4GU5A

Structure of full-length drosophila cryptochrome
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
537
structure length
537
Chain Sequence
TRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLRACVRGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Updated structure of Drosophila cryptochrome.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
molecule keywords Cryptochrome-1
total genus 200
structure length 537
sequence length 537
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4gu5A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gu5A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4gu5A01
3NBKA 3PNVA 1NP7A 2PZ8A 4MQ6A 4MUIA 3IUEA 4MUFA 1O0CA 4AQ7A 2V0GA 1GZUA 3G6KA 3H97A 4ND7A 3IMCA 4R2LA 4R2MA 2X0KA 3IOBA 4Q16A 3PXUA 3G5AA 5LFAA 4HJXA 3I05A 4YP6A 1Q77A 1KORA 4JXXA 1F9AA 1EFVA 3FI0A 4JFAA 2CT8A 2CSXA 2VTBA 1ILEA 4MW6A 1ZUNA 3FDXA 4KR7A 1OWNA 4PBRA 1KAMA 4YP7A 5FO0A 2G36A 1FYDA 1OWMA 1QJCA 1IRXA 1JECA 3DO8A 4NDAA 1KQPA 1WOYA 1YULA 4ZCTA 1KAQA 1KP3A 1EUYA 1T9GS 1VBMA 4NAHA 2A1TR 4L2IA 1TYDE 2CV1A 2YY5A 4MUKA 5HG0A 2QTMA 2X1MA 1N1DA 2PFSA 1JIKA 2J08A 2B7LA 4Q93A 2DXIA 2DEUA 3A2KA 1MAUA 2A86A 4F4HA 1OBCA 4FZJA 4K03A 1TQ8A 2NZ2A 3SEQA 2BYTA 3HL4A 4MVYA 1IHOA 1V8FA 2HMAA 4OUDA 2CYAA 1NUPA 1DNPA 4OJMX 1O94C 4MW1A 1YIAA 2A84A 3COWA 1K4KA 2JAXA 3SYTA 2ZUEA 2A1TS 4MWEA 4KR6A 2QUIA 1T9GR 4MLPA 2D54A 1UFVA 3HMQA 3H99A 4DE5A 1WXFA 5DB4A 3CLRC 3CLUC 3AL0C 2DR2A 3ND6A 1KH2A 3P0IA 4F3RA 2Z08A 1WQ3A 3X1MA 1I6MA 1X6VA 2CUZA 2QUJA 1N77A 3FOCA 4KR9A 2D5BA 1I6LA 1YUNA 2D13A 1QRUA 4DDHA 4ZT6A 4ZCRA 2IELA 2Z3VA 3RK1A 2J09A 2QTRA 1SURA 1U7DA 2WQ6A 1EFPB 1WY5A 2JA2A 1GTRA 1OWPA 3IVCA 4ND6A 3IH5A 4XSVA 2ZUFA 2XRZA 1IQRA 3Q12A 2CV2A 1EFVB 1O97D 1N2IA 4HK4A 2EL7A 1K97A 1Q19A 3Q4GA 3ND5A 1G59A 1A8HA 1WKBA 2J5BA 1JMVA 1N3LA 1OWOA 1O95C 1U0BB 1F7VA 2QJFA 2CYCA 1ZH0A 1JEEA 1PFYA 5HUHA 2X1LA 3LCJA 4DNXA 4DLPA 1T6YA 4YP5A 1PFUA 3MLBA 3CA8A 3HGMA 4G6ZA 3IVXA 3ZJUA 2Z09A 4NATA 4TS1A 4U63A 3UMVA 1S4MA 2PXHA 3GUZA 4EG7A 1M8PA 4X0EA 2BTEA 1MAWA 3RHSA 2WQ7A 4EG5A 3GMIA 2DPLA 3IMEA 2VXOA 1BS2A 1KH3A 3IODA 3IDFA 5K0TA 1KQNA 2GM3A 4JZYA 3ZIUA 1COZA 4MVWA 1U3DA 1G8GA 1TFUA 4RPIA 3OTWA 4R0NA 1Y42X 4KPUB 3SDBA 3HZRA 3H9CA 4WNYA 4PBSA 5TEVA 3ELBA 4I6JA 3CVWA 1H1TA 3JXEA 5LM3A 4MWCA 3TZEA 4QRDA 3P0HA 3CLUD 5KWVA 4E1AA 3AKZA 4MULA 4KKVA 2EJCA 1J09A 3P52A 3HFJA 5BNZA 2JANA 3K32A 4ARIA 4UZEA 1JZSA 5IJXA 3PRHA 1M1ZA 3SZ3A 3CVXA 2A4MA 4MUHA 3IVGA 5TEWA 1TYBE 1GPMA 3DV2A 3RFFA 3KT3A 3H05A 5KHAA 1JGTA 4EG1A 1GTSA 2CV0A 1N2OA 3UC5A 1TYAE 1PG0A 1IFXA 3KT0A 3G59A 2V0CA 5DASA 1WJGA 4XFDA 4ZT2A 5DK4A 1K4MA 3FNRA 4CDNA 2O5RA 1QRSA 1O97C 2A88A 1H3EA 3A4IA 1KP2A 2IP1A 5K0SA 1K92A 4ZCQA 4I6EA 2QTNA 1O95D 3HV0A 1JHDA 2R5WA 3ZUGA 2AZXA 1QRTA 1MJHA 1GN8A 1GLNA 2DLCX 1P7PA 3M5WA 3TQOA 3Q10A 1NURA 4WSOA 4JXZA 4MUJA 2HZ7A 4BWVA 1VBNA 3TS1A 1Q11A 4DDMA 4U7JA 3ZGZA 3LOQA 3NBAA 2E18A 3N2YA 3FWKA 3ISJA 4ZT7A 3QE4A 3CLSC 1O5TA 3MUEA 1N2GA 1J20A 3A05A 1XJQA 1OD6A 1D2RA 3CLTD 1I2DA 3D6UA 5EKDA 2PG3A 3X1JA 4JYZA 3IOEA 1VBKA 1N75A 2O8VA 5F23A 3FHJA 3IOCA 4QBTA 5FNZA 2A1UA 4MUGA 2IJGX 4NZPA 2RE8A 2H29A 4NX2A 5DEOA 1G8HA 1T6XA 4GRIA 1PFWA 3MLAA 4QREA 3ZJTA 2J4DA 4I6GA 4L2IB 1OBHA 4RUKA 3SP1A 3INNA 2DETA 1M8GA 4ZCSA 2C5SA 3KT8A 1WXGA 5J58A 4J75A 4MW9A 1J1ZA 3C8ZA 3PNYA 1LW7A 1N2JA 4CT0A 1NUUA 1XNHA 1EFPA 4MW2A 4PY2A 4MVXA 1N2EA 1GAXA 3CVVA 1F4LA 2E0IA 1WQ4A 2NSYA 2H2AA 1O96A 3H9BA 3FY4A 1VL2A 1H3FA 5H16A 2WSIA 2DERA 3AFHA 1LI7A 1MC1A 2YWCA 4MUNA 2A1UB 3AG5A 4MWBA 1O96B 1U7XA 3N05A 4A91A 3CVYA 1JIIA 3D6VA 1WXEA 1VLHA 4EG8A 1N2HA 3AIIA 1JIJA 4GU5A 5IHXA 4YMIA 2AG6A 4U8HA 4NAUA 4HPWA 1EXDA 3AG6A 4OUDB 5TS2A 1MBZA 3DPIA 4EG6A 1RQGA 1KR2A 4MW0A 2XRYA 2PZBA 5J59A 3RBAA 4EG3A 3IUBA 3A04A 3FETA 1O6BA 4CQNA 1QTQA 3VU8A 1FFYA 5H7XA 3S3TA 1O94D 1T6ZA 1YI8A 3PNBA 5TGTA 4DJAA 3COYA 1WXIA 3CLTC 4H3SA 4MW5A 3CVUA 3FH0A 3QTBA 1M83A 3IMGA 1EUQA 2QJTA 2ZP1A 3ILVA 5AHWA 1NYLA 3FIUA 2AKEA 3K9WA 4K0RA 3L92A 4UZFA 3QTTA 3UY4A 2VTBB 1NUTA 1YIDA 3ZXIA 1H3NA 2CYBA 1U3CA 3RJZA 3TQIA 1NSYA 1J70A 2X3FA 4G5FA 1R6UA 4EGAA 1XNGA 3UK2A 1JZQA 2RD2A 3N8HA 1NUQA 2WB2A 3ZJVA 4MVCA 2OV4A 2TS1A 4ZCPA 1MRZA 3NV7A 3ND7A 1N78A 1QU3A 1QQTA 1PG2A 1O0BA 4ARCA 1MOPA 5KCMA 1JILA 1TEZA 1JEDA 1EJ2A 1IQ0A 4CDMA 1KKUA 2DUMA 4KPUA 1NZJA 4MUEA 1QU2A 1V47A 1MB2A 4EG4A 3P0JA 3COVA 4MW4A 4S1OA 3SZGA 3LE8A 4P2BA 3F3MA 1X8XA 1IVSA 1G8FA 2GKSA 2QUHA 5FO1A 4PBTA 2YXNA 1KQOA 3COZA 2E89A 1QNFA 1YUMA 3VRHA 2QUKA 1NI5A 3TNJA 2CFOA 1PFVA 3L93A 1R6XA 4DDKA 3N9IA 2J07A 3VGJA 4ZT5A 1J21A 1M8KA 2E21A 3BL5A 1ZJWA 2GOYA 3X1KA 1LI5A 5J5AA 3UOWA 1IQUA 2YWBA 2I1LA 1ULHA 4J76A 1TYCA 3KT6A 4AS1A 2QJOA 2OQ2A 3GLVA 3OP1A 2A7XA 4MW7A 1M8FA 3MXTA 4HJRA 3MMXA 4YBRA 3E27A 4ZT4A 1WZ2A 1XNJA 3CLSD 1IH8A 1MB9A 1J1UA 1M8JA 3RK0A 1NUSA 1HYBA 4ZT3A 1WXHA 3SEZA 3CLRD 4EFKA 3CR8A 4MWDA 3FG9A 3TZLA 1KH1A 1Q15A 1ZH6A 3U1VA 2PIDA 4XFJA 1CT9A 1R6TA 3KFLA 2PZAA 1B6TA 1N2BA 2HGZA 3DLAA 4G5YA 4MAFA 5LLTA 5HUJA 5JBNA 1I6KA 4EF6A 1F7UA 1EE1A 1OWLA 3ZXSA
chains in the Genus database with same CATH superfamily
4C4PA 1NJSA 1GRQA 2VP6A 3EZLA 3OBIA 1N1EA 1QGUB 4J0EA 4QUBA 3UTDA 3ZHOA 4CUJA 3HCAA 4IHQA 5K3AA 4K0KB 4PO1A 3GARA 4QA9A 3GJZA 5NLLA 5IUNC 3SFTA 3FTPA 1MQSA 3QXGA 2V4LA 3BH6A 2HM7A 1VPLA 2FSGA 4FI3C 4KXXA 3BMNA 4ADSG 1ABBA 3EHDA 3WLMA 1NXQA 3G0OA 3GPIA 1UMDA 1KBOA 5EY5B 5F78A 2CKDA 1WU8A 1CR6A 3DBRB 3RUIA 1OW3B 1GR0A 1TVMA 4FR0A 4UTOA 3E9NA 1F51E 3WGMA 2QVBA 1TM5E 4RFSB 5E7QA 4CMIA 1Q20A 2QRMA 2XAUA 3EY9A 4ZVOA 4WWOA 1YASA 3VR5H 1OCEA 2HT6A 3AVVA 4RTSA 1IBRA 2WXNA 3A10A 3N59A 1QF6A 1OILA 1NMEA 1PJ2A 5AW9A 3OA2A 2XCUA 3L6AA 4GTMA 3IUMA 3GH3A 4FS8A 3V8QA 2RGRA 5EIBE 3WSTA 2A9JA 2MIIA 2CG2A 1W4LA 1N6HA 1YB5A 1ZLXA 3BE8A 3LA6A 4PYOA 4RD1A 2HSEA 5I8ZA 2DBZA 1BZYA 3VV3A 2XB2A 4DSUA 5EOVA 2IHJA 3K8ZA 4OK5A 4Q4LA 4ZVPA 3TK1A 3KLPX 3ZU4A 4ARVA 1L7OA 3JAKA 4Y98A 3RUHA 1JXMA 5KC8A 1Y6QA 4TXMA 3UATA 3W2FA 5BQFA 4WGGA 5BQOA 2OZLA 2GEDA 2IXGA 2JBWA 1AHPA 1I1NA 3WDMA 5MGBA 2C5BA 3AY7A 1UPFA 5BNWA 2ZULA 5TQ2B 3A1WA 4NENB 2UXCB 1USGA 4DOMA 2HT1A 2PVCA 4EYSA 4AJIA 1N9ZA 4IVQA 1DRWA 2V7QD 1R0KA 4UVGA 4F4HA 3GIDA 3EVDA 4N01A 4D92A 4K03A 2NZ2A 4UDYX 2FN7A 3U0BA 2BYTA 1XTKA 2O8NA 2QMUA 4GPD1 1V8FA 1EVEA 1G98A 5HM6A 2YWGA 3DOOA 3E7DA 4BNMA 4J8SA 3EIWA 3BF8A 1OPRA 2JLSA 1CX9B 2EGUA 2J3HA 3D4PA 3QEJA 3ZGQA 4AECA 3DDCA 4R1OA 2A5UA 5F4ZA 5LZ2A 1TDJA 4UBIA 2PCJA 5IZCC 1LNZA 4D9FA 4LMRA 3ZS9A 4JN6B 3QUAA 1SXJD 4N9WA 4NK5A 1ZM3A 4Y2RA 1WQ3A 1QZUA 3RSEG 4OMFG 3I58A 3NHFA 3PWTA 2X6KA 2Z3ZA 2H5EA 1AF4A 4LRXA 1NXOA 1PAQA 1VPEA 2X4IA 4LZPA 1NM5A 4XKJA 4FC7A 1RYYA 1IPHA 4IKOA 1EE9A 1G3IA 4KR9A 3EWAA 4Q1AA 2DTXA 2PM8A 2A0FA 2HWXA 3A9WA 1QGUA 2NYAA 3R7AA 5JW6A 3OURA 2A0UA 2VGXA 1E5DA 1QIJA 4A03A 1Z5UA 4WPGA 3SMVA 4AKIA 1A95A 3NGXA 1IOWA 3E23A 2ZSBA 2PO7A 1PQYA 3BL6A 3NBXX 1PQPA 1NVFA 1FP4A 2Z30A 3BS4A 3I3SR 1JR3A 3IUYA 4H77A 4OA8A 1NR7A 4FFBA 4I2ZA 3PUIA 3UWPA 5HIAA 5CFRA 2O0HA 1RFGE 3HCRA 2C77A 1CVRA 5AM4A 3ZLUA 3C41J 3EH2A 3L8CA 2QU7A 1H19A 2W2OA 4QSMA 3V2UA 1KYQA 5DRTA 1Y8CA 3EVZA 5FWDA 4C4XA 1G8PA 4XEIG 3VPBA 2LDXA 3DD1A 4YLGA 1VE3A 3I1FA 1OBVA 1A71A 1DRUA 3THXB 4C2UA 3Q4GA 1IHYA 1MTZA 1RPJA 3EGDA 4M0PA 4MLDA 3OEED 3RVBA 1ZCAA 3SS7X 2Y66A 2HCTA 5I7RA 2OBBA 1L4YA 1ZC4A 5G55A 4PPYA 2CMFA 1HO8A 3L4KA 5A7FA 1LEHA 2V5VA 1AT1A 1PFYA 3AFGA 3EWSA 5JNUA 3N7UA 2AK2A 4UHEA 1YTUA 3FUUA 4COOA 1Q2UA 3L79A 1MDFA 4XWTA 2Z8YM 1W44A 2RCYA 4MS3A 5A4IS 3RC1A 4QQFA 4BMXA 4JKYA 3K6KA 1IDN1 1ZRMA 1W1WA 3IVXA 1QK3A 4L4UA 1HYQA 1GKKA 3TD6A 2QGNA 3KD3A 2NZJA 3JCZA 4TYWA 2RH8A 3LKBA 2HW8A 5EESA 1EQUA 1KFJB 3HVRA 4O4LB 3GUZA 1RWMA 4PO3X 2BFFB 4R3NA 3DOUA 3OPVA 4HNAD 1INLA 2X6RA 2B4YA 3B8EA 4NH4A 1ZUWA 4RKEA 2JH9A 4DSTA 1JAHA 1QH1A 3K09C 4BJ3A 3VZDA 2P2CA 1OAAA 4JZYA 3U7HB 4A10A 1B16A 4MDHA 4NONA 4R1UA 2WSLA 3PITA 1ISIA 3UNXA 5BW6B 2H31A 3LM8A 3SQNA 3VPXA 1KPSB 4H7YA 2P9GA 5H82A 3VO1A 4X45A 5BSKA 1S1MA 4X85A 2I2CA 1VBFA 3ONFA 1JJIA 1NQXA 1T4BA 3LH5A 1OPXA 4YRGA 1SHKA 2I78A 4ZQHA 1I7PA 2YIMA 3GLGA 3CK7A 3KPUA 2HBQA 1EHIA 4I4IA 4KKVA 4YDHB 2AEMA 2X9NA 3QFFA 4HNGA 2OCCE 2P65A 3ROZA 1OH8A 1MEOA 9MHTA 3K32A 3HCOA 4C89A 4JYAB 4LK3A 4U7DA 4YR9A 1YQEA 4MYSA 5DLEA 3RREA 3S0JA 5J9FA 1Z0KA 2KS6A 4KR2A 4JV5B 1H2AS 1SXHA 1YJCA 4JL0A 1GPMA 3EHRA 5D66A 3T9KA 1RRVA 1I5EA 2A59A 4RW0A 4U2FA 1Y8ZA 1GRCA 3BH7A 4N0EA 5ALFA 1NVXQ 2ZBEA 3JD1A 1C3OA 1JQ3A 2Z83A 4A8JA 1SG0A 5DNCA 3USES 4DTCA 3PJRA 4WLEA 5BP7A 2JKZA 1XTBA 3LUDA 1REQB 2XIJA 1QOQB 1G1MA 2AJBA 2FSUA 4P58A 3P4UA 4DZZA 1VHTA 2NUAA 4KJZA 2DBRA 4LXTA 1OAOA 2JJ2A 4FNGA 4R69A 4F4IA 4G26A 2Z4RA 4GMGA 4U7PB 1WXQA 4NBTA 4UD6A 5LC1A 1QAMA 2FU5C 1USUA 2NUPA 4RE6A 3OF2A 4YGXB 1R74A 4JI6B 1LS1A 3VKUA 5B4TA 1QHHB 3ON5A 1RRGA 4KMMA 2ENUA 2Z9BA 1P81A 3AIKA 4D79A 2JAPA 3H4VA 4TTTS 1N9GA 2C04A 3PUYA 2Q4TA 4J7UA 1G9XA 3MPOA 4LY0A 3OZVA 3ISMC 5ECYA 4DCCA 4OKSA 3S28A 2C5AA 2RBGA 2PWZA 4ZAGA 1JALA 2WJHA 1IHPA 4LFCB 3T54A 2ZAYA 2B8JA 4BKMA 1A97A 1YR7A 3E9MA 4DLXA 4LW8A 3A6LA 4PC7A 1AHHA 3VDMA 1Z6YA 2NO7A 4QAQA 1GPUA 2K87A 3ZY3A 4A0GA 2B9VA 2WXOA 1PZEA 1I4EB 5JY1A 1LWOA 5HCNA 3CW2A 3BXXA 1TJYA 5T4BA 2VDPB 3G85A 4N5IX 3UENA 2AOUA 1MRNA 2QJWA 2IDZA 3R3SA 3AR6A 3DSVA 5AVKA 5TSDA 1O5TA 2WU8A 3ZU7B 3I2GA 3BA1A 3GJRA 1YE5A 3A05A 3C74A 3QH4A 1XJQA 4RHUA 3SHOA 3WBFA 3ZE7A 3G1UA 5B58T 2AFHA 4ZI7B 3PS9A 1S9HA 3OICA 2P2ZA 3VTYA 1N75A 4GR4A 2ET6A 1RPTA 2BEVB 4QYIA 3FHJA 4CM4A 3F6YA 1I5RA 1A8PA 2A1UA 5IMSA 5HKOA 5T41A 3N2EA 1RLJA 4NZPA 4FM9A 3LGXA 3Q9NC 4B34A 5AM1A 1I7LA 4M1QA 4JR2A 1KZYC 1T6XA 4HQFA 4YRIA 1QKKA 2OMKA 3TWQA 2M2IA 4O3FA 2J4DA 4I6GA 1CQIA 3H2KA 1PR5A 4L2IB 4LHEA 4M8IA 5CVVA 4CKXA 1H2UA 1ZWLA 3DAGA 1H0RA 4AW9A 1E7UA 2HYIC 4I1PA 1L9KA 1PNVA 4YDWA 2WIKA 5ESRA 5JAQA 4KX5A 3PXBA 3QJYA 2EIKE 4B74A 5CEJA 1Z2AA 3UJAA 4Y1GA 2HRZA 1DFGA 3KT8A 4EHNA 3GFRA 5F2KA 2KM4A 5MN4A 3OO1A 3H9JA 4MW9A 4B8CB 4Z3KA 3EF3A 3DPDA 1N2JA 1NUUA 1TI7A 4ZDWA 3AILA 4YUXA 3EDMA 5EWJB 4LXXA 5EEGA 4E31A 1V5IA 1E5QA 2QUZA 2VNJA 1UN9A 5CFMA 3BK2A 3IMKA 4UDXX 1F4LA 1NVEA 1Q50A 1RMTA 3C3KA 2BP7A 2OOKA 2Y93A 1YDEA 2HIGA 4Z4QA 1VJ1A 4MRVA 1BU9A 4CIYA 2HADA 4BRZA 1E8DA 1QPGA 1C9JA 1GUBA 1UK7A 2C92A 4IG9A 1LFDB 2ZVJA 3AL2A 2WSIA 4EF4A 5EXSA 4AO7A 2HLPA 3MKQB 1B2RA 4P4SB 5DNWA 4HGYA 2J49A 1ZN8A 2ZWIA 2HV9A 3INYA 4OMUA 4WKPA 3NOOA 2PFGA 2CEKA 3CVYA 4WWHA 1PS9A 4P5EA 5AYVA 3KIPA 2AXEA 2D0IA 1GAQA 4LQ4A 3TQTA 2F17A 5DGXA 3E1GA 2X3MA 3QIAA 4R1QA 3U3WA 1BEEA 1T2NA 3DVSX 3K20A 3TAXA 2G25A 4MRNA 1OB2A 1SUFA 4RAOA 5FJYA 4KTTE 1A9TA 4KWIA 2JGRA 2Z43A 3ESXA 4OB8A 5B2ZA 2JDID 2Q5FA 4DEVA 2LSVA 3GDOA 4XE0A 3KZCA 3QPVA 4PSAA 1F06A 4ZZ2A 5AW2A 2EBHX 5I3CA 3PRJA 5EE1A 4A1OA 4EG6A 1RQGA 3TSYA 4EY7A 2DBYA 2QTVB 2PZBA 2R8EA 1U90A 4ACKA 1UCFA 3V8EA 3WYDA 3IUBA 1G7TA 4XTRA 4F92B 1L1FA 1BWQA 3NJRA 3ZHEA 1P39A 2NQ2C 1FLDA 1H23A 1UEJA 2VOEA 2XYVA 4G5HA 3IEPA 5CBPB 3FPBA 4KFCA 1U0RA 2AXUA 1K7XB 3Q78A 3JVDA 3L77A 3CHYA 3CJTA 5HNKA 4EY6A 1D4ZA 4YMVA 4HB3A 1M83A 2QTFA 3MEKA 3K1AA 2ZZMA 3B2QA 4PYKA 5H3CA 3ED1A 5ARCA 2VSYA 1LPPA 1U2EA 5IJAA 3AJEA 1SQSA 4PAQA 1N8KA 2QAJA 4JIMA 2A7QA 1ZVKA 3K71B 4UZFA 1FMFA 4RPJA 1NUTA 3QARA 1V8PA 4EPZA 4ITRC 5K3SA 1GGJA 1HF8A 1V6CA 2DFKB 3HWRA 1VL0A 2R48A 3KV1A 3D5TA 4UPEA 2XBLA 1T13A 4CLDA 1PL6A 3H0KA 3SKXA 2H4FA 2OHIA 4JI4B 2QTVA 4H7EA 1E7MA 5EE3A 1LBHA 1JX6A 3AB7A 3T5TA 5IWCA 2PZKA 2A1IA 4TSFA 2PCLA 3JQ6A 1FQJA 3TZKA 1W5AA 5AR1A 3LC7O 4HDMB 1O9GA 3F5DA 4J2HA 3LX4A 3V34A 4B8YA 1KWGA 5LP0A 1FS5A 3HBAA 4NOJA 5F73A 4PNHA 3HXMA 3ZZNA 4AYXA 2WYHA 4WTOA 4P3OA 4KYOB 1GSOA 2P9HA 1F9EA 1NY6A 1RZUA 1K8RA 4JBNA 3DP9A 1VTKA 3O8NA 4OY3A 1XWFA 1FSSA 2O3TA 1I3CA 4IJQA 5E7IA 4ZA2A 4D3FA 5B2FA 3NUGA 3DE2X 4DIKA 2EP8A 3H6HA 4KPUA 4YGYA 5HK8A 1Y4ZA 2CHEA 4LEUA 2YXLA 2A9PA 3UKRG 2VJOA 4P2BA 1NJ2A 4B89A 4JJKA 4CT4B 1IVSA 4L5BA 1HE5A 2R97A 1KK3A 1HSZA 3PZ4A 2O8DA 4ND8B 4YPFA 3KQHA 1JCSA 1E2IA 4NU0A 5DLDA 3T7EA 3ML8A 2EQ5A 2EFEB 1BGXT 1CSEE 1IAVA 3L8GA 4U0KA 4Y67A 3RYFA 3KUCA 4QU8A 4BNWA 2OZKA 2GVZC 5EWJA 3KVYA 1JEAA 2VDMB 1ODJA 3F49S 3JD4A 3QWAA 3K73O 2OUKA 3HADA 4TV8F 5F1PA 1GARA 3VRHA 3WJ1A 2QN6A 1VJRA 2QIPA 2ZJ0A 5HF9A 3QHPA 5EP3A 1HQDA 3VGJA 2FEMA 3UKDA 1H2EA 4MYTA 3QFHA 2VVTA 1VLLA 1Z7BA 2VHVA 4XVUA 3VZQA 2IQ5A 1XWIA 3LUKA 3VMFA 4LN1A 3SIWA 4IL5A 4ENWA 2QJOA 4DQ0A 4UC0A 1QZ2A 3DCIA 4QTXA 3MTJA 4JLDA 4MW7A 4RMHA 1NXTA 4C6TA 4ER0A 5FQ4A 1EA5A 4G8LA 1XMIA 2D4HA 3AH8A 5CGZA 1S7CA 2COKA 2N1MA 3EHQA 3GJ4A 1UXHA 4CEIA 4EUSA 4IYPA 1LDGA 2Y1LE 3AT1A 5I8PA 1GM5A 4Z3OA 4CEJB 3ZJ5A 3BD6A 4MV9A 2EJVA 4FYJA 4GX0A 4CL8A 5LVAA 1O89A 4JC0A 3TWTA 3PFWO 1R6TA 2UV8A 3O38A 3P9IA 1OFIA 3R8CA 2WD7B 3OOHA 4FC8A 1Q17A 1GGHA 2Q3CA 1YMUA 1SBYA 2R00A 2NO4A 2ODBA 4QXPA 4ZO8A 1LLDA 2P3OA 1QFYA 3GA0A 4BNIA 2ZTVA 1X2BA 2WUFA 2JJMA 3AGQA 2ZWPA 3D4NA 5JDIC 3FGPA 4RIEA 1R0SA 4AQ7A 2X8AA 2YJTD 4MKZA 2DFTA 2MOKA 4I08A 5I8WA 4NMMA 3HYCA 3HVEB 1US8A 4R2LA 4S2UA 4XSHA 4YH1A 2GEJA 3AXSA 1ZNYA 2O50A 5JSYA 3WK4A 2BEUB 2C2OA 1ZM4A 4CYMD 2GSDA 2WVIA 2OCDA 3DZIA 3I64A 2I87A 1QGAA 4YP6A 4DPKA 4OYYA 4HGQA 4HRXA 3EIHA 4HNVA 5GZ6A 5TPZD 3E3NA 4MVJH 5JJKA 5BUCA 4KLAA 4XR4A 3KLMX 4Y6OA 2IONA 4GA1A 5DZSA 3E5NA 4A5OA 3EU5A 4UTVA 2RHGB 5KI6A 1P91A 2QMZA 2VP4A 4OIMA 2DWZA 4HS9A 4WMLA 3UPDA 4GVPA 2C97A 1M5RA 1UMCB 3U4TA 1B41A 3WSWA 1UKYA 2I1JA 3EEIA 2NUAB 4F1KA 3SF8B 5EKQD 1WOYA 1OY3D 3ISVA 1CC1S 1HDOA 1YULA 3PPIA 3QJGA 1KAQA 2Y3IA 3FNBA 2IIQA 3UWOA 1VBMA 4I8DA 4EY8A 4IRUB 2HQRA 1XKTA 1QVVA 4RU1A 4A8JB 5IAOA 1H9CA 4ILGA 5IAJA 2D7CA 4FFVA 4TKVA 4ZVRA 1WS6A 3FDIA 4Q9LA 1DQZA 4X1KA 5E3HA 1W7AA 5KYKA 3PXXA 2ZLBA 4HL6A 2PFSA 1DEHA 2HEGA 3LVRE 4Q1BA 1H6BA 1ZOLA 3NQPA 1Q0ZA 2AEJA 2B7LA 1GTZA 4DB4A 4EUNA 3A2KA 1VKZA 3VPGA 2C57A 1OASA 1VXOA 4FNMA 4MMXB 5LOVF 3L41A 1P19A 2FX2A 2L17A 2Z58A 1RXYA 1JIUA 4J7WA 2GYVA 2HQSA 1LSJA 1WDLA 2JJ1A 3OIVA 4YEDA 3FB1A 3FLMA 2BHNA 4O1PA 1RE0A 4LX8A 2Z3WA 3RARA 3IB3A 5KOHB 1AQLA 4BO3A 4G56A 2FMFA 1A9RA 1U9CA 2UVPA 1BFUA 3HUFA 1R12A 1S01A 3EGEA 3PP8A 4MS1A 2X6TA 4ZFNA 1SH7A 4TMKA 3BGSA 3H75A 1GQQA 3T7CA 2QUIA 13PKA 3O0DA 1DXQA 4JC5A 1TFRA 4MS4B 1ND5A 3RTBA 3R24A 1KH2A 3SNXA 3MTGA 1EX9A 4REOA 1RHUA 5CXSA 3X1MA 3CZMA 2AHOA 3ESLA 3QDNA 2VTKA 3O3OB 3FOFC 3NANA 1FTWA 5I7AA 3CUTA 4HF7A 2F7SA 4B3HA 4G4SP 4LYAA 2VUHB 1EXVA 2Y1WA 3JXIA 2ZIGA 1LD8A 2IELA 1N2CB 1C8LA 5IK2D 2D3WA 4X20B 4MRAA 1MB3A 2H0RA 3NVMB 4W63A 4L9WA 1NQTA 3JU3A 1U0GA 4O6FA 2DCMA 4IHJA 4JLPA 2GCNA 3DYVA 4YECA 4G23A 2G3YA 3GQVA 3WYBA 5BSVA 2XWSA 3SC4A 1GLVA 4MS3B 2JA2A 3NVDA 4YAKA 1M2OB 4KQHA 2XTJA 4GLFA 3OZIA 2EARA 4JT9A 1M2WA 3EFHA 5IJ0B 4L6CA 7REQB 4ALKA 3ZHVA 2DKFA 2C9YA 4R5HA 4BZQA 4CTOA 4YDQA 1P73A 1EHYA 1N4DA 4HRMB 1H5NA 4LNBA 3HVHA 3M4ZA 1OQAA 2VBIA 5F35A 3T5CA 3WE7A 4U8VD 2BKKB 1YO6A 3ILHA 2DYKA 1XCBA 4IS2A 3G8DA 2GPJA 1PKEA 2OC4A 1IMOA 2VF5X 5E3IA 3V2GA 1W4RA 4DJEC 5EMJA 1PD1A 5AI4A 2I6TA 4BO1A 4OKNA 2WU3A 1N2XA 3PEFA 1V48A 4ZI2A 3IP1A 4FQ8A 1TTTA 4FIZA 2FPMA 1LZLA 3B1WA 2WJVA 3VR6H 2XNHA 3DDZX 4GP9A 2I6XA 2GRNB 1VYHA 4ZI3A 2PJDA 5CVCA 5EZQA 2H2WA 3UIPC 2R62A 3UMFA 4I4TA 4BSXA 3DYIA 3V4LA 5C8VA 1L8XA 1L7QA 3GUHA 3NEPX 2V74B 3DBLB 4NFYA 3G0HA 2JK1A 1I4LD 1JRLA 3G7UA 4ZC1A 4HVAA 1ZMTA 4F04A 1S4MA 3CUWA 1VKJA 3TUIC 1ISGA 5B3AA 3F5FA 2H65A 3ADKA 1NFFA 3VYTB 1RWWA 4KBYA 3DE1X 2GBCA 3LQYA 1DLJA 2Q1TA 1KJNA 5AHRA 5TMPA 4Z4EA 3SY2A 4PX9A 5H4GA 5L40A 2AI1A 4HX5A 5JXGA 1XF1A 3I9V1 4D9BA 2J48A 4XEHA 3HABA 4MUXA 4E2FA 1ISRA 4KGZA 2OLEA 3HA5A 5B3LA 2VYNA 3IR5A 2C7QA 5CCLA 3UV6A 4C08A 4PCUA 1VMDA 2W0SA 3DT8A 4RD0A 4FHDA 5A4MS 3VNQA 4C6HA 3OU6A 4LVOA 5DM4A 4XD7A 2GRMA 1IG3A 2QNBA 2JIOA 4I55A 3U3MA 5BMVA 2YS6A 1KIMA 2FBNA 4DEXA 2R87A 3PREA 1XMPA 3W2HA 1E92A 4LYHA 5G04C 4JZKA 4ZO6A 1FRZA 4HFJA 2RKBA 3S2IA 1QDUA 2HFKA 1JA9A 1WQ1R 4IS3A 2VATA 4XB2A 1DRVA 4FLFA 4J0JA 1ZWKA 2R1UA 2FZ5A 3TZBA 3ZWKA 4EENA 1YB7A 3K2QA 3IBGA 2VPQA 5E7JA 3VAZA 3FTWA 5HDQA 4OM7A 3VYUB 3NBYC 4CUKA 3WIBA 4YMWA 4J07A 1ZGBA 4BN0A 3NBNB 1NW9B 3KT3A 1AS2A 1K8ZB 3BBPA 2FPIA 5ENOD 5C80A 3FYDA 3OTQA 5IG2A 2C2XA 3OTNA 4Q05A 4F6CA 3I4GA 2GDJA 1ODSA 1IFXA 2O2SA 2XVMA 3HN6A 3P96A 4TMWA 3B95A 1AUVA 1GSIA 1KI8A 1U04A 3AUFA 5K0NA 1WJGA 5FWXA 4CQLB 4I99A 5DF1A 1RKBA 2C5FA 3EMDA 4KWCA 4ZT2A 2R2LA 5FZSA 4J8FA 3RDPA 3PQEA 3WGVA 1WHTB 3BERA 4D82A 2FPSA 1FP2A 3EG5A 3ANMA 4DFDA 2RGNC 1UBNA 3OKFA 4OFXA 1KY4A 1F38A 1XZAA 4G4SO 3OIDA 1K92A 4MRRA 1HZJA 1P9RA 3CWQA 2CB0A 3DL7A 4IIJA 5IKOA 4Q3DA 1LRJA 4AWAA 4QOJA 3WL7A 2QL6A 4ANXA 4I9CA 3NHLA 4QGAA 4U3JA 4MQEB 3NM6B 3DXMG 1AQIA 3EPKA 1YFJA 3UAVA 1N2CA 4BO7A 4KSBA 4EYKA 4LNAA 1GN8A 4L27A 2A92A 2E82A 1T9CA 4PZEA 4CI9A 1RACA 2GA9A 4PR3A 1XXLA 2FUCA 2Y76A 2FFJA 4WCDA 3UB4A 1DRJA 3TB6A 1H5UA 3G2SA 1X74A 4I19A 1GZVA 3D6FA 3FRHA 4LJKA 3ZBUA 2OYCA 3FX2A 5BN1A 3L0OA 1ZP6A 2J6BA 3JQ7A 4ENSA 4U0ZA 3T5PA 1VBNA 1OREA 4IKPA 4U7JA 4IWYA 4HC4A 2OWEA 3D4IA 1P1HA 3LDFA 4RVOA 2YV3A 4LDJA 1H66A 4Q18A 4QBIA 3VNAA 2YINC 5A6VA 5KOHA 5LKRA 2M6RA 3K15A 1I1HA 5HKKD 1XUOA 3MUEA 1HSOA 3V46A 2UVPB 1SUAA 2HTEA 2SBTA 2Y71A 3DL2A 4C22A 1UDWA 3Q4AB 3WKAA 3JZDA 2C82A 3EVAA 2IS1A 1WCYA 3PFHA 4BEJA 3KFXA 3QXSA 2CCJA 4YFYA 1FRFS 4EWLA 5K51A 2DY1A 1DKOA 3EODA 4K1XA 5TF4A 4OAUC 2R25B 4H08A 1QNLA 4PHCA 4QPZA 2IJGX 1ZIPA 2AE2A 3CEAA 1UJNA 4IQ8A 1G8HA 2CE2X 4G0QA 3QWHA 4A1FA 1PFWA 4IM7A 4DLVA 1Y4SA 3PEYA 3I0NA 1V7QA 2FRXA 4MIYA 4GMLA 1D0IA 1G6HA 4IRUA 3A4VA 1ZQ9A 3MCTA 4RTKA 1WU7A 2YOFA 5AOCA 1DEKA 4K6HA 1AZTA 3R0IA 5GJCA 5HIJA 1O03A 4AP6A 7GPBA 3VO2A 2OAEA 1OR8A 3QZUA 4H27A 2X0NA 2XUIA 3B2EA 4RV4A 1UMCA 3IXQA 3L7LA 4E6PA 3A27A 4MKIA 3RT9A 2WOJA 2NO9A 4E3ZA 2VAVA 3NH6A 1QVWA 1QQBA 2HF8A 4PY2A 4QFMA 2ZXEA 1TA9A 2XDYA 2DPXA 3C70A 3DVAB 3PTAA 2H1CA 1QO0D 3EAFA 3IT3A 2CVOA 4OMDA 4DDWA 1Y82A 1N2ZA 2H9IA 2YICA 5IYZB 1PEYA 3PQ7A 4JFRA 1N5LA 1XOIA 4M87A 3RIEA 5HUQA 1Z62A 3C3QA 4R4JA 4HSGA 1D8TA 1R8YA 2COEA 1LI7A 1NLMA 4XQEA 1MIHA 1P2BA 3ZHSA 4DAOA 2X5NA 1FFXB 3GT3A 1PI3A 2OPHA 1EX7A 1F2UA 1GFSA 1GPKA 3ITEA 4BJ1A 3BRQA 2YC2C 3IAM1 2PUGA 1TYQG 2FCRA 1CD5A 4AUMA 5KBYA 2RH5A 2BRUC 1VRVA 4GU5A 3RSCA 4YMIA 1UFKA 1EFKA 4HAWA 1RRPA 5EXPA 2DHEA 2PSHA 1TM4E 3LVFO 1DQSA 4UHDA 1NG9A 2WTMA 4WOCA 1OX4A 3DE7X 4Q6BA 2QUBA 4NYIQ 1X8LA 4AAYA 4F5DA 1XU7A 3DAPA 3C3XA 1LLCA 3TZQA 2JFYA 2GZ2A 3UT5A 1VIAA 4DQXA 4QJBA 2B92A 3QX7A 1SCIA 3JARB 2H48A 4GR5A 4HX2A 1X80A 2SCUA 3FETA 1S0PA 2VA8A 1V5GA 3NT2A 4JR1A 4NJMA 1MGOA 2V58A 3F98A 1YU9A 3DC2A 2WD8A 3L7MA 2C4UA 2GFQA 4LOJA 1KBQA 2QIOA 5DYWA 3QKWA 3H7AA 5A3SA 4GWKA 4F6LA 3DUWA 3T61A 2UVQA 2DKNA 5CFNA 5JYBA 4PE5B 4YJFA 4H3SA 4LJAA 5JHBA 5E9WA 3RUFA 3S1LA 4DWWA 1YVRA 3V55A 3CC8A 1G16A 1XP5A 2WWIA 4FDMA 3RU9A 2BFEB 3ILVA 4MEBA 3EPHA 2ZJBA 1PR9A 3LCUA 1W19A 4FJ2A 4YXWA 4HDKB 2XMZA 1QYIA 3MXOA 3R0JA 3B5EA 5ALLA 3W6OA 1VG8A 2CF6A 4IOLA 3L92A 3ZE1B 1T9KA 3CGWA 3L6OO 1X9GA 2GJ9A 4Q1EA 4PZPA 4R41A 1ODKA 3IERA 2DPHA 1JP7A 1TMYA 1T4GA 3ESQA 1QVAA 4DLNA 3FRIA 1AZSC 3L7DA 2X3YA 3V30A 5FBHA 3AVUA 2EZ9A 4PYNA 2YJ4A 4MVJA 5FYQA 4B2YA 4YRZA 3AHGA 5BQ5A 1NWHA 4A8PA 2OGZA 3PEUA 1A9OA 3G8CA 3O8QA 1CQZA 3RCBA 5FJJA 2QP3A 2XMQA 5AW4A 3VR2A 2CY0A 5FA6A 4ETWA 1N57A 3KOWA 2IXFA 1ULBA 1ZESA 3IT0A 4OLHA 2NO0A 2V6MA 2QZPA 3V7NA 3MAGA 3PZ3A 4AUNA 1FOEB 2G8NA 1UN8A 1UDXA 3HSKA 4B81A 2YOHA 1FVXA 3CW9A 4BO2A 2A33A 1VLVA 3PFKA 4M7CA 1TEZA 3ABKE 2ALJA 4KAFA 4MQFA 2GCOB 5GWXA 1JHPA 3LVQE 2YCLA 4X71A 4YJ3F 2D2IA 3P0RA 2GCEA 4RGQA 2Q28A 1N0IA 1L3BA 4NPAA 3IAS6 2BH9A 2QX7A 3AHEA 1D5CA 4Q6WA 3QPUA 1P8AA 3WI7A 1XTRA 5HQ8A 3D31A 5E6SA 4H2DA 4MO2A 4PBTA 4RANA 1B74A 2WWFA 2J3DA 1KQOA 4E33A 4UU1A 2XH8A 3TRDA 4DZTA 3F7OA 4CUZA 2G82A 2B0OE 2EYQA 3CTPA 3IAEA 4FCVA 1DCMA 4II7A 1EA7A 4RORA 4OHPA 5H3HA 4DRZA 2MU1A 4YAOA 2Q8NA 3FTUA 1T34A 5K3OA 1JHQA 4JGBA 4Y8VA 3QEBZ 5LOVB 1XLTC 5F7OA 5F98A 1F1JA 4AG3A 3PK0A 2PMBA 1NI4A 3OJWA 5ARBA 5GOZA 5JISA 1JFFB 2WTNA 3KZXA 4YJ2F 4WZAE 5F7JA 1HLPA 1E96A 2NTEA 2JCXA 4HXEB 1XTIA 1LI5A 1YB4A 2Y1EA 4XKCA 1F17A 2YWBA 3MJSA 5EKTA 5ESWA 3WL8A 4YAWA 3ZC3A 2P1RA 1AS0A 4NNPA 5IWAB 1ECBA 5LQAA 3C1OA 3TI7A 4ZJZA 1WLYA 3H04A 3HXKA 4HY3A 4OXIA 3MJRA 3LC1O 5FKJA 5K8JB 4M1KA 4EB6A 3RVNA 3GJTA 3DWIA 1K0UA 1QJ4A 1WEKA 2Q3FA 3CLSD 1U9YA 4PC1A 4WX2B 1GGNA 2VP2A 1QORA 2VZLA 1UINA 3VU3A 4I5FA 1HYBA 2D1RA 3P9RA 3PDNA 5B37A 4PQYA 1MVLA 3HCCA 4EH1A 3RRBA 1CUYA 1E7VA 1R8QA 4IX1A 4ZZ1A 5C53B 4BWRA 1U2QA 1GQFA 3MRSA 1IUPA 2HHAA 5D3ZA 1MW8X 3FPKA 4A6DA 2W8BB 1BMTA 2W6QA 1JKMA 2AB0A 2H85A 3GEIA 3GK3A 3HEMA 4NBNA 1NOJA 2HGZA 1TVKA 2D5CA 5JBNA 3KR9A 1KQFA 4MIOA 3GAMA 4GTPA 3SYMA 4YRAA 1U3GA 5HGJA 4IH4A 3QKRB 3RS4A 4MUFA 2IYOA 3T15A 5FBVB 1MT0A 5EMNA 1L7PA 1ARZA 5FPPA 3FPHA 2QR5A 3IAAA 2FOLA 2XOKA 3C45A 3EUWA 4BFZA 4F45A 1K2VN 2GXQA 5FQ6A 1GKYA 1JCRA 1MJGA 1RWQA 4FMDB 4ZQFA 5JNLA 1MC5A 2AN3A 2BP7B 2PL3A 2PRSA 5AD1A 4FA6A 3O90A 1YZYA 3E4BA 2ZTLA 3L0SA 4AYWA 5LP6A 6AT1A 3KXKA 3OWOA 3RGGA 4DUGD 3IR7A 3P7MA 3ENVA 3FVWA 4J7AA 4DX1A 4Z2YA 1WIWA 2PEZA 3D1LA 3SHFA 4UVDA 3S5UA 5J4YA 4AX4A 1XRLA 3H9QA 4FZRA 4L6IA 3D8BA 4FYXA 3CVPA 1C8BA 1XSEA 4Q7KA 4NDAA 4WZBA 3LXUX 1O9HA 3FROA 2X0DA 2IIPA 2I3BA 2NXWA 4MKGA 2RG7A 3K0KA 1UAYA 1HA3A 4G41A 2YNMC 3TLGB 4EDFA 1HZZA 2VXYA 4R01A 3W7AA 4PCAA 4TKUA 4D4IA 5AVZA 1SBTA 2IZ1A 2YY5A 4MUKA 5HG0A 2SICE 2QTMA 3O1HB 4K9MA 4MLZA 4HH0A 1N1MA 4M0MA 5IP5A 5LCXA 2VGEA 3LFTA 1V9LA 1TZJA 1TNZA 1U8AA 1GZHB 2D2XA 2G09A 1ZBPA 3ZNGA 5DXJA 3G2UA 4CM4B 1VPDA 3RRUA 1HNWB 1CHDA 1I01A 3JUIA 1ZGGA 4O2AF 4UCWA 4UU8A 4X7BA 2IQIA 2N0SA 3FCOA 5DIFA 2ZM6B 3QEAZ 3DEIA 3JYSA 3FLEA 3SEQA 1R7RA 3Q5DA 3H1BA 3VLDA 1Q7EA 1RI2A 3V4OA 4YYEA 3V1MA 1AKNA 2OV1A 3HZZA 3RS8A 4WINA 1BMFD 3CE9A 1GWNA 1V1RB 3PJGA 4YIHA 1O1RA 5ISMA 2YXPX 5AYWD 3DC7A 3QITA 2A58A 4YQZA 1UC9A 2ZGGA 1E63A 2FW8A 3HO6A 1AKWA 3D2CA 4KYUA 4LDRA 3UMBA 2AOUB 1VXRA 4Z49A 4QVIA 3INGA 4KK3A 5CCMA 3VH1A 4HPXB 4M1MA 3L43A 3D5QA 4DLLA 2I2BA 3TW4A 2WJ4A 5IUJC 4QL3A 1TECE 5MDHA 4Q66C 2FPPA 1P7ZA 1DO0A 1GQYA 1QE0A 4P7JA 1I2BA 5LU8A 2P6NA 3E34A 1FRNA 4Y6SA 3ZYCA 1RZRD 2WPDD 4WOBA 5HOEA 2P2YA 4K8RB 4G0NA 1CHNA 1PX2A 5JLJA 3GLIA 3I83A 5BYKA 1HT0A 1RQRA 2HJRA 2ISSD 1RABA 3LQ4A 1XU4A 4HN4B 1Y63A 1ZMBA 4P92A 3D7NA 4IJMA 3W06A 3WFJA 4Z4CA 1E9CA 3DTYA 5KNDD 1CDOA 1EI9A 2ZW9A 2C9ZA 3WGTA 3ICOA 3WQQA 3Q5EA 5DPMA 2ATIA 2IOFA 5FX2A 2GZ1A 2QN8A 3B1KA 5TQ0B 1WY5A 1QHHA 2ZWOA 3ESRA 3C1AA 3HB1A 1QHXA 5GPBA 3TLYA 2GPSA 4B87A 1GTRA 3DMTA 2VC2B 1J07A 3IQFA 4DMRA 2PX3A 4WLOA 2ZB3A 3HDHA 4QOIA 5CXQA 2FVXA 3ESZA 4N7BA 2OK8A 3OLVA 2Q4RA 2QTLA 3TCXB 4GD3Q 4FW8A 3TN7A 5CDFE 1N7HA 1NW5A 1XI2A 1PNOA 4Y6WA 2GAIA 3B3GA 4JLMA 2WIGA 1XYGA 3N6XA 2QYOA 3Q85A 4UD2A 2JEZA 3NJ4A 3SYNA 3FD8A 3X1DA 4G8KA 4XCQA 2J5BA 3GP8A 3JVEA 2AFIE 3PD0A 4MV4A 2XUFA 4ANWA 1QH8A 1PTKA 1V39A 4UM9B 2NZYA 2VCEA 4WFJA 1RWVA 2C3PA 3AEYA 4EZEA 4ZCIA 2GD1O 4UJ5A 1D07A 3LOUA 4JLAA 5SZJA 3RYIA 3D9MA 1YRWA 1N7GA 4RO0A 2VYVA 3RIBA 1E0JA 1I3MA 1RM0A 5AXDA 2Z2KA 3KTFA 5JANA 4UQXA 2B21A 1LTHR 3UPTA 4ENRA 1DELA 5CUQA 3AFNA 4KOEC 2IL1A 1DL5A 2LBPA 3F67A 5ETJA 1Z6QA 1J42A 2FUG6 4J0KA 2MHCA 3RRXA 2EG9A 3NUZA 2OO5C 2Q9AA 2G8LA 4FX5A 4URZR 3R8FA 3BIFA 4G81A 1J9ZA 1T8WA 2V7BA 3F7MA 3D9IA 5K0TA 4NARA 3PIDA 2WDPA 1S89A 1N54A 5FL3A 2JJ2D 3F8TA 3KL4A 3VPAA 3H2YA 1PAUA 4MVWA 5B30A 4Y6CA 4XH9B 3B6EA 4DQLA 2O7QA 3GAAA 5B1SA 4J0IA 2G80A 4MROA 2AFHE 3WIVA 1ZZEA 4JOCA 3LY9A 4L8LA 4POAA 4Q01A 4UTRA 4C30A 1OFUX 4DT1B 4MWCA 4LBYA 1AU9A 2JFUA 2JF0A 3MZLB 2QW1A 4ZVTA 3FVQA 2SKDA 3O9VA 1ZONA 1PGJA 3NPMA 2J9ZB 3V8NA 3PJFA 2P9IG 4W7IA 3ML9A 4ARIA 3F2VA 4Q69A 1ZK2A 4AURA 1W5SA 2KPOA 3QAQA 2J6CA 1OC2A 1HE8B 1KMHA 3BEDA 1LBSA 2ZT8A 2HF9A 2FVYA 4J7XA 3O8OA 2P9JA 3URMA 5JPCA 1Z7GA 1RM5A 2V0PA 2V5AA 4GMKA 4PAWA 3VR5D 1VYVA 3ZI4A 2B8NA 3CZRA 4CEMA 2VN8A 4RVHA 4PSVA 2GPWA 3KU4A 3IEGA 1VSBA 2FHSA 5ELMA 3UJ8A 4TSFD 2CMKA 1EINA 3ADOA 2FB9A 4XGQA 3UQZA 2YJ5A 2WV7A 2F4VB 1G63A 3DZCA 3JQ8A 4AJWA 1JYEA 5KNBH 1DT3A 1K08A 1ZHFA 3THXA 1BVRA 4J6FA 2XUQA 3AF3A 3CGGA 2EJTA 1DIHA 3PDJA 3DBIA 4RLSA 4UI9J 3BG0B 1WA5A 2FEAA 2WYOA 4CTKA 1G5TA 3GJ5A 4JWKA 1O97C 1N0QA 1Z2OX 1GXSB 1KEUA 3U9WA 4PLFA 4C0EA 1EVLA 8ATCA 1MO2A 4KGVA 2YS7A 3RROA 4HRLA 1HXHA 2IH2A 3ZWXA 5JVDF 2RARA 5BW8C 1FDSA 3RC9A 5LMUB 5FTKA 2HBYA 1Z2NX 4U7HA 5E8JA 3RS7A 4BV3A 2QM3A 4XDZA 3TLMA 4ARSA 4RTNA 2ZSFA 1DBRA 2FKAA 3FCUB 4HUQA 3GZ4A 5FUXA 2RIRA 1B0ZA 2GBLA 1G5QA 2WAOA 4IICA 1Y3AA 1VSTA 5T3YA 2X9LA 4AJ4A 4P36A 1TEVA 5CM9C 4W5QA 3UIOC 3KC2A 4CZ2D 3T99A 1Y1LA 3NYIA 2WNHA 4IIDA 4E88A 4YLEA 6CHYA 2EJBA 3QEMA 5AESA 1IYGA 4P22A 2XYRA 2JG3A 1XKLA 3C7CB 1TRKA 2JPDA 1DTEA 3GEPA 3Q8WA 1UIRA 2GN9A 4G2TA 1DI0A 1OXJA 1KMIY 3COPA 3H2ZA 3IFSA 5U4XA 3N2NA 5KX5A 4O4JA 3DMGA 1JDJA 1NJGA 5KEIA 3A3KA 1P0CA 2I8CA 4DGQA 4FW9A 1N2GA 4UHBA 5FBLB 2ZCJA 1Z5PA 1D9ZA 1YMPA 3LD9A 1LQ2A 4BFVA 3I09A 1P2VA 4D9CA 4WY5A 3QNUA 5AO9A 5M34A 2GAJA 5EKDA 2PG3A 1NSFA 2C8LA 2HU7A 1KMQA 2XNCA 3A9CA 4YRDA 4WXHA 1G7SA 1ZM2A 4JOBA 3IOCA 2FK8A 1BDHA 1RXUA 4CFYA 1UQUA 4XCVA 5EWLA 3HXOA 2HCJB 4YCLA 1CUSA 1YUBA 3JWGA 3DDWA 3W9BA 5DEOA 2W6JD 2H3HA 5BSFA 1BU8A 1NRIA 3PC7A 3LPLA 2XVAA 1EQAA 1Y3CE 1IL0A 2G28A 4HADA 1FXSA 1WBJB 3IRVA 4NPHA 4Y1FA 4C5BA 2NT3A 3ASVA 1KK1A 5JWRA 2GK4A 2P0AA 1ITZA 1SZJG 3E5HA 2WUWE 1ML3A 2X41A 3TBFA 3TM5A 4DCGA 3WZ2A 3L7NA 1Z0UA 1SXJB 4PHGA 9LDBA 4U2EA 1U28A 3CRRA 1SU8A 4QELA 4YO8A 1WUYA 2BGWA 2ZAIA 4LJ4A 5AK3A 1M2OA 5LD2C 1TJPB 3ZWWA 3T1TA 1L1EA 2PRIA 3DFFA 5BUZA 3UWKA 3WFZA 4WOJA 5IDWA 1T1IA 4CMIB 4EHJA 2J0QA 3AY3A 3W5CA 2GD2A 2AOTA 3EGIA 3UWSA 3EIJA 4CMKA 4RDIA 3LBIA 3QV1A 4OQMA 4DR4B 2QX8A 4MQBA 4MPTA 3IAM6 1SCUA 3R0VA 2NP6A 3LRPA 3P1JA 5A3JA 1EP9A 1IRIA 4PYIA 1PVOA 3TNLA 3CVLA 3C5EA 2GGSA 2QYHA 1HO3A 5AW6A 2CF5A 3V8RA 1TAGA 4PG5A 1UC5B 2YNMD 4Q12A 4PZ0A 3S2GA 3VOBA 4GI1A 4O4IF 1JKJA 1XDBA 3W7VA 4AWBA 1Y1RA 3RNOA 5K05A 4Z1OA 1HM5A 3RG8A 3W6PA 3C3RA 4OQPA 1SQ5A 4RLHA 3W3AD 3IEXA 1VLHA 4TUUA 1I4OA 1SA4A 1N34B 4W7SA 4LJ7A 5DCWA 3VZPA 1GR1A 1OOEA 1Q0HA 5JO0A 4U8HA 4RA9A 4CR6A 1UJBA 4D8XA 2VSXE 2P9ZA 3DYBA 3E33A 4U9HS 1HC7A 5KX5F 4IQFA 2NVBA 4E1VA 2P58C 1W5EA 4F6RD 5BWCA 3CF4G 1OJLA 2I71A 3L9XA 4FBGA 5EIXA 3OHPA 2BFDA 4RTMA 1XEWX 2B7BA 5HF8A 3TPZA 1FXWF 3U1TA 2DECA 3OQNA 2LSUA 3ENKA 3WLEA 5FLXA 3HXQA 3GFGA 4F9EA 1O77A 4CJXA 1EDOA 2QORA 3M6XA 4XYLA 2QY7A 4L9SA 1QFMA 3C2QA 2LXNA 3EE6A 3NZEA 4J2TA 5H7XA 5CA0F 2G1PA 4FU3A 2UZ1B 3NWPA 1A7KA 4ESVA 2XB6A 3GFSA 4HWRA 2NX2A 2VPPA 1ZUHA 2C9BA 1CZUA 1X86B 2IXAA 3O8OB 4XRRA 3RU2A 1SKBA 2QLJA 4E4RA 5JHGB 2E55A 2GM4A 4D25A 4F3TA 1PTJC 3FH0A 3JQGA 3PNOA 3QPDA 1P4JA 1A8IA 3JR7A 3S99A 3WNBA 2QRQA 5ULLA 3VAAA 2QJTA 4H9GA 1EB9A 1FNDA 1UT8A 2YNMA 4FUQA 4AY3A 4M83A 4Z0TA 5M29A 5MN5A 4BASA 2UUAB 4B9EA 3FDHA 2VYCA 2H6HA 2WZCA 5DW3A 3WNQA 4B83A 2PJUA 1L8QA 2QX4A 3OETA 1IZ9A 5DM70 1E2UA 5L7YA 1WULS 4BFWA 3QVXA 3A1VA 3AR2A 2XEHA 2CXRA 3ZWMA 1X94A 1EAMA 3KBOA 1NMQA 5JCJA 5ALDA 3ZIMA 4FNAA 3L7AA 3HVJA 3BJRA 3LZDA 1T4CA 4OLFA 1MPTA 4OJKA 3BXFA 4O2RA 1NNEA 3JQQA 4FFLA 2X3FA 1IDOA 5DK6A 2DWOA 2X19A 3FKSD 1XNGA 3UJDA 1QLWA 5F1KA 5JMND 2GAOA 4MR7B 1PJLA 1HQCA 2QMYA 4Z3DA 2IV2X 3R6GA 3RHFA 5JHAA 3R23A 4HDRB 5U1PA 3ZHTA 2R4UA 2EFYA 1A4IA 1PUJA 3AZOA 4OAVB 4F5WA 3FWYA 4R9VA 4LJYA 3RWOA 1QHGA 2BF7A 2O3UA 1S4QA 2XMSA 2C54A 2VPYA 1NVUQ 3JVVA 3NV7A 4HTAA 4BV9A 5AW1A 5L45A 5FDFA 1ORHA 1RKQA 2W2LD 4G5QA 2WV9A 3B3AA 4M9QA 4ZAYA 3ZCVA 2JKVA 4BMNA 1OCCE 2H6IA 2QG6A 1SHLA 1CRQA 4BJ6A 1E94E 4N8SA 2FO1E 1Z56C 4OP2A 3RK4A 1V47A 3IL2A 1Y9ZA 4DXAA 3A3OA 2I6FA 3COVA 3E48A 4IUYA 2EEZA 4F4FA 2OFFA 4L6AA 1NJ1A 2A9RA 5EWMB 2E5FA 2FSVC 5C3UA 4CIXA 4EA8A 1JDTA 5K0BA 3P9XA 3QYFA 3EXAA 3MJHA 3TOCA 3SFXA 3NPAA 1FYVA 1E6MA 3GRRA 1YAHA 1S7GA 1YJ8A 1PSDA 3B1YA 3HDTA 1JEYB 4JI8B 5BV7A 2DH5A 3IIIA 3R6DA 3Q7AA 4J0UA 2WK1A 5JCJD 5J5CA 2RI0A 1Z4PX 4DJDC 1RWNA 3VC3A 5B1YA 1YUMA 2VYFA 1R88A 1JT9A 2BKXA 2QUKA 2PKQO 3D9KA 4XPIB 3FU0A 2P78A 3HYMB 3KXPA 3HKDB 2GCIA 4XQGA 1QG0A 3OPYA 1R6BX 3QVGB 4IXWA 4KK4A 2YFKA 5HKBA 2BOVA 3Q6IA 2FZWA 1Q7GA 2CJYA 1Z08A 2QN2A 3EHMA 4ARZA 4OK6A 4MEJA 2I2DA 3I5PA 4MO9A 2I7XA 4E21A 1KHTA 4D41A 2GVDC 2O0MA 2WC1A 3PTLA 3UOWA 5FUQA 4BDSA 2PUAA 2BUCA 3HNPA 3F96A 3KT6A 5LR6A 3TJZA 3A1NA 4R8MA 2RKOA 3O4GA 3DFMA 3GELA 1IC6A 3FF4A 3JQ9C 3IVMA 4G1UC 1XU9A 3GPCA 2Y4TA 1RLMA 3CNOA 3HLYA 1HLGA 1NASA 2CHUA 2J8ZA 3B38A 3FZQA 3JQAA 4HFNA 4FYVA 1ZD8A 3I4LA 3AEUA 2ZIZA 1XZHA 4M7RA 4OJQA 1R9JA 1T5BA 4XD7D 4DARA 4EFKA 3WAJA 2BHSA 1DG9A 3FVVA 2EQAA 4O29A 1KH1A 5P8WA 2MRIA 1SR8A 1KSGA 2V1UA 3LBNA 1W29A 1YNOA 4PTZA 2CDAA 3L9WA 4H15A 4DV5B 1JR6A 1UOQA 2BJVA 3P2BA 3EDRA 1ZB1A 2I2XB 4AM8A 2ZUCA 4P82A 1ESNA 1SCJA 3ETEA 3OM1A 5SY6A 4O33A 2XYQA 1WL8A 5DWQA 1I6KA 1PWYE 3C8HA 4F72A 2JHAA 3R5KA 1R0XA 3ELYA 3GXBA 4H7DA 4X6LA 3W8NA 5K0ZA 1JXAA 2E9SA 2J8SD 3BILA 5AJTA 1TZ2A 3IUEA 1JLSA 4KVZA 4MDFA 3IAHA 2XXBA 4J49A 2TYSB 5CEAA 5EZYB 3NAMA 5KYYA 1RIIA 2F55A 2ES4A 2I54A 3UT8A 2GM9A 4ZJYA 3UX4A 2YWXA 3IXLA 3DBHA 2JL1A 3QLVA 2VSQA 5CJ2A 4BVFA 3WZLA 1EFAA 1RLTA 1Z16A 1C0KA 3PXUA 5J40A 2CNOA 2J67A 4FMBB 2AZDA 2D6FA 1COWD 1E4OA 1TVEA 2G6TA 2OKCA 3M9XA 5AWFC 5GP1A 4EZIA 5JSZB 5LDDC 4CKBA 1KO7A 4Y2VA 3OESA 1EFVA 5HKPA 4Q3EA 3LTNC 2G5GX 3FGOA 4KC0A 5JD4A 2CT8A 4D4HA 4YRPA 3QVUA 5L3RA 2AJAA 4TV3A 2VAPA 2X2FA 1HRDA 2Z56A 4PBRA 5BT9A 5JS2A 4EYEA 1FYDA 1OWMA 1EGAA 3CVQA 2DM6A 3OCXA 4KRXA 5KU7A 2BLNA 1CNFA 2A5FA 2XT9A 1KQPA 3SO8A 1ULTA 1ZSVA 2HXGA 1H94A 3N8GA 3TECE 3C16C 1JH9A 2PLRA 3JWIA 1JE0A 1UMBB 2FWAA 2QT0A 5C9ZA 1P1RA 1OT5A 3WNDA 3ESDA 4YMUA 4K9NA 1S8NA 1G3QA 3SZ7A 3PVSA 2IOSA 2HMUA 1G0OA 2HZBA 2JFGA 4NYMR 1U0OC 4R9UC 2WWYA 1J6UA 4OV6B 4PINA 5BN4B 4D9JA 2O06A 2O20A 4O60A 4O63O 1KO5A 4ZMSA 5C3MA 3KR2A 1QB7A 4A6PA 4A0FA 1SC4A 4UWGA 4V39A 2YV2A 2VT3A 5A4JA 7YASA 1NULA 1P9WA 1YQXA 2ISCA 1OBCA 1VKOA 3EHEA 3G5MA 3LV8A 4U9IS 3KKNA 5C8YB 3ZJYA 1RYBA 4JD5A 4HH3C 3CKMA 3JAMA 1K7FB 1ZM9A 4RVNA 4B5KA 3ZYLA 4Q5IA 2REQA 4YLYA 1CW2B 3A11A 1MZPA 3QXXA 1UBKS 4CEHA 2PSDA 2DR0A 3RQIA 3DKIA 3FAZA 3EOZA 3RB8A 2HQ1A 3U3XA 5GVRA 4N47A 2AZMA 2DZDA 4I2NA 5AKGA 2E48A 4QO7A 4F7WA 3T7KA 2DZNA 1YDFA 1RI5A 4YWHA 3V3KA 2YV1A 4G8CA 5EILA 2GTHA 4C4OA 4BTAA 5TE9A 4A92A 1T0HB 1AO0A 2HXSA 2PX5A 2ZIEA 5A03A 3D3EA 3HB0A 1TK9A 2BFPA 5D7NA 3MOIA 2FJUA 1QPZA 2CUZA 1EXNA 4MV8A 5BN4A 1YBHA 5TPWB 3PL5A 4AULA 1NMXA 3I5UA 4CIVA 4KVMA 4P7GA 5KWDA 4Q4HA 3HYNA 3M1AA 1TGYA 4DDHA 2JW5A 3PPYA 3C85A 3N0WA 4O2BF 3PHBE 1R0ZA 1IVNA 3C6QA 4NS4A 2AGVA 3UEOA 2ZR7A 1UKAA 2EZ8A 2ZJZA 1N5KA 4HV4A 2J9XB 1Y3IA 2BGUA 1A7JA 2FA9A 1CY6A 1JDZA 1BVUA 4P80A 1SPXA 1GVHA 2BTDA 2XE4A 1MHPA 2XWPA 3NALA 4LRYA 4M1TA 5HGXA 5JZSA 5ALNA 3PU6A 3MMZA 4QT0A 3P2MA 1NLZA 3DMFA 4B3RB 1EFVB 1TN8A 1CETA 1E69A 3PYXA 5EHGA 2PKYX 2QGFA 3AI7A 1AB6A 2NT4A 3DDUA 3R8XA 5EC8A 3BQNB 4HYTA 4ABYA 3NIWA 3CR3A 1YR2A 2OA0A 5C52B 2WNIA 3VTZA 3NKVA 3X2SA 3O74A 4ZEOA 1T5IA 5KTMA 4KQWA 1VP9A 1SKYB 1UT5A 4PF1A 4KO8A 5AQAA 3ME5A 4DMMA 1PQWA 2NU8A 1FMTA 1KJYA 3U37A 4OP1A 1IWBB 2XI4A 1FB5A 4E09A 3CLJA 5KSYA 1NXPA 3CH5A 1OU4A 1ZH0A 4WUVA 5KO2A 2HR1A 1ZI6A 4UXIA 3FPJA 2P8SA 3T4EA 2DYSE 1F12A 4MWTA 4YMSA 4YRMA 1EDDA 3PC3A 1HH4A 1U8YA 2HA5A 4YP5A 2H1IA 5I7WA 3LDZA 1NPDA 5CDFA 3QNKA 1JXQA 1XPJA 3OFND 5FIUA 3CEJA 3VR2D 3ANXA 2GZDA 4ZYWA 3ER8A 3CVNA 3LEWA 2PXHA 3NHUA 3ROTA 2XPIA 1CBUA 4A27A 2BTEA 2FSPA 1VLMA 3C5VA 1R16A 4G63A 2RIPA 4YJGB 3VSCA 3TQQA 1IHXA 2P5YA 2HSZA 1YR3A 2A67A 1YJ5A 3JYPA 4J8EA 4BV8A 1TKCA 4F5YA 1RYMA 5CLJA 2OWDA 2HGSA 2PXXA 1KQNA 5BPHA 3UPVA 1E20A 1E7YA 3EZFA 1ENYA 5KAPA 3V6MA 3W79A 5JRDS 5GADl 1COZA 3MOGA 5A9SA 2Z1MA 1LY1A 2I3DA 2MOWA 1EFHA 2P0EA 3EC2A 1MOQA 1UBEA 3RSQA 1PL0A 4G8BA 5IF3A 2XECA 4RTPA 1UR5A 3H9CA 1EDUA 3T1HB 4XZ3A 4C4RA 3VH3A 1D2CA 5LZ9A 4JLJA 1ZIXA 4G4IA 3R5JA 4OHMA 5A7GA 2P75A 4B47A 2ZSAA 4II2A 4EHHA 1ST3A 1C9NA 2C1EA 4F9GA 2XQKA 3FMPB 2XJ4A 1Z6ZA 4JEHA 5DP2A 5BNZA 4GS5A 4AY6A 2JANA 1M72A 2QRKA 3BWEA 3FPFA 3FYSA 3OG9A 5D6OA 4UEKA 1PJ8A 3DHVA 1UPUA 1KFCB 2KBXA 4L02A 3W2EA 2YMQA 1GFZA 2JZCA 4MVJD 2FSIA 4TM7A 1TT5B 1UEIA 3UJBA 4B8WA 3FSJX 2JBAA 3PBKA 5TQJA 4K5CA 4MARA 4ZYUA 3MCZA 3N8IA 5AI0A 2RD0A 4G1CA 1JE1A 4DSOA 3CS3A 1KO4A 2KQUA 3BXPA 1TR4A 1HORA 1PG0A 3IQDB 3PJEA 4UWHA 3WR5A 4DUZB 1HX8A 2FUKA 4XJSA 5U4QA 1QOPB 2NV0A 3SYKA 3SBSA 3D2BA 3GRKA 4QUAA 1XTTA 3QOFA 2QBYA 3GVPA 1Z5ZA 4M88A 2BLLA 5K8LA 4FOLA 4OXQA 1Y6ZA 4RQAA 1SAYA 4LXHA 1XCMA 4Q3KA 4BMCA 1A69A 1BFKA 2OXRA 2XMBA 2E1PA 2XZTA 4UMEA 3DV9A 4BX3A 3O94A 1LJUA 2C61A 3K1YA 4KXKB 2JGAA 5HR5A 3S8EA 4ZCQA 4TXPA 1PFKA 1QAQA 4WNGA 1JHXA 2D2VA 3FYUC 4KZKA 1SXQA 4F1PA 3ETGA 5J2UB 1A8SA 2X0IA 2RONA 1T1SA 3FCAA 4GRDA 2FV8A 2JGFA 2QK4A 2QSJA 3R7DA 3TH5A 5L95A 4WLVA 3HB5X 5BOVA 3TO5A 1Z3CA 1QYXA 5EKSA 2XZPA 3I8SA 2N1BA 5KYTA 5IAEA 3CPSA 1U1DA 5SY9A 3RTEA 4CNBA 4ZI7F 1K6JA 4UCFA 2NOAA 3FUXA 5CB4B 2PRYA 1CQJB 3KPVA 5EP1A 4ZZIA 1GCOA 2FLKA 1J7JA 3LO5A 2E4VA 3OOYA 3EEYA 3AG1E 1NNSA 1L5HB 4AMGA 4B6GA 3HCFA 1N7IA 1JFLA 2BZSA 3HDGA 3MBIA 3TNYA 1Q74A 1B89A 3RO2A 3GBPA 4MQLA 2CFIA 4G86A 1TE2A 4JVSB 3F6BX 4ACAA 3FWKA 4ZVMA 3WGJA 2IY7A 4AOFA 1A9PA 1NIJA 2NV2B 3UOAB 4NOMA 4IFBA 1I9GA 1NOKA 3GPDG 3BJEA 1R4AA 4MKFA 4PNZA 1SWVA 1XGWA 3SICE 3WRYA 4DUGA 1KS2A 1IATA 1EDZA 2GCGA 2KBEA 3OZEA 1DVPA 1AUXA 2PH7A 3CUEF 1X15A 1ML4A 1UK8A 2B30A 3QG5A 4KQCA 5DBIA 1TF2A 1PBTA 4UVEA 1Z28A 2IZ5A 4D4MA 3PE3A 5D5HA 1UK6A 1M1YB 1XMVA 2P9CA 2C1ZA 2B5VA 4PAGA 2ZUTA 1HKHA 3KYCB 4K28A 4QQIA 4L9RA 4N12A 2VDWA 5KSWB 5F9FA 2WMNA 4ED9A 4B4OA 1PE0A 3LNTA 2ZSDA 2D5LA 3HVKA 4QQRA 4KNYA 2QX6A 5J63A 3CWCA 1J23A 3DAOA 3I2YX 4R1NA 3FEYA 2GYWA 2XR1A 2Z5GA 2C0MA 5KTTA 4MCHA 3DAYA 2A9FA 1P31A 2F00A 5DULA 2IU1A 1L6IA 3LYUA 2PKEA 2IOFK 4XQ0A 3RVRA 4AP5A 4G24A 4CL2A 1NWCA 1G5RA 1P7CA 5KQPA 3RHTA 2DLDA 2I3GA 3A6EA 2IYXA 4BNDB 1FUIA 1FNMA 1MD9A 2B99A 4MVXA 2R6JA 3BMXA 1Z8DA 2EF0A 4YS6A 2C84A 4RA6A 4L8VA 2FF4A 3AHIA 2V59A 3TW8A 2JLUA 1CP2A 3ESKA 2H2AA 2EBWA 3LHIA 4BVAA 4HDNA 1ZMXA 2FF7A 1F8FA 1NN3A 2NTJA 3H9BA 1OLXB 2JZOA 3H2BA 3IS3A 4FGJA 4LHZA 3ZWQA 4DMCA 2JCSA 1D8DA 4LNHA 1YE3A 3RSOA 2ZM5A 1RJWA 1XB2A 3ZV7A 3HKEB 5GJBA 4GLOA 4YPVA 3MJCA 3NVKI 1BA2A 1PVVA 3PXAA 1XTVA 2SECE 1I0LA 3R5SA 3DM5A 3BA6A 4J3JA 4D7AA 1EGMB 2KYRA 3LBYA 1IYZA 3BFKA 1HFEL 1LD7A 5CU7A 2IHTA 4DYDA 3FWNA 1EH5A 3ASHA 1R4MA 1XRPA 2MMGA 4JSTA 1MG0A 4KMOA 2ID8A 3DZFA 2MYTA 4IIJB 3X1XA 1AKEA 1EFTA 1QG2A 1JAXA 2JFOA 3ACDA 2WWWA 2PL2A 1YFZA 2GYYA 3GL9A 3UWMA 3BX1A 4NAUA 3ZIAA 4MWGA 1WDKA 2C2YA 2QZZA 3X2FA 1JVSA 2FWIA 2C58A 1C0PA 1M75A 3AG6A 4Y2SA 1X13A 2WIDA 4XM0A 1SG6A 1YMQA 2IEIA 1KR2A 4AJ2A 1QHIA 2W2MA 1Z4QA 2UYGA 3Q87B 5J59A 3MB5A 4UREA 1ESEA 3BN3A 1QP0A 3UAYA 3WLNA 3LWZA 4ZALA 1X70A 2M6LA 1IY8A 3T3HA 1JBQA 1XVAA 3PV0A 4EEXA 3UC5A 2OUIA 3VU9A 1FNNA 3SMQA 5M72A 1TU4A 5TGTA 4IJ5A 1RC8A 1N6OA 1GU1A 2CD9A 5FXMA 1OXTA 5LMCA 3LHKA 3ZDAA 1U8UA 1X7YA 1LQUA 1BMFA 3CVUA 3QBTA 4IH9A 3VO8A 4B6SA 3WQBA 5AENA 2ZP1A 3EFOB 2VRWA 5FI1B 4AXBA 4ZZ0A 2IO2C 4HLLA 1B0PA 4OGFA 4TPKA 5KNCH 2VZ8A 5B3JA 1DO8A 2RAVA 5KJEA 3OT4A 4I55B 4NDZA 3SM9A 4O4JB 4AQYB 2PUWA 3MAAC 5KNCD 1LLQA 5AM0A 3EZXA 3LC0A 4X41A 1VPTA 2V8BA 1TNOA 3CH7A 1WB9A 4KQGA 1DS6A 1G3UA 2IYNA 1VGVA 3TIIA 2J3JA 1HETA 5FOWA 3ST7A 3UJ9A 2ZYAA 3NIDB 5ES4B 2JGDA 2CWDA 4Q96A 1Y9EA 2CMDA 1T2CA 3OU2A 3RIHA 7ABPA 1W87A 1SVKA 4KQKA 5ER6A 4RH0A 4WNIA 4MB6A 5ALJA 2P9SG 2J3KA 1Y5RA 2TRSB 5T6BA 4BIIA 4MVJF 4JI1B 2VAMA 2YRXA 3BZBA 2RJOA 1J5XA 2AMYA 3D6AA 2ZI4A 3K9HA 3N8HA 1PT5A 4R8KA 4KQMA 2Y3AA 2WB2A 2E37A 1P1CA 2C2LA 1SQ0A 3OP4A 5DTMA 4YQFA 3WGIA 4JXZA 2EKPA 2IUEA 4R8VA 2A14A 4LDPA 3ML1A 2J5KA 1DAHA 5JXJA 1WUHS 1AGYA 1GZ7A 4YCCA 1LK7A 5G4KA 1Z3XA 1T8PA 1KYTA 2YVKA 3AKYA 2FEPA 3EWNA 4G01B 1JILA 5E2AA 5GIPE 4AG6A 2DQ4A 2Q2NA 3AU8A 3PUZA 3ORQA 2VNHA 2JASA 3QIVA 3L13A 1G5IA 4FZ3A 1CDDA 2ZSIA 3I76A 1QP8A 3CSDA 4HB5A 3JQ8B 2ZKIA 4HAZA 5KDLA 3WKEA 3N2IA 1IZ0A 1Y5NA 3U2QA 1GG9A 1SZAA 1WRBA 5FO1A 2I6QA 1Y3FE 2WXIA 3IIEA 1GGVA 1MABB 4YASA 1YZGA 1ZPDA 1KSJA 1SQMA 4MRMA 3T94A 1IJFA 3F73A 1QTIA 1J56A 2YC4C 4BYGA 1WP4A 2L6BA 2BPOA 2C4VA 4E7PA 1TTPB 5HZMA 4RQIA 1OYWA 1MVOA 4IIBA 2G5TA 4RFVA 4LF5B 4J16C 3DCNA 4O8CA 3ZTTA 4ENQA 4XWAA 1FS4A 1RMYA 4JQZA 3Q8KA 4HGPA 2SNIE 1Q1NA 5INTA 2J07A 4ZT5A 3URKA 5CRVA 3ANTA 3E37A 4FP7A 1QMGA 1ZIYA 5AQBA 3IR6A 4I66A 4N6OA 3QYPA 1IK4A 4DT1A 1U7TA 2WABA 5C18A 1E3DA 1VIVA 3UVEA 1EK0A 2ZDGA 5AW5A 1ABFA 2W2KA 5J4KA 1Z6XA 1XTUA 4UHJA 4X60A 1KPIA 3M83A 1DQNA 1KDOA 3OP1A 4M0EA 4RZIA 2Y99A 4HGNA 2YIDA 1TM2A 1L4FA 3G2WA 2ZSUA 1AZWA 2D4AA 3GLFB 2XVZA 5JAUA 3FDZB 4IHJF 2PBLA 3HYLA 4HR7A 2VT2A 3I6IA 3HR4A 2VZ0A 3O4IA 4EABA 1FMLA 3GJ7A 1LK0A 4B79A 2C2HA 1GG5A 1FJ2A 1UMBA 5CM8B 4QLAA 2ZREA 3GJ6A 3R3VA 4E2XA 2QYTA 1MJ5A 1YJBA 4B44A 4I3GA 4MAFA 4A6EA 1KMNA 4DR6B 2YW2A 1SQFA 3RYHB 3FN4A 2Y0EA 2XENA 2AMLA 2DWUA 1Y34E 3CZCA 3GJ3A 3OZAA 3KJEA 3OJEA 1L5FA 1R10A 4NMLA 1KO8A 3LBAA 5F1OA 3UA4A 1UKVY 2I8AA 1R4NB 5JS8A 1SIBE 1YONA 3T8MA 2FJPA 2QAIA 3ZVVA 2QPAA 1TKRA 1EB8A 2JFFA 1E9FA 2W4IA 3CX6A 3LKVA 3NBUA 3O75A 2V8SE 1ECJA 1CUZA 2JIBA 3A6HA 4Q1DA 5KZMB 2DYRE 1EG7A 1PJTA 1FIUA 3UUGA 2D1SA 4O0MA 4V0OA 5LLSA 3H2JA 5A62A 2WIAA 1DB3A 2QJRA 4OREX 3RG2A 2E87A 4OHZA 3R3WA 2VUTA 2R96A 4UJ3A 5AT1A 5TMDA 3DNFA 3KSDO 3S7ZA 1P1FA 3NKFA 3K30A 4NBSA 1RYHA 4QKQA 4X1IB 2YV4A 5ADVA 4JXXA 1WZNA 4TMTA 3MWJA 4HWGA 1J9EA 2PZLA 4JCCA 1TCVA 2XUPA 3OLXA 1ORTA 4BVHA 1OWNA 2H16A 1KVTA 2NAFA 2WAAA 2W6JA 1BGWA 3F47A 3NQ41 3OFSA 3QFSA 1A7UA 1QHYA 3KTAB 3RIGA 1KF0A 5AUOB 5KVAA 4UATA 3WXMA 4LBVA 3JR3A 3FCSB 4NV3A 4L73A 4HLEA 4NOLA 4DPRA 4UKDA 4J6EA 2BC9A 5H4HA 3UG6A 1U8TA 4HUTA 3DBSA 3LU1A 4L5YA 2BGRA 3FUEA 1JI3A 3GF4A 3L6EA 4QVGA 4AC9A 4KQIA 1D2EA 4QPCA 4AZ0A 1OXMA 3U19A 4E5YA 3KHKA 1I3OA 1T0BA 1G2PA 2JLRA 4URFA 3IP7A 2PH1A 3CRNA 5D00A 3RT1A 1ECFA 3ZQJA 1T1EA 1XTSA 2CJWA 2EFDB 4G07A 2R2GA 1TNDA 3PDIB 4FOOA 2J08A 4AV7A 5SY4A 3HVEA 1US8B 1GNPA 4I17A 2ATVA 3AJRA 3KEOA 1MKYA 4HQLA 2C03A 4NEHB 4DLYA 1G4HA 2WT8A 5U9CA 2D74A 1T15A 2VHQA 2IGBA 4P0PB 1WTCA 4KXQA 5EE9A 1DAPA 3NLLA 1U8XX 2ZI6A 2V6FA 2QXTA 1S8FA 1MN6A 5KJMA 4MVYA 3RFTA 1ZCBA 2JGMA 1E18A 3OPMA 4YT2A 1IU9A 2PEYA 3JQ9A 3PJDA 3FH5A 4HNRA 1GG8A 4FZ5A 1V1RA 3OPYB 3LFUA 2RJ3A 3T7JA 1U98A 4G8DA 3ZS8A 3DVLA 4BP9A 4I9FA 5EJIA 1Q1ZA 5HOQA 1O3YA 2W2PA 1YIAA 2GH1A 1K4KA 3COWA 1I2MA 2TMYA 1C9DB 5PNTA 1ZK4A 4OQFA 5CA1A 1PJ4A 1NZFA 1AGRA 2IEBA 4TQ9A 5EIFA 4F1JA 3W2IA 1Z73A 1U3UA 4BVEA 3SC2B 3N7AA 4C9BA 1G1AA 1GL6A 2VIIA 2MYNA 2XOXA 3M0EA 3QA9A 3SHQA 3NGMA 4MGYR 1E7RA 4DCVA 3VKGA 3GDGA 1XNRB 1Q0SA 3D3JA 4BTEA 2OXFA 1SN7A 3SD7A 2ONJA 3RVJA 3HPQA 5A4DA 1HMYA 1RXEA 2VPIA 5ABPA 2HXYA 2O8EA 2Z3VA 2ZYVX 4RELA 3T35A 3IB6A 2QZAA 4BLVA 1VYUA 2A2ZA 1C9YA 3INTA 5T5QA 4CETA 1KEZA 4PDXA 3PQCA 3VNUA 1JFSA 3MYYA 3QVSA 4M7OA 4OQDA 3RC8A 1T0IA 5IF9A 2LCIA 1OWPA 2CLDX 3AEKB 2M1ZA 5FUBA 4HDRA 3NWEA 4HEHA 1GNTA 4CRWA 1NV9A 3G5TA 3GEMA 2OBFA 2PLFA 3GT0A 4JQCA 4MV7A 5F76A 3CTMA 2I7DA 3Q7RA 2YJ6A 4N8DA 2ZXFA 4H1TA 1CTQA 3FSRA 4D74A 2AEFA 4ZQGA 1KJZA 4UPVA 5JG7A 1FQWA 3DWEX 6ABPA 2VEDA 3DH0A 2B35A 3FDJA 4NEGA 2V8OA 1ICIA 5E4JA 1Z5SC 1V3TA 4CT4A 3PXEA 1NA0A 2VPZA 5IXYA 1I7NA 1U2GC 5TGDA 1N3LA 4PRYA 4X93A 3D7MA 2QL9A 4PZLA 1F7VA 3PENA 3WLKX 4DR5B 2X1LA 3LCJA 5FEMA 2JCVA 2MYUA 2W2KB 2FW6A 5C1IA 4DLPA 5CD9A 1ICEA 5ITZF 3D3WA 1VL1A 1K2WA 1PFUA 2NQ8A 5BSHA 4MYHA 3K0AA 3C7TA 4RZHA 3G02A 4MR8A 3ZEIA 4U7FA 1FU7A 5HILA 2IHYA 1E1RA 4Y7CA 2Z09A 4RGBA 5LYJA 4U63A 5JEDA 2HLDD 1M8PA 2IVFA 4JP1A 3UHOA 3EXFA 4Y6LA 2PVSA 1OLSA 1YVEI 3Q2IA 4GVXA 2D0PB 2QLNA 5FWYB 1QIMA 4HDAA 4W1SA 4O08A 1K7SN 4KFSA 3V7UA 2IOYA 4RZSA 5J2TA 5FR2A 1KDVA 3DHEA 1BD3A 2ZCUA 3GFOA 1XPRA 4ZVSA 2P2NA 3CB4A 4FLHA 5M04A 4F71A 1SULA 1G8GA 4S1TA 2I66A 2B69A 3QELB 2IXBA 1KZ7B 5C7OO 2DIWA 2PGDA 2FFRA 4MAMA 3R7BA 1ZA2A 4WWNA 2H7XA 4EELA 1R8SA 4TSKA 3WLIA 3IE0A 3IKLA 3M70A 4JSYA 5CT8A 5CNKA 5TEVA 5JSHA 4L16A 2VTDA 5EAIA 1H1TA 3EDCA 3JXEA 5G4KB 1DEOA 4GSKA 4NYJR 3VBEA 5DSZA 1G20A 2QN1A 5FZRA 1Z2PX 4LF9B 4PLWA 4XJVA 3FFWA 1SCNE 3QKIA 4ZI5A 3RUCA 3F46A 4DV7B 3THYA 3P52A 4P4LA 2XSZA 4RK5A 2EJWA 4MJXA 4RZ2A 3AX6A 1EVKA 2H2DA 2QPTA 4FNOA 1Z33A 3WLLA 1DADA 1KZGB 4HO1X 4LHVA 1IVYA 5CW2A 3SZLA 1JTVA 4FGKA 4KNVA 5FV4A 1JYSA 4M0DA 3KG2A 2FMXA 1AV6A 1MV5A 1D6SA 1IIBA 2XE6A 3DV2A 1U1EA 4HAIA 4X1YA 4D96A 1Z5VA 2O6HA 1G64A 1TYZA 5DX8A 2AD5A 1RI4A 2O3JA 2QZSA 1DDGA 2XUJA 3G7NA 2QVGA 4OUKX 2GO1A 4RJ2A 4WUTA 2XUAA 3C5CA 3ONWA 5CNJA 5IANA 1XZFA 2G88A 3ORFA 3QB2A 2H5LA 4WOPA 5KSPA 3T6KA 3FMOB 3LKDA 4QM7A 4CDNA 2JZNA 4CMHA 5IKMA 4DLTA 3I2FA 2Z8XA 4BFCA 1Z29A 4V0KA 4C29A 2XUZA 3IULA 2G0TA 3NT4A 3R7WA 1I0IA 1N0HA 1G2OA 4ZEVA 3HS3A 5AKYA 2FRDC 1UP7A 3FDFA 4H0NA 1SBHA 1FCJA 5EYPB 5FBWB 2M32A 2PM6A 1C4XA 1M9NA 1WM5A 1V95A 5MHTA 3PC8C 2P77A 3ZDFA 3WMFA 4E13A 1PBNA 2J4BA 1TGVA 4OQ4A 4L22A 3MM4A 4OB7A 5ENVA 1QZXA 2H92A 4LHYA 2FLVA 4LJRA 1VG1A 3AYXB 1MHTA 1KS9A 1CJMA 5CX1B 2CVPA 3MSXA 1FXWA 1RWBA 2O0KA 4DLRA 5HRUA 1QH0A 4MUBA 1AN0A 3SSMA 1TRHA 2EP5A 1EUDB 1ZJ6A 4WSOA 4EBAG 2XQGA 1Z82A 1QP7A 2W83A 3DEHA 3CH6A 4JYMA 2IWHA 5JROA 3F97A 4WKCA 5LBIA 4O5OA 4N9QA 5HKKA 1QBGA 1GRRA 2FEWB 1A2OA 3T41A 3VKVA 5ENPD 4RIHA 4ZT7A 5A2GA 1WCXA 3QE4A 2WXFA 2Q6KA 2HA7A 4EY4A 2ZI