4GU5A

Structure of full-length drosophila cryptochrome
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
537
structure length
537
Chain Sequence
TRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLRACVRGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Updated structure of Drosophila cryptochrome.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
molecule keywords Cryptochrome-1
total genus 200
structure length 537
sequence length 537
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4gu5A03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gu5A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4gu5A01
3DV2A 1WQ4A 3HL4A 4MW7A 3CR8A 3CVUA 3CLUC 3IUEA 5TGTA 4WSOA 1V8FA 4EFKA 4MUNA 3QTBA 1IQUA 1I6LA 1NI5A 3DO8A 1G8FA 1ZUNA 1Q11A 1KH1A 2GM3A 4MW2A 1PFUA 2X0KA 4JZYA 1YUMA 4MWEA 3BL5A 3TNJA 3INNA 1NURA 1N75A 3M5WA 4OUDB 1SURA 3SP1A 1T6YA 3OP1A 2PZ8A 1KKUA 4RPIA 1H3NA 1TYCA 4NAUA 5HUJA 2O5RA 3H9BA 3IMGA 3CA8A 3UC5A 1KP2A 4I6JA 2VXOA 3DPIA 1TEZA 3P52A 4KPUB 5DASA 1IHOA 1WZ2A 1T6ZA 3IODA 4U8HA 3RHSA 1U3CA 1O97D 3IH5A 1X6VA 3ND7A 4YMIA 2HMAA 3E27A 3FOCA 3ILVA 5KHAA 1JIIA 1M83A 3CVYA 1XNGA 2WQ7A 3N2YA 4MVXA 4FZJA 4JYZA 1HYBA 3D6UA 4ZT5A 1PFWA 3FIUA 4EG3A 1WXGA 2TS1A 3FY4A 1FYDA 1WXEA 1GZUA 1EUYA 1XNHA 3KFLA 3U1VA 1N1DA 4NAHA 4MW1A 4EG8A 1O94D 1ZH6A 3UMVA 2YWBA 3RK0A 3C8ZA 3FNRA 1GAXA 4EG4A 1I6MA 1YUNA 5BNZA 3IMCA 2WB2A 2WQ6A 1S4MA 2E89A 3FI0A 2PZBA 1O96B 1PG2A 3A2KA 1O5TA 4UZEA 3CLRD 2BTEA 1QRUA 1IRXA 3RJZA 4JXZA 1J1UA 4MQ6A 3ND5A 3IDFA 3RFFA 1LI7A 3H9CA 4R2MA 2PXHA 1EFVA 1MAWA 1J1ZA 1G8HA 2ZUFA 2QUHA 4MVCA 1M8GA 2H2AA 2IJGX 3CLTD 1NUPA 3Q4GA 4PBRA 4KKVA 2GKSA 2J07A 3SZGA 3P0HA 3FETA 3AFHA 3PXUA 2A1UB 2CV1A 1P7PA 1NYLA 3PRHA 4ND7A 1EXDA 3ZXIA 2QUKA 3KT0A 4MWCA 1KORA 3COVA 1MB9A 3COWA 1O94C 4MVWA 1I6KA 5EKDA 1R6TA 1OWMA 1N3LA 1GPMA 2ZUEA 3HMQA 1IH8A 1PFYA 2XRYA 3UK2A 4JFAA 4ARIA 3X1KA 4I6EA 1QJCA 2RE8A 3CLSD 2A86A 3MLBA 4EG1A 1QRSA 3HZRA 2J08A 3LCJA 1GLNA 1EFVB 1K97A 4EG5A 4HPWA 2DEUA 3PNVA 1OWOA 2NZ2A 2PFSA 1JILA 5K0SA 1JECA 4ZT2A 3FHJA 2CT8A 4P2BA 3RBAA 1MRZA 1N2GA 2QTNA 4MW4A 4QBTA 3VU8A 3JXEA 1M8KA 1M8PA 1QQTA 1F7UA 4ZT3A 2ZP1A 2PG3A 3IOBA 4F4HA 3ZJUA 4Q16A 3ZIUA 4R2LA 1MAUA 2CUZA 3KT8A 3TZLA 5DK4A 1O95C 3D6VA 3K32A 4ZT7A 3CLTC 1YIDA 1GTRA 1BS2A 1EFPA 1MOPA 4ZCSA 4K03A 1JIKA 2CYBA 5LFAA 3H97A 1IQRA 2E18A 2X1LA 5H16A 2HGZA 2J09A 3G59A 4PBSA 3AG5A 3COYA 2CYAA 1H3FA 2HZ7A 1M1ZA 5IJXA 4RUKA 1EJ2A 2YWCA 2QJTA 3UOWA 2IP1A 1Q77A 3IVXA 2IELA 1DNPA 3MMXA 4DDKA 3RK1A 3CLUD 4YP5A 4MW6A 4J75A 4EF6A 3G5AA 1O6BA 1IQ0A 1G8GA 1KQNA 1F4LA 1IFXA 2WSIA 1JIJA 3AIIA 3CLSC 4CQNA 5FO0A 4U63A 3IVCA 3COZA 5J58A 1VL2A 3A4IA 1OWPA 1PG0A 3NV7A 4QRDA 1NUQA 2CSXA 4QREA 3HGMA 1J21A 3CVXA 1J70A 4JXXA 2E21A 2DPLA 2Z09A 4G6ZA 3FH0A 4PY2A 4XFJA 1VBNA 1X8XA 2O8VA 2QJFA 1K4KA 1KQPA 3Q10A 5TEVA 1T9GS 3H99A 4MUKA 2CV0A 1OBHA 1YI8A 1TQ8A 5DEOA 2X3FA 5TS2A 3FDXA 4R0NA 4DJAA 1K4MA 1N2OA 2A88A 4XFDA 1MBZA 3MXTA 2Z3VA 1YIAA 3G6KA 4Q93A 1EFPB 4NX2A 3CVWA 3ZJVA 2I1LA 4ZT4A 2DETA 1ZH0A 4AS1A 1EE1A 2D13A 1ZJWA 1JGTA 4NDAA 2J5BA 2A7XA 2A1TR 2PIDA 1WJGA 1IVSA 1KP3A 1YULA 3SEQA 3K9WA 3SDBA 4S1OA 3ZXSA 4ZCPA 4MUFA 2VTBA 1XJQA 4PBTA 5AHWA 4MW5A 1WQ3A 1N2EA 2Z08A 3KT3A 1OBCA 2J4DA 3HV0A 4OUDA 1WY5A 1JHDA 2JA2A 3TS1A 2A1UA 4MVYA 1F7VA 1M8FA 3PNBA 3UY4A 5KWVA 2DXIA 4I6GA 2DLCX 3FWKA 1I2DA 5HG0A 1U7XA 2OV4A 3X1MA 3VGJA 1QU3A 2YXNA 3SZ3A 1NUUA 1G59A 4CDNA 1WXHA 1JEEA 2D5BA 2QJOA 1J20A 3N05A 4MAFA 3L92A 5KCMA 1N2IA 4CT0A 2XRZA 1ULHA 1A8HA 5DB4A 5LLTA 4YBRA 2QTRA 4MWBA 3ND6A 4MUGA 4HJXA 1O96A 3NBAA 4L2IB 4X0EA 2GOYA 1QTQA 2RD2A 3P0JA 4MUIA 1T6XA 4G5YA 2JAXA 1F9AA 3PNYA 1LW7A 4DE5A 1R6XA 4MUJA 1N2JA 3MLAA 4ARCA 5FO1A 3ELBA 4EGAA 4NATA 3LE8A 4HJRA 5F23A 1N78A 3IUBA 3GUZA 3IVGA 4YP6A 4MWDA 4TS1A 2DUMA 2DERA 1N2BA 3S3TA 2A84A 3LOQA 1GN8A 2C5SA 1Q15A 4OJMX 3ZGZA 4UZFA 1KH3A 4H3SA 4BWVA 4ZCRA 1KQOA 4CDMA 3ZUGA 3AKZA 2EL7A 2V0CA 1NP7A 2EJCA 4KPUA 3DLAA 2NSYA 1CT9A 1QNFA 1NSYA 2AKEA 1RQGA 1R6UA 1B6TA 4MUEA 3TZEA 1JMVA 4MW9A 2BYTA 2R5WA 4U7JA 2B7LA 3L93A 2OQ2A 3P0IA 1O97C 4EG6A 2H29A 2PZAA 1NUSA 3MUEA 5H7XA 2VTBB 4J76A 3N8HA 5LM3A 1TYBE 4KR7A 3X1JA 3TQIA 4G5FA 4NZPA 3AL0C 3CLRC 4AQ7A 2A1TS 4HK4A 3I05A 1U0BB 2E0IA 3FG9A 3IOCA 3ISJA 3QE4A 3QTTA 1EUQA 1GTSA 5JBNA 5IHXA 1TYAE 5J5AA 3TQOA 4EG7A 2G36A 4DNXA 3GLVA 4MW0A 3GMIA 1MJHA 1N77A 1WKBA 3KT6A 1VBKA 1UFVA 1ILEA 1Q19A 1VBMA 2QUIA 2QTMA 2CFOA 1H3EA 1WXFA 1JEDA 1Y42X 4MUHA 5K0TA 4YP7A 1QU2A 4ZCQA 2JANA 4A91A 1N2HA 3HFJA 3CVVA 3IOEA 4L2IA 4MLPA 1OD6A 1KAQA 1TYDE 1WXIA 1U7DA 5HUHA 2A4MA 1KH2A 4ZT6A 4KR9A 1D2RA 1JZSA 4GRIA 3H05A 1O0CA 1H1TA 1JZQA 2AZXA 1FFYA 1MC1A 5J59A 1U3DA 4MULA 3A04A 3SYTA 4DLPA 4XSVA 2CV2A 1TFUA 3Q12A 2X1MA 1XNJA 4KR6A 4DDMA 2YY5A 1OWNA 2CYCA 4K0RA 1QRTA 1WOYA 3SEZA 1O0BA 2D54A 3F3MA 3VRHA 1PFVA 3N9IA 1K92A 2AG6A 1COZA 4WNYA 4GU5A 1O95D 1J09A 4DDHA 4F3RA 4ZCTA 3OTWA 1MB2A 1KR2A 4E1AA 4ND6A 5TEWA 1VLHA 1M8JA 1T9GR 3A05A 3ZJTA 1KAMA 5FNZA 2QUJA 2DR2A 1NUTA 1V47A 1LI5A 1OWLA 3IMEA 3NBKA 1NZJA 2V0GA 3AG6A
chains in the Genus database with same CATH superfamily
3FCYA 3CTPA 1ZXXA 2XMBA 3UK6A 3AVQA 2VOEA 3IUEA 5HKAA 1Q0QA 3U61B 1AS0A 1HYEA 1X77A 4MUNA 3RIYA 4ITUA 3TR0A 4QGSA 4NCIA 5TR9A 1QGZA 5G05C 1PG5A 3DZDA 1CQPA 1F38A 1QRDA 1Q12A 3EGDA 3H8WA 4MQFB 5GVRA 4EMTA 3Q73A 1R00A 3DXKG 3ITKA 2FPUA 4DQDA 4NOMA 3W2TA 3T5MA 1GV0A 1WAMA 1K7EB 4FKMA 4NEGA 3WAJA 4HPJB 5UKDA 2PUDA 5FDFA 2LGJA 2IOLA 1OJ7A 3VTYA 2QV7A 3WJAA 3UGQA 1T4BA 4DG5A 1D3AA 1NLZA 3UT4A 4OQPA 5T4HA 4DGSA 1T6YA 2Z58A 2BFCB 5G0VA 2XCQA 4HHEA 1TAUA 4G1TA 3G2PA 5EMMA 4P32A 4C2BA 1V25A 3NEAA 3OO1A 1IXVA 1YR6A 4GH5A 5KVCA 5MGNA 3BRSA 1C7IA 1EEXB 3LJ3A 4FN5A 4JX8A 4DTCA 3T8YA 1UJ2A 3QXSA 5LXTF 1WG8A 5LXTB 3L1VA 3PQ2A 3EA0A 4RL6A 5IWAB 2WMYA 4M1OA 2CLFB 2PT7A 3Q8WA 3LTNC 1F8FA 4NESA 2H2GA 3TM5A 3HVRA 3UJHA 5A23A 3VJLA 1SM4A 1ZGCA 1VFNA 5F7ZA 4URZR 3WKBA 3BDAA 1U1FA 1SB8A 4F53A 3KLOA 4DLUA 1ZIDA 4GLFA 4N5LA 4W6QA 2VHWA 3UKRG 4DWWA 1YGYA 3EVDA 1PK8A 3D6UA 5EIFA 4LY6A 3SI5A 2VLIA 4DLXA 3TUIC 2HKIA 2ATXA 4GMHA 5KVVA 3VTKA 5FJIA 2WU1A 3FGOA 4JI4B 1N1DA 4DB4A 1H2BA 3SF8B 1W5AA 2VJCA 1H8ED 3DTTA 4S3MA 1K3FA 3FUVA 1CUJA 3ZE2B 4F6LA 3T5XA 2JCXA 5AIJA 1MA0A 1WV1A 2W4QA 3PXCX 5F5LA 2V03A 1D2CA 1RBYA 1XX6A 1YONA 3ZRHA 1BWSA 3I45A 2WQ6A 5CX1A 3TIXB 3EFBA 4PVDA 4X6YA 3TG2A 1TQDA 3W3AA 1M1XB 2PZBA 5EUMA 4FHDA 3ZNPA 1EFRA 1QFXA 3HXEA 3HACA 1VCIA 2XSZD 3L82B 1HU3A 4JLUA 4UUPA 3LZ6A 3BFPA 3NQ41 3GC6A 4N54A 4IJ6A 3RFFA 2H3EA 3P9CA 4TRMA 2IFTA 5E38A 2O8CA 4Z51A 5IBQA 2PLAA 3GW4A 3WL7A 1DTWB 5LJIA 1NM5A 4K28A 3BJMA 3C6KA 4ACLA 2GEBA 1M6HA 2PA3A 4KQFA 4PX2A 3GD7A 1JFRA 1Q0TA 2HHAA 1C30B 2QUHA 1O1TA 2B6CA 1KI2A 4MVCA 4TWRA 3WOVA 4DKXA 2HDHA 4C5CA 3FCAA 3W4KA 2Y9MB 3C3CA 1HLFA 4DHEA 1JLHA 3NETA 4EFLA 4RG6A 1DC5A 1ECFA 2PA0A 4XWOA 4WY8A 1EXWA 1FFBA 1C9MA 1O2DA 2XUIA 3I01A 1UWLA 2PUAA 1L4MA 1JHMA 2AI3A 3C5EA 3TLAA 3IKJA 4BFUA 2GBPA 1N8NA 5A71A 1F4VA 4GXQA 4BZZA 1TTHA 3IUQA 4LSGA 3SC4A 4LNUD 4R4JA 3MWGA 5T5QA 1O94C 4MAAA 5IN4A 4ZN6A 2HFKA 3OQ1A 3DWLG 5AJLA 1IWBB 3ZU2A 4ZYYA 2BBTA 4ZZIA 5A4IS 3EJNA 1SVLA 3KSBC 2IXBA 4L72A 4XM2A 2A5LA 5B57C 1JEOA 1Y82A 4ZV9A 2W6JA 3NBMA 5JJIA 3MRTA 1RKQA 3IAS1 1KU6A 1GTZA 3ZYMA 4I6EA 4OX9Y 4IX9A 2NVBA 2HBYA 1KI8A 3LKZA 3N2EA 4EDFA 3HKBA 5KOIA 1DVPA 1UWCA 3B6IA 4MVJA 4DYVA 4PC7A 4ASUA 4GZ3A 3HZRA 3YASA 2V7XA 3AF6A 3EPKA 1LF8A 1Y8QA 2AE2A 3G79A 3JQ9C 4E7PA 3MZLB 4C0LA 4AXXA 1YJQA 1EWVA 3ETHA 3OJLA 1NAHA 4I08A 3WBFA 3GRPA 3LXUX 4NMHA 4D9MA 1L9XA 3KQOA 2FWJA 3CO5A 3QE0A 2DEUA 4F38A 2XKBA 1JILA 4M1TA 4QPCA 3Q47B 2X8JB 2WF6A 5FORA 4EI7A 4IO1A 2QTNA 3D7KA 5F1YA 1E8NA 1M5TA 5T64A 1XLUA 4EHKA 5DHSA 5JAZA 3H9EO 4OGWA 1U98A 2IDKA 4BO5A 3AVWA 2AEFA 4IY1A 3I6ZA 4G1EB 5DM60 1PNVA 2IT1A 4XXHA 1VB5A 4OP2A 2DMRA 4NU5A 4PRLA 2PSJA 1E0KA 4EFDA 4EOGA 3TWQA 3O93A 2XRFA 5FA8A 3RIBA 3R7QA 2ZUBA 4Z8YA 3DOOA 5B1IA 1R9JA 4QFDA 3PYLA 4WVFA 1PT9A 1YBFA 1E3TA 3UT6A 5AJUA 5E4JA 1RQNA 1ZVMA 4MKFA 4D0LB 3ASHA 4FHGA 4DARA 3IAUA 4P4SA 3W05A 4WNGA 2CXXA 1U28A 3OEWA 1E3JA 4X63A 3IBEA 4L73A 2ZYWX 2JGIA 1YB4A 2QN8A 1S8AA 3O8LA 3JWIA 1KLXA 4DUYB 1FVXA 2R5FA 3T95A 3B6MA 4RO0A 1A9XB 1UPBA 4OMUA 2HSZA 4X6UA 4JI7B 4L02A 1DOAA 2F3UA 3RRUA 3B9PA 5IJXA 4YRDA 1FUEA 3C16C 3GUYA 4IXTA 4QICA 1R4MA 3TCKA 3OOEA 5I7UA 3APFA 5J47A 3HY4A 1KZ1A 3CG4A 1K6MA 3F2IA 3KTAB 1L7RA 4MO2A 3EHMA 1CHNA 1KAHA 2F8LA 3QUSA 5F1KA 1E4YA 4JJIA 4R1PA 1F5SA 1ETUA 4PZ0A 3RO2A 4R1NA 2TMDA 3LGXA 3AIIA 3OURA 1KJ9A 3CF6R 4XUEA 4V0OA 5FO0A 4D82A 4HUQA 1NIPA 3WLOA 3D7LA 3MFQA 2RFLA 4Q1AA 3B7SA 1IOZA 1E77A 1JHPA 4XQ9A 3PGJA 4YK7A 5AKEA 3S8YA 3GP5A 3HB4X 3NV7A 5HCIA 2XECA 4QREA 2EATA 4QLAA 1TDJA 4BJ3A 1I24A 1OHHA 4OK5A 3ZTYA 5JEEA 3BG5A 1SCAA 1XK7A 3AVYA 2YQZA 1RPNA 5GADl 1QG2A 3JYSA 3I1IA 1GPUA 3O9ZA 4LJLA 4MDFA 2B34A 3L5OA 1QQBA 1ZBDA 2X23A 4OBBA 2HHLA 4G6ZA 2MJLA 3B7GA 1HSOA 2RFAA 1ODFA 2ZRHA 2Y2VA 1ESNA 5CIWA 3I39X 3VSAA 2V7EA 4ZXFA 3DLIA 4AFNA 4EO7A 1NVBA 4P58A 2G0TA 3KSDO 1CJCA 1C14A 1U4SA 4WJKB 3QKUA 1OBHA 2FZGA 3ZWXA 4Z7NB 5CMYA 1YB1A 1PY1A 2WXPA 1U0SY 4MJ3A 4LVOA 1GFSA 2LXMA 4R0NA 5AKJA 3ZGQA 4MVJM 4IRUB 3V4OA 3WSTA 1YSCA 2BHRA 4IIYA 2F7SA 3VQTA 2D7JA 2ZS8A 3VX4A 3Q5DA 3RRNB 1W76A 4FQ7A 5ER6A 4BAZA 2RHLA 2YH2A 3PWSA 1QQ5A 4X92A 3TRFA 2KZTB 3A1NA 1JFFB 1UMBA 1KXZA 1C9DB 2IKSA 3UEOA 2YUTA 2JJQA 3SHFA 1B16A 1L6RA 3DAOA 3ZWAA 1WW8A 3I2KA 4C7KA 3PEWA 2PIDA 4FWTA 3ULQA 1E3IA 1M7BA 4RKRA 3WFJA 1WCWA 3ZZ0A 3ND8A 2R8YA 1T0HB 3SEQA 1H4QA 2Y68A 5KTNA 4QLBA 2HK8A 2M1ZA 3U3OA 4QU0A 3WGIA 4IR7A 5JD4A 1XDWA 1YAJA 3G68A 4JBLA 1Q14A 4PPFA 5L8VA 1JUDA 4ZCPA 1PWZA 3PHGA 4EPRA 3OWHA 1JDBB 4RGYA 4WA7A 1MJ0A 1QWSA 1FU7A 4IN3B 4WD3A 1IUKA 1E0JA 1JHYA 4KAJA 4KBYA 4V3BA 3KTOA 4RTJA 3EPPA 1XP5A 3IXLA 4NBWA 2GRLA 1WQ3A 1X13A 2AL7A 2WFZA 4XEUA 3WIOA 4JC4A 3WADA 3DSTA 3KRTA 1J7KA 2V6FA 4BC0A 3FZNA 1GRRA 2KBXA 1BXGA 4W9RA 5AAOA 1GGFA 4US1R 4RIGA 3SPXA 5JZSA 1T5TA 3E7FA 3QQPA 4TMYA 5GJVC 2XBMA 4B7XA 2ZTUA 4TROA 2CXSA 1JWAB 1Z0DA 2W5UA 3ZQ6A 3UCEA 3JALA 3N39C 4RWZA 4YRSA 5IZ4A 1V1MB 4FHZA 3QPWA 4KO4S 4MQUA 4W7SA 2P9LG 4ZVKA 1YU6A 3ABZA 4TKMA 1ISPA 3KC2A 1W8DA 3L18A 3S27A 3WX0A 4UWHA 4FQ5A 3ON5A 2GKGA 2PQMA 3FTEA 2I71A 4LRWA 4CT0A 1UXOA 1ZICA 3VOTA 4F86A 5JAUA 2WTBA 3G23A 1GPDG 3OBIA 4OKIA 4HGOA 2H63A 5AP9A 2K4MA 3EGXB 3CHMA 3V48A 2ETVA 3GHYA 4B71A 3FMPB 3GWGA 4DL9A 1Z75A 2DIWA 1E5VA 1IG0A 3OPNA 4X1KA 4FFNA 4XFKA 2MSNA 5EGNA 3SDSA 5JDIA 3LVRE 1J8YF 3FTNA 1HG2A 3SIPA 1QTQA 3MBIA 4X94A 5C4GB 2G1KA 1WHTB 4OQDA 3O90A 4Q1BA 5F7OA 5JH7A 2QQFA 4ZO7A 1OAAA 3AOGA 3PNYA 1B2RA 2H4FA 1UEIA 2HPHA 2XMRA 4POAA 4TV9A 1GAJA 4MUJA 3ZYCA 2QE6A 3PC8C 3QYPA 3AYZB 1X1BA 2QE7D 4FFRA 4V1CI 3ZK8A 5JW6A 1BAPA 3EFHA 4D02A 1C8BA 1ZVQA 5LLSA 4A8JA 1NHWA 3L6CA 4KLZA 4Q66C 4NR0A 3OLCX 2WTEA 2CHZA 5EP4A 4FLMA 1RI1A 3TZBA 5K3AA 3OZUA 3GEDA 2GILA 1LBQA 3EGOA 2BFDB 3S3TA 4H1TA 1IMOA 2C5SA 1NT4A 1Q15A 5AXDA 3VHXA 2EVWX 3ZYLA 4R9RA 4CFZA 2DE0X 4UZFA 5C8XA 4KW7A 4YJGB 4P3YA 1XB2A 3KWMA 4RX1A 5PNTA 3TGPA 4JSRA 4NQ0A 3WE7A 1Z83A 4CDMA 2XE6A 3B2QA 3RANA 3U5TA 5K4HA 1ZLYA 3M9LA 1I4LD 5LZ5A 5ADWA 2YVUA 5HKBA 3WBJA 1K8RA 2PUJA 3G49A 4GEKA 3JS5A 4XQ0A 3RCBA 3RFXA 3GLGB 3ZWWA 2CK3D 2C83A 2H4WA 1H4VB 1GGNA 2ACVA 2H7XA 5CVCA 4JHLA 3EWSA 1QHEA 5BRNA 4MGEA 4N0DA 2G9NA 4W82A 3QVMA 4AX4A 3H1BA 4KBGA 1RJ9B 1SFRA 2OQ2A 3I72A 4OD0A 4NK5A 1ABBA 2VNJA 3OUTA 3AU5A 5BV1A 3EF0A 3M1IA 4DG8A 3A9SA 4UEWA 3EK2A 2R7LA 5B37A 3VKVA 1X5BA 4LE1A 1GKLA 2X1HA 3PD7A 1CS0A 2C82A 2O14A 2G28A 2FUNB 4D9IA 2IUFA 2QI9F 4J76A 2IIVA 4R8LA 5I7RA 4XYBA 2OHGA 4EF4A 1U8CB 1LU9A 1Y1QA 1UJCA 5EE5B 3TEFA 5JI2E 2HQSA 4QATA 4D44A 5BSFA 1SG6A 1VG0B 3DT8A 4FJ2A 4J2OA 1LBHA 2E0IA 2PX0A 1QP7A 1H6AA 2NUTB 3K0FB 3CZPA 4JLJA 3VPGA 1DC7A 1E20A 3D81A 3WIBA 1TC1A 4B3GA 2MSDB 4ENSA 1TYAE 4UEOA 5G2NA 1OGYA 3SFZA 2HU8A 1MOSA 3KP1A 3NGXA 4I66A 4QUKA 1BPOA 4B4KA 1UC5B 2A0UA 3IAM6 5AXAA 5H68A 3UXEA 1DXQA 1A17A 4UUNA 4AB1A 3D4NA 3TOVA 1S2DA 2C5GA 3W5SA 1SHJA 5K3CA 3HYRA 3LS8A 4DNPA 1ILEA 4BVGA 1OFIA 4CL3A 5AVSA 4UQYA 4OHMA 5LDHA 2HA2A 2REQB 1GARA 1JIUA 2CN1A 3CUKA 4WBNF 1TNDA 1W52X 1YRWA 2GPJA 2VK4A 4RSMA 2OT3B 3FWVA 3HR8A 4Y1RA 3UG6A 3ZVKA 4NCBA 4A55A 5EG5A 2QROA 1QH9A 3LNTA 1J5XA 1XD2A 3OLWA 4IDEA 4TTRA 3TD6A 2IUYA 4L2IA 5KNBD 4MIYA 3K1AB 4CKXA 1VDZA 4GBGA 4UEKA 4D3YA 5CDFA 4YJ3B 1CFJA 3DE1X 5JAOA 2PY6A 2XYHA 4A0FA 4TL9A 3CR7A 1QQ6A 1I80A 4CF7A 1D2RA 2P9IG 1RWXA 2B99A 3LW7A 3OKPA 2VZ9A 3WBKA 4AYTA 1II8B 4EY7A 2BGKA 2JFFA 1LLCA 3FW1A 4LRUA 5IANA 5SZHB 3B3GA 2FLVA 2GUWA 1ECJA 3I5PA 1MJGM 3GRCA 3I64A 3CEMA 3IELA 4BFTA 4OXRA 1XZPA 1DWQA 1W1WA 1WDTA 2BEVB 5EYPF 2J41A 2JCYA 3Q5GA 4IIJF 1ZJJA 3GV0A 3W6UA 1POWA 3P1JA 2B94A 2O48X 1AF7A 3F4KA 1SC4A 2AJLI 3CH7A 3TW8B 5AKGA 5HM8A 4DDMA 3HE3A 1H9CA 3LCUA 5EKTA 3ZKWA 5B55A 1BCSA 1MPXA 2XCLA 1RC8A 3FCSB 1UXHA 4PYRA 4XPIA 3LAWA 4BLPA 3CN7A 1JIQA 3MS2A 1C4OA 4WACA 1NBOA 3EBPA 1NBMD 4F8EA 2PSSA 5KNCA 4OVVA 4D26A 1T36A 3TR5A 1XEFA 2IU3A 2DHQA 2R59A 1T8WA 3I58A 2J67A 3K6SA 3K5WA 2KSQA 4YJ2F 2FUG6 2O4CA 2BFFA 3CF2A 2FSFA 1Q1QA 3E48A 4WKCA 3SHVA 3OFNA 1MNQA 2ZBRA 4L07A 5CJJA 2AZXA 4P7GA 3QFRA 4HQFA 4MS1B 1E3DA 3VYWA 4AKTA 1AVTA 2DM6A 4XUGB 2WHQA 2IGTA 2Q49A 1AHIA 1PEDA 3NAQA 3AERB 3MWFA 2FZ5A 3PFFA 1NBHA 2ZCUA 3MRXA 3R0XA 3EU5A 2YJZA 3WIVA 5BWBA 5D66A 1M7GA 3E22B 1VSQA 2HA4A 1E2FA 1EFUA 3AB7A 2O2IA 1MAVA 4OB6A 2C5AA 1EWYA 4RV5A 4W1RA 5F35A 5FNZA 3CRQA 3QZUA 1XWFA 5A06A 1NUTA 1UCFA 2EBWA 2FW0A 2XA9A 4HB4A 3RRNA 4RORA 3ISVA 1KARA 4R9VA 4IYPA 2JA1A 4S1PA 1AD2A 3IHWA 5CLHA 5IARA 2P5TB 3SZ7A 5KOHB 2CHUA 5IW8A 1LBEA 4COKA 4D96A 3KL2A 1LNSA 4F2GA 5DF1A 5DGHA 5TQJA 3VC1A 4WNEA 1UKZA 4GS5A 1TM4E 1Q84A 2XUDA 5L7WA 2OLEA 4M1WA 4MVJP 3TTVA 3WSWA 4H16A 5ARGA 5K4GA 3LW8A 5G41A 4NBUA 1DEOA 2Z9DA 2OBXA 3OPVA 2HA5A 2Y67A 1MX5A 4Y2SA 1GR0A 4DLNA 4MWEA 1CU1A 1EBFA 5LP6F 1VB3A 4N3CA 2BHLA 3M4NA 5JNRA 4JI8B 4IOKA 1ZS9A 3G2MA 1DEXA 3ESRA 1TK3A 3F6SA 4L6AA 1JR3D 4GR4A 1Y1TA 1YDFA 3GFFA 4ZDIA 1X86B 4UU8A 4L8YA 5TQVA 4EX7A 4CUKA 1PS9A 4GTMA 1F3OA 3BG1B 1VL5A 3I4LA 4A03A 2AR0A 1H6DA 3ABQB 2QU7A 4P92A 3SHQA 3SOZA 2HTFA 3Q1LA 4BO0A 4QOIA 1UC8A 1W0JD 1YB2A 3QM1A 4JENA 1FNMA 2P9EA 4KPUB 2PFKA 4NOLA 3T5DA 4ZYXA 5CDYA 1JEJA 4OLHA 2HT6A 4CG3A 3I5XA 2OCKA 1RZ4A 1IPHA 2FR0A 5CFRA 1KJ8A 1PU2A 2EWWA 4ZYTA 5K8LA 4CF4A 2EIKE 1IEQA 2RI6A 2HA7A 5KTOA 4I1MA 3E35A 3HJGA 4Q01A 1GAWA 4AN4A 5IT0A 1SHZA 4GTVA 4Q4JB 3KDPA 4ZV4A 1E63A 1QPGA 4ZVNA 2WJPA 4HORA 3CX6A 3EEFA 3UAVA 1LQUA 4D6YA 1GCIA 4R9SA 5LL6P 3E4BA 1MOZA 2G1AA 3VZRA 3SBXA 1EUCA 1FYDA 4UTOA 1UBCA 2WXNA 3KFLA 1NUHA 4EMUA 3O31A 2FPPA 4FDTA 4RTSA 3KXPA 1CJSA 2HBQA 3RRFA 3M6WA 4QC2A 4YAWA 5G0UA 4YRZA 4BMPB 2EX4A 4JMLA 3MFYA 1J8QA 1VMAA 1ZIPA 3NKFA 4V0SA 3FTSA 3D64A 3RI3A 2OM6A 2X9NA 1K8XB 1H6PA 4NVRA 4XIIA 3FPLA 1V9CA 2RGWA 4OVUA 2V4HC 1QHIA 1KVQA 1WR8A 4U1RA 3SX0A 1BYUA 2V74B 1T9KA 3PKIA 3SLKA 3UAWA 4N7RA 1FMFA 3FEYA 4NCHA 4NOKA 3K94A 4WA8A 5EZQA 4I1IA 3EIFA 1FXUA 4PH4B 3H9CA 1C9NA 4IGIA 2C2ZA 4BNMA 5L51A 5EN5D 3O1IC 1W5BA 3W1WA 1DJNA 4O2BF 4CCSA 4ZCIA 2A6PA 3CSFA 1D1PA 5HWSA 2RH9B 1UMDB 2D1RA 3OWOA 4LK2A 4TL8A 1RLTA 2O1SA 2R65A 1C7ZA 4ZODA 5A1JA 1M8GA 2G4VA 4KQIA 1GEGA 4BDSA 2QC9A 1TF7A 1LA2A 2Y1WA 3CLTD 3FOWA 3F73A 4GGPA 2GS9A 4Z3DA 3FPFA 1Y8MA 1DJOA 1YVUA 3BEOA 1JG6A 2GARA 3EAQA 1CB7A 1XLTC 2HNKA 1Q7GA 3H1PA 4XLLA 4MWGA 3V7NA 4CKCA 2HRDA 2WWXA 4ZZ0A 4MV8A 4NJEB 2CV1A 2R00C 3DBSA 2ZQYA 1KF0A 2AUNA 2CCGA 5JHAA 3L9XA 3ZXXA 2G06A 5EJGA 3CQCB 1LS6A 5ICFA 3ZBUA 3V2UA 4JI0B 4WLOA 2G5GX 3EWNA 1OX5A 2PHZA 3EXIB 5ES3A 2OPBA 1I6KA 2PMWB 1U0RA 3NOCD 3L6UA 5JCOA 3TZQA 4CF6A 1KYWA 2V4UA 4CN8A 4YUAA 5EOVA 4GYYA 4L0MA 1BOOA 2ZDQA 2YW2A 4LHSA 2J7KA 5CXUA 1ECLA 1B74A 3HUUA 4DGQA 2X13A 1BTOA 2YMPA 4KX3A 2X6KA 2XGMA 3LG2A 4P54A 5F3RA 4R7GA 3WHPA 2VHUA 2PX4A 2YJTD 5F2NA 4JI6B 3SFTA 3TECE 2ESRA 1CY8A 2IEYA 2JHAA 3V8RA 1E6MA 4MMZB 3TTTA 3UNXA 4OKSA 4J0UA 2W37A 3ZDCA 1N9ZA 1H85A 2AXEA 1FPQA 1HFWA 3CUEF 4B0ZA 4XGRA 4F93B 2XYGA 2V8SE 3O26A 4L4ZA 1W4ZA 2YV2A 3G7UA 2IUUA 5I9NA 5K0SA 4F46A 2HLDD 2OCBA 2CT8A 3O82A 2F43B 4YP1A 3ACBA 2NP6A 1HDGO 1DKOA 4LOIA 3HP7A 4YACA 3ORFA 3ZGOA 1BW9A 4HEHA 1V71A 5BV0A 1YASA 3CRZA 4PLZA 1RRPA 2VHZA 3C5RA 1A5AB 3T52A 1YRHA 2QU8A 2X3UA 4RKYA 3RRJA 4NYJR 1W6RA 3AKEA 2FSUA 3KT8A 3QWAA 2H2IA 3AS8A 2JEYA 3LK6A 2Z4RA 2V6JA 5BOVA 5SY4A 3GLHE 2I8CA 1HPLA 1LTXA 1Y6ZA 4QFBA 4ZALA 3N0XA 3APDA 2FPWA 3U4MA 1JKMA 2BGUA 3TD9A 3C8DA 4URHA 3VPDA 4IUYA 3E5MA 3DBLA 4EEKA 3LKDA 3NHAA 2B6HA 3E9NA 5KNBH 1YFLA 3BS4A 4IZIA 5J2UF 4PLHA 3MOSA 1N9KA 1NQTA 2HZ7A 3QEJA 3S5UA 1JPJA 4D46A 4DJEC 4ZHQB 3DZCA 4BMZA 1M1ZA 2FV8A 1R0SA 3F5QA 1K5GA 2YV3A 3PZRA 3TXYA 3ZHCA 2RB4A 1SXGA 2I3DA 4GM4A 4JEMA 3C3DA 1G8MA 2HADA 3F5SA 4RKEA 4YRBA 5LUAA 1JWGA 2IP1A 5ALXA 3TQQA 2PUBA 3BTSA 4BEJA 1FJXA 4YJKA 4WZAB 4F5YA 2X41A 5EJ4A 2E5FA 5KWIA 4DMCA 4GL2A 4NV0A 4LF8B 4YMSA 2X6FA 4RY9A 1IFXA 1L5VA 2OCIA 4D5GA 3FVRA 2NVWA 1TW3A 3IAM1 5AHOA 1T0IA 3HXQA 2F8MA 1MX6A 1T9HA 1A50B 1SPBS 3IVCA 2FVXA 4IIHA 4A6PA 3P27A 2UZ3A 1JDNA 1NVTA 2CSXA 3ZGLA 2FZEA 4B73A 2CDRA 4N0EA 4KUHA 3WYGA 4TKVA 2NO4A 4M8LA 3FYSA 4JB3A 5EWMA 5BUQA 2XWBF 3PFHA 4FKBA 4RA9B 2VK1A 5CHYA 4UHEA 4PVCA 3IJPA 4HGZA 1R4NB 1CEYA 1PK7A 1P31A 1PR0A 2ZWMA 1EK1A 4KRGA 5JMPA 1KQPA 4IF6A 2X7JA 4CWAA 4M8KA 3E05A 3R7RA 4HYYA 3U1BA 5FIOA 2ZROA 3I9NA 3VFDA 2RB5A 1YR3A 1O89A 1HDCA 3AUYA 1YI8A 3NGMA 5KSYA 1ST3A 3QHQA 3EY9A 4KHZA 4NJOA 3SYNA 3G0OA 4CMEA 1I4DD 1K4MA 1RAFA 5FWYA 3IDAA 3N7UA 4MS4B 2OV6A 2I1VB 2X22A 1XZLA 4ILIA 5AOBA 1DINA 7MDHA 4UOQA 2O05A 3UHFA 5FL7D 5IVIA 4QOEA 4ZT4A 4PC6A 1KRWA 1PD1A 4UU0A 2KPOA 1OYVA 1LDEA 3KXLA 3OUZA 1TLTA 2D13A 2KI5A 3QUAA 1YNSA 3G9UA 3LYAA 4M9RA 4L78A 4FUQA 4TT3D 2A7XA 1SZJG 4INPA 1SXJB 3S7FA 1BU8A 2GFQA 3E2MA 1PTJA 5ANLA 5FLYA 1IVSA 5IAEA 4KAFA 3NONA 4GX2A 4M7RA 3WLFA 4Q48A 3ZE8A 5L95A 1L8QA 5LYJB 4M4SA 3WWEA 2LPMA 3N74A 3O4VA 3PK0A 1FDRA 1UOPA 3URZA 2GVNA 1E94E 2JLAA 3LF1A 3HB9A 5I7SA 4BPRA 2OYCA 1ACLA 4ALMA 1BE1A 4ZHQF 1E79A 2IPAB 4LECA 2XGGA 4GPEA 3RG8A 1YR8A 1RWVA 1UOQA 3B53X 1R10A 3EA4A 2VQDA 1CZHA 3NHZA 1PVVA 4ZYZA 4MR8A 3ONKA 4YCBA 5C5CA 4JR1A 3IIKA 1J2EA 2K7ZA 1YR9A 3E22A 4MQ4A 4HNVA 4LZAA 4N3GA 2GEVA 3ELUA 2LBPA 2ANCA 2D8AA 4JCCA 1RXUA 1B26A 2UZ0A 4JY7A 4L5BA 1A7KA 4R5HA 4I9NA 3ACCA 5A3SA 4YXFA 4XOUA 5K1ZA 1BD8A 3EGEA 1TRKA 3QLVC 3L49A 3QKRB 4BVKA 3FOAA 3SBSA 2XCIA 3JX9A 4I4LA 2NXNA 3C5CA 4LHEA 4YRJA 2VAVA 3THSA 1LWNA 1XG5A 4BMDA 3NP9A 2AX3A 5KCMA 1N7HA 1IM8A 2J49A 3WYNA 3PE4A 1FFXA 2A9OA 2F9FA 4B3TB 1UKCA 4HNAD 4GI3A 4UFPA 4RLYA 3Q0EA 3E9DA 3DCIA 2NSZA 3H6HA 1AOXA 2QTRA 2I4MA 4J0IA 4MI6A 1OZ0A 2ZYAA 5JJKA 3SR3A 1RZRD 2XDYA 3ZD7A 1XROA 3UJNA 4F3KA 5F4BA 2GO1A 1JFVA 2FF7A 1X3LA 1A8QA 2BR4A 5TT1A 3FSGA 16PKA 1IE3A 2CLEB 3CLHA 2G88A 3P0JA 3I4GA 5ICSA 2RKWA 4HYQA 4P29A 5F7JA 3TWTA 3WB0A 2E4ZA 4J0CA 5CVJA 5DM0A 5F73A 1RYHA 1EUDB 1NMSA 2Z8YM 4WCFA 3SDZA 3T0GA 3U7RA 1Y6FA 3OCWA 4UOZA 4EZEA 2VUSA 1SY7A 3G8BA 4TMKA 1YR7A 3TMKA 4BE7B 4IDCA 1Y89A 2NADA 1GZ6A 1NXTA 1OROA 1Y9EA 4RK1A 2QGZA 5JS2A 2RJ3A 1Y6JA 3H18A 4KFSA 2JG3A 4MWDA 2HF8A 5ITSA 1N2BA 1NQVA 4IQ0A 4QYXA 1JR6A 2NAPA 4GXNA 5KQRA 2QSYA 4L51A 1I3NA 1KAOA 2Q2VA 3A27A 3LQ4A 1LNQA 2QX8A 4Q1CA 4U7HA 5GGYA 2ZANA 5B64A 4KVFA 1J0AA 1NKVA 1WULS 3VSBA 2RKOA 5BW4A 2H1LA 5GTDA 1A04A 3ZS9A 4EM6A 4ZQHA 2ZULA 2YNMD 4YMTA 4FCWA 1Z3IX 5FNVB 1DAGA 1NF2A 5EEHA 2BGWA 4YUXA 1NSYA 4O4LB 4G9GA 1W5FA 2ODTX 2B35A 3EJ6A 3ESDA 1R6UA 4GEGA 2I4NA 4IMPA 2R5NA 4NG4A 5IF9A 3KPJA 4ITVA 5ITWA 5KJNA 2H7YA 2WFLA 5IG2A 4I9EA 2P8SA 2BM1A 3KZVA 2GBFA 1JA9A 1E96B 2DVWA 1CX9B 4N5CA 2F3SA 1OCOE 3ABSB 4J1QA 3SSMA 1PJTA 3BGOS 3EMDA 4FNMA 2D59A 2BFAA 4N6OA 3T9BA 3TNDA 1VTKA 4Y6QA 2ZSUA 3VTXA 1G5RA 3NC0C 1FTSA 1XJWA 2YOHA 4BMVA 1K8ZB 3RYTC 5JS8A 2I8AA 3R6WA 2GD0A 3I4RB 2DSNA 2MSLA 1YMPA 1GNQA 3EYAA 1I9GA 5FLEX 1Q0LA 2QQ5A 3TW4A 4FHKA 1F5NA 5KJEA 2IYAA 4AKEA 2P77A 2QN6A 2YYZA 2KCLA 5M7EA 3TI7A 5ALZA 1J23A 1ACMA 3I4CA 3P7MA 3RAGA 1NF3A 3JWJA 5JQGF 5JU6A 1AQYA 4QDJA 3EVGA 2RMKA 4IJWA 1Z36A 4P4UA 4YYZA 5KYXA 1QV9A 2G4CA 1U8AA 4RGQA 1RWQA 1HFJA 1L7DA 1U6JA 1M0TA 2ZIVB 4NL4H 4OOEA 2X0JA 4PSVA 2JVKA 2XXJA 5CBPB 3VKGA 1G7SA 5DP1A 1L5MA 2MMGA 2J85A 2G17A 2ETCA 2HPZA 1US8B 2MDTA 3HDHA 4NQRA 4L8WB 3H4IA 3IULA 2VPZA 4Q7QA 4ZI2A 5DNUA 1PJ4A 2P6RA 3O8OA 2AQ8A 4I1VA 4WZBA 3AVPA 2JPDA 1E6UA 3EIJA 4BV9A 4D0SA 5F98A 5G0TA 3QKYA 2R84A 2JCBA 4N7JA 3UH1A 4XJTA 4BKMA 3NYWA 2P0YA 1IB0A 3H1AA 3OTQA 2JIOA 4W9NC 1P1HA 1RI4A 1S2LA 2BEUB 2YC2C 4MI1A 1WXIA 2ZZMA 1XQYA 1I5EA 1FK8A 4PZCA 1JCQA 3G13A 3ANXA 3NIWA 3ZYQA 1A5BB 1S9DA 3AF5A 5ERXA 4WLEA 4BVEA 1QYIA 5IXYA 2QGNA 2O3RA 3E9CA 1ACJA 4GC9A 2RDMA 2BTDA 2P2ZA 4RKQA 2ZIEA 1Z22A 5EINA 1MC1A 2I6GA 4DWOA 3IJEB 5HNKA 5EE1A 1P75A 4OFXA 3EW9A 3ZKJA 3DV0A 3RROA 3VSEA 1EJBA 4OA5A 3D5EA 5H4HA 1O94A 4Y9UA 1G4HA 3LK7A 1TFUA 1XGKA 3T7DA 5FCDA 2F4NA 3IQFA 4FD2A 4K8RB 2BM8A 3RH0A 2IL1A 2VT3A 3Q40A 2V3CC 3W7AA 2OV1A 3LCAA 1QRAA 2D0OB 2CYCA 3GW8A 1WTCA 2W7TA 3FF4A 2A30A 3ME5A 1AXGA 1C8KA 1OXXK 3JATA 4GZMA 4PU0A 4H7DA 5BXOA 2YBEA 5JBQA 2J4CA 2J48A 1ZD8A 3HHEA 2R0QC 5KDDA 2XF2A 2HPAA 1RBZA 3N5CA 4AL4A 1DKQA 3F6YA 3USZA 2H0QA 5H3CA 3C39A 3NEYA 2NN3C 2D2XA 4BCCA 1P6QA 2C4TA 3GYZA 1EB8A 2HX1A 4BB0A 3NJRA 3QWPA 5T8KA 4DDHA 3ZTWA 2FEOA 5ANRB 3GNTA 3NMUF 2VJNA 3LUAA 4Z5XA 3GK3A 3RAUA 4FCVA 1YCSB 4N2QA 1X0XA 1XCBA 2WZQA 4DCMA 2V7WA 3DLCA 5NLLA 1P62B 1K86A 4TX1A 1H42A 5CCMA 5DCWA 3FUTA 5BO5A 1Z29A 3DMYA 1E2GA 1V47A 1YS6A 3KEAA 2QXUA 1GNRA 4HLUA 2OGTA 5JZOA 2ZYRA 2FF4A 1HOXA 1RD4A 4KB5A 3TJMA 2PUTA 2Q4RA 2D7CA 2BFWA 3GF4A 1OZHA 3DKPA 4YT8A 3OFND 4MW7A 121PA 2IBSA 1KVTA 4R8MA 1RYYA 3N6XA 2ZT5A 2XLCA 4D97A 5C8VA 1F9EA 1NBME 1G3RA 3SS7X 4UQLA 3ORYA 2DQZA 4HDAA 4F96A 2KM1A 4KV7A 2QVZX 1A97A 2GM3A 2IYYA 2QSUA 4FXPA 4MKIA 4XWGA 2V0NA 3KXKA 3JWHA 4Q4AB 4B44A 1QM5A 3PC6A 1UMBB 2M6KA 1D07A 1DIRA 3L8DA 3LUKA 2OHJA 3KK0A 2R03A 1R4AA 2WIBA 1BNCA 2X4IA 1XPJA 1MAHA 4AZVA 4HGYA 1TN7A 2JFPA 2O8NA 5AJDA 3T7KA 4C3ZA 2NYRA 3DLHA 1VKJA 2A0XA 1TYCA 5EUBA 1SHTX 1WSWA 2W93A 1ZVVA 2AJ8A 1YC5A 1X14A 1IMJA 4K9DA 4XZ4A 4I55A 1L5NA 1CDEA 2BKGA 3AKYA 3KM0A 3HXFA 3O3MB 4WRRA 1E4VA 2VRCA 3AUTA 3KQPA 3KD2A 5TQ2B 5T7BA 3ZKAA 3B12A 1U7ZA 3KCNA 4Q02A 1TIKA 3W04A 3SQMA 3E53A 3X3HA 2ENUA 4ZAGA 4UDNA 4AO7A 1MQ8B 5DEIA 4BO9A 4G0WA 1JHRA 1M83A 5DMHA 5EZYF 3QE3A 2VSNA 3JU3A 3TE6A 1GT6A 3S2AA 4G8JA 4QNNA 3ZHZA 1B15A 3QUTA 4JYZA 1WZEA 3NOXA 4H7EA 3V4VB 1SKMA 4B3SB 3BC1A 2OO5A 4RIIA 2FP3A 1QYRA 2R87A 1UPTA 3PUVA 4TTPA 4UQOA 3M6LA 3TI9A 5KHLB 3ZHRA 5ALTA 7MHTA 2XCCA 3OICA 2BUGA 4QBIA 3HXPA 1OFGA 1NL3A 2H92A 2FB9A 2HO5A 4R0VA 3CRMA 2NVUB 3UM3A 3UUGA 3T9KA 2P3OA 4DAOA 4UI9K 3O4HA 4EG4A 3IMCA 3NAZA 1M1YA 1SCQA 4RVHA 4F7DA 3ZY4A 4GL4A 1XXHB 3VDNB 1X8LA 1UKYA 1EYZA 2P90A 4KX5A 4U2GA 1AHHA 4HDNB 2X9QA 2OV8A 3PHLA 3WGHA 1ZSNA 1YA6A 3V31A 2RJOA 3AM3A 3DEYX 4GR5A 4KI7A 1XAHA 3VI3B 1JJAA 1A95A 1EESA 5DCLA 1ENZA 2HY7A 3B9QA 3CKYA 1K5PA 2HH9A 2GPNA 3N5KA 5G0SA 1VGVA 2PBRA 1WD5A 1XCPA 3WA6A 2JH8A 1Z3XA 3PHCA 2PWZA 1DKMA 2NSHA 4DUGD 2NXCA 1EG2A 1E62A 2OKGA 2XCBA 2P4UA 4E70A 2ZCJA 3LLVA 4OBEA 2PN1A 4BFYA 2FMFA 1XKXA 4D0RA 3AJDA 1KQ3A 3A1FA 3QKTA 4L27A 1O57A 1TL7C 3A4LA 2RHMA 4IJKA 4MICA 2UXDB 1MR3F 2C2KA 2R7AA 2IJGX 2J3IA 3RRMA 5GJCA 5JT1A 2QY9A 3EHRA 4BNYA 2JBWA 3FDZA 1XP8A 1XTQA 1GDHA 3STHA 1RRCA 3HR7A 1V96A 1ZINA 2J59A 3TD2A 2X40A 3OX1A 3QDNA 2R11A 4Q96A 4YVOA 2WXFA 1ZFNA 3C6ZA 1EKXA 2NQ2C 3DXFA 4IZ6A 5D6NA 4MR8B 3OHPA 3UXYA 1QG6A 2YW9A 3IP8A 1HS6A 4ND1A 2AIRA 1G5FA 1KGSA 3AY0A 1JH8A 2VFAA 2JHCA 1RTKA 1OUVA 1E9AA 1Y4AE 4XI9A 2GVZC 3KT0A 2JEOA 3NZEA 5AKYA 3JAMA 2YIJA 3M1AA 4EP1A 4LG1A 2XPZA 3X1DA 3BORA 4DCJA 4JU8A 4X3PA 1GPMA 3BD6A 4DR6B 3ECSA 4B80A 2PU7A 1LCIA 2VSXE 5SYNA 1BDHA 2A7QA 2QRHA 3LLSA 4YAFA 4ARIA 2Y0BA 1IBLB 3IE0A 2RE8A 1EIWA 4NXMB 5T4FA 1M6VB 1RXCA 3OLQA 4Z7OB 5HOQA 1PYOA 4EG1A 3OEHD 4BBJA 1PDWA 1W0CA 4XD7A 1SUWA 2AWOA 2ERXA 2OWEA 3AG4E 3KPYA 4RLHA 3D9MA 3EIWA 3TL3A 2WHEA 5T3YA 3EGWA 1AG9A 1MOQA 2ZBQA 2W83A 4PSCA 1NXSA 1PQWA 1IHBA 2O59A 4KRFA 3Q2IA 1OWOA 1IU9A 4U0SA 5A5FA 1IAVA 4M55A 5BPFA 2WXGA 1JECA 3AU9A 3B1ZA 4DDTA 3DCNA 3ROQA 1WP4A 4YDEA 3DZBA 5BWMA 3B48A 2P30A 3I09A 4ZDJA 5E1MA 3TF5A 1JX6A 1RPJA 5IDVA 4BSZB 4CE6A 1YS7A 1YZ3A 221PA 2AGVA 3FYDA 4UU7A 4K9RA 2ZISA 4EHLA 3KYJB 4CZ2D 5ICCA 4Q16A 2ZSAA 1S1MA 1I1NA 4LVUA 3V4SA 1Z7EA 2VF4X 1QCDA 4D80A 4LAFA 3ASDA 3TX6A 3G2KA 1CZKA 5EWLB 4B2LA 1GTRA 4H3HB 3ZPJA 3EIQC 2C9DA 4K03A 2HV9A 3HJAA 4DCVA 3AP1A 1HMYA 1V8OA 4F1SA 1Y6RA 2ZWPA 5LFAA 5EMNA 4DDWA 1TT7A 4AM9A 3CBGA 1X81A 4YXWA 3TSZA 1SXJE 2XBUA 3CPEA 3UQ3A 5LD2B 4KRYA 1FFCA 4AP9A 2DZNA 3FUCA 2X2FA 1UT6A 5IN5A 5LN1A 4WBNA 5AIBA 3R3VA 4KQ6A 3NGLA 4QYIB 4BNXA 1M6YA 1SOWA 3BILA 1RJGA 4TZKA 3DAHA 4RC9A 1I2MA 1NBEA 4I1OA 3Q78A 4K9MA 1YB7A 1XVTA 1F2DA 2QTVB 4YRNA 3IEIA 2PS9A 3LVFO 1SA0A 2FWMX 3VH1A 1CRLA 3MKRA 4M0UA 5SYAA 4I55B 3RT1A 3RVNA 1J56A 4PAWA 3PYXA 3CNHA 1Z45A 4LJ6A 5DOZA 5BSRA 4YJ3F 1BA3A 1T9ZA 2B2CA 1EDOA 5ITZA 3V4FA 1YVPA 4Z86A 3BHMA 4Z4HA 3RV3A 3OTOB 2JATA 1SG9A 3HGMA 3KAEA 1SWWA 2AG5A 2PX6A 3BBLA 3JR3A 2QRVB 1ZEMA 3NHYA 4PIPA 3CZQA 5B3JA 3ZV5A 2GPAA 4Q4AA 3WGKA 2OK7A 4BNWA 1MH9A 1ZOLA 5EJEA 2ZE7A 2DPLA 1IK6A 2QP9X 1MX2A 1FMJA 4DCUA 5F3DA 1CLUA 1Z34A 2QJFA 1V35A 4ZI7F 3DUFA 5IDXA 3R6GA 4IV5A 4N5IX 4Q3DA 2Y27A 4AF7A 5DYGA 4PXYA 1Y9AA 3PYMA 5G2OA 3PP8A 3G2LA 3EBOA 4FMDB 2ZM5A 1JEYA 3CQ9A 2WVHA 4PICA 2C84A 2PR7A 3TKYA 4BC1A 5FJJA 3P9NA 4HNUA 4IKOA 4M0CA 3GAAA 2XXBA 3C3XA 3OFJA 4QTUB 4BBZA 4URXR 4Q93A 3CVWA 1DAMA 1A2KC 1YZTA 4JA9A 2EC5A 2F0YA 1GADO 3IP7A 4QYSA 2H6EA 1IN8A 1NJGA 3GQBA 1IPEA 1J4AA 1U1CA 3IIJA 4P35A 4G9BA 1R8YA 3WB1A 4CV0A 3RUPA 1U3VA 4RZXA 4GZ5A 5K6RA 4Z4GA 1YFZA 2IP4A 4JLOA 3UOAB 3QBDA 3K9WA 2YS7A 3BN3A 5FPPA 4D4MA 3L1UA 1OTXA 1H5UA 4RZHA 4ENTA 1OZFA 2IYFA 1CP3A 1DAOA 3D9OA 1E9CA 3I3OA 2PL5A 1NMXA 4BFRA 1KPHA 3P9XA 4MPDA 4BOYA 3EOZA 2OD2A 2FAXA 3IIIA 3H5AA 3W7BA 4M7CA 2WIJA 4RKFA 2Z08A 4A10A 5LLDA 4GX5A 4N48A 5CB6A 4E13A 3HXKA 1JU4A 3U4DA 1WTAA 1NXWA 4X62B 3E37A 5CM8B 3AHGA 4AMZA 3TS1A 1FYWA 1F17A 4XRRA 1I9CA 4HRVA 4JGBA 4MRSA 2Y1FA 3BZUA 3P9ZA 4WW0A 4HGQA 4K88A 4O25A 4WGFA 4EO4A 1RYZA 4WE3A 2V3WA 1DIGA 1WG0A 1U90A 1X19A 1SK8A 1KFKB 1EZZA 4MUBA 2NV6A 2WRZA 4RZQA 4U6NA 5DOVA 4TRQA 3SSOA 3EF3A 3ZQ4A 2W48A 4ATZD 2WTXA 2C00A 2ZE5A 1TMYA 1JG2A 3KZXA 1A8HA 3SMQA 4IDOA 3GBSA 4INAA 5CFOA 3T1HB 4ZHQA 1R3DA 1IBSA 4NEHB 4DNFA 4A8PA 1W36B 3MNFA 1O8BA 2F8SA 1ZSYA 3KLNA 1F14A 5JQGB 4BX9A 1ADCA 1U8UA 2ET6A 4G5YA 4OMDA 4H77A 1QFMA 2BMDA 2NU6B 4V2UA 4JQZA 1EBUA 3L8CA 1OIWA 4LCEA 4QXPA 2ZK7A 3D0OA 3ZU3A 4DRXB 4OHYA 4EI9A 1N2ZA 2R1UA 5THXA 1ZJZA 4MWOA 1DBQA 4NPCA 2HHHB 4QDTA 4I81A 3ZDZB 2ACEA 1ITZA 3DAPA 1RJEA 3MINA 4II7A 4C0EA 4PCUA 1RBMA 1BQ4A 3RC7A 4HJRA 1PJSA 5GPBA 3MMZA 4FR0A 4GT1A 1DC8A 1W2HA 4JYPA 4QJBA 5K2MA 3N53A 2NACA 5AW9A 2I6HA 1V95A 2V7TA 3ZZTA 5CERB 3EZYA 3C1TA 4BNNA 1NFFA 3KSAC 2VF5X 2F2TA 2FFQA 2P9FA 4TN1A 3S29A 4BWVA 5CK5A 5LQUA 4X85A 4Y6SA 1ULTA 1E61A 3PT5A 3ZUGA 4PO3X 3X2FA 3AKZA 1RFGE 3ZCPA 2UUAB 3TTWA 1XL0A 1M1UA 4B33A 1B0UA 1BU5A 4UBNA 4KPUA 2I2DA 3PREA 4H3VA 3OIVA 5AJWA 4YAKA 4DIUA 3NO4A 4PN3A 5B30A 2ZM6B 4RS4A 2LVBA 2C99A 2ZIZA 3JWPA 3HXOA 4QGHA 1RYBA 3IXQA 1KPGA 3KWLA 1QO9A 3OPYA 2FX2A 1QXSA 4JW1A 3CV0A 3KLMX 4TTAA 3F3SA 2C2OA 2WVIA 3OPYI 4RK6A 3W2GA 2QRMA 4BP1A 4EY6A 4K9NA 2H1WA 4PXSA 3CEJA 4NICA 4EG6A 1O77A 5JWOA 5I47A 4OI2A 3TTXA 1QAQA 2OCDA 2VWPA 1VJGA 5BW8C 3BCUA 1NW6A 3GVPA 2COUA 3G6WA 4D8VA 1KPIA 3X1JA 4DSUA 2AXNA 4K26A 1BS1A 3U3XA 3WLRA 1NMZA 4YMVA 1RLIA 3FKJA 3MWEB 2JJ8A 4BETA 2QX6A 4FDUA 2IO3C 1EWQA 2ZI9A 5LVAA 5KOHA 1GG9A 1KMQA 2WD7B 4YCNA 2BGIA 2VAWA 3HBMA 4K5AB 1BMTA 3R9AB 1ULZA 5AW7A 2XWSA 5IVDA 3SHTA 4HLEA 4P9NA 5A5EA 5G4KB 5LCWJ 1ONBA 4FYXA 1M7HA 5LPNA 2P9NG 2Y1GA 1NT2A 3DF7A 1H5QA 1NY6A 1X15A 3R20A 3IHLA 5L3QB 1MJHA 2QG6A 3KQYA 5HZKA 4HVTA 3EVCA 4XIGS 1TNZA 4RH0A 1SRRA 3TQCA 4A27A 4YFYA 4YLEA 2HXSA 3ZHUA 4YRIA 3BRQA 1T3LA 2OECA 2ANBA 3FYHA 1S8FA 1GKIA 2FZCA 1OC4A 2R7KA 3FFWA 3NATA 1QFJA 1Y42X 3NLLA 5HFJA 3SVZA 4Z7QB 1GPAA 4YT2A 3H9JA 2I65A 4LQCA 1UINA 4KE7A 1USIA 4N40A 4UHFA 3QFHA 2BKVA 4M46A 2ODQA 1N2HA 1OIVA 1TAQA 1ZUWA 2FKAA 1FDVA 2G4LA 2GLUA 2OOEA 1N0UA 2J87A 3MCVA 1ZIOA 3WTBA 1RMQA 1XYVA 2BFFB 3F9IA 4ARUA 1BEUB 4MLPA 4LJ8A 4ZHSA 1WNTA 1U7DA 1M0WA 2X9GA 2CWDA 4BASA 1JHAA 2OESA 4ZT6A 4ETIA 4W5OA 1HI9A 1AWCB 1A4IA 4I5FA 5HJ7A 4IHJA 1TADA 1DE0A 3BIXA 3GL9A 4E2WA 3A1TA 1ONPA 4NQZA 1FFWA 1BCSB 1PX2A 2GFIA 2V7GA 4QVGA 4RSRA 4RD1A 4HOTA 1MP0A 3B8HA 5DHFA 1N2CB 2XSZA 5FULA 5J59A 2INGX 3A04A 1SQ5A 4MRMA 4DM3A 3L6AA 2ZIXB 3DB2A 4QVIA 4HN4B 3ENVA 4I4CA 3DQQA 4DLPA 3WLQA 5CDTA 2G40A 4NULA 3DZ8A 4HF7A 2ODAA 4DS3A 2P78A 2XQ0A 1NVKA 2ASVA 3FSRA 2V97A 4E46A 9ATCA 1ZHHA 2ZU6B 1IHYA 3I0ZA 3ZXYA 3WG7E 5J43A 1SA5A 2XADA 3K1ZA 5LNK1 2AFHA 1YBVA 5LQAA 2W6QA 3AUFA 3MYVA 4IGEA 4R9NA 5AVJA 4B7AA 2X0DA 3ENWA 1L1EA 1X2BA 2C7RA 2DU8A 1UP6A 2AKYA 2C29D 1LLQA 3H8SA 4MPTA 4OQMA 4R68A 5TE9A 1Q6ZA 5I7VA 3SGHA 1QK3A 2AZ4A 3GCZA 3T7RA 4RAOA 3CSDA 3SC6A 2RIPA 4DEYA 1WY6A 3NWBA 3QOYA 3PDWA 2EEPA 2X5NA 1RM5A 2Y1XA 4HDRA 3UXMA 1A1VA 2X5KO 4KIWA 4RAQA 3D3QA 1CZOA 2I3GA 5D5PA 4CMCA 3LC2O 1HKUA 2WV9A 4NABA 1GPH1 4OLFA 3ZLJA 4DMKA 3ERCA 4ZKEA 5HSGA 5JMTA 3AI3A 1J99A 3CH6A 4M0MA 5AESA 4Z9BA 4FZVA 3QHAA 1C9EA 1J25A 1W1IA 2IU4A 2IYRA 2KBFA 2JI6A 2PRKA 2AF4C 2Q28A 4J7XA 4P4GA 1Z0UA 2ZUWA 2M6LA 5HGXA 2YNMA 3NWPA 1L7OA 3KZKA 5G02A 1W4LA 2F3RA 2PXXA 4BVLA 4O1OA 2A9JA 4ASUD 2PSHA 1NMEA 1LLUA 3QITA 4FIZA 3T7JA 2GJ9A 3P32A 3L0SA 2GRPB 2AG8A 4D4LA 4NE7A 5MFPA 3A0RB 1Q5PA 1XQVA 2V65A 2V8OA 2NO6A 4FI3C 4DIKA 2R25B 3EXHA 5KHOC 3SVLA 1YKGA 4WSOA 3OJCA 4RLQA 4XB6B 3UA3A 2UY1B 3G0CA 4LRQA 1PJCA 4ZA2A 2QZSA 3TZCA 3TL6A 1YKSA 3PWKA 3ZEAA 1JVBA 1Z17A 2Y0DA 4IDFA 4LV5B 1KJWA 3LRTA 3JQPA 1LSSA 1ORDA 4I5EA 1C3XA 3JQQA 3A3KA 2VP3A 1KH1A 3TN7A 3VBEA 2E5LB 4TUYA 2GCOB 4YBZA 2NNLD 1XDSA 3DFIA 4LQ4A 3I12A 5E2AA 5EWMB 2QRVA 2VSOA 3E3AA 2X0NA 2PZMA 3CC8A 4GMKA 2BTQB 4YY3B 4K6GA 3DSUA 3GXBA 5A4MS 5ALVA 5BN3B 3I2FA 3FROA 4NNJA 2AVPA 1T1JA 2HBZA 2B8NA 2OENG 3E2IA 3JQCA 4KNVA 3DCYA 4KTTE 3ZBPA 4NAUA 1RZRA 2XXAA 2XF8A 4QDKA 1B4DA 5JYCA 1PJQA 1KP2A 3OU6A 3DRAA 1RJWA 1EFKA 3L41A 3EXEA 1BD4A 4DMFA 1TEVA 1TJ3A 3RU0A 1Z6YA 4TTTS 2ZTMA 5EQTA 1N3BA 3VI4B 2B82A 3LSTA 1UKBA 1ATIA 1MQSA 2R86A 4MGKR 4ZO8A 5JXGA 2ZUDA 1P2TA 2ZXUA 5KJLA 1ZOSA 2C77A 3DGFC 1RXVA 2I7CA 3RBZA 1X6VA 3ND7A 1PT5A 4L76A 2BMAA 4AJ4A 5CNJA 1NPYA 4QEZA 1XIVA 4J6FA 3V3KA 3ZCTA 2I4RA 1VHQA 4B5LA 1RC0A 1JSXA 1OW3B 2V96A 3DC2A 4RY8A 4AN0A 2B2XA 2VP4A 4TLBA 4MRNA 3UV7A 4TUYF 1FLVA 1JRLA 1LFAA 4GOXA 1X8JA 4Q3CA 3ZTTA 2WE7A 1PNQA 4YFVA 2OAP1 1FNDA 1UMCA 4LKRA 4MKGA 5NULA 3BMOB 1A4XA 2EINE 1IN5A 2B4YA 4MW1A 3R7AA 1VLMA 1JTEA 4LDQA 2AHOA 3ELYA 4B93B 3FLMA 3IBFA 4M0DA 4PG5A 5HS6A 5IMBA 1BLXB 3MWDB 4CLOA 2YWBA 1AJEA 2Z3WA 5CMLA 3DPYA 1G5QA 4YRTA 3OQHA 1FF9A 1S4MA 3JD3A 3UB2A 1NNUA 3JVEA 4QPJC 2PCJA 4K6FA 3SZOA 3ZNNA 4AP6A 5K6AC 3A2KA 1Z08A 5H1YA 2HQBA 2WKWA 3ASOE 2MU1A 3QWHA 3E15A 3GNSA 1F6BA 2JJ1A 2ZJ1A 4PPQA 3I2YX 3KUKA 1LI7A 5HM6A 1L4FA 1Q0RA 1TF2A 2B69A 4GO1A 1J9EA 4FB4A 2IZ6A 1AKVA 1Y7PA 4RL4A 4Q3OA 4E5YA 2LNIA 2DYSE 2H08A 2OBFA 2IV7A 4D8UA 5ITZF 1NBAA 2YIVX 4YROA 2PMBA 1ORTA 1XHEA 5D1NA 5JANA 1JFTA 2Q5HA 5B3AA 1QNLA 1G8PA 3T3EA 1SVSA 4ZV7A 3MWYW 1PJ2A 4MZDA 5IK2D 5BQ3A 1RKXA 1ODTC 5BSEA 3F8SA 1B6RA 4LYEA 5H80A 1JUQA 1P7PA 3KSUA 4FFVA 4FNOA 2IEJA 2R6CA 4MB6A 3RSHA 1DWOA 3VOSA 2HE0A 2R62A 5IC5A 3IPYA 3TNFA 4WERA 1UJ5A 1WBDA 3PLRA 3FTCA 4M36A 3AY6A 4MWCA 4O29A 4LJ5A 2CNWA 4D4HA 4IOMA 1TTPB 5ALOA 1X7YB 1VL1A 1F48A 2XZTG 4JLBA 3ZCRA 3T8KA 5K8TA 4M0PA 1TOAA 4LE2A 1VPVA 4JLSA 4YMUA 3H7AA 2XHEA 1HO8A 3H3JA 3QW4B 4Q4HB 2HK9A 1XN1A 2QI9C 2ZJBA 3V8QA 5AYWD 5E9WA 5L7YA 3X1ZA 1QF6A 3Q7EA 2QMEA 2JABA 4IIJA 4TGLA 3T4UA 1YQQA 5CHEA 4O1HA 1P9OA 1CFZA 5CA1A 2H4YA 3FPHA 4Z54A 1V16B 3URMA 2FZ4A 4FLEA 4W9NA 4QBFA 2O2EA 3PIDA 2BT4A 4EI2A 1JFFA 3PEUB 4O4HF 3T1TA 3LCJA 4HH1A 3NDBB 4F2PA 4IDAA 3F97A 3PGXA 2OD7A 3L13A 3KXDA 2JZCA 1JB9A 3K9HA 1VSBA 1E79D 4JKIA 2IEDA 3ZDBA 2GTPA 4XUDA 3LO8A 3WLEA 2XPIA 1BDIA 3I1JA 4HGNA 2V0PA 1T3TA 5CFMA 1MRZA 4G36A 5FOXA 1QF9A 5LYJA 3UM9A 1GZSA 2PH3A 1KDZA 1W85A 3DOUA 4KBQA 5I7OA 2QGFA 1W581 2M98A 2OGWA 3E4DA 2ONYA 3CH5A 3WQRA 4F4HA 3W77A 3QXCA 5JTTA 4C3UA 3HTXA 4EARA 1LSUA 2ON6A 3C45A 3CSUA 4J4TA 1SQ6A 1O95C 1QVZA 3INRA 2Y0CA 3AUXA 1SUCA 3DP9A 4XZ3A 1BS2A 4FULA 1DZ3A 1EK5A 1TU4A 1MQ9A 2Z4SA 3AVOA 4I0WB 4MH0R 1ELOA 4YH1A 3VTZA 2WWTA 5AM5A 3I73A 4O3MA 4JIGA 3ONLA 1ICIA 4JP8A 4OATA 4ZI5A 3WVNA 1RWNA 1EP9A 2VXCA 3W8RA 2PIAA 3CB2A 4PYLA 4CMHA 4EZBA 1YMUA 2EFEB 3HXMA 3PI7A 1G20A 1ABFA 3BB4A 2PBFA 2HR2A 2WY2D 3HDQA 3VR6D 3VAYA 3PX7A 3AG5A 3D59A 2AMVA 3OD5A 4A8JC 4YDQA 1HE2A 1RIIA 3MYYA 3UWMA 2ZB2A 1YJBA 1P8JA 5B1SA 5BVGA 4WESA 4RUKA 3HLYA 3D6TB 2OAGA 2XEEA 2DQKA 5J2UB 1JR3A 2QX4A 1W75A 2C3UA 3INGA 3UOWA 2P6MA 3DYBA 3Q5MA 4XEHA 1Y3AA 2DPHA 1EAMA 2TECE 3B1WA 4NMWA 1DXHA 1Z2NX 4V2IA 4PDXA 4UC0A 2J33A 3RK1A 4DLYA 3X2QE 1HQKA 3L1IA 4WWNA 2ZIRA 1CCWA 1L5HB 1Y80A 1ZVJA 2ZBDA 6CHYA 3NBQA 4MVJE 4QDZA 3VR1A 1JIJA 1O5MA 3R41A 5DBHX 5G3ZA 1Z3YA 2B61A 3DHYA 3K05A 3KBBA 1F06A 1SIBE 5AVYA 1OWPA 2O4UX 2RHCA 5JMND 4BB5A 3Q7SA 1NUQA 2QQEA 4B7UA 3JYOA 1J21A 2RFMA 1G6HA 2HGSA 1XKTA 3NIFB 2LSUA 4D9CA 2AW6A 1W94A 2QLFA 1PZMA 4BPBA 2AWIA 3AJ9A 3FLBA 4WVLA 5HGJA 4QDUA 4EL0A 2OP0A 1TXGA 2VP2A 4CDGA 3HJCA 1ISHA 3M81A 1IPFA 4ZDWA 3UKUG 1N4RA 3GLKA 1QCYA 2AJBA 3KCQA 4G63A 5TEVA 3VDRA 3ZE9A 4B3HA 4RPGA 1KY4A 1FRNA 4FE4A 4KLNA 5G4LA 4EBFA 4XDHA 1S0PA 2ATEA 4B3CA 4DR5B 2ZGGA 4H2DA 4JBHA 4TXLA 4KR2A 4O4JF 2BEWA 2E7ZA 2RG8A 2WJJA 3C3AA 4I9UA 4YJ2B 3E9ZA 3H7IA 3FUNA 4D5EA 1M75A 2FSVA 2JDIA 2A3RA 2W2KA 2ZYVX 5E7MA 3RGGA 4BU1A 1IXZA 1LK0A 3GCWA 3WLPA 3Q8MA 5TPWA 5DTRA 2JD0A 4JV5B 2WUVA 3QNKA 3DDHA 2XR1A 1PC2A 1LEHA 1DCFA 1VLQA 2RAPA 1ODJA 2MT9A 4ZVSA 4AS1A 1QTNA 3HKBB 4JD5A 4P84A 3W5DA 3M4XA 1TVEA 1U1DA 3D7MA 2NO0A 5C2YA 4XWKA 3HCEA 1LNZA 2ZAIA 3HWRA 1BDMA 4ER3A 4B3MB 3UAOA 3BXHA 4ABTA 3LBFA 4CQMD 5GIPE 3WGOA 2C7QA 1BE8A 3CK7A 1WSBA 5EPOA 4M54A 3KKOA 3SF4A 2HWUA 2NPFA 3EXFB 3OY7A 3LL4A 4Y6LA 4MITA 2LUOA 3FCCA 2Z0MA 2V7BA 4PBTA 4RJTA 1HWYA 3OXGA 4IINA 1T36B 2GSWA 1T25A 4NKRA 4OUDA 3ZJ5A 1W93A 1KDVA 2EDCA 3K0CA 1WKCA 1T2AA 1RM0A 4GPMA 1KAEA 2FR8A 1KS9A 2VYQA 4V24A 2PUFA 1P5ZB 2AI1A 3NIGB 1M8FA 4FSDA 1YS2X 3B78A 3E18A 4KT6B 4OHBA 2C4UA 4PG7A 5KWVA 2ZIWB 3UAGA 4I6GA 4AKIA 4MWTA 1H2FA 1I2DA 2ZR7A 3D4OA 3MCAA 1CUAA 1U7XA 2BD0A 2CUTA 2OV4A 3KTDA 4F6CA 4JDUA 4JQSA 3UT8A 2H2WA 4OSPA 2G80A 3MN1A 4ZK6A 2IZ7A 3TMAA 4ZTZB 5T3UA 4EQFA 3KOWA 5COQA 5CT9A 3WHKA 4IDPA 4S12A 3N2LA 1ISJA 1FTWA 3WK5A 3QVKA 1ZA2A 3O2QB 2OFXA 1Y63A 1FSZA 1PT8A 5KYVA 3DKIA 2AJTA 2YS6A 3F6QA 3HXDA 1K3UB 1H69A 1HYGA 2GLTA 4LWOA 5TX7A 2OA0A 1A8IA 2YWFA 1UBSB 3U64A 4IV8A 1LRLA 1YA8A 4DUGA 4MS6A 1X7ZB 2G67A 1P0PA 2J9ZB 4MWBA 3ZXPA 4IJQA 5C80A 2SCUB 1GU7A 3K1AA 1V2HE 5DCYA 3WL6A 4HADA 4L2IB 4Q3LA 3AG2E 3UXGA 4S35A 2UVPA 4OXYA 2RD2A 1TUBA 4HH3C 2R1TB 3MLEA 3R6DA 5FOTA 4OHCA 3GT3A 5KMGA 4YLGA 1ABEA 3IAS6 4NFSA 4CLDA 1OV6A 1OVMA 4BMCA 5IJ0A 4DX7D 5K3BA 4TYWA 2QMYA 3D8HA 2B4TO 1E2IA 4FTWA 5FQ4A 3AI2A 1BMQA 1PJ8A 1Y5RA 3DV0B 3HN7A 3KR0A 4G89A 3ZDFA 4ALLA 2R17C 1BS9A 4FGUA 1LPMA 1GUDA 3EHEA 1BVYF 2VWQA 3LXRA 3Q3HA 4C4SA 1ESMA 1HL3A 1RQPA 2FP4B 4JMPA 1A2QA 2HSGA 2YICA 3I04A 1XC7A 2FMXA 5ALDA 1A9SA 3G2QA 4FC6A 3HU1A 1N5DA 4A6EA 5GOZA 3M1LA 1GN8A 4ZFNA 1UXGA 4M1QA 1ADFA 2Y99A 3BIOA 3DDZX 3JTMA 4X91A 2CXOA 2HWXA 4AO8A 4CR7A 4NZOA 5FHQA 1YDWA 3NTOA 2WLSA 4EB6B 1ZI6A 4HSGA 2FDCA 3E84A 4RDXA 3WXXA 5FBHA 4WKGA 2XOKD 3KU4A 4J8EA 1KYYA 1U8ZA 2YQ8A 1CT9A 2AFVA 3KDSE 3O8OB 2GRNB 1D2AA 1JF8A 2NZWA 3C3KA 3IUSA 3PFWO 2BEVA 5IUKC 4HDQB 3I0MA 3SZRA 4CCYB 4F1PA 1KEZA 1ZWKA 2IX9A 2PS3A 4MUEA 3TW6A 3JQDA 4EHBA 4WINA 4U7JA 4DXAA 1YS9A 4CU2A 1M54A 2A5YB 4LCBA 1KOLA 1WB5A 3QNMA 3N8IA 3LWNA 1O97C 3L7IA 1C3LA 1H05A 1GA1A 1IY2A 1U3FA 2RHWA 3DHVA 1HUQA 3CNQS 3MUEA 1PD0A 5JJLA 2IF0A 3PNLA 3SNKA 3PUJA 4BLTA 3HEMA 5T67A 3TIGA 2JH9A 4PRKA 1NJ2A 5I4CA 2EFYA 3E81A 1Y7TA 4UHBA 1OYWA 1W47A 1YZFA 2REQA 2HWKA 2PO5A 3LOUA 3Q98A 4GPTA 3QLEA 4OQFA 4C78A 1QC5B 2NU9A 1U0BB 2WU4A 1AX9A 4ZAXA 4BWFB 3W5BA 2DKFA 1UG3A 5IHXA 3DBRA 4QHSA 5AW5A 3O2JA 1TFRA 3X1XA 4JSYA 1DAIA 1M1YE 3VR5H 4OSEA 3TWUA 1GAEO 5JMOA 1F3LA 3ROFA 3CH4B 3ZWDA 1XPRA 4QUAA 4YAGA 4IZHA 4FYIA 3WLMA 2FWNA 3GLVA 1QZUA 3I61A 1OXJA 3Q8KA 2F1OA 3DW3X 3MMSA 4IGFA 1EDZA 3KT6A 2ZGDA 1FRFS 4WEOA 5CDSA 1E2DA 3FMVA 1U6IA 3C7TA 4PFQA 3K71B 2X6HA 2L6BA 4IRXA 2EFJA 4X8HA 2Q4TA 3REOA 3ZY2A 2IYOA 5KYYB 3ZHEA 4Q9LA 3GUHA 1OH6A 3FLEA 1OCZE 3HCFA 4FOPA 3QBJA 1TT5A 3IL2A 2P58C 2BMJA 1QH8A 3KVOA 4U3JB 3EDTB 1CVIA 1CULC 2C8VA 3K1TA 4JUDX 3AB8A 4Y6OA 3T34A 4I1UA 5T6MA 4JBGA 5AMXA 3U4QB 2QPLA 1KDOA 1CY4A 2CXRA 4KN9S 1CDDA 2OBBA 1LDBA 2WXMA 1UQTA 4E12A 1N34B 1AF4A 1I0LA 1T0PA 4Y2XA 1E6KA 3UKJA 3FRHA 1ID8A 2GN0A 1JHOA 1I36A 1Z28A 2JFOA 1SVNA 2P7IA 2QRUA 4OIMA 4HVLA 2JAUA 5E1OA 1ZNQO 2PV7A 5AVQA 2OHHA 2OORC 2XJ9A 3T3IA 3TVDA 3QMPA 1TYQG 2Z2XA 3RVQA 4PQYA 4JCOA 3UHAA 5J63A 4C7OA 2GN9A 1GL9B 4G65A 5DYWA 2AXVA 3FKQA 5HW0A 2EKLA 4GKBA 1BDJA 1CB0A 5AO9A 1SG0A 1T9DA 5JC1A 3UYKA 4FONA 1BO6A 1UOOA 2I6UA 2BR5A 3KVVA 4L57A 3IURA 1KT1A 1PAQA 1CUSA 3EE6A 3PDUA 2RI1A 3HN6A 3TDKA 3ZDQA 1PHRA 4YMLA 3SQXA 2VJMA 4C0XA 4B4UA 4J1TA 5H0IA 3MTAA 3H2GA 6GPBA 1P2GA 3KPVA 4FINA 1OH7A 8AT1A 3DCJA 1G0NA 1E5TA 3QP9A 4HAZA 4NHOA 4B0OA 4F9FA 5KQSA 2NZYA 2H4JA 2VJQA 3R9XA 1YQDA 4CM6A 2CKMA 4ZYVA 1PGQA 1HDOA 3OLZA 3RTBA 3DNMA 4DQLA 2JLBA 5JV5A 3P1UA 1J09A 2GPBA 4FOTA 2BZSA 3ILXA 1K66A 2NU7B 3CCBA 3CNBA 3PT9A 4IQ8A 4UNIA 3TG5A 1MVNA 2R97A 4L8GA 4RE6A 3TSCA 5LNK6 1RCUA 2WUGA 1FMCA 4DX1A 1KR2A 4E1AA 5JRDS 2XMSA 4EW2A 5IM5A 3A1WA 1VLHA 2P2LA 3DNFA 3KB2A 3QLTA 4G0NA 1T9GR 3MJSA 5AI9A 2KZTA 2IZZA 5E0KB 1HETA 3TJRA 3FHEA 4E5PA 1W36C 3EODA 1J22A 1A1SA 1DEAA 1RJDA 4RTOA 1MU0A 1OWLA 3CWCA 1VM6A 4JU9A 4FGLA 4I50B 3MPOA 3IUPA 3NBKA 1JKIA 4D57A 5L45A 3TEJA 3FH8A 3ENKA 2X8AA 4HH0A 1BRTA 1WWKA 1R4ZA 2B5OA 4NDZA 1P4RA 1RWWA 3DBHB 3DMTC 1IHDA 1GOTA 2I2WA 2OORA 4HNQA 3VYSB 2BF7A 2IXGA 4KMMA 1I51A 4AUNA 2HQ1A 3ND9A 1MX9A 2VUUA 4CHGA 4WDQA 3HYMB 1H2ZA 2OO7A 3QKWA 4C5BA 4G26A 1WF6A 4K9QA 4G41A 5EHIA 1PL0A 4CM9A 4MRRA 4ZVUA 1D0SA 5G04C 3VU1A 4UWGA 1I3CA 4QUBA 5AICA 4D9EA 4FWBA 1EFTA 4Z2AA 3D9KA 1V7PC 1D8DA 2QTFA 4DT1B 3NTRA 4BJHB 3TNJA 1D0VA 6ADHA 2I1QA 4HOQA 3UM0A 1UBTS 1N75A 3T7IA 3AZPA 1PQ4A 2QMZA 3DE7X 5G53C 3STUA 4EHNA 3TXAA 1U9CA 1UBRS 4ALNA 2EEZA 5JDCA 1GKKA 5EHXA 3OPYB 1ZM7A 3DE4X 1FUIA 1AUQA 4I6JA 1ADBA 1P73A 2EW2A 3HEAA 4R40A 4CKWA 2BDEA 4B45A 5DASA 2P6PA 4Y2RA 4YXWD 5HYVA 4CEJA 1XCOA 2IHTA 2VBFA 2AYYA 4FZ5A 4TT3A 5EXDA 4DFDA 3QVGA 2XKKA 3KVYA 1X1EA 2CVFA 2DTXA 1P4JA 1QIHA 3E27A 1A82A 4R83A 4CQJA 4BATA 1TUEA 3FNIA 2ZBGA 2ZI7A 4NP6A 1EB9A 2UZ4A 1L7XA 3AEZA 3W5CA 4NE2A 2EKDA 1Z7GA 3M4ZA 3NBZC 1JP7A 4I5IA 3N7TA 3OM0A 1R9MA 2D1TA 1R8XA 3I8XA 2F9MA 1EUYA 4IULA 1GZUA 4ANVA 1PKXA 4ENUA 2PL3A 3F78A 4XGNA 4YECA 1G8JA 5CLGA 3KVRA 3O6VA 4FYMA 3W2EA 4EJSB 4EVRA 4HNTA 1NC3A 5D3KA 1XTTA 4F04A 3AFMA 1AM4D 2FK7A 4PINA 1JS1X 1PBNA 4AJIA 1EM8A 3BCHA 4F5EA 3U49A 2IHBA 2OG1A 3BQOA 3KL4A 3SBEA 3UICA 4DCOA 1KMIY 4JYAB 4K5CA 1HG0A 4U8YD 4EO9A 1DJLA 1O5TA 5KYGA 4BLVA 5C32A 1KIMA 1LTHR 3CLRD 2GCNA 4X1IA 3T99A 4AWBA 1J1UA 1J6UA 2PGJA 3P0RA 4OOFA 1IN7A 1CKEA 2YRWA 3FGZA 2VQ2A 4GMXA 3I9JA 4G4SP 2FVYA 3D2LA 1ODIA 2DLDA 4B2YA 5B6JA 5AJYA 4BMSA 3L8GA 3WISA 2GN1A 2RH4A 4WZBB 1CJVC 4KZKA 3R0VA 1ZJYA 3JASA 3PF9A 1DJMA 4U95D 2JI7A 2QZ4A 3PPXA 2JIDA 2HJGA 2F8YA 5CW1A 1G98A 3F5FA 3SZGA 3QHPA 4JNKA 4LF6B 3RIMA 5FNVF 4PG8A 5L53A 2B7BA 4AKGA 5JWHA 1CBUA 1AXEA 4U8VD 2FWPA 3TFWA 4FMPA 1P77A 5L3ZA 3UJAA 3EA5A 2Q3BA 5HKLA 2B20A 4EHIA 3EXIA 4JJAA 3QE9Y 1T91A 4DANA 3H16A 2LAIA 3PF8A 2BI8A 5DYYA 1S7GA 4HP8A 3LBAA 3HMQA 2IOFK 2QYOA 3R6TA 4PWYA 1N2CE 2BF0X 1I4OA 2DWUA 4GZCA 6YASA 3G0HA 5BVHA 1ZUNB 2QRNA 1AU9A 4Q12A 4XWAA 1OI4A 3A28A 3A6FA 3GRAA 1JI0A 2Q29A 3W8FA 2A86A 1WB6A 2CNDA 3GJXC 3NU1A 3L17A 1KQGA 3QPVA 1QB7A 5LOVA 2J08A 1ZB1A 1XZGA 2FRXA 1MC5A 3HM2A 4IG4A 4Q9NA 1GGMA 3PEFA 5EN4A 1L7BA 4EG5A 3D3MA 4NCAA 2L82A 3V9AA 4HDSB 1NHGA 2SICE 4E4TA 1IJEA 3DR5A 3FUFA 2IYQA 3PNVA 3IPAA 3PE6A 1M73E 4ZT2A 4ZEXA 4KAAA 3ZDEA 2J5KA 1QGED 1THZA 2IVZA 4WH0A 4AZ3A 5JSQA 1DVRA 1S63A 1PS0A 2P79A 2PXCA 5E4FA 2FUG1 2QN9A 3MQ4A 5TY0A 3VSCA 4W5TA 3P0EA 1MG5A 1ATZA 2PG3A 3ZHYA 2XMZA 1WS6A 5F76A 3FH5A 1DIBA 3CO0S 3QY0A 3BFKA 2PX3A 1GRNA 3F9CA 4E6PA 3H84A 4ZTBA 4JN6B 5KYWA 5CURA 1OY1A 4B3JA 2HSDA 3VNBA 4LOHA 1EJ6A 3CLTC 3KOXA 1YHZA 1VG1A 3ZWVA 2OGZA 4KLCA 4YB8A 3WNDA 3L6DA 2G6BA 3E7XA 5CLJA 1WBJB 3SR0A 3WMXA 3JQ8A 4QRHA 1V6AA 2ZBPA 2B92A 1QWOA 3CEPB 1KTIA 2BJWA 3CURA 4MRVA 3HY6A 3UF0A 3ZWKA 1FSPA 3FTUA 3UKDA 1D4FA 3PL1A 5LQDA 1SN7A 1U1GA 3HDYA 4AI6A 1V5GA 1CF2O 2ONJA 1L4NA 4J0HA 3VYUB 5KREA 5LYJF 3F67A 3IVXA 5FO1A 4PO8A 2JHPA 1H8HA 2ORWA 1SNYA 3CLUD 3UMSA 4RHCA 4TV8B 3I92A 5U4QA 2VBCA 1L7QA 1XC