4GU5A

Structure of full-length drosophila cryptochrome
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
537
structure length
537
Chain Sequence
TRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLRACVRGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Cryptochrome-1
publication title Updated structure of Drosophila cryptochrome.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 200
structure length 537
sequence length 537
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4gu5A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gu5A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4gu5A01
1U3DA 2Z09A 2QTRA 2QUKA 1O94C 2OV4A 3UC5A 3A2KA 2HZ7A 3ZIUA 1EUYA 4EG7A 5HUHA 3ILVA 1IQ0A 2AG6A 3CVVA 2C5SA 1OWMA 1I6KA 5J59A 2PXHA 1K92A 2G36A 3MLBA 4P2BA 4DDMA 5LM3A 1QTQA 1X8XA 1V47A 2GM3A 3IVGA 2DUMA 4JFAA 4YP6A 1J70A 1MB9A 1U3CA 4L2IA 1TYBE 4MUJA 3FI0A 3H97A 3Q10A 1WJGA 3INNA 2GOYA 3GUZA 3SP1A 2CYBA 3CA8A 3PXUA 1ULHA 4MUIA 3FIUA 4YP7A 1NI5A 3KT8A 4G5YA 3ZJUA 1KH1A 1WQ3A 1MB2A 3KT0A 3VGJA 4J75A 1A8HA 1MAUA 1TFUA 3K9WA 4WNYA 2DPLA 3OTWA 1F7UA 4JXZA 3G6KA 3ZGZA 2YWBA 3QTTA 1G59A 3GLVA 4QRDA 1KAMA 3CVWA 5IJXA 3N9IA 1JILA 1JECA 1GLNA 4S1OA 4BWVA 4MVWA 3F3MA 4KPUA 3OP1A 1NUQA 1FYDA 2Z08A 1ZH6A 1O0BA 4AS1A 1TQ8A 4MUKA 1F4LA 3TNJA 3TZEA 4HPWA 1ZJWA 1KQNA 1M8JA 3KT6A 2H2AA 1JIKA 1P7PA 5TEVA 5KWVA 1O96A 4ND6A 3P52A 3CLUC 1NYLA 4MWEA 3QE4A 3ISJA 4MW6A 1KR2A 4MVXA 1R6UA 3N05A 3AFHA 5HUJA 4K0RA 1O97D 1YULA 1LW7A 1M8FA 1IHOA 1YI8A 1N2GA 3IUBA 3FY4A 2RE8A 1JEEA 1TYDE 2PZAA 1XNGA 3ND7A 2PZ8A 2QTMA 3AL0C 1NP7A 4MWBA 4ZCTA 2CV0A 1G8GA 2HMAA 4KPUB 1FFYA 2QUHA 3VRHA 2PIDA 2H29A 3E27A 1WXIA 3H9BA 1X6VA 2NSYA 3KFLA 5EKDA 1TYCA 5K0TA 3LOQA 2E0IA 3PNYA 1N78A 2A1UB 1GTRA 2ZUEA 3SEZA 1OWNA 1D2RA 1M8GA 1NUTA 3IVXA 1O96B 3D6VA 3RHSA 4ARIA 2CFOA 1WXEA 1N1DA 2A88A 5JBNA 2DETA 2DEUA 3CLUD 1MJHA 4MQ6A 2I1LA 2J5BA 4CDNA 1M83A 4ND7A 2DLCX 3RK1A 2Z3VA 3NBKA 4F3RA 1WXGA 1WY5A 5FO1A 4EG8A 1N2OA 2XRZA 3M5WA 1QQTA 1Q77A 4ZT3A 1WOYA 1EJ2A 1QU3A 1OBCA 4ARCA 1KKUA 3Q12A 3P0JA 4R2MA 1K4MA 4MW1A 4EGAA 3IMCA 3H99A 1EFVA 2B7LA 1Q11A 3A4IA 1TYAE 1S4MA 4Q16A 4XFJA 1U0BB 3CVUA 4AQ7A 3COWA 4CDMA 2YXNA 4U7JA 5LFAA 2PG3A 4EF6A 5TS2A 2QTNA 3FH0A 4Q93A 1B6TA 3FG9A 4MW7A 2QJTA 2XRYA 4GU5A 4MUGA 1KH2A 3G59A 1KAQA 3K32A 4R2LA 2E18A 4I6GA 4U63A 5DEOA 2CYAA 1JGTA 2J08A 1OWLA 5BNZA 4ZCRA 1O97C 3Q4GA 4A91A 1JZSA 4UZFA 1J1ZA 1PFUA 1JHDA 3ZUGA 4UZEA 3ND5A 2V0CA 2D13A 2D54A 1NUUA 2JANA 4YMIA 3VU8A 1VBNA 3SDBA 3IOCA 1RQGA 2VXOA 1EFVB 3UOWA 2IJGX 3AG6A 5TGTA 1IRXA 1N77A 2O8VA 3FOCA 5J58A 3D6UA 3ZJTA 4EG6A 3GMIA 2V0GA 3IOBA 4KR6A 2DXIA 4RPIA 2WB2A 3A05A 4JZYA 3SZ3A 4DE5A 4L2IB 4MUEA 1KQOA 1ZUNA 4MWDA 3X1JA 3COVA 4EG5A 4KKVA 4MW5A 3ZXIA 3A04A 3C8ZA 3PRHA 4KR7A 1V8FA 2A7XA 3DPIA 3DV2A 4MWCA 4I6EA 3L92A 4EG1A 2VTBA 3TQOA 4MUNA 2J4DA 2X3FA 4HJXA 1KP3A 4PBTA 4XSVA 3UY4A 2QUJA 1M1ZA 1Q19A 4J76A 4MLPA 2A1TS 4NX2A 3CLRD 3CR8A 1JIJA 3HV0A 2OQ2A 4G5FA 4MAFA 1IQUA 4NATA 1IVSA 4ZT4A 1ILEA 4HJRA 4DNXA 3FETA 3RJZA 3UK2A 3HL4A 3AIIA 3P0IA 2CYCA 1VLHA 2A1TR 1OWPA 1EXDA 1T6YA 1QJCA 1U7DA 4U8HA 1T6XA 1COZA 3IUEA 1UFVA 2TS1A 3AG5A 2J09A 1R6XA 5H16A 3PNVA 1WZ2A 2DR2A 1F7VA 2CT8A 1NURA 4MW4A 3CLTC 3NV7A 4CT0A 4DJAA 3COYA 2VTBB 3FWKA 3PNBA 4EG3A 2DERA 4NDAA 3FNRA 4I6JA 4K03A 1ZH0A 3ZXSA 4MW2A 3MLAA 1QRSA 4CQNA 1OWOA 2NZ2A 1JMVA 4PBSA 1CT9A 1KQPA 2YWCA 4ZT5A 1YUNA 1MAWA 1LI5A 5DB4A 4E1AA 1J1UA 3TQIA 2RD2A 1VBKA 4KR9A 5KCMA 1QRTA 1PFWA 1EFPA 2X1LA 1GPMA 5F23A 1LI7A 3N2YA 2CV2A 1GZUA 5DK4A 3TS1A 1J09A 3IOEA 1O0CA 3IMEA 1U7XA 3MUEA 2JA2A 1NUSA 2R5WA 5DASA 4DDKA 3CLTD 2X0KA 4TS1A 1T6ZA 2ZP1A 1EE1A 3ND6A 5AHWA 1JIIA 3LCJA 3H05A 1MRZA 3P0HA 1QU2A 4DLPA 4MVCA 3U1VA 3DO8A 1G8HA 4R0NA 5J5AA 4ZT2A 2A84A 2IELA 3NBAA 1OD6A 2EL7A 3IDFA 1TEZA 1J21A 3AKZA 1H3EA 2AZXA 1T9GS 2E21A 1O95D 3CLRC 4FZJA 1EFPB 4ZT6A 1GN8A 3QTBA 5IHXA 1YIAA 5FO0A 1O5TA 4NAUA 4OJMX 1VL2A 2PZBA 1H1TA 4JYZA 3SZGA 2X1MA 1T9GR 1XJQA 2E89A 4RUKA 1I2DA 1PG2A 1Y42X 4YBRA 1O94D 3RK0A 3ELBA 4MVYA 1K4KA 1J20A 1EUQA 2QJFA 1O6BA 1R6TA 3CVYA 1OBHA 4HK4A 1XNJA 1MC1A 4PY2A 2AKEA 3CVXA 4ZCSA 2O5RA 3HZRA 1I6MA 2A86A 2A1UA 5TEWA 1N75A 1WKBA 2PFSA 1JEDA 3JXEA 4EFKA 4X0EA 2WSIA 1YIDA 2A4MA 3TZLA 1N2HA 3BL5A 3IVCA 2BTEA 3UMVA 1N2IA 4G6ZA 1DNPA 5HG0A 4F4HA 1YUMA 3HMQA 3L93A 1VBMA 1MOPA 3N8HA 1N3LA 4OUDA 4H3SA 4GRIA 3RFFA 3MMXA 3X1KA 4DDHA 4ZCPA 1GAXA 1IQRA 1XNHA 2QJOA 1IH8A 3CLSC 1NZJA 2CUZA 1KP2A 1Q15A 5FNZA 2CV1A 3MXTA 2GKSA 1G8FA 3IODA 1I6LA 1WXFA 1M8KA 4MULA 1GTSA 1N2BA 4YP5A 3G5AA 4MW0A 3S3TA 5K0SA 2BYTA 1H3NA 3DLAA 3HGMA 2WQ6A 3IMGA 3H9CA 1IFXA 3I05A 1WXHA 1JZQA 1N2EA 1PFYA 4NAHA 1NUPA 3HFJA 4ZCQA 5LLTA 4JXXA 2YY5A 2WQ7A 1H3FA 1PG0A 2IP1A 3ZJVA 1QRUA 1K97A 4QBTA 5KHAA 1BS2A 3COZA 4WSOA 1MBZA 2EJCA 3SYTA 4XFDA 1HYBA 1WQ4A 2HGZA 3FDXA 1O95C 1NSYA 5H7XA 2JAXA 1N2JA 4MUHA 2ZUFA 4OUDB 2CSXA 3IH5A 4MUFA 4QREA 3SEQA 4EG4A 3KT3A 3CLSD 3RBAA 2J07A 2QUIA 4MW9A 2D5BA 3LE8A 4NZPA 1KH3A 1M8PA 1QNFA 4PBRA 1KORA 3X1MA 1F9AA 4ZT7A 3FHJA 1SURA 1PFVA
chains in the Genus database with same CATH superfamily
1Y4AE 2HK9A 2XD4A 3UC5A 4KJZA 3JQAD 3T1OA 1L5GB 4JP2A 5J59A 3JD3A 3IQFA 3MLBA 2GCNA 3LRTA 1U0HC 2BZGA 4IJMA 3BA1A 3IAM1 3RSQA 4QO7A 4E1BA 2FW6A 1PGJA 2CJWA 5FFMA 4HNQA 1CLUA 1UBUS 1FTGA 3O2NA 2QTHA 2QE7A 4KYOB 1JJVA 4L4RA 3K5IA 4LQCA 4GSYA 2HI0A 3CFYA 3A9SA 3CEMA 2HV9A 1MOQA 3Q3HA 4WXHA 2WUDA 1I7NA 4HLUC 1JHYA 3TB4A 1V16A 3GEGA 3S5UA 1G2QA 3I8OA 1ELRA 1INZA 3MF4A 1IJBA 5CTAA 1JVNA 1FP2A 2PZAA 3KQVA 2VVTA 9LDBA 3KD3A 1DOAA 3HN6A 3D6MA 4M0EA 2CV0A 4KVFA 5C1BA 2FO1E 1ODFA 1XLVA 3LKZA 1YTLA 2I4RA 1NAIA 2ZWIA 3FPAA 1ODSA 4MV3A 4LGCA 5U9CA 2E85A 4KACA 3ROTA 4B45A 3ISTA 1QGZA 4MARA 4X8QA 4TXLA 3WLQA 3VO2A 4QNMA 3PNTB 5E75A 3BK7A 1W3BA 1JDSA 4QGSA 2J9FA 3GLQA 1IM8A 5B3SE 4C14A 1OHHD 5LFAA 3PA6A 3GG2A 3HJBA 2Q9BA 4M7RA 4IAOA 5HWSA 1SXHA 1KH2A 3KL4A 3I62A 1RPNA 4GMFA 4D4IA 4ND5A 5JDCA 1Y34E 1TUBB 1VLJA 4L08A 4YO7A 3TVYA 1HYHA 2WAMA 5DMXA 2C5FA 1YXMA 3CN7A 1ZKMA 1E1QA 1IHYA 3PXCX 3ON5A 2Q6OA 2P6PA 5TNXA 1ELWA 3FR8A 3PLNA 1C50A 4NMXB 4N5QA 1PQYA 4GOXA 4W6QA 1J1IA 5CYOA 1X7YB 5DI3A 4BO4A 4JI0B 2BTOA 5KOIA 2W0SA 3GEBA 4RQTA 4WUVA 3RS5A 2NXPA 5JNVA 3COJA 1D4AA 4K9SA 4KO8A 1XV5A 3LCMA 3WS7A 1AG9A 3IRVA 3FEXA 4DLUA 3PXEA 1SIOA 2FZWA 3WMGA 1R6DA 1GFIA 1P2UA 4H16A 4F45A 4WLNA 1U7OA 4C0MA 1VBKA 1TF5A 2HXSA 3WXBA 1IONA 3IR5A 5KSWB 2XMBA 4FOTA 1F12A 4NF2A 2J4FA 5JXWA 4HFNA 3IBSA 2JI8A 4RVBA 2RH9B 2QYJA 3LCJA 3L54A 2PX5A 4PAMA 3WDKA 4P5DA 4BPRA 3PQ3A 1AX9A 3WGYA 2IELA 3DOJA 4V1CI 4I1UA 3OTOB 3L84A 3LC0A 2B1IA 2G5PA 1DO8A 3GUHA 3T9EA 5HS6A 1ZNYA 5IKXA 1KI8A 4TMKA 3D3MA 1M1NA 1TF7A 3EQZA 1E61A 2XUQA 2EIHA 3N2GA 4HZUA 1L4UA 2A59A 4UMDA 3KXLA 3JYSA 4E4YA 3P9CA 2P0YA 2B2NA 2AKEA 2QA5A 3EGXB 1SXPA 2JGKA 5E8JA 3A32A 1T2EA 1HA3A 2JGDA 2J0UB 1AXGA 1LPOA 1Z8HA 2R00A 2CHGA 4NDNE 3E2MA 2EDAA 4ZOLB 1KO4A 1UBKS 4UREA 2X0EA 2Y2UA 2GN2A 6NULA 2FPKA 3UKJA 5JFTA 1U9IC 1FSGA 4N8SA 1BZYA 1ID1A 3OOHA 4IHJB 2WAOA 1M75A 3QEOA 2L0IA 1PVVA 2BVNA 4O2LA 4O59O 3LA6A 3IA2A 4G9EA 5A06A 4EG0A 1AS2A 3CVLA 3DB1A 5C2JB 4ROSA 2FSGA 3BUSA 2IS6A 1ZMTA 3R3WA 4XFKA 3HK2A 5IULC 2C7RA 1GYRA 4BVFA 3N2NA 2EERA 2VDMB 2Q4DA 5BQ3A 4OHPA 5A23A 1EBBA 1VJ5A 1EQAA 2WWHA 5C8XA 1DKLA 4MZDA 1QFZA 1NATA 1VIMA 3W2FA 2C2LA 4Q1DA 2PJDA 4E3ZA 3NOOA 4D8VA 3BWBA 5BSRA 3RS3A 1UWCA 1JWBB 3HKDB 2H4ZA 1MF7A 4UBJA 3QA9A 1VP3A 2CVFA 4BTBA 1JIKA 1P7PA 1NYLA 1X7XB 4US0R 4Y2JA 3ZTYA 3I37X 1DC7A 1ZD4A 4UBLA 2FUKA 1B4DA 1PJQA 2GA8A 3A6DA 2BP7B 1V8PA 3NB2A 1DEOA 1X0XA 5IDVA 1VSQA 5EE0A 1U3WA 1TAUA 2VGXA 3CPEA 1Y8CA 4KODA 3CUTA 1E9SA 1M7GA 2XOKD 3BQMB 4V2IA 4J0EA 1R12A 3D3JA 4UTNA 4H7EA 3TZHA 4AC9A 3KOMA 2P1ZA 4B40A 1UBLS 1IQPA 5BPPA 1CJUC 1U0SY 2G1PA 3FCXA 1CUSA 3TQSA 4P3PA 2KWIA 5I6DA 1WMAA 5K0FA 3A7DA 4V3BA 3OO0A 1EE9A 2W6QA 4CCAA 2QG4A 4M7WA 1OIXA 1E9CA 2XGJA 3UK6A 2ZTHA 4E51A 3DYVA 4EVQA 4KI0A 2VKQA 4MPRA 1EIZA 2R7MA 4LSMA 1ZUIA 4OMCA 5LR6A 1AC5A 2DP4E 5JEEA 1UL1X 2QRZA 1SKMA 1KBZA 1OA1A 3CY6A 1X80A 4BCBA 3TOSA 3SZ3A 3ESAA 1L1EA 5SZKB 4QTUB 2D62A 2PMFA 2PYZA 1HNZB 2OHHA 3ITDA 4PGFA 5EVCA 1BU8A 3G17A 1OGJA 4BNMA 2YFQA 3IT0A 4CU2A 1S2IA 1W76A 4Q4HB 1FNBA 3SKXA 4G36A 3OZUA 2YMPA 1E2HA 4QFDA 3IDZA 1AA9A 2UZ0A 2XH8A 3NUQA 1RXYA 4FJ2A 1R0YA 2BHTA 2CJPA 3C6BA 2IGTA 3DMFA 4AZWA 4GDMA 2PUFA 3BRQA 3WGZA 4K5CA 4E5DA 3TAUA 4DREA 5LKRA 5FPSA 2HHHB 4XM0A 1KJ9A 3IP7A 5EJ7A 3O9ZA 4K9LA 3RD5A 4NE2A 5BN1A 3F7NA 4XDYA 4LJ4A 5JSYA 2OCCE 1VCIA 1IUOA 3JPWA 4GYWA 2YN2A 3V8NA 1YO6A 4IH4A 2IYRA 4Q1FA 4MS1A 3SFXA 1O57A 2G72A 4PLTA 3P71T 3J5QB 2QGZA 1EP2B 5TGZA 3AVUA 1P9LA 4HDMB 1E2EA 5CA1F 2NG1A 3H1AA 4PC7A 3SD7A 4MKGA 3AFGA 1NDHA 1U0FA 2R66A 3AKZA 4ZMRA 2J6BA 2HM8A 3VR6D 2O20A 3I4RB 1DUSA 2QM0A 4IDEA 3L13A 3F6QA 4DA0A 4F2WA 4HOYA 2PU5A 3CKKA 4BFTA 3CKBA 3MGBA 2BKLA 5J43A 5ANLA 1PE0A 1C7ZA 4KZ0A 3GMDA 3PDIB 1L7PA 1RCFA 4CEIB 5MFPA 4A1SA 1OLUB 4JDPA 2YJ6A 1O54A 5A1JA 4XEIG 1H9AA 3B1XA 1KJZA 3PR1A 3QWPA 3C1UA 5JADA 2VJYA 2B35A 3NEPX 3LY9A 2O3TA 1DPGA 3IPRA 1G8FA 1SZCA 4TOIA 3MXOA 3OPQA 2HR1A 1Z74A 1KK3A 4JAVC 3FMFA 3GWZA 1R3UA 2VWPA 1WEKA 1XYVA 2ZB3A 4L4ZA 4LXGA 4X7RA 1HYBA 1OXBB 4BNZA 3O2JA 4MUHA 1N2JA 3MKQA 3QYAA 2XPIA 2Q4OA 1NJ1A 1IOWA 1DXQA 4BQRA 2IS1A 4XQGA 3QJYA 4FZ3A 1SURA 4NE7A 2PWPA 4BNYA 1QHXA 1AUOA 7MHTA 4H7DA 5JSQA 1SIUA 4ENVA 2H2HA 5J08A 2VJ8A 3GUYA 1OSNA 3BG1B 2HJSA 2V59A 4O6FA 2PQMA 3WOHA 1KZ1A 4OJYA 5I7FA 1WQ3A 4F3CA 3VGJA 1TK9A 4RS3A 4YFYA 4IGEA 1NXVA 1PFGA 3K9WA 4JXZA 4QRDA 4ZOEA 4CM9D 5JRDS 1KYIA 1XAGA 1NUQA 2BELA 2WXIA 4HPWA 4A3VA 1PGNA 4J0GA 3LW7A 3ZQKA 3JQBC 2P90A 1XCOA 3EVZA 1T3ZA 1BD3A 4YRAA 4UVHA 3SK0A 4AJ4A 1EXMA 1QG2A 2RI6A 4CKWA 1PW5A 3CUUA 2WHPB 3AW9A 3D9PA 5TPWB 5AVRA 3TTYA 3WIVA 5EXPA 2H5JA 5EJIA 3PNYA 4GE3A 4NG5A 4G8BA 1BIFA 3FZYA 2RAPA 4Y6SA 3H5NA 3UKRG 4DCVA 4IIYA 1MX1A 2B21A 3ZDCA 1DC3A 5EGSA 2G4VA 5GJBA 4QUHA 3WKEA 4CR7A 3PVSA 4QIHA 2NOAA 4EL0A 1ADCA 4HH1A 3OP4A 3H5OA 1Q2ZA 4ER7A 1W36B 4EPZA 1USVA 3QFCA 3ND9A 2PG3A 1H66A 1BX0A 3SQLA 1E6LA 3BTVA 4AV7A 2JFBA 5CFPA 1HORA 3Q0EA 2WMNA 1U90A 4Y9DA 4ATGA 3IQHX 1JDTA 1U2ZA 2OVFA 3Q72A 3I1JA 4DIOA 4FUTA 4GOKA 1PFKA 1IZ0A 3VVBA 3FSGD 1NQVA 2JLSA 3GJ4A 4C89A 3DBHA 2DY1A 1KSHA 2H6GA 1GGKA 2LXLA 3FDZA 1JCSA 2WIJA 3FVRA 4C5CA 3VTKA 5BT9A 4MW5A 2YW2A 3IEIA 2BLNA 4EPWA 4GO1A 2WLSA 4FONA 4ETNA 2QZ4A 2UUAB 1TTHA 1XKLA 3HM2A 2H8KA 2GKGA 2PIAA 4UHBA 3SF8B 4RCVA 3IAS6 1E99A 2WSLA 1BC5A 4NJOA 2JJ2D 4QQ8A 3WLNA 2WIDA 2H7XA 2CNDA 3WOVA 3UX4A 1W0KA 2P9TA 5BUSA 3CHOA 4KQCA 3QNUA 2PUJA 5I4IA 1RWKA 2E48A 5G1NA 1Z4JA 2J0VA 5DCYA 1JMVA 2WNIA 4EZEA 3G9ZA 1IG0A 4TT3D 3KZNA 4C0JA 3MOGA 4QGFA 4ETIA 4GCOA 1FS4A 1X1RA 3H5AA 3U31A 1HFWA 3TK1A 4D9EA 3BQOA 1ZOPA 4PIMA 3UMFA 1Z8FA 1TPZA 3QG5A 2JCBA 4J8YA 2TYSB 3DZDA 3B2EA 2HUPA 3SPXA 2QVBA 1P29A 4IXWA 3EXG1 3O2SB 4JP8A 2R6CA 1CDEA 1NYTA 1YQQA 2Q5EA 4CMBA 3NTOA 2ZYIA 3C39A 3W1VA 1KE1A 3MHPA 3PUXA 4XJSA 1P9NA 4B4OA 4HWOA 1SKBA 2I65A 1SMKA 1U0EA 2FN9A 2FO7A 3ENZA 2AHRA 1LSOA 2VYND 5A7HA 1IOZA 3BH7A 1KMNA 5FPQA 4MR7A 3A1EA 1U8UA 2WTNA 3TL5A 3Q9NA 3RGGA 2PVCA 1EEXB 5B58T 1ZIOA 4RM2A 2IHBA 1HLFA 5EE9A 1TCUA 1XEAA 3OBBA 3AHHA 3K1YA 4G84A 3SJUA 2WU3A 2YNMA 1H5QA 3RQIA 3U39A 2ZCUA 3K0AA 3TCXB 3A3NA 2V4MA 4P81A 4JPSA 4B8AA 3NBQA 4LC9A 4DLWA 2O1WA 4HXIA 4WN3A 2Y2VA 3CISA 4GX0A 2G77B 1RCUA 3O48A 4BJHB 2NO9A 4UM5A 2NC9A 3U6BA 3W2IA 3OIFA 4YUWA 1S3IA 4JHJA 2YV3A 1QYMA 3KQUA 1BA3A 3SFVA 1I1QB 5EEGA 4BE4A 4BFYA 1ZSVA 4HS2A 1YKSA 3OIGA 3M89A 5KX5B 3TLGB 1D1PA 2PD3A 2HOQA 4MIYA 4OI2A 2Q07A 3H5IA 1CUYA 3FJOA 3QMWA 5ILQA 3VPAA 1NJ6A 4Y6WA 1RI3A 2DFKB 4MGKR 4LTDA 1YULA 4QA9A 2V1UA 2JLCA 1TJFA 1XF9A 5BSEA 2JFUA 4M22A 5CT8A 2Q46A 2QROA 1JSXA 4C04A 5IJZA 1FFYA 4KV9A 4P31A 4GXTA 1RKXA 4BFLA 4RVCA 3LXXA 4I9FA 5GJWC 1QMPA 4UKDA 5CERB 1EUDA 4CLOB 1EFDN 2PXAA 4EJSA 2G71A 1ZNWA 5D5HA 1Y6GA 2R62A 4J0FA 2I1QA 2V9ZA 3L8GA 2GEDA 4LJ9A 3NWEA 5LIRA 4BNUA 2F55A 1I2AA 1RRPA 1J0BA 5CX1B 4BMYA 5IDWA 4EI2A 5CITA 5F4ZA 2NAPA 2CDCA 3PVLA 3QK0A 5AXBA 3K5WA 3S27A 4Q7JB 3ZH9B 1RHMA 2C3OA 1M10A 1EFVB 1X42A 4Q01A 3QWVA 3H2ZA 1WHSA 4S2EA 4OYHA 2RKKA 1DWUA 1CIJA 4KR6A 1QH0A 4R51A 1IEXA 5FEUA 1I80A 3FPFA 3FMPB 2OV3A 4DV4B 4UQLA 4C6HA 1BD8A 3EHRA 1NW4A 2D2IA 4BVHA 4YR9A 1AKNA 5ALSA 5E4FA 3K3PA 2ZJ8A 4F4IA 4OK6A 1ULTA 4OG2A 4F2PA 3LT2A 1UXOA 4TSFD 3I2JA 3R9WA 2B2CA 1C3OB 4LCJA 4UD6A 1K7XB 4NONA 3LZ6A 3NHBA 2IFTA 3LLMA 2UZ4A 2R87A 4B7AA 3ZJ5A 1B8VA 5FHQA 4AS2A 4XLZA 2VTDA 4OREX 2WYVA 1C3LA 4LA4A 3PPVA 3ADOA 1LI7A 2CV2A 5A7DB 2W8BB 5GIPE 1D2GA 3MCVA 4AJOA 5FLYA 1MA0A 4BNNA 3HRKA 4CLEA 2XEVA 6GPBA 1CJKC 2QW8A 1RYEA 1ZO8A 4IQFA 1JA0A 2OCDA 5E4JA 3GGOA 4U00A 2D1YA 4BFZA 4MPJA 2W70A 4Y1FA 3QW4B 2QNRA 1FW8A 3B6IA 2OBNA 1WDWB 4TRNA 2PZBA 5JZVA 1ENYA 4XIJA 5KWJA 4Z2YA 5AJZA 4XWTA 1NI3A 1NE2A 3NT5A 3OX1A 3R7WB 1TUEA 2OHJA 3Q7SA 1N1EA 3W34A 4QYIA 2ADFA 3EIOA 4BLWA 4TMXA 2DQZA 4FGLA 2D0DA 4QYSA 2G9VA 1NMSA 2G08A 1W46A 3T3GA 1PKXA 3ZHTA 3T3MB 3O0DA 1DLJA 1HEIA 1F0KA 4V0QA 2EOAA 5HKKA 3ZU5A 4NCIA 1JI0A 2P6MA 3QNKA 3D8SA 2VSNA 1XO1A 4RC9A 3L7AA 2HA5A 3KEAA 4KOAA 1GKIA 1QAMA 3KB1A 2R17C 2WA2A 1B7GO 5LQDA 2RJNA 1D9ZA 4NYMQ 4PRYA 3QVUA 4Y9TA 2L6BA 4YS6A 2JASA 5B3AA 2VA8A 3ZDQA 4C7OA 4Q4AB 1ULSA 2DRIA 1XTSA 5KYGA 3M8KA 3BWMA 3KXIA 2FFRA 2RDMA 3C97A 2GEUA 4EKGA 3W8FA 4KYVA 4I1PA 3D59A 1UT6A 3OXLA 2A0YA 2ZIXB 2VRBA 3HB9A 2EATA 3I9KA 1MB2A 3HJHA 4X65B 5I9IA 1NMEA 2Z8YA 3CO5A 1Q50A 3LHSA 2CMGA 1ZNQO 3NUZA 6REQB 5HSGA 3T5AA 4TLBA 3MWDA 3PZ2A 1DL5A 1IBSA 4GM4A 2P11A 4JZKA 3HKBA 2AEMA 5TEVA 3PDJA 3QEMA 2REXB 1S8OA 5B4TA 4MVXA 1ONSA 2C5EA 3LWBA 5I9MA 2XAUA 3L6UA 4BIMA 4MVJH 2OD2A 5IC5A 3PJRA 1SBNE 2DUUA 1V1MB 2F43B 4NI5A 1N9AA 5I7VA 2YHIB 3ZKJA 4QDXA 2YWFA 1E58A 3K2BA 4PWZA 2IEAA 1IBRA 4JUCA 5FQOA 2WFLA 4TV3A 1DBRA 1Z45A 3PUYA 4Y7CA 1KNQA 3E9CA 1NSTA 1W9HA 4WINA 1QR2A 1UH5A 2EGHA 3HPQA 4N49A 1H6CA 1HEYA 2M6RA 4EVSA 2AD5A 4TXNA 4FK8A 2JF0A 4NWIA 1LF8A 3L4KA 2NYUA 1H2HA 3G82C 3R5FA 2O0KA 5JPDA 1LJUA 2PSJA 5FCDA 3EDQA 1ZY2A 4HEQA 4WWNA 3CONA 5CDHA 3KVYA 3RSGA 3Q4AB 5F9FA 3UGQA 3RUPA 3OTHA 3HCBA 2XNJA 2VWQA 1W85B 5JRZA 2EQAA 3SCZA 2G67A 1U5CA 1AB6A 3WZ2A 5A02A 4ENQA 2VHQA 4X5OA 4GL2A 2B7CA 3LQKA 4J2TA 3OH8A 1XZCA 4E3WA 1QKIA 1C9DB 3AI3A 5JD4A 5KC9A 2EIKE 2ES4A 2SICE 2NADA 3U7GA 5C7LO 1VM6A 1EP3B 1I4TD 1SRRA 3B9RA 2C7QA 1OWPA 1JR3D 4TL9A 3FTUA 3VR4H 3GEDA 2YYSA 4GHWA 4PS0A 2PUHA 4JGIA 2R8OA 4FEGA 4OXYA 3COYA 3PQ4A 1LF0A 1UAGA 3DOHA 3EOAI 1I4LD 1SJ9A 3AR4A 2Y0PA 2LXNA 4REQA 2DY0A 4JJ4A 3RIMA 1GQ2A 2GBGA 4DQKA 1QBGA 3F7TA 1TKAA 4J0HA 3L4BC 2HSZA 4JT9A 4IIDA 4F6CA 5A3SA 2SCUA 2R5WA 5JVDA 3HS3A 3HVRA 5TSDA 4FUQA 4YMSA 4QXMA 2WJPA 4MWOA 2PH7A 2RAFA 1DE0A 4ZI7B 2KI5A 2BDUA 3UTDA 4TWZA 3HCOA 4P4UA 2QORA 4E13A 4PTYA 5DGIA 1I94B 1O94A 2BBTA 4A8HA 2QZ9A 1EHYA 3PP8A 1MFZA 3RS9A 4B1FA 2D2XA 4OIMA 2CDAA 4RNDB 5CA1A 4ASUA 4MR8A 2UXBB 3RK0A 4R8MA 1RP1A 1PK7A 1H0AA 1N7JA 1O6BA 1DKOA 4DOMA 3HZZA 1C1DA 1YZYA 4UBNA 3VR2A 1N57A 1GKUB 2NP6A 1K6EA 4XD7D 2D1TA 4WK2B 4U95D 4EAQA 2YWRA 1FYWA 3G2VA 1P0IA 1U4NA 1NLMA 1ZLXA 3RFFA 3PCRB 2H2IA 2JI7A 3RYCA 1YV9A 4C22A 2LO6A 1C7EA 3UCEA 3UW3A 1Z2AA 4QULA 4CR8A 2Q2OA 1F48A 3ANLA 4GTOA 1DQPA 2YVLA 3TTVA 3FCOA 1RFLA 1DQNA 4QTTB 1MBZA 5SYNA 3KO8A 4HAZA 4X7PA 5F2NA 4RZHA 4AZ3A 1U7WA 3ES9A 3GY0A 4Z4EA 2C54A 3WLIA 3O0TA 5AM3A 3TCKA 3THWA 4J0CA 3QX9A 5C4MA 4DV5B 1CWUA 2NPFA 3RU3A 4L51A 5JAHA 1E90A 6AT1A 1LVUA 1NN0A 3B78A 3O8QB 4RYLA 2IU0A 1U1DA 1IM5A 4WOCA 2DSNA 3X44A 5K6AA 4B6RA 3G85A 4XH9B 3LPAA 2TMDA 4DLRA 4D9MA 1PI3A 1VG8A 1SCUA 1E92A 3CZCA 4D9GA 2Y71A 4KMSA 4JEIA 3NJRA 1KMHB 3W7BA 5M72A 2NQTA 2C8VA 3DP7A 2Y0CA 1IULA 1XDSA 3HCCA 3KKNA 3STTA 1ADFA 4CTKA 1NNLA 5BXYA 3G9XA 3A9UA 1I3LA 2HBRA 3IQWA 3LDGA 1O6CA 2EQXA 1M6EX 3AW8A 3H4MA 1IHOA 5JJ6A 3FHOA 1NY6A 2NO5A 3TLXA 3B7WA 2HTFA 3I52A 3ELYA 2EEPA 3NP7A 3R8CA 2QRUA 3DZCA 4FGJA 1KYVA 4H3VA 1DBIA 3KJGA 1GJRA 1M8GA 5THQA 4TRJA 1JV2B 5C1DA 2FZVA 2I1LA 4B2YA 4RVDA 5IZ4A 3MD0A 1QQBA 2UDPA 1HFEL 3ZJ4A 4Z4CA 1NR5A 1K8KG 3A6EA 4OBBA 3K96A 4Q37A 5A6SB 1T5LA 1ECLA 4HAIA 4UTRA 1TD1A 4F97A 2V7QD 4LOJA 3RG8A 5CH3A 3CT4A 4CDMA 5ICGA 3FE2A 1DWOA 1JLKA 1EDOA 3TI9A 1BVHA 2VZ9A 4MOWA 5B6IA 1XU9A 1SUIA 4M38A 4I8IA 1IWBB 4YV7A 3C6QA 1JHDA 3EJ6A 3L1KA 1NUUA 1TYZA 1ZM9A 1Z56C 4XKCA 4A03A 3OLYA 2GERA 3TRJA 4U96D 2JBHA 2X9VA 4NRHB 3CSUA 4BV8A 4C4AA 5FADA 3OHPA 4DLSA 4G1CA 5CCBA 1NT4A 4G0UA 1KMIY 4OLJA 1L6IA 2VHJA 1UJJA 2COKA 1QO0A 4J76A 4D2IA 5JMND 2R1ZA 3PI7A 2CHVA 4NJMA 3P0IA 1LCIA 1ODKA 2O8EB 2PH5A 2ZRFA 3FOZA 5F3RA 4JBWA 3C6KA 1YB5A 1CDZA 3FUDA 2OE2A 2DPYA 1FMTA 2C00A 3V80A 4MB0A 1E3MA 4B4KA 4RENA 5KVAA 1FT2A 4W5OA 1CZHA 2NZYA 4N5DA 1G17A 1HH8A 1O0CA 2F9FA 2LKDA 4DDKA 3WADA 3GZ1A 1T6ZA 3IUPA 5LXTF 5TQ2A 4ALKA 4ZC1A 1IBMB 3G2LA 4R69A 1IU9A 5E95A 2J6IA 3SJZA 2QZAA 4FZJA 3JXJA 3T0GA 1Z38A 3Q73A 1YQXA 3WNBA 4RD2A 4KO2S 2IX3A 4R83A 1FY2A 2IU6A 1R1DA 1C3JA 3M1YA 4I4TA 4LHYA 2Q5OA 1CUZA 2B2XA 2AEJA 2H6HA 4OI0A 3GLIE 2NU6A 4EHJA 3H8WA 3PDUA 4K0KB 1KZHA 3TQQA 2VCHA 3ZNNA 5JI2E 3ANNA 4X44A 2W98A 4CI0B 3Q0TA 4M2LA 4H7YA 1Z5SC 5GV7A 4EW1A 1V9LA 1NF9A 3LY7A 1VKJA 4R3UC 4J1TC 1AKMA 1GOTA 3G0CA 3WRYC 1FTSA 4IX1A 4EHKA 1ISMA 1ZOIA 5ALPA 4KPEC 1GDDA 2Z9BA 3GCWA 4LJKA 3FMVA 4MP6A 3KT3A 4J1QA 1ARZA 2BGUA 3F5SA 3N0XA 4JBXA 3BSYA 3AILA 5H82A 3C6XA 1VYTA 4XR9A 4X64B 2OZEA 2YCLA 2VCEA 1C9MA 3LDFA 1JRLA 3OEED 1QJ4A 3TXMA 4IR7A 1W48A 1VKRA 4I4IA 1EESA 2DFPA 4YP7A 5AJHA 4QE3A 2WXFA 1TQ6A 4UU1A 1VHQA 3BWYA 1NXOA 2C4UA 1UF9A 1ZGAA 4CXMA 3ZIAA 4X91A 1VXRA 4I55A 4M8SA 3LK6A 2CXHA 4XE0A 4PYNA 4BFSA 2H2AA 1WDMA 2IV3A 2GFIA 5CHEE 4Q02A 3GT4A 4GMDA 4GM1A 4HLLA 3EZNA 1YI0A 3MAAC 3ETJA 2HMAA 3LJKA 4D0GA 2UYCA 2AX4A 3QEJA 3LHFA 3HUEA 4PH4B 1YA4A 5FLEX 4G2NA 4DM3A 1IPHA 2AOUB 1M83A 3F90A 4NBVA 3AEQA 5AHRA 1IAVA 3H1TA 3BZWA 4FP9A 2ZIFA 3F6BX 1KYTA 2WF6A 4Q96A 1N94A 4TTVA 4GQAA 3PPWA 1ETHA 1GZ4A 5DTQA 4R2MA 4PYKA 2I2WA 3PLRA 5AKYA 1R0LA 2XZTA 1D4OA 4E70A 3DHNA 2IBTA 1KPGA 1XJ0A 3COSA 1DX9A 5GP1A 3UBMA 1X7HA 1PEDA 4LXUA 4TMTA 4M54A 4OL9A 3F8WA 2ZRKA 2C92A 3P9QA 4TQ9A 3KOUA 1LX7A 4O5AA 1YQUA 2XUPA 4NTZA 3OURA 2HWYA 1R0XA 1X1AA 1Z5GA 4WJLA 2VPQA 4QRHA 3ZJTA 1H2BA 4X6LA 4F12A 2R9VA 2OD9A 5FUQA 3PNSA 5T5QA 3RVBA 4JJEA 2FMTA 4GOJA 1G63A 1Y5LA 3OZIA 3ZOKA 4XPIA 5LMNB 3NTQA 4P6VF 3UH0A 2X5KO 1SXJB 3T9FA 4NATA 1KQ3A 1JALA 3FETA 5AVVA 4KWCA 1CCWA 3PEVB 1X13A 3DYIA 3ESQA 1J4AA 4C0QC 2DE0X 3KV1A 3OZSA 1A5BB 3BMQB 2FW9A 1J0CA 2Z9DA 4P4NA 4OPMA 3SZUA 2IU4A 4NOKA 3QRWA 3AJIA 1CHDA 3KEOA 3MX3A 1BMFA 3J81k 2OC9A 1L8LA 4HSEA 4EKEA 2PX3A 3H5LA 1DAHA 4QHYA 2BGLA 1NVEA 1Z6TA 3DMPA 3CVQA 1ZVVA 3C3EA 2QLTA 4FQ5A 2JJMA 4WFKA 3O3MB 5CVCA 5TF0A 2VH5R 5FQ6A 3DMHA 3UT5A 1ZYUA 5AKZA 3KSRA 1J8FA 1AQIA 4XCVA 3FJ1A 2XYVA 4OHRA 5KUTA 1FNNA 3R7LA 1G7CA 1U99A 5GADl 1UEIA 2ZDGA 1FXSA 4OP1A 3EIFA 1B0UA 5G2OA 5JO9A 3NTVA 5FZRA 1GA4A 4ZOQI 1SUWA 5DMHA 3ZZMA 3OTGA 3ZVMA 2L17A 3NWOA 3W5DA 3Q7TA 2X8JA 1EVLA 3PITA 4L3VA 3F98A 4U02A 5DOZA 4M1KA 1XDWA 3ADPA 3KCNA 4GI2A 2P67A 1FZQA 4O4HB 4PICA 3U16A 2H4YA 2RB4A 5TQ0A 1JKXA 3H6GA 5AM0A 3AVPA 4YP5A 1AO3A 3RRMB 2GD0A 1C30B 5E1BA 1CPYA 3D2LA 2VWGA 4GZCA 1NG1A 1Z2CA 2GRLA 2I4OA 4WZBA 2WXMA 5A5FA 1PYOA 1GSHA 1M7HA 2VP5A 1QYDA 1Y4UA 1E1RA 1DC2A 5IMBA 3KTOA 4Y2XA 2IYOA 2QQGA 3S8EA 4K2HA 3SVTA 2DOKA 2PKYX 1WB5A 2PM8A 5FBVB 1M3SA 1T8SA 1SZDA 5TMDA 2PWBA 3AEYA 3W6OA 2DH6A 2XY4A 1U2DC 3M4JA 4XWAA 3CA8A 1YCHA 2NWQA 3QAQA 3LG2A 4RADA 4PLHA 3EQ7A 3II6X 2JJQA 2QHXA 1XZJA 5GJVC 3W5BA 3LRXA 5K3DA 3BRSA 1KAGA 1WV1A 1T3TA 3N5CA 2XF2A 4YASA 4J8FA 5J4KA 2OV2A 3G0BA 2DFDA 3ZU7B 2VBFA 5EWMA 2W22A 4V3CA 1O0SA 2EXXA 3HG7A 3LUKA 3V7FA 3VC3A 3JAWB 3KJIA 1F06A 1FUEA 2J32A 5EX3A 4BNIA 2XJ9A 2FRDA 3OD5A 1ZK4A 4TRMA 4KV7A 2Q2WA 1XZHA 1AE1A 4ND1A 2R7AA 2VP4A 3KEZA 4ALNA 4C4TA 3M4YA 2GRUA 3WG7E 1YNOA 4HDQB 1YU9A 3V5NA 2ESRA 2K2WA 3CSTA 3RTDA 4CZ2D 1I0ZA 1JHXA 1I7LA 1CS0B 1LTKA 2UYQA 2WWGA 4UDYX 3UAWA 4E6PA 2EWWA 4IL5A 5AK3A 4KWIA 3C6MA 3I2IA 5KYYA 3LT1A 3B1FA 2H1CA 4PAQA 1Y82A 3HYCA 1AF4A 4OFXA 2EKDA 2G80A 2FWNA 2LCIA 4B75A 1AHNA 2IO3C 5BORA 4LSGA 1JGTA 1K3TA 1KFCB 1W93A 3OG9A 3U5TA 2J3QA 5IXSA 1TW3A 1XWWA 2R05A 1X8KA 5LYJB 4JMPA 2X4IA 4E11A 4IBOA 2ZPTX 3NMUF 2WVJA 3UGTA 3M6VA 2AUMA 4KP7A 3AB3A 2HL6A 1QRDA 5C5CA 3C3KA 1WVIA 5DBFA 5I7UA 2O7NA 3TF5A 4YR7A 3SHFA 1U7DA 4FU0A 1WDYA 5WRFA 1LV8A 3SR4A 4XPZA 3HUUA 1PQUA 3R3UA 4RSRA 3NNSA 2FETA 2W2MA 2WXKA 2Q1YA 3U7FB 2IQ5A 3I4CA 3ZGLA 1GARA 5J3JA 2BEJA 1MIOB 4MO2A 2YUTA 4HY3A 4KH1A 1DCQA 3DPUA 5CRVA 2XB4A 4YRCA 2WYIA 3PK0A 3IOEA 2ZR8A 2O8FA 2BFFB 3UZUA 3TR5A 1JQ5A 1BX3A 1V5WA 4PHGA 4P32A 3FFTA 4RZIA 4H7IA 3EB9A 3VOTA 5EJ5A 3RC9A 1ZRSA 4RTNA 2EFJA 3RSZA 2ZB7A 3DAOA 2HNKA 5L51A 5BW8A 1HO3A 4KL8S 1UMCA 4D57A 1O6GA 3EUAA 1O3YA 2WIAA 1TO1E 4DX1A 1YIAA 4MK4A 2IT1A 1QYXA 1RRVA 4MIKA 4CG1A 1DJPA 3DVAA 3CNNA 1I9GA 2TMGA 2HU7A 2CE2X 4F9EA 5F77A 4CG3A 2VZEA 1E9FA 3UAZA 1PVDA 1EA7A 3S1LA 1D8TA 1KGSA 2PJUA 1W9MA 2PMCA 3BRCA 3R44A 4UNRA 1M1YE 2AFIE 4RMJA 1F9EA 2BTEA 4CFSA 3WV5A 1X70A 4F4HA 1OZ0A 3WFIA 4MO9A 3CEQA 4FMCF 4QJBA 4Y6LA 2JD2A 1R4MB 3I73A 3GUVA 5KNDA 3RT1A 3U3DA 2CVOA 2NU8A 3DD1A 3WLLA 4R7ZA 4BN5A 2QT0A 4NAHA 6CHYA 4JXXA 4CMEC 3ZZ1A 3NT2A 3JCKC 4Y6RA 1YJBA 1H8HA 2X4LA 3FSJX 2CNOA 4P2GA 4PZZA 2YJNA 1DBPA 1FBNA 2EKQA 4G37A 3VPCA 1SD2A 1ZJYA 4KO1S 5AOCA 2REQA 4K8RB 4WD3A 3PGXA 4RFSB 1QS0B 1SGWA 1PX0A 2CFZA 4O08A 4CF6A 3GMTA 2BEUB 3NOCD 4IDFA 5BWBA 4US2R 2P5UA 1YL7A 4ANVA 3KU1A 1G64A 1YS2X 5F73A 3U4QA 3U7IA 4MUJA 3QPVA 5CDSA 2G1KA 4MPDA 3T5GA 1VJCA 1PZXA 2O0HA 3ADBA 4INOA 1PT5A 2J46A 1QZXA 4JLJA 1YE8A 4Z7OB 1X92A 9LDTA 1ESEA 3AFNA 1P1KA 5FUBA 4AJHA 1OT8A 3RT7A 4MHTA 2BZ1A 4NHEA 3ZHOA 4UQOA 3S2IA 3CK7A 3U64A 4A36A 2V3CC 3KQWA 3M6WA 2HXGA 1YL6A 3UMCA 3HZOA 1GRVA 2VP6A 2HIHA 2I2AA 4WZAE 3KHSA 5LOVA 3QXJA 5BQPA 2QM7A 2AW3A 2VTEA 1BGVA 3LLVA 4Z3DA 4BU0A 1YVPA 4RWZA 2WZBA 4TMZA 4RLYA 1FDVA 5HIMA 4G41A 4RG6A 4EPRA 1J8VA 1KBQA 3NVDA 1AH2A 1BX1A 2AEEA 2UXDB 4C7JA 1YDMA 1J22A 4FMDF 5FO1A 5JVDF 3CURA 3CBGA 2C03A 3LOUA 3NF1A 3TMAA 4K7JA 2DJIA 4HWSA 1YSCA 4UNNA 2X6JA 3WRXC 3P2YA 5D1HA 4DYDA 3QLTA 3JQAB 2P9LG 3UM2A 1RI1A 4ESEA 3LUHA 3THOA 4Q3AA 2WQZA 3A1WA 3STXA 1MAAA 3OFND 3SHTA 5IJ9A 4M0CA 1VBNA 3KKOA 3OQIA 4Q19A 3QKTA 5A05A 1VYUA 5CNIA 1JW9B 5D2MC 5HIIA 4EHLA 4TLCA 3UAYA 3PD7A 1MO4A 2EDCA 4L2LA 4EWLA 1NTRA 3TTTA 2QTVB 2GK7A 1VJGA 5FWNA 5FQ8A 3LBHA 3ASYA 3MEQA 4WFJA 1U5BA 2AVNA 2EG5A 3SXUB 1K2WA 1FDIA 5FUYA 4ZZ3A 3H65A 2P3SA 2A1TR 1E0KA 1R18A 4GWLA 1NQTA 4KBQA 4N2SA 4MINA 1HDGO 1Z2NX 5CT4A 4GZMA 3WGHA 5EINA 2VOJA 4AB1A 4KJXA 3CW2A 5G0SA 2ZQ5A 4FFDA 1ZGJA 4I6JA 2WT9A 4O63O 1QYIA 2J9ZB 4NS4A 1LD3A 3VKHA 3BL6A 3JALB 2VJBA 1EF1C 1ZCFA 4UUMA 2VJLA 5LP6C 5B5SA 1ZHFA 2IEBA 4OAQA 4JDUA 2QRVA 3FYCA 4YX9A 1OFUA 3CLTD 1JHOA 3O3NB 2DWUA 1AKEA 4FXPA 4RGYA 3MB5A 2BMAA 3JVIA 2QMZA 4GBED 2M98A 5C18A 1RQLA 1ID8A 3UFBA 4BE7B 1EFPB 3HV2A 1Q44A 1GN8A 5D3QA 3FR7A 4MMYB 4IIFA 3C3MA 2IUEA 1L5HB 4JOCA 4HMQA 2D1SA 2X1MA 5LXTA 1VE9A 2BCGY 3MWEA 4NIKA 4WOPA 1II0A 3DQPA 1PG2A 1NL4A 2EWVA 4TS3A 1RJ9A 4ECEA 2BFDA 3HVEA 4P4SA 5DGHA 2ONDA 3A1UA 4UE3S 1JHPA 2I6SA 2ECFA 1B1CA 1HRDA 5AW8A 4D3FA 4P54A 3MQFA 4QFCA 4XVRA 3PUZA 4LHVA 3RWMB 4XRGA 1SCNE 4JEHA 5L4LA 2W2QA 1N8NA 2Y77A 3L2OB 3BCRA 2VHYA 4KAAA 5AI0A 3K9LA 2PKCA 3D2CA 5ANRA 4GE0A 2B0OE 4W4TA 1FCHA 4BMVA 2FP4A 4NZYA 3QLVC 5C8DA 2WV9A 2QUIA 3BICA 3KAJA 4G1FA 3X1MA 1PSZA 3QP9A 3QVXA 3TG2A 1IY0A 2EFCB 2QUZA 4B48A 1Q7BA 4CL3A 3FNBA 2KCVA 2NTEA 5CM8B 3TIVA 3TE6A 4AJLA 1MB9A 3BFXA 3AV3A 3GNTA 3K71B 4LQ4A 1FFCA 2C97A 2BFOA 4F21A 2WRZA 2O59A 2FDRA 2EW2A 4QHSA 1UK7A 1X7ZB 4GLLA 4HEHA 5AQEA 1NWHA 3VHXB 2G7ZA 3L77A 1F8GA 3N9IA 3MTBA 1GTL1 3TLJA 2IOLA 4Y0VA 3SLRA 4GQIA 2PXXA 4TMVA 1T3LA 2GZRA 3OT1B 4E14A 1B8UA 4Y0AA 3WHPA 2O6LA 4CMJA 4GECA 4DX7D 3IUBA 1L3CA 3E37A 1YGYA 3V4ZA 1XVTA 3QG1A 3DOUA 1V3TA 2FLWA 3IHKA 3NIGB 2OBYA 2CE7A 4N4AA 4PX3A 2QS9A 3EAFA 2P68A 3QU9A 4KXXA 2Y6UA 3TINA 1NUHA 1WMEA 2OHOA 2I7XA 3L4SO 1N2OA 4QNRA 5A62A 2BAGA 1LF5A 2PPVA 3KE9A 3NGMA 4BP3A 4RPCA 1ZXLA 1VE5A 4JJ6A 4MICA 2D0IA 2H9YA 1OT3A 1DIAA 1E98A 2JJ1A 4LDZA 5C32A 5D2CA 2NMVA 5HGJA 1B6TA 1DRVA 4JA9A 2F8TA 3SBEA 4I6GA 4OXQA 4RK6A 1XCLA 4HQKA 1Z0ZA 4L5CA 1S7CA 4I4TF 3PYMA 1I3CA 4IEEA 5ALWA 1YI1A 3W4KA 1W59A 4PG8A 5EC8A 3BXZA 3ZE8A 5BV2P 1M2OB 1FLAA 3AP1A 4RDHA 4LX0A 1SZPA 4JBHA 3VNAA 2BT4A 2PJRA 2GAFA 5JASA 2WMOA 2V8BA 3IT2A 3MJTA 1NZNA 2EZ4A 2H1WA 2NV6A 3ZHCA 2ZI4A 4MP8A 1S1MA 1Z0AA 4LOIA 2YMQA 2B0JA 4BMNA 2F0YA 1RM5A 4F71A 4J1NA 4DR3B 2H52A 4YMVA 3AIIA 1XAHA 2DBYA 2CYCA 4JVLA 1GVHA 4V0NA 2ODAA 3SS7X 1XE3A 3U4TA 1KETA 3CLTC 4DI3A 1Y3HA 4P7GA 4EFNA 4WCFA 5HKLA 3KQQA 4CQNA 5COAA 1J90A 1UBOS 5I5EA 2XA9A 3NHRA 4W9MC 3W9FA 3U9TA 1PFWA 3D8UA 8ADHA 3C3OA 4TRQA 3RM3A 1Q3TA 2DTXA 2QNIA 3K2IA 1Y8QA 1KI1A 1TLFA 1TEVA 2F3SA 3AZPA 3VVMA 1MQ9A 4LNHA 2VQ2A 4HQFA 1TQHA 5EERA 4PDXA 4I55F 3FJYA 1JE0A 5EPEA 1PNTA 3M5PA 3WGVA 4MRMB 1DG9A 1U3VA 3RSOA 2A0KA 4I3GA 2E89A 4GVLA 3E6AA 1INLA 3OHMA 1YFJA 4F4CA 2Y05A 3MAGA 4RNCA 1R0RE 1YZUA 3GUUA 2QMYA 1SOMA 4ZV9A 3TZQA 2A1UA 4XTRA 4OHOA 1JTVA 1QYCA 3CW8X 1XQYA 2GCEA 1D3AA 1LK5A 4G8DA 5T6MA 3ESKA 4IGKA 4LTMA 1R00A 4GXRA 2AI3A 3OJFA 3MLEA 4KUGA 4G2TA 2HRRA 3TQCA 2Z4TA 2FMIA 4YT5A 2H4WA 2O7QA 5LUBA 1JG6A 1F0PA 4HDRA 1E77A 1EK1A 2JA1A 4TV9B 1D6JA 1QRUA 1SOAA 3OLCX 2OCLA 2QT9A 2LDXA 3S2GA 2ZB4A 1CUCA 4O6VA 5H7XA 4KK3A 4ZV7A 2XCOA 4LF8B 2DYKA 2V58A 1J42A 3ZYLA 4B89A 1XJWA 4MKZA 3OETA 1EP1B 3PR2B 2JFGA 2VL7A 2O8CB 5CBPB 1BJTA 2NVBA 4H7JA 2V9CA 3PENA 4G86A 1NC1A 1EAYA 2BGJA 2BKGA 1JDUA 1ETUA 4DKXA 2P4UA 5HDBB 3ZHBA 3Q10A 4G0XA 1H2AS 3PXUA 5ERYA 1CZLA 4DMRA 2IXAA 4DSAA 5REQA 3OKPA 1OXSC 2N1BA 3QEBZ 4OU5A 3DCNA 4HNAD 1NGSA 2HQOA 4Y1RA 1H5NA 3W6ZA 4WUTA 4E5UA 4LJ7A 2F9MA 1RMTA 1T4GA 3V97A 4YDHB 4UWFA 4FNOA 4AXXA 4S35A 3AUUA 4B0PA 4X6XA 4GMKA 1CFJA 2JEOA 2NP7A 5DNDA 2BCJQ 4KPGA 2IYLD 2PZ8A 3F49S 3P9ZA 1VIAA 4ZCTA 4YHBA 3QFRA 3EWIA 1XJCA 5CLIA 4YRKA 3IVAA 4BKQA 4TVKA 4WFQA 2R84A 1GTRA 5GVRA 3DR5A 2XT9A 1JXMA 3OZ7A 4ARIA 4DCSA 1X1QA 4CMIB 1UT5A 2CZQA 1CQWA 1TIPA 5HF5A 4IIXA 5ENTD 5DN9A 3EXEA 2NLOA 4NFLA 2OAP1 1J99A 5IBRA 4F04A 5L4SA 4NLLA 3GR6A 3ZWAA 3FPSA 3F3SA 5CRIA 5AO9A 2QLMA 2XOEA 1RQXA 1M66A 3KTFA 4WOJA 3WHLA 4BBAA 5KSZA 5KQRA 2GD6A 2ORWA 3U5ZB 3PRYA 2VJKA 3FYHA 4Q48A 5EZ5A 4V0MA 3TBKA 5AP9A 4MLDA 2G9QA 4YAGA 5JAZA 3GJ8A 4RTMA 3SNKA 4M98A 1OBVA 3KYDA 1ZI9A 3LWDA 1Z0UA 2DBRA 3GGJA 2FWRA 3AVXA 5DNEA 3ICCA 2WYUA 2Z04A 2X0JA 2OG1A 2X2FA 1L5NA 4J16A 3A05A 4MWDA 2O2IA 5AK6A 2XYHA 3TR0A 5F7XA 3PB3A 1NULA 2DZNA 3OJXA 5ALQA 4YQEA 3GO4A 1WLSA 4MLPA 4DZRA 4O0MA 2BM1A 4JT4A 5DN6D 1F2TA 3HEBA 1XBTA 4TXJA 4E7PA 2PGOA 1EEHA 1MGPA 1TN8A 5L45A 2F3QA 3E3OA 3FPLA 1EXDA 1WPRA 3TI7A 4I5GA 3TW6A 5H16A 2O5CA 3GUCA 4TKLA 5KNBH 4MUXA 8GPBA 5DBKA 1QLJA 1ZMRA 2DWQA 1V7CA 3ZYQA 4R98A 1EXWA 1AMNA 4JQCA 3T4PA 1Z5PA 3EXHC 4AMUA 2F4VB 4DILA 3ANTA 3OTNA 4X7MA 3G8AA 3LO5A 3FHTA 4HUQB 4ENTA 2W37A 1AUPA 5C8YA 1S3FA 4GTSA 1RLMA 3MAJA 2P3OA 4KBGA 1I9CA 2FPUA 3QELB 4ZYVA 4IXDA 2BJVA 3OWOA 5J2TB 4E5VA 5BRJA 1JJ7A 3Q40A 5DM0A 3Q3GE 1QGUA 2W6JD 4UFNA 2I7TA 5C1IA 1H1TA 1ZBDA 2X6RA 4W1RA 4C3ZA 3GVPA 3DEYX 2IEGA 3BWEA 3LCRA 4BGIA 5CIYA 5TT1A 3BFJA 4DJTA 1VCMA 2C0CA 5KS2A 3U09A 3P20A 3QQ5A 1S7GA 5ITZA 5JIBA 4OGFA 3W3AH 2IZ6A 1YVEI 2B4YA 4F3YA 2ACEA 2A0UA 1FFXA 1QX3A 2KCLA 2OZLA 4CM5A 1CJTC 2FR8C 2XMCA 1NZJA 4KDRA 3O38A 1I6LA 2HXYA 4EYKA 4ND8A 1VECA 2PMWB 1NPDA 2WM3A 2VPWA 1N6HA 3JAMA 2W48A 3IPLA 3WG9A 2F8XK 4RL6A 3T7DA 1H4SA 1TKBA 4GX2A 4KG7A 5EMKA 1V37A 2P8SA 1EXVA 4OQQA 1NSYA 4IHAA 4G2VA 1SH7A 2PGDA 3BPSA 4L72A 2WXJA 3DJFA 2WWWA 3THYB 4EA7A 3FRIA 3RUCA 4AEZC 2VDQB 4R5MA 4JLUA 1RQPA 4MDYA 4MEBA 1QCYA 4BFXA 3DL4A 3HU3A 2OL4A 4AURA 3U3JA 1C1XB 4EQFA 4WK6A 3RVJA 4EFLA 2DX7A 4DSOA 2NACA 3GW8A 3OCXA 3A9CA 1FDTA 3G68A 4Z4HA 2OOSA 1VG9B 1Y0BA 4DLZA 3ZLVA 2VJMA 1VL0A 3PFHA 3RIHA 3KAPA 2IVFA 1VPWA 4BQIA 2ETXA 3A25A 5LDGA 4GMJA 4DLNA 1JILA 2GK3A 3ZWYA 1W19A 4AS1A 4X66B 2HHLA 1M2KA 5FWDA 5B7NA 3APCA 2X8WA 1B3BA 3QJGA 4LCTA 4ND6A 2C8LA 5JANA 4NS1A 4BN0A 1OTYA 5FTKA 4LZOA 1YE5A 5G04C 2DTEA 3ZYKA 4ICIA 5G0VA 1Z37A 1PR6A 4NL4H 1FFSA 3BH6A 1M73E 3GDWA 1AM4D 1VFPA 4ESOA 4RA9A 3VR0A 4QLOA 4IFIA 3GGCA 4MQEA 3UAXA 4HFMA 4Z3OA 1JDVA 1I51A 5L53A 1E2QA 4L3OA 4RZUA 3RFXA 4R31A 3CGGA 3DAPA 4DEVA 4KUEA 4CDNA 1SUBA 4HOSA 3LS2A 3LT4A 1L7MA 1Q7CA 4JR1A 3ZE9A 4DBZA 4C4XA 2YY6A 1FT1A 2DPMA 2VSQA 5L3QB 4A26A 5KTOA 3PNLB 1DSSG 2R1TA 2YYAA 5IVKA 1L2TA 3R77A 1VRCA 1DKPA 4OL0A 3BMOB 4LDQA 5AW9A 2P0EA 2F48A 3JQFC 2ECKA 4C1NA 4NQRA 4YJ3A 1JXOA 1A1VA 3L9WA 2B1QA 3PE6A 2H0QA 3A27A 3OSUA 1XI2A 1J1ZA 1JBQA 3WR5A 2J9XB 4NU5A 2BR4A 1RQGA 1Y7IA 2RFMA 3IR7A 4D3SA 2JZOA 5EP4A 4B6FA 3HL0A 1ZGZA 3PGA1 3CHYA 2F37A 1JKFA 2F1JA 5E76A 2V4HC 4ZU6X 3C98A 1BDJA 3KFVA 1RZ3A 3PXAA 3OCWA 2QN1A 2XVMA 2GCOA 4KR7A 4MWCA 2OORC 3EDCA 1SC9A 4IIEA 1UFKA 5G53C 2GXUA 2W9XA 5EKXA 1PCXA 1L7VC 1FP4A 4MAAA 4RD3A 4YH1A 1FIUA 1FPPA 2NVWA 3NWPA 4C6TA 2ZSBA 1ZUNB 4GUDA 2TS1A 1C8VB 4FI3F 2VSOA 1TIBA 4YT2A 5I9LA 4HKTA 2R02A 1HTWA 2X8AA 2JKYA 3HP1A 4V03A 3ZG6A 5INTA 3CUWA 3I9V6 2RD2A 2P2GA 3K70D 2PMBA 2XKKA 5I7OA 4CUKA 4PZUA 5KBAA 3HI6A 2Y3IA 3QEAZ 4GPBA 1F1JA 3ET4A 2LRHA 4L6IA 4X3OA 1LNSA 3UGJA 1MD9A 2I1VB 2GEVA 3R9AB 1Y5NA 3GA5A 3HLTA 1VYHA 1C7FA 2FX3A 3IPYA 1XXHB 2HLDD 4YJFA 1WTAA 6ABPA 2C83A 2CUTA 4Q7QA 3V31A 4U39A 3ZLJA 1GTJ1 2ODQA 3V8RA 4P22A 2XNCA 5LOVF 4DR2B 3H6KA 4QUGA 4JLWA 3GEEA 3CVYA 1NU6A 4HQOA 4U7EB 4ZQIA 4R9SA 1BXRB 3TLKA 3HADA 5GZ3A 5A4AA 3LEWA 3WYGA 4G6ZA 1D6SA 2Q1TA 3BJRA 2Q4BA 4Y2UA 5SY9A 1Y9AA 2MU1A 1DBSA 2ZUUA 4NFYA 3KKQA 2V98A 5E6UB 2HHAA 1UMDA 3JYOA 2UYHA 1EJ0A 1JEYA 2WQ6A 3RNLA 3GQBB 4WLVA 4GD3Q 2KXPC 2FJ0A 3RJ5A 4GYKA 4CF3A 4LYHA 4Z7JA 2HGZA 5GONB 3EGWA 5LCXA 1EZZA 5LMUB 3DDUA 5ENPD 2D5BA 3RKUA 3JQQA 3ZN3A 1TTTA 2HPAA 2Z09A 1KYXA 2JCYA 1QOZA 3QKIA 1UPAA 1KVTA 4Z9YA 4PANA 3UOGA 3PZRA 2P9JA 3KOXA 2WICA 1T0BA 5CFRA 1ESMA 1A3CA 3I6ZA 5BSKA 4PXYA 3ZVKA 4ZEXA 3CXRA 5BV0A 2X0FA 3WLAA 3IT3A 1MXFA 1KE2A 1TGVA 2OCIA 3LD9A 3KETA 4LS3A 2BEWB 1E69A 1PR4A 3ST7A 2JVJA 4F2HA 3EFEA 4XB6B 5EMNA 3BJIC 1Y4ZA 2F2TA 3ET5A 2QD3A 4BE9A 3EUWA 1QIIA 4PE5B 2XDQB 1NNSA 4PFQA 4BSZB 4AUEA 4P9NA 1YZVA 4I9CA 2DFNA 1DMRA 2RE8A 1FBTA 3NLLA 3O92A 2GPJA 3GVCA 4MQLA 4LYYA 1E2LA 1ONNA 5EG5A 1H6KA 3U4HA 1KEEA 2E0IA 4A8JA 1OWNA 1EXNA 5B2EA 4U3JA 4KGDA 5JH7F 3BBPA 4HQ0A 2AH5A 2FPPB 5K1ZA 3JQCA 2AVPA 1D2AA 4EBBA 1LSSA 3UI2A 4BB0A 9MHTA 5KNLA 3V4PB 5FPYA 1L4BA 3R6DA 2OCGA 1B8OA 3CWZA 3FNHA 1E2DA 1IN4A 3TRKA 3I2KA 4PS1A 4R71A 5CXUA 3SYNA 2FPGA 4MGHA 3WB2A 4EHAA 1QKJA 2JJ8A 4ATNA 2BUBA 2QAIA 1KSGA 2QPLA 3IKLA 3MMSA 4QTZA 4K5BA 1EVJA 3UCXA 1QGYA 2M1XA 1E79A 1N9GA 2AN3A 1UBRS 3BT7A 1QNLA 3PC4A 3HKEA 3CLHA 3I32A 5KDOA 4JCOA 3W9UA 4IWYA 1DBVO 3TRIA 3WIEA 3B1JA 4ESHA 2XITA 1TNYA 3B2QA 5HOEA 5AJWA 5GOZA 5JTUA 2CJXA 4ITRC 4JBYA 1E60A 4CKZA 3UANA 1XRMA 2B8NA 1EDEA 3HNRA 3VV3A 3ZRHA 4UVGA 1HY3A 4J29A 5DCUA 2EHDA 1SAYA 3KJNA 3K70C 4YROA 3SQDA 1AUVA 4NESA 5CLFA 4MAMA 1E59A 5KJNA 1D09A 4IULA 1DBQA 1L7QA 4XSHA 2VYVA 1SU8A 2DULA 1B89A 1Z0IA 2FWJA 2OXCA 4EG3A 3D9KA 4OOEA 3U3RA 5B3JA 4PRZA 1ZNXA 2P9GA 3IRUA 2NVOA 1J1UA 1RBZA 1J8DA 2W6OA 3KUXA 3QV2A 3WZLA 2YFKA 1FX0A 3T8YA 2XXAB 1RU3A 3FKSA 4FJ0A 3EY9A 4M9QA 3BA6A 4JGGA 3ASNE 3HGQA 5DCWA 4JL0A 3X1ZA 1CZRA 3HWSA 2ETBA 1LLCA 4PSCA 4ZVTA 1ZVQA 4WASA 1E3EA 3TWXA 3EMDA 3RS7A 4C0KA 3B38A 1MTZA 4DCCA 1IY8A 1GUZA 1GNVA 5CB8A 1NY5A 4JYZA 2QI9C 2VSXE 4LOKA 2JLWA 1NX6A 5KTRA 1YMPA 5ALZA 3EVTA 3QSYA 3P45A 1UR5A 1NXSA 4ODIA 5AN8A 5HKBA 4Y7DA 2FYTA 1H4TA 4X85A 1OBOA 4V2UA 2LCFA 2C88A 4HPJB 1GNQA 4YB8A 1YHYA 4QYTA 1LBEA 3O47A 2I6XA 1TF2A 5KYWA 2VK4A 3HYTA 2A6PA 4KNWA 4QQFA 1JBEA 1KMQA 3RBXA 3NJ4A 3UUGA 4HAXA 3STVA 3RC1A 5NULA 2C07A 2EINE 2KW5A 3E7DA 3ESZA 3KPWA 2C9OA 1V7QA 2YDXA 1AQYA 2D2EA 4WV3A 4FLHA 4PAWA 5CT9A 3BORA 5ULLA 4CQLB 3LY5A 3R4VA 3OPYA 3AGPA 521PA 1M2VA 5E0OA 5ECGC 3JWEA 3S8YA 1SB9A 4Y30A 1QYWA 1FZTA 3DTVB 4EEKA 1XDZA 3INNA 3SP1A 4XW2A 4FNAA 2GM5A 4QXAA 4RSGA 1ZAKA 3AIMA 3GPBA 1OV4A 2NTJA 2ZYAA 4LNUD 4LOLA 3F9IA 3DWGA 3W78A 2G5CA 4KSCA 1FK8A 1V5EA 2R2LA 1PKEA 3O3OB 1IXVA 3WDMA 5IZCA 4S1PA 1JDBB 3FTWA 3BMCA 5BOSB 4PN3A 3AS8A 2FZ4A 3T8MA 2WM2A 2CK3A 5ADHA 3VRHA 3TGOA 4A8PA 2QD4A 4B44A 3MA5A 3KFLA 2WSSD 3QM1A 2ZUEA 1Z39A 2PRZA 3F0TA 1NUTA 3CHQA 2JLUA 1CJBA 2RHHA 4EP1A 4BFRA 1U2GA 3UMSA 1RKVA 2RHBA 4YJHB 4NABA 2NZVG 1CUAA 2PSEA 3EDTB 1I2BA 1RE1A 3MBOA 2IHKA 2BMJA 4AW9A 4EX7A 3KX2A 1F6DA 1D2MA 5HDQA 3E0XA 5DRYA 1V5IA 4CPDA 3LBNA 5CDYA 5AJDA 3AF2A 4XQCA 4N01A 2XUGA 3KDSE 4FTWA 2O4UX 4AZ0B 2A58A 2P65A 3O4JA 2VI5A 3U26A 3I8SA 4I46A 4BATA 1P19A 1HE3A 1UKZA 2XCQA 3WWZA 4K6OA 4X1KB 2ARKA 1VA5A 4Z0PA 1XN4A 2PA3A 1U2PA 4FM9A 3N2KA 3JASA 5IYZF 3NHSA 2B1GA 3SJBA 1MRNA 2O2SA 2J87A 1G42A 4X7BA 3UMMA 3U13A 4G26A 1DAGA 2ID7A 4ABTA 3UJ3X 2ACWA 4H4CA 2IUTA 3PFWO 4MEJA 1EWKA 3JZIA 3OCVA 3UBTA 3T06B 4G0NA 2EGUA 4RLQA 3VDNB 3PNBA 1E18A 3OKCA 4IZHA 2VQ6A 4D3ZA 2MJLA 3E22A 3CBQA 1SHLA 2GN4A 4Q69A 3UAGA 5JSZA 2V6MA 1H94A 3ZLTA 1AVTA 2Y6VA 1BGWA 4H1TA 2C0LA 1ZSYA 3RE1A 2Q8NA 4FYWA 1V3QE 4RMIA 3IMEA 2AIRA 3LU1A 1HRKA 1HE5A 1X87A 4J0UA 3CIAA 5HJEA 4U7PB 3O84A 3WFJA 3S7FA 1DWPA 1A7UA 2ETVA 4G9GA 2ACVA 5DE3A 2H0AA 3LZDA 4PYQA 5K4AA 5JR3A 2B5WA 3IAS1 4G3XA 1OY1A 1W6UA 1UBMS 1E1CA 3FPKA 3UKUG 4PTLA 1U2QA 2PT7A 1A8UA 5CB4A 1DTWA 2E55A 4JBGA 3MCWA 1OBHA 3U61B 3C24A 5KNHD 1OUMA 3PRZA 2F1OA 3DXKG 2JK1A 4I9UA 1JG7A 3STYA 2IEIA 4Y2GA 1QGAA 1A2KC 3HDHA 5CJ2A 1VBMA 4PSKA 5F21A 5JXGA 2SHKA 3MS7A 5LJIA 4LTNA 2FOXA 4P3KA 2HF7A 4EQ6A 4B34A 3G8BA 3CCFA 3CZ4A 4KSBA 2XBMA 1YZHA 2O50A 2Y99A 4UE2A 5EXXA 1FP6A 1VE3A 3IBYA 1LRJA 4CKBA 5FNVA 4CLRA 1QVAA 4LOAA 5EZYB 4BFCA 4XYGA 4D8UA 5MN6A 1RRFA 3U3MA 3RHTA 4MHSA 4KC0A 4BL5A 3RC7A 1QM5A 4OQXA 3NALA 2O5VA 3G8CA 3A2KA 1ORWA 3OTQA 1P0CA 5AW6A 3U60B 1LRLA 4OVVA 2K87A 4DCMA 4BCCA 4XYBA 3OUTA 2ZJ1A 5TXGA 3EQ6A 1CS4C 5CEEA 2G6TA 5LQKA 1K5GA 4GT1A 5JROA 3PV0A 1S4QA 1LJ8A 1YR3A 1MJ5A 1RJDA 4EJ6A 2YBDA 3REGA 1YUBA 4FBGA 1HURA 1LBQA 4UNQA 3FFBA 1N2CE 3O8OB 5CYPA 4KYUA 1OAOC 4M76B 3I30X 4FGSA 3ZCPA 1JLLA 3RSLA 3LPNA 3CVOA 4B46A 1AZLA 4KMOA 3EXIB 2A0XA 5K8UA 2NZWA 1IN6A 1K5HA 3LRPA 1RAFA 5LVAA 3RAFC 2SNIE 3HR4A 7GPBA 3WLFA 1P31A 3HLYA 3CLUD 1N4DA 1WETA 3T4XA 4HBDA 5MGNA 1GSIA 1O03A 4B9EA 5IPFA 5C8YF 4HRVA 1V8OA 1LC0A 1W4ZA 5IEBA 2CLCX 2X14A 1P1CA 1W96A 4U2DA 2QN2A 1OW3B 3I5PA 1Z2PX 2EBHX 4Z0HO 4RD6A 3FTSA 4C20A 4N12A 3BVPA 4GNKA 3DJYA 4M3NA 4K9KA 3ZR4B 1W5TA 2QTNA 3FZGA 3RFTA 2WJ3A 1EB9A 1KDRA 2AXEA 1JG2A 5CK5A 2KSQA 3F46A 2X6FA 2J08A 2IY7A 2ZAIA 5AICA 1H69A 4ZODA 3ZD9A 4EYSA 2P62A 1Z68A 2FSUA 4C4OA 3WB1A 2JBAA 1IRXA 4M8KA 1HMPA 5ITZF 5E1OA 1FNDA 1GDHA 3T94A 1AS3A 3PYXA 3T7SA 3V8PA 1C2TA 5K8CA 4YVFA 3SHWA 1JVBA 2XDWA 3AVTA 1PD1A 1MRSA 1P0MA 4Y2YA 3NRBA 4AMYA 1KT1A 3V1YA 4Y9SA 1AKVA 3SI7A 4UM9D 3HR7A 3S44A 4RFLA 3MJCA 3U66A 4EJ0A 2WIKA 2PEZA 5CVUA 5DX1A 4QNNA 4KZKA 3R5HA 2GGFA 4KN8A 1ZMBA 3PNVA 1P4GA 1NURA 3CWCA 2GPBA 3ZH2A 3N59A 2VNIA 1NKSA 3OLVA 1OFGA 3HVUA 3L6EA 5IAOA 2RKWA 2R8ZA 2NIPA 2CLDX 4PCAA 5G55A 4F91B 3JYPA 2IOSA 2I67A 2Y1GA 3UVEA 4Q7EA 4DSNA 3M7IA 1YF3A 3JYLA 5DXAA 2JIQA 4HDSB 1LLFA 3Q3VA 3JUIA 2ZBEA 1TFRA 4LXTA 4LHXA 2H2DA 5JISA 5BN5A 1FDSA 3KZOA 9ABPA 5CM2Z 4F3VA 4LECA 2AXPA 4IJKA 3NTXA 2ADMA 2IZOA 3ZYZA 1D1TA 1US8B 2Q5JA 2A5UA 4DRYA 4M1ZA 2Y1DA 1RWXA 3DOOA 3LTEA 2X3UA 3RYIB 1PS0A 4AKTA 1XFAA 3BL5A 3G0DA 4DEXA 1JQDA 3GHHA 1FF9A 3F5FA 1PU2A 3DOEA 4MQMA 4Z7NB 3R2JA 2IHJA 2RHDA 1T0UA 2TSYB 4DAEA 1NYQA 1OIVA 1U8YA 2I91A 3UK1A 3IUMA 4C0XA 4CM6A 2XEEA 4DY6A 4KO3S 4HB5A 1K97A 1JU9A 1KZ7B 1A9ZA 2Z2IA 2ZUFA 4F4JA 3LCUA 2V4ZA 3BDIA 4ZFHA 5LBTA 4YJ3F 2ANBA 1ZIDA 2O48X 3C3JA 5A2GA 5KYXB 5GGYA 4O4IA 4CBVA 1UBFA 3U56A 3AP3A 3FPBA 4MKIA 3RCBA 3DH0A 5IK2D 4LSWA 2CG2A 4C21A 3HB7A 3PH0C 2RHTA 2GOYA 1DXHA 2CYBA 5BR8B 1UWKA 3LJ3A 2OCYC 3Q9UA 5K3BA 2UZ1A 5B58C 3GAMA 4KPUA 1MYOA 1NRJB 1EMDA 4MUKA 1ZJWA 1N4RA 5EJ8A 3LSYA 1P5HA 3RASA 2JAOA 3CLUC 3GAFA 4OM7A 3BN3A 1OGIA 3SWWA 4LEUA 3VR5D 3HIZA 2Y67A 4G1TA 3HXKA 2C4VA 4P0QB 1RBQA 3GHYA 1Z6YA 5ARBA 3G2IA 4P35A 1QOPB 5HF6A 3D7MA 5JUWA 3PREA 4HFRA 2KLHA 1KJYA 2D4AA 1N1DA 1AK1A 3FNFA 3AINA 2VWHA 3L1JA 4DF3A 3GI1A 1WIWA 2P9UG 3ZC3A 3MGAA 4ZYLA 1EB8A 4B6GA 1SU4A 3OEYA 3FTYA 3TTSA 5JH7A 2QDXA 3HSSA 4OP3A 3PNPA 4CVNA 5LYYA 2BTDA 4HADA 4RHEA 1EM8A 2AHOA 4E5YA 5CFMA 3AC0A 1PZNA 4Y6QA 1Q7GA 4GIBA 4IVNA 3GNLA 1GG2A 5HIKA 5BN4B 2A5DA 4E2ZA 2MHKA 2F64A 4M49A 2HQBA 3ETEA 1FNSA 4FX5A 4GYOA 4B76A 1DX4A 4OSEA 1Y63A 4HVTA 4N1AA 1MO6A 4R2XA 1S8NA 2NO6A 121PA 3BUAA 2PQRA 3GPLA 3QVLA 3IO5A 1WABA 2NU7B 2OUKA 4JUDX 2ORED 4HWRA 1G3NB 1KP3A 4KFRA 1DVRA 3S7ZA 1E0AA 1WKVA 2PAFA 2UWJG 2GD2A 5K8JB 1AQLA 1Y5MA 1NJFA 4M9XA 2Q0SA 1KZ6A 1QUFA 1R8SA 2CW5A 4IX9A 2M6KA 5EQDA 4GPD1 4LOHA 2DR2A 2DQ4A 4D5GA 2B4QA 4UBKA 4TXQA 5EUCA 3LGAA 4MS3A 1OC2A 1XNRB 1QH1B 1RZRA 1JVSA 1J2TA 1L4MA 1TUGA 2XZTG 5JCZA 4PCLA 4R1UA 1RAHA 4APOA 2JLBA 1K7FB 4Y8VA 4PS8A 1Y3IA 4DUZB 3SQWA 5D0QD 3NAQA 3D31A 4Y2PA 3N28A 1TVCA 3HFGA 2WOOA 3KSUA 2C31A 4F5YA 3PEUB 4YYEA 4DMUB 4H4DA 1CE8B 4JK3A 2AFHA 4HP8A 4BO1A 1YWGO 4Q9HA 1DVPA 3NIWA 4ZOLF 1H2WA 3OU7A 3NH6A 1ECGA 1PZGA 4Z1MA 3L46A 3T7CA 2FGKA 4LWPA 5K99A 4C0LA 4YLYA 2Y0BA 2W2NA 1P62B 1RNLA 1D2CA 1XJQA 2X2EA 3AFOA 4HNUA 3AEUA 5K8LA 5G02A 3VAAA 4XUDA 4KXMA 4PYLA 4DLLA 3TSAA 2IUYA 4CFYA 1I6MA 3ABSB 1TIKA 3G0OA 1E4EA 4AO7A 5L3VA 1Z7EA 1VMAA 1PT8A 4R6XA 1GTZA 2HMTA 5KMGB 3PCTA 3KTAA 4EKDA 3V4LA 3WZMA 3IVRA 2W4QA 1KP2A 1LW6E 4G25A 5D3KA 3DLTA 4ZVLA 3LXRA 5TF4A 1JLMA 2EEZA 2R48A 2BFWA 3QITA 2H2GA 3K2EA 3ZDXB 2MYUA 1PTKA 3DEJA 3PC7A 2O8DA 4CMGA 2ZBDA 1N1MA 3WWPA 3I6YA 3F6CA 3EA5A 4EGQA 2QZSA 2GN1A 3CLSD 1G5IA 1V3UA 3BMNA 3HDTA 1RZ4A 4AG5A 1YAHA 4DTIA 2P9YA 2R2AA 5BW6B 3CPHA 2C1ZA 4JQYA 5JJCA 4G89A 4C43A 3RUDA 1T8WA 7ABPA 2CCJA 1TM1E 3QQPA 4ARUA 1ZWKA 3AM4A 2M2IA 2VRCA 3WDLA 2Q3CA 3DDNA 3L9TA 5FBWB 1NMZA 4K6HA 5DFAA 1N3IA 4D9FA 1BMQA 2E6UX 3U3OA 1Z4NA 3KEGA 4YJGB 5CURA 3HJUA 4G0VA 2BEKA 4K86A 3AP2A 4JBNA 2I66A 2H16A 3LZCA 2CF6A 5F5NA 1T0JB 4TS4A 2Z1MA 4J8PA 5SZHB 3AUFA 5KWVA 3VOAA 4OHKA 5AJYA 1RXCA 5EMLA 4H1WA 1PBNA 5T4YA 3FYUB 1Z4PX 2NSLA 5T67A 3K0CC 4PZLA 2GEKA 1REQB 4M7OA 3TXAA 4G4GA 4H3HB 2BKVA 5AM2A 2XNKA 3DDCA 3RHSA 1EFRA 4RF3A 2Y68A 1VCHA 4NPHA 4AIFA 3KWMA 1P80A 5F5XA 4H27A 3H0KA 1M1UA 3KXKA 3B13B 3NATA 4JSTA 1QDUA 3T5DA 3OT5A 2JZCA 4J3FA 1OXUA 1KAHA 3IHLA 4EW3A 3O91A 2ZYRA 3FH0A 4O2AA 3HR8A 4TMYA 1NBOA 4A5SA 1CUJA 3VH2A 1QIHA 2FMHA 4G0MA 3N75A 4WKNA 5BNZA 5JAQA 2I4LA 3IDAA 5T4FA 4QVKA 4YWJA 3FDFA 1SOUA 1SUCA 2H17A 4FCVA 2DBVO 2B83A 3LP6A 3TZCA 3FD8A 1ISHA 3VO1A 1QH8A 1HETA 1NBHA 1T25A 2I2FA 1XALA 1LPMA 4G0ZA 1A5EA 5IBCA 3ASHA 3CNQS 3PWSA 4ZJUA 4WNAB 2H4XA 1N6OA 1H85A 3KSLA 4D42A 3FFWA 4HCJA 5KDDA 1J24A 2W2LA 5IYZA 3FXAA 5DP2A 2W58A 3F5MA 1FYFA 1UANA 3AVQA 3P2JA 3R5TA 5JCJD 1YNSA 3VKUA 5JFGA 1RHRA 2CVZA 1Y6JA 7REQA 4NDAA 3ZVLA 5BVHB 2XCSB 4O4JA 2WM8A 4IICA 4ZCMA 2YINC 4YMGA 1KF0A 3K6RA 3JQ8A 1RLIA 2JGLA 4IH9A 4UVDA 3K30A 2A0WA 1RWOA 1OC4A 4KAXA 1MEOA 3DPDA 2Q7DA 5BN3B 2X8BA 3DTYA 1SQSA 3MM4A 4LG6A 4HEA1 1SXQA 2XLCA 2QIOA 5JI3E 1OU4A 2OPHA 3HZHA 5JRJA 1MT0A 3Q87B 4ZT2A 1EVQA 3C45A 3PUIA 3T3PB 4JD2G 3BJEA 3SZOA 5AXDA 3U44B 3NONA 1KVRA 3ZTTA 1KTVA 3ZDAA 5DEIA 5LZ4A 5I7SA 1EGHA 2AJ8A 3KJHA 4AVYA 4PZCA 2ZJ3A 4I5FA 1P2SA 5LWHA 4O2BB 4N0QA 4YBRA 1DRKA 2XZPA 1F51E 3NWBA 4DADA 4DJ5X 4WLEA 1U9JA 5JYEA 3MYRA 3T52A 1XDUA 1EX1A 2JI4A 3TAHA 1GN9A 4FXOA 4XVHA 1W47A 4YRZA 5BWLA 1NI1A 3CLSC 4IEIA 3ZCUA 2OP1A 3IJPA 2IUFA 1DRWA 4S1VA 4K6MA 1HT1E 3GBVA 5DTIA 1CJVC 4HB4A 3MTEA 1MNQA 4TKUB 5HZGA 2IXBA 2M9MA 4ZD6A 3RSSA 4UI9K 4DLOA 2C7GA 3A1CA 4TXHA 3UJNA 3E0QA 2B4KA 5IWAB 3BD7A 4QTXA 4QREA 2O6HA 1QK4A 1AQUA 3N0WA 2AWNA 1JQ3A 3U3WA 1AD2A 3TEMA 1F8YA 4ZMSA 1FU4A 1BGXT 3DKVA 1SD1A 1Y8RB 3GRPA 3L4JA 2HEGA 5HF8A 1OA0A 4RKYA 3U9SA 2G36A 2ZJYA 3EGIA 1EYHA 3GLGA 2P2CP 1S01A 3PIRA 1DI0A 1NQXA 4EECA 4OYRA 2G7MC 4WNYA 3GLVA 2NSZA 2W83A 4X1IB 1P3DA 5BP7A 5AJVB 4G4SO 1FE8A 8ATCA 3ZUVB 3KBBA 4I1MA 1NM5C 1FEZA 221PA 2PZJA 4E46A 1BMDA 2FCRA 2NYJA 2UVQA 5DTEA 2WF8A 4NH0A 1RABA 3GJ0A 3GLKA 4I81A 1UK8A 3PTLA 4JELA 1XP8A 2BSAA 1A98A 2R85A 3K6SA 4KLCA 4JXKA 2ZVQX 4N0PA 5J2UA 1BEUB 1Q0HA 3KP1A 1WCIB 5BMVF 1SUFA 4QGGA 2BEVA 2NU9B 2NTNA 2NSYA 2Z30A 3K9NA 1TA9A 3D3EA 4ZP1A 5JHHB 3E4DA 3GRKA 3I9NA 4C2BA 1F8FA 4DV1B 4G24A 1U9ZA 2A9OA 2J3EA 4ZGBA 3RRNB 3TFWA 4Y9RA 2BJWA 1NI4B 3OE5A 3RADC 2ERXA 2UVPB 5H68A 5IDXA 1HF8A 4DA7A 1ECBA 1K6XA 1JYEA 4WGGA 5CEDB 1QHIA 4H7HA 1J9ZA 1K8XB 4B6SA 4WH0A 3M6MD 4DT1A 4X1YB 2O8BB 2VBCA 5SV2A 5A7FA 3ESCA 3HEAA 5CB4F 5ECDA 4A8TA 4DLXA 3AG6A 1KI6A 4RIEA 2OWDA 1KT0A 2BPOA 1TXGA 5J4YA 5EJ9A 1C8KA 2VNKA 2HO4A 4MITA 1GD1O 1TM5E 4KWEA 3B1VA 1XUOA 2IEYA 2IOHA 3DT8A 3R6LA 5IUNC 1XD2A 3AB8A 2OO7A 3DV0B 4P5EA 1T5SA 2X19A 5JY6A 1JJFA 2EX1A 5KOHB 4B7CA 4IOKA 2VF7A 2YW9A 4BRZA 3IGFA 4B7XA 4XI0A 1F2UA 1U6IA 2YQ5A 2JEYA 3SG0A 5FNVF 1A1SA 3PHJA 4EY7A 4G4JA 5K45A 3KSBC 4L4SA 3IV9A 3TWQA