4GU5A

Structure of full-length drosophila cryptochrome
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
537
structure length
537
Chain Sequence
b'TRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLRACVRGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWLAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cryptochrome-1
publication title Updated structure of Drosophila cryptochrome.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 200
structure length 537
sequence length 537
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4gu5A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gu5A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4gu5A01
3FWKA 1QU2A 4NX2A 3TS1A 4WSOA 2A1TR 1SURA 5TEVA 3FH0A 5HG0A 1RQGA 4NZPA 4YP5A 2DEUA 1GAXA 1KQNA 2JANA 1VBKA 3AFHA 1KH1A 1KORA 5LLTA 4ND6A 1OD6A 3SP1A 2DUMA 5IJXA 1K92A 3RHSA 4NATA 1EJ2A 1MC1A 3COVA 2CUZA 4MWCA 4DLPA 1M8KA 4G5YA 1O94D 1WQ4A 3DPIA 4XFDA 4R2LA 2X1MA 1D2RA 4CT0A 2C5SA 1O0CA 4K0RA 3G6KA 1LI7A 3AIIA 4EF6A 1F7VA 1PFUA 5BNZA 1PFWA 2V0CA 1WXFA 5FO1A 1EFPB 3NV7A 1VL2A 4F3RA 1K97A 1EFPA 2V0GA 4PY2A 2RE8A 2E21A 4Q93A 4MWBA 2EL7A 1PG0A 3ELBA 4MWDA 1QU3A 2IJGX 1P7PA 1N2OA 2J08A 2E18A 1O97D 3AL0C 1Q19A 3X1MA 5KWVA 1KP2A 1JZQA 3TQIA 4AS1A 1Q15A 3INNA 5J58A 1ZUNA 4FZJA 1EUQA 3N9IA 1WXEA 3IMEA 2VTBA 1WXIA 4MLPA 1J09A 3Q10A 4HK4A 3C8ZA 1XJQA 2CYBA 3KT0A 1HYBA 1MJHA 1N1DA 4OUDB 3HL4A 5DEOA 4HJRA 4OUDA 3E27A 3FDXA 1O0BA 2H29A 4MVYA 4MWEA 4MW4A 4MUEA 3ZJVA 4CDNA 1YIDA 1EFVA 4MUFA 3Q12A 4JZYA 1TQ8A 3ZUGA 2DR2A 4RUKA 1JIIA 5K0SA 1IQ0A 5EKDA 2RD2A 4PBRA 4YBRA 3COWA 4MUNA 3NBAA 1XNJA 1IFXA 2NSYA 1WOYA 3G59A 1KR2A 1OWOA 3A04A 1S4MA 1WKBA 1J20A 4KR6A 1R6UA 3NBKA 4MW6A 1IHOA 1QNFA 2R5WA 1NI5A 3LOQA 4EG5A 4EG8A 3VGJA 1QRTA 3X1JA 1NUQA 3TQOA 4J75A 4ZT2A 2BTEA 2PIDA 1QJCA 2O5RA 2GM3A 3HZRA 4DDHA 3ZIUA 3CLUC 4MQ6A 2PZBA 1N3LA 3MLBA 4I6GA 3CLRC 3K32A 4ZT7A 4ZCTA 1R6TA 3MUEA 3SEZA 3A2KA 4EFKA 2WQ7A 4ZCQA 2Z09A 3DV2A 2ZUEA 1T6ZA 4P2BA 5KCMA 4EG1A 4MW1A 3DLAA 1V47A 4S1OA 3P0HA 1NZJA 4PBTA 4MVXA 3TNJA 4ZT3A 3K9WA 4I6EA 1NUPA 1Q77A 1TYBE 4ZT4A 2QTRA 2QUHA 1U7XA 3ND6A 4QREA 1OBCA 1CT9A 1M8GA 4GRIA 3SEQA 1NURA 4MAFA 2O8VA 4Q16A 4DJAA 2JAXA 4G6ZA 2XRZA 4MUHA 5AHWA 1K4MA 3KT3A 2J4DA 4QBTA 5LM3A 1J1ZA 3CLSC 5H7XA 4DDMA 1F9AA 4ZCSA 2VXOA 2WSIA 3ISJA 1N2IA 1NSYA 3A05A 3OTWA 4CDMA 3D6UA 2H2AA 1I6KA 1TYCA 4ND7A 2Z3VA 2XRYA 1M8PA 2PXHA 4XFJA 4YP6A 4TS1A 1GN8A 2A86A 2X1LA 4L2IA 3RJZA 1JECA 4MW0A 2HZ7A 3FI0A 3PXUA 2QJFA 1JHDA 3ZXSA 1G59A 3CVWA 1TYDE 2B7LA 1N2BA 1KQPA 1BS2A 4HPWA 2Z08A 1Q11A 2QTMA 3IMCA 1KQOA 1VLHA 2VTBB 1G8FA 2QTNA 3AKZA 2IELA 3CLUD 4DNXA 1MAUA 3LE8A 3HV0A 2D13A 3IVCA 1O96A 5DK4A 4I6JA 2YWBA 3FETA 4G5FA 3COZA 3CLRD 3L92A 4NAUA 3AG6A 2D54A 1WY5A 4MW7A 1XNGA 3I05A 1ZH0A 1N2JA 2A7XA 3IUBA 3MXTA 4JFAA 1G8HA 4ZT5A 4DDKA 2J09A 2ZP1A 4KR9A 2I1LA 4MUGA 4KPUA 2QUKA 1J21A 1EE1A 4QRDA 1JIJA 3ILVA 1EFVB 1WXHA 1M8JA 2X3FA 1F7UA 2YXNA 4ARCA 2TS1A 3PRHA 3COYA 1KH3A 2A88A 4ZCRA 1YULA 2GKSA 3PNVA 4YMIA 3SZGA 3CVUA 3P52A 3UK2A 1YUNA 2AG6A 1PFYA 1KH2A 3OP1A 3CVXA 1JZSA 2CSXA 1NUSA 1KKUA 3CR8A 4KR7A 2J07A 4U8HA 1N2EA 1GZUA 5F23A 4YP7A 1O6BA 1QRUA 3RBAA 1O5TA 5DASA 3TZEA 3VU8A 1H3EA 4MW2A 1WJGA 3KFLA 1X8XA 1A8HA 3CVVA 1JEDA 2E89A 1QRSA 5IHXA 1N77A 5TS2A 2DXIA 3CLSD 1MBZA 1OBHA 1VBMA 3MLAA 4MVWA 1NP7A 2J5BA 1OWMA 1J70A 4CQNA 2AKEA 1B6TA 4BWVA 4U63A 3FOCA 1T6XA 2QJOA 3U1VA 3FNRA 1YUMA 3IOBA 1ILEA 4J76A 1EXDA 1V8FA 2IP1A 3FG9A 3N2YA 4EG4A 1YIAA 1NYLA 3M5WA 1QQTA 2CYCA 5TEWA 2A1UA 1FYDA 1Y42X 1K4KA 1M8FA 1PFVA 2D5BA 3PNYA 2DETA 1JMVA 3QE4A 2E0IA 1M1ZA 1ZJWA 1MOPA 4GU5A 4K03A 1OWNA 1MAWA 3D6VA 3SYTA 1U3CA 1N2GA 3IOCA 1LI5A 3ZJTA 3F3MA 3GLVA 3N8HA 3ND5A 1H3FA 3HFJA 2A4MA 3IODA 3P0IA 1XNHA 4HJXA 1JEEA 1IQUA 3CLTC 1KAMA 3IVXA 4H3SA 5HUJA 1WQ3A 1WZ2A 1F4LA 2QUJA 3QTTA 5J5AA 5KHAA 2CFOA 1QTQA 4RPIA 3UMVA 1MRZA 5JBNA 1H1TA 1COZA 2OV4A 4R2MA 3RK0A 1TYAE 4JXXA 3H9CA 3TZLA 1KP3A 1O95C 1ULHA 3FY4A 4L2IB 3ZXIA 3UOWA 2NZ2A 4JXZA 2YWCA 4DE5A 4UZFA 1T6YA 1TEZA 3Q4GA 5J59A 2WQ6A 2WB2A 4E1AA 2DPLA 2PFSA 4XSVA 3RK1A 1R6XA 2QUIA 4F4HA 3ZGZA 2X0KA 2A84A 4MW9A 3ND7A 1I6MA 1G8GA 3H99A 4EGAA 3PNBA 2CV0A 1ZH6A 5DB4A 4ARIA 1OWLA 3G5AA 4MUIA 4WNYA 1IVSA 3DO8A 3IDFA 5H16A 1O96B 4ZCPA 4NAHA 3VRHA 1TFUA 3KT6A 1UFVA 4ZT6A 2HGZA 1FFYA 3MMXA 1N75A 3S3TA 2A1TS 4KPUB 2PZAA 1I6LA 1J1UA 3IVGA 1U0BB 3IMGA 4KKVA 4U7JA 4AQ7A 1I2DA 3LCJA 1T9GR 4MUJA 3UC5A 1M83A 3IUEA 4MVCA 4OJMX 3SZ3A 4EG3A 2EJCA 3RFFA 1X6VA 3HGMA 3JXEA 3CA8A 2CV2A 2CV1A 1N2HA 5FNZA 1JILA 5LFAA 2QJTA 2HMAA 3GMIA 1MB9A 2GOYA 3HMQA 1YI8A 2CT8A 3KT8A 4EG7A 2CYAA 1OWPA 5K0TA 4NDAA 3UY4A 1O94C 3CLTD 3P0JA 3H97A 1LW7A 3FIUA 3H9BA 2YY5A 4UZEA 1GTSA 3H05A 2JA2A 3IH5A 3L93A 1MB2A 1GPMA 1N78A 2DERA 3A4IA 3BL5A 1DNPA 1JIKA 1NUUA 1H3NA 4MW5A 1O95D 1JGTA 1PG2A 4R0NA 1U3DA 2ZUFA 4MUKA 3X1KA 2DLCX 2A1UB 3N05A 4X0EA 1GLNA 4JYZA 1O97C 1T9GS 5TGTA 4A91A 3IOEA 4EG6A 1IRXA 2G36A 1IQRA 3AG5A 5FO0A 4MULA 1IH8A 3SDBA 1WXGA 1GTRA 3QTBA 2PG3A 2OQ2A 1EUYA 3GUZA 4PBSA 5HUHA 3ZJUA 2PZ8A 1NUTA 2BYTA 3FHJA 3CVYA 1VBNA 1U7DA 2AZXA 1KAQA
chains in the Genus database with same CATH superfamily
4MP8A 2ZWVA 1FFCA 2A1TR 1K68A 1B2LA 3B6MA 4QEZA 4KO1S 1Z0DA 3CJRA 4GX1A 2G5TA 4AWXA 2GPSA 4TUUA 3H4VA 1W4LA 3TEMA 1L4GA 4JOQA 2XMZA 3M3PA 3WP0A 3UK6A 3JQRA 1MO5A 3BFPA 1Z73A 2DBVO 5C7OO 3G9XA 2PYIA 4UTOA 1CUFA 2Y3AA 2JF0A 2OCKA 3B1WA 3VO1A 3G6KA 2ZJAA 4DV6B 1TJCA 3LDGA 2HA3A 1NRIA 1DARA 1WS6A 2N1MA 3QF7A 5DI3A 3RFXA 3WWYA 1O6GA 3VUFA 2FHSA 4GUAA 5EXTA 1VYVA 1Z0FA 1G8AA 1L7XA 3UMSA 2X2FA 4FHJA 2HIHA 4IOLA 3GIDA 2P6UA 1DBWA 1K7FB 1KZOA 2IQCA 2C3YA 2AH5A 4CDGA 3GPBA 4QT0A 4IRUA 3EXHB 3DOUA 4C01A 2JIMA 3LP8A 1X77A 4MQFB 4EUFA 3FTYA 2ODBA 2DE0X 4EG8A 2AEMA 3VZPA 3GPDG 2JFXA 3KSMA 3TE7A 1YR9A 2A5EA 2BMDA 4TYQA 3X0DA 3PD0A 3MWJA 4R40A 5EQDA 3BMCA 3IIEA 2VHUA 2Q7XA 1EFAA 3PXGA 3V4PB 3K35A 5ELMA 3NXSA 4R1MA 1N4QA 2GYYA 2YHBA 1SUPA 4GXRA 4GFDA 1VP9A 4H0NA 2I7VA 3ZU2A 4G2NA 2CMGA 2H6FA 1Z0KA 2XYHA 3PUYA 4BVBA 1FYVA 5KWDA 4NR0A 5CRIA 2ZUDA 4L5JA 3UB2A 2WTXA 1XPUA 5TPWB 3HGQA 3OA0A 5JCOC 3G8DA 4MW0A 4QOFA 2PMKA 2ZRNA 2O0KA 1HG2A 1X0VA 3TG5A 2NZXA 2M2IA 2ZWOA 2G09A 2YWFA 1OZGA 3CUKA 3ZE2B 5JXWA 3LJKA 3IXQA 2GCEA 3ZNQA 1U1EA 2VTBB 2R44A 4BFVA 5IKMA 3AHEA 1KE1A 1JQ5A 1Y48E 4K28A 5FA6A 4RCYA 3C5HA 3EEBA 4F91B 5LU8A 3UT8A 1Z0ZA 1T4CB 4H7DA 3FJ1A 1WXHA 5BQ3A 5AD1A 4B46A 3ZBTA 1S9DA 4UBMA 3QC1A 3O83A 4KIJA 4EZIA 2DH5A 4ZOQI 1THMA 1X9GA 2P67A 3QKWA 1EVYA 5FADA 4CV1A 5DASA 1RXIA 4XB2A 4PYQA 2OHHA 2Z56A 4ZYTA 1U2VG 3BERA 3IEVA 4ECEA 1T8YA 1E1CA 2GARA 1DEXA 2XNSA 4INAA 1JHRA 1YUMA 4J76A 1GUDA 3HXMA 4Q03A 4QPPA 3EMVA 5D2CA 3RSHA 3TG4A 3D7KA 3D3WB 1VGRA 1C14A 1LQ2A 1QBGA 4O2RA 3KQPA 4GBGA 3ENNA 5CG1A 2FZWA 3D9NA 2INGX 3K05A 1I2MA 2QDXA 2W2MA 4IJUA 1FS5A 4RJJA 4BNIA 2EX0A 2XVZA 4L9AA 5E2IA 5CVEA 1WBBA 1S02A 1U4SA 1THTA 3BXZA 3EU5A 3WG7E 1FMLA 2CLCX 4AURA 5FZRA 2RJOA 2R11A 1VIVA 4BERA 3C45A 5CDHA 4FN5A 4Y3UA 1M5UA 3HXLA 4B8CB 1IJFA 4EGAA 3I76A 4EHDA 3ABRB 1IY2A 1IC6A 4ALJA 1F0NA 3VRHA 2PMFA 3H8JA 3VPAA 2HO4A 3CX8A 1R4NA 1DG9A 5DHUA 3Q1LA 3SQDA 1H1LA 4MUMA 2C58A 1DXQA 2A2ZA 2B99A 3NRJA 2P2DA 1FRNA 3G79A 4FMBB 3SLGA 1X8KA 3AR9A 3WLQA 4O1OA 1IZ9A 2O2YA 4O1MA 3RVSA 1OWPA 2ZYGA 1X9IA 2HRRA 2CXSA 4P4SB 1BGWA 3ZCVA 2QTTA 2HSDA 3V97A 1N9GB 2BV3A 2J3MA 3PQCA 2VPIA 4ZGGA 2F8MA 3EMKA 1GZ4A 1LDYA 2QHXA 3RSZA 3BQOA 3QYFA 4IDAA 4XI0A 4FDUA 2W2KA 1NZDA 4FHEA 4FOPA 4YRSA 4LXYA 4LHZA 2EP7A 4ZTUB 1CZLA 1N5OX 4JCOA 1BGVA 4C2AA 5LYJF 3OPXA 2ETVA 4MKFA 3WGUA 4UM7A 3I6ZA 3KQHA 2AFHB 3LY5A 3KV3O 3CF4G 3PEFA 4CFYA 3WLLA 3RSCA 4RTJA 3AI2A 2AJCA 3L7CA 1ONNA 3M49A 1IPFA 3M6IA 4ALNA 5EEHA 4DZRA 3RRNB 3PNSA 4Y6PA 2C99A 1QOPB 2LPMA 1PD0A 3WMFA 2H7CA 3LY7A 4U0KA 2YV5A 1BOOA 4W82A 1XAGA 1VSTA 4UI9K 1Q15A 4TX1A 4JAVC 3O2NA 3K1ZA 4JYBA 2XUHA 4Y2QA 1Z6AA 1GDHA 5LB4A 2GCOA 2P6RA 3ZUGA 2MYPA 1TO2E 4F8EA 1YS2X 2PKQO 3ITKA 3LQFA 3PEEA 4J3JA 4PTZA 4JL8A 2HUNA 3APFA 1KR2A 1ZOOA 4R1LA 3X1XA 1A7UA 5SY4A 4JC0A 5BT8A 2C7VA 1JR6A 3T34A 5FOWA 3ABIA 3KP1A 4X3OA 4TGLA 2E5WA 2X3UA 5CFOA 5HS0A 3FBTA 2GW1A 3VBEA 1JG6A 2OAP1 3H3FA 9LDTA 5JDCA 3FRIA 3SZOA 2CDBA 1M8GA 4G41A 3Q7SA 3BJMA 3CR3A 2QTFA 1A8QA 2IHBA 2OOKA 4MV0A 5CT9A 1YS4A 4E5DA 2ZIUB 3MF4A 4KQEA 3GRKA 4PINA 3WV5A 1MUUA 2AJDA 2X8BA 2Q6KA 1D1TA 5L3SB 4DIDA 4APOA 1UBCA 4WCDA 4O4IF 4OJTA 4DEXA 4RDXA 2FSHA 2VC2B 4A5OA 2NIPA 3M6MD 1ZCJA 5FBLB 1TOAA 1CUVA 1M33A 4KXQA 3HADA 2HE0A 3IURA 4JYMA 1LZLA 3GA0A 4DLYA 3UVEA 2WJJA 1QZUA 3QBEA 1RPAA 4CIVA 3Q8KA 1QIEA 3V5NA 4NQ0A 1G4UR 4QHYA 3FHTA 3SFVA 5H81A 3KCQA 2KM4A 4FZ3A 3LXRA 5F12A 1YOVB 3JASB 4NF2A 4RIHA 4KYOB 3IJ5A 2OHFA 1F51E 3CPSA 3CKBA 4RQIA 3DM9B 4NIMA 3KEZA 5H4HA 3NYIA 4MA0A 5J5VA 4BQEA 1UEJA 3U49A 2AG6A 4XLLA 1W49A 3CVXA 1P73A 1W36C 3MTAA 2J07A 2FWPA 1A9OA 2H8KA 1UPAA 2KI5A 1JALA 3L07A 4K0KB 4MW2A 2WWIA 1YQXA 1H2RS 3L6DA 2DXIA 4MVWA 3R24A 4BO9A 4V0RA 1DQRA 1A2OA 1R6DA 2Y66A 2QPLA 4MB0A 3IT1A 3RSSA 5BRNA 4JLMA 1HFJA 4ZEXA 4DQ0A 2XSZA 4DXHA 4RVCA 5KJMA 3FUCA 1WUYA 4CPDA 1O57A 1VL8A 1XTJA 3KOOA 3D1JA 1G60A 4W7IA 3ZGLA 2PLRA 4QQKA 5CNJA 4L51A 4OQ4A 2WYHA 1VE3A 4MTCA 3I37X 1FT1A 1GXSB 1GZSA 1WMBA 3TQTA 4IKEA 3RIYA 9ABPA 3PVLA 1DKLA 1E59A 1U2RA 1YT5A 3KJGA 1UN9A 4HEQA 5TQ2A 1P45A 5H02A 4GGOA 5EXDA 4A1FA 2DHCA 3FNGA 5DWDA 5J4VA 5SV2A 3V8RA 3ZDAA 3Q78A 1BRTA 1JTVA 2CY0A 4KAXA 2A84A 4DMCA 1KARA 4GZLA 3DB1A 3EUAA 4LJ8A 2X2EA 1N33B 2G17A 3L1HA 5LQJA 1DKPA 3ZE0B 3EQ2A 1H2UA 4GF5A 1EI9A 4XDGA 5E2AA 5H82A 1IB0A 1TK9A 2Q46A 2XYGA 3TQHA 1RLJA 2EWWA 3REQA 1Z4OA 1PZHA 1A98A 2GOYA 4OP3A 4B2IA 1QH1A 1FVOA 3H2ZA 4HI8A 2H6GA 5IYZF 4DMKA 5G4LA 2G6TA 3O4FA 4M1MA 3N1UA 4LCJA 5HR5A 1L1QA 5AUNB 3MWDA 4GEGA 4OKSA 3B52X 4B73A 3NIBA 3JQ8B 2Z4TA 3QARA 5K6AA 3ZJUA 4RANA 1UDWA 4A3SA 2H51A 3ZWPA 1OBOA 3J5PA 5GJVC 1D2NA 5IBQA 3CWZA 5DTJA 4RORA 2BFDA 4BQFA 3H9GA 4TMWA 1QFXA 1JJAA 1SXJA 5ADVA 1QV7A 2HQSA 5I9MA 5K05A 4PGHA 1NG1A 1TADA 3OTOB 3KFXA 4I5IA 1XEAA 2ZJ1A 5IKPA 2AR0A 4CCWA 1E6KA 3KV1A 3H1AA 4J7UA 4KTTE 3UX4A 3ZWKA 4U6SA 1W4AA 4YA6A 1EBBA 1HNXB 1DG1G 2YHSA 4MWDA 4ATZD 4CG2A 1DAIA 2OGUA 1BZYA 5IN5A 2DVMA 1TF7A 5I6DA 5KMGA 3CNHA 4MB2A 3FH5A 3QVOA 4CKWA 1TZCA 1YR8A 4FT2A 1RI5A 5L40A 3G0OA 4BJ6A 3WNCA 3ZBQA 1Q0SA 4JBLA 3ZVMA 1YZNA 3EGOA 4DV3B 5EDSA 1UKEA 5KTRA 1MG5A 1Z7GA 4YBRA 4N7JA 2IE8A 1OKKA 3PFHA 1HK7A 4Z68A 4Y6WA 2ZB2A 3QM1A 5EYPB 1MFPA 4FHCA 2Q1YA 3GVCA 2BUAA 2J4CA 4J8SA 3AUUA 5JSZB 4JC5A 3MCTA 1TL7C 4OP2A 3URMA 4MRAA 4HYTA 4URFA 2JH9A 3ZWAA 1Z75A 4UZSA 5AW5A 3PZ2A 3KETA 4RK0A 3OCJA 5CCMA 1U0SY 3ZQJA 2QTHA 3FE2A 1GSHA 4UQZA 4Q1BA 1JHXA 1ZBQA 2EX1A 4KQKA 2P5SA 2XS1A 2LNDA 1Z26A 1PD1A 4K3UA 1H5NA 4NQZA 3HP7A 1QGYA 1NF9A 3PUZA 1IHYA 5HTOA 4XX0A 4A6DA 4G25A 4BGDA 5BWBA 4F8JA 2NV2B 2SICE 1OCCE 3K0EA 2W83A 3NKVA 1NFFA 1QVWA 1V45E 2EZ8A 2Q27A 3VR5A 5A4AA 1LF5A 4Q00A 4Y2HA 1B41A 3SDSA 1WXDA 2HGSA 4XE5A 1ZD4A 3QEAZ 2FV8A 2I7XA 4KIUA 4LV8B 2XCRB 3GCXA 2O4CA 4O4HF 3VFDA 4F38A 3ZQ4A 2OQRA 3RBAA 3KDAA 1X94A 2UUAB 2WHPA 3QKRA 3TRDA 2C4TA 5COQA 2D2XA 1B6TA 2F90A 4FDTA 2BSXA 1V4BA 4GSLA 4N9QA 2OB2A 4JJIA 3V79K 3RGWS 2G72A 2GAIA 1P44A 1GG5A 1UC5B 3DTVD 2G71A 1KJQA 4DC1A 1XA4A 3HY3A 3EASA 2PQ2A 3K72B 5LP6C 2ZPTX 3C7CB 3VSBA 3HCAA 3QU2A 4KQXA 1Z83A 4KQMA 1UJKA 2ZU6B 1MLDA 2O06A 3FLBA 2Q3MA 4B7CA 2QN9A 5DEIA 2NO9A 3ECAA 3N0WA 2Q5IA 3WLJA 1BH6A 3ZXIA 4DWVA 4KK3A 1NT2A 1MOQA 5JZSA 4TQGA 2OV1A 1TJNA 5D1NA 2QL5A 2RKOA 3W3AD 4K05A 3U26A 3THXB 5IC5A 3BWYA 3KT6A 3E9YA 4XYLA 1BJTA 2EDCA 2WPDD 4M7PA 4D9IA 5BO5A 2FP4A 3KJQA 3F8SA 1XRNA 1J0AA 3HRKA 3DVRX 4ZOEA 3EK2A 2QRJA 4UEKA 3UT0A 1CUEA 4Q7QA 5EQTA 1IWOA 1VL5A 5K4GA 1S8FA 1HDZA 3CH7A 1FMTA 1RHRA 3HCRA 3JWHA 4I14A 3R3SA 2CUKA 2EIXA 3U4DA 3TO5A 4UNRA 4IIEA 5JNSA 1B43A 4BLRA 3U7RA 2OCXA 2Y0EA 4TS4A 4PSCA 1JIKA 5JWRA 1KEPA 2R8BA 1DG3A 1W0CA 1FFEA 4LX0A 3RJ9A 4D82A 1XTRA 2MRIA 3QEBZ 3UAOA 3NOVA 4G23A 3AV0B 1OCRE 4AWBA 3EF3A 4DA9A 1T8PA 2VAPA 1QU2A 2D2VA 2VRCA 3R9WA 3WQRA 3DEFA 1Q14A 2B1IA 1BVHA 3HVUA 3VYWA 4RY0A 4A1OA 3ADKA 2PWPA 4KPYA 1NJSA 4C3VA 4YYZA 3HG0D 1Q2UA 1GWNA 4ETNA 4A0SA 2CLMB 3DE4X 4URKA 4GNKA 4D9HA 3DL0A 4X65B 1AS3A 1J8YF 2V0CA 4KZ0A 2WAYA 2IW3A 2UKDA 4HQRA 4EYQA 1Z4QA 2C8KA 2OCPA 3CX3A 1M5RA 3OQIB 4PZAA 4LMRA 1ECGA 5E6UB 4WTOA 4D98A 1W0KA 4V3BA 4RV5A 1SFRA 1ND6A 3EY9A 4KMSA 1PGQA 4MDEA 3TW4A 4MCAA 1OFUX 3IPRA 1E9FA 3A1NA 2W8BB 1S7CA 3C6ZA 4HNQA 1DDGA 3VU3A 1SQ5A 3BDVA 3CWQA 4D99A 5AVKA 4TTIA 4JKYA 2C77A 1EX9A 5K8UA 3R3XA 1TW2A 2I9KA 2J6IA 1Y6ZA 1Y89A 3AV3A 3HUUA 3SGLA 4DAOA 3DMNA 4AEZC 1QVVA 4QXMA 5I7AA 4O1IA 1S70B 4Y7CA 3UA4A 3ZQKA 2IKSA 3DFFA 3OIGA 2XRZA 1VI6A 4LMBA 1O9BA 5E2BA 3HKEA 3X1ZA 3IP7A 3CUWA 2C5GA 4LKOA 3L8CA 4AG6A 2PXHA 2ZQ5A 4D3DA 3EQ9A 2VWHA 4IS2A 3K70B 1RPTA 1S01A 2YZNA 1UAYA 2CEAA 4LGYA 1X86B 1UJ4A 4BUJA 3U4QB 4EWLA 1V54E 1K6XA 2V7PA 3B7PA 2ERYA 5LP0A 3GJQA 1E8WA 1HRKA 2XA2A 4GE0A 3ZXXA 2ECFA 4E12A 3IR7A 1OC2A 4WOKA 3H5LA 1UK7A 3G0IA 3LCAA 4CMEC 3KE8A 5LUBA 3LL7A 4PLTA 3RFUA 1JZSA 3WB0A 4AJJA 1KEWA 1GGFA 1SGWA 1NX6A 2RGXA 2XTNA 4DA4A 2N0SA 3BQMB 2VPWA 1N6RA 5HA5A 3M6FA 3S81A 3S8EA 5GZ1A 2R8XA 1C2YA 3MJRA 3MTEA 4I5FA 4GC5A 2WXOA 1PUJA 2XB6A 4MGKR 3OTIA 3JYLA 3D0KA 2I1VB 1U3CA 2ZTUA 3IOCA 3UT6A 4NURA 1TM2A 1X7HA 3VTYA 2X5NA 2W98A 2BIFA 4JENA 3H0EA 1GCAA 1CUBA 2B8TA 4WFIA 1II8A 3RRYA 2QN8A 4ZQHA 3VU9A 4HAZA 4ZYLA 2M32A 3H1GA 5FLEX 4FLFA 4DMRA 3FEXA 3BDIA 2VGEA 3U3XA 5C37A 3A6KA 1N5KA 3DEIA 4JHRA 3KYDB 4MUIA 3VAZA 2F8LA 1WUTA 4O4LB 4MLZA 4PZLA 1IXVA 1RFGE 1UBFA 2OM2A 3HLYA 2QUBA 4XIIA 1V7PC 3FGNA 5JEEA 5IW8A 4OLJA 5K01A 3BMQA 1M83A 2UUOA 5B57C 4Q0MA 1RKXA 1IOWA 1B15A 2V7WA 4AKSA 2V5UA 3S2ZA 3L4BA 3DSWA 2CVPA 1JFLA 3H1PA 5E1BA 1UAAA 5M29A 4PQFA 5CRUA 1E1KA 4M1SA 5LP1A 3DYBA 2KB0A 1RQ2A 1PZXA 4YUAA 1O97C 2VK1A 3DD1A 3CCCA 3PUIA 1WM1A 1T5TA 5D8DA 3ZDQA 1J0BA 1E89A 4J8FA 4ALMA 4WSOA 3CNLA 3AYXB 1FNBA 1YQGA 4JHXA 2V1XA 3VH3A 4LBZA 3DBRA 5LXTB 5HKLA 5IVPA 5LVAA 4HNAA 4EFDA 3ACBA 4LIPD 3B7RL 5IX8A 4X7RA 5CA1A 3F9IA 1K8QA 4KIGA 3OCWA 1VCMA 1ACLA 3TH5A 1VPVA 2O7NA 1RJ9A 4HQNA 4PW0A 3QRWA 4ENWA 2UUPA 3ZJYA 5CM8B 1U2QA 4TOIA 3PE3A 5H70A 2ODPA 3BILA 1ABEA 2QM0A 1PL7A 1E1MA 2RARA 5DYWA 4E09A 2HOQA 2WXLA 2EQBA 4OGGA 4YALA 1F5SA 3PZ3A 4TUYB 4QUKA 2VQ3A 2HK6A 4K6FA 4GI2A 4GLFA 2JAUA 3W7VA 4X64B 3AO0B 1ZESA 5EE5B 1OH8A 2WG1A 4WK6A 3UKDA 2IEIA 4UAUA 4ARVA 4AKGA 2EGHA 2EIME 3AX6A 6CHYA 4CKBA 2EIJE 2YXLA 5FI3A 4AY6A 4R2HA 4RIEA 4EY6A 4MRMA 3JALB 3B7BA 1K1AA 1Y7LA 2VPYA 2IY0C 3BE4A 3Q2OA 5F76A 4HMOA 4RAQA 3ANLA 4G65A 4C4ZA 2W0MA 3PF9A 3KQQA 1YQTA 4HFNA 1IHGA 4E85A 3MRSA 3UHPA 3E5NA 3IO3A 5CVVA 3LHIA 1O5OA 3R8CA 2PU5A 1LLCA 1KK2A 4PNPA 3I5AA 5CD1A 2B20A 1DWPA 4JSRA 5AXCA 2Q62A 4YP6A 4RZHA 3PT9A 1EINA 1PV2A 2P62A 5WRFA 3PE4A 1MMFB 3EW7A 1ZNQO 3PUJA 4R9NA 1NVDA 2F1HA 1ESEA 3IV6A 3SM9A 1N8SA 4MJ7A 4QDZA 4JP8A 4REMA 4E30A 5KREA 2JFHA 3S99A 1OLUA 3ZK8A 4B3XA 3FTUA 1CP3A 4R1TA 3TTWA 1ODSA 1C9JA 4D26A 3CV0A 2OESA 4XX1A 4LG1A 4AT1A 3CVUA 3W9GA 2AX4A 3D8BA 3AW8A 1XCGB 4C78A 1TFRA 4YLYA 2QP3A 5DHSA 2FO1E 3RS3A 3FKQA 5I8PA 1ZISA 5EZYB 2AKEA 5C5IA 4LS3A 5BW8A 5KC9A 1KKLA 4H0FA 2GZ1A 3D5QA 3QLUC 3C4QA 4N8SA 5D3QA 1TC2A 1M1ZA 1K7CA 3T5TA 1VMEA 2NGRA 1OWNA 2J9GA 2VGXA 3WB2A 2P30A 3RSLA 5FHRA 3JQGA 1E0AA 1WXQA 5D87A 1U3TA 2O1EA 1T0IA 2F1JA 5EIDA 2RBGA 3N87A 4B4DA 1Q1ZA 2PUTA 3VR3A 3KCNA 4HTFB 1ODKA 3PB3A 2XE6A 3OIUA 2IS4A 4I1SA 1HE1C 4MMYB 3LUGA 4P3KA 3DJYA 3WL5A 3V8BA 5FWYB 4F92B 5AM5A 4EJSB 5KYYB 4XLTA 3ORRA 2VA9A 1ORVA 3CPJB 4WECA 3PUVA 2RHDA 4MYDA 4YCAA 2WYVA 4X8LA 5IF3A 1KZ9A 2JCBA 2IUFA 3SVZA 2RC6A 3IH5A 1BKDR 2EV9A 2VF2A 5FOXA 3T99A 1VLLA 3P96A 3WDSA 1VL6A 4KZCA 1JGTA 1XXHA 2NYRA 3LZCA 4LEUA 2MSDB 4PZPA 1WXWA 2XX3A 4H4EA 4TVBA 2XNHA 2BGTA 1I24A 3TX2A 3A9CA 1HQYE 3FHJA 4L1BA 1QVZA 4NCBA 1Y1QA 4NYJQ 2WNHA 4NZPA 1TX4B 1WEHA 1R64A 2D1FA 2MWMA 3MCAA 5JU6A 5F98A 5FP0A 3NBYC 1UXHA 1T43A 2VJPA 2RGYA 4OXKA 5JG7A 2QV7A 4NZZA 3V4RA 4M0DA 5KYKA 2H6EA 2O20A 4HWOA 4F72A 4R9SA 3GW8A 5L6MB 4KQCA 2Z5GA 4NFSA 1EG7A 2FLVA 5F5XA 1A1SA 1KNQA 1XQ6A 1OCOE 1ZB1A 2ZUUA 5FYDA 4ZO4A 1RYNA 1LY1A 2NACA 2ORVA 2XE8A 2JCXA 3BH6A 3MV3B 4KYUA 4UM9D 1DJNA 1PU2A 5K03A 1F12A 3ZW7A 2E48A 2OAEA 2FUKA 2IFTA 3FTFA 1NNLA 4QNMA 2XPIA 2QRUA 3SPXA 1Z0JA 3JR3A 2P2YA 1J8QA 1SKQA 1CB0A 3PWKA 2ZFUA 2WMYA 5JBQA 1I3KA 1CQZA 4D4KA 1LW6E 4CTJA 2WKRA 2XWJI 4M55A 2QX7A 3U4IA 1E79D 3DE6X 5AM0A 2D1TA 3WHKA 4UFOA 5ALRA 3WJ2A 5SY9A 1C7JA 1K8XB 4X66B 4U7TB 4J0IA 5BNFA 2GEUA 1U7TA 3UQZA 3H2JA 2OENG 5G02A 3EGEA 5IF9A 4F7AA 4KLAA 5FQOA 5DNCA 3LNCA 4B7UA 2B7LA 3JAMA 3C3EA 2O50A 1Z4PX 4DARA 3VH2A 4WNGA 2D13A 2ROQA 3KL2A 1XMIA 1F0KA 2I2XB 4II2A 4II3A 2VG8A 3BKXA 1PL0A 3SU8A 4ZJUA 2QMZA 3SO8A 2YXNA 4DRXE 3R5XA 4HQDA 1ORDA 5FBZA 4H18A 3P52A 1FL9A 1KH2A 3C3YA 3VR2A 5HFJA 1CJVC 1N7HA 4M0LA 3FYSA 5BN3A 4JHLA 3BXOA 1A95A 2OV6A 1EP3B 4YJ2B 3JUEA 4WCFB 2ECOA 3A2LA 3MKQA 3UV3A 2BE7A 3JVUA 1ELWA 4NEHB 3LUKA 1Y42X 2FEPA 2AIRA 1K4KA 3AEYA 1T36B 1V1MB 2W7TA 2FZVA 4G5RA 5G04J 5IZ4A 1DCTA 3A7DA 3AR8A 2ZBPA 3KC2A 2BE9A 5CP8A 1C80A 2E1PA 1RXCA 4HB3A 4M7RA 2AHRA 1A4RA 3V4ZA 3HXTA 5DV9A 1G63A 2R6GA 2VHXA 5L3QB 4B4KA 1WSDA 2J9ZB 3FCOA 5EAIA 1IVSA 2H4YA 5JTTA 2YZKA 3JYQA 4AF6A 2P91A 4BKOA 3FUWA 2PSSA 4OHOA 3E1KA 2QVXX 2E9SA 3KAKA 3CUYA 4FB5A 3WRXC 2HRZA 4ZXFA 1IJEA 4OQNA 4I4TB 3E9QA 2PM6A 4GPTA 4RTRA 2WT4A 4IX1A 2EYQA 5K3EA 2Q6VA 4IF4A 4RHTA 1QGAA 2V9CA 1RADA 2BFNA 3UB3A 1PAUA 4MRNA 4BAGA 1AQLA 1I2CA 3C48A 4LWOA 2Q3LA 1NWHA 2RSLA 2GF9A 3ZI0A 2VJKA 2R6HA 3OESA 3AJIA 1II0A 1F8YA 4OSEA 2ZUWA 3D64A 4CQMD 4ENTA 4YUWA 5JTUA 5TLSA 2Y4TA 4GPBA 1ZQ9A 4WXHA 3FNIA 3LRPA 4HVLA 3KOUA 1JQ3A 1O08A 2ZSAA 4LDJA 3OF3A 3SIWA 3AHDA 4FBMA 3P26A 1PR9A 3QBVA 2GMWA 3L08A 3O3MB 1TU3A 2XMGA 3KOZA 2J3EA 4JGIA 4I2ZA 2IXTA 3E7FA 3ASVA 3UO8B 3CZAA 4RM3A 3DZCA 4J4BA 4LRZA 5EIBE 1I4OA 1LJLA 2P1ZA 3JR7A 1JSLA 5DEOA 3B38A 1O0BA 5I48A 5A3VA 4ABTA 2CMKA 4ZGWA 1ZKDA 3Q12A 1OYVA 4R3WA 4XIGS 4HPXB 3DMDA 2PXAA 4JI1B 3KQUA 3L8EA 2WUGA 1V5FA 4K2HA 1HV8A 3TRFA 1KZ4A 5JY6A 1U0HC 1NSFA 3ZCPA 1XI2A 3K32A 2TRSB 3QVMA 1NSTA 1HGXA 2O54A 4RSGA 3MJWA 1VYHA 1LEHA 3VYSB 2ONKA 3QKUA 2XTMA 1WTAA 3ND8A 1JR3E 4QREA 3IBSA 5CXXA 2Z0MA 4UI9C 1NURA 2YV1A 1LS1A 1UKAA 4YJ3A 5AQ7A 1RRKA 2E6UX 3C1UA 3P9SA 1GPAA 2YR0A 2WMOA 3I92A 3GJ6A 2PWAA 2Y0CA 5HRUA 1FUYB 4R98A 3DAOA 4GUDA 1PX0A 5KKCA 2VDJA 2UV8A 1BVUA 4E4RA 3HQ4O 4EARA 3HC7A 5JO0A 3D8NA 1H8ED 4XGIA 4UAJA 4ISCA 4PLVA 3UWSA 2JLAA 2I6QA 1HORA 2FPRA 5TGZA 1ZN9A 1Q11A 4QGAA 1XRLA 4WLNA 1G6KA 4YGXB 4F3NA 4QBHA 2DECA 1GNQA 4H7IA 4XFKA 3H5AA 4I50A 4BTVA 2HJ9A 5G1OA 3ABLE 4ZMSA 1IN4A 3TSYA 3IPAA 1L1RA 3TQQA 2K6GA 1QRUA 4M3NA 1FPQA 5CT8A 2Q9UA 1A5TA 3SXPA 3WADA 3DYVA 4Y2GA 1RHJA 4QTYA 1YV9A 3NANA 3HN6A 4KPFC 4LVOA 2P11A 1ILEA 2NAPA 2QTCA 2DSTA 1VE5A 2WDPA 3ZWMA 5MHTA 4PLGA 3X44A 4ERXA 4RQBA 4G1BA 5B37A 1YBVA 2GESA 2AI1A 4FX5A 5JDCC 5IMBA 2PGOA 2CGEA 2G4VA 3E18A 3TR0A 1E9BA 4D10C 3SQXA 5B2EA 3P9CA 5DM70 2GBPA 1DAKA 1LD8A 1P0CA 1OXXK 1RU3A 3NDIA 1ZD9A 2ZBDA 2AD5A 3CZQA 3KXKA 4LWZA 1SOAA 1CBUA 3Q7IA 1QB8A 4E7OA 1FMFA 1KO4A 2C07A 5IDWA 1Y5LA 4TRRA 3DTTA 1U90A 4AJIA 4PZEA 3CVLA 3MMXA 5C1DA 3A9VA 1E2NA 4TL7A 4CV2A 4F11A 1T2DA 4CYMA 1Y8QA 3E23A 5ER6A 4Y6QA 3TPCA 4WADA 3EVBA 1NOKA 1NJ2A 2I6FA 4G09A 1FFXB 1UBEA 5DSTA 3M6AA 3W5HA 4K1XA 3BQNB 3BUSA 2HHHB 5JFOA 5B7GA 2XYPA 4RG6A 3ZI7A 1N78A 1EHCA 3I0ZA 2PJDA 3IQWA 4GVXA 3L1JA 4QAQA 4OOEA 1MZCA 4A82A 5IHPA 3X1KA 1IYZA 3OHMA 4X0EA 1VTKA 1ANKA 1JKXA 4KAFA 1IM2A 1EYZA 2JLSA 2AKAB 2V6BA 5AUQA 5EHIA 5FTWA 1KMQA 4WJLA 1EDUA 4AIRA 3MT9A 2OOSA 5EUQB 3O4GA 4QLOA 4ETWA 2ZIVB 1RWOA 1OFUA 3AERB 1DQNA 1XNQB 3FIJA 3NM5A 4OL0A 3QPCA 5F77A 5JYBA 2ZW9A 3WI7A 4B3DA 1JXOA 1OTHA 5L7WA 5BXYA 2BFWA 1Y9DA 1KMHB 4IQGA 4S1PA 5J1TB 3GFRA 2ZDGA 4BBZA 3ZWNA 1AQIA 4AZ3B 1M2VB 4AG5A 3F5MA 3M81A 3K2QA 4RSHA 4CVNA 1TU4A 3UWKA 4FCWA 2WKPA 2QOEA 2P0YA 3PWZA 4QQ8A 4P0PB 2H85A 3HWWA 5DT2A 1FJXA 4EBBA 4BUCA 2P9UG 5EJEA 4P3XA 4LHEA 1Z7EA 4XB1A 1D3AA 3MHPA 4WW0A 4BE7B 5J2TA 4MIKA 3SF4A 1QRAA 1GGNA 4PLFA 3C1AA 1T6BY 4HOUA 5ALDA 3WGJA 2WQ7A 2G28A 1M2KA 3VNAA 2BMAA 4YN3A 4DC9A 5K6AC 3AMVA 1XV5A 4ZXPA 1IK6A 1SCUB 3BWEA 4EJ0A 4ZCLA 2FSSA 1XRPA 5BR7A 4CIAA 3O4VA 2WSSA 1SXJC 1XNFA 2DCMA 3C5WP 3NGXA 3FU5A 1CQWA 1LTXA 2H1SA 2W90A 5CHEE 4KGVA 4F86A 3QITA 4HVTA 3C15C 4N39A 4P22A 2EFHB 1TLLA 3PHGA 2IE0A 1VKOA 4N8EA 1X1SA 2V3VA 1G16A 5JNUA 5JRDS 3L06A 1RPJA 3R76A 3U19A 3M89A 1XAHA 5AH0A 5CECB 4DGSA 2W6OA 1ICEA 3ZEAA 3HKDB 1R4MA 4LF9B 3QELA 1ENOA 4ZI3A 3LG2A 2IHNA 2C57A 5IJAA 3KSUA 4OK5A 1QS0B 5F23A 3M0EA 3RRBA 1AQNA 1XLVA 1N6IA 2WFZA 3NAZA 5KUTA 3H83A 3AFOA 4UQPA 5FTKA 3HXKA 5C3UA 4WN9A 3WLAA 3EFOB 4PO3X 3V80A 3HR7A 2ZI3A 4D4IA 5AP9A 4FUQA 4D4MA 4ZFHA 3U3MA 4UUBA 4EUSA 1G19A 5AKGA 3HYTA 3SYNA 3ND5A 4QU8A 2BR4A 3B3FA 4O2LA 2VH2A 2C3MA 4ANUA 4Y9SA 2PR2A 1U1FA 2B7BA 1ZDMA 4P3PA 2HA7A 3HDYA 4P7BA 1BI8B 3RJMA 2I4TA 5DBOA 1SIOA 3HNPA 5DP1A 3O0DA 1GD1O 4QJ4A 4WOCA 4X6YA 3PNBA 4URXR 1V11B 2PA0A 3Q7QA 3LCMA 4U39A 5D51S 1VA4A 4IIJB 2VNIA 5DTRA 3SZ3A 3C72A 1GRQA 1MPTA 2CNWD 1NRWA 4P54A 3FB4A 2RK4A 4KODA 1FMCA 3ORYA 4D4GA 2RONA 3ED5A 3IAM1 2RI1A 3DC2A 2FF4A 1JWGA 4RMJA 2YIMA 1YRYE 1US8B 1LDMA 4WCVA 5F5LA 5JLAA 3GYGA 1A04A 3EAFA 5FWDA 4AMBA 1O95D 1XN1A 2R62A 3NTRA 3IR5A 2QQ5A 5AI0A 4MUKA 3S1SA 4HF7A 3PD1A 1E5LA 5AI6A 5TGTA 3N7TA 3BFVA 5M72A 1RIIA 2OQ2A 1TUIA 1UXJA 1PQUA 3SOPA 5ABPA 4D4LA 2P6PA 5AQEA 3LUHA 4E2WA 1PG5A 1CUXA 1EDDA 1Q1GA 4LY6A 2VPQA 3PSAA 1EFTA 3QVVA 2YJTD 4FS3A 1W5BA 3AM4A 5DMXA 4JLNA 1M2GA 4YRFA 1CQIB 5BOSB 4MAAA 3ZHEA 3LZ6A 5J90A 2QE7D 4EB8A 4Y6LA 3H11B 1PR2A 2P2LA 1G3IA 4F3KA 1YB5A 3F71A 3GYBA 1DKMA 3T4XA 1JIVA 3LPCA 3QWHA 3RUEA 2PD3A 4WXRA 3NAMA 3QA9A 1EEXB 3ZR4B 2ZXEA 1EFRD 1L5RA 3FPFA 4YCSA 1HEUA 5EIAA 1AWCB 2C59A 4LXHA 1KAEA 4PF1A 5JASA 3FP3A 2YUTA 2PUJA 3P2OA 5JCZA 1SZPA 4OAPA 4YIKA 5CXSA 2AFIB 4EBAG 1C3XA 3OQ6A 4QFDA 1V3VA 2BKAA 4R8SA 4NCAA 4B5KA 3W2HA 4MI1A 5ALIA 5GGXA 2OFOA 1G7SA 1YA4A 4DZZA 3WBBA 2DBAA 3KUCA 1C81A 1XA3A 2C4MA 5MGNA 5EWLB 4HMQA 1JAHA 3LQ2A 3RIHA 1Z38A 3PD7A 5HUQA 2W8ZA 4L8VA 2BR3A 4CHGA 5IEBA 3VZQA 1M34A 4XUCA 5DYYA 3PEYA 1J33A 3ED1A 2JIRA 4B31A 5I7SA 2PH7A 2KMLA 4BO1A 2I6XA 1XZEA 4HS4A 4QUAA 4I1YA 3WLEA 3GLFB 3NIWA 3JSXA 5IJ0A 1NMQA 1ZOPA 4OGWA 4Q69A 3IKJA 4UE2A 4DYVA 4IGFA 1TYCA 4D92A 5G05J 1YMUA 1QZXA 4BXOA 1XAIA 3CUEF 4DLTA 1QYXA 2RK3A 3CVWA 2XQGA 3H17A 1AO3A 4RACA 3Q5MA 3ZEIA 3OJ0A 1SHUX 2JLCA 3UXYA 3B1FA 2AJBA 3OFND 4I9CA 3NT5A 2I1LA 1NNEA 2PZGA 2L0TB 1VKHA 3FUKA 5KHOC 3HJUA 5EP2A 4B82A 4CMHA 3OFJA 3Q7TA 2JJMA 3D8UA 4ZGBA 4X1KB 3CRNA 1HNZB 4XWKA 3J81A 2H6HA 3QOYA 1E4YA 5G3YA 1CUGA 1GUYA 3QQ5A 4GPEA 5IS2A 3U56A 4HH0A 2J1LA 3PRYA 3U16A 4ED9A 2O2HA 4DUGA 2II6A 4AN1A 5CUQA 3RJ5A 2Z83A 1IXYA 3ZVRA 4NJMB 1YS9A 3FOWA 3PNYA 5J08A 3ZU4A 1HH8A 1MKYA 2R8ZA 5G3ZA 3OJLA 4D2IA 2YXBA 2CXTA 3K8OE 2ZGVA 3E9NA 1P9LA 2MYNA 1CNMA 1H3FA 1T2FA 3P0IA 3A6EA 2JBAB 4ZCMA 1QCCA 1QO9A 3T7IA 4CZ2A 4O2BA 3N8GA 3RK0A 1JDJA 2YQZA 2L82A 5K8IA 2XIQA 1L4YA 3OURA 2G63A 3BWMA 5BV8A 4EI2A 2J6BA 3MCVA 2X0JA 1NI3A 4PC3A 3LQYA 1GNTA 1G20B 4G8KA 1ADFA 3FUIA 2HLHA 5AJDA 4K5QA 1JQJC 4QUJA 1O96B 3EGCA 3SI5A 2CZQA 2VK4A 5ALUA 2OVBA 1UDRA 1D07A 3EQZA 4M0FA 1QV6A 1KWGA 1T9GR 1TNUA 2QF7A 3OHSX 3PENA 5KYWB 4AJOA 5LFAA 4EHIA 4GZDA 3LCRA 1JDZA 5JH7A 5KX5A 1YC5A 1YA0A 3LUBA 1ZGAA 2IFUA 2H16A 3DE7X 3DWIA 3UXGA 1Q0PA 3E3OA 4MV3A 3GO4A 4HH3C 4WZBE 3TI9A 1W581 4TSRA 5C81A 4M9QA 5ALWA 1HX8A 3PDNA 2D5CA 1YFKA 5GADl 2CD7A 1ZNZA 4B8YA 4YXWA 2PUEA 2A5JA 3PNLA 2AZXA 1KAQA 5K3OA 3UKUG 3CE6A 4QEKA 4RD3A 4MIYA 2QVZX 1IDOA 2MSNA 3AI3A 3DB2A 3LK6A 5L4LA 4PG5A 4N3AA 4GQAA 4MPDA 5DZSA 1PFUA 3QENA 2C7QA 1Y9EA 2FRDC 4DTIA 3GJ5A 4JEIA 3MAJA 1O6ZA 4DSZA 1NI4A 2DBRA 2A57A 4EUKA 5KWEA 2QAGA 5JNWA 2PFGA 3R5JA 4K9KA 1N1DA 1X92A 3EEIA 3SNXA 3OMXA 1Z6PA 5DM4A 2WRZA 2RIPA 3U7QA 4CNQA 3EC7A 1QH9A 5BXQC 3L4BC 5LLDA 5T4BA 4BO6A 2BC9A 3NBAA 1KSJA 3QUSA 4GPD1 1WAMA 1T6NA 1W4BA 3RYCA 5ALFA 3K6SA 5KVVA 3TUZC 3DL2A 3FFWA 4B0PA 1MJFA 3ZIUA 1E4EA 1FP7A 1DKRA 1K3UB 2JAHA 4TWZA 3GYZA 2JGAA 3CMMA 2VP5A 4E7PA 1ZU4A 1NUPA 1G4AE 1WB6A 2IUYA 1C8KA 2CJXA 2UZ1B 1GPKA 3WGKA 2CFSA 5LWQA 3OZ7A 4Y1FA 3HB5X 2PYDA 3F49S 2ISSD 3ZY5A 4WDRA 4KMMA 1N6KA 4TL6A 3UTMA 4ENSA 1YA6A 5IVIA 3H1BA 4G3XA 2Q5FA 5AICA 5DM60 3FUEA 4W1PA 1ZM3A 4YPFA 1H4TA 1E1YA 1Q7EA 4WGGA 1E3SA 1AHHA 1CUSA 1HBJA 1XJ0A 4ZQEA 1RPNA 1MAUA 3OY7A 3Q3CA 4UFNA 4F60A 3I73A 3SYMA 2XOXA 2FE4A 3QBTA 1I9GA 5CHYA 1U98A 2BPOA 3HBNA 3QK7A 1ZONA 5EX3A 1Y4SA 4ATGA 2G5PA 1PT5A 1K86A 3IUMA 5IUJC 3Q0EA 4D9BA 2OFFA 4KH0A 5J9FA 4AROA 5EE0A 3UCXA 1YR1A 3WSWA 2OHIA 3LYHA 1KHHA 1LX6A 1SO8A 1DBIA 3SJZA 3SJ7A 4L28A 5BUZA 4JHJA 2I33A 3IV0A 4IL5A 1DTSA 2R97A 3FCEA 1A72A 3OAWA 4CLRB 2VJAA 1PJRA 3PA8A 3O2QB 1MAWA 3GFVA 1IVNA 4DQLA 4ZKEA 5A4IS 2GKOA 1E9VA 4AJ2A 4HWSA 1NVGA 1SBZA 3AW9A 1FU4A 4MGHA 3GNTA 3O4RA 5EQFA 4LXTA 1MIOA 3TW6A 4M1TA 3URKA 3MD0A 3FPKA 3TGOA 1ZO8A 3QV2A 1DAOA 4XWAA 2NTEA 1AKYA 4PPYA 1HTWA 1K06A 5BN5A 2J9FA 2JABA 2Z1NA 1CS0B 7YASA 2QS9A 1HETA 1RHMA 4KFSA 4G1EB 1KAOA 4QYSA 4AJ9A 1F3LA 3NVKI 1UFVA 1T0UA 3VTKA 3ZQ6A 1YCGA 4I9HA 2YVKA 4X1YA 3M1AA 3KYJB 2PUBA 4D6XA 2XT6A 2IXFA 3O8CA 3G89A 2FW7A 3T1HB 2FZEA 1TLFA 1WP9A 4ASUD 3H97A 5GIPE 3FIUA 2OV2A 3N7UA 1A9QA 1QCZA 3ZXUB 1V1JA 2WUWE 3UUFA 3AL2A 2GPWA 1H3NA 1EMDA 2KSQA 2EHJA 5CH8A 1VI5A 5CG2A 1OU4A 2X8LA 5F7ZA 3EARA 3KXPA 4MWOA 1K5PA 4ZZIA 3AR7A 4P7FA 4JBNA 3IUPA 1IQRA 3T3DA 2ZBQA 1QDUA 2CFCA 3ENWA 4TLMB 1LPAB 4TKUB 3SQVA 2IYTA 2CL7X 3E84A 2H5IA 4C76A 4Q9DA 3RC1A 4L7QA 2QP9X 4ARZA 1NXVA 4I66A 4MHOA 1DEHA 1UBMS 4ZRNA 3OQ1A 5LOZA 5LBIA 4HADA 4B75A 5EEGA 3DPIA 1JMKC 2H3EA 1DMSA 1O0CA 3CW2A 4NEGA 3P4YA 4K0RA 3AIIA 3IUJA 4QYXA 1NBIA 1XK7A 1EFPB 3C6QA 3MS2A 3I01A 1N4DA 4EPYA 2WM8A 4QQRA 1PG0A 2GF2A 2B37A 2F2TA 3QVGB 1YD7A 1ZUNB 2EDAA 3MGGA 3UMJA 1YDMA 4U0JA 2DFTA 3LX5A 1WXEA 3OT1A 4EYEA 3GLGB 3K9NA 2JLRA 1JT9A 5B6JA 1YRLA 2J3IA 1HKUA 4YAKA 2HA5A 2XUKA 1Q6ZA 2XBMA 2PWBA 1IQ0A 4R2IA 4DM4A 2XQFA 1SCJA 1MC4A 1SZJG 3K9BA 2O8EA 3CXRA 1ZW1A 1JU4A 4HEA1 2V96A 4BNJA 5IRCD 3FCUB 1RP1A 3L1IA 2MR5A 3I8SA 2PS0A 2QZZA 3CLRC 4OMUA 1SQMA 4UNIA 4JY7A 3KALA 5L53A 2BD0A 3IMKA 2VSQA 3ILSA 4NARA 1AE1A 2PRKA 3WJ7A 1PW5A 4WZAB 1QHGA 3FH8A 4PAOA 2H2HA 2B2NA 2FPPB 1QUEA 1L5GB 3MEQA 5KJFA 2ZIXB 2AEJA 3OEEA 4BV3A 3CJQA 4RY9A 4RTNA 4DXAA 3A1SA 2R96A 1QIDA 1XPJA 5K0EA 1DV2A 5IAAA 5HDBB 5TQVA 5E1DA 4ZO9A 3TXNA 1RBZA 5JPIA 4LHXA 4E13A 4B3FX 5AOVA 4XJXA 4JT2A 4XEHA 1E9SA 2CHZA 1DRUA 3D4LA 1G9TA 3COYA 1G9XA 5TX7A 3FRHA 4XCXA 1PK7A 4BJ3A 2ID7A 2B4QA 1KKUA 3CR8A 6GPBA 1YBAA 4BO3A 5F9FA 1SWWA 3FDZA 2GN9A 3NHLA 3Q79A 1KYQA 1A97A 3FJYA 3ZU5A 4S1WA 2NTJA 1C30A 1ITZA 3LRTA 2Y1GA 1M1NA 4ZDJA 2DPGA 1MX6A 5DLYA 5FJJA 2X2OA 2C4NA 4D6PA 4E5KA 2HUPA 4I1MA 2C97A 4KK4A 5LNK6 2HA2A 1F8GA 3ZI4A 3H42B 2ASEA 2YVAA 4JZKA 1QAOA 1B26A 1FBTA 1UBRS 1MQ8B 5JS1A 4J3NA 4YDYA 4IEEA 1L7AA 4YUXA 4DSOA 5KOJB 4FLEA 4RZUA 1TUBA 5ALMA 1Z6TA 5BWMA 1HU3A 3GQBB 4NFLA 1KQGA 3IKOB 1V7CA 4ARIA 3NBQA 1EK0A 1GARA 5I9TA 4JS0A 3I8XA 1VJGA 4ZCPA 2A0XA 3DEPA 4A6EA 2OGZA 3BGVA 4KPUB 3H4TA 4RA6B 1IBLB 5L4NA 1EG2A 5JCPA 2CLKB 5JFGA 5LJIA 2PL9A 1BIFA 2BEUB 3PNQA 2XYQA 1BKSB 3S7DA 1NONA 3BZBA 3R7RA 3GZNA 4PSAA 4GCNA 1E3WB 1AJEA 4TV3A 3WIUA 2B98A 5D3MB 1ZNXA 1NW7A 4K8OA 3CKYA 2RG7A 3HLKA 2P9CA 2O1WA 4DPRA 5CCXA 5H3HA 3SC6A 1KYIA 3D3JA 5HIAA 3BU8A 1W52X 1SEVA 5DGDA 5KSWB 3WKBA 1RBQA 4R1PA 2HR1A 1NYRA 2CEKA 3B78A 4PBSA 4L27A 2XEEA 3V7NA 4PIMA 4GMHA 4R8MA 2WG2A 5CFZA 3BMOA 4NCJA 2ZEJA 2HYDA 3QFSA 3ETHA 4Y6GB 2QXYA 4MWCA 5JAZA 3HO6A 1XZBA 3HDTA 4OHWA 1YF3A 3VYVA 2EZTA 2CCKA 1YZFA 1WULS 4U8GA 4JJ6A 3WLIA 1NY6A 4TSFA 1G2PA 4BL5A 3ZOZA 3QFTA 3KAPA 5BPFA 5IMSA 3UOGA 2C96A 4C5CA 2C1EA 7AT1A 3MWKA 3BGSA 5PNTA 3TZ6A 2LBPA 2OB1A 2QGNA 2HMVA 2M6RA 4N1AA 4RVBA 1F6DA 5HKBA 5HRYA 4PFKA 4BEBA 2DYSE 2D5LA 4I4LA 1JIIA 4RY8A 5HCNA 4UTNA 2SECE 3RJVA 3ZNPA 4DLQA 2HL6A 4DCTA 3CEHA 1Q7RA 3IAEA 3DRAA 2SCUB 3VPHA 4ON9A 1CRLA 4W1SA 3ZQUA 3K0CC 1RAFA 3G5TA 3W5BA 4NU0A 1MIHA 4U07A 2AF3C 4ZT7A 1D0VA 2Z09A 4YROA 5HNKA 4F6RB 1NWCA 4FR0A 2OXFA 4TTSA 3SAJA 1EK5A 3VR4D 3K94A 4KVGA 5U9CA 1SUCA 2BZ0A 1CLEA 4IOMA 3OO0A 1VDYA 4N65A 3WIEA 3SXUA 2ATIA 4AUMA 2O8VA 5AI4A 1XP8A 1L7NA 2HTEA 4M21A 4HN9A 1U8AA 4R51A 1L9KA 4LY3A 4BMSA 1ZZEA 1ZUWA 3ILHA 3V48A 1VCHA 3QX9A 4BYGA 4ZN6A 4J29A 1WUJS 2WY2D 4QFMA 3CGGA 3EIQA 3GJ0A 5K0CA 1OXSC 2NXJA 2Y3IA 3HCDA 2XT0A 4L23A 4FWBA 1KGDA 2VYCA 1ISRA 1N2BA 1NHGA 3U7GA 1DCQA 3AR4A 4AO8A 3HH8A 5IVHA 2FDXA 3AH8A 4OBEA 2IYLD 1JUQA 2DY1A 5CH3A 3N2EA 2IS1A 1W36B 4ZOAA 3O38A 1J2TA 1C9KA 2Z5FA 1Z4JA 1UN8A 4O25A 1WF6A 2OUKA 1ADCA 2DWUA 5IAKA 2D3WA 3KZCA 4FLMA 4GIBA 3UTDA 2OQVA 5K99A 1K2WA 5FUBA 2NSJA 2J5BA 1J70A 4OQPA 3HI4A 4PRYA 1R8SA 1V8FA 1UBUS 4Q1FA 1DIAA 4WD3A 5KSPA 3JQ7B 4BNDB 5ALEA 4Z4EA 3ZD6A 3ZHVA 3CFYA 4OX9B 3TOCA 3TZCA 5IARA 3K5HA 2A4MA 1GGEA 3VNRA 4TVSA 4UUMA 4BVJA 1WQ3A 3ESBA 5L3RA 5KWJA 2X3MA 4B17A 4BCDA 1H1TA 1RKBA 1PC2A 1TCAA 5IJZA 3R7WB 3BEEA 1FTNA 2EZ9A 1Y6GA 3QHQA 4XAQA 2SKCA 2PJUA 1R0WA 4GOOD 4JKIA 4KR2A 1DUVG 4KX5A 1PVVA 4J7CA 1GFSA 3AVUA 3BGOS 3B8EA 1QHHA 3FTZA 5FTLA 2CFZA 1LK7A 4AMZA 2O7QA 5CAEB 4Z2AA 1YI1A 5A6VA 2C7GA 2CBZA 4YRQA 3QVXA 3KAEA 4EW3A 2ILRA 4RE5A 2XQIA 5H9WA 4V0QA 3QVLA 2FOLA 4RE6A 1PF7E 3KJFA 3TTXA 2R66A 2H3HA 1UOHA 3RS2A 1W4CA 2UVPA 3R41A 4BN0A 3FNBA 1EQAA 1RZ3A 4LF5B 3RIBA 1PG2A 1KS9A 4YXFA 3VVBA 1GA6A 5DBGA 1P2VA 3ORSA 7GPBA 4TMKA 1SUAA 2BRUA 2YC4C 2A5GA 1HT3A 3DQQA 1LDNA 4OQQA 4E1VA 2Q2VA 2Q4DA 1E92A 1UT8A 1CE8A 4JYCA 1SD2A 3DH0A 3RAJA 3R7QA 2PT9A 3HYCA 3IXMA 4DLZA 4F4UA 3NWBA 1Y37A 3RHTA 4BX8A 1L5SA 3C3OA 3JXJA 4I1PA 1HE2A 4BNLA 4EW2A 3QMMA 3REOA 1V16A 2B1GA 2CUZA 3C43A 3VAYA 4EHBA 4XPIB 4JELA 3UFXB 1EVEA 1C3OB 1N5RA 1KIFA 3F97A 2V7QA 4F3RA 2UXBB 5IJ9A 4DQDA 1QC5A 1MN6A 4NMXB 1G21E 4MDYA 4MQUA 2GK3A 1M76A 3K1TA 3TQIA 4PHHA 1E2LA 1XZLA 3C6KA 5F35A 4C05A 2B61A 3DOCA 3KB6A 3PHJA 2Q4BA 3K96A 4BTAA 1N54A 5AT1A 1PNQA 2FUG1 2A7QA 3WYNA 1Z35A 4LJ4A 4UCWA 1NRJB 4UASA 1RAAA 2HDWA 1VHDA 1GT91 4EA9A 1GVNB 3W4JA 1TVEA 2QP4A 4FC6A 5BSHA 5J43A 1XMOB 3STTA 3D81A 3U3RA 3LKBA 3MA5A 1AV7A 1G5RA 3OETA 1RRVA 16PKA 3DUWA 4JJFA 5IT4A 3RK4A 2PO5A 6NULA 3NQ41 3GRFA 3VTAA 3BL8A 5JQGB 4JJAA 5TT1A 2ST1A 3OLYA 1ILWA 4M9XA 3OBBA 4H35A 3DEOA 1WQ1R 1CIJA 3EMBA 3H7AA 4B34A 2WDZA 3J80A 5FINA 1UP6A 4G5QA 3ZNNA 5IUKC 4MI6A 1V5WA 2FWMX 1V48A 3PC7A 5KNCD 1ML4A 5AWFC 4XGKA 4M4SA 1Q50A 2VDLB 2R7NA 1V26A 4WUVA 1CHNA 1YH3A 2HZ7A 4NH4A 2JJQA 1L5HA 2NUPB 4M1OA 1M66A 4BVGA 1PEAA 4YQYA 4L9SA 2X7HA 2FF7A 2V1UA 2JKZA 3ROPA 4B6RA 4AMUA 1Y5RA 3KLBA 2NAFA 3ILVA 1M8JA 2QQFA 3U7JA 4V2IA 3T0IA 4TMVA 5GV8A 3MOIA 5C4GB 1GIAA 4QOIA 2VYVA 4YNBA 4N8DA 5KYUA 4B1FA 2C54A 3KFLA 2I1JA 4GZ6A 2E89A 1K66A 1HT2E 2K2WA 3DHYA 1R0CA 4EYKA 4L7TA 3L46A 3U4HA 4WRRA 1OLSA 4EG4A 3M5WA 5LP6B 2WP8J 3AHGA 1YHYA 3AVOA 2E0IA 3L82B 3DE1X 3LY9A 3IT3A 2R8PA 4JNKA 1KVTA 1JNYA 1U9IA 3EX7C 4U7HA 5IT0A 4HJXA 2ZSUA 3VR6D 3QKSB 1LPNA 4RABA 2JK1A 3UWPA 3O74A 5EFOA 1P8AA 4YMGA 3HVRA 4JD2G 2X76A 1P8JA 3A4VA 1JPLA 3EDRA 3PCRB 3RF7A 1TB4A 2XAUA 5THXA 2RCYA 1P0QA 3ETDA 5JISA 2Z2YA 1U2DA 4C9BA 1U8EA 4M8SA 1NQ5A 3OH8A 1AF7A 4G4SP 3HJBA 1MO3A 3NB0A 3I9NA 2R1VA 3WC4A 2QXTA 2MYTA 2BEJA 4KKVA 3GBPA 2OLJA 5JI3E 3JRNA 2CFRA 3QX3A 2XZDA 3FWZA 2MYUA 4RV4A 4CGZA 3S29A 2B25A 1UDAA 4R83A 3ZWWA 2ZSFA 3ELUA 2ZUVA 3OZTA 4Q7JB 1WCIB 3AILA 4R9VA 1KFCB 1I2AA 2RGWA 5TQJA 1EZ1A 5FAXA 1Q1QA 2EFJA 5ALSA 2NP6A 1T13A 2WU3A 3ZU7B 3KWLA 2L6BA 2HWWA 2HK9A 4K6HA 1ZK4A 3M1LA 2XMRA 4BOYA 4E2ZA 5JARA 3F47A 3ICQB 3LS8A 1OYOA 2Q45A 5LIRA 3AETA 3W3ZB 4WESB 2ZJZA 1D2EA 2XJ4A 4CI0B 4K87A 2AZMA 3E61A 2ATXA 3K5WA 3Q0IA 4OJQA 1KIAA 3DPSA 3GK3A 3AKCA 1R5JA 1XF9A 3FHLA 4FE7A 5COAA 3UJNA 1X80A 1GCOA 4IQ0A 4ZIRA 3HUFA 2J5QA 3TR6A 3IHTA 4XFDA 3SBTB 5EKSA 1VHWA 4URWR 4EF6A 1N8TA 2ZYIA 1ZCZA 1JYSA 4M7WA 2QTZA 2XDYA 3OXGA 2CZGA 1J99A 1JN0A 1GKUB 2EL7A 5IKXA 3UJDA 3MWYW 1PT9A 4PO9A 5ISMA 4LE0A 4R31A 2UZIR 2CNKA 1RT9A 2G9ZA 3DVSX 1N2CA 2AQHA 1IRIA 3MFQA 1L5FA 4JZYA 4ALIA 2HNBA 4KQFA 3ILYA 1X1QA 4JYAB 4HRLA 3DBLB 3EVCA 1CS4C 1ZJ6A 1IFXA 5DXJA 3SDZA 4CMGA 4REOA 1T5LA 1N9KA 3IUNA 3W9YA 1JSXA 4O2AB 5BXUA 2FJPA 3GJYA 2X9VA 1T1JA 4UBKA 2KM1A 4UHFA 4JJ7A 3OKCA 2FSPA 3BTUA 1CJUC 2H1IA 2OGTA 1ABBA 3ZG6A 4I6EA 4BGVA 1HE4A 1Q77A 2FZGA 3L0IB 1PY1A 2H5JA 3K4PA 4PVCA 5I7UA 4E07A 2Z1MA 1GTG1 2EBWA 2HH9A 4QM6A 1U5BB 3CR3C 3RRFA 1FLDA 1T10A 4XARA 3QGMA 3PGMA 5G4KA 2QY9A 1BWQA 1U8XX 1C1XA 3FTQA 4RJKA 3ANMA 3GPCA 2OE2A 1G3NB 4IHJF 1L4EA 3MT7A 3IT0A 3IT2A 4B09A 1M2JA 1NI1A 3U48A 2QZAA 2LP4Y 2J7KA 1I32A 3NB2A 3Q2IA 3NUZA 1ZH0A 1R37A 4KE7A 3FDFA 2HHJA 2R5FA 2VSXA 2PBFA 1ZM9A 3CMCO 1K5HA 3DSXA 1GR0A 2XI4A 5A6SB 10MHA 1T5DX 1Z28A 2F6RA 4NICA 3K1JA 3MJSA 3EDOA 1AKVA 5FR1A 2FUCA 3LGSA 3ETNA 4EKGA 5LKRA 3JWPA 2WJHA 1NASA 4PG4A 3UINC 1WRBA 3ICCA 2KCKA 2JAOA 5C31A 4MVJM 3SEFA 2HF2A 4LJSA 3PFGA 5GQSA 3Q3VA 3N2KB 1BEZA 3R74A 4W5QA 3TKYA 2OMEA 2QLJA 1ADGA 3OMLA 3C0KA 3FZGA 1BJRE 3NC4A 2WBLC 1OR8A 2QI9C 2F3UA 4HDAA 2WABA 2FWBA 4W5TA 2XS8A 4PCVA 4LYFA 1NBME 1CUJA 4HVAA 4FFWA 1L4LA 2E49A 4F6LA 1O77A 3DBOB 4TSKA 2BHSA 2YW2A 4RC9A 3GUVA 1D9SA 4Q94A 2VCEA 4ML3A 5KQMA 4L3WA 2CCGA 3CWCA 1WB4A 2VBGA 1G18A 3T5BA 2IWRA 5BSEA 3LPDA 2CUTA 3BF8A 3N2GA 4HS2A 3I2FA 2WIKA 2OFXA 4ZC1A 4BZQA 1NN0A 4TTTS 3KE9A 3RYIA 5JMND 3QE3A 3G02A 3HM9A 2IHZA 3AXSA 1U8ZA 5E76A 1IZZA 1CLUA 4PYLA 3RFFA 4GDFA 1DTWA 1OFHA 4U2CA 4KQHA 4IGKA 1W3BA 1PK8A 3A28A 2ZTSA 4ND5A 3D1LA 2GAAA 2WMNB 1J1IA 5K0NA 1ULBA 3LOUA 3SKXA 1VDMA 3ECSA 3QPDA 1SY7A 3A6FA 4NPCA 5JD5A 4F4DA 3UT7A 1VYUA 4R9RA 3OP4A 4QODA 3M1YA 2PZIA 5BYBA 3LA6A 1UPBA 4O6FA 2GTPA 2XGMA 4NEQA 3JWJA 3R5SA 2BR5A 1DHRA 3B7UX 4ZARA 5T41A 3E2PA 4PR3A 3P2IA 2YS7A 3TZBA 5BURA 3QTBA 1OHHA 4JP3A 2FI1A 3OPYA 4PNHA 2IYVA 1JEQB 3AU4A 2ZSEA 1E32A 1KJ9A 4YP9A 3C5EA 3IEPA 4CM9A 1XCJA 2FPUA 4HZIA 4UVGA 2P6OA 2CVOA 2OGWA 1JG7A 2H8GA 4LMAA 1YONA 4JUFA 1ETHA 2WD8A 4V1CA 4CN9A 2C9CA 5DO9A 3GG9A 2G40A 4AY4A 3QW4B 3BD8A 4XEIG 1A4IA 4BEVA 4JLDA 1DT5A 1BE0A 2XD9A 1A9YA 1P1HA 3CQGB 5IEJA 4CV3A 1S3GA 1D2HA 2Q6OA 4JI6B 1MVOA 4KWEA 1NL3A 5TF4A 1H9CA 2AN4A 2GFIA 3C14C 4P33A 3LO8A 4L9PA 5B2ZA 2P7HA 2CLDX 2GO7A 4I8DA 4RXUA 3EJNA 3LF1A 1JTFA 3PFFA 4UTRA 1B6SA 1YHZA 4FFOA 1M7BA 5AKXA 4YMUA 1XQ1A 4DLOA 3OCXA 4BO4A 1JJVA 4I17A 1X7WA 1AHNA 4EMTA 3LO5A 1X7XA 3JYNA 4JPSA 4Y6RA 2HF7A 1UMDB 2CN1A 1GL3A 1KDRA 3EVDA 3G2LA 3S55A 4MQ6A 4LDRA 2PZBA 5EI5A 1K5GA 1UK6A 1FXWF 5HOQA 3A2KA 3OUUA 3DLTA 1D0SA 3MRTA 2VSYA 4H60A 2V03A 4DDTA 3ZUVB 4XSGA 1YJAA 3AESB 3K9WA 1XZPA 4X91A 4R2KA 4ZOLB 5CFRA 4IDEA 3NR2A 4IYRA 5KYGA 4Z4GA 2IITA 4DPKA 1Z4KA 4IY1A 2IL1A 3CYFA 3UCFA 1B1AA 5BMVA 2HXGA 2O5CA 4X62B 3TWVA 4FYJA 1H05A 1QPBA 2LD4A 4DX6D 1PHPA 5C1BA 3V00A 2NUAB 3DKIA 4KUEA 3QPVA 2XVXA 1BU8A 1CK4A 4UQYA 1SHZA 3E9DA 1UT6A 2OKCA 3ZVLA 3F6CA 4J0KA 4ZO7A 2QJWA 3MIZA 1K5DA 1J23A 1HE5A 5DK4A 2HWUA 3FETA 3PJEA 2MHKA 1NV8A 1R6VA 1M2OB 1N2JA 3PI6A 3DZHA 5F1YA 2QAGC 1L8QA 2BGLA 4MKGA 2GVZC 4E2FA 5KNDA 3L7IA 4MV1A 2PUGA 2IHJA 2IPLA 3MAAC 1HDRA 1I7DA 1T3LA 3ASGA 3DEYX 3IBCA 4WERA 4A16A 3VU8A 3OAAA 3MGBA 3HCCA 2ARKA 4ZHQA 1AKRA 5BYKA 1VBMA 5JA4D 2JBWA 3ZDBA 1T6XA 2V6IA 3T9FA 2P9ZA 3DKRA 3FG9A 1KGSA 4GI1A 1PR4A 4HDMB 2XJ9A 4PS7A 4AIIA 4EI8A 5FZSA 4JI3B 5DK6A 5DISB 1PWZA 3JZFA 4AS3A 3MFYA 3R7DA 3W7AA 4H3SA 2IF0A 3A6LA 4XWTA 4MDFA 2ZWIA 4F45A 4KW7A 4GRAA 4OXYA 1I0IA 3H9CA 3CVQA 3E5MA 4RK7A 3D3EA 1ELKA 3ER8A 4I3HA 2E1RA 3GELA 4EITA 3CSSA 3L6AA 1G8GA 2ZTMA 1EYHA 3ID6C 2CXUA 1CUCA 2WJ6A 4PLHA 3LUAA 4CM8A 4O4JF 1D2GA 3KUUA 3S3TA 1UW4B 4HDKA 4ZVNA 2YQ4A 3UA3A 1JFFB 5JVDB 1FFDA 4QXOA 4BKUA 1KY4A 3H6GA 4AFNA 5F4ZA 3FD8A 5LMUB 3IRUA 1Z2EA 1ORRA 4LOAA 1ZJJA 3BGIA 3IKLA 3TWOA 3OZSA 4Z9XA 4ZO6A 1DB3A 1ODIA 1JI3A 1X7YB 4HBGA 3VXKA 4UAVA 2GK7A 1VG8A 2G1PA 3VDMA 5FI0B 1NW8A 2NTNA 2V6JA 2CE7A 4FINA 4PFSA 3F6RA 1FUKA 4N82A 2JIPA 3GUYA 3BXEA 4M99A 1CJTC 1L4UA 2P6MA 1C9YA 3TS1A 1N0IA 3VR1A 2B0OE 1I3MA 1FEZA 4LZLA 5DXFA 1GAXA 3AEQB 3OFKA 4LV5B 3IVAA 5CBKA 4M0PA 5EZ5A 1GFIA 1OY3D 1DIBA 5DH9A 3R7NA 1KEEB 1DBSA 3UQ3A 4G86A 2Q5LA 2XMPA 4GTRA 5E95A 5LUAA 4MYRA 1CDOA 2PWZA 3VC7A 1RZUA 3GNSA 1F14A 3QIVA 1XP5A 2PUVA 1JHUA 1RM0A 4JQOA 3FU0A 1F1BA 2JIZD 4BFRA 4C6TA 4CQLA 1J0DA 5BN1A 2JFZA 3HN2A 3WAGA 3QEMA 1AHPA 3R5TA 4YJFA 2NVWA 1DXYA 4ISBA 5JROA 1XELA 3AF1A 4WFKA 3RRMB 2R6JA 4UEOA 3W5DA 5IC6A 2XB4A 5IUNC 4K9MA 4X61A 2VT3A 3IAHA 3SQLA 4YAEA 3GXBA 2BGUA 2GRMA 3V7YA 1PNVA 4DX7D 1J9EA 3ZCUA 2R3SA 3PDCA 3P19A 3DSVA 4UOEA 5ES3A 1NQOA 2B69A 5HSGA 1IM5A 4PRKA 5SZHB 4AXBA 1PJBA 4RH1A 1UT5A 3TGWA 3NRCA 4KFTA 4EG1A 1RJFA 4MW1A 3IDQA 4WVFA 5AIJA 1W4RA 1SKYE 1K1BA 2WV9A 4DQKA 4U95D 1JHYA 3TUIC 3VVLA 2WA1A 4YCNA 1SC9A 4FGJA 4UJ5A 5C8XA 3Q5EA 3DMRA 2P2CA 1KE2A 1L5ZA 3AUKA 3DXFA 3U5ZB 1G7CA 4A8PA 3LW8A 1FVHA 1ODTC 2VT2A 4UU1A 4HLNA 4TS1A 1C7FA 5CURA 1JHOA 2WFMA 2GZ2A 5DI3B 1PQPA 4G36A 4LSZE 2QJFA 3LWDA 2B5OA 3ZXSA 3HU3A 3BH0A 2NLOA 4M9SA 5GV7A 2IOQA 2V65A 1W2HA 4V02A 4B6FA 4RULA 1P1JA 4LCBA 3AHCA 1SVKA 2ZM6B 1CV2A 2HNKA 1V95A 1SVLA 5T8KA 1OAOA 4UTPA 5EMNA 1XZQA 2HHAA 4QGBA 1VE9A 4U7DA 3GIWA 3EAQA 3I61A 4AZ0A 1LA2A 1YDFA 4JVSA 1ZN2A 3E81A 2CL6X 1PWYE 3BD9A 3ZCTA 3ZRHA 3M6WA 1DTEA 4QICA 4EG0A 4OU5A 3WVNA 4YX9A 4PSKA 3BMCB 4K9NA 4C14A 4C7VA 2ZXWE 3MTBA 1E8ZA 2C9ZA 2JH3A 3R0JA 3L4SO 3FHCB 1D09A 2IDZA 3LY8A 4LGMA 3UXHA 4XR4A 2XLCA 4GD3Q 3DT6A 2QRPA 3I28A 3BSWA 1UUFA 2CHEA 1A2BA 2IH5A 3O4JA 5FNVA 3D7LA 3MTJA 4YWJA 4BO5A 1T8SA 2VJQA 1B0UA 4NJEA 1WZIA 5EJ9A 2WB2A 4KXUA 1WSWA 3JQ0A 1KRHA 4WAFA 3RRUA 4QO7A 3BM5A 2F37A 1F2TA 4DR6B 3IDFA 2P9QA 4B4OA 1QGUA 3GJTA 3E0XA 3FSEA 4E94A 4TROA 4GKKB 2REXB 2BM1A 3BD6A 4G81A 5GMOA 4RHCA 4KP7A 3QE9Y 5DYNA 3BXHA 2UY1A 1WZEA 4W8GA 4WACA 1VJ5A 1YVPA 1FP4B 3DV0B 3G3EA 2YY5A 3GH3A 4E5UA 2B6CA 3I4LA 4DC0A 1E1CB 3AJ9A 4HLDA 4XUDA 2JARA 3VMFA 1R1DA 3LJNA 1FT2A 2PCLA 4M0CA 4BFXA 1IBCA 3MTQA 5BVHB 1EU1A 5T67A 3NJ8A 2V54A 5CDUA 4M9RA 2PKRA 3BXPA 3MTGA 2Y4NA 4BBPA 2PMDA 4Q24A 1C7QA 2ID4A 2ZQZA 4ZDIA 1V41E 4JL6A 4LF6B 4ODIA 4CETA 4OEHA 2AEEA 3PH0C 3STUA 2NXPA 2PUWA 3LDUA 4HORA 1FFAA 4Z7NB 2Q1WA 3ZWDA 1S2DA 2C92A 5LL6P 3R4CA 1X42A 2P6NA 2CNOA 3RT7A 3SSNA 4BT8A 3E03A 3NTVA 1Y4UA 1K6IA 2YIVX 2H1CA 2NU8A 1MJNA 2O2DA 3KAJA 1FDOA 4BX0A 1HDGO 1MJHA 2AE2A 4M53A 4J6EA 3AP1A 5JNTA 1XCLA 3TRKA 5IKOA 3LBHA 5EKDA 1V1RB 2P2CP 3D4NA 3HSKA 3JD2A 1A9RA 4BNUA 1UCFA 3PFNA 4I2VA 3ZU3A 5FJYA 1Y1PA 4Z4CA 5JXJA 2QX6A 3MMZA 1S96A 1QRTA 2XCCA 1BI7B 1KPSB 4G26A 4BVFA 2W2KB 4PAGA 1X1EA 3F1LA 2ZT5A 2WOOA 2JHGA 1EE9A 4YV7A 1SPBS 1AGYA 4LRXA 3AZQA 4I9FA 2QMQA 2NPFA 2AYXA 3LQKA 1P9RA 2I76A 4A55A 3LC7O 1SXHA 4XYBA 2W93A 2H9IA 3WYBA 2ONYA 1Q20A 1P0PA 3EGDA 3T95A 3KBBA 4XQEA 4H1TA 1PJZA 3GOHA 1JHZA 2JAXA 4LQLA 4R6XA 4M1ZA 2QRHA 1R12A 1NXOA 4XQGA 4XYGA 3BK2A 1XTIA 4AM8A 3JPYA 5A0VA 2FWAA 1QF6A 4WLFA 3U3ZA 2EKPA 3UIPC 2MTBA 1JHDA 1XZHA 2XNCA 3CF6R 1Z37A 2O14A 3RUHA 3TTYA 2H2IA 4UARA 5C7IO 3ZGOA 5TIIA 2C9BA 2NW6A 2QLTA 4IPTA 1L7OA 1GZVA 2CXRA 2GCOB 3HGTA 4OB7A 1ZIPA 4IUDS 2VYQA 4Y98A 4I3GA 4CLDA 5JRZA 1X5BA 3TL6A 2HWXA 3JWIA 5B30A 3H9UA 3WO0A 3AINA 1EXMA 5FJIA 3PHBE 3N0TA 1G42A 4N2SA 4ACAA 4CBVA 2WUEA 3EF1A 3R7BA 1WJGA 1AC5A 3PDUA 2BGNA 3VISA 1OBHA 4L9WA 4QUHA 3KSBC 4JKOA 2OHOA 3QPBA 3QWBA 4PEVA 5TR9A 3TM4A 3L8HA 2YUIA 4EUEA 5AJLA 3EAGA 2Z2XA 1QWOA 2IBSA 5BW8C 2QSZA 4MPJA 2GZAA 3WOVA 3PQ7A 1H0SA 3AHFA 2AMVA 4UWHA 3RTDA 4FDMA 1V8ZA 3GLVA 1ZSNA 4X7PA 5DHQA 3NBUA 4KWIA 3AG2E 1QGOA 2OQIA 4U7WA 1AGNA 2I1WA 2XQ0A 1ZFNA 2UVQA 4QLBA 4U00A 4H3HB 5EHZA 4IV5A 3B1YA 4NDZA 2R87A 3LHKA 4FFDA 5EZ6B 4NFHA 2WWHA 5MFZA 3B1XA 4NTZA 2EFYA 2Q5OA 2I3AA 1IMJA 4ROSA 1DX9A 2CF6A 4LYDA 2B0JA 3DFKA 4WL0A 1DCEA 5J4HA 4D1YA 1MZPA 2VA8A 2I6TA 3OD1A 4J6IA 3OPVA 2W37A 3BAZA 3CVJA 4ZI7F 2QSUA 3QJYA 3R3JA 2G1KA 4NDAA 3NOCD 2X5OA 2IYFA 4ZMBA 2ZIFA 4J1QA 3W3AH 3EPKA 5ICEA 1NV9A 3FPEA 4FGZA 2ZRDA 4E1BA 4REQA 1FNNA 4GDMA 1SIUA 4II7A 1W46A 3LCCA 3MD9A 5L8VA 3PV0A 2XCLA 4LC0A 3LWNA 4CM5A 1NAHA 2OPHA 3T15A 3AG5A 1D03A 2PZ8A 3IP5A 4Y2UA 4JT9A 2HREA 3B3GA 4XW2A 1ZIOA 5L95A 1CY2A 5DCYA 5JXGA 3BT7A 3EUEA 5E9WA 1KJJA 4W8HA 5TQ2B 2PH1A 1Q0ZA 4Z7QB 3E7XA 1LVHA 1ZHOA 2YY7A 2X22A 3ADOA 4BLVA 1GFWA 1BE1A 1EB9A 1JBEA 1G5TA 2RE8A 1VLZA 4X92A 4C04A 3C3RA 2BFFA 3ET4A 4QL3A 3QUQA 4KXNA 4MS6A 4MR7B 1RJDA 4LYGA 2C04A 2AUTA 4UD6A 2I8CA 1JG2A 2LO6A 1PZEA 2Q2WA 3P94A 1NOIA 4F3YA 5D7NA 5SYMA 3DP9A 4MW4A 2W6JA 3CB4A 4JLUA 4F6CA 1LNSA 1NL4A 1O7JA 5FOTA 4LZAA 1Q22A 3KZVA 1BU5A 4KJZA 3FUNA 3MWDB 2IQIA 2OSBA 4FCVA 3R2JA 5BYAA 4QGHA 4XVCA 3WG9A 1JFRA 2VSFA 3VZRA 1EESA 3O2JA 4UVHA 1PN3A 1SXJB 3FPCA 5CYOA 4DMFA 1TKCA 2CXNA 3K5PA 1UK9A 1UBSB 3K70D 2WTMA 3DT9A 3CC8A 4FYWA 2Y68A 3PZBA 3DSRA 1U0OC 1ZMOA 5D6OA 6AT1A 5K0FA 2IDJA 1C3JA 2PS3A 4EJ2A 2JS7A 1Q2XA 3W6NA 3GGCA 3OOJA 2MU1A 1AMOA 2WUFA 4IWNA 1DJOA 3I5PA 3OJOA 4QFBA 5KMGB 2WWVD 1OXMA 4RTQA 4O63O 4HPWA 4X41A 4CKWB 1M0WA 4PYIA 1F3OA 2R2LA 3C3AA 2VI5A 1H2YA 4OOFA 1J21A 5I7WA 2B1JA 1WW3A 3OQMA 2IXEA 5KTYA 4DY4A 3QVUA 2EOAA 5KNLA 1EIWA 3G8BA 4DIBA 2XUFA 3FMIA 1ZMXA 1ZLXA 1QSGA 4OUKX 2NT3A 2OLKA