1GGNA 1I9GA 1G18A 2VPQA 4M1YA 5L3RA 4PX2A 1DS6A 4KIWA 4MVJP 4JBYA 1AKTA 1O4VA 2D5LA 2AKYA 3TTYA 3ADBA 5A7FA 2RIRA 1XR3A 3QFTA 4YP7A 2UUAB 1KAHA 4GICA 3UXEA 4EHBA 3Q4AB 3ZUVB 4E07A 5K03A 2ODPA 2H06A 4FJ0A 1V1MA 1RT9A 2G1UA 2X8AA 2ZUUA 3NAWA 1W48A 2GPBA 3DLIA 5B12A 1WULS 3N2KA 4PFQA 3CF4G 5ABPA 4EJSA 1E8ZA 4KO1S 4DX1A 3GCGA 5EX3A 3H42B 3NFRA 3L6CA 4M55A 1QGED 3C7KA 2BHSA 2MTBA 4IUBS 5KYXB 2DTXA 3L82B 3QYFA 1I7SB 3BIWA 2BE7A 4GPAA 4AS3A 5EJ4A 2DE0X 1KIMA 5KOIA 2FEKA 1AC5A 2NLOA 5CT6A 2RFMA 4FLBA 2PN1A 2REQA 3C8MA 3KEFA 4Q3DA 2EKZA 4TYPA 4ARZA 3SQVA 3NETA 1ORVA 1KDPA 1QZUA 4W5JA 5J58A 2O8EB 1ABBA 1PFQA 1MHTA 3AL0C 4B45A 3HCNA 4H60A 4ZMBA 3IVRA 2QE7A 1DARA 3H9JA 2QDKA 1EJ0A 3MT0A 4KPYA 1SMKA 5BSRA 3C5RA 1XA0A 3LYHA 4O4IA 1NGSA 3U17A 3QEOA 3DJYA 4MYCA 4PQRA 4A8TA 4JLVA 5C5IA 3WOVA 2XNDA 1PR9A 7REQA 4G6ZA 2GEKA 4DIOA 4UAJA 1UJNA 3AR9A 2H6FA 3D3KA 4XW2A 3CLUD 4ZWNA 5BQPA 1JDNA 1LGYA 1T35A 2QRHA 2VQSA 4W1PA 4B3XA 2IYUA 4WW0A 5IJ9B 1PEYA 2CBZA 4LRUA 4PSAA 3V1LA 2VTVA 3CX3A 1E3EA 4RCVA 3ZBUA 4KG7A 3ZWQA 2BMAA 4YX9A 1RC8A 3X1DA 1T0JB 5ALFA 2Y76A 3G1TA 1QO7A 1TK2A 2XZDG 2WFLA 3LHKA 2KXPC 3DAHA 3MMXA 4MV0A 1XN1A 4KVOA 2DPLA 4IGAA 3VLFA 3CF2A 5IF3A 5U9CA 1L8LA 1X7DA 3PH0C 4RZUA 4XPIB 4JC4A 4C5CA 4DY6A 2DPMA 1M9NA 3JZDA 2EHDA 5A6SB 4P7KA 4YJGB 4RL6A 3RC8A 4FMDB 1EFUA 2XBUA 2VDPB 1X7WA 1KJQA 3FYHA 3GEBA 3PNSA 4R5HA 1AMOA 5JASA 4F38A 1A9RA 1P9LA 4R81A 3JYSA 3SC2A 1XNGA 1V43A 2KLBA 4QOSA 1Z18A 4U2CA 1OC2A 1YACA 3D4LA 5ALGA 3MINB 2PZAA 3C3WA 3I76A 3HDVA 2I6XA 5EMHA 2CZQA 3TLGA 1FP4A 5H68A 3PFIA 3D59A 1YFZA 3ESAA 2W2KA 3WLRA 2QJFA 2XUQA 4J2HA 5EKXA 1QG2A 2H7VA 1FUEA 1O5OA 1VPDA 2Q3HA 3GG2A 5K0NA 3K7EA 4J0UA 5DGCA 3UM3A 1MW9X 4U7JA 3V1UA 2GTHA 4C0LA 1ST3A 3WAGA 2DHRA 1EFTA 2WJHA 3HR7A 2C61A 4JI8B 5AVOA 2V8SE 3JCKC 1V1MB 2HMTA 3G7UA 1UOPA 1V5EA 4KWEA 2J46A 4IO1A 4R3WA 4DIDA 2EKLA 2ILRA 1Z25A 4KTTE 4JSRA 1ZISA 4KYOB 5EHGA 2F1RA 2WMDA 5ERXA 1G8PA 4GI5A 4I2VA 4IDNA 3K9NA 4XGIA 4RTSA 1ML3A 3D3WB 4G84A 5K6AA 1EJ2A 2X5JO 5FWYB 2BGNA 5HM8A 5LMNB 4HZUA 4CR6A 1ECLA 4QFMA 1V45E 2DLCX 4J4BA 4LYEA 3ACCA 4IV8A 5AOVA 3HO1A 4ITRC 3LVQE 4HI9A 1EJBA 1QG4A 2C95A 3PI7A 4ITVA 1U8ZA 4REQA 1TM5E 1YQUA 3D3JA 4BECA 2BR5A 2I2BA 1YB1A 3CH4B 4DQKA 2D6FA 3LXRA 4X20A 4J91A 1RWNA 4HQDA 4KQ9A 4O3FA 1HG1A 5JSYA 1NPDA 1E2FA 2DGDA 4JXJA 5HQJA 4BB9A 1O5TA 2ZG6A 3OCXA 4NEGA 3ER9A 3S40A 1LZLA 3ABOB 2DKOA 1GG5A 2P8SA 4L8VA 4O2AA 3K92A 2JZNA 5BXOA 3QE2A 1GN9A 2R0QC 2LWIA 1XSEA 4WBSA 2I3ZA 2XNSA 3STXA 3HJHA 2WM9A 1UINA 1Z4NA 1CEXA 4LY3A 1NG9A 4D81A 5JIBA 3RIYA 2Z4TA 3LE8A 1WV1A 1YBMA 2PEZA 3ABIA 2UV8A 4F5ZA 3P9ZA 4EUFA 4ZYXA 5C8YF 4GT1A 3JQ6A 3IEIA 4LJ9A 5CU7A 3B82A 3DL0A 3WG7E 2ZSBA 3WGIA 1CJCA 1M6HA 2AXVA 4H1UA 4EGSA 3DRAA 5D5PA 4ZC8A 3AUXA 2R44A 2NNWB 2QLNA 4DXAA 1MW8X 5LX8A 3IIMA 1PWHA 2IEZA 1P4HA 1TUEA 1UBMS 2WYIA 2YZ7A 3WYEA 1EHIA 2GN8A 3I6QA 1Y7TA 2D7DA 2RCYA 2F1OA 4QE3A 3ZZNA 1XXLA 5GONB 1YCHA 3A9RA 3AR4A 1DBIA 5C18A 3L7NA 2PUCA 4IV5A 5AKIA 4MR8A 3SC2B 3GVCA 3WKEA 4N0DA 3KQUA 4PPFA 2VHVA 3GBSA 5E3JA 2JIOA 4PYKA 1XF9A 4X65B 1EVZA 1JLSA 1HLDA 1XWFA 3QWWA 2P9SG 3OBBA 4BEJA 1GL9B 3J81k 3EEQA 3JWGA 4P5EA 4RETA 3TE6A 2O2YA 4E5UA 4DGSA 2V98A 3HXMA 4GPTA 4ID9A 4L0DA 5E3HA 2AG8A 1WW8A 2DYRE 1U0JA 1WEHA 2P6PA 3EK2A 2B8NA 3GEDA 3P9RA 4FHFA 3AIMA 4PFSA 2AOTB 1L1FA 1XTPA 1KWGA 4P4SA 4ZAZA 4LCBA 4ZI7F 4GPEA 1T2DA 3UM2A 4F7AA 1L7DA 1M34A 4XVHA 3LNCA 4I99A 4R3NA 3SIPA 3WNZA 2J6IA 3A2MA 4QHYA 1TW3A 4QQKA 4M1OA 2C2LA 3LPDA 2VJQA 4K40A 3BSYA 1GQFA 1CKEA 3VH3A 3EXEA 1QE3A 4OSEA 3W5IA 1XX6A 2NNLD 3M5PA 3NHJA 1OX6A 4BVEA 3MBIA 5EUQB 2Q49A 4FFBA 2IYOA 4M7WA 4HRXA 3FH8A 1EFLA 3TSAA 1T91A 1AHNA 4EZKA 4HRVA 4RH0A 1H6OA 4YLEA 2QRUA 3OZCA 3MKQA 1ENPA 1SUPA 4CLRA 4BT9A 2YYSA 2QW1A 4B3MB 3E48A 1OILA 2PZJA 3L8GA 4C06A 1OFGA 4CL8A 2UKDA 1LPMA 4RJKA 4EEKA 1QCDA 3W4JA 4D97A 3J5QB 1DIRA 3EC2A 4KDFA 4RABA 1XO1A 5I4KA 1ZITA 3N0RA 2P0AA 3QKSA 1E4VA 2DFTA 3L18A 5AI0A 4BJ5A 4CTKA 3EAFA 2IVZA 4E2FA 3IRVA 1R9MA 1S7CA 2WKQA 2WZDA 4K6GA 2DPXA 1HDZA 1ZN8A 3L7OA 4LV8B 4BX9A 5LQJA 4KYVA 4LUNU 3EWIA 5EPEA 3RC9A 2H4FA 2F8TA 2OM6A 3IDFA 2WU4A 3SBOA 3RIMA 3FYCA 3N8DA 3EC7A 3V8MA 3ZX4A 2O2CA 5BWNA 3FSJX 4DSAA 5EFOA 1QH8B 3R5TA 1UOHA 1WPGA 4X6UA 4KI0A 1KP2A 3JSXA 2IX3A 4QVGA 1NY6A 1PL7A 2NXJA 3CUUA 2MSKA 3CZAA 5C5EA 4E85A 1LEHA 5K3SA 4ZTBA 5TEVA 2Q4OA 3GFOA 3WWDA 1G5TA 3IPAA 3DAFA 5EXTA 5CVDA 3K9HA 5SY6A 3RFVA 1SXIA 3T3NA 1IXRC 3W5AA 1GPYA 5LQDA 5DCLA 5KWIA 3AM3A 1II0A 3LYAA 1M2GA 4F53A 2RHDA 2WFAA 4TWIA 3U4TA 5BWBA 1MA3A 3LZDA 3OZEA 3TI9A 3T1YB 1FPPA 1HNNA 4DX7D 3CHYA 4NE7A 5ITZB 3C3PA 3FHTA 5AJHA 1JHZA 1Q12A 2P40A 3PQ4A 5K0EA 3ASOE 1NN0A 3MVEA 4QECA 5KTMA 1ZOPA 4YCJA 1RQ7A 5EXDA 3ZHOA 3A9UA 3HZZA 1DB3A 1FBTA 1IY8A 3GGDA 3IVMA 1ZGHA 4MA0A 1T1JA 2PKQP 3RDPA 2VNAA 2VT2A 4BNDA 1HTWA 1IONA 2J3HA 5GV7A 3GPDG 1CB7A 4YY3B 2XA9A 5EG5A 4H7DA 4FW9A 4G0ZA 5FNVB 2GZRA 3II6X 3DTTA 3DD1A 1DXOA 5CB4A 5IBPA 3AVPA 3QHPA 3D1LA 4YTEA 1YJCA 1B74A 2B61A 5EC8A 2I4LA 2Y1OA 3HYTA 5BQFA 1YRLA 1X9HA 5GJWC 1F6BA 5FOWA 1HNXB 5JECA 1BI8B 2TSYB 1ULHA 2OLEA 1Z63A 1MIHA 4JI5B 3KJQA 4HFJA 2IHVA 1B76A 1UMBA 4H3VA 3KKLA 4FR2A 1GTJ1 1O8BA 1P4JA 1CEEA 2V4HC 4MWEA 4U7PB 1YZFA 1WUIS 2Q7DA 1UFVA 3FMIA 3R6GA 2H0RA 4F72A 3B48A 1P5JA 4Q3NA 5HHTA 2WU0A 3QITA 4HTFB 3KSRA 2QSZA 3V3KA 4UOEA 3JD0A 3H1GA 4N5MA 5JALA 4LVCA 1V1RB 1Z62A 5EMJA 4FKZA 1EVKA 3V31A 1BWQA 2O5RA 3OY7A 1LSSA 4NNJA 4Z8YA 5DTIA 4B6PA 4ED9A 5K0ZA 1Y8CA 1RXSA 1C7EA 1H4SA 1KYZA 3UWMA 5B3KA 4IJ6A 1EAYA 2XOKD 3CO5A 4U7WA 4GMKA 3ZQJA 3I37X 4RTRA 3FNFA 3KP1A 2IGTA 3MV3B 2DBYA 4XAQA 2GRPB 5FO1A 2B92A 4NNPA 5A1TA 2H57A 2WU8A 1ULBA 1O03A 5DN9A 2HPHA 3A25A 2H1HA 3N53A 1ZSYA 2B2CA 2O8CB 4NDZA 2E48A 3VU0A 1ZNQO 1AU9A 1QKIA 1U3CA 3G1UA 1OT3A 1BVYF 1CFJA 3KJNA 4UTZA 5D1NA 1GR0A 1HEYA 3PNYA 3Q73A 2XCRB 3V1NA 1X0VA 4DJTA 1UMDA 4X8QA 1FP7A 4KH0A 1K9SA 3SOPA 4XQCA 4UQYA 1MB2A 3CLTD 5FHRA 5H02A 3E7DA 3QTLA 3PE4A 3BN3A 2E0IA 1Q14A 4QUIA 3G0BA 3NAGA 3JASA 2HRDA 1L4KA 3QIVA 4LSZE 5IY5E 1YKSA 4BFRA 3VU8A 4A6EA 1N9GB 4JKOA 4E88A 1PJSA 1BGWA 3D6FA 2WKPA 3D7NA 3IAUA 3NR2A 5ALLA 2MYOA 2OFFA 4HDRB 4RA9A 4ZV4A 1H2TC 2H1CA 4EA6A 5C7YA 4NJMB 4OX9B 3NOOA 4U07A 1BROA 4M0CA 4I3HA 5AOAA 2CXXA 3RADC 4ZVPA 4GYKA 4J07A 4BKRA 2FXVA 3HBLA 2VTBB 5L9AA 3L93A 1C1XB 4OMUA 3TBHA 4LWZA 3TQIA 5H1YA 3V1YA 1KU0A 1XROA 3C24A 3ET5A 3TQFA 3QXJA 3C1OA 2YC4C 3QXGA 3EQZA 4KWIA 2QTWB 3H05A 3RU9A 3RU3A 3T3IA 2OCYC 1I7DA 4RPKA 4I1SA 1V3QE 3D5EA 4ZCSA 3RARA 4PBTA 4TTAA 4D6XA 1QMPA 1P18A 2QL9A 5TGTA 3HNPA 1DFGA 3OC6A 3MUEA 4F9EA 3WIVA 3ASGA 3NU1A 4X90A 4ZOCA 1YJ8A 4MKTA 3R6TA 2A57A 4RTLA 5BPFA 1ZMXA 3EULA 4B6SA 1K8RA 3KX2A 3P2BA 4PPGA 4ZAYA 3IAM6 1HRKA 5IZCC 1QQ6A 1T0IA 1AIPA 3GRAA 3IUMA 2IXEA 3CQGB 1WP9A 2QT1A 3DV9A 2LZ0A 4MCHA 4AUEA 2WE7A 3ZYLA 2C5AA 2IY0C 4FI3C 3JQAA 5DX8A 3QUAA 3KQOA 3FR7A 4IJMA 1WQ4A 2PRIA 1EUCA 1BFKA 3K4PA 1OXKB 2RIPA 3JZFA 1W25A 1CE8B 1T25A 1XQVA 1ADBA 5DZSA 3FHLA 1NBME 5FI1B 5TQ0A 1T6YA 4XQEA 2ZYAA 5A3QA 3IURA 2QP4A 1U0NA 1T3GA 1EESA 2PV0A 4UOQA 5FOXA 1FQOA 4MYRA 1FX0B 4MP6A 4DT1B 4F2WA 3HUEA 1T43A 1PS9A 3OLXA 1FXUA 5EIEA 1N5OX 3K70D 4CCYA 3P5BA 2WMNB 1XNJA 2W5UA 3Q5GA 4KQMA 1V11B 4XM1A 3VNQA 1JYFA 1J39A 5KQPA 2CD7A 4JHRA 4U7HA 4DCMA 5ENPD 5AOBA 1T8TA 1W5FA 1ZJYA 1A50B 1PZMA 2PGIA 3PYMA 4L5IA 2ES4A 1E9EA 3OQHA 4RKQA 4AZWA 4J16C 5INTA 1M7HA 1PQUA 4FOLA 1AGXA 1K8QA 2WINI 1BVHA 5AM4A 2AC7A 2EP8A 2Q21A 2XJ9A 4NBTA 4WHMA 3MGAA 4BDTA 3RO3A 3L0SA 1N3YA 2CE2X 4HDAA 1VKNA 4JBHA 2YJZA 3IEUA 4X1KB 2C8LA 1EX9A 2I80A 3ZWCA 1B8UA 1EWTA 1N6KA 5L3QA 3KQLA 5TS2A 4HOQA 1YS2X 5IH7A 3B6MA 2FQYA 2EIHA 1NM5A 4YAFA 4KPUA 4HEQA 3K30A 3OICA 1U7ZA 4ZU1X 1WXGA 4Q24A 5DN6A 3M70A 1VKOA 4HWPA 2ZYHA 1KZ4A 1PDWA 3ANLA 4A9AA 2JZCA 5BW4A 1IEXA 4B6FA 1AURA 2EG9A 3ZYMA 3OM0A 4GP7A 3ROMA 4BFVA 1RLTA 3NALA 4WBNF 1WOMA 4YRAA 2DUMA 5FUMA 5ALMA 2H9IA 2DLDA 1JFTA 5G4LA 3FMPB 1OTHA 2F90A 3RPEA 3ZJYA 2ZOSA 2DBRA 2ACVA 3HYRA 4LNHA 4M49A 1C8VB 3G8CA 4MI9A 5CNKA 1JT9A 3UQYS 4Q9LA 4B3DA 3RAFC 3OE4A 4PC1A 4PGGA 2VGYA 4PLGA 2YWDA 1UJBA 3ULYA 4R2WA 2VDJA 1SPXA 3U5TA 2CXQA 1KVUA 2BKUA 4OL9A 4UD2A 2D8MA 1RLMA 4XFKA 1KY3A 3HWX1 1D4ZA 5CEFA 5FWYA 1YTLA 1JCRA 1YOBA 3VQTA 3AUYA 2XNKA 5ENNA 1XZIA 4HPJB 1NRIA 3C3RA 4DIEA 4RZSA 4GW3A 5G1OA 2P4SA 4P7FA 3UJPA 4AKHA 2RI6A 5HTKA 3C3KA 3DYBA 1FDUA 5EIOA 1KA9H 1XTSA 1Z39A 4YRMA 3E30A 3EAQA 2FF5A 1JFLA 3ITNA 2IYFA 3R23A 3REFA 5DHAA 3DEHA 3EW9A 2PUDA 4O2AB 5JXGA 5B53A 5CVCA 5HUJA 3ICVA 1OWLA 3CZPA 4O2LA 4YMTA 1EVIA 3QI2A 3GRCA 3ZN2A 1L4BA 2ADFA 3AY6A 3L8CA 4CIDA 1QDUA 1ISFA 3CZMA 4YV7A 1SOVA 2FUG1 2YUTA 3OWOA 4FFSA 3FOZA 2O5EA 5FFMA 2AN4A 5C8YB 4Y9DA 4MDHA 2PQRA 3BUAA 3KJIA 3CLSD 3G0DA 3KPUA 2P5TB 4IICA 1O0CA 3UJ8A 1RPTA 4DF3A 1RI5A 2EQXA 4BZQA 2F9MA 3F2IA 5TT1A 2XOKA 1IBKB 3FTNA 3HVRA 2KCVA 1DIGA 2P3LA 1NVEA 4ZOLF 3RTGA 4P3NA 3V8EA 1JT2A 1DQRA 5FAXA 5EE3A 4RU1A 4F46A 4PCLA 4YT2A 1ZBQA 4DCTA 3K6KA 4URWR 3FH7A 1OKKA 2VBFA 5F9HA 3AY0A 1JCQA 2FHSA 2PKRA 2QM0A 3BKXA 3KT3A 4PF1A 1XEWY 3GZ4A 5BN5A 3W5JA 2JKVA 3GCDA 4WNGA 2X76A 1TEZA 3R3VA 4HJXA 2AOWA 3L40A 4AJ1A 2XAUA 1FTGA 2DY0A 3AVYA 1KBZA 1MP0A 4MB2A 4UVDA 3L06A 1G291 1KBOA 4C7BA 3PNLB 1GNVA 3OEHD 5AJWA 5ALHA 4WEQA 4HGRA 2IA5A 5AT1A 4YT4A 2EVWX 4FS3A 4U2FA 2LE0A 1KK0A 4I4IA 3H1BA 5A23A 2W2XA 3IBSA 4HAIA 3GRVA 4RK6A 4ZOLA 5EWLA 5LU9A 4XWOA 1F3OA 3U4IA 1D4AA 1PX2A 2ECKA 3GDFA 2ACEA 1RHUA 2GRAA 4OGLA 3TOVA 2FSHA 2XPYA 1JLLA 2A4MA 2PTHA 4G1VA 3N0TA 3IP1A 2CK3D 1YUBA 3FF4A 3OLVA 4MZXA 1L5SA 1P60A 1E64A 1ZWLA 4FDUA 4JYPA 4BJ3A 5HJEA 2FMHA 4DJDC 1HFJA 1HR0B 3JRWA 5WRFA 3UPUA 1NYQA 1WBDA 2Z2KA 2IWHA 3KR1A 1X1QA 2WSIA 4DMUB 4DY4A 1WXIA 4KHPB 1KH3A 2O57A 2P77A 4PW0A 4QPJC 5LNK6 5L7WA 1WVMA 2ET6A 2H5EA 4EO4A 3GNSA 3A4VA 1MU0A 4OIFA 3S2SA 2FPSA 4QJIA 2Q6TA 5KNDH 3ED5A 2AN9A 1AD2A 3NAMA 4R01A 1GKUB 3RUAA 3MTIA 1PR2A 1RI1A 3JTMA 3HSSA 5TV2A 2P90A 3N2YA 4OXXA 1JKMA 1GY8A 1K08A 5ICFA 4P3OA 4XFJA 3VGJA 4TYNA 5BQ3A 1SVKA 1DIAA 2CFCA 2JIMA 1XAHA 3IC5A 4KK3A 4DV2B 3ASZA 4II7A 3KKQA 2WPNA 4Q4AA 3HL4A 5CA1A 4UXHA 5TNXA 5YASA 3FOAA 4PNHA 4F8JA 5ALIA 5T8IA 3SVZA 2ZGDA 1SN7A 3A1SA 3ADKA 1V41E 3UIPC 3E5MA 3L1HA 1FDOA 4KREA 2XQFA 4LRXA 2Z6AA 2KQUA 3U7GA 2ZT6A 3L13A 1FRZA 4FXPA 3PCRB 2AZMA 2Z2YA 1IK6A 1ELWA 1VL2A 3PC8A 1YR8A 4K7JA 3KS2A 2AW5A 2NIPA 2XOXA 1QOZA 1AKNA 3TQCA 2JPDA 4OO3A 3R7FA 3ZY6A 2F6RA 4RVBA 3QTTA 4DCVA 5KDDA 3SZLA 2X6FA 1WB6A 5HR5A 5L6MB 2O8DA 4L27A 4WECA 3ZQUA 2AQIA 4N6OA 4EP1A 3C43A 4X1YA 3T15A 3RAJA 4JB3A 3ME5A 4J03A 4QGHA 1L5ZA 3DKRA 1QRSA 3I5MA 2R8XA 3A4IA 5BNIA 4OOFA 5F21A 4APFA 5TQVA 4M9ZA 3SE0A 3VZPA 4F5EA 1X7YA 2VOEA 4GI7A 2AN1A 4Y2TA 3RC3A 1P1RA 2RAUA 4APOA 2AEJA 2WD8A 4I14A 5J63A 1ZGAA 5AO9A 4NY1A 1KO4A 1OT5A 4KE8A 4WCFA 3NIGB 4R8RA 2PX8A 1CRZA 1Y7HA 3GK3A 4URVR 3JQ9A 2NTYC 4L1KA 4BWYA 1GTSA 1S3FA 4HWTA 1OV6A 2ZE6A 3CQCB 3C3OA 3VR3D 5KQGA 4YJFA 2ODNA 4YCBA 4S35A 4ZFHA 4KXQA 1ORWA 4MV8A 1B1CA 5CLQA 5JAUA 1BXKA 2PFSA 2YY7A 3DAOA 4V0OA 3LC1O 2GD2A 4TX1A 3ZW9A 1OZFA 2HPVA 1OI2A 2DBAA 2AG1A 2PUWA 1HWYA 2NU7A 2VHYA 4JIGA 1F14A 4XH9B 4CTJA 2AVNA 5A5EA 5L4SA 2B2XA 4X62B 1H3NA 2I2AA 3QVVA 2RGYA 1DAKA 4MCJA 2OC9A 2IXAA 1Y3BE 3QOUA 2X38A 3GRPA 3R0IA 4NEQA 5K3FB 1DJPA 2X22A 3S99A 4E5NA 4BJ1A 2PH3A 3MTAA 4PLVA 3A3YA 1EFDN 4A8JB 4UUCA 2GWRA 4A0RA 3KOMA 4HNSA 4NZOA 4RPLA 1RYFA 3VZQA 4AG3A 1DCFA 5FPPA 1UXGA 1DOAA 2XW6A 4IILA 3LW7A 4W9NC 4ZVRA 5C2JB 5HQ3B 1VLJA 3PGVA 5EHNA 2GN1A 2IYRA 2H48A 5BSFA 3NOXA 8ATCA 1YONA 1TNUA 5JFOA 2YIDA 1NRJB 1ZJ4A 2BP7B 4JN6B 3SBXA 3SQOA 3WTCA 2DVMA 4ANVA 1M0SA 2EDAA 4NABA 1B42A 5K3CA 1CJSA 1QUEA 3U7JA 1UKVY 3QOWA 1O1RA 1S9HA 3E3LA 1Y8RB 3UB4A 1JHQA 4QU9A 2XCUA 3WDMA 2NU9A 4UUAA 2Z1MA 3NBKA 5F73A 1XEAA 4KQIA 5EZYA 1BX1A 2I1KA 3AU9A 1MX5A 2W2NA 3B1FA 4NK5A 4P81A 1LSOA 2H65A 5DNAA 3ZOKA 4ARUA 4BVJA 4ILKA 1SHJA 5BVGB 1CR0A 1T29A 3NNDA 3QXSA 5DNVA 3CLTC 4E46A 3LCAA 4CG3A 1I1OA 2QXYA 4JUBA 3AFHA 3USES 2ECFA 1M6NA 5ALTA 1IN8A 4L50A 4MUYA 4TLAA 4IEIA 1Q16A 1IM2A 3AR8A 1LRKA 3U3WA 3BQOA 2X0JA 5HVNA 1DFIA 1WCIB 1SULA 2P5YA 4NSNA 4TVKA 1A3CA 2VPIA 3H2IA 2UVPA 4DCNA 2M6SA 3H86A 1ZC3A 1DNPA 3GT0A 2GUWA 1QHSA 3GO4A 3VSAA 3H1EA 3V42A 5TS3A 2VYIA 5KNHD 1N52A 2I67A 2JJQA 4BNWA 5BV2P 2E5FA 3Q9SA 2Z6UA 1O5MA 3SNXA 2DFKB 3IAS1 2PMCA 4FFDA 4INOA 4R1MA 3ZDFA 2VYVD 3AEXA 3FNEA 3CJRA 2NSDA 3JZMA 4IGEA 4MB6A 3G9TA 1XD9A 3HVHA 5GONA 3R3WA 4NL4H 3PJRA 4OYHA 1XMSA 2MR6A 3CWCA 1C3XA 1P1BA 1U98A 2C59A 3D81A 4L9SA 3W5UA 1P6QA 2YQ8A 4TRQA 3E6AA 4J0HA 3LCCA 2XTJA 1ETHA 3PT9A 4JSTA 1VHQA 3GN1A 4KVFA 1U3WA 3U3RA 3H97A 4A1SA 3VZRA 1FEZA 2B37A 3HYNA 1ULAA 2BEVA 4GBMA 1T36A 1HEIA 1L4HA 1VPLA 2CLKB 1ZIOA 2CXRA 2ODBA 1N1EA 2OHVA 2OXEA 2FKNA 4QT4A 3HKDB 4GZ5A 2E89A 3F47A 1QP0A 1PS0A 2E7ZA 2PRYA 1SVIA 3G2UA 2GUGA 1DBPA 3CV0A 4BN5A 2DYSE 3FOEC 1N9ZA 1C30A 3I64A 3LBNA 1ACJA 2NPFA 1JYSA 2X0KA 4LW8A 2FE1A 5FPYA 3THXA 3JYLA 1NW3A 4KJXA 4G86A 1JGTA 3R0VA 1R6VA 1PJTA 1PT5A 3ZU2A 3WK8A 1SKYE 2FR0A 1XA4A 1YRHA 2G08A 4YUZA 1DO2A 4M86A 1AKWA 1OE0A 2W6IA 1E20A 3NPAA 4IDFA 1E2HA 2IV3A 1QANA 4B7CA 4BNJA 4JV5B 1R7RA 3Q0TA 3G68A 4IIDA 2G9NA 1C4WA 2QLBA 4CL0A 1M8GA 4N03A 2Z6VA 4DAOA 2Y71A 1YL7A 2GM9A 4Q16A 4QLAA 1OYWA 4TXMA 4GZ3A 2GZHA 2FMFA 4BT8A 2FLWA 3E82A 3HADA 3I28A 3KL2A 5LZ7A 3N5KA 2ZQZA 4GQBA 4KW7A 4L78A 3ZDEA 3ZIDA 5DM60 4UUNA 4FONA 3QNWA 4LRWA 4B71A 3R9IA 1AKRA 3OY2A 4TXHA 4W63A 3VDNB 4AK9A 2FZ5A 3ZHTA 1F06A 4CEHB 1GZUA 3UJDA 4GZ6A 1TTTA 5FBZA 5BSHA 1FNNA 4JB8A 4PX3A 2XCLA 3IVXA 2A1UA 4LXYA 2P6OA 3R7DA 3DFMA 1C0EA 3ZK9A 1D9XA 1EXDA 1E5TA 3ETLA 2EYQA 3KBOA 3VU9A 3HN6A 1JQKA 2X4LA 3O4JA 4O4JB 3EZYA 4NPHA 3UNXA 3ZZ1A 4H3KB 4CCYB 2RKWA 4MEAA 3PDIB 5G3ZA 2L0IA 1HDOA 4IHQA 4UE3S 3CVXA 1WEKA 4LNUD 5KCZA 4QU8A 4U7DA 4JC8A 2WDPA 3O8LA 2XZTA 1QNFA 1QUFA 4OUDB 4PNEA 3FH0A 5TB5A 2YOFA 4U4AA 4DC9A 3WBFA 1KMCA 3JPYA 4MMXB 4M89A 4KSCA 1TC1A 4EI9A 3GJ4A 1ZU4A 4Y1EA 4O4LA 4LY9A 3T3DA 3CVVA 4LJYA 5H83A 1TYDE 4TMVA 2BUAA 4BMDA 2F4VB 3QYAA 4ZK6A 5L3QB 2XV1A 4YACA 4DVGA 3W6OA 3L2OB 1QQEA 2DQZA 2P2LA 3UMFA 1LXCA 1QPZA 2D4HA 5AICA 2XWPA 1L7AA 4L9WA 1QFZA 2C42A 1IL0A 3F5DA 4OV6B 1MQAA 3KSUA 4PC7A 1ISMA 2QAGA 4ZQGA 5CDGA 1FZTA 4DLSA 3E5RA 3QPVA 1VGRA 4C07A 2HJHA 3Q78A 2DWPA 2O50A 5D7NA 3RAPR 3AWIA 3SYNA 2AXZA 1FDTA 3NF1A 3BKWA 1ZK2A 4KPGA 2BHTA 4X1IA 4DE5A 4E6PA 2VUIB 2HYIC 5BSEA 4EITA 4OHKA 3L82A 5KYXA 3WQBA 5E75A 1TDJA 1X94A 3IALA 1H85A 5K4HA 4U39A 3SY2A 1C3EA 2B2NA 4GF5A 3NTXA 3T9AA 1ISPA 5B1AE 2BV3A 3K0CC 1ZLYA 1XDDA 2P6MA 4GA0A 2VCHA 4XR4A 2CVFA 4YUYA 2PVCA 1BMQA 1C30B 1H1LA 2QMZA 4I2ZA 1P33A 4OYLA 3CS3A 1N4RA 1KAMA 2DP4E 5D5QA 1DTSA 2WXMA 1UJJA 3S7BA 3RS7A 4XGQA 4EEZA 3G2VA 4WFJA 5MFZA 4ANFA 4OXKA 1YVRA 4M2LA 4XM0A 4UE2A 3H4MA 4DJAA 3ENVA 1EX7A 3ZY4A 5F1KA 1U99A 3V33A 1DKUA 2D2FA 5DGTA 3MGKA 2OQIA 2VR1A 4ECEA 4PN3A 1OI3A 5C1PA 3IE1A 5GOZA 2EX0A 2HIAA 2QD2A 3KQSA 4U0JA 3TFQA 4GA2A 2DYKA 2OECA 2CG2A 2JBAA 3BREA 4BCCA 1J9ZA 3EZ7A 4DQ0A 3E32A 2K6GA 4OQ4A 1H42A 3NTVA 4XX0B 2ZR9A 5LLSA 4KRYA 1KETA 6NULA 5IJ9A 1W5AA 3AX6A 2PQ6A 3M5WA 4LISA 1Z6TA 1UBUS 2KX7A 4Y98A 2O05A 2C8KA 4FP7A 2BM9A 4MV1A 4G23A 2FW8A 4MA4A 4P4LA 5CYOA 1XE3A 3E2MA 2EGHA 1WVGA 3I09A 3VU9B 3I30X 4TS3A 3R7NA 1RRFA 4XUDA 5AK3A 5C37A 4FNAA 4UU8A 3RSCA 4JUFA 3RBAA 1VLMA 3IB6A 3QBVA 2YVUA 5AFSA 2JH3A 3KT8A 4G0XA 1LBTA 4LECA 3GF4A 2OY0A 1CV2A 2GPTA 4B3JA 5BOSA 3BIXA 3I2YX 2VFAA 5KNLA 3ERCA 5ALPA 2IUUA 4YP6A 5HUQA 2WXHA 1CU1A 3JQQA 4UI9K 2HA5A 2VPYA 4G1FA 4R6XA 1XEXB 4CMCA 2V7VA 4OG2A 4YXWD 1HTTA 5FBWB 4BKQA 3PC8C 3AHGA 2J5BA 4KU4A 4Y6QA 3G9ZA 2XZLA 2JH8A 5JHBA 2HEIA 3HGQA 3GARA 3RNOA 3WG9A 1AQJA 1HE8A 1E8XA 4GTQA 1JHAA 2E85A 2I8CA 1V7PC 2R751 4N5CA 2X1HA 4TV8B 4O0MA 3RVPA 4CLEA 4EHLA 3PCTA 1T9KA 2R5NA 3DE4X 3FUXA 1P74A 4D46A 3MIIA 1AE1A 4MRMB 2I4MA 1S3IA 2QQ5A 3AXTA 3O3MB 4IF4A 3EVNA 4LX8A 4RQUA 2UU9B 3GYBA 1EFCA 2XD4A 4PQYA 4QLBA 4TTSA 1SCIA 4TRRA 4IM7A 5D3MA 5IUNC 2EGUA 4JODA 5LOVB 4NCAA 4ZDJA 1EBUA 4B8YA 2Q2NA 4R2HA 4R3UC 2AR0A 1TJFA 2ZJYA 3PD1A 3DEPA 3A1EA 4PG5A 5B1SA 4Q48A 2C5EA 2DVWA 2FQWA 2JGDB 3THRA 4BTEA 1R00A 1E6WA 3TMYA 5LP0A 1JG3A 4REQB 5A7HA 2XUFA 3G2HA 2ZT8A 3MKRA 4B3RB 4V3CA 4PV7A 3HR8A 2EILE 1R1DA 4HVAA 3SYMA 5AR1A 3O2NA 5JANA 3DFUA 2JGJA 1H69A 2P9YA 3K9GA 1EFVA 4Q1FA 5ECGC 3JXEA 4IOKA 4HADA 5BQXA 1RQNA 4JI1B 5FV7A 4FSHA 4H3SA 2H5IA 4GSKA 1NR7A 1X1EA 1ODIA 1MXFA 3EUWA 1Y6FA 5LKAA 3WLTA 1JL3A 4U0SA 1WW2A 1BJRE 1T9CA 2FZGA 2CLFB 4YNDA 2Q8QA 3AEKA 3OPYA 1U2QA 5KHOC 4K9SA 5DP1A 1AGNA 1WY5A 2HYZA 3FDXA 4R68A 2XTAA 3QYJA 4W9NA 1F8UA 3EXHA 1DV2A 1KNXA 2XHZA 4NTZA 5CDFE 3IDSA 1NVMB 2NQ8A 4V03A 4DUGA 5KEIA 4WK4B 1BOFA 4C1BA 2QYTA 1NBHA 1N75A 3N6XA 2UVDA 2XKKA 1CS0B 1QP7A 5KOJA 3CN9A 2BLNA 1G3QA 4FQ5A 4Z4GA 3FB1A 4A3TA 1GSHA 3QNUA 4MIKA 4AO8A 1KEZA 1GV0A 1P44A 1YCDA 3DEFA 5CFPA 3LJNA 3DLAA 1D2EA 1K6EA 5F78A 4AP6A 5A1JA 5BSWA 1XZNA 3TWRA 3DE7X 5I7SA 5IMBA 1YCFA 2EWVA 2QAIA 5GJVC 4C3VA 4P2GA 3D2BA 1JR3A 3KPVA 4B3IA 1U0BB 2Z8YM 4U9UA 4ALLA 1YVPA 4P3KA 5ALOA 5AAOA 1P8JA 3JV7A 1XZHA 2YHIA 1ZD3A 1X1AA 4L8YA 1WDMA 2UYGA 3FTQA 2FGKA 4F8YA 2UZ3A 4KZKA 4TUYF 2UXDB 3CR7A 4G4JA 2R2LA 1F8FA 2CHZA 2B5VA 2UZ1B 2CYBA 3LFHA 5CDTA 2BH2A 1A04A 2CLMB 4IWNA 4EG4A 2A94A 3FLAA 3RJ5A 5MFPA 1J8YF 3S7TA 2VAVA 2WDZA 3BSWA 3BDAA 4X5OA 3VLEA 2I7VA 1ELOA 5CVEA 1B6SA 1LVHA 1TUBB 5DK4A 4BLQA 2K4MA 2CYCA 2ID4A 3R09A 4WADA 4ICIA 1PTJC 4PAQA 4DIUA 1BHSA 3EB9A 4C88A 4K6MA 1TNOA 4Z9YA 3OFSA 4MO2A 4AO6A 1BAPA 1YVUA 1JHXA 3D6TB 3E70C 1BHJA 3S2FA 3WGYA 4AG5A 3FNIA 1DOHA 2CB0A 2FBNA 3NEAA 1WM1A 1KOJA 1VE1A 1GCAA 4J6EA 4QQ8A 1R0RE 1GPJA 1R6UA 1BJTA 1WZIA 2Y1KA 1P80A 2DHEA 1PW7A 3IHKA 3P9CA 2ZU6B 4RZXA 3OTOB 4AKIA 3GCXA 5A9SA 3GROA 1CDDA 2J33A 2W2QA 4Q01A 3ADOA 4DQDA 4EMBA 1G3IA 4KAXA 1CUDA 2WZCA 4PWYA 2IUYA 3MCTA 3MS2A 2CHVA 4NNOA 2PRKA 5L51A 4N5DA 1XMQB 3BL5A 3SO8A 3CURA 1RJWA 4N49A 1I1HA 4QUEA 2GHRA 3A32A 5CX1B 4ZHSA 5LQRA 2F4NA 1QBKC 4BZWA 4F9GA 1QTIA 3AEKB 2V4ZA 3O47A 1NJ8A 1RLUA 2IUTA 5FYDA 3SU8A 3O6VA 1SR8A 2W83A 3N70A 3T0IA 2V5FA 1Q7BA 1U80A 2FDRA 5CB0A 3A1VA 1V8BA 1NNI1 2ENWA 1E2UA 4PYLA 5D0QD 1OASA 3B95A 4O2BF 2P9JA 1GVNB 4PZCA 2IEAA 3PFHA 5CUQA 4CKWB 2PT7A 1X1RA 2BP7A 3DFZA 3WHPA 3P2IA 4EY7A 3ZHEA 1OA0A 3F7NA 2Y6UA 3H4IA 3P9NA 3PC2A 4DWVA 3EMBA 4YJHB 4YAIA 2XCCA 3NIBA 3HXOA 3PBKA 3CE6A 4IIVA 2QTVA 1KZGB 1MQ8B 5CPFA 4A26A 4PZEA 2RK4A 4L07A 1X7ZB 3O5AA 3U4CA 4B6OA 1BX0A 1K86A 1KEUA 4HRLA 1KO7A 1V9CA 2DPGA 2MSNA 2OT3B 4MQLA 4IEFB 3WLJA 2QTAA 3OKCA 1LC3A 2ZM5A 2AOUA 4BMPB 1ZP6A 3GQBA 3R76A 3CTPA 4TXNA 2XF8A 4R1PA 5DB4A 5CFOA 1PHRA 4WZ6A 5BQOA 4I4LA 4WWOA 3KUDA 3P7MA 5JDIA 3QOFA 4HGOA 3LX5A 4XD7D 2ONDA 5I7VA 4YAUA 4XQ9A 2V7PA 5JJLA 4NFHA 2O2IA 2BKEA 2PXCA 3V2UA 4RD0A 4GWLA 4UAGA 5DULA 4UXIA 4ARIA 3SJ7A 3IT3A 4G67A 5FEMA 2CXNA 3T4PA 2MOWA 3DC7A 3RYIB 5ICEA 1UP6A 3Q5DA 1R8SA 1BKSB 4XARA 4JC5A 3GZNB 1OGIA 3SQNA 1J49A 2WA1A 3ADCA 4QFDA 2O7RA 4MUMA 4ETNA 2IITA 3FUKA 4MR9A 3BCSA 3JWHA 2GZ3A 5IVDA 3CJQA 3REOA 4MQUA 4Y30A 4CRWB 2IYEA 2VPWA 1KBQA 2WSMA 4H15A 5TXGA 4CUJA 1JQDA 4FM9A 2C57A 4ADSG 4TOIA 4JQZA 3FWVA 2ZB4A 1KMHB 1KYVA 3K4HA 4OXIA 5AWFC 5B1HA 1H3EA 5K8UA 4B73A 2DY1A 2OGUA 3KB1A 3R3SA 4O5OA 3J81A 1OH7A 3FWNA 2HT1A 3B85A 4BXOA 2DBQA 5KREA 1D0SA 4NK4A 2QNRA 4NJOA 5BWLA 2HI0A 3CNLA 4QL3A 3EH2A 2DX7A 4LJ5A 4RV4A 4RJIA 4J43A 3FTXA 1Z56C 5BT9A 1RMQA 2LUHA 1E7SA 2XDAA 4PAWA 4AP5A 1G6HA 4URXR 1XC7A 1T9GS 2X5XA 2VJLA 3E84A 5C31A 1YS9A 3TRIA 3SQXA 3B13A 3ZNGA 4MVJI 2PCJA 1CUHA 3UHAA 3IP8A 3P0JA 1LVGA 4WY5A 4EBBA 1HF3A 2ZB2A 4A15A 3OXFA 4GPBA 6ABPA 2ZUSA 3J80A 3D3EA 3E3MA 4NFYA 3CHRA 1OT8A 1J2YA 5FTKA 1VM6A 4XGKA 3VUEA 3VU1A 4NZMA 2G6BA 3O4IA 3A6PC 3DE0X 1KTIA 2EOAA 1S4QA 1ZK1A 1UXIA 2JZOA 1NQAO 2ODTX 3KJEA 4TQGA 1G66A 2R47A 2CMGA 1I30A 3JQAD 3LWZA 5JI3E 5FOVA 2ZT5A 1PGJA 1Z4PX 1P2SA 1KI1A 3FCXA 4AJ9A 3QKIA 4C01A 1O97D 1ISIA 3S5UA 2A5DA 3HK2A 1VL1A 3LLCA 4YDHB 1UL1X 1TR4A 1JV2B 1X7ZA 3F4KA 2VZEA 3M34A 3SMVA 4RULA 2XA2A 3PZDA 1T5DX 1TA9A 2XMCA 4J9UE 1M0EA 3BRQA 4MW7A 2LSUA 3SBTB 4JP8A 3S70A 4HXIA 3VJRA 1N54A 4I5DA 2B4TO 2H1FA 4Q18A 5BR4A 1U3GA 3KTAB 1NN3A 2QQGA 5CR9A 3JVDA 3EJ6A 3AG4E 1HSOA 2GS9A 1JIXA 1GKIA 3USZA 4ZVNA 4OYRA 5MN6A 4QEDA 5EP2A 4F0JA 3LQ1A 4GR5A 5JRJA 3D9IA 2JFOA 4QPZA 5H16A 5BR7A 5J3JA 4Q1VA 4F4CA 4P35A 3FGZA 4X85A 2HSJA 4A5SA 3DYIA 2Y1LE 4I1VA 4MPDA 4EJ6A 1M1YE 4W9MC 1U5AA 5KUTA 3K8ZA 1T3ZA 2C0PA 5EZYF 4A8HA 2I03A 3IV0A 3PFGA 4A0HA 2WHQA 5H9WA 3DQQA 2C9DA 2C31A 3DDOA 4ND1A 3W6UA 2PZEA 1VIAA 4WXEA 1RAEA 2B69A 4FJ2A 4ASUA 3HDYA 3TPZA 3V32A 4XVUA 4ZC1A 3G79A 4P0TA 1SC6A 4QFBA 4JI3B 1FRQA 1ACLA 4LFCB 1BVUA 4KAFA 3TB4A 3TOZA 2RGNA 1W5SA 2HK9A 3DVRX 1SEPA 1LW6E 3AR6A 4KE6A 1Y1RA 1CRWG 2Q99A 1V7QA 1TIPA 3EWAA 3EXAA 4Q4JB 4ISBA 4M7PA 2BJWA 5JCPA 1B0ZA 2FZCA 4MB0A 4OJNA 3UYKA 4B2YA 3BGSA 4D1YA 2YHUA 3IUNA 1XAGA 4IGFA 4PR3A 3PEVB 2C9MA 2BD0A 5JYEA 4DI4A 1ETUA 1R6XA 4JJKA 4ZRMA 4DXDA 4HN4B 4H08A 4DR6B 2JI7A 2NVWA 3DMTC 4B3GA 4YPVA 2Q2OA 4IW3B 2J3IA 1RHQA 1RYDA 4UW9A 4DLVA 3EVZA 5HE8A 5CAEB 2FEXA 2QZ4A 1LQ2A 1HG0A 3R20A 3T52A 5JCZA 4W5NA 5GM2A 2OV6A 4CT5A 3CKCA 1H94A 4J8FA 2HWKA 2X0IA 3EMKA 3T7TA 5KWDA 4Z9AA 2TMDA 5F3RA 5FQ6A 2NO9A 3S1AA 2JJ8A 3CZ9A 1OBFO 1UZNA 3EVAA 4AWAA 4GD3Q 2GFIA 2E4YA 3UB2A 2Q2VA 2WIKA 4RQBA 4TLLB 5SYNA 3SZUA 4YNBA 3G2NA 1Y6ZA 1V48A 2XF2A 4OAUC 2HYDA 2A58A 5JSUA 4S2UA 4MRPA 1YT5A 2Q1TA 2NSZA 2VLBA 3C1UA 3P9KA 4Z51A 4AY3A 1Q0SA 3IHTA 1S2LA 3GMTA 4WOPA 3PUKA 4TTIA 3QKUA 2ZBQA 3Q8XB 4CZ2A 5C53B 4HRMB 2VBIA 3TNLA 1Q7EA 2Y0CA 2Z8ZA 4KVAA 2PL1A 3RBXA 4P22A 3TZLA 3PUZA 4D02A 2LP4Y 4JXTA 5AW5A 3TBKA 1KPSB 4KWCA 3U80A 4L4ZA 1YOVB 1P0CA 1FTSA 1GARA 3IILA 1GYRA 2WJPA 4HN9A 4KC0A 4RVSA 3TRKA 4NONA 2VJOA 4X1KA 5EP1A 3VNBA 3H5LA 1Z08A 1O94D 3RS8A 1YI1A 2FK7A 2QRGA 1ZCAA 3I4CA 3KQKA 3MM4A 1RD4A 4WUVA 3EHNA 1U4OA 2JGLA 3P2KA 2OK7A 3R3HA 4L15A 4UXJA 4W1RA 3PQDA 4A3SA 2C5BA 2HSGA 3WO0A 4G2VA 3BZUA 4LGMA 3WWEA 4B7ZA 4TL7A 4FBLA 5J5VA 3WLIA 3R7RA 1Q1ZA 1Z6ZA 5JS1A 2QC9A 1JFFA 1I3KA 5KU1A 1KVSA 3HKCA 4TV8A 4BNUA 3P5SA 4YUWA 3O74A 2EWMA 1E5QA 2R4QA 2I6SA 4CF6A 1JKFA 4X8LA 4EQFA 4L76A 3ZQ6A 1G20A 3QMPA 5CM2Z 1KQPA 3UFXA 3IP5A 3D6AA 3TJRA 4CT4A 3Q4GA 5BORA 5IAOA 4DR2B 3SZ3A 5I4BA 2AW6A 3B5IA 1QJ4A 5L8VA 1QIFA 1J8DA 3PNMA 4YP1A 4FMCF 4HLEA 2C2YA 4DREA 5IVKA 4WV3A 2IU1A 1PTJA 4D4HA 1IY2A 3QRWA 5ITVA 3INNA 2XMRA 3WIUA 4ABYA 3U39A 1Q44A 3PKZA 3SS9X 1FU7A 2VZ0A 5F3WB 3U81A 2JAWA 3DT9A 1XGKA 3UMRA 1W59A 4NWIA 2CFIA 3FFAA 2YH2A 4ANWA 1UFRA 2YXNA 4EF5A 3OFND 2BUCA 3L7YA 2YMQA 3O92A 1ZAKA 1D03A 2ZYGA 1U0FA 3DWFA 3GVIA 3AH8A 5ELXA 1U7XA 2P75A 3S2YA 2P9GA 2YVQA 1Z9BA 2LV8A 3O1LA 3C3JA 1EGHA 3EHDA 2BY4A 3PHJA 4K8RB 3IPXA 1GZSA 5C7LO 2YS7A 1IUOA 1D7OA 1Z4MA 3UIOC 1F2TB 1P17A 2JFVA 4QOHA 1Q1NA 3AF0A 2W8BB 4PTZA 1JPJA 2VHJA 1HKHA 1I33A 2RARA 3EZFA 2CFRA 2E18A 1R6DA 3CUSA 4GS5A 4X71A 2FSVA 4Z7QB 4N3BA 4NDAA 4NJEB 1EZZA 4EHFA 4YV1A 3F98A 3AU5A 1EDDA 4DRXA 1SQSA 1P77A 4HWSA 2V7BA 4LZWA 4B4DA 4JYBA 2FQ1A 3QQ5A 1VFNA 2NT4A 2WM2A 3MJSA 4J16A 2HRCA 4DS3A 4EGAA 1DQSA 1USKA 4Q9KA 3AGQA 5G4KB 2VBGA 2AD5A 2C84A 1W75A 1CZKA 1IIBA 3SDBA 5KJ6A 2LUOA 4J29A 3KEMA 1KQGA 1KH2A 2Z0MA 2YOHA 3OIDA 3KWLA 2F48A 2AZ4A 3E34A 3QPAA 3E4BA 4LQ4A 1E6EA 1PD1A 3FLBA 2YYYA 4BE4A 3CNOA 4PCAA 4IDQA 4EKEA 5JHAA 3I01A 6ADHA 1QTQA 1TO6A 2NP6A 4YVFA 3Q7FA 2FWNA 2VSOA 2Z4RA 1HZ4A 3DTVA 3K20A 4GGPA 2DH5A 3X1WA 3OD5A 5IVHA 2IZ7A 3QK0A 3H87A 5DGDA 1U9ZA 5EXXA 1ODFA 3ZNOA 1AKUA 3K35A 2IH4A 3LTNC 5JZBA 3R0JA 5KMGA 2Z56A 4L0CA 2WFMA 1G63A 3IIEA 3IUEA 1FB5A 1T5IA 2XUZA 3OEWA 3L4EA 3PQ7A 2WM8A 1USVA 2PU5A 4JYMA 1L4FA 4QYMA 3P0HA 2YICA 4V0SA 3RRJA 1ATIA 4HJRA 2QRZA 3UHOA 3TR6A 3IX7A 2CLLB 3T1OA 2XECA 2Y1EA 1C1DB 1DC7A 1VA5A 3ZZMA 3GFVA 1TUGA 1V3TA 1W1UA 4G63A 3AT1A 3C3CA 2I7TA 3L05A 3QW4B 5BR8B 1C0LA 2XCBA 4HB3A 3EVTA 3LM8A 4ZCTA 3HCWA 4KRGA 3U7IA 1H22A 5KC9A 4DPRA 3ONEA 1PT6A 5JNSA 3I1YA 4MCAA 4G1CA 1GZDA 2AMYA 3OZWA 4Y2UA 4DZTA 2ANBA 3BIFA 4G85A 2K2QB 1CEQA 3OQ6A 2QVYX 4PLPA 2SNIE 3WHKA 3ZWXA 4C5AA 4EJSB 2DFNA 5F76A 2QRJA 3LP5A 4JOSA 1ZVKA 1DJQA 3STWA 3N05A 2BGGA 4BEWA 3DS8A 4EATA 1D2NA 2YY6A 5EVCA 4C2AA 2PPVA 2C2WA 2ZZKA 2ZRQA 2G5GX 4ARZB 4PY2A 1DRWA 3PEUB 1ABFA 4Z68A 1NL3A 5CX1A 3KSQA 3N6RA 1XA3A 3IVGA 3PVLA 3RJ9A 3OLWA 1U6KA 1N5RA 2IOLA 4HWRA 2MJLA 1SELA 2OM2A 4DNQA 4DV4B 3HKEB 3ZCPA 1O7JA 2BTQA 3GOQA