4GU5A

Structure of full-length drosophila cryptochrome
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
537
structure length
537
Chain Sequence
TRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLRACVRGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cryptochrome-1
publication title Updated structure of Drosophila cryptochrome.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 200
structure length 537
sequence length 537
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4gu5A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gu5A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4gu5A01
1PG2A 4X0EA 4YP7A 3NV7A 3MLAA 4MW1A 1O96A 3COWA 4P2BA 1EFPA 3X1JA 1IQ0A 4DDKA 1N1DA 4WSOA 1O0CA 1GTSA 3KT6A 4PBRA 4NDAA 1MJHA 3DPIA 4MVWA 3P52A 3SEZA 4JYZA 3IOCA 1M83A 1COZA 4MUFA 3CLSD 3HV0A 2GOYA 1O94D 4EG4A 1EE1A 4ZCSA 4ZCTA 4RPIA 4EG3A 2QUJA 5H16A 4ZT2A 4ZT7A 3ND6A 4I6JA 3HFJA 1Q11A 2D13A 3E27A 3GUZA 3BL5A 1O95C 2WSIA 3QE4A 4NAUA 3H99A 1IFXA 2DR2A 1MAUA 3TNJA 4G5FA 4XFJA 1WXHA 2QTMA 1IVSA 1VBMA 3X1KA 4YP6A 1EUYA 2E18A 3ZIUA 5HUJA 1N2EA 4ARCA 1XNGA 1B6TA 4AQ7A 3S3TA 1OWOA 2J09A 4Q93A 5FNZA 5FO1A 3Q4GA 1OD6A 4MUEA 1NP7A 4MWBA 1ZJWA 2A88A 3RHSA 1O95D 3TZEA 3VGJA 1OWNA 3CVUA 1Q19A 3P0JA 1KQNA 3H9CA 4QREA 1GN8A 1NUSA 2YY5A 4MUHA 3LOQA 4DLPA 1KH1A 3HL4A 2DLCX 1N2JA 2DUMA 1ZH0A 2VTBB 3DLAA 4EG8A 1Y42X 1NSYA 1H3EA 2J08A 2C5SA 3IOBA 1YI8A 3UC5A 1F9AA 4MW6A 3M5WA 3GMIA 3D6VA 1IQUA 2H2AA 3ZUGA 1TYCA 2CUZA 3SZGA 2XRZA 1XNHA 1O0BA 4GRIA 1JEDA 3MUEA 1JIJA 2A7XA 4MUNA 1V8FA 1IRXA 2OQ2A 3IUEA 3AKZA 1VBNA 4ND6A 4HJXA 3FNRA 1XJQA 4H3SA 3CVVA 3COZA 4L2IA 4KR6A 4JZYA 5J5AA 4TS1A 1WZ2A 3CLTC 3IODA 2X3FA 1NUUA 1U7DA 1O96B 1X8XA 3ZXSA 1EFPB 3PNBA 4ZCPA 3IMEA 4MVXA 4I6GA 4EG1A 2NSYA 4NZPA 5BNZA 1J20A 1JZSA 3Q10A 2AZXA 4KR9A 3PXUA 1JILA 5TS2A 1OBCA 1KAMA 3IMGA 4MW4A 4MWCA 4XFDA 3RK0A 1K92A 5H7XA 1GPMA 4F3RA 4MLPA 1Q15A 4MUKA 3CLRC 1K4KA 3D6UA 1N2GA 2QUHA 3TS1A 3H05A 2O5RA 3ND5A 3P0HA 1IHOA 1N77A 1G8HA 4OJMX 3ISJA 1HYBA 1TFUA 1X6VA 3FDXA 4HK4A 1N2IA 1M1ZA 1KKUA 1NUQA 2PG3A 1YULA 1LI7A 4MW0A 1Q77A 4AS1A 4KR7A 4UZEA 2HZ7A 4OUDA 5TEWA 1EUQA 2Z3VA 2A84A 5TEVA 1KH2A 3UOWA 4EG7A 1ZH6A 1PG0A 4ZT4A 1M8PA 3LE8A 2JAXA 1G8FA 4R2LA 3CLRD 3P0IA 1KH3A 1TYDE 1VL2A 4JXXA 1N75A 2PFSA 4HJRA 2PZ8A 4DE5A 2G36A 1F7VA 3IMCA 3SYTA 3N8HA 3AG5A 1WKBA 1MBZA 3MLBA 4PBSA 3INNA 1WXFA 4WNYA 3A05A 1T9GR 4J76A 1NUTA 3ZXIA 4EFKA 1GAXA 1H3NA 1KP3A 3ZJTA 1JIIA 2QUIA 2EJCA 3COVA 3OP1A 3FIUA 2GKSA 4MWDA 3A2KA 3ZJVA 1GTRA 2IP1A 5LFAA 5IJXA 2VXOA 4YBRA 5IHXA 1YUMA 1OWLA 3AG6A 1VBKA 4DNXA 2X1MA 2BYTA 1IQRA 4L2IB 2TS1A 1T6ZA 2AKEA 2D5BA 1WXGA 2V0CA 4CDMA 2E0IA 2CV0A 4HPWA 4NX2A 2HMAA 4MVYA 1ILEA 4ND7A 3IOEA 4MW9A 3X1MA 5HUHA 1QTQA 2QJFA 2QJTA 1U3CA 4K0RA 2A1TR 1F4LA 1JZQA 4DJAA 1RQGA 1YIAA 3CR8A 4I6EA 5LM3A 4MUIA 2QUKA 3RK1A 2DXIA 3L93A 1J21A 3OTWA 4MWEA 2IELA 4MW5A 2R5WA 3I05A 2J07A 2ZUFA 4A91A 3KT8A 4U63A 1O97D 2I1LA 1QRUA 1KQPA 3IDFA 3VRHA 1T9GS 1H3FA 2J5BA 1OWPA 1JIKA 4U8HA 3RFFA 3H97A 1T6YA 3TZLA 1KAQA 5KHAA 1MAWA 4OUDB 2WQ6A 3ILVA 1JECA 3FG9A 4R2MA 3HMQA 3AL0C 1P7PA 3JXEA 2H29A 1NYLA 5LLTA 4G6ZA 4MUGA 1U7XA 4U7JA 3ND7A 3IVCA 3IVGA 2JA2A 4GU5A 3CLUC 2XRYA 5F23A 1I2DA 1D2RA 4ARIA 2A4MA 1TYBE 3AFHA 1N3LA 1MRZA 1UFVA 3NBKA 3H9BA 2CYAA 3CVXA 1FYDA 4ZT5A 4DDHA 1O5TA 3GLVA 3KFLA 4NAHA 4NATA 1M8KA 4CT0A 1R6TA 1KR2A 1R6UA 2DERA 4KPUA 3PRHA 3KT3A 3SEQA 1NZJA 1M8GA 4KKVA 4S1OA 1N2OA 3CA8A 5DB4A 4EG5A 2CV1A 4MVCA 2CYCA 2A1TS 3F3MA 1WY5A 2GM3A 3G59A 4EGAA 4UZFA 3L92A 5KCMA 1KORA 3KT0A 3ZJUA 1PFYA 5DASA 3CLUD 5J59A 1I6MA 3K32A 1T6XA 3A04A 3A4IA 2A86A 3N2YA 1ZUNA 3PNVA 2OV4A 1MOPA 4E1AA 4Q16A 3UK2A 1NI5A 3AIIA 1OWMA 3RJZA 4BWVA 1QU3A 4EG6A 2PIDA 2PXHA 1JGTA 3SDBA 1J70A 1I6KA 1OBHA 1MC1A 3TQOA 1H1TA 1LW7A 4F4HA 3HGMA 3HZRA 3C8ZA 1SURA 4PY2A 4J75A 2RE8A 1QU2A 3K9WA 2ZUEA 1N78A 2CT8A 4FZJA 4ZCQA 3PNYA 1XNJA 3QTBA 2PZBA 1J1UA 2A1UA 3VU8A 4QBTA 5K0SA 3QTTA 3ELBA 1V47A 3SP1A 4MQ6A 2AG6A 2IJGX 1DNPA 2YXNA 4QRDA 1FFYA 3UY4A 1WXIA 2WQ7A 1MB2A 2E89A 1IH8A 1WJGA 3N05A 4R0NA 3NBAA 4DDMA 5FO0A 4XSVA 2PZAA 2B7LA 3ZGZA 5DEOA 4MAFA 2O8VA 2DETA 3CVYA 4MULA 1NUPA 1O97C 1G59A 1U0BB 3N9IA 1TEZA 3U1VA 3MXTA 2Z08A 2QTNA 1QJCA 1JEEA 4YP5A 5K0TA 1F7UA 5TGTA 1EFVB 2YWCA 1U3DA 1QNFA 2QJOA 1I6LA 3G5AA 3DV2A 1M8FA 1JMVA 4MUJA 4ZT6A 4YMIA 1PFWA 1GLNA 1YIDA 2EL7A 2JANA 1CT9A 2V0GA 1TYAE 2CSXA 3Q12A 1YUNA 3RBAA 3TQIA 1S4MA 1GZUA 5HG0A 2WB2A 3IUBA 1A8HA 4KPUB 1JHDA 1PFUA 2X0KA 3LCJA 2X1LA 3FETA 1J09A 1G8GA 1BS2A 1TQ8A 1N2BA 1WQ4A 2CFOA 2RD2A 2DEUA 1K97A 1VLHA 1WQ3A 2ZP1A 1QRSA 4CQNA 5EKDA 1PFVA 4ZCRA 1EFVA 1QRTA 4ZT3A 1EXDA 2BTEA 1O6BA 1QQTA 5JBNA 3CVWA 2NZ2A 3IH5A 4RUKA 3FH0A 2J4DA 5J58A 5DK4A 4JXZA 4JFAA 4EF6A 4K03A 1KQOA 1KP2A 2D54A 2VTBA 1WXEA 1WOYA 2YWBA 5KWVA 1J1ZA 5AHWA 2CYBA 3COYA 1K4MA 3SZ3A 1M8JA 1ULHA 1LI5A 3FI0A 2CV2A 1MB9A 3FHJA 2Z09A 1N2HA 2E21A 3CLSC 2QTRA 3UMVA 4MW7A 1EJ2A 1O94C 3FWKA 3G6KA 4PBTA 4CDNA 3FY4A 3MMXA 2A1UB 3IVXA 1NURA 3CLTD 1R6XA 2HGZA 3DO8A 4G5YA 4MW2A 3FOCA 2DPLA
chains in the Genus database with same CATH superfamily
1U5BB 3ERCA 4GZCA 5HQJA 1PUJA 4K5AB 3IDZA 3A1NA 1MH1A 4OREX 4B7XA 3PZ4A 2R65A 1V54E 4JPSA 3ZCVA 1LZKA 5CXXA 4BNXA 1HZZC 4I6JA 3GUZA 3GW8A 4KN9S 1THZA 1JKIA 5FOUA 4QT4A 2P6RA 3GLIA 4US2R 3BMCA 2AQKA 3AMVA 2ZS9A 2XEVA 5LP6A 5JLJA 5GJVC 3R3XA 1UKVY 4RHYA 5C1BA 3GOHA 1RE0A 3GUUA 3NWOA 4HXIA 2X8JA 1ZMXA 3L46A 4BX2A 3UATA 4YRIA 4MCAA 3H9JA 4DR2B 4BNNA 1GGVA 1RM5A 2ZI7A 2WINI 4KN8A 1CUSA 3TKLA 1BYUA 1W5AA 4I5IA 4A2QA 2JIZA 3EMKA 2BI8A 3N74A 4FMCF 3UKRG 4ZJYA 1CUVA 1GP2A 5H82A 5BURA 4MVJM 4MR7A 3VKGA 3DMPA 3DCNA 2WWGA 3R7SA 1FNCA 1UBTS 2GF2A 1NBOA 2VT3A 3BF8A 3EWNA 3TWUA 1XGWA 4R84A 4DCUA 5CK4A 2PVSA 1B42A 4V39A 4ACBA 4QWWA 1AV7A 3E4DA 3O73A 1LEHA 4R2LA 1UMCB 1X39A 1IXSB 4Q47A 4NZ9A 3LX6A 1ZD5A 2VBIA 5E4JA 3ED5A 1UBUS 2NZJA 1E4VA 1XDWA 4ZWNA 2SICE 4MYCA 1YXMA 2M6SA 1T35A 3DAHA 1HF3A 4G09A 1SZAA 1SU8A 4UBIA 1T4GA 1JDUA 3P9QA 1GR1A 2E6KA 1ZUWA 2HDHA 3RTBA 1KK0A 1P81A 4BJ3A 1NI3A 1ENYA 4X6YA 5D6OA 4CLDA 4DMGA 1QTQA 1AOXA 4F85A 2V6FA 1G8PA 4QECA 3R9WA 3CR8A 2Q5HA 2G8NA 3ORFA 1MC8A 2WP8J 2DKFA 3B6MA 3N8IA 4AP6A 4QDTA 1ZMRA 1IU9A 4GX1A 2AFHB 1QR6A 1K1EA 1VI5A 1FRQA 1ZFNA 2MYOA 2OXEA 2FUG1 4QPNA 1HE5A 2HMTA 3VC2A 4N4AA 1W87A 1ISJA 2PD3A 2VSFA 1RM3A 4YAGA 1AKNA 1PTJC 5GVSA 1R3DA 4IDFA 2IYUA 1AN0A 3EMBA 3AVVA 3R7AA 3AXSA 4ZVSA 3CT4A 3BUAA 4FKZA 3FTZA 3ASUA 4WVLA 4U8GA 3MBKA 3CK8A 3WL5A 2ZT5A 3KETA 1M5TA 5K8IA 1AM4D 2WU1A 2MSEB 1N4QA 4HQNA 4AQDA 3IXMA 4YLGA 3K9QO 3N0WA 1XRLA 1LQUA 5FOWA 4I14A 1IXZA 1B0AA 4MRAA 4ZYXA 1DAGA 4RW0A 1FPQA 4C3VA 4M0MA 3UWMA 1XD8A 4R54A 4EFLA 1MA0A 3O8QB 1AKUA 4WXPA 1QZ2A 5CCDA 1Y6QA 3SXUA 3LJNA 1U6KA 5EL0A 3GT4A 4BASA 2XUJA 2GHTA 3WNCA 1ODFA 4G8DA 2ZJFA 3UA4A 3AUXA 4EB3A 3LUJA 4HY3A 4AZ0B 2Z5LA 4M8SA 3RLFA 1J09A 4CIDA 3P2IA 4U95D 3C6XA 2QY7A 3K96A 5DP2A 3IHYA 5D0QD 1COWA 3FMIA 3L17A 4FZ3A 2Z5GA 4B09A 3GVXA 2BKVA 1TA4A 4D9IA 1XPUA 5CXSA 1R7RA 3I39X 2OHHA 2ZI3A 4N48A 2P69A 2ECKA 4A5SA 2CSUA 4MYUA 1F4PA 3P4UA 1Z75A 2H6FA 3GRFA 4CUJA 2QUJA 5K3SA 2OD9A 1NU8A 1PE0A 4TLEA 5DSXA 4O8ZA 1N0RA 3WNVA 1Q7EA 2BVNA 4UNQA 2SKCA 1E1RD 2QR2A 4AM9A 1YR9A 1L4FA 5KOJA 5JPCA 1A9QA 3VR6D 4WERA 1H4VB 4AUMA 3ZGNA 3LQKA 1I10A 1Q19A 5LZ7A 5BN5A 5EZSA 3H9CA 4MNTA 4FGKA 4MUHA 1S64A 3OF2A 2WG2A 4JDUA 3U3OA 2YY6A 2WSMA 2Z9DA 3IOBA 1K1AA 4C05A 5HM6A 3FUWA 4IRUA 4B6FA 1POWA 4YRJA 4B8AA 3D3QA 3HUUA 1NJSA 1CE8B 2EJTA 2J0UA 3CVVA 2C42A 3FA2A 5E6RA 5M7EA 3K7EA 3ZDZB 5BNZA 2F6RA 3Q10A 2BDTA 3PFIA 1OBCA 1PD0A 2ZQZA 4BP3A 3OOHA 1JAYA 4C7BA 4L2YA 5AK6A 4F3RA 1Y5MA 2Q45A 1Z2PX 1DSSG 4BETA 1A8IA 5CLLA 1JS1X 2YQZA 3TTXA 1T15A 2CFIA 1L7MA 5K0ZA 4UZEA 3ZY5A 5ARBA 2AFHE 1B15A 2WVGA 4Q48A 1GVHA 5CIYA 1E79D 1BHJA 3WKDA 4GPTA 3WFZA 5G0VA 1KDPA 2GD0A 1O1SA 3G5TA 4JL8A 5HDQA 2N1BA 4ZEXA 4HOYA 3K0EA 2JBHA 2VBFA 5JQWA 4ARVA 3WNZA 4ILKA 2OHFA 1VJTA 2V7PA 4IIEA 1IN1A 4GXRA 3NQPA 2QVCA 5JANA 4TOIA 2FX3A 2OOKA 4WKPA 2J9FB 2OWEA 3QE9Y 1T9CA 1PAUA 3L8GA 3LKVA 2BGTA 1E4OA 3TG5A 3TO5A 5AIAA 5DNCA 1MABB 2B8NA 2OCGA 4KAXA 4INZA 4JB8P 1O97D 1THMA 2FEXA 3ZKJA 2Y4TA 1QP8A 1NSFA 1ULUA 3FUTA 4UUCA 1MG5A 1XXHB 3FZNA 2J5QA 2PL1A 4G1BA 1G8YA 3P4XA 3B1WA 4BRUA 2UKDA 4TV9F 1JXOA 4CQLB 3MX3A 1GCUA 2PMWB 2EFYA 3G0IA 2Q8NA 5I51A 1FU7A 3CNEA 4LCEA 4TLCA 3KEAA 5J2UB 3VR4A 2IFTA 4KYTA 1LDYA 2VO1A 3A9WA 4L1KA 3NCTA 5A5GA 3AFIA 1XP5A 1NAIA 3DVQX 5JJ7A 3NXKA 4CKWA 3QELA 4CR8A 3PF8A 1XU4A 2VGYA 3VV3A 1U0FA 1D2HA 1DCQA 1HQYE 4L7VA 3CUUA 4DKXA 1AH2A 4KAJA 4HNSA 1PJ3A 5LB4A 3G0DA 1XELA 2QN3A 2GS9A 3L7YA 1J39A 1L7RA 1T9AA 1M8FA 1L4GA 3EF3A 1KSFX 5C7LO 3IPAA 1PFWA 1ONSA 1N7JA 3FKSD 1V9SA 2IHKA 1NXTA 2ZROA 1G8GA 5HEKA 3K15A 1XQYA 5IYZB 1U4SA 2Q7DA 4ZCRA 4AYXA 4XRGA 1H6PA 4X41A 2Z6UA 4ZDWA 4BLTA 2W6NA 4AICA 3UT7A 1YDFA 2BMEA 4LXHA 3NI2A 5IFKA 4TMFA 3IAHA 2DBRA 2CV2A 4LNHA 3K09A 3K5PA 1OR8A 1G291 4RSRA 1EK6A 3D3NA 3APDA 2QM0A 2ZW9A 1I1QB 5FFFA 1E63A 3GEMA 2I6GA 5CRUA 1UAGA 2VZ9A 2NXEA 4RABA 3S2EA 3ZE0B 2XCBA 1X8LA 3B82A 1LQ2A 2Q2OA 4BO0A 4AMGA 2BRUC 2WXQA 3W78A 2JLQA 4PYKA 2IUFA 1CQIA 3R6LA 4BB5A 5JTUA 2CVZA 3D0QA 4IQ4A 3A6KA 5FEMA 5EIDA 4OYLA 2YOFA 2YC2C 5HZKA 3NC0C 3T34A 1FSFA 3KYCA 1GPH1 1WXDA 5ADWA 2ZPUA 2ZXFA 4CTNA 4BL5A 2FHSA 2XADA 3G85A 1KBOA 3EXFA 5INTA 4MR9B 5FLYA 4UDXX 5DTEA 5JAMA 5B1HA 5H81A 5LA6F 5LMUB 2EKLA 1U8TA 4BLUA 4F8YA 2CUZA 1INLA 1N0IA 5AW1A 4LXUA 3HJAA 1UK6A 2W4IA 2BJWA 5HYVA 1E92A 3FLMA 4H35A 3ZLVA 2X6QA 4RDIA 1YFZA 5LSAA 4L0CA 4OGWA 4BLQA 2PO7A 4PLTA 1GPMA 1ZGJA 1ZW1A 2WZBA 2P9QA 3ZJ5A 3SHOA 2BGUA 1VJ0A 4IMRA 1ZIOA 1RXEA 1HYBA 4IKOA 1SQSA 2C1EA 1RIIA 1UDBA 2AVNA 3WYAA 3RSGA 1E0DA 3UPUA 3NBMA 4RZUA 3IV6A 4J0HA 5JD5A 2W4QA 1LRJA 3PD0A 2GAIA 2PX6A 5ERGB 4EHMA 3A05A 3EIQC 4FX2A 3A1DA 3FWZA 5DMXA 2Q6OA 1GCIA 1PKXA 1Y0BA 1XEWX 4JBWA 4BFCA 1YL7A 4LG1A 3PIIA 2ERXA 3V4FA 1Z63A 3G0OA 1CKEA 4RLFA 3F6RA 4BMOB 1Z56C 3VJLA 1TEHA 3U4TA 1X1QA 4Q4AB 3CRZA 2EOAA 4UQYA 4I2NA 2WUWE 2RJOA 4O2RA 3KVYA 1NQUA 2J7PD 2AYZA 4TUYB 1FFHA 4PTLA 4AY2A 5FWNA 5I9NA 1EVZA 1KYQA 2WDPA 3AONB 3DZIA 3O9ZA 1UAAA 1IIRA 2O2JA 1FT2A 4YREA 4UAGA 4J16C 4RA9A 3IUQA 4C9BA 5GMOA 3UM1A 3MJRA 4C30A 4OHBA 4V0RA 4MDYA 2O0KA 3PRHA 2HV9A 1MO5A 2XNDA 4ARBA 1B7GO 3AI7A 5L3QB 3G8BA 4GMXA 1X1SA 1A76A 1G20A 4HQOA 3KHUA 5TDHA 1U1FA 2CLSA 3A9UA 4HXGA 4MRRA 2NVWA 5L8VA 3L8CA 3OM9A 1N4AA 4JV5B 1WCV1 4GS5A 1NYTA 4X63A 2Q5JA 2RE8A 3RYFA 2G5CA 2EX0A 1ATZA 5JS2A 2PZBA 2F2TA 2EFEB 2OV8A 4OQFA 2WU0A 3R5TA 2PRSA 4J91A 4M49A 2B1QA 5KOHA 2ZRIA 4FMPA 3GVCA 3HA2A 2AMYA 1I5OA 5E9JA 4Q18A 2FWRA 3HE3A 1AGXA 1YBFA 5C7YA 1EXVA 1AN9A 1BG6A 2P67A 4NV3A 3O90A 1ZRSA 4W5NA 4B6EA 1BE6A 1B00A 1ZG3A 1YIDA 5E4YA 1AUVA 2II6A 5B36A 2G0AA 2MINA 2BUAA 1NXSA 1O57A 3N75A 3O8DA 4KUHA 1C7IA 4MHTA 5HR5A 2BGRA 3ZCQA 4KX5A 4YCLA 2DG2A 2CY0A 4HB0A 2E7ZA 2F9FA 4UAJA 2GO1A 4L0QA 4EF6A 1XWFA 1KQOA 3Q7SA 2OXRA 2X58A 1Y1SA 2ECPA 2A2ZA 2QPLA 1FDWA 1XVTA 3I9KA 4KOAA 1YB6A 4G4SP 3GIWA 4J8EA 4U1RA 5L3SB 2VXCA 5AJZA 3R77A 1JG1A 1OOEA 4DX6D 1QOQB 1DOAA 2NW6A 5D3QA 5E3JA 1XMQB 3N8DA 1UQRA 3P52A 2GPWA 3BH6A 3K9GA 1TN6A 1I7LA 3PCTA 4LUNU 4PE5B 4ZCSA 4ZT7A 4QBHA 5DK6A 3F4LA 3PJGA 4GD3Q 4C4YA 2YOHA 1J8DA 4P3PA 4BV2A 4BWFB 2QV0A 4R81A 1VBMA 3R23A 4Y6PA 4B44A 2PR7A 2I9KA 5BSGA 1N3YA 4AN4A 5B1DA 4C06A 2HRQA 2RFLA 3V3TA 3D7RA 1P2FA 3ZBPA 1EUCB 4DQKA 1GA4A 1BGVA 5EXTA 3SHWA 4KE9A 5FTMA 1OGIA 3CY6A 3B7GA 3B7RL 1WZ2A 1EGVB 4EVRA 1ZNQO 5IN4A 4TYMA 3LY5A 5IW8A 5JUWA 1MPTA 2CVFA 5IT4A 1HWYA 3WK8A 3IBTA 4CGYA 1H66A 3IP3A 2OLEA 3E22A 5CA1F 1JSXA 4P3YA 4XWTA 8OHMA 4NC9A 5ALNA 3KXIA 1QJ4A 4MGKR 4ED9A 4MPJA 5CT4A 3DL4A 4YXFA 2D0OB 1EE9A 2PUFA 1I1OA 1U9CA 2A84A 1UQUA 6AT1A 4G26A 4JMPA 1ZJ5A 2REOA 2OP1A 3DE7X 1K98A 1AQIA 2OYRA 3DAOA 3NHSA 4N8EA 3ROXA 1UWLA 4TRJA 9ABPA 3GBPA 1U4NA 3K1AA 5F4BA 3RVRA 5LFAA 4A8PA 1SNYA 4DNXA 2V1UA 1SVUA 1IZ7A 4GVLA 3R75A 3NBYC 5KJFA 1KDVA 3H5RA 1EWVA 3RYHA 1YQXA 3TLKA 2OMEA 1R0LA 2AK3A 1IZYA 2QRNA 3VU0A 4B1FA 3T3IA 1WUJS 2FZWA 1VSBA 2YHUA 3R6WA 3DEOA 4YMWA 3E30A 2OAGA 1K3FA 3MKRA 3PKZA 1KEZA 4MDHA 4F3NA 2CHEA 1QP7A 1DUVG 1JDNA 4MQMA 3K2QA 4B8WA 5DHSA 5AKGA 4LY0A 3NHUA 1X3SA 3E03A 1GG2A 3SI7A 2FSVA 1C50A 2F4VB 1QHHA 1VRWA 1BJKA 5AVXA 1GAEO 3CF6R 3Q0TA 1DJNA 1FYFA 1M1NA 3CG0A 2IH5A 1K8RA 1QIGA 3C14C 5C34B 3EIFA 4DDHA 4U2KA 4D97A 4KT6B 3ZYMA 3L08A 4M53A 2EU8A 2WPVA 3IB6A 3T1HB 1VE1A 3H2SA 1XRQA 1OLSB 4KWCA 2V6IA 1LA2A 3RASA 4DVJA 3FU6A 3IUPA 3H2HA 3ZDBA 1N7IA 1SKQA 1NMQA 1VFNA 2PK3A 3QG5A 4Q7QA 3K31A 1Z45A 1SZ9A 1T26A 2I54A 3GDWA 2ADFA 2COUA 1A9TA 3G7NA 4PC7A 2UZ1A 2O59A 3CE6A 4O1HA 4QQFA 1X94A 4YRNA 4WY8A 3ITEA 1T4CA 2IXDA 4O5AA 4JROA 3OEEA 5EINA 1JLRA 2PUDA 1NONA 1S7CA 4HNHA 2JZCA 3EXHC 4V03A 4HB5A 2JGEA 3Q12A 4N0EA 4Z0NA 1Z16A 3T38A 1ABEA 4TTPA 3WL7A 4IF4A 1DEHA 1TVKB 1VB3A 1R0SA 3GV0A 1K97A 2IOFK 1SCJA 5CHEA 1O1YA 2IYFA 3RS3A 4IEFB 1NOJA 1W96A 2PKCA 1Z7WA 1DBVO 3HJFA 3BGSA 2QW1A 3FI0A 7MHTA 3B5IA 4RF3A 2RG7A 4FR5A 1QHYA 4HQLA 4JKYA 2HX1A 3THYA 2QTLA 3W1WA 4GC5A 4TWAA 2X14A 3MLAA 3PUJA 3CB2A 3MA0A 4MW1A 4EP1A 5A4JA 1X87A 4Q12A 4QUJA 4LVOA 1YAHA 4OHPA 2ATCA 3D9HA 4ZO7A 3FRJA 2ZREA 5KDDA 1RVV1 2GRAA 1DQNA 5KNCA 3BDIA 3DNPA 1ARZA 2WYOA 2Q62A 1M6EX 2WFMA 4HVTA 2YJ6A 2P7HA 4TZ6A 1D9XA 2R6GA 2ZWMA 5ITZB 1BJRE 4MPTA 4ZVUA 3TQRA 5D66A 1B6TA 1UPBA 3KAPA 2QOEA 3U60B 1JJBA 4EX6A 2MHCA 2Y0DA 4DZZA 3SSMA 3E1GA 3ELYA 2BF7A 4DIBA 3EK2A 1VLLA 1AS3A 1HT2E 4FU3A 1XNHA 5EKUA 1V6AA 4G4JA 3RSLA 3JWHA 1U5CA 3W4IA 2H48A 4EI2A 2FCAA 2XIQA 1ZESA 4PTZA 3ZK7A 4FFDA 5D5QA 3ASDA 3IMEA 1BMDA 4DNPA 4H1VA 5A4DA 2FPGB 1MVLA 1OYWA 4QQRA 5KJ6A 4TV3A 2PVPA 5IAEA 3RUPA 1YOVB 3HVEB 3EH2A 3KJEA 3K72B 3WRYC 1LLDA 4YI3A 2FSPA 3NVKI 4B7CA 3HO6A 1D03A 4IVQA 5B64A 4ZT4A 5CB4B 1P1HA 3TWSA 5DJ5A 2X5NA 2D5CA 4Q1VA 1NY5A 2X1HA 4NR0A 4OAQA 1BMFA 3QF4A 2O2DA 4S0ZA 4EUEA 3T1VA 3ZWVA 4HAXA 1L7NA 4NXMB 2R2GA 4DZRA 4Y2QA 4IIYA 1WKVA 1NVBA 2O3TA 3HEMA 4D42A 2JVJA 3SSAA 4K2AA 1W3BA 1B14A 1SG0A 2ILVA 2VHEA 3SYKA 2HPVA 4PYNA 1FPPA 1T4DA 4G1UC 1KFJB 3BIOA 2R8ZA 3AIMA 4DJTA 4IDQA 2WSSA 3E0XA 2CNLA 3IQWA 4LVUA 3OTWA 1VCHA 3OI7A 1XT6A 1E1YA 3VTAA 4MS1A 1XJ5A 1IJKA 5L53A 3DF9A 1WMAA 3K35A 5JD4A 3EHQA 3REOA 2D2XA 2YX1A 4HDNA 3ZYLA 2PSSA 2G1UA 3CR3C 3WXMA 4H0CA 3PDHA 4X94A 1UODA 3HVUA 1EFKA 3V8PA 3CHYA 2QQFA 4IIJA 1UFVA 4ZT5A 2DFVA 2DERA 3MMSA 3LM8A 4TT3D 1DELA 4JUCA 4E1BA 1MB0A 5CLJA 5DRTA 3QKTA 4X44A 3QYFA 4AKTA 5HQ3B 2W48A 5LYJF 3A04A 4AD8A 2PQMA 4NFSA 3S8MA 3RVPA 4XX1A 3GP5A 3R8CA 2QTVA 3S2UA 3C6MA 3TG8A 2IW3A 3R3ZA 4MI6A 2LKCA 3DZHA 1M0EA 3CEQA 3MCVA 3M5CA 3V7FA 5EMNA 3H1TA 2OV6A 1WD7A 3RS0A 3T7EA 1Z5WA 4EYGA 3HXTA 4NQRA 4JBYA 3KE9A 3PEUB 3PE3A 1QKKA 4JHJA 4LBZA 2CHWA 3JALA 4EA8A 4EY7A 2AMVA 3BMNB 1Y5LA 4DLXA 3W79A 1UDWA 1W2HA 4D45A 4UUQA 1XL1A 4J8DA 1E2IA 5EZ6B 3M9LA 3W90A 3FPJA 4N7MA 1QHGA 5TY0A 3EC2A 1KK3A 1LBEA 3ZHVA 5JTTA 4J4BA 1A96A 2XGSA 3ZJ4A 3PJFA 2XUZA 4X62B 1XJ0A 2BTQA 3R3HA 2QV7A 4ZCIA 5HF6A 4TMZA 1DC5A 2JHFA 1G3IA 4B3TB 2TYSB 1DHRA 1A2QA 3B1KA 4KW7A 4G9EA 1TIBA 4LFBB 4JP5A 3FE2A 4LDJA 1ABFA 5FLXA 3OM8A 4NNPA 4OL0A 4FNGA 4IVNA 1VSVA 2ILRA 3IOCA 1XZMA 2I4MA 2WIBA 3JD0A 1J8FA 3HJCA 1Q0SA 2UYOA 4FBMA 3QVUA 4GGOA 4MCIA 2ZBDA 5B6IA 4RG6A 4BKPA 4FOPA 2NO6A 3QLEA 2QTMA 1IVSA 2Q9UA 3X1KA 1SKBA 4CDRA 5E6SA 4RKYA 1MF7A 2R00C 2MSKA 1ZSNA 4IDPA 1Z68A 4L07A 5DCWA 2JASA 4E3ZA 1JAIA 2F43A 4MV0A 4FI3C 2HJ9A 2DFDA 4F84A 4WCFC 4PR3A 2CVOA 3NRJA 4DBLE 2FR8A 3TPCA 3FMVA 5JNLA 1UKEA 2X9NA 4B7UA 2CBXA 3IE1A 4TS1A 3MJSA 4O02B 3LFHA 4ZV4A 1I2CA 2AXPA 4RF2A 2ZSDA 4K7JA 3VAZA 5IFLA 4LE1A 3WGJA 4YEDA 4YVFA 1A3CA 4C0LA 5FTWA 3M49A 4MH0R 3ZI4A 3NHYA 1PF7E 4W5QA 1M1YA 4LRQA 1IEWA 3CHRA 5G2OA 4JUIA 2H85A 3Q9UC 1SC6A 1OTXA 4QBGB 5TEVA 3BWYA 4NYIR 2XVXA 3ICOA 1UBHS 5JXJA 5GIPE 3LDZA 1Q84A 3CW9A 1OKKA 1UP4A 1UUFA 4LSZE 3DV0A 3EC7A 1NOKA 1T6BY 4A23A 2C97A 1HH8A 3K0CA 1JH8A 3GGDA 1VYUA 1Y4UA 1XEFA 3FMGA 2OD2A 3ROTA 3Q9SA 3GYBA 2LP4Y 4TXJA 4YROA 2FVXA 2CJPA 3PLAE 5H9VA 1I30A 3LKDA 4MVJH 4KG7A 2Y1EA 3LT5A 4CKEB 2J32A 2J4FA 1SEVA 1YNOA 3WFJA 2OILA 3LXUX 5DM1A 3ANXA 3APCA 4UUOA 3UQ3A 2RGEA 4TL9A 1H2FA 5KYWA 1A97A 4B0OA 4RQTA 3CZMA 1B41A 4GQAA 5LCWJ 1BDHA 3TZLA 3WLQA 1N52A 2BN4A 4BFXA 4WNGA 1P7VA 3B3FA 3JQAA 2YXPX 1EEXB 4MUGA 4ON9A 4EZEA 4MKTA 4NJOA 4D9MA 2QAJA 4LC1A 4JN6B 5KYUB 2VWPA 2AIRA 2C2BA 2FZ4A 2ARKA 2Y92A 3W9YA 3WLEA 4F5DA 1WCIB 4PC1A 1LBQA 3EAGA 4IM7A 5JY6A 4NBSA 4RZ3A 3OLVA 3PNVA 4QRIA 2H2DA 4AZSA 2C9CA 4RJLA 1XHFA 5F21A 4KFRA 3QF7A 1OXJA 1SBCA 4FP7A 2EBFX 4FSXA 1WU7A 4G07A 2J3MA 1J1UA 1AO3A 3P5SA 1ZWKA 3GDOA 2GAAA 4FGZA 4F53A 2KLBA 2X2FA 1Y3CE 4EPTA 5GQSA 1C14A 1HC7A 1BU9A 1MC5A 3Q6NA 3FYUB 2YUIA 1M2GA 4CMIB 5COBA 2Z2JA 1XLTC 1EFVB 1TT5A 3S6JA 3M1LA 4O4IA 2IY8A 3CIFA 2QVGA 2P3QA 1TZMA 5FNVA 2XS1A 2HLPA 4A2PA 4UDNA 3B9BA 1IJBA 4B45A 1Y37A 1CUIA 5JLAA 3C74A 2NVBA 3GRPA 1ZQ9A 3ZWKA 1TU3A 2PLNA 3QA9A 2NNWB 4I8IA 2D06A 4DDWA 1MEEA 2OZVA 3O4VA 2F17A 5JNUA 2C7QA 2O0HA 4R7LA 3T0IA 3SS7X 1QQ5A 3B6IA 1VFPA 2E3JA 1KS9A 2QE7A 3DP9A 4LNUA 3UENA 4U4AA 3CUVA 3ZV7A 1MB3A 1QKIA 3TPFA 4R0MA 2NN3C 5C32A 5CW1A 3L0YA 4V0NA 1FXSA 2MOKA 2P3SA 3BEEA 5CD1A 3AEQB 4O4JB 4IIBA 4JBLA 1T1SA 4W5RA 3O2QB 1AXEA 2P9KG 421PA 1TJFA 4OPMA 2V9CA 5EYPF 3DHNA 4ZVNA 4INOA 4IXTA 9LDBA 3PXXA 1QYVA 1MZCA 1GFZA 3H1AA 3UVEA 5EPOA 1II8A 3N39C 3MD9A 4OB7A 1FFXB 1JHRA 2EZUA 4HRVA 5E1OA 1KPHA 3C70A 1F9AA 2V6JA 1JCQA 2YHCA 2ZJ0A 4BQFA 3AEXA 4QPDA 1C7RA 4P4NA 2AHOA 1P1IA 1V5FA 1B8PA 3C7KA 3U44A 2XKJE 4MV7A 4H9GA 4M9CA 4IEEA 4BEVA 4AG3A 1JR3A 3ZYKA 2CN1A 3KR2A 2VAWA 1K92A 5H7XA 4FYYA 2VNAA 3OZCA 2VPTA 4Z4QA 3LRXA 1F8GA 2QL5A 2QUHA 1HG5A 3HP7A 3HM9A 3ND5A 4NJMA 4B2IA 5JAOA 4G1CA 3AVWA 1VSQA 3ZQKA 3INTA 2CUTA 3PHGA 1Y6IA 4CW7A 1ZU5A 2YOGA 3OTNA 4QGAA 4F38A 2PRJA 1SAYA 3KAEA 1XMJA 4XLLA 4N0DA 4GRDA 4LVNA 1KH3A 2Q0QA 4EBAA 1E3MA 4LZWA 4KJXA 1BS9A 3KFVA 4YAWA 2B5OA 1PU2A 2ZJ1A 4AULA 1M2WA 1JLMA 2QAGC 1CZKA 1PEAA 3LLVA 4WNAB 2Q7XA 5IBRA 1E69A 4NMWA 1CJUC 3NS7A 4Q4LA 1IOWA 1E0JA 4PIMA 3TLJA 5LLSA 1QQEA 1JEQA 3OH8A 4MQ5A 4Y6OA 1VI2A 5LBUA 2O8EA 1VKHA 2F1KA 1IN8A 3A1WA 3I58A 5CVEA 3PFGA 1YRBA 4WXYB 2ZXEA 2YUTA 1SUCA 3ORRA 5HJEA 4JC0A 4F92B 3E4CA 3AWIA 4DY6A 3DBHA 5A3SA 5JJ6A 1R4ZA 1IM5A 4UHBA 4BQNA 3AR7A 4EQ6A 4BKMA 5SZIA 3I4GA 3T5CA 4I50B 4QDJA 2I6FA 2XZOA 2WT4A 4UDYX 1JTFA 1K4YA 3QUTA 2REXB 1N4DA 1VP9A 3OIDA 3LBAA 3W5DA 4Q0MA 5FQ4A 4OFWA 3ICQB 3PE4A 1KARA 4E5NA 5CT5A 4K9SA 4CM7A 3TKAA 4CWAA 2BM0A 3IQFA 5SV2A 1ZI6A 5A23A 2QRUA 1RJWA 4XYMA 3N0TA 3PV0A 4QJBA 3MGKA 2Q3EA 2AYXA 4X24A 2HDOA 3J7AC 1KVQA 4GPD1 3BJZA 1MEJA 1NXQA 1H0SA 2CXOA 4J9UE 3H0CA 3ZLBA 3JQ1A 2AUMA 2CK3A 3OCWA 5TQ0B 3JCZA 1I7DA 4PLHA 1N5LA 1PEKE 4U0JA 2EWMA 3RH0A 2GN4A 4PHFA 1M2OB 3FCOA 4EGSA 3NIWA 5ENQD 5TC4A 3COJA 3SJUA 1DPFA 2DETA 2FWAA 4JQOA 1BGXT 1KFCB 2GCOB 4JS0A 4L57A 4XOUA 3G5MA 2QLFA 3LCMA 3I8OA 2N9UA 4D43A 4MUJA 3IQHX 4MV5A 4DCJA 3CX7A 3AJAA 4P4UA 1W52X 1A72A 2CSXA 3O3OB 3UAVA 4P4LA 5TQ2A 1P5JA 5JFGA 1JEYB 5KJ1A 2CLOB 4GCNA 3TRIA 1UQTA 6YASA 5FR2A 3RTEA 3OQOA 2BH2A 3FSGA 3IDAA 1SUSA 3VYWA 3FTXA 1JAHA 2P9UG 3VHXA 2ACKA 2PH3A 2Q21A 3IJPA 3FH5A 5I9IA 2L42A 1JNXX 1HDOA 1M34A 5EZQA 4C43A 3BE8A 2ZG6A 2DPGA 1ZBDA 3SIXA 3OZWA 4KQMA 1Q92A 3RUAA 3TQHA 3K1YA 2YWRA 1TZCA 2ZYVX 3IDOA 1U8CB 1M83A 2O2SA 3CT6A 1F1BA 2G08A 3CBQA 1GQYA 3F7TA 2VRCD 4UFPA 1ORDA 1CZHA 2AVDA 1TADA 5BPPA 4C3UA 1U8ZA 5E1DA 3URZA 5EVJA 2FHPA 5EWMB 2H31A 3LT0A 3ZHYA 3ANMA 2PN1A 1AT1A 1HOTA 1QMPA 4K0KB 4JCOA 1Q2XA 3RRZA 5JHHB 7REQA 4M76B 3PUWA 4QYWA 1LLQA 4MHSA 4JI5B 2HR1A 2YICA 3RAJA 2BCEA 4U8VD 2A59A 1QYXA 2AJTA 3H16A 1WUYA 4DSTA 2IE0A 2OCCE 4J0KA 1HH4A 4NDNE 1O0BA 1NLMA 3OPYB 1UZNA 1WSWA 5LWHA 4GTTA 3TLGA 1QIMA 2AUNA 2W6PA 1BX1A 3V4LA 2AE2A 1Z62A 2Z4SA 3M0EA 3BSYA 3S5UA 1CS0B 1Y7LA 2BKXA 4NNOA 5CUQA 1NVVR 2JAQA 5B55A 4AW9A 3WLIA 4X91A 4R2JA 4RH0A 4C3ZA 3ZZ0A 3SXJA 3IPCA 4EHLA 4RTRA 3PUHA 2X38A 5C5EA 3DYIA 3ANNA 5TV2A 3OEWA 3E5HA 4ATNA 2PX3A 2AN5A 2AOUB 4EG7A 3UPVA 3S81A 4ZCLA 4BIMA 2RI1A 1OXBB 1NVDA 3CSTA 2H4ZA 3OPNA 2NYAA 2CLEB 3CNBA 4JITA 1STOA 2Q4BA 4RMJA 3VKUA 5CGZA 3LEWA 1X0VA 4BY6A 3B7SA 5DO9A 3AU9A 4DW8A 1WXGA 1EHIA 3EUAA 4R8VA 2HRCA 4EYKA 3HHEA 4FYVA 2PT9A 1EK1A 2C7GA 1KY3A 1S01A 3S0JA 1YJQA 5HE9A 1EIZA 3BCSA 1F1JA 1O5OA 4WE3A 3AR5A 4DM3A 4MYSA 2VNHA 4OB8A 2J5BA 2IHVA 1UP7A 1GKIA 5DMHA 3IRUA 5F12A 3MSCA 5EILA 2Y6VA 4RD6A 1DZIA 3L0BA 3Q9NA 1Z38A 2X7HA 5YASA 1IY0A 4WEOA 3QOUA 4U2GA 2ORED 5CCBA 5FD8A 1IXRC 3C39A 4EVIA 3A4IA 2GBCA 2IU6A 1XZAA 4ZYZA 4R69A 2E87A 3JQDA 3MW8A 4UWHA 4QTTB 1MC1A 3ZVVA 1UANA 1D1TA 1P45A 1RQNA 3I0ZA 3T61A 4B3JA 4M88A 4K8RB 4XZ3A 5EZYA 5KQMA 1U2TA 3GIDA 3A3NA 3KJQA 1YS2X 4FT2A 4I2WA 4D7AA 4QRDA 3NT5A 3W8FA 3D8NA 1RTKA 1IH8A 1UM9B 2FEWB 4DXAA 3U1VA 1HF8A 4L9SA 2WB4A 2Q4TA 1A4IA 4J6EA 3TSYA 2VDRB 4ZT6A 1FBTA 2R97A 4LPSA 2P7IA 2HF2A 3A6DA 3QC1A 4ZU1X 3M1AA 2QSJA 4ID3A 3AR9A 3S5JA 2DZOA 3VTKA 4ND8B 4BB9A 3E15A 5IBPA 4CM4B 5BW8A 5B3LA 4EB6A 3DGEC 3LKBA 4UHKA 3QBDA 1H6OA 3IEPA 1SG9A 1VLVA 2EZ8A 1TNUA 3ICEA 1J2YA 1JVNA 1IAVA 4AG6A 2NXWA 5ENSD 4JCCA 4TKLA 2O2GA 5EUQB 4LF4B 5EUMA 4MIEA 4AU1A 2PBLA 3U7QA 4EZIA 1PNOA 1Z25A 4GQBA 4G67A 3E2PA 4PQFA 1SHUX 3DL0A 1X7ZA 1IEXA 5F35A 3COSA 2RGCA 3K0FA 3OG9A 1E2EA 1U0HC 1YZGA 3GFVA 3QFHA 5BXQC 2FUKA 1EX9A 2I9PA 2RH8A 3M7IA 4HS4A 1WM5A 4AQYB 2R02A 4U39A 2R60A 4EKEA 1H23A 4MX8A 2FSUA 3RD5A 3VKFA 4LYYA 4MLDA 1D8AA 1T43A 1YIOA 1VJGA 2O7VA 1BJTA 1EDDA 3BXXA 2C5SA 3RADC 2IY7A 3ELUA 3OAAD 1USIA 3KYDB 3GR6A 2B6NA 3GAAA 1RZ3A 4IBOA 4J7AA 3PK0A 2J3IA 1P2BA 4YN3A 2QY6A 1P6XA 3SGLA 2ENWA 3ZPJA 4DCSA 4BVKA 1DXYA 4H77A 4A16A 4ZO6A 1J20A 3O38A 3DPDA 3R7NA 4PAOA 1UKYA 1QCZA 2P4HX 5LQKA 1QH1A 4FJ2A 1I3OA 4RJ2A 2ZZNA 4CODB 3MAAC 2PMDA 3DD5A 5IRCD 1GVNB 2AI1A 4FC6A 4FI3F 4Y1RB 2IOFA 4CG1A 1LRLA 2QI9C 4GMGA 2IYYA 1P1BA 4CCYA 3LE8A 3P0IA 4L8VA 3TWQA 4RPLA 4LCJA 3KEFA 1IB0A 1RDFA 4WI1A 4EJSB 4Q4CA 2HO1A 2P4QA 3IGFA 2X15A 3RNLA 1QO0D 2J3DA 4KBGA 2WUDA 3A2KA 5K4GA 4MSUA 2GSDA 2AJ8A 3CSSA 5SZJA 3VTXA 5GIOE 1X77A 1L8AA 2ZU0C 1QE3A 2BKEA 1LRKA 3HJHA 2TMYA 3FFWA 1Z12A 4ARAA 3TNDA 1W0KA 2GVZC 2VK1A 2IS4A 2ACVA 1XTBA 4LA4A 3JQEA 1EDZA 4ACLA 2ZAOA 3IIKA 2DY0A 5J63A 3LUHA 2R1VA 5JD6A 1XTIA 1N34B 3EPHA 4P3KA 2YCBA 4HCJA 3P2BA 4WECA 1CCWA 3QGMA 2YV4A 2C20A 4JD5A 4WRRA 1ADYA 1S3FA 5DLEA 2H0AA 2Y0CA 3EGXB 1ZR4A 3U4QB 4B4KA 4FYKA 3PENA 4L9PA 2FYTA 5EA2A 2F55A 4NHEA 1V8OA 3KQVA 5HJ7A 1WY5A 1I7NA 3KVNA 4JLAA 1XRSB 1DAPA 1EVJA 2ENUA 1JALA 1QC5B 3UK2A 4KHPB 4GOND 5E2AA 3HRKA 5CAEA 1E7VA 3O8RA 4HL6A 2VJYA 1PR2A 1ACMA 4DUIA 2XB8A 3O8OA 4LGMA 1W0CA 1NQOA 5LMZA 4TUUA 5C5DA 4WGFA 3TIGA 4F72A 4X85A 3IAS1 1ADJA 1U0BB 3E34A 3VPHA 1VHLA 4LECA 5ERXA 3KS2A 2ZBGA 4YR9A 2PUHA 2LDBA 4FCVA 3IESA 3DS8A 1KDYA 2GD1O 1DVPA 1GY8A 5JFTA 1Z33A 1JN0A 1IG0A 1FE8A 1JHDA 3SVLA 4D6PA 4URHA 3SKXA 1XQ6A 2ZE7A 3UO8B 2AFIB 3W9FA 1E5XA 2IIVA 4HLUA 3KCNA 2G4LA 4MKHA 3TVYA 4MPPA 1XLWA 1TU4A 2HPHA 1NN5A 2AX4A 2PDAA 3O94A 5DXAA 3O4RA 4KO8A 5HGJA 2Y27A 3I8XA 4CMCA 4XR4A 1YA0A 5AJDA 1SIUA 3N2KB 4YCMA 3MYRA 1L8LA 3W6NA 5ARCA 1SKYB 5CT8A 5CFQA 4EYSA 4PSVA 5K0EA 4MGZR 1XVIA 1XXHE 1XZHA 1ZM3A 2JH9A 1UMKA 1KOGA 4R9VA 4EVQA 3VTYA 1PJLA 1ECCA 5FZRA 2I8AA 1UJJA 5JCOA 2BFFB 1FRVA 3T35A 4M8KA 4MS4A 3EZ9A 2G28A 2G70A 3X43A 1W4ZA 3HN7A 3B1YA 2BKKB 2P4UA 4KQJA 3ZZMA 5CPBA 4DLKA 1T34A 3HDTA 4QUGA 2EP5A 2NVUB 5EOVA 1V1RA 4MUNA 2IS1A 3ILHA 4GMJA 1CQJB 4I2VA 2AEJA 1AGRA 4CN8A 4RS4A 2YZKA 1JHAA 3DXMG 4TL8A 3OHSX 2AJCA 3FUEA 1UBCA 4IUCS 2FOIA 2JI4A 3K9NA 4XVQA 1CD5A 5BWMA 4GPMA 1A8SA 3RJMA 4PW0A 5ITVA 3II6X 3GWGA 4C4RA 3P32A 1NSTA 3KLMX 1H0RA 4TMKA 4KLNA 3O21A 1RYFA 4JVOA 1PZFA 1EUQA 5KJKA 4YPFA 4FEGA 3EHDA 2W58A 4JXXA 1BMQA 4PIVA 2WXIA 3ODGA 4WLVA 4E1VA 1B0UA 4LDNA 4MEBA 1IZ9A 1ZD2P 5B2ZA 1IVNA 2Q3BA 4KNWA 1KLXA 2GYUA 3B6JA 3TVDA 2KATA 4IKEA 4CUZA 3GLHA 4G5RA 3OQ1A 1FYVA 3MWJA 4EZBA 4F6RA 4LK2A 2A1TR 4BVAA 3AW8A 4BVGA 1YUBA 2ZSIA 3GDHA 4C7OB 1F8XA 3OO0A 3FOEC 3TIVA 4U0SA 2NYUA 5EJ4A 4BMDA 5HKBA 3JQRA 1TZBA 3OTQA 3KUXA 10MHA 2A4ZA 4PC3A 5C1IA 4M3NA 2ZIVB 1M6NA 1US8A 4YC7A 1KC3A 5AJTA 3Q3VA 4YDEA 3ABZA 1U7XA 3PYLA 3Q8LA 2YRFA 4IZIA 1HR0B 3PWTA 3ZY6A 5ENNA 2JFWA 5B12A 3NHFA 5JAIA 4U96D 1LY1A 3TZ6A 2B7CA 5KNHD 1UKZA 4WLEA 3QK7A 5A0FA 2A1TS 5EE0A 1E96A 1V48A 1KI3A 2RD0A 5G55A 3IQEA 3E2MA 2IZ1A 2AFIE 1OVGA 4DV7B 5J23A 4JB8A 3ZC3A 1NFRA 2LXLA 1XF1A 3I5MA 2PUAA 4AJEA 2DYSE 2RCYA 5HKKD 2BD0A 4FZJA 3VHLB 3KDPA 3BSSA 1O5IA 2QG6A 4WESA 1F17A 4KIUA 3KSLA 5K0SA 1ZAYA 4TM8A 5DVZA 1X7HA 2H92A 3BXGA 1P4HA 1W5EA 1L5WA 4LOLA 1F2VA 3LP8A 1MB2A 2Y69E 2X0FA 1A1SA 3DEHA 3EDTB 2XCRB 4DOMA 1HXIA 1AKEA 1SKYE 2C0PA 3Q6IA 4D8XA 2TMDA 5CYGA 2GCEA 2Y76A 1XMVA 5JARA 3BHJA 3PX2A 2FMTA 2VPIA 1D8TA 1J2EA 4UUBA 4C4ZA 4CM9A 1OXKB 5FWYB 4HNTA 2XEHA 3NEAA 2OBBA 3MJEA 4D96A 1EBBA 2AEEA 3FMOB 3IB3A 3Q0IA 3V1YA 4K8OA 3L4JA 2HU2A 1TO1E 3LKZA 5JDCC 1NJ1A 5JJCA 1QYWA 4X8MA 5AI0A 1UWVA 4TV8B 1MB4A 2FPIA 4IH9A 1VMIA 4LXTA 3DWIA 2REQB 4BAZA 5D2CA 4K2HA 3AB3A 1NOIA 1YMUA 1GGMA 3M4YA 2D13A 5K6AA 3KBBA 4R1TA 3T5TA 1CLEA 4ARZA 3MS2A 1E7WA 1RW2A 3ZDXB 2UXBB 2H0QA 4KQ6A 1YU9A 2RG8A 2QRGA 3AG3E 3SS8A 2VGXA 3LKUA 3SYLA 2QRKA 2CUKA 5I7FA 1FVFA 5DNYB 5DBHX 1ZEMA 1NPYA 2ZVJA 5AK3A 1IN4A 4GTVA 2RBKA 3TDMA 1XZLA 5C5IA 2NSDA 4RMIA 3PI6A 1BH6A 5FQ7A 4XKBA 1UT5A 3CRNA 1TYCA 3KWLA 4JVLA 4L3OA 2H08A 1DCKA 2FDCA 3B9PA 4ZJZA 3V1NA 1PFGA 1RJEA 3C7TA 2ZRLA 2GRRB 4YXWA 5ENTD 2CMFA 4G24A 1E7SA 2ZGDA 4D0LB 2RHRA 4AL4A 3AB8A 1BIFA 1DCMA 1X7XA 3M82A 1BNCA 2UZIR 2HL6A 2H1OA 1DGQA 4Q3CA 3O9MA 1X6VA 2JGIA 2OFWA 3QUSA 4YRMA 2IXAA 1VGRA 1EVYA 4FYWA 1QF9A 3RYCB 4FYXA 3UJHA 3ZIAD 5BMVF 2WNHA 1HE2A 4U5QA 1MT0A 2EEZA 5TEWA 4B8YA 4J07A 3BQMB 4KVFA 1N1GA 3R4VA 4JP3A 2FMFA 4QGGA 1JKJB 4OHWA 5F2OA 2CJXA 4ESOA 3QV1A 3SU8A 3OY2A 2QU8A 1QGYA 4CYMD 1OV6A 2B0CA 5AI8A 2YYAA 4N39A 3JPYA 3OOJA 3VPCA 2JBWA 4EPVA 2CD7A 2RKKA 4QXMA 4J4HA 1R37A 1T0JB 3NUQA 3RK4A 4F46A 2RHHA 1GADO 3H5VA 1NFIE 1TE2A 2BZGA 4FA6A 3QB2A 2BTOA 4DIDA 3PR2B 3LT4A 2GRPB 2EHJA 5KS2A 1JU4A 1U3TA 1V35A 4BZWA 4UM7A 2YZGA 3VLEA 4NOMA 2CFRA 4XYBA 3A25A 3IV9A 4AECA 3AEZA 3I6ZA 4D82A 4EWLA 6GPBA 2AXUA 5K51A 3VISA 1QG6A 1S9HA 4F3TA 1CR6A 5IXJA 2XZLA 4YECA 4WPGA 4YMTA 1WNFA 1X13A 3ZE2B 4C0KA 1Z6QA 3KT3A 1I9CA 3IPLA 2EKDA 1OTHA 3B13B 2XAUA 4WVFA 2W37A 2D4AA 4G0PA 1OZAA 2Q3LA 5BVGA 3ZCRA 1NDUA 4YV7A 1LPOA 1X15A 5AOBA 1H2WA 5ALMA 1DIHA 4O33A 2JFVA 3N3BC 4OQNA 3PUVA 5KINB 1UOEA 5H83A 5K3DA 1ESEA 1L5ZA 1CVLA 2WR8A 2AKAB 5BSMA 1KK1A 1UDAA 3GWZA 1E94E 3PRYA 1DMRA 1U5AA 4OOFA 4PRKA 4IV0A 4AI6A 1FXWF 1RXIA 9MHTA 4KFTA 1NJ6A 3OHMA 1I7QB 5IAAA 4LHVA 1UFRA 3W8EA 1T8UA 3C3DA 4ITRC 3MCZA 5KU7A 2GRLA 5ALSA 5DHQA 4BESA 3HXMA 3HIZA 2UY1B 4PZCA 5K0BA 1XXLA 3G2WA 2FETA 1TU0A 4KXNA 3SC6A 2NPFA 4QTUB 2VP2A 4M1YA 4LWPA 5JDIA 1J1IA 2Y9PB 1KZ7B 3VTFA 1VE6A 1CY8A 2YN4A 2FPPB 5BRAA 1MX9A 2WAXA 4N3BA 4MPRA 3HYLA 1Y3IA 4B79A 4G81A 4GYWA 4R2KA 4WSOA 5HRCA 1PJZA 3ROGA 2CNKA 4TWIA 3ND8A 5JS6A 5JVDF 3V2XA 5AI9A 4EG4A 2YYYA 1FA9A 1QLHA 4B3GA 2QTBA 4V0KA 2X6HA 4LEUA 1KE1A 4WUVA 4XDYA 1VRCA 2VA9A 3N6XA 4PYRA 2WOOA 3CV3A 4O1IA 1F6WA 3TTYA 4N01A 4RHUA 3IKJA 4R5MA 2XCTB 1KXJA 4FC8A 1U7HA 2QRPA 2Z5FA 3G1TA 1SVSA 3AJRA 2VTBB 1QB8A 4UULA 1U0RA 2J08A 4IDDA 4QPZA 1MQ8B 2IBMA 4MQLA 5FAKA 3OWHA 3EA5A 1WCWA 2PJDA 3MUEA 1ZOIA 2WTAA 3KQLA 3NKVA 1KGSA 1HOXA 1P2DA 2WF8A 4QYXA 1PS0A 4A5OA 3RQSA 4BMYA 3KYJB 4X54A 3HZOA 4B4UA 5CMLA 3QPWA 3Q75A 1KJWA 1WF3A 1YJAA 4DMKA 2W00A 3NHJA 2YNQA 2Y2UA 4F1SA 4EK9A 1P2SA 5LOVA 4GR4A 4N2QA 2YVLA 3ZZ1A 3OJOA 5EKXA 5CA0F 2DTDA 3FD8A 4BNYA 4YRQA 3CCFA 3WGMA 1SHKA 5I7AA 1LPMA 4J1NA 4X1YA 5EE1A 2HF8A 4HWRA 4XGNA 3Q79A 4H0NA 5E2BA 3M3HA 2O5EA 3O1HB 2PS9A 4DIEA 4DS3A 1DBSA 5A3VA 1A9RA 5C81A 3IHKA 3QVJA 3AKEA 3T5XA 1XTPA 3SJ7A 2HA7A 3O74A 4L78A 3ZHEA 2XCSB 3QVKA 1MGOA 1XQ9A 2ID9A 2QI9F 4ZI2A 2ICAA 1T5TA 4YCNA 4AJNA 4UMDA 1N3IA 2VIIA 1EJBA 5JMPA 1F4VA 2EYUA 3OPQA 1JT2A 4UQPA 2AI3A 5AYWD 3VDQA 1L5HB 1P3Y1 3EUWA 4MAMA 2JCYA 1CERA 5AJXA 4IR7A 1MVOA 3G49A 2ORIA 3RWMB 2Y1LA 1VYTA 3C2QA 3H1FA 4Q15A 5JAQA 4CGVA 3ND7A 3T9EA 3CTMA 4WCDA 4P5EA 4P29A 1VBFA 5KTRA 4PFSA 3RIMA 1M8KA 4RVFA 2QMOA 2BMFA 3ZU2A 3NUGA 1L4UA 1U7ZA 4O2BB 3TAXA 1TUIA 2WHPA 3S44A 3BAFA 1V0JA 1N9GB 3DQQA 3D4IA 2AUTA 2H8KA 1SA0B 4MQFA 4GKKB 4ANUA 3JQ7A 1K6EA 4HNUA 4RHCA 4DKJA 1H0KA 2WMOB 3FHOA 1JT9A 3ONKA 4M36A 3S8EA 1GARA 4RLHA 4FR0A 4BO1A 2I6QA 5ABPA 3S68A 1EJ6A 1W6UA 5FINA 5LD2B 3WBJA 4MRVA 3T7AA 2ZM5A 2QM8A 4DUYB 4V0SA 2QTNA 2IUEA 1U28C 2ZR8A 2NTVA 3PPWA 4L6AA 1FU8A 3R7FA 3AY6A 1NNSA 3I4CA 1N5IA 1R2QA 4B33A 1P1FA 3KTAB 2WLSA 2VF5X 2ATIA 3G5LA 1UEXC 1SD2A 3BAZA 4RS3A 2QRVB 1U80A 2Z8XA 2X0JA 3C41J 1XYYA 4QOJA 1BXRB 3EVZA 1WQ3A 3M70A 4XE5A 2QT9A 1QSGA 2PSDA 3EMVA 2RAUA 1VA5A 3B7PA 4KYIB 5TPZA 4QQKA 3R20A 4MPDA 1A7UA 3JAKB 4AKIA 3K4HA 1A9XA 1IMOA 2VR1A 4DDKA 3BILA 3GPLA 1G8MA 4YH1A 2D1TA 1OLUA 4IOMA 1XQVA 4B74A 5T64A 3PH0C 4DY4A 4L22A 3BEDA 1NWCA 1K8KG 5I8PA 3U9LA 1YZVA 2Z3WA 4LSWA 5JPDA 3HXKA 3RT9A 1BROA 1EUYA 1DEOA 1ICEA 1N2EA 1SHZA 3WQRA 5JQGB 1M5RA 4RBNA 1V55E 2PX8A 4Z7JA 3TTVA 2AV6A 1RKUA 2V45A 2ZCUA 1P0PA 2PXAA 1I7PA 5EMMA 3CXUA 2L82A 4RQUA 1XGKA 3SYNA 5SYMA 2XQFA 3KZVA 4UTOA 2OQ2A 3L1KA 1V1JA 4JZYA 3DLTA 1TIPA 2B8TA 2QUZA 4FFVA 5AQ1A 2PKWA 5I4KA 3FPHA 3WJ2A 4P0PB 3TEFA 4J0GA 1RSZA 4IHQA 3FVRA 4MUKA 4WXMA 1C9KA 3GQVA 3NHPA 1GTL1 3ZQUA 1IBMB 1A2KC 4HFJA 1QPBA 4GBGA 1J49A 4JBXA 4L5AA 3T4XA 4LJRA 3VZPA 2GEFA 2NV2B 1IK6A 3J5QB 2YQ4A 1PT9A 4YRSA 2CLFB 2O06A 3ILSA 1OJLA 2AZMA 4BNFA 5JNWA 1EB8A 4JLVA 2WMYA 3LBNA 3OD1A 3ZJVA 2EVWX 1E6LA 1K66A 1N54A 3P9XA 1K0UA 4E5YA 1GPUA 3BWDD 4P6VF 1VQ1A 3OCYA 4UU0A 4AJJA 3U26A 4EGCB 4N12A 4PG8A 3WLJA 2W2PA 5FH9A 1OFIA 5IULC 4L4UA 1TQ4A 1IB6A 4HGQA 4MZXA 5JCXA 2RIRA 1A5TA 2KMLA 2ZRAA 1WETA 5IP5A 2PM6A 4OXXA 4O63O 1BWPA 3K9LA 1ESNA 1MIHA 3ZTWA 2WQ6A 3E82A 4CNQA 1P7PA 2FPKA 3QHQA 1J0DA 3IR5A 5FP0A 4ZZ1A 1G60A 4PXAA 3R8XA 4AKSA 2BM8A 4K87A 5KTSA 4FFSA 4NATA 4QJ4A 4B2PA 1W8IA 5KTTA 1M8GA 1YK0A 4RD2A 5EC8A 2XEXA 2IU1A 4O0LA 4L08A 4M1OA 2O4UX 3R5KA 4UVDA 3AILA 4N0PA 1EFRD 4WWPA 4FE4A 5KDOA 5BOSB 3SBEA 5DSTA 3RRBA 4LBVA 4ZYLA 3F46A 2XUDA 1WF6A 4Z3KA 4FSHA 4ZI3A 3T5DA 3U7RA 4MRPA 3TIFA 3NFYA 4A1GA 1SBNE 4Y2PA 3VU8A 3V9AA 2OM6A 4IHAA 3SHFA 4REOA 4IIFA 1CYEA 3CNLA 2HPZA 1ZVVA 4LG6A 4O8CA 2WQ7A 3U6KA 1J9EA 2NWQA 3DZBA 2IEJA 4IGIA 1CF4A 1KPGA 2VJMA 3QY9A 2GCGA 2WM3A 4CQJA 3JVDA 2PL9A 1ZUHA 5AQEA 4YLEA 3EVEA 4HDKA 2FPMA 3BULA 1BHSA 2EEPA 2O07A 2WFLB 3MT8A 3LUBA 4CCWA 1NNUA 4D56A 2QPTA 4BGEA 1X2EA 2QD3A 2Z8YA 1PN3A 3D64A 5SY6A 1NW5A 1CQZA 3DXYA 4BNLA 3FHLA 2YWBA 2D1QA 1S89A 2PUVA 2X2EA 5CXQA 5HGXA 2IX9A 3I5UA 1VMKA 3DFUA 3RS7A 3FZQA 4CMEA 4ASUA 1CVRA 3W9SA 3DO8A 4UE2A 2YMQA 4LNBA 5LLDA 2W83A 3GELA 4WT7A 4CL2A 5J90A 1J22A 2C7BA 3PB3A 2FF7A 1I5RA 2PKEA 4OH7A 1Z39A 4OQDA 5BYJA 1NR1A 4G0VA 1Q11A 1VM6A 3PGMA 2O0JA 3SFXA 2OKCA 4MLCA 3FOBA 3I8SA 1L8OA 3SDZA 3DE0X 2GRUA 1IFXA 3IBYA 1OB2A 4MI3A 4ZREA 4RTNA 3ORSA 3BMQB 1X7YA 4OM8A 1J9GA 4Y6CA 4RA6A 3PX7A 6REQA 1MZPA 2JPDA 3HXQA 3DEZA 3KPYA 2EZ9A 3CVPA 2B61A 1GN8A 4ERNA 1HO3A 2VXYA 2BAGA 2D7JA 3O91A 1Z5UA 3U31A 1ZK0A 1Z0ZA 3M4ZA 1AE1A 3X2FA 3S2SA 5JS7A 3OVMA 4M6WA 4BOYA 4OHUA 4RTSA 2Q3JA 4R98A 1S2OA 1IBLB 3LNTA 3KZOA 2YFHA 4Q9AA 5IX8A 2HSEA 5CH3A 4KXXA 5JHGB 4ER6A 4GNRA 3MCWA 2W42A 3RIYA 3ISTA 4RYDA 3MGBA 4OI4A 3VNRA 5KTPA 3KJFA 2RK3A 1G8HA 4XYEA 1V4NA 1W36B 3ISJA 1IN7A 3WGVA 1XCBA 5EKQD 3ZCXA 3N1UA 2GFIA 4UNPA 4M98A 3T12A 4BZZA 3Q1LA 2C2HA 1XD2B 3ZHSA 4HJRA 2CMGA 4Z5XA 3UTDA 1ZI8A 4Y2YA 4E33A 3P9PA 2O7NA 3OOWA 3ZXIA 1E2LA 4FDMA 3EVDA 4QE3A 3OQIA 3IUJA 3KX2A 4ME2A 4ZQGA 3ZY2A 1UKAA 1H2ZA 4DWOA 2HFJA 4J8YA 3M89A 3DE3X 1P9RA 5LWQA 2VATA 4EF4A 1NZDA 4V3BA 5D1HA 3VSAA 5DNWA 3HB0A 4N3AA 1O94A 3UUFA 3H7AA 3GPIA 2X13A 3CRVA 3DVRX 4MUIA 3CN9A 2E1PA 1Z7GA 2F8LA 1MX1A 4NSNA 1PZMA 1YR2A 5L40A 5JAZA 2C98A 1EDUA 4HB3A 1WW8A 3HVRA 2PZGA 3MINA 4PZ9A 3NYRA 1TAQA 1JECA 4PZYA 1XMOB 1QGED 3RS4A 3R09A 1KU6A 4W1SA 1E2KA 3AQ4A 1OYOA 1OA1A 1GXSA 4HNAA 5IJZA 4NQ0A 2AC2A 3KHSA 2NAFA 2YNMD 2FA9A 3R7WA 3HFSA 3CA8A 1PVVA 5AAOA 4TKUA 1U9IC 2ZIXB 3CLUD 1Z17A 1Q21A 3FPAA 1EWQA 4K28A 1EFCA 4G23A 3QBVA 4QG7A 5EXPA 2CGEA 4BWVA 4B31A 1ZU4A 2I9CA 2ZE6A 4NL4H 3NAWA 2ERYA 4D8VA 2BGLA 1KEEA 3K92A 1XEWY 1TF5A 4H31A 1A5ZA 1OXUA 1H8EA 4G4SO 4B3BA 4ZIRA 1E64A 2QZSA 2WWTA 3V8VA 4PWYA 4G5GA 5EHQA 3PRKE 7GPBA 1GG8A 4Z7OB 1NMYA 2XSZA 4UEJA 5AI6A 5EFOA 4QYMA 4QOFA 5KX5B 4OHKA 3A6GA 1OFUA 4YMIA 4C7JA 2AA3A 4FN4A 4DJFC 4AJIA 3WADA 2E5FA 3TVTA 1VSTA 2W71A 1M2VA 3DWGA 1G9TA 3ZNQA 2X8AA 1YD7A 2JEKA 4ZTUB 1KBQA 2P9FA 4D8TA 5JD3A 4N3GA 5KJCA 3PA8A 4XWGA 5LQSA 3OZGA 1W2GA 2C2WA 4PCUA 1EJ2A 4G5SA 2KCLA 4WBNB 1BN7A 3C3RA 2HQRA 4GI1A 3W3ZB 1A8PA 3QBTA 4NMMA 3KVOA 1BHO1 1C7EA 4IS3A 5AP9A 2BM1A 1UBFA 3JQ0A 4L5CA 1ICIA 4IIDA 5AARA 4A0HA 1JLSA 2XOKD 2P68A 3D3WB 2C1ZA 2FVYA 3B53X 4K9RA 3DBIA 3TWVA 1IVYA 3ROMA 3HXBA 3HR7A 5JRJA 2BMWA 5M2QA 3RUIA 1E2QA 3WK5A 1TNYA 3RAGA 3FUHA 4LAFA 5IWCA 4P7JA 1HXHA 4MV4A 3E7PA 1FNNA 4RIHA 2ODQA 2GO7A 2G7MC 3WYNA 1MGPA 4DA8A 3QLUC 1Y9JA 5ISMA 2ZJBA 1SA4A 2P6UA 3UFXA 3CCCA 4U0KA 3VR0A 1E8DA 1A95A 2XDQA 2PWAA 4Q96A 3BXZA 3NAGA 1HT0A 2DF8A 4L2IA 5IWAB 3S1AB 1GPJA 1FDSA 2DLDA 1PVOA 1OXTA 1TNDA 1AXRA 1ZBPA 5IM4F 4PHHA 2DBQA 2C9BA 2M1XA 2VSXA 2AWNA 5HFAA 3R1IA 2XT6A 4BV8A 4BVJA 4GZDA 4JA2A 5EG5A 1MW8X 3LP6A 4DSAA 4KVOA 1V8DA 4F86A 4HK4A 3PNOA 3I09A 4ZANA 4QGSA 4CL3A 4A0QA 3AHGA 2CXRA 2VTDA 5HZGA 3WP1B 4DRXB 3NNDA 4TSFD 3A9TA 4NMLA 4ZI7B 3V32A 1Y89A 2IQCA 1OHHD 4N5MA 2OG1A 4JOSA 3EXIB 5EUCA 2ERCA 4QUAA 3VO1A 4XA8A 1ZRMA 3BF7A 5DU2A 1MOQA 1XA4A 2IF2A 3A1EA 4BNWA 2IKSA 3EG9B 4CF3A 2B21A 1SRRA 2OBYA 1ZH4A 4KYOB 3WAGA 4CT4B 2O3QA 3DSSA 3UHJA 2OXCA 1ZOOA 2HMAA 4H4DA 3H8WA 4ND7A 4KMRA 3PL5A 1DO8A 1UK9A 2H5IA 1PRYA 3U4GA 1W29A 2NZYA 3OEYA 1KY5A 2DXIA 4DIUA 1U7UA 3H87A 4DV6B 3CX4A 5EUBA 4IGFA 4UXIA 2W9XA 4GAAA 3BGIA 2GSWA 2I1LA 3HZZA 3MGCA 3VRHA 4M0EA 4EELA 5JYEA 3EW7A 1HLFA 3LDUA 4GI2A 2WJ6A 1ZCBA 2ETAA 1O1TA 3D9JA 2PM8A 5ED0A 4LVCA 3H5OA 1CY6A 1KFKB 3AFHA 4GLBA 4URKA 1WZIA 5AKIA 2I4NA 1VHQA 5AQ9A 5KCMA 3LY7A 5KJMA 3QVOA 1C0PA 5EIWA 2J5XA 3EFHA 2QIPA 3IALA 5FI0B 1FDVA 4ER7A 4IDBA 4H1TA 3DZCA 4G97A 3L7NA 2R7LA 2VJKA 3AESB 4IF6A 3S28A 3T7IA 1CS4C 4WBSA 1ODCA 2Y66A 1J4AA 1KJZA 1XLVA 3ZE7A 3VJKA 3QWAA 5G02A 4BGVA 3SQWA 3AL2A 3OT5A 1ZO8A 1J5PA 4HOSA 5KVCA 4GYOA 4XM1A 1Y3BE 2F3RA 4I9HA 4KI7A 5FULA 5I7RA 4ZHQA 4FMCB 1F2UA 2LVBA 1LSSA 2C0CA 2IITA 2NU6B 1HDZA 2LXMA 4YO8A 4XB6B 3I5XA 3R7LA 2J6HA 5FTKA 3QU2A 1YQTA 3IUBA 2WTNA 3WA7A 4D0SA 4D9BA 5T3YA 1WQ4A 3RKSA 4ZVRA 5CVJA 3DKIA 1LH0A 5C3MA 3IAM6 3U9SA 3NEPX 3L0SA 4DYVA 1QRTA 4LNAA 4X1KA 4JLUA 3Q3HA 1GGNA 5DNAA 4P31A 4K03A 1NFQA 3AU5A 5BR8B 3QHAA 4I3FA 3OZRA 2NQ2C 4WV3A 3FTFA 2AXVA 4G63A 4WLNA 3SO8A 2Z04A 2KB0A 4JA9A 4NH4A 3Q78A 5CEFA 4UJ3A 4XPIA 3KLPX 1CDEA 5E7JA 2LNIA 3EHNA 2L17A 4X3OA 1COZA 2LGJA 4R2IA 1P9NA 4RNCA 1WCYA 3S2FA 4GTOA 4IXNA 3D7SA 1JB1A 2XQ0A 1XRPA 1JTVA 2A5YB 2AI2A 4E5MA 1E2MA 4F2PA 3N6RA 2PWYA 4Q1AA 1E8WA 2MT9A 1HK7A 3O3CA 2HK7A 4P35A 2IYSA 1XF9A 1Y8RA 3E9ZA 4U7EB 3JQCA 3FBTA 1J2JA 3IBCA 4DRXE 2G04A 1LK0A 2FMUA 4D0NA 4WNEA 4KWIA 3HDYA 1WPRA 3GJ3A 1B26A 4ZC8A 2YJ3A 4OSPA 3UT5B 2CXSA 1WE2A 2ZJ3A 3KM0A 3PR3A 4LE2A 2UDPA 3R3JA 2H52A 1X3LA 3MUFA 1KVUA 1Z2NX 4FIZA 4RCYA 1SXJA 1N4PA 4G8BA 3KQKA 1IC6A 5EKSA 3ZE9A 4B6RA 1H42A 4ENWA 3WRVA 5CX1A 2VP9A 5JADA 3G2QA 1NVWQ 2P9CA 1E58A 1QF7A 4QNRA 5CCMA 3NZEA 3V8RA 1XK7A 5JH7F 2OHOA 2LO6A 4U6QA 1GTJ1 4Q1FA 3PGLA 3QPCA 5H7PA 4Z3DA 2CFCA 3WKCA 4ANWA 1PWXA 3NKFA 1ZOSA 4KL8S 1TYDE 1X7DA 2NACA 1P7YA 5I4BA 4RGYA 3IMCA 5JZ9A 5J9FA 4E2XA 4URUR 3ME5A 2PHZA 1TPZA 3E9EA 3TMAA 1AY0A 4DHEA 4X1IA 1U2RA 4QOEA 1P3JA 2QHXA 3U64A 2EC5A 3AX6A 3O95A 3TKYA 1XMXA 2R5FA 2WHEA 2R03A 5DHTA 1JU9A 3LQRA 2R3SA 1FTQA 4MP3A 4PV7A 1Z74A 3NNNA 4GMKA 3R0XA 4GLOA 1U2DA 1ILEA 4QG3A 3D6JA 1LNSA 1Z5GA 5KHLB 1F4LA 2ZATA 2ZBPA 4LZPA 5DM4A 1Z8FA 3APFA 2YJ5A 4ANVA 3RAUA 1EVIA 5B3SE 3VU9B 1WDYA 3EPLA 1OT8A 4DMUB 5F98A 1RLIA 3S2IA 2FH5B 1GDTA 4RFLA 2QEQA 5T4HA 3NBUA 3UJ6A 4ZC1A 2VHTA 3KZ1E 1KGDA 4IDGA 3LIIA 2AJBA 1GZHB 3ZJYA 3TN7A 1MX3A 1OIVA 1E3DA 2V6MA 4A3VA 4PS8A 5B4UA 4U3JA 1EINA 2W2KB 3T8KA 3OLCX 1E1CB 3ACBA 3IIEA 4DC9A 4LJYA 2MR5A 2Y3IA 1NKSA 2WG1A 5KYXA 4WLOA 2NUTA 4P0TA 3JQFA 5D1NA 4YHBA 1LF0A 1U04A 2V6BA 3SMQA 3W77A 1PJ8A 1E98A 4EG6A 1YS7A 5FYQA 5JJIA 1KMQA 1SO8A 3FUIA 1YQDA 3N76A 3BREA 3HCRA 1IBRA 1RWKA 2I8LA 3TRFA 2A1UA 1AF7A 1T25A 4BFTA 5JAUA 4DIFA 3SC2A 5A4IS 2AMLA 2QRHA 3RSHA 1QOPB 1F2TB 5DLQC 5J5VA 3QX8A 1Q1AA 3STTA 2GZRA 2YJNA 4ILGA 3R5FA 2KHZA 1B73A 2PY6A 1TPYA 3PZRA 1KMHA 5HFNA 5IU6A 1Z6XA 3I9MA 5A6SB 3EIOA 5EDSA 2WM8A 121PA 3FFAA 4R1UA 2W0MA 2YXDA 4U7HA 5C52B 3S1SA 3K6KA 3ROFA 1ZA2A 2FSSA 4WXEA 5BNIA 1WRBA 3AFOA 5EXEA 2WNIA 2JHCA 4QHYA 2VAXA 4BDTA 4EHAA 4B3RB 2OQRA 5FUWA 2HIGA 4DEVA 3ESXA 1P61B 3EIJA 2BMJA 1M8JA 3FOWA 2XZDA 3QYPA 3D0RA 2JAPA 3LTEA 2O2CA 5J47A 3TR6A 4LWOA 1LLCA 2J4CA 4G5YA 1ZGCA 3OD5A 3L04A 2FSHA 4UCFA 2C83A 1NYQA 3GJ7A 3ZQ6A 5MDHA 1EESA 2NYJA 4J1TA 8LDHA 3ROKA 2F3UA 3GLUA 5IEJA 3HBLA 4KVAA 5PNTA 2XITA 1KI1A 1A1VA 1H94A 3IBSA 4PHTA 4PRYA 1G41A 3OZDA 3W2GA 2HYZA 2CEKA 2ZYHA 1UBKS 4JFRA 4YDSA 4JYCA 3NBZC 2BFNA 1E89A 2ZKIA 3PEFA 1G9XA 4HN4B 4R40A 1FYWA 5K0JA 3AETB 2NQTA 4J6FA 5AT1A 2JJ1A 3DWFA 4M9ZA 5E76A 5JSFA 1OB5A 1USWA 4A2WA 1T9HA 4KDRA 4R2HA 2XBUA 3AB7A 2MYPA 4YGYA 3M4JA 4YFVA 3NGLA 4U7PB 1OU4A 1C41A 2MSLA 3K3PA 2YFYA 3HCAA 3FGOA 2JFBA 1QGOA 5KJEA 3HKBB 1DOZA 3GFSA 4M1KA 4EHJA 4MVJG 1P74A 2VFAA 3AM1A 4TTTS 2JLSA 5A7DB 4YJFB 3EXG1 1P7WA 2GEDA 4XFDA 2OORC 3WGHA 1MD9A 3WTBA 5HS4A 3IE2A 3H7IA 3FAKA 1I32A 4JBHA 3JUIA 3IS3A 1BKDR 1JSRA 2C03A 2ZBFA 3UK6A 3R7QA 1P2GA 3MFYA 1JVSA 4ZYTA 5B1SA 3MOSA 2Z3VA 3HCFA 3ZIMA 4GGMX 2PL2A 3EHEA 5K3FA 1TK9A 3V1LA 1NR7A 3AG5A 4HWGA 1ENPA 1O9GA 2EBHX 4JJ6A 3ZNPA 2WQZA 4NYMQ 3KRTA 2F8YA 4WWHA 4I5EA 4ZMSA 1J99A 2WTUA 2EJCA 2FY8A 5T4EA 3MUNA 1Z5PA 3AG2E 2FR0A 1WNTA 4G85A 3PE6A 4MWGA 1EQUA 1IQRA 2NYRA 1MIOB 4CF6A 1V9CA 4L2LA 5JNSA 2WXKA 1XCLA 4GA0A 2FPXA 3GN1A 3LCVB 2CFUA 3HO8A 2F1IA 1T5LA 4GWLA 2VH1A 1JG3A 3FR7A 3UAOA 1BKSB 1YONA 5L4NA 4ZU3A 2NXNA 3SEAA 3GAZA 1USKA 3TFQA 4U8HA 1Z3XA 4FFPA 3NHWA 2SBTA 2A0XA 1F12A 3CR7A 2WAOA 3AHJA 3Q85A 4RTPA 5FXMA 5M3BA 1E66A 2J3JA 2J7KA 1Q91A 1YJCA 1GQ2A 3Q3CA 3SOPA 2A9PA 5DNDA 2OWDA 3TB4A 1YVUA 1CVIA 4PAMA 3F8SA 1ES9A 3VH3A 1Q6ZA 4E4YA 1H4QA 3UW3A 1RP1A 4Y2VA 4G1MB 4EW2A 4XEHA 2A5DA 3EDMA 1JA1A 1WZCA 4EJFA 2HU5A 1R8SA 1NI5A 3CH5A 1FP7A 1MZVA 3ZX4A 4QO7A 3HUFA 4H7KA 2OGZA 2XPIA 1NASA 3Q7AA 4G2TA 4PX3A 4CL0A 2DY1A 4HPJB 1RC8A 4FIDA 2FW9A 2MWMA 1JFFB 3UBTA 1NIPA 3AG4E 4RU1A 5LA6B 3B52X 2QF7A 4QGBA 1QQBA 2ZQ5A 3TZQA 1D4FA 4JLWA 4IYRA 1E79A 1RM4A 3BD6A 5FIUA 1R64A 4O2AF 2BM9A 2YWCA 5EXSA 3FWVA 2CJWB 3K0AB 2XW6A 3LWBA 5MHTA 3UICA 4CKBB 1YA8A 3QP9A 3MVEA 2XUOA 2G5GX 1QP4A 3G17A 2J3LA 4GKJB 2XWQA 4F4JA 1H2RS 2JK0A 1XUOA 4HOTA 1HLGA 3K71B 1SVMA 1N7GA 4YJ2A 4XOIA 2OPHA 3BGDA 4OUKX 1GZSA 2H4JA 2D62A 1C1XB 3FI9A 3ADDA 3PHIA 1UL1X 5IEBA 3R44A 3EIWA 2HNAA 5B3KA 1C2TA 1E2NA 1RKBA 4ZO9A 5GZ3A 1GAJA 4DA9A 3RT7A 4DG5A 4AURA 4BKOA 3KEGA 1W85B 2IQIA 2I76A 3BJEA 1NE7A 3MJHA 1MXFA 3H8SA 4ZEVA 3RC7A 3R3WA 4YR7A 4MKFA 1PUIA 2BOVA 4O4HF 3E8MA 3PZ1A 3KJNA 1FZTA 5L95A 4A26A 1H6AA 5E8RA 2FEPA 5JBIA 3RC3A 4K9QA 3UPDA 1OFGA 4RV5A 1X5BA 1EQ2A 2I7VA 1GNPA 2BDEA 4GTMA 4N5NA 1YZTA 3FRIA 4XYGA 4UBOA 1W8DA 1GFSA 5BVHA 3VYVA 3CO0S 1ZSYA 2I3GA 1NI4A 3LK7A 5B7GA 1M9NA 3Q8MA 4EG8A 2B34A 3RRNA 2H7CA 2NLOA 1QBGA 1XG5A 2WJIA 2ZULA 4Q9LA 3ETEA 4IMIB 1EVEA 1NN3A 4MLZA 5HCNA 1KWKA 2IONA 3ZZTA 3JATA 2BMAA 3NC4A 5ALVA 1OCOE 1N5RA 1OBOA 3CS3A 2F64A 2IRWA 4LJKA 1V6CA 5FZQA 3F7NA 5HXAA 3FKSA 1ZGBA 2LWIA 1A5SB 1IHOA 4TSRA 1ECBA 4MQEB 4OJMX 1Z4LA 1RC1A 4OI0A 4EZKA 1UADA 2XA2A 3TZBA 3NVMB 4G1TA 4FGWA 2WWHA 4ZK2A 3S7DA 1F3OA 5BWCA 4EGJA 2FMXA 3F7MA 3QX9A 3IEGA 1SELA 5AK4A 5JXWA 2P9SG 4I1AA 3DTNA 1X7GA 4N5LA 1GAXA 2VK2A 3KUDA 4PX9A 1W4AA 2GQ0A 5IZCC 1FT1A 1CHNA 3H9UA 3G1UA 4MVJD 4GPBA 3BHNA 4QDZA 1GT6A 4RE6A 2F4NA 4OP1A 1R0KA 4TS3A 1T0IA 1X9IA 3DZ8A 4BE9A 1N5KA 5DX1A 2R1UA 2D3TA 2WJGA 1DP4A 2YJ4A 4R51A 3H5NA 1PK8A 5NLLA 1ZLYA 2QLMA 3VPGA 1DIRA 4A1FA 1U8UA 3RFFA 1P2TA 4L8LA 4V0QA 3R9XA 2MSWA 5JSZA 1NJFA 4FVTA 3VM6A 2Q6VA 4QU8A 1YDHA 5BUCA 3UK0A 1XZEA 4MKRA 1RKXA 4OYSA 4Z99A 4U7JA 1RAGA 1S5PA 2Q3CA 1HRDA 2P62A 3QVSA 3Q0EA 4YJKA 4RWEA 1GL6A 2QD5A 1ZOPA 3QBJA 2AMFA 5G4LA 4GE0A 5FTNA 4JENA 3E7FA 4YA6A 4DF3A 1DQPA 2FP4B 3FDJA 2IPAB 1Y8QB 2VWHA 3N2YA 3ZXUB 4CTMA 3DT6A 4CLEA 4KQFA 4OHVA 5HWSA 3DLIA 1KR5A 5ESDA 1HI9A 2FE1A 4H7IA 1P1RA 4BE4A 1T8TA 3BXOA 5FJYA 2GILA 2RKOA 3FPFA 2YASA 1Q3KA 1K6IA 2J30A 4HX5A 5EESA 3LUKA 3WX0A 3TSAA 4ZQBA 4X6LA 1SCAA 1WXQA 3VR1A 3IEKA 4MGHA 3PJRA 2VQDA 3VOSA 2JH8A 2V7TA 3LF1A 5I9MA 1HPLA 1KRXA 1NVKA 2O8BB 2CL7X 4AG5A 1YB2A 4I8XA 4HHEA 5KO2A 4NPHA 4TLLB 3OE4A 2ZRDA 4ZAZA 1YDMA 2I1VB 5LP6C 1WMDA 1BQ3A 3TZKA 4AN0A 5F7ZA 3ZHUA 2JLYA 2C54A 2R1TB 1VJRA 1Y1QA 5DBGA 4G5HA 3V4RA 3RAPR 5A6VA 4JBIA 1GRQA 2NUAB 1V8PA